4GRMB

The crystal structure of the high affinity tcr a6
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
243
structure length
240
Chain Sequence
b'GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASRPGLQPEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A6 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Increased Peptide Contacts Govern High Affinity Binding of a Modified TCR Whilst Maintaining a Native pMHC Docking Mode.
pubmed doi rcsb
total genus 60
structure length 240
sequence length 243
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4grmB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4grmB02
4LIQH 4JM2A 1CF8H 4LVOB 3MGTA 1LHZA 4M1GH 3QFJE 3MYJB 1A6WH 4OD1H 4GG8B 4UAOB 1AGBA 3GSRB 4TOYH 3DRQB 1M7IB 3E2HC 3FT3B 3FO0L 3L7FA 2X05A 5D5MA 1PBYA 3QDMA 1EHLL 4HLZH 4QCIB 3BP4A 4GUPB 7CGTA 2A0LC 4RFEA 2E8YA 4N68A 2ZG1A 1JPTL 3G6DH 1UXWB 2MCG1 3B43A 4DZ8A 5JPNA 3T0DA 5D7LB 5F44A 3EJYD 4JN2A 4P5KA 4JZNB 5IBTL 2QADB 5CEXA 2Z8VC 5IB1A 1PJ9A 3TJEL 1R3HB 1UB5A 5L8JB 4LSTL 3I75B 3PQYB 4KKBC 4XVJL 1P7QD 1SJEB 3U1SH 1I7ZA 2WQ8A 1ZHBB 4NQED 5JOPE 1P4BH 1UB6B 1LDPL 2XWTA 1B2WL 4XGZA 4EN3B 2X1QA 5JPNB 4IIQA 1YN7B 3NIDF 2BNQE 1OGTB 2P5WA 4NT6A 3V4PH 3QEQE 4ZOCA 2OI9B 5FO9A 3MJ8A 2Q8BL 3HNSL 1RUPH 1MJJB 1V8HA 5DRXA 4OFIA 4S1RL 2YPVL 1FPTL 1B3JA 2NY0D 5JHDA 4PGDB 2R2BA 5EBMA 4DUWA 1I7ZB 1JWUB 1S9VA 3SY0B 1MHHA 2B39A 4JRYA 3U0TB 3W2DH 3I3EA 1A8JH 1UB6A 3C09C 4W6XB 1AC6A 3TT3H 1ZWIB 4B50A 1OSPH 1DUZB 4LMQE 1RAMA 1PG7H 2PTTA 2HLAA 4G6KH 5CJBA 4POZC 4QRRA 4TUOA 4I48A 4FQLL 5DURB 3ILQC 2XA8L 4LLUA 4X6CF 1Q9KB 3QQ9C 3Q6FB 5DJZA 4PY7A 2E9JA 1U8NB 5ID0B 1MHHB 2DOCA 4MXWH 3B5HA 2H1PL 2GJ6D 2X89D 4MA3B 3RKDD 2P42B 4FTVE 4ODTL 3KPRE 5IEHB 3W0WE 4JFXB 5C08B 2F15A 4WGVB 3S3JA 5HYJA 4MGXA 3AREB 2XWJB 1RU9L 3SPVB 1RQ5A 1VFBA 2W07A 4K94H 2WK2A 4JQXA 1OARH 2UZXB 2ZUVA 5EU3A 5MENB 2RIKA 2WV3A 3HPLB 4PY8J 4U1HB 1R5WA 2J4WH 4KXZH 1M1SA 2MCPL 5LKNA 4BFGA 5CGYC 4Y5XB 1NCBH 5GS3A 4S11A 5F9JB 5KVMC 2MWCA 4DTGH 3GMNA 1ACYL 3ZT5A 5IG7A 4PJBE 1MF2H 1YDPA 3NZ8A 3QG7H 2YXMA 3BKMH 4UILH 1AP2A 5F7NC 1DBBH 2XWJA 2DQFB 3IF1B 3OR7A 3GUTA 3HUJF 4AG4L 3U30C 1IGTA 2BOCA 3IFNH 5JHLL 3SDYL 3GSXB 3PABB 4XTRD 1I9IL 2FX9H 4EOWL 3FTGB 3HZMA 3VRJB 3EYOA 1XGUA 5TE6H 2G2RA 4ODSH 1B90A 1GHFL 5F96H 5F93C 4OLZL 4YBLB 2C3VB 4QRRD 4OF7A 4JFQA 3C5JA 4JKLA 4L3EB 1S7WB 5KVEL 1Y6NR 1T0PB 3R8BB 3MRNB 3ULUE 3IAQA 4UT6H 4L8BA 3QHFL 5E00B 4OF6A 1H3PL 1K4DB 1RJZA 2I27N 4GXVL 4IDJL 4J3OC 4WRLA 1GOGA 3S3PA 1FE8L 4HFWB 5E2UH 3WJJC 1OGAD 1B2WH 2DTMH 2WM0A 3MFFA 3DMMD 3VRJA 4XPTL 1F97A 1F3JB 3M1BB 1QR1B 4HZLB 1DEEA 3VW3L 3T0AA 1WFNA 1MCSA 4OCMC 1XIWD 4O02H 1MSPA 1OT1A 2I24N 3OTTA 3QAZC 4KKNA 2FEEI 1KPVB 3IFOA 3ISWA 5EBLA 5IV2A 4ZSOB 5IB2B 2EE6A 3K4ZA 2UWEF 4G8GE 2CUHA 1JFQL 2D7MA 1AO7A 1KB5B 4KK8C 1RHHB 1OQXA 1F13A 1AXTL 2Q3AA 1L7TL 1F6AA 4XP9H 5FIEA 4C56A 4X7SH 3ULVE 2BFVL 5J3HD 2OS7A 1G9MC 2YPLA 1CFTB 1WFUA 4J4PA 4NHUA 5F7YC 2ICEB 1FAIH 2GYSA 3LKNA 2MHAB 3BPOB 4QEGA 4Q6IB 2J2ZA 5FA3A 5JDSA 4P0DA 1SMOA 5TF0A 1DL7H 1CD1A 3O3BB 1Q1JH 5I8EA 4LPYA 3FN0L 3LN4B 3MV7B 5FCUH 3HTLX 3ARBC 2YPLB 1IL1B 1JZ3A 3MA9L 2YBRA 1U8LA 4P23A 2X4TB 3T77B 4XMKH 3ZTNH 5H37H 1QLRB 3CLFH 2HRPH 4PGJA 4Z7WE 4P57A 1KCSH 5D1XB 2YD8A 4NPYB 3U7WL 3LRHA 5J13B 5A43C 3SJVD 4HIJB 3SCMA 2WAHA 1T1XB 3EO0A 4LAJH 3U46B 4BFEA 3QUYA 3PHOB 1CT8A 1M71B 1E4JA 2R2EB 3SE8H 4TQEL 1T04B 5D70L 1FN4A 1IC5L 3ES6A 2WMPA 4D3CL 1MREL 3QIWD 4NOFA 2AV1A 3QIWC 4HH9A 3ZYIA 4U1SB 2FX7L 2GTWA 1TJIL 1S5IH 2DQGL 2FEDD 1KELH 5I1IH 5I1LA 1QSEB 4KUCD 1TJHH 4OQTA 4OZIE 3WE6B 1G7IA 5IW3A 4HX1B 3V8OA 5GSRB 3NFSL 4KU1A 5E9DA 4ODBD 4QO1A 4G43B 4OSUL 2CUMA 4LSUH 4PBWD 2LU3A 5IIEA 5FHBH 4KHXL 5I1AB 4Q9QL 3IRPX 3KPSD 3KPOB 4M6NL 1CFSB 4KMLB 2ARWA 1K2DB 4XPAH 3MNVB 4GRLC 2C4XA 43C9B 1RPQA 2ADGA 4D9LH 1NCAL 4HKZB 1GZQB 3NIGF 3P4OB 3L3DB 4M7LL 1CXIA 4D8PB 3UC0L 3FO2B 4PJGA 4WU7B 4FNLH 4MJ5B 3K4AA 1IE5A 3KPOA 4PJIB 1CI5A 5KG9A 3SKJL 3W0WD 3TNMB 4GH7B 4Z7VE 5DVKA 4NZTL 4DVRH 1EV2E 4HS6A 4RX4A 1BZ9B 4PBXA 3MLSH 4HCRH 5CMAA 2YEZA 4XNQA 3D3VD 1I8LC 5F1KC 2NXYD 3VRIA 3SE4C 1I3GL 4OFVA 4NIKB 5CHNB 2FD6H 1ZTXH 5IHUL 1HILA 3FQTA 3CD4A 3GRWH 5KZCD 5E2VH 2AABL 2FJFA 4LLDA 5CJXC 4ELKA 1JL8A 4N0CD 5EULV 2C1OB 2EIDA 2DLFH 2VR9A 3B2UD 3O41A 4YLQT 2AEWA 3F65A 4LHUB 3QUYC 5CSGA 2H8PA 3VFPB 4PJAF 4LCYB 1FDLL 2A6KB 5IQ7H 2X4RA 1M05B 1NANH 2UYLB 3RL1A 2QV2A 5E99H 3S96A 3FQTB 1GYAA 1P6FA 4UU9B 1QLFB 2CLRA 3PHQA 3RX5A 2F19L 4HEPG 4OFPA 3ALWA 5JXAH 1CLOL 1J87A 4XH2B 5EU4A 1PX4A 3FONB 1UM5H 1C7SA 1KIQA 2CK2A 1N0XH 2QSCL 3MRDA 3I9GL 4YHYB 2PXYC 4JZJA 4G6ML 4PJGE 3KPQA 4Z7UE 3MLXH 4LCCB 4N1EA 2YUVA 3DUUB 1S5IL 3FB7B 4APQD 4PRHB 3S5LG 3LVEA 2XRAL 4NFBA 4XBEL 4E42B 1TETH 1N2RA 3LS4H 2YD2A 3MV11 4JFEA 2VZVA 4ESKA 3BP5A 4R8WH 4HIHB 4OLWL 1KEMH 1PYWA 1DP0A 4OAWA 4TSAH 4LEXH 4F7EA 3GJEA 1BOGB 4MNHA 5BZWB 4R96A 1XCQB 1HEZA 4JFED 4WEBH 3KPRB 2VITA 3FT2A 4PJXA 5IMMB 3QT2A 4HUMB 1I1YB 5DC4B 3D25B 3KGRA 2G5BA 4PJCA 5FKAB 4H5SA 4U6YA 3OF6A 2CXGA 3SOBH 4ZMAT 4Z7OE 1NC2A 4QYOA 2B0SH 2XKUA 5HHQA 5KW9H 