4GRMB

The crystal structure of the high affinity tcr a6
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
243
structure length
240
Chain Sequence
GVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASRPGLQPEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords A6 alpha chain
publication title Increased Peptide Contacts Govern High Affinity Binding of a Modified TCR Whilst Maintaining a Native pMHC Docking Mode.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 240
sequence length 243
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4grmB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4grmB02
3GMOB 2Z91A 4YFDB 1OTTC 1LEGA 5B38A 3DMMA 4KKLC 3KPRA 1BMGA 1CXLA 1NEZG 2F19L 3C6LC 3F7QA 1G9NH 1Z6JT 3IAPA 2VE6B 3GHEH 1CU4L 5E2TH 3FTGB 1VHPA 3O0RH 5F1IA 4P9MH 1G7JB 4ZOAA 5E8PB 3QG7L 4FFWD 2EZ0C 2R2EB 3WSQH 1RIHH 2XOTA 1GL4B 1P4BL 3L7FB 4ZTOL 1X4XA 3MRKB 3OF6D 4WW1B 2ZJSL 3GJEB 5EO1A 1GGCL 4Y16A 2V9QA 3CJJA 4N90D 4WI8A 5H2BB 5IHUH 2E6PA 2VC2L 4HBCH 3UAJD 1XGRA 4EI6A 2DD8L 4JM2D 1ZXQA 4X6BB 1CFVL 4YQXL 2BXYA 3ILPB 4JM2B 4I77H 1EEQA 2GCYB 1H15A 5IVNA 2ZOKA 1KSRA 1PZ5A 1U8KB 3P77B 4BH8B 3BH8B 5KBNC 4AZ8A 2C7UA 3QDMB 4NO0D 5FXCH 1X4ZA 1LO2L 3QJHA 3QDHA 4HV8B 3KPQB 1T83A 2F8OA 1B4JH 2IAMA 1P7QA 4AMKH 1KT2B 3ZDXF 3QHZL 1MY7A 4QYOA 3IJSA 4XPGH 3WN5A 5D2NC 4DW2L 4L1DA 4TVPH 4XPTL 1PKQE 1FE8L 1YJDH 3U7YH 5CBEB 2R23A 1BIHA 4LCYB 1CDGA 3MNVA 4DQOH 1FORH 1JIBA 2DWDB 4MQXD 4WNQA 1UKSA 4R9HA 3VW3H 5JUEL 3SDXB 3CX5K 1I85A 1L9MA 3JVGA 2D7PA 2DKSA 1FNSL 1QBML 1UJ3C 2VDML 4UTAL 1U58B 3G04B 3QDGE 3O3EB 1QBLL 4XNMA 1RZFL 5IVZA 4M4RA 4OLWH 2I9LA 4F37K 1NFIB 4K7PH 1F4YH 3PL6B 4L4TD 3VA2C 1JL8A 3KYNB 2X4UB 5A40E 2X5PA 3SY0B 3GKZA 3TO4D 1BBDH 4L4TB 3PWPE 5HHQA 4Z77B 3TO4B 4XP5L 3QUXA 1X6LA 