2BSSB 5HYSB 2Q76A 3ARED 1FO0L 2FYYB 4EI5C 2B1HH 3TESA 1I85A 3ULVD 1YNKL 3B83A 3FFCA 5D7JA 2OL3L 1UA6L 5FA4A 4AY0A 2A6JA 2ICES 1IAIL 1OTSC 4F9PA 1CGSH 5DJ8A 1HH6B 1EX0A 2VABB 3S3SA 4IHOA 4OD2A 3WMSA 1U8JB 4PRNA 5JW3H 3IAPA 1E4KA 3D25A 3EDDA 2XT1B 1M7DA 2VDLH 3MLYH 4MNGE 4LBEA 3DNKA 4QYOB 4LLQB 4IIQC 3SGEH 2P8PB 1E4WL 1WCBA 3V6FB 3MYJA 4AYFA 1GVIA 4Z7UF 1MLCA 1BFOB 3GHEH 3FFCB 1N5AB 4HCRA 2GITA 5IMLA 1LEIB 4JKMA 4CUCA 1KJ2A 2CRZA 1ETZB 2NY2B 1AI1H 3BP4B 1CFVL 1T2QH 4LVNC 4OD2B 4Y19D 3TH2T 3MV9D 3REVA 4J2XA 3KXFB 3U2SB 4ZPTA 3KYKL 3VFUA 4HUVB 1MCQA 4TVSa 3SY0A 2Y5EA 1MRFH 4APQA 5HPMB 1HYSD 2VQTA 3FO1A 2V7NA 4HG4K 4NNXB 4F2MA 4IDJH 1EGJA 2R2CA 3MZTA 1U95B 3TO2B 1KJ2B 1RJCA 4XPGL 1F3DJ 5ICZA 1MAML 3PP3H 3MV7E 2ZNXA 5H35A 3IB4A 3VD9A 4CADA 5F7EL 4RMRA 1ZHBA 3HRZA 4HWZA 1G7HB 1JNLH 3FFDA 3NABH 3QRFM 1CICA 1MJ7L 5F1NA 1CGYA 1MIMH 4ZFOA 4AL8L 3P9LB 5I1CH 1JGVH 3SDCB 5CWSA 4MS8D 1AJ7L 5JHDB 3RVUD 4ZOEA 3TJEH 1L6XA 4M1DL 2AGJH 2ICWI 1HDMB 4LSRH 4PJDE 4ZUWA 3ESUF 3SDXB 3V5DA 3DX9A 1TETL 3KPSA 3GSWA 4N0YH 2ICCA 3QXWA 1U58A 2ED9A 4UMGA 4UOJA 3HG1D 3TPUA 3DO3A 1A7NL 4QRPB 4Z95L 3VMPA 4Q9RH 5JXED 5KVDH 3BKML 4UILL 3MLTA 4JFYB 5C71A 4XCNA 1EFXA 4X4YB 5CWSB 3AXLB 3R4DA 1HHHA 1OP5H 5TQ2L 2GJZA 3KPLA 4EDWL 2A9MH 3G6JF 5DD3L 1WEJL 3BZEB 1OAZH 5C0FA 5DVMA 1ITCA 2F8OA 2ZOKB 5ANMA 2FB4H 2YD1A 3IXTA 3KJ4B 4N0RA 3C6LD 4OGXL 1T7WA 3C6LC 4ZO8A 5J9PB 1JF6A 5F9OL 2VSCA 3CVIL 3JWOL 1F3DH 4DGIL 4RGND 1HHKB 2B5IB 1N0LA 5MP6L 4PD4J 3C09B 5F96L 1IAIH 1UC6A 1JI1A 5B4MC 3CCHA 4Y16C 1MFCL 1U3HA 4QHMA 1WIUA 3CFKB 4TQEH 5ITFB 3VCLA 4G7VH 4CJ1A 5D70H 2Z35A 3U9UA 1HI6A 2X70B 1S9WB 1A14L 1I8KA 1NCTA 2FCBA 3GKWL 4D2NA 4Y4KB 5IVOA 3GMNB 2Q87A 1X5AA 3MR9A 1D5MA 3EYFA 4OZFB 1YA5A 2K1MA 1FG2A 3DV4A 1P7KB 3IU3B 1HHKA 5IB5B 3U4AA 5E9DD 1JMXA 5EN2B 3LRSB 5GJSL 5ICXB 3CCHB 4PRAB 4ZNEE 4J1UB 5IWLC 4W4NA 2ZUWA 1RZ8A 4O02L 4Y1AE 2IALA 5DHXB 1MHEB 3MV9E 4R90H 3ZHKA 3INUH 5HGGS 5EBGA 3PWPA 1LNUA 3KLDA 4BK4A 1G6RA 4HXBL 1PZ5B 2Z31B 3IFOB 5GJTL 2QSQA 5IBLD 5L8LB 1QQDA 4OZFA 5D9SA 5LQBH 4ZPVB 2VZSA 2AJZA 1VKXB 3EYOB 4JJHA 5T5NF 2UUDH 2EDWA 4AEHH 1LK3L 3LKRB 1YYMH 2DLIA 4C56B 1EO5A 5L7XH 3P73B 2F53D 1VENA 1QA9B 3HLAA 4CVXA 4Z8FH 4K3JH 3LZFH 1IM9B 5H94B 5JDSB 5AYQA 2A74A 4NKIH 4KROC 4S1SH 1A1NA 2R1XA 1DZBA 3BPLC 1OPGL 5IB4A 3L3KB 4EI5B 5I15H 1QVOA 2QTEA 5D2NA 2C7UA 4LRIA 2VWEE 3K7UA 3AU1A 3BSZL 4NUJA 5I1EH 3MRGB 1HZHL 5FB8B 4FXGA 3V6OE 2DQEL 4KDVA 5TQ0L 2F5BH 4L5FL 2DYPB 5C0AE 3FMGL 4JEGB 4PJ5B 5T3XE 25C8H 1AO7E 2YXFA 5D1XA 5M95B 5EIIB 4NZUH 4F58L 4HHAB 1FE8H 1ZLWH 3SGJC 3VXTA 1QFWI 4OZ4B 1YEFH 1XH3B 1MJ8H 1CFQB 2B4CC 1C12B 1Q1JL 2DMCA 4KK9D 1FFPA 2DD8H 1XGQB 3QG6B 3FN3A 5CUSL 4FMKA 1YUHA 2MHAA 3PWUB 2HT2C 2QQLH 1MIEL 1G7PB 2GY7B 1AQDA 5DRZA 3CMGA 3O6FD 1AR1D 1DQTA 4YDKH 5IFAL 3ARFC 3ULSB 5EIIA 5I0ZA 3CLFL 1QP1A 6FABL 3RWIB 2AXJA 1FNGB 1CD1B 4M02A 3L9RA 3UPCA 4JPWH 4YPGB 2BNUA 3OB0H 3QUZA 3QFJD 3BIAX 3SDAC 4HX1A 5E4IA 1FAKT 3BQUC 3BOVA 3NCJL 5DDHA 3WCYA 2F54A 3BQUD 1JNHA 1CD9B 1EFQA 1WWBX 3QDME 2VDOH 1C08A 1YUHB 1A7QH 3REWA 4O4YL 2OTWA 3ZDXE 5DRZB 1BFTA 3MX0A 3OR6A 3QIUA 3FOLB 4U6XA 4GMTL 1FVEA 4TTDC 2HFGL 1GAFL 3F12A 1S7QB 3BX7C 4PP2A 2HWZH 4C83B 2ZSVB 1HE7A 1RZIB 1UXSB 2MCPH 2R0KL 15C8L 1AQKH 4LL9A 5TH2B 2ICWB 3AS3A 4P2RA 3BW9A 1AD9A 1I1FB 2A2QT 5I8CB 5GS1C 3REWB 3UYRL 2FECI 3VWKC 3UTTB 3MGOB 1BGXH 4R0LA 5IM7B 4JRXB 3VG0L 5GHWH 4N90E 5SX4H 4Y4HB 1G9NC 3B3IB 4NZDA 3ZKSD 4B41A 3QHZH 3B6SA 4ODWB 1HSAA 2XPGA 3C2AH 4P2OA 3WIHH 4Z7UA 1UVQA 1LD9A 5I1JL 1H8SA 1TVBB 4CU8A 2G60L 1CFSA 4NC1C 1MNUL 5C07B 4HXBH 1SYVA 4NKOB 5IVZB 4UTBL 1JTTA 3WUZA 1RUML 5TPWH 2X2YA 5F3BA 1CD0A 3N1MC 2DN7A 1I7UA 1SEQL 3P0VL 1UKQA 4WU7A 1NGPH 4P46A 3TIEA 3WSQH 3OJDA 2V5MA 1R5VB 2R23B 4RAUA 4CN6A 2HN7A 4YHIB 1DQJB 2AXFB 2E9IA 5F1OB 3B9KB 1A6ZB 2FIRT 1T0NB 1M4KA 5GRZA 4KTDL 3MOBL 2VLJB 2XTJE 4K7FB 1I7UB 2V5TA 5HBBA 1FYHB 3WNPA 1BQUA 4NM4H 2PYEA 3JV6B 4MWFB 3RVWC 1FDLH 3HI5H 2X4OA 1OAUH 2X7LA 3MRMB 3NIDE 4G3YL 4NO3A 3TN0D 1HKFA 4JFFD 5KANG 1GL4B 4XP6H 1MIEH 4WNQA 2FJHA 5T1LB 3FB7A 1MY5A 4XNYH 3QEGH 5I76A 3ZYJA 3EOTH 1ND0A 4E41A 4LCYA 2XQBH 4F7EB 3OHXA 3RTQD 1MIML 4JANA 4DZBB 4YR6A 4KMQA 4WWKB 2EDLA 1I9RH 2OTPA 2R4SL 4M8VA 1P7QB 5FYJU 4NQEB 4UV4H 2DQCH 4BFIB 4JJ5A 2F5AH 2DWEB 5I1KL 4XVUC 3NCEB 4IDLA 3VFWA 4OIBA 4PJDB 4WWKC 1KIQB 4OLWH 4PJAA 1FFNA 4MHHG 5F7HA 1PSKL 4R4NC 3QUXC 3CLEH 5MEOA 4R4ND 4EBQH 4JANB 4DZBA 1NEUA 2O61B 3EDJA 1YEDA 1QLEH 4F7CA 3WUWA 1RZKC 1EUUA 4GJTB 2YK1H 4P46C 4WI9A 1NCNA 4OLXL 1HN1A 2NPLX 3KLAA 3QNYA 4U05A 3UTQB 1EH9A 2A9NL 4NQTA 5ACZA 1RZJL 5E5MA 5GIRA 4NN7B 4Y5YB 1YQVH 4NRYB 1D5BB 4MMXC 5E8NA 2M1KA 1L9MA 1Y6KR 3IDIA 5CBEB 2APVA 4Y5VC 3HNVL 4OLYL 4WTWA 3DYPA 4JFFA 2AJXL 3ZTJG 5GRYA 3E6HA 1EEUA 4YUEH 4KWUA 5TPWL 4PB9L 4R4FH 3N1FC 5JHDE 4PJGF 2YMXH 2D31A 4QXGL 3M17B 3FT3A 1D5IH 3MLRL 3OAZK 3W82A 3QUXA 3KYOB 2OYPA 3STBA 4MNQB 5D1ZD 3MUHL 5IWLA 5HI5C 3NGBB 4M7JL 3UTPE 2IC2A 3GBMH 2WINB 1YPZB 1FZOA 1VA9A 5IW6A 1JWSB 5E6YA 2XI9A 2E9BA 4JDZB 5HVGB 3DV6B 3JSSA 3QWRA 2BP3A 2ZZUT 4OCXH 3IXAA 1KN2L 4N1CA 2DICA 5EUOA 