1JP5A 4N8PA 2ICWB 2DM2A 3O8XA 1ZHLA 4PJXA 1FC1A 1KIQA 5L2KB 1WWBX 1JF6A 1N5AB 4G80B 5EC1A 1RUKH 3FQUA 4FFYL 4F7PA 5BVPL 1M71A 5EO0B 5C3TA 2B2XH 1U3HB 2AW2A 5TPWH 4U1SB 1TCRA 5FO8B 1NC2A 2MHAA 3SJVD 3QWRD 2RBLA 2XQBH 5E9DA 4S1QL 4M03A 2A9MH 5EBMA 3KXFA 1BOYA 1NCWH 2ARJQ 1QLEL 5KS9A 4HWBL 1XF3B 5IK3A 3MR9A 15C8H 3HRPA 4AEFA 4MNQE 1MCWW 5DWUL 3BD4A 3U7WH 4QRPA 4NQED 1FGVH 2BVPA 1KOAA 4NQEB 4ALAL 1UGNA 5LGJA 5E95B 1EX0A 2P8LB 3VRIB 3M07A 4C83B 2HFEB 3FO0L 1I4FA 4M7ZC 3E2HB 1S7SA 5ALCL 3BPLC 3LEVH 3FN0L 2MKLC 3FZUC 1W72L 3QEGL 4N9GA 4IMLB 5MEOB 5D7LE 3CFIC 3U6RB 1KCRH 2YK1H 3CVIH 4N68A 1U41A 1ORQB 2X4OA 5KVGH 2HRLA 4HKJA 4IDLA 1HILA 4ODHL 4MCYA 1WBZA 1I3GL 5EG6C 3GMNA 3MRIB 5DD5H 1DQJA 3GBNH 3DYMA 4OF8A 5IBTL 3QHTC 1DQQA 3M1BA 2J8UF 3T65A 2N4IA 3IDNA 4WO4D 4BFBD 2CUMA 4BQ6A 1QOKA 2HJLA 5EU7C 1MHPH 3UTQA 1OTUD 2EE9A 1XFPA 4GW4A 4S1RH 4RISL 1AGFA 5I8KH 4BKLB 2LV4A 1T04A 3HC0A 3SE9H 4X6CF 3Q6FA 4PY7A 3NCMA 3I6LD 2XY1A 5DJXB 3BVNA 3RBSA 2VR9A 1F2XK 4NRXB 2E7LA 1NSNL 3QG6B 5A2LH 2WIMA 1WC7A 4PS4L 3PV7A 1I3VA 1CFTA 3BD5A 1DN0A 1NFDB 4OFVA 4U6HB 5D2NE 1XR8B 1TVBB 5E6ZA 4ZS7H 4LLQB 5HPMA 4ZTOH 4X7FC 5F8QC 3WS6C 5FAAA 5BRZD 2ITDB 1GGCH 1RK0A 3BEVB 1QFPA 3E6FB 5DQDH 2A77L 1G7QB 5B3NA 3RL1A 2NXYC 3MV9A 3HI5L 4Z0XB 2VC2H 4C56D 3BW9B 1F4AA 2XQYG 4GRMB 1CFVH 1O0VA 1DQTA 3E6HB 4P57A 3VI3E 3IU3B 2FJHA 4OF5A 2O61A 4N90E 4JFHD 1BF2A 1CD1B 5KSAD 3BQUD 4Y5YC 4NZUH 1U2HA 4YFLI 1LO2H 3T8XA 1KELL 3BQUB 3ZKND 2XN9D 3JZ7A 2JJUA 1PYWA 3O2DH 2Z93A 4O00A 4FN0A 4FQLL 2V5SA 3GGWA 1NGZB 2ZSVB 3RX7A 1UZ8A 1UB5A 3QHZH 3QEQA 1OB1B 1OHQA 3GK8H 4R4ND 1MCRA 3QDME 1EMTL 5FOBA 4XPTH 4PJ7F 3QDJA 3RGVD 4RSVA 1GXEA 5DRWB 2WLZA 2BY3A 4O9HL 3LKSA 3RGVB 2Q3AA 4HIHB 5KSVB 5JUEH 1KJVB 4K94L 1WFNA 3JV5A 3JV4B 5DJCB 1KJ2L 5SWZD 2X70A 