3M17A 3QPQC 3DGGB 5K9QI 2YD4A 3MBXL 1U3HD 5DSCA 4JLRB 4X6DA 5LQBL 2Y7QA 2NY0C 4ZUUB 3UCRA 5JW5A 4EUPB 3QDJA 4E5XB 3OJVC 4PV9B 1YEJL 4WHDA 1U3ZA 3CZFA 1PEWA 3O4LD 4UT6L 3V5DB 2OJZH 3C6LA 1NGQH 1RJYA 2FZ3B 1R3JA 4M43H 5I2IA 3TFKD 1J05A 3HZVA 3VA2C 5SV3A 2PXYB 2QSTA 5MEQA 1R5IB 2EZ0D 1XGRA 3H42L 1ZEAL 2HLFD 4ORGA 3I2CL 1OGTA 2P5WB 4HAGA 3IETA 3X3FH 4LVEA 1JZ6A 4HWEL 3EJYC 1MVUA 3B8SA 1MLBB 3RHWF 4H1LB 4X4ZA 3QA3B 2ARJA 4LCWB 1M7IA 5BZDB 1V7NL 5CIPA 3BSZH 5F7LB 5D7IF 5J11B 1Q0YL 1NC4D 3DROA 2A77H 3QFDB 1MRFL 3K8MA 1S9XB 3CMOH 3JBG7 5KS9E 1Y18B 5E1AA 4JDVA 2OJEA 4F15B 5BO1H 1X6LA 4WUUD 5DJAA 3IDNA 5GGRY 1NMBH 3N1PC 4GAYA 4PUBL 2A1WL 4LFHD 3KPTA 5HYFA 3RBGA 2VQUA 1LEGB 4LRNL 1MJUL 4I0PB 4XPGH 2ORBL 4LKCA 3QIBB 1YEFL 5DJZB 3RI5F 3S35X 2JJTC 3ZKXC 2FR4A 4JZOA 1I9RL 2IEPA 2J6EH 3B9KD 1RUQL 5KAQF 1HI6B 2A9ML 3TBVB 4AT6B 5CEZH 3LPGA 1DANT 2GFBB 2VAAA 3ARFB 1U58B 3WL9B 1OARL 1G7LA 1VGEL 3EDFA 3WHE0 3QJHA 1I1RA 4K9EC 2VE6B 2ZUXA 4QXTA 4V1DB 1T4KB 4LKCB 4PJ8D 2J8HA 1MRCL 1XF5B 2UWEA 5C2UB 1QLEL 1RZ8B 1NGYA 4JM4L 5DHYA 4R0LC 5CEYB 2KL6A 1MJJA 5DA4A 2W0PA 5ICYB 3MFGB 3CFDA 4X5WA 1G7LB 1K8IA 2V2XA 3OWEA 1A4KB 4X80H 4EUPG 3HE6C 1JF1B 1GPOH 5EU6B 1W0VB 4G9FA 1CLYL 1QTYT 5I75C 2P48B 3T0ED 4IRZH 3TYGH 1FO0B 3VMNA 1UQSB 3HRPA 1ZWIA 3V4VH 5HDBF 4N5UA 1ODAA 2P5ED 4AM0B 3VCLB 1KXQE 3WO4B 1LO5B 4FQQB 4Q2ZA 4Z8FL 3T1FA 4GRLB 1FYTD 2ZOLA 1MOEA 4DOHB 1YPZF 1FNLA 3OGCA 4L8DA 1IEAB 5C0JB 4K23L 3VFRB 3VI4E 5JQHC 3GSVB 1OAQL 3SKMA 4ZXBC 1FO0A 3Q2CA 4Y7MA 3KJ4C 3LQAH 3ZE1F 3O6LH 1CU4H 2VLJE 1I8IB 2Z4QA 4Y2DD 2NYYD 4PREB 4K3JL 5I8OH 4RZCA 2EXWD 3V0AC 1K8DA 2LAGB 3ZHDA 1A21A 1T20A 3MFFB 4YHPB 4U1HA 1KT2B 2DI8A 3U9PL 3VWJA 4UUJA 5EC2A 4H88L 4HUXB 4HMDA 4YC2C 5BVPH 5FECB 1QSZA 1I3RB 2JB5H 4PRPE 3WNNA 1FGNL 2VIRA 3WKNA 5ETUA 2RQ8A 2DTSA 5TDOB 4GLRI 4HGKC 1SBSH 2DJUA 2V17H 4W81A 1AQDB 4K94C 4GRWE 2K7PA 4FXKA 1EFXD 4BSWB 5JIHA 3MV9B 4OZHF 2VERN 1AO7B 4NQEE 5J89A 4MCYB 5JOPD 1NDGB 2YZ8A 5TF1L 2P8LA 2BDNL 3MOAL 1KN4H 2AJ3B 4Q6YA 4ZFZA 3DURB 3VFGH 2YUZA 4F7TA 2Z8WC 4JPIB 1WWWX 4LF3B 4S1RH 1TENA 4KJQD 1A7QL 1IQWL 3EJZD 2EYRB 1N4XH 2DKSA 3EJZC 3JXAA 5FUZL 4TNWK 3MREB 1DQML 1JV5A 5L2JB 1S7WA 4O5LL 5LGJA 3A6CL 2RAMA 2EIEA 2HJFA 2ZUQC 1CQKA 2P8LB 2DQHH 3HE7B 4P2QA 4WFHD 5HGHB 4QTHB 4K3GA 4J8RB 3NCYS 3DX7B 3PXJA 4WTZG 3FRPG 2VC2H 4KPHL 2HKFL 3F7YB 3O11A 5DK0B 4XBPB 5FF6B 3V7AG 4ZFFA 5D72H 3BGFB 3TZVC 3MRCB 2EDQA 4M03A 1EMTH 2X09A 2B2XL 4PRPD 4YGVA 1FHGA 2W59A 5EOCJ 5EU7C 5FUOH 3DWTA 3HPJB 4XI5C 4PJ5D 4DAGH 1OAZL 4OF3A 4X4ME 5HYEA 1UM5L 2RFXB 3HUJE 4HQQL 4HPYH 4ZSOA 3LQZB 5IB2A 1ZLUH 4QTHA 2R0KH 3AB0C 4ODWA 3C5ZD 4LSQH 5DJDA 1PKQA 3T4AB 5EUOF 1N64H 1S7SA 5I1JH 1UVQB 4K94L 3OKMB 4JO4L 3I6KB 3U4EA 4DQOH 4JQVA 5DJCB 4QTIL 5IESL 1QRNB 5HYJE 1F3RB 2H2PC 5EORH 4F9LA 3WO4C 3WDIA 2H2PD 5FFLA 2ILLA 4X83A 5C9JB 1YJDH 4O58L 3VWKB 2VRAA 2I9TB 4ZG1A 3LQAL 3NCJH 4F9LC 5A2IH 1BBDL 3U36A 3TIEB 1E4KC 2NNAB 5ENWB 1LO2L 1N6UA 5EBWA 5J06A 4YNYA 2OX5A 5IJKA 4OGZA 5JHLH 1HHIB 2GCYA 3GGWA 5CILH 3EHBC 2ZNWA 3SGKC 4P23B 3EGSB 1FVCA 3E6FA 3CSPA 2PR4H 2VAJA 3KS0H 3T1WA 1CTNA 4K71B 3G5YB 5DO2C 4OD1L 1MFEL 4U1KA 3K74B 1FGNH 1DTUA 1CT8B 4X4XA 3C8KB 5KVEH 5JPMA 4LLVA 2NMSA 3Q3GB 1KYOK 1FORL 1R24A 4PB0H 2V9TA 3RGHA 3QO1B 1RIUH 1FZMA 3FCTB 2EXYD 2EXYC 2J8UB 1ND0B 2AI0L 1T7VA 4P3CL 4P2OD 2AQ2A 5TFSH 1MCKA 4X9GA 2EC9U 3NA4A 1JZ4A 4NCC1 3P9MB 5CSBA 4N0FA 5EZJA 4IS6A 5JPMB 2DM2A 3BI9X 8FABB 4BYHA 4M1CD 1U2HA 2WBKA 3Q3GA 4MXVE 4TULH 1AC0A 4MJIA 3JV0A 4MQXD 1F02I 4LNRA 1EJOL 4JPVL 4NQDD 1ADQH 4M43L 2X4RB 3VFNB 1PFCA 5LJYH 4X7DC 3H9SD 3IDMA 4GG6A 2H45A 4WFGD 5I30L 3KPNA 4APQC 1FAIL 3RHWK 4XXDA 3ME0A 3DVNA 5EIQA 1NUGA 1JGLH 12E8L 1WISA 3FAWA 5I73B 3UTQA 4U1MA 2V5RA 4PBVC 5ACZB 2YPKB 3BZFA 1CIDA 3ZHLA 1O0VA 3ARDA 4D0CB 5GZNC 4U7KA 1YC7A 1P4BL 1PG7L 1TMCB 3WFHA 3WHXA 1T21A 4I0KA 3OKEB 5AWNL 4MD0A 5DHVH 3CFIC 3EOAA 3X3GH 4ALAL 1HHJA 3O8XB 4YUEL 4HGMA 4NFDA 3QQ4A 5FV1L 2RBLA 5LGKA 2D31B 1ZGLA 1FJ1B 5CJOH 1SEBB 4U6TA 4O51B 4ODHH 4JY5H 1DN2A 4GG6F 1RJLB 4C55A 1PGRB 4FXLA 5E03A 5EH1A 5DGQA 3PDDA 4MQTB 3RBSA 4H5SB 2ENSA 5D1XD 4OV5B 3H3PL 2YRPA 3DV6A 2OSLA 5LBSL 3NCMA 3W11C 4I5BA 4O2EA 1A6VL 1TJHL 3UJIH 4BSVA 3TH3T 4OLUL 2BVYA 5B21A 2WUBL 4MXQC 4TOYL 4QWWC 1DN0B 4CJ0A 4RFOL 1DEDA 3H9SB 1KTDA 3GK8H 1WTLA 1A7PH 3DPBA 3K8LA 3GBML 5ERWB 2XZCH 4JFFB 3OAYH 4LSDA 3UO1H 1UT9A 3C6LB 2P24A 5JW4N 4XPAL 3DBXB 4PG9B 1LP9A 1DBML 4OBRA 1Q9LB 4X9IA 2PXYA 5AZEH 1ZEAH 1T0MB 1X5LA 1C5BL 2J4WL 2JIXB 4GRWB 1KOAA 5C0NC 1TITA 2CLZB 1TJGH 1SM3H 1XZ0A 2VL5A 2P49B 1FNFA 2B1AH 4LASH 1MLBA 3ARGB 3G08A 1AGEA 1MCNA 1Q72H 1QYGL 3G9VA 1ACZA 5CIPB 3MNZB 4HUVA 5B39B 3MMEB 4QLRA 2Q20A 4KK6D 4V1DE 5I66B 1JCKA 2HMID 2A1WH 4G80A 1NGWB 1NFDF 1QKZL 3L95B 3DHMA 4WUUA 3HAEG 1N7ML 3H0TB 4GG8A 1ZVYA 1GGIH 1AGEB 3MRKB 2CO6B 4H1LH 3VFMA 1TXKA 1NJ9B 1G7QA 3BXNA 3HRZB 4KFZC 4PY8I 3RVXC 5I2IB 5L88H 1KN2H 4YO0B 2E27H 3HUJA 2AJUL 2Q86B 2VXVL 2BY2A 3BUTA 1OLZA 2VXUH 1FZKB 4YBLC 1U6AH 3BKYL 1WCBB 5CZVL 1GH7A 3QEHB 2R15A 4GW4A 4P48A 4OQ1A 1R3KB 1WBXB 2BDNH 2HH0L 3MOAH 1KCUL 5TE4H 2OQJB 