2NW3A 1A7RH 4P0DA 2AI0H 5HTSA 3OB8A 1KLUB 1F6AB 4PJHB 3HNVL 5SWZB 5ETUB 4O5LL 2WWMC 1S5HB 2JJVA 3SDXE 2XI9A 4A6YB 4X9GA 2JJTA 1IQWH 5ID0B 1FQ9C 4MNGB 3HAEB 3MV7D 2K7QA 2VZVA 2FWOA 5J9PB 1DBBL 3FRPG 2I5YL 1N8ZA 3MV7B 1U95B 5TGBA 3RY5A 1TDQA 1F97A 5C0BD 1BGXH 4KQ4L 4YNYA 4U0RB 2P8MB 4Y5VB 1LD9A 3GSNH 5DFTA 4Y1AA 4HKXB 4L4TE 3TLRA 4G6AC 2X4PA 1C08A 3D0VA 1DANU 1UB6B 3QZWG 3R1GL 5MI0C 3DVGA 5TH2A 5BVPH 3ARWA 4NRYA 2NY2B 2ITCB 4LSUL 2VXUH 4AM0B 4G6ML 1GGUA 2PETA 5FYKD 3IXTA 3T4AA 5IBLD 5L2KE 3IDIA 4I1NB 3MLSL 3FB7B 2HAZA 3DX7A 2EXYC 2QSQA 4EI5C 4HUVA 3LS4L 1QLEH 2FEDC 3I6GB 1JUFB 4HWBH 3FO9B 3DSNA 3T0WA 4XMPH 4XPHL 5MENA 3ELAT 3RWFA 4XNQA 3GIZH 2AEPH 3C08H 4N8VB 3HG1D 1MRDH 1XGQA 2DIJA 4Z95H 3DV4A 2XWTA 4YFEA 3W0WD 4HKZB 2J6EL 4WUUD 2YD5A 1BFVH 5HY9A 2IPKB 4X98B 4K8RD 5ALCH 2ZG1A 1G7IA 2BNRA 4XX1E 2HFGH 4D0BB 4FZEL 4NQEE 3KYOB 3KJ6L 4Z76A 4PJ8C 1PG7L 5EBLB 5JPMA 3RGHA 4AIZB 3C2AL 3T0EA 1MJ7L 1SMAA 4CVZB 4N1CA 1X4YA 4ODHH 1JTOA 4IIQA 4UNTA 1JWUB 5F9AC 4YHPB 4CN1A 3TBSA 4JDTL 3DRTA 1KCKA 4P48A 2VR4A 3DUSA 2VABA 5JIPA 4D9QD 4NN5C 4KMLB 1CFSB 1T1WB 1T5XB 4WU7B 4G9DA 4P2QB 5BS0D 1FZMB 5HYSA 4RISH 1IGYA 2VLLB 1YYMH 1P5VA 1QYGL 2H6PA 4PGCB 5I17A 1MF2L 3P3YA 3L3GB 1G7PB 5BS0B 5JQ6L 2FX7L 4NIKB 2AJVL 3P9LB 4KMTL 1RJZB 2W0PA 1AR1D 2R0ZH 1FFPA 4HFWB 1U8PB 3MBEC 3BP5A 1EERB 4FXLA 5SWQA 2YWYA 6FABL 3I6LE 1DEDA 5DD0L 1D6VH 5HHVH 5J8OA 5AD0A 3FKUS 3HLAB 2UWEF 4GRWB 1NFDE 3TN0C 1Z5LA 1MVFA 3GBLA 3O4LB 2A77H 2P8PA 1UVQB 1AIFA 1WEJH 4J3XA 1U92A 1LO0L 2D03H 2GIYA 1NFKA 1AKJD 5IFHL 3TIEA 2OBGA 3RQ3A 3AM8A 1BZ7A 1AKJB 5I1LB 3IDXL 4U1HA 3CXHJ 2PYED 3IXAA 3T2NH 3TT1H 5KJRL 4JKKA 1CGWA 1U91B 5TJWK 4Q6IC 1B2WL 2AJYL 5TE7L 3W5MA 3IKCA 3LIZH 3VFSA 5IW3A 1ADQH 3VXSD 5DD6B 1LO5A 4W6XB 4JANA 5ITFA 3X17A 4PJDF 2IANB 4FQLH 2IG2H 4Y4FA 4PJGF 3NH7L 2YUZA 4WENB 5HI3C 3IAQA 1J10A 3FFDB 2EDJA 1EMTH 4KJQC 5CP7B 5D1QD 3ARXA 3S9DB 4PJAF 3UYPA 4QRRA 2QEJA 4LLUB 1KPRA 1L7IH 2DQHH 1WZ1L 1D5MA 4LEXL 3PABA 1CR9L 2C4XA 3MLWL 4KKCC 5F44A 1YA5A 3IVKA 3VWKD 1JHTB 2XZQH 3ULUE 3PE9A 1KJ2H 3MODL 5ICYA 1PVHA 4M6MH 2CO7B 3BYYA 5DJ2A 3EZ8A 4D2NA 4L9DA 1V8HA 1EEZB 5DSCB 4MDJB 4M43H 3U9PH 4O2EB 2P44B 4BSVA 5EH1A 4F2MB 3MRFA 4PJHE 2HWZH 1DBBH 5SWZE 3S5LB 5D96C 2I5YH 1WWCA 3Q6GH 4NYLA 2GITB 2MQ3A 3GSWA 3ULVC 3OR6B 5FECA 4YHYB 4MNGE 1ZLVK 3W39B 4UIKL 3ZE2F 5EOTA 5EC2A 3P4MA 1TNNA 3TBWB 1R3LA 5B4MC 4LSUH 4HKBB 1T66D 2ORBL 2B8OT 1YDPB 5GGRY 2Y5EA 2HT2C 1KB5A 4Z6AT 4NO3B 2GTZA 4XMKH 3PG2A 4KVNH 1OF2A 5DA4A 1J8HD 3DVNB 3CD4A 1NBVL 4U2ZA 2Q8AH 5F89A 1MCWM 3V5KB 1FIGL 3NABL 3BPOC 3C8HA 4DZBB 2E7HA 2FZ3B 1UM6L 2CLZA 3CZFA 1GZPA 4OB5L 2BOCA 1OAYH 4HJGB 4XPHH 2WBKA 3KYMA 1A4KB 5C6WH 4M61B 3THML 3RTQC 2OI9B 5I71C 4QO1A 5D7IA 1T7XA 3MGAA 2J88H 1R3IH 5AUMA 5DJZA 1F00I 5MHSE 4IRSD 1IEBB 2ED9A 4P23A 4ODUA 3WLBB 1MCFA 3EO0B 1FYTD 3F62A 2GW5A 2DS4A 1NKOA 3UJIL 1FYTB 3MLYH 4QRSA 1E6OL 3BOVA 3C2AH 3HZKB 4U6VL 4Y4KC 2X05A 1MFNA 5JLZB 2BERA 4OJFL 1RHHA 1G0DA 2N1KA 4S1SH 3UTSE 4R3SA 4JDTH 4PRAA 5M7QA 1AHWC 2VLJD 2Q76B 1Q9LB 4TULH 2JB6A 3FT3A 5ESAA 4GKZB 4PP2A 2BMKB 4WFGE 4Z7UA 1QFUL 4YEFA 2VLJB 4XCEB 5CHNB 3I6KB 4U1KB 2EDNA 4H26B 4MXWL 2BVOA 3WEXA 3S88L 1EFXA 2UYLA 1QKZL 2JJWA 2Y23A 1MF2H 1MHEA 5JQ6H 3CFDA 3ZKMD 1M05B 5CJOL 5I19H 3GSRA 4QWWD 4P2QE 4WDIB 1IGFH 3C60C 3SPVB 3HNSL 4J3TA 1ES0B 3BWAB 1XF1A 1AC6A 5KSBA 1BEYL 1BVZA 4KJYB 1BECA 3GBML 4MLSA 4HAFA 4XP4L 3X3GL 4X7EC 4JQVA 2M8XA 1GOFA 2VWEE 4TUKH 5HGAA 3WUWB 3BDBA 1FPTH 3HTLX 1CICA 1H5BA 2GI7A 3X12B 4K23L 1HQRA 3DVFA 4DN3H 3RZCA 1AD0A 1PY4A 3C5ZD 5IFHH 4GRWE 4BFIB 3C5ZB 3Q1SL 3FQXA 2FLRT 