2X1XR 1CDGA 3VXSA 2Q6WB 2P8MB 3MV8A 5T3ZH 4UINH 3IDYC 3I84A 3RAJH 1IARB 1MAMH 1NEZG 5FYJH 25C8L 3SDCC 5A3ID 1TVHB 3WXWH 1JRHL 4HC1H 3DETC 2GSGB 4UQ2A 1YNLH 1JRHI 1J7VR 2P5WD 4P2QD 4OFKA 1MRDL 5B4MD 4JY5L 3TWCL 4YDJB 3CUPB 4JM2D 3QDGE 4LSVH 5E6ZA 4P5TD 4MA1C 4DGYL 3DVFA 5L0QB 4S10A 1YMHA 1VEOA 4GRLA 4WJ5B 3JUYA 1U8IB 3VFSA 5ALBH 2BHYA 5C0FB 2QSVA 4M1DH 4YWGL 5I9QB 4L29A 2AV7A 1IKFH 5I17B 4N9OB 5FYKU 3GI8H 4Y0GA 4XMPL 1KCSL 1MPAL 4EQ3A 1UACH 4H20H 4HIIA 4GRMA 1U8OA 2Y72A 4FZ8H 1C16A 2VOTA 5EU6E 3I02B 4J6RL 3TA3A 4I0PD 1DUZA 2V7HB 1J0ZA 2V2WB 4LEOB 5FO8B 5BVJB 2ESVD 3CFEA 1RUKL 1I8KB 2OK0H 3V4UH 2DDQH 5EOCH 5T1DL 4KVCH 4Z7WF 1DJSA 3SEPA 5IHZB 1HDMA 1R3LB 2B0SL 3O2VH 4TYUA 4PGCA 4L4VD 1PQZB 3KPSB 3S36X 3WFCL 1FO0H 2JCCB 3AC0A 3TF7C 1RVFL 3TZVA 3IJSA 3P4MB 1UM4L 1YN7A 3ARPA 3BWAB 3WO3B 2JB5L 1SJHB 4ELMA 3DVIA 4GBXA 3KYMB 4D94A 1P6AB 3EIFA 3PV6A 5SWSB 3VI3F 4HK0B 3CFEB 1IRAY 3WKMH 1Z5LA 1NBQA 1ZVSB 3EFFB 3MLUH 1EPFA 3D3VE 5DJXB 5D7LE 2GHWB 2DJ4A 4P23C 5DD6B 2EO9A 3MV9A 1JWUA 1S9VB 1DBMH 2Y06H 4NHCH 3GSVA 2WNGA 4OCXL 3T0EB 3C87A 3ULVF 1NCAH 1QBAA 3FRUA 3OXSA 4U7MA 3CU1A 2Y6SC 4HS8L 2IMNA 5J6HA 2CK0H 5ALCH 2D03L 3UTSA 5BCAA 3VH8G 4LLYA 2ZCKL 2ADJA 1IC4L 5BV7L 1MFEH 3JTSB 4PJFA 3P11H 5JTWA 4YC2B 1JWMB 2BSTB 4RMSA 1S8DB 3ARYA 4PY7B 2BVPB 3TYFB 2GIYA 3K1DA 5C2BH 4YAQA 2SEBA 3BH9A 4J4PD 3MLVH 2I60H 3KXFD 4N8VG 4DVRL 5ACLA 1T22A 3Q6GL 1Y0LB 3CFJA 4Y4KA 4NN6B 2HFFB 1YY8B 5FGCE 3FFCD 3OB8A 4BQ8A 1OT2A 2XN9B 4JO2L 4ODXA 2W9EL 3ZKMC 4R7NA 4KKBD 2HKFH 3JTSA 3BGAA 3F7YA 3V52L 5FF6A 4ZS6C 1O7SA 1YEHH 1MCPH 2E7MA 4PLKD 4Z18A 3ULVL 3V5KB 3C8HA 3GEWB 3L3OB 4PJXF 4KZEH 4OZGE 4M62L 1NCDH 2PW1A 4KQ3L 2XRAH 1NFDA 3W5MA 2Z8SA 4ZUSB 6FABH 5ADOL 1H3TA 4XAKE 5HDQH 1MCJA 1BVLB 4GLRH 3KPPB 5EO0A 3VXOB 3ARGC 3IF1A 3IJYA 2IG2L 5JR1H 2KH2B 1OM3H 4HUUA 4L8SB 1QRNA 1AD0A 1FYTA 3FMGH 5IW1B 1H9VA 2YPVH 4CNIB 1Z0NA 4ZYKB 1F90L 1CFNB 1EIBA 3MRLB 4X5LA 4POZD 3F8UB 3IJHB 2P45B 3PV7A 1ZVHA 1AGFA 5BRZE 2A74B 5JXAL 1YYLH 1BBDH 1C08B 1CS6A 3FKUS 3LB6C 4M93C 4KGJA 4MA1B 5INCB 4WDIA 1IT9L 2Z92A 1ONQA 1K6QL 1PY9A 1FVEB 3D48R 2FX7H 5C0EA 5IW1A 2YWYA 3LH2L 4S1QL 3ARBB 1ES0B 3MV7D 4JFDB 3JWNC 2VN4A 1MPAH 5HY9B 4M6OH 2MSPA 3ELAT 4IRSA 5FYLL 4V2CB 5AYUH 4TSAL 1QSFD 4B53A 4LSSH 4HZLA 4IOFC 3W39B 1I1AA 4QRPD 3MV7A 3UZEA 3MCLH 1KULA 5CSZB 4PJ9C 4R0LB 1RUKH 4ZD3L 1RUAL 3A0OA 4OCRH 1MWAB 3GM8A 4OUOA 2IAMD 4UIKL 5F89B 2ED8A 2YA0A 4U1JB 1W0WA 4E9LA 2PR4L 4P2RD 5C0IB 1RHHA 2E7CA 1FL3A 2VXTH 4ZAKC 5I71B 3U46A 1QFWM 1ZT4B 4MCZB 2VZ1A 4F3FB 1EHXA 3LOWA 3P0VH 5J1AA 4FFYH 1QSVA 2JF1A 5HYSG 3IDXH 1B0RB 3DUSA 5J8OA 2JELL 2RHEA 2OTWB 2V9RA 5TDNA 1N5YH 4CVZA 2IGFL 2YMXL 4QXGH 1V7MH 2NR6D 4LHQB 4XCCL 3BPCA 1I9IH 5HVHB 1N6VA 1T5WA 5HHOE 5I8EB 1QSFA 3RWJB 4X9BA 4EI6A 2XZZA 3MOBH 4XCYB 3ARZA 3FOMB 3CXDL 2P5EE 5GSRA 1JUFB 4RQQA 3WIHL 3VW3H 4WW2C 4U6HB 2W65B 5T5FH 4HIEB 4GAGL 4RMVA 2EDYA 4P57B 5F7MC 5DK2A 1CGVA 2IFGA 3HI1A 5GZOC 3K81A 4YBQC 3RY4A 5GZOD 4N9GA 2NXZC 3RWGA 3LHPL 5ESVA 3CNKA 4JRXA 1FQ9C 4EI6B 1AE6H 1CDBA 4HWBA 3S9DB 3QDJD 4KVNH 4LARL 4PRIB 1FN4B 4PJXE 2XFXA 5CJQH 4WNQB 5AWNH 4KK5C 4ZAKA 2F5BL 5HVHC 3WXVL 4MJIB 2DBLH 5JUEH 5FK9A 5IP4A 5DK2B 3H9SE 3CJJA 4PRDA 3VFNA 4J12A 1XF2A 5K9OB 4CDGC 4LPWA 3A6CH 1JHKH 3RVWD 5IOPA 1YJDC 5DF0A 1V7NH 3GSQB 4QRTA 3TCLB 4JJ5B 4L9LC 4ODVL 1MFBL 4OGAD 2VB5A 2RGSA 1QBMH 5FK9B 4YXLH 2JE8A 4LHJB 2CDGA 4ENED 4G7VL 3WD5H 3RNQA 2NTFA 2CR6A 3V6OC 4QOKA 4RIRB 1KTLB 3HNTL 3NABL 3VRLF 5IOPB 2VSDA 3P4OA 5LXGL 2C4FT 1TVDA 3SDDA 3RJDA 5DJYB 3D69B 5HI3C 1KLUA 4LKXB 4D0BA 4L4VA 4HJ0C 3OKDA 1NQBA 1RMFH 5C3TA 3UO1L 5F6HI 1RUAH 2H2SC 4NO3B 1E6JH 4P3WA 4XP4H 5E4EC 1OTUC 5DD3H 3LDBC 5E2TH 1S3KL 1U8QA 2WWKO 4RGOL 5D1ZC 4HG4J 4RIRA 2AW2A 2B1HL 4DCQB 4N0YL 2VL4A 2WUBH 1U91A 4Y16B 2F9BT 4YZFE 1U41A 3IS1X 4E41B 3DARA 2ZG2A 4YHNA 3ARGA 3G08B 5MP6H 1DLFH 3CLEL 3BJLA 4NQXB 5I1HL 1WIPA 1A02N 3B9VA 1TIUA 4UBDC 4CKVX 3U6RB 4YDLC 5ELIA 4R7DA 4L9DA 3FQRA 5IVXB 1QSFE 2EDBA 3P3YA 1EGJH 3G6DL 4JFEB 4HXAL 3EAKA 1AHWB 2VISA 2WINA 1KEGH 5BW7A 4WI2A 3DI2B 1AFVH 3WNOA 2A0LD 1UM4H 5C0CB 5FGCB 1XGTA 2EDXA 1YQVL 2R8SL 4BH8A 4PGBB 3FHAA 4LDOB 3GJFA 4WFFD 4XNXH 3PIQB 1YEJH 3FQRB 3ZDYF 1KGCE 3O3DB 2WQRA 1A3LH 2BNRA 2X4PA 4FQPA 1C8PA 1WICA 1T7ZA 1NDMA 3DMMB 5KSVA 4WI6A 3NAAL 4XHJC 4X8XA 3D85D 4MD5A 4M6AA 4JZJB 4Z7VF 5ANME 2XYCA 1JPST 2XIDA 4KUCF 3NZHH 3TBWA 2J12B 3VDBA 3O3DA 1YEEH 3BP7A 4PJ5E 2CGRL 3LS5H 2ARJQ 4MVBD 5HHMB 1S7VB 5D4QA 1BIHA 3HE7C 3MBEC 1JGEA 3UTZB 2CH8A 3OQ3B 1AE6L 3MBED 4OF8A 3VGGA 1BD2D 3MLZH 1IAII 4ZFOL 1JNNH 2ADIB 3PF2A 1J86A 2EDKA 4LSPL 5GRUH 3LPFA 2AK4B 3UJTH 4TN9A 4NN5C 4S0TD 1R3HA 1UB5B 4NO0A 4FFWC 2F54D 4BH7B 3PQYD 1NC2B 3O2DL 1SJEA 1KJ3L 4OM1L 1NC4B 2NY3D 4KV5F 3QI9D 2XN9D 1J0IA 5KS9A 1NFDE 1KCRH 3ZDYE 3WHE1 4L4JA 2XZAH 1IQWH 1U95A 2O5ZH 3AAZB 3C6SA 3QQ3B 3TPKA 2BJMH 5E6IC 2PW2A 3PGCA 5CUSH 4R3SB 3WL9A 2CJUH 2NY0B 3FQUB 2BXZA 3X12B 5FYKE 5HHVH 4O5LH 1FLRL 2AJUH 5KZCB 3ZKXB 4YX2H 3KXFE 4O9HH 3LS4L 1CICB 1G9EA 1KJ2L 3QDAA 1JE6A 2Y4SA 1PSKH 1WBZA 4PV8A 4ZFOB 1YMMA 2YD9A 5GS1A 4LEXL 1G6RL 1AY1L 