3O4LE 4NQTA 3ARDA 5C0GA 1EO5A 1ZANL 3ZLQC 3GRWH 5J4MA 2P24A 3WFHA 3ULUL 3S6CA 5DZOA 1IGCH 4KY1L 1B2WH 4NQVB 1XR9B 2OJEA 2W0LA 3RHWF 1FFOB 2A2QT 4H5SA 4R4BB 2F74A 3SGKC 3N1PC 4P4RA 4QHLA 4OUUB 5BV7B 5EU6D 2JELL 3BSZL 3NH7H 1VACA 1I8KB 3QUYB 1WAAE 1EFQA 5AAMA 4EVNA 3OXSB 1A1MA 5ID1B 5I73B 5JW3L 5E08L 5EZJA 5DQ9A 2IANE 5FYJE 3BMWA 1HH9A 2X89A 4XGZA 4BYHA 1FSKC 5I76B 4FQJL 1EA9C 4MXQD 5IB5B 1HINH 1K8IA 4NO5A 5E6IA 1Z9MA 3TIDB 1CXKA 2BVUA 3KYKL 3O3AB 4KUCF 2BFVL 4U1NB 5GS1C 1OSZA 3V6ZA 3MLZL 4RZCA 2EDFA 2HJKA 3RIFK 2XIDA 1A6AB 5DEGB 5K9JH 3PIQB 5F9WC 5ESVA 5FYKU 2EC8A 2Y5TB 5IR1B 1RIUL 2H2SC 5EOCL 3OGCA 5BZWB 3VXTB 4GUPB 4DKEL 2X10A 3LN4B 2BNUB 1MNUH 1J12A 3MBXL 3VXRA 2CRYA 2J3SA 3FN9A 4JKMA 5F1NA 4JY5H 3X13B 1JNLH 1IAKB 4ODWA 32C2A 2ORBH 4UDTB 1H0DB 4JFEE 4AK1A 1FJ1B 1P6AB 3FAXA 4F57L 4PLNC 5KVEL 2LU7A 4QHMB 4U1JB 3CDGB 3T77B 1NBVH 8FABB 1FIGH 1ZA3B 3NABH 4GQ9L 4H25A 3CK0L 2H3NB 3LD8B 5SX5K 4P46D 5EZOL 4JCLA 4OB5H 3NA4A 3PUCA 4JR9L 2AERT 4FMKA 2R9HC 1UZ6E 3PQYD 1QSFB 2R2BB 5FOJA 1U6AH 1RPQA 2NTSP 5BXFB 3N1QC 2DLTA 5F72S 3ALPA 2XYCA 4Y2OA 4BH7B 3AXLA 1S7TB 4UNUA 4XRCB 2WP3T 3IDGB 1MJJB 1DSFH 1ZT7B 5CCKH 4U1IA 4H0IA 4M9OA 1V05A 1KN2L 3ILQC 1FN4A 3CFEB 3AS2A 1E6OH 1IEAA 4HJJH 4KKBD 3QNXB 4U6VH 1R5VA 4PGBB 4Q2ZA 3MRNB 3BPNB 3QIUC 1A7NH 4OM0L 5GGVH 3RP1A 1FYTE 2X4QB 3O9WC 1LO3H 3LHPL 1CGUA 2WBJB 4Y2DD 4J3WA 1QFUH 3TVMD 4Y2DB 5EU5B 3TVMB 3S88H 2WQRA 3WV0A 2RFXA 3QCVL 1LO4L 3BZFA 2AEWA 2Q8BL 3QFJA 1L4IA 3HNSH 1HWHB 5C0AA 1J1OL 1U8QB 5DA0B 5GSVB 4EXPX 5A16A 1U93A 5C7XH 2F15A 4WV1B 4IRJC 4JHAL 1UWGH 5JZ7C 1TVHA 3DJ9A 1IM3B 5DK2B 1B0GA 4XP4H 3G08B 3L3KA 3QIBA 1MSPA 1UENA 1BJ1H 6CGTA 4TSBL 1IZJA 2DQUH 2NY7L 4OM1L 1P5UA 2NTFA 2VAAA 1R3KA 3TNMB 3AS3A 1VADA 3OGOE 5C0IB 4K23H 3OAZK 3AVEA 5JPNA 5FYJL 5J13C 3RWDA 1XZ0A 3JTSA 4MNHB 5C0RL 1G7MB 3E1F1 3Q1SH 3AS1A 1I7RA 4EBQH 3V0AC 5D72H 5EOQL 4CADA 3GJFH 5I1CH 3WIIL 3ECBB 1MHCA 4KXZH 3S4SB 3SO5A 1HIML 3MRJA 2NR6C 3IF1B 3NOIA 4LSVL 2ENYA 1RJYB 2P45B 4N0RA 4MWFB 2FCBA 2GFBA 2E7MA 2HG5A 2VLKA 3L3JA 3D1MC 2W9DH 4M7LT 3NPZB 2JELH 3IFNH 3LN5A 4BK4A 3FOMB 5JW3H 2DRUA 5DJ6A 2PR4L 4A6YH 5D1ZA 4PRNA 4HULB 5IIEA 1HSAA 5IB1A 4DN4H 4LHQB 3RPKA 2DBJA 5IJVB 4JO3L 1H3PL 3VI3F 2E7CA 4K3GA 1G1CA 2A9NH 4RDQF 1SEBA 2ERJB 5I6XC 1EHLH 4YAQB 2WWKO 1FG2A 2PW1A 5JNYA 5L2JB 5DJAB 1NAML 5FV1L 5LKNA 2X9WA 4ZUTB 5EULV 1ETZB 4AT6A 1B9ZA 3IT8D 4XVSL 4X5XB 3WO4B 2EYRB 4L8SB 1AFVH 4LMQI 5DQJA 1T3FB 3OBAA 3ZZ1A 5KANG 3V79C 1I8MA 2ZUUA 2GYSA 2X4RA 1BQHB 1QP1A 3UBXA 2HMIC 4HSQA 4ETQA 4F7MB 2DLIA 5HVFB 3QA3B 3JUZA 4LSSL 1S7XA 1DJSA 3LMJL 3DO7B 4JFFD 1RUPL 5FM4A 2IJ0C 1I1AB 5I8EA 1P2CB 4JFFB 4HMDA 5KVEH 5FCUH 1MFBL 2BVQB 3B3IB 3MC0A 1ZWIA 2NY0D 4HQQL 2B5IC 3VRLE 4WFED 3VXPB 1JFQL 2KBGA 3ARFB 4GQ9H 4U6YA 5CJ5A 3CSYB 3MFFB 2NY0B 4XXDA 3QWQB 3MJ9A 2NW2B 1CXHA 3TJEL 1WF5A 3G6AB 4K8RH 4M6NL 2QHRH 5GGSY 4MQSB 2J8UA 3MRQB 3MLRL 3LV3B 1UH2A 4M3KB 1LE5A 2EZ0D 1S78C 1T1ZB 3O4OB 4ZNEA 3B9VA 4M48H 1XGTB 4DZ8A 1OPGH 4OZFB 1JGVH 1QSFE 3O6ML 4OBRA 3UBXI 4P2OB 4KV5E 4ZXBD 4JVPA 1MCOH 1UCBH 1ORSB 1NPUA 4ZXBB 3SE8H 3WNKA 1CDJA 2HFFA 4PJEF 5T1MB 4OCLC 4OT1L 4XC3L 1YN7A 1HYSC 4WW2B 3MOAL 4OM0H 2GJ6D 4S10A 4QXGL 1B3JA 4G6KL 5JW4M 3RKPA 4KU1A 5BO1H 1W8NA 4GAGH 4OKVA 5IJKA 3W2DH 1NCBL 4YPJA 4MVBD 4UBDD 1QLFB 1X7QB 1MLCB 5IOPB 4OD1L 1QO3B 3V5DB 4OLVH 5GS3A 5IEHA 2D7QA 3LRGA 4PRHB 2AJ3A 4MS8C 3PGFL 3RVVC 1ACZA 2JIXB 2P5WA 1OAKL 1ZLWK 3DLQR 3ARUA 3DMMC 2Q8BH 5EU4A 3Q5YA 5F7EH 4P2RB 1JGLH 2X1QA 1ITBB 2L7JA 1J1OH 1MPAL 3QXWA 3HUJF 4LLWA 5DR5L 2ED7A 4RNRA 3VXNB 1JPSH 1IC7L 4HUWB 5F1SA 3JWNC 2GQHA 