4R3SA 1N0XL 3DXAA 4QF1A 1B88A 2CIKA 1JRHH 4HC1L 1FL6B 3I9GH 3EO1B 2UVEA 2AEPH 5GQBA 4CAGA 2ENYA 4MAYA 5C0BE 1YN6B 3O6FB 1U8MA 3HR5B 5DD5H 3D0LA 3LKPA 2P7TA 5SX5H 2OJEB 1WBZB 4PV8B 2XTJB 4JAMA 4P5TB 5LWYH 2LU4A 4QRPA 3MJ8B 2YKLH 1F4WL 2DQIL 4NZRH 4XCNB 4TNWF 2C5DC 4LMQI 1F4XH 3HAEA 2XG5A 2I5YL 3ALPA 3CX2A 5F9WC 3OGCB 1CU4L 3M45A 1JYWA 4KJWD 5IHZA 3L3JB 1IC5H 3SBWA 2VAAB 3ARFA 3W9EA 3PL6B 2HLAB 3T0EE 4JFFE 3ARDC 1ROWA 1A6TB 5SWSA 2EDNA 2DQFA 3N1GC 5B38G 3V52H 1WIOA 4ODUA 4P4KA 3TV3L 3IDUA 5DS8B 2G75A 4YHKH 3SO3B 1U8NA 2GJ6E 3ZKQD 4KKAC 1A6AA 2XQYK 2PNDA 1E28B 1FG9C 1OP3H 3EFDH 3MUGB 1EEYA 2ATPA 3VXNA 3EZ8A 4W70A 4HUXA 1J5OL 3CXHK 1OD9A 3QO0A 2JK5A 1AKJB 1J1XH 2F54E 1A4KA 5IBUG 3QPXL 4P59H 1XIWC 1NLDL 4P5MB 1CVSC 3W5NA 3DX6B 1U0QA 2R2BB 3LRSA 4XP9L 3BPOC 1VCAA 4L5FH 2BVOA 4JFQB 3CU7A 1BQHG 4Z0BH 2IJ0C 2NY7L 3F5WB 4LOUC 4AM0A 2SEBB 3BH9B 1NMCB 4LLWB 1PLGH 4K3EH 1NSNL 3OF6D 3VXNB 3GMQB 5IBTH 3I2CH 1JPSL 1XMWA 3RTQB 1JYXA 4QRRB 1MJ8L 1MJ7H 1P7HL 1I1CA 1X3DA 5DZNA 4ELMF 1Q9WB 4WV1C 1EXUA 1N3NA 1TCMA 4XP1L 1T5XB 2Z4QB 4WO4A 3U9UB 4I2XB 4LCWD 4HBQA 2YRZA 1LO4H 3LSOB 2DBLL 2W91A 4LPVA 5IKCA 1H3PH 1OSZA 4Y4FD 3LEXB 1FPTH 1IGMH 1D5MB 3EYFB 3QNXB 1QG3A 3D6GA 5D5MF 1DBKL 2VDMH 4KJYA 4U1GC 1VFBB 3RDTB 2VDOL 1QUNA 4JQIL 1DUYA 2DQJL 3F58L 1RK0B 1U2CA 3BGMA 5C6TL 1X5FA 2NCMA 5D7IA 1T1YA 4LAQH 1LNUB 1BPVA 1KC5H 4DKFH 4GAJL 4ORZC 5DD0L 4QHKJ 4Q6IA 5IG7B 4OBSA 4IMLB 5ADOH 5FOBA 3MBEB 4F7PA 3QFJB 4YHYC 1J8HD 4DUXA 4I9WE 4NQSA 3CX5J 4MDJA 1Z2KA 4TVPE 5C0RL 4MMZC 5HHMD 4Y5YC 2AJSL 3VXME 1UCBL 2E5EA 4XAWL 1MUJA 3V8CA 4KMTL 4JN1L 4CVXB 2VLRE 5I18H 4OI7A 3OX8B 5CCKH 2IH1B 4O00A 4YFLI 4EDXB 5EDXA 1P4IH 2B2XH 1Z9MA 3FTGA 3HZMB 2Q1EA 4MNQD 4X6CE 5D1ZB 1ZOXA 5DO2D 2Y1VA 2KZ1B 2PO6A 1A1NB 2NX5B 2PYEE 2VR5A 5F7WC 4IOIB 2OR7A 3QI9B 2GW5A 1J10A 3BVNA 3CXDH 1S7XA 4QGTA 1RIVH 3MBXH 2OTUB 5D2LE 2D7PA 3UTTD 4NKDB 4EJ1C 3FQNB 3DOSA 4G8IB 2X6MA 3ZDZF 5E08L 4U1SA 3ZT6A 3CX5K 1BZQK 4QOKE 2R2HB 2COQA 4ZO9A 1N5YL 5C0IA 4YK4B 1ORQB 4N9GB 1CE1H 2RCSH 2P5EB 4JG0L 3AM8A 3T65B 1FFPB 3JZ7A 3O6ML 3NIFF 5IBLC 5L7XL 2Y07L 3L5HA 3QDGA 1IZJA 1WZ1H 3EO9H 1Q9OA 1DBAL 3OKMA 4MQXC 4UDTA 4YHKL 4PLNC 5EUKA 2R8SH 2VYRE 3BZDA 3RZCA 5C0AB 2C3HA 1F45A 1BFVH 2AJXH 4HKZA 5JW3L 1KJMB 5FEBA 1F58L 3QHFH 3H7BB 2B1AL 4LASL 1ADQL 3C5ZA 1Z9OA 4XBGA 1CN4A 5CS7A 2WLZA 2VNCA 3N0PB 4P2OB 4LIQE 4XP6L 3Q1SL 1LK2B 4Y8DC 2GTWB 4GW1B 3KPSE 3B2UC 3BEVA 4OQTH 1LP9F 3BDYL 3WD5L 1R3IL 2BRQA 1HCVA 3TNMA 1V7ML 2BVTA 4OUUA 4UV7H 1G7IB 3NCBB 3P0GB 4K8RH 4A6YA 3MROB 2O5YH 4GG6B 3QIBD 3H7BA 3WS6C 4ONGH 1M6OA 3MXWH 3PL6D 4YFDB 2R4SH 3T77A 1HNFA 4FQXA 4WVRA 4PRBB 1SY6L 4JKKA 4MQ7B 1LO4L 4OIAA 1TQBB 2QR0A 5B8CA 1Z6JT 3GZKA 3HB3D 1ZS8A 4R26L 2BSRA 3IFLL 3BPNB 3MLSL 1NAMA 1A5FL 1BQSA 1X7QB 5LXGH 1I8MB 2QLVB 1ZLVH 1CLYH 3H7LA 4MWFA 1F4YL 5D7JC 4MJ5A 3QJFB 1RUPL 3VGBA 2A83A 2APFA 2WIIB 1H0DA 3BPNC 3VI3E 1BAFL 2XZQH 1KPRB 3WFBL 4QKXB 2YSSA 2BSRB 3RX8A 3TM6A 5E8OB 3DO7A 4XNUL 2NY6B 4LNRB 4S1DC 4ZTOL 3PQYE 4W6YB 4HMCA 1NMBL 4PUBH 4P46B 5HJ3B 4FQLH 2JJWA 2NZ9C 2HN7B 3HFML 3GRWA 2HFEA 5LGHH 2NZ9D 3NIFE 4I1NB 5GGSB 3V0VA 1BQLH 4U6VH 4I8DA 1QSEE 2ADGB 3R1GL 5I8KL 2PCPB 4DFHA 5D1QB 2IPTL 4Y2DA 3W9DB 1XCTB 4MX7A 3I3DA 2EE3A 4Y4HC 2W0KA 4Y4HD 1L6ZA 1YEIH 1DBJL 2A6DB 1J0YA 1JZ5A 1KELL 3VWKD 5HTSA 3S34L 4NKMB 1G9ML 2X4OB 4HMEA 4PJBB 1YNKH 5L9DH 2VXTL 4HJGB 3BRDA 1LP9B 1T21B 3NZHL 3U6RA 1NAML 3LKSA 4OLZH 4F7PB 3TBWB 1BZ9A 4JY6B 4YIQB 1MCCA 1KLGA 1GOHA 3KLAB 3P77B 4PJEE 4WHTA 4UTBH 1CGWA 4NJAH 3K2UH 3CDYA 5CBAA 1VERA 4QWWD 5TE7H 1FC2D 2FGWH 1A7OH 3ARTA 4KKLC 1A14H 2DLTA 2FECL 3VRIB 5GGUB 4XVTH 1BIIB 5FA4B 2V2TA 2EH7H 3AUVA 5FM5O 2DQDH 3KPQB 5DUBB 2FJFB 2FHCA 3C60A 3IKCA 4LLDB 4AG4H 4ELKB 3G6JE 3T4YA 5GSVB 5HHNB 2E6JA 2DI9A 1KJ3H 3TO4D 1ZV5A 4QT5A 3W0WB 2YC1B 3RWEB 4HIHA 2KBGA 3IYLW 3RRQA 1FFNB 1W72L 3GSNA 1WBYA 1KCKA 1P84J 3EYUH 3F7QA 1W72B 3FT2B 5IB1B 3MA7B 1FFOA 2DIBA 1II4E 4HF5L 1AXSA 4RISL 5AAMA 4P99A 3O3AA 2QHLA 4NSKB 3D2UA 1OLLA 3IFLH 4HT1H 1EVTC 5EUOB 3BZ4A 4P4KD 3GBNH 3GSNB 5FYJE 4P4RB 4KTDH 4WW2F 1FBIL 4AJ0A 4XCEB 4NKIL 4Z5RB 1B4RA 5JOEA 1U92A 3HCVB 2GSIB 4OCWH 4Q74A 1HOCB 4E41E 2AEPL 1CG9B 1QFWL 1I7TB 4QHUA 4NSKA 1DQDH 5E56A 3BEWB 3IDJB 1MCEA 1PYWB 4OAWB 1I4FB 4Q9BA 5KS9B 4BQBA 1ED3A 1U8KB 3TNNA 5DD5L 1SHMA 5C08E 2DF3A 1LEIA 2PTTB 4JAMB 5FUCC 1A6UH 1HEZB 4JZNA 4WUUB 4F15C 4KHTL 2EC8A 5EC1A 1CDYA 3UJTL 1FZOB 4F37F 4JM2B 1T1ZA 2YPLD 5I17A 3BKCH 4UINL 3PQYA 4WWKD 5ISZD 3F7VB 3BEWA 4YZFF 1NL0L 3D39D 5FOJA 3KNBA 2V2WA 3TYGL 3MODL 5DD0H 3RWFB 4JM2C 3FB8A 4QY8A 1V3LA 4L4TE 3B2VL 4WTXA 4JCMA 4PGDA 4X9HA 1OVZA 2FL5B 5IROC 4KRLB 4CADB 1B0GA 3PGDA 4LSRL 4LCWE 5JOFB 4RMTA 3D18B 1BHGA 4DZ8B 2ZOKA 3VRLE 2P7TB 2Y6SD 4XT1C 1CXFA 2RJMA 4ORGB 4ELMB 4QHLB 4UQ2B 2YRLA 5ID1A 2XOTA 1G7JB 5GGQH 3O6LL 5BQ7B 1KXTB 5DWUH 4MSWB 4M61A 2FIKA 4M7LT 3M8OH 4E0RB 4ZQKB 2BVOB 3VFUB 2IANE 3DX9B 1AQKL 2Z35B 4U7SA 1H15B 4FMFA 1JTPA 2R0ZH 3TEUA 3FT4B 3VFTA 3VXPA 4WFGE 2XTJD 1QRNE 4ZTPH 5HYJB 1JGUL 3WN5A 1NBVH 4JE4B 1BJMA 2EKSB 1A7OL 2BVEA 2Z8RA 4JG0H 2H6PB 5DS8A 4DVBB 2V7HA 1EERB 4ZXBB 1EXUB 2D2OA 5EB9A 4WIQA 2DQEH 4Q2ZB 4OTXH 2NY7H 4KROD 4Y5XA 2JIXD 1BVKB 3QO0B 1XFPA 3MLWH 1KYOJ 2HFFA 3S5LB 2CDEB 1ZLSH 1OWRM 1JHTB 3HG1E 1N7MH 5DUML 12E8H 4NRXA 3ARGD 1PQZA 4MZ3A 3D39A 1Q9KA 3SKMB 5DQ9A 1XF5A 3LKRA 3TV3H 3GNML 3S4SA 4KXZI 1QA9A 3HLAB 4KQ4H 2ZCKH 3GSWB 3GSXA 1NGXA 4L3EE 4X5WB 2Y25A 4JFEE 4RISH 1VESA 1VADA 4ZUSA 4EXPX 5DD6A 2ZSWA 4QRQA 5D2LB 2L7UA 4NUGH 4F33A 3WLWC 4WO4C 1IGML 1DQQA 3OZ9L 3WLWD 5TGBA 3CDGA 4HDIB 3QRGL 3J7HA 4PJ7E 5TE4L 3NA9H 1H3WM 1UYWL 3OX8A 2WUCH 3T1FB 4PLKC 2ZJSL 1XR8B 3SKNA 5KTEL 2HP4A 3QXVA 1FFRA 5FKPB 1CIUA 2EO1A 1OSZB 2EIZB 4RSVA 3MRPB 1QR4A 3H3PH 2HVKA 2IH3A 4MCYA 4XMKL 4IOFD 3HC0A 2F74B 3FQXA 4RAVA 1DUYB 3P73A 2Z93A 5HHXL 5F88B 1A9BA 1RULL 1TZHA 4R4BB 4TVPH 1NGZB 1T2XA 3U79A 5J12B 1G6RH 5LG1A 5I30H 1EEQA 3OKLA 3S37L 4OIIL 3BD4A 1ZLVK 4NPYA 4OZFH 3RWDA 5KSUB 3VJ6A 4I3SH 3V5KA 4FZ8L 3D87B 2EYSB 3RL2A 4ETYA 1GPOL 2HVJB 1H8NA 1FNEB 2C7UB 2X5PA 3FFCE 3HE7A 4P2QB 1U8PA 3P2TA 3MACL 4XTRC 4FXGB 1WV7T 3K46A 3UTPD 1Q94A 4FHBD 4GW5B 4V1DD 1RK1A 1TJGL 4YBHA 2AJYL 1VB9A 4YHZL 2ADFH 3OR6B 5KSUA 3RWDB 1ZHLA 4X7FC 4Z7VA 4CNIA 1JHLL 2CKBB 2JB6A 4ZUTB 5LAXA 2NQCA 3PJSA 1ACYH 4NO2A 3MRHA 4RBPK 3LQZA 1AIFB 5BXFB 5A16A 3PE9A 5E9DB 1Q94B 5KVGH 3TIDB 4RDQF 3BUYA 4TSBL 3V79C 2OL3A 3E3QE 4PB0L 2NY1D 2IAMC 1QO3A 5DJCA 5DXWA 1XF3B 3SGDH 4Z7VB 5JIPA 5T5FL 4OB5L 3NPSC 2MOVA 2HWZL 1G0DA 2VWEC 4Y4HA 4R90L 3D1MC 3CVHL 3PWVA 2OZ4L 5BS0E 5A1AA 3L3DA 3MRHB 4KK5D 3MZGB 1RIHL 1I7RA 3RIAF 4AIOA 3LKNB 4Z7UB 3QWRD 4XWGH 3V6ZA 1M7XA 1GHFH 4HCRL 2BSED 1T7XA 4MJ2A 1P1ZB 1N26A 3VFOA 3KLHD 1MCFA 1ZGLM 3O4LB 1UWXH 4Y88A 3MRFB 3UTOA 2F53E 5DZLA 4M6ML 4NKOA 5IVZA 3A6BL 5J3HC 1KPUA 4Z7NE 1RURL 4MAUH 2WWMD 2O5YL 1J0KA 5DJDB 1UJ3B 2QQNH 1FFQA 1JGDB 3IT8D 1CD8A 4P2RB 4RA0C 1CXHA 4FQCL 3T3MF 5HGDB 4GRWF 4OGAC 4H25B 2LAAA 3TBYB 2HJLA 1T2QL 1UWXK 3N1QC 3ZYOA 3OG6B 3RUGF 3RVTD 4NWTL 3MUJA 3ARRA 3RTQC 3VWKA 3H6JA 2J8UA 4D8PA 2OJZL 1HSAB 1LP9E 2XPGB 4K07A 1F8TH 5EU5B 3LHPH 3GSQA 5D8JH 3BYTA 1OAYL 1OP9A 5T1KB 3G5XA 3V6OA 3PWNA 5CP7B 1OM3L 5KSBE 2Y23A 2WW8A 3I85A 2CDGB 4KKCC 1JUFA 2ATKB 4Z76B 4NC0B 4G5ZH 5T1LA 3VDCA 2ESVA 4LFHG 3A67L 2W65A 2ZCHL 4OLXH 4Q9CA 1QPPA 1MCDA 4TNVK 1BZ7B 1EA9C 3MJ9H 3OKDB 5I8CA 4NQDE 2DQHL 4B5EA 4Y89A 3LY6A 3HI5L 4G6KL 4DTGL 3DYMA 1KEML 4AENB 2VXQH 2E3VA 1E4XH 5L8KB 2I26N 1D3CA 3STLB 3TJHC 4G6AC 4XXDB 3C5ZC 1T0NA 4I4WB 5GRWA 2D0GA 1IC7L 1J8HB 4K55A 3BP5B 1BZ7A 4E41D 3ARBD 4G42A 1GIGH 4X0KA 4EUPH 2A9NH 4JRXD 4PJAB 2UYLA 5K9OA 4HJ0D 4CW1B 3HS0B 4HXAH 5EO1A 4FG6D 2QKIB 1YY9C 3LMJH 3ZE2E 3S96B 1MH5A 1NPUA 1RZJH 4URTB 5L9DL 3CC5A 5C07A 4GKNA 5IK3B 2D03H 2EDJA 3BH8A 4KC3B 1TQCC 1XCTA 4MX7B 3U0PB 1J8HA 1UZ6E 4QT5B 3VH8B 1JK8B 3UXFA 4X7CC 5EU4B 1CF8L 1IGCL 1HINL 5DD1L 1NANI 3WLBA 3K2UL 3JV4A 5DR5H 2GAZB 2VZUA 1V3KA 4X6EB 2OMBA 1RJLA 3FZUC 2CO7B 3NFPA 5C9KA 5IUSA 3RUGB 4Y19B 4JB9L 4KDTC 5F1IA 5IROA 1MEXH 4IMKC 4JFOA 4CU7A 1CBVL 3A6BH 3VGHA 1AI1L 3M07A 1N6QH 1UZ8A 2JJUA 1HH9B 2KQMA 3IFNL 3VFVB 5F72S 1U3JA 3RJQB 3ARDB 4MJ4A 3MCG1 3C9NB 3HI6L 4FQIH 3EYUL 1F58H 1KTDB 3IGAA 2G9HA 1JJUA 3C60B 1KB9J 3WEXB 1YPZA 5I76B 4OLYH 1QFWH 4LQFL 5E8EA 3LKQA 1AXTH 1N8ZB 4P2OC 5C09E 4APQB 3PWLB 4PJ9A 3FONA 3MLUL 4XPFH 3UX9B 3WYRA 2NY2C 3BE1L 4CBPA 1TZGH 3JWDL 5HHOB 2NLJA 1QD0A 4M1CC 4IRSC 4XHJD 1QFUL 1SQ2N 5DYOA 2VLRA 5KBNC 2X9XA 4A2MA 4PV9A 5D96B 2EYTA 3CIQA 1T3FB 4ELME 1HXYA 4FABH 2GK0A 4ZOBA 1U9KA 1JN6B 3V6FA 1JPFA 1FV1A 4X6CA 1BFOA 1GGUA 4MDIB 1IILE 3X17A 1N59A 2AKRA 2MTPA 3CK0L 5D7LA 1SBSL 2V17L 2I07B 4L1HA 3ZTNL 3LDBB 2IBZY 4J3WA 1S7RB 3L3GB 1MAKA 4Z5RA 1MCLA 3QIUC 4BFBD 2FH6A 4YHMH 5JO5B 2WIMA 3P4NA 4PJ8B 1JWSA 2EYTB 1P5VA 2FL5A 4N8PA 5ERWA 3QNYB 4U3XA 1CFBA 4Z7NF 5HGBA 3UTSE 3O4OB 1NGQL 4KRPB 1I9EA 3GSRA 3SDAA 4GKSB 4PIRF 5E6IB 4EN3A 1DDHA 1WQVT 2V7NB 1MQ8A 1TQBC 5EWIH 1HSBA 2FEEL 2AKRB 3TPUB 1FRGL 3S35L 1GIGL 2HFGH 3MGTB 4OJFL 4PJ8C 3GIVB 2WBJD 1S7RA 3L3GA 4MB5A 5DWUL 5E8NB 4JFDE 4UB0H 4KQ3H 1C5CL 4RGNB 3X11B 3KPMB 2BC4A 3KPLB 4XP5H 1IT9H 3S37X 3O9WC 1VPOL 4PR5B 2VXQL 1H15A 4AT6A 3HE6D 1YN6A 3ILQD 3O6FA 4HWNA 1S3KH 1CK0L 4RGOH 3LH2H 2IQAB 2CXKA 3UJIL 5J57B 1NCBL 1H5BA 2C4FU 3T3PE 4KUZH 2IGFH 2EKSA 5FUOL 2E6PA 4Y4KC 4N0UB 2Q8AL 2BC4B 1IQDB 2IANB 2OR9L 3EZJB 1YYLL 4R2GD 3N50A 4HUWA 1NGYB 1U8HB 5DJ2A 3LIZL 4Q0XH 4QRUA 1MREH 4FN0A 1NCWH 4OCRL 2BXYA 5KSAD 3RZWA 2Q86A 4PJ7B 1VEPA 1ZLSL 4FFVD 4JZJC 4NNXA 4F2MB 4QHLA 5FO9B 5EU6A 4ZUUA 4WI4A 4OFYD 2DLEA 4M9PA 5K9JL 2R56L 5DEFB 4ODUB 4P4KB 2IPKB 2XWTB 4NJAL 1I1AC 2NYYC 1UWGL 4B0MM 4JM2F 1J0JA 1WAAF 3AREC 3WNKA 3THML 3D3VB 4QHNA 2WWKT 2AXGA 5I8OL 3LZFL 3MGAA 2OMNA 1QEWA 3HG1B 3QRGH 4HIXH 4V1DA 1KN4L 1IGJA 4XNMB 3IJSB 2H6PA 4DVBA 4ZUWB 1I8IA 2MPAL 4WW1B 3SDXA 2J6EA 1IGFH 2DKUA 5CEYA 1L0YA 5BS0B 4CN4A 1A9EA 4BA8A 5K9QG 2P4AB 3MOQA 4WUUE 4TNVF 2BVUA 3KPRD 2CDEA 3UBXA 1SJXA 3MRPA 4JG1L 4GAGH 1X6NA 4OD3H 5DURD 4UT9H 2R1XB 1TFHA 1I8LA 3UTSD 1VFOA 1K3IA 3U1SL 3CFCL 4XNMA 3RVXD 1U6AL 3BKYH 2FR4B 3GSNL 3HPLA 5FCSH 1S7TB 2UZIH 4WO4B 4TUKH 1A6TA 1P5UA 1CCZA 5ANMB 1J1PH 5TFSL 1BBJB 4OQTL 2OI9C 5DMIL 4FTVB 2E7HA 3GIZL 4O2CA 1R5WB 3BESR 5EFIB 1Q0YH 3RDTA 5E2TL 2VLKD 4HQQH 1MRDH 4AL8H 2X10A 1AP2B 2JKXA 5D8JL 2CKBL 3ARXA 3NN8A 4K2UL 2NTSP 1GOFA 4RGNC 1K9TA 5DJXA 5EO9B 3LD8C 3LQMA 1CL7H 5F6IB 4OFDA 2FATH 4O2CB 1ZHLB 3BKCL 4Y16D 1UZ6F 3MBEA 4HEME 5B38A 1ZTXL 2JB6B 3GI8L 4ZUTA 1IGIH 1Q0XL 3EOTL 3AU1B 5TF1H 4RAVB 5HGHA 5EPMB 3Q48A 5AD0A 4DJMA 3PWPB 1OW0C 5D7SH 3KPPA 4EDXA 4I3RH 2R69L 4G6JL 4L8DB 3BISA 4DGYH 5DMGC 1Q9WA 5FUZH 2ADFL 5JXEC 4HHAA 3F12B 1MFDL 1KC5L 4K71C 5SWZB 4GAJH 4HSQA 1ORSA 3T8XA 2A6IB 4ZTOH 1CZ8L 1CICC 1X5ZA 1CICD 5I75B 2Z91B 3MRRA 1O5DT 3JWOH 4JREB 5MHSD 5GPRA 5DLML 5INDB 2ITDA 5C07D 5BV7B 2I5YH 4FZEH 2X42A 1BECA 4M4PA 2Z92B 2ZPKL 4X5XA 3O81A 2VZTA 1XIWB 4O2FA 5L2JA 3LMJL 3DI3B 4YXKL 1CLZL 2YZ1A 3UAJC 5M7QA 4M48H 5F70A 4K7PX 1QVOB 5EOCL 4XP4L 3ZSSA 4NQCD 1E4XI 4PLJD 4NUJB 1YEIL 2EDOA 4ONHB 5KSBB 5D93B 2FGZA 4DEPB 2RB8A 4MJIE 4V2BA 1BFSA 1KTKE 3EYSH 2ITDB 4MDJB 4JO3H 4FXKB 4U6XB 4YDIH 3R0NA 4OF5A 3VXTB 3QXTA 2CKNA 2ICEA 4AIZB 4IRJA 3HPJA 4WV1B 4C56D 1HHGA 1VACB 3RUGE 1W0WB 4TTGA 1MFAL 5D1ZA 5T3XH 3KWWB 5GXBB 4ZODA 2DL9A 5INCA 4D9QE 5I74B 3C5SA 3Q5TA 4JO2H 5HVWA 4N0UE 1LGVA 2W9EH 4JHAL 1HWHB 4LVNB 4HWEH 5A40E 1RY7B 3L1OH 4MCZA 4F3FA 1FVDA 4F9PC 3E1F1 2FX8L 5EIVA 1YEHL 2FJGB 3NCYP 3QUYB 5JORA 3FCTA 2VLME 2DQTH 3ZKMD 3ES6B 4JFDA 1T7YA 3FRPA 2F54B 1MI5D 2HT2D 3FO2A 3QAZB 1W72H 2DB8A 3CXHJ 5D7KD 4O9HL 2DLHA 3T2PA 3SO5A 5HDQL 3W39A 3P9MA 3HR6A 2PO6D 5BRZB 1HZHH 4L9LA 4HD9A 2XQBL 1DVFD 5F7DA 1QFUH 3V2AR 5SX4I 1KFAL 5IF0B 4MB3A 1MVFA 1U42A 1FZJA 3FO9B 1MCPL 4NZJA 3C8DA 2WP3O 2GT9A 1CXKA 3RVVC 2XNAA 1A4JA 3IFPA 5SWQA 3VI4F 3QIWA 5EU6D 1FBIH 4B7IA 1FL3B 1INDH 2BOBB 4JHBA 1NCDL 4EKXA 1KJMA 2NY4D 1P2CA 2ESVE 3GO1H 3L6FB 3FN0H 1E6JL 4OGYL 4TSCL 1GZQA 4XB8A 4LSPH 3O41B 4N5ED 4PGEA 3FJTA 1F4XL 2Q7YA 4N5EC 4UTAH 1YMMD 4K7FA 2HKHH 2J1KA 4CDHA 3U7YL 5EU7E 5HDLA 5IVNA 5KSAA 3ARFD 5GGSA 1HHIA 2GCYB 3GGWB 3F7RA 8FABA 4LU5H 1TCRA 2CLRB 3PHQB 3SKOB 5ISZB 3MRJA 4JO1L 4XP5L 5EZOH 4H8WC 4XX1G 5BMFH 4YHZH 1UH3A 1EGJL 1DLHA 5C0DA 4CRPA 1NBZB 4OKVA 1KENH 2QR0B 5B8CB 1PD6A 3WS3A 5I16A 2AEQL 3NH7H 4XNUH 1CDHA 3G04A 1DCLA 2YEZB 2YUXA 3WFDH 3ROLB 3UROR 3VWJD 3RWCB 4TUJB 1PKOA 1D5IL 3MLRH 5DEZA 1A0QL 3T08A 4BFIA 4MA7L 1A7PL 2BK8A 2D0HA 5IHBA 1MHCB 4XNXL 5IQ9B 5JQ6L 1YYML 2ERJC 2A83B 5F3HB 4PJEA 1QHPA 5DRNA 4ZAKD 4I9WD 4PJ9B 4KHXH 3STZA 3VXQB 1OF2B 1XF2B 4NM8H 1XEDA 3G5VA 2C1OA 4RA3A 4XPBL 5J6GA 2HT4C 3QWOB 1DQLH 1OCWH 2AEIT 2NLJB 3G04B 4U1LA 3CPLA 1C5BH 4FRWA 1FL5A 4H88H 4JDTH 4JRYD 3T4YB 3PP4L 3NBNA 3HKFA 3RUGA 4MAYC 4WFHE 1A6WL 3TT1H 3GDBA 1ZMYA 5FDWB 5D5ME 3WDHA 2LABA 4LLMA 5HHQB 1YEEL 2BRRL 2W60A 5IJKC 1G1CA 1R0AL 3JTTA 2NXZB 2Y5TB 4OZIA 3CPLB 3LEVL 3HMXA 4HGWA 1W72A 3GKWH 1D5BA 4MNQE 4NQEA 5EZIH 4P9HL 4Q97A 5BS0D 1GGIL 4IRJC 2CRMA 4LBEB 1TZIA 4H1LG 4M7LH 3NGBC 3P0YH 3DIFA 3TO4C 4BSVB 5DC9B 4GKSA 4I0CC 5E6IA 5TDPB 4UDUA 4XAKD 3PIQA 3KS0J 1F6LL 1UWEL 5EA0H 5E2VL 4RWYL 2QQLL 2BNRD 1ZANL 4JG1H 1NCCH 2W9LA 4F7CB 4ZO6A 4HW6A 2ZUUA 2MFNA 3QZWG 2JJSA 4JRWA 4U0QB 3RIFK 4KI5D 5FM8A 5ESAA 5A3IC 3K0WA 2HH0H 1JN6A 1LMKA 3PWJA 1QACA 4YDVB 3IKCB 4UT7L 4MJID 2FWOB 3V5HA 4O51A 5FKAA 4GAYB 3JWDH 3TO2A 1Q8MA 3OL2A 2Y36L 4H8WH 2AXHA 4IHOB 1L7IL 4MNGA 5CBEA 5ICZB 4PJHB 5KVDL 1INDL 1JPGA 4S2SB 4AH2B 1WZKA 3BYYA 1EZVY 4ENEC 5HGAA 3KHOA 3DSFH 3FFDB 3ARUA 1CGXA 4MS8C 3S6CA 4AQOA 5EZOL 4C54A 4PRNB 3LV3B 3S7GA 4HC1A 4QTIH 5IESH 2FB4L 4LPCA 2IADA 1QFOA 3EYVA 3D2UB 3VD3A 5DMKA 2EH8H 2YD5A 3O6KH 5BZDA 4CVWA 4EVNB 4KTEH 5HHME 4Z7OF 1C7TA 3E8UH 4JDZA 4XB7A 3DRTB 4PR5A 4NQCA 2VLLA 3QDHA 4PG9A 4ODHL 2B5IC 5D72L 3O6MH 1OWWA 4G9DB 1MCWM 5HI5D 3TBSB 1WZ1L 1RU9H 2XTJC 2E9WA 4GQPH 5T1DH 1XR9A 1CG9A 3L3HB 1H5BB 3ZDZE 4U1IB 2BCKB 5I9QC 4M61B 3O4OC 1I4FA 1WC7B 4NQUA 1GGCH 4YFLF 3UTZA 4I18B 4OLVH 5I1GL 3RX7A 4AQ1B 4LGRB 4RDQG 5DJ2B 1VPOH 4WU5A 1YC8A 4NNYB 5BJTB 5ALBL 1QNZL 4G9DA 1PEZA 4JFPB 4U31A 1WWAX 3RY6C 3ARVA 3WN5B 1R0AH 2VE6A 4QXTB 3BD3A 4AIXA 2I60L 2UZYB 2VDLL 3GMOA 3WJJA 4RFNC 3IVKB 2R0WL 4I18A 1UG9A 1IM3A 1U3HB 4UV7L 5JNYA 3AS1A 2F58H 5ID0A 1F11B 2HG5B 3DJ9A 3HMXH 3KYMA 2JJSC 3RNKB 3NACL 2IWGA 4JDTL 5CEXB 4NNYA 3WIIH 1NCUA 2XY1A 3PGCB 2J88L 1KNOA 4LLUB 1HXMA 4L29B 4OM0L 4JFPA 4FTVA 3X12A 3AMKA 5DJAB 4G8EA 2AQ1A 1NKOA 3MLTB 1T20B 4JFYA 3FQWA 3QEHA 5EA0L 4G8FA 1K5NB 1LE5B 2D7TL 4P9ML 2BMKA 3BP6B 1BFVL 4MHHI 3RY6A 3SDDC 3OXSB 5I15L 4JFXA 1V3JA 2P8MA 4ONFL 5A2JH 5BVJA 1LDSA 5J6HB 4XC3L 1LE9B 1NGXB 4HPOH 5TDOA 3MUZ1 3PHSA 3RFZC 5HHPB 3QPQD 4MVBC 3WFZA 4JFZL 4DW2H 3QJHB 1MI5E 5MENA 4QRQB 3HE7D 5D2LA 3UPRA 4JFHD 3IDYB 4LCIL 1J9CT 1RIUL 3GUTB 4G8FB 2XZQL 4K8RL 2GUOA 4CMHC 4NCDA 5KS9F 7FABH 4OFYA 2IQ9H 3OAZH 2JJVA 4W4OA 1LE9A 5ILTH 2B8OT 4RNRA 4QXUL 2E7BA 3VXUA 3TCXA 2EZ0C 3CDCA 1S5HB 2EIZA 1QOKA 2QADD 5T1MB 2GTZA 2IH3B 4TULL 3TC9A 2XY2A 1BX2B 4PJHF 1S9WA 2CRYA 5FYKH 3SE3A 3PWPE 5ADPL 1A6UL 1EVUA 4ISVB 4NGHL 4XPHH 1X5YA 1FG2B 3DV4B 2IBBA 3UTSB 1W2KT 3IJYB 2XKNB 4LSSL 4NQVB 3NN8B 5D7KE 2OLDA 2LV4A 3EJJX 4YFEA 3QCUL 3BIKB 3S88H 2O5ZL 4YH6A 1ZAGA 4Z7WB 3G6JB 3U83A 3O9WA 4M5ZH 3MUGA 2VDQL 2DL2A 3R06A 1XH3A 1P4LA 1PZ5A 2Z31A 1X5GA 1FLRH 1AKJA 1AGFB 3X13A 5DGRA 1SJHA 3MJ9L 3IDGA 1L4IA 4U3HA 5KVFH 1G7PA 4BZYA 3QP3A 5KN5A 4RAHA 43CAB 1FH5H 1WFOA 5IB4B 3MJGX 1KT2A 1XGPB 4IM8A 5D7IB 1XR8A 3Q5OA 4I77H 3R06B 3R8QA 2X4QA 3CH8A 4Z78A 2DS4A 1DE4A 1V5JA 4U3CA 1ERNA 2V5SA 4I3SL 4NO5B 5A16B 5GGQL 3F7PC 2AVGA 5CJOL 1KTRL 5GS0D 1C1EH 2FH8A 3QFJA 3TO4A 2Z9TA 4LGSB 2XICA 1E27B 1F6AB 3ZO0A 1SJVA 3MRCA 1UENA 3WFDL 4BSWA 4N8VA 4W6WB 5F88A 1FGVH 1CDIA 1XGPA 2X1PA 2ZSVA 2R1YA 2DYPA 2MQCA 4XZUB 1CLCA 3LN4A 5DTFB 1NEZB 1DLFL 3X14B 1DE4B 2VLRD 1MCBA 1HINH 3WKML 1OAKH 2XA3A 1BQHA 3OV6A 4HFWA 1A7RH 2D7TH 4P9MH 1PKQB 5DR5L 3T4AA 4BKLA 1BOYA 4WDIB 4HPOL 1ZT4A 1D5XA 4TPRL 5D1QC 3ILPB 3VGAB 3QG6A 4HIJA 4GW5A 3HNSH 1B0RA 3D85B 1IGFL 1T03L 1U93A 4FQHB 3PWUA 1M71A 4HAFA 2W9DH 5DK3A 2R2HA 4YEEA 3ULSA 2ID5A 3IFPB 5EO0B 4WW2B 1Z9LA 2OZ4H 2EXWC 1AKJD 2NNAA 4WCYH 4YJZL 3QULA 2VXUL 5EZJB 4NM4L 2H32B 3B8YA 1QSEA 4PJFE 5IMOB 3VXUD 3JUZA 3SO3C 4GS7B 3UBXI 1C5DB 4L3ED 4DKEL 3C60D 5MEPA 2VN7A 1AHWC 3QEGL 1TDQA 4OCLC 5DMIH 1O7VA 3GSUA 2PYFB 3TZVD 4HUNB 2E7LC 4MZ2A 4MXVF 1R5VA 2R23A 1FYTE 3I6LD 4RAUB 1ONQB 4LHUG 1DQJA 4FTVD 4G6AD 1KG0B 1OSPL 1MWAL 1CGTA 4XC1L 1AD9B 3BW9B 4PG2A 2DD8L 5DHVB 2FO4A 4GW1A 4WFED 5HHOD 1K2DA 3HHRB 3QIWB 4K3DH 1LD9B 4EQ2A 5C0DB 3ETBF 4FFZL 1HK6A 4UT7H 2JCCE 2CIIA 5EBWB 2X4UB 4K8RC 2HTKD 4D0DA 4UOW0 2AV1B 2PUQT 2H26A 3QDGB 4QRTB 3TCLA 3GSOB 4HBCL 4M8QB 4KMTH 3HC3L 2FO4B 2BZDA 3OKNA 5ISZE 1QRND 3IU4H 1D6EA 3D39E 5JXEA 1MFDH 5CHNA 4I3GA 1KF9B 1IGCH 4L4VE 1JHKL 3SDXE 3EDEA 3K1KC 5ISZA 3SKOA 4XI5D 3GSOA 4M8QA 3QUXD 4NBYB 3L5WA 4PS4L 1EUTA 4Y1AB 2VQ1B 4LLMB 3P4LA 3U0WL 4HS3A 2Q7NA 4GBXD 3U7YH 1UH4A 1CLZH 1RUQH 4GBXC 3S36H 5CEZL 4D9RD 5H8DA 1DN0A 2LTQC 2PTUA 5IFJA 2OR9H 1QLFA 3MRBB 4UIKH 1YY9D 2DTML 4YHNB 2DM3A 3OKKB 1IAOB 3PP4H 2D7OA 3QUKB 2FBOJ 4F8QA 4FQIL 3SJVE 3DIFB 1FIEA 4X99A 2K9UA 3QQ4B 3QSKB 4FQXD 4UDUB 5DJ6A 2DQUH 1RFDH 4IRSD 1ZS8B 1HIML 2R4RL 1OAKL 2DM7A 5KSBF 1F2QA 5IR1A 3C9NA 1BWWA 3L3IA 2A6DA 3LEVH 4G42B 2RCSL 4D0BB 2OZ4A 4EEEA 3OZ9H 5GHWL 3ULUL 3MNZA 4KGLA 5IHLB 1DANU 1EBAA 5EG6C 1A7BA 4WWKA 3NA9L 3H8NA 2IMMA 4WUKH 3DUUA 3G5ZA 2L4OA 3BPLB 4JR9L 5IK3A 5CD5D 1U8QB 3MPCA 2R1WB 4EIGB 4YIQA 4WEMB 4RRPG 4HT1L 4R96B 1N4XL 4XPBH 5F7EH 1UWEH 2NW2A 4GMSL 4KI5F 2DQTL 2AP2A 3X3FL 3H9HA 4N0CC 2G5BB 4PJCB 4H0IA 3EOAB 4GKZA 2WANA 5GGUA 3QEQA 4BZ1L 1QBLL 1ZXQA 4AEFA 5I6XC 4UZGA 2CJUL 1ZGLB 2IG2H 1BLNA 5JR1L 1KCUH 2JTDA 2WBJC 4KROB 1RZJC 2BNQA 3TFKC 4KI5E 1UZ8B 2VISB 3RGVB 4R6UA 1JGEB 2B4CL 2NW3A 3AS2A 5EZIL 3O9WD 5HI4D 5HGBB 3MMEA 3I3BA 5E5MB 5GIRB 3QDMB 1HH6A 2VABA 1C5CH 2G9HB 1EJ6A 4PRHA 4UQ3B 4KH2A 3HC4L 3TLRA 2LE9A 3AFLA 5DFWH 5IQ7L 5T33H 4TVPD 2BNRB 2X4PB 2BCKA 1F5WA 4ZDHA 5CBAB 1FIGL 4K3DL 3UJJH 3OSKA 3WUWG 3ZTJH 2NW3B 4F57H 2APWA 4HFUH 3KYOA 4ZPTB 3MYZA 2BY3A 5ECJE 1A5FH 1JNNL 3SGJA 1U8IA 2CPCA 4YHML 5FYJD 2PW2B 5L2KE 4KAQL 5DYOB 5GSVA 4XXCA 2VC2L 4S1DD 1D9KC 1P9MC 1ADQA 2F53B 1F90H 3IXAB 3QH3A 2X9WA 1I1AD 3QUMB 3BDBA 1ED3B 1U8KA 3FL7A 4N0UA 3TNNB 1S9KC 5BMFL 1MCOH 3KVQA 3OGOE 3ZE0E 4I3RL 5DT1L 2Z0BA 3NH7L 6CGTA 1T2JA 5F8RC 4WI8A 5KANI 3S97C 5C0CD 1EAPB 2R0ZL 5LBSH 3P9LA 4FFYL 2P8PA 5L6YL 2QHRL 3FQWB 1AGDA 2OBGA 4TRPH 2DAVA 1IBGH 1R5IA 4BZ2H 5JZ7D 2GITB 5IMLB 1OAQH 4P4RA 5JZ7C 3UZVB 4R4FL 3SN6N 1QPXA 3AAZA 3C6SB 3W11D 4JKPH 3QUML 5F6HJ 3T0EC 1UFUA 4RFNB 1Y18A 1ZVSA 1U92B 2HFTA 5E1AB 3NACH 1I9JH 2AXGB 4LCWA 3I75A 2E6QA 3ECBA 4ZD3H 5JMOC 1BEYL 2EDFA 4LCIH 1VFMA 3QNZA 1IC4H 2ITCA 3T0EA 2F8XC 1LO0H 4RBPH 3V9FA 4QNPF 4WFFE 2DM4A 1YMMB 5GS1B 2MKLC 2YN3A 3GMLA 5D5MB 5E8DL 1D6VH 5DRXB 1T89C 5FXCH 3AREA 4NQDB 1LEGA 4YDIL 2YS4A 4L3CB 3AVEA 5J9PA 3ECBB 4YQXH 5DI8A 4LSUL 3QNZB 1CGUA 3D0LB 3LKPB 2A73A 4F8TA 2W0FA 3MSPA 5DHYB 3ULVH 1OD7A 4WJ5A 3WN5C 3B9DA 3H42H 1RSFA 2AK4E 3OR7B 3GMMB 1VEMA 4OT1H 1T4KA 5B3JF 2IPKA 5F97E 4MA8H 1QBLH 1CR9H 3QDGD 2DMKA 1ZA3B 5DI8B 1B6DA 1UEYA 4Y4FC 3WIFB 4G9FE 5ICYA 1NUNB 3TVMB 4XGZB 3TGXA 5IEHA 3PL6A 2H9GA 3X13B 5FECA 2BFVH 3CZJA 3MRIB 2D7QA 4LLYB 3BGFC 1F2XK 2B4CH 1A1OA 2XXCB 4YPJA 2CLVB 5EBMB 2AI0H 2H3NA 2VR4A 4YXHL 1J0HA 5C0BD 5I18L 4NDMB 1FYTB 4Q58C 5B39G 3QCUH 1KCRL 4I2XA 4KTYA 1K4DA 1L0QA 3LSOA 2AJ3A 4ZFZB 2X9YA 4M5ZL 4OCWL 3UBXB 5FCUL 4IOSD 3QNXA 4F7TB 5D9SB 1OB1A 3UEZA 2XN9A 4ODXB 4F7MB 4EN3C 2CDFA 3V7MA 4EN3D 4XBEH 4P2YA 4GXUN 2X1WL 1OP3K 1EJOH 4JPVH 1X5IA 3CAFA 1JV5B 4DOHE 4CL7A 1SVZA 4QHMB 3U48A 4U2YA 4W68A 5BOZG 2ORBH 4XRCB 3UYRH 1KPVA 1A2YB 1BREA 3OMZA 3IDGB 2J6EL 5C0GB 1GGBH 1CE1L 3BD5A 3HA0A 1B0WA 4UUJB 5EC2B 5AZEL 1X4YA 3ZYZA 2J8OA 2IALB 1IC1A 2EICA 1E28A 1TZHB 1NFIB 2VIRB 3WNLA 1G6RB 3D85A 1T22B 3AY4C 2JK5B 5F89A 5FA3B 3V95A 1CDUA 1QNZH 2O5XL 4JPIA 5HYQB 1S7SB 2BNRE 5T1LD 3HZKA 5DD1H 5IVXF 5CD3B 4OLUH 1FNEA 3N9GH 3E2HB 2XWBB 4M6NH 1JIBA 1UM6L 1FNGA 3U4BL 3NPSB 3OKOA 4IRJB 1RK1B 4XZUA 2WP3T 5MEPB 1K3ZA 1U36A 3UAJD 1RZGA 3RTQA 3L1OL 5IV2B 2J88H 3QXDB 2ZKHH 5CEZD 2VUYA 32C2A 5F1SA 5GJSH 4JGMA 4NM8L 2R0LL 5JIIA 3U36B 2G2RB 2CKBA 3SE9H 2HJFB 3SGEI 2QQNL 5DUMH 5D2NB 4ZFFB 1X5JA 1BP3B 2K7QA 4IMKA 4U1NA 1I85C 4ONGL 3MRGA 2NZIA 5FB8A