2LAAA 1K8DA 3CSGA 3M45A 1QLRB 2PF6A 4HLJA 1UADC 5DYOB 3CVHB 4Y16C 1DL7L 4IRZL 2BSRB 2WMPA 1IGJB 1SBBA 1F8TL 4PJ7A 1U0QA 3UPRA 3QQ4B 4KZEL 1RMFL 3G9VA 1GOHA 3D2UA 5FYJH 1DQDH 4F37F 5BV7L 1AQDA 4LLMB 3L3IA 3HNTL 4G8IB 5C0RH 2ZZUT 5GRXG 1DBAH 2CLVA 4Z7WA 4UOW1 2VZOA 2FX8L 3D9AH 3ZT5A 1D5BB 3QUKB 5IMLA 1AO7D 7FABL 3LRSA 3GNML 3WIIH 4BZ2L 1IAOB 3KPSB 2NY4C 4IS6A 1HIMH 1TJHL 1T83C 3S8WA 5C0EA 2DLEA 1LVEA 4CDHA 1I3UA 4EIGB 2WW8A 1HDMA 5FA4A 1TCMA 3TBVA 4YX2H 2PXYD 1J1XL 1XIWA 4F15C 2AEQL 2EDQA 5CILH 3EFFB 4OIAA 5GZOC 4U2YA 2PXYB 4M7KL 3HS0B 2JB5H 2O93L 3OHXA 1IAIM 4AJ0A 5DVNA 4Z0BL 4ZFFA 5LCVL 4Y5XA 4Z7NF 2WNGA 2HFTA 1I85C 1ZHNA 3JVGC 1D9KB 4E41A 3T3ME 3PHOB 2X40A 2QTEA 4UT6L 4CVXB 1FZKB 1NGWB 2VNCA 4OLUL 3CDFA 1UT9A 1CDHA 1T20A 4RAVB 3K2MC 1MJ8L 1XGYH 1LP9E 4HH9A 1KTLA 3LKOA 1QSVA 4OLYL 1B90A 2B4CH 1UEYA 2F8VA 2J5LB 3QO0B 4UI2A 3QQ3B 2VDQL 2WSKA 4HUUA 5K9OA 4BQ9A 5I1EL 1MCBA 1WUNT 3QUXC 3RNKB 1RU9L 3RWJA 2Z31B 4UB0H 4FABL 2C3XA 4OFYD 3K8LA 1A21A 5C3LD 3O8XC 4HGKC 2AVGA 3IS0X 4LCWD 1EJOL 4XI5C 3GB7A 4LHJB 4LEOB 5CZKA 4LCWB 1JCKA 2O5YH 3LMJH 5C08B 5DMYA 3L9RB 3ULUF 1NLBL 3DBXB 2P46B 4LCIH 3DPBA 1JYWA 1NGPH 4QOKD 5IGXL 5D8JH 2XV6B 3MV8A 2YR3A 4QOKB 3SKOA 5E4EB 4V1DD 1R0AH 1N6UA 1RUML 3WUWG 1JFQH 4DUVA 4PG9B 4V1DB 4JFFE 4PTTB 2OL3A 5I75B 4AIXA 1DLHB 5C09A 2ZNWA 1CBVL 5EPMA 3QUMB 5C9JB 3OSKA 3VJ6B 2P4AB 5C71A 4OLXL 4RRPA 3MLRH 2GT9B 3LB6D 2Q7YA 4YHLH 3UDWA 4CNIB 3BXNB 4QHKJ 1DTUA 3AU1A 3F7YB 1NUDA 4GAJL 4OCRL 4WHYH 1YMHA 4JB9H 4OZGF 3OAYK 4WWKC 3QCUL 1A3LL 3TCXA 1FL6A 5MP6L 4TOYL 3UCRA 4AQ1B 1RULL 5F7DB 4ENEC 4LRIC 5BCAA 5CAYB 4GFTB 1CFNA 4J6RL 4MJIA 5ENWB 4JPVH 2V2TB 3BN3B 4MJ2A 5C07A 4QXTB 4XC3H 4EN3A 3AFLA 1U8IA 4XCNA 5CBAA 4RX4D 3MOAH 1H3GA 1ZLVH 2FATL 1QA9A 2GSIB 4QXGH 1IC4L 3HC4L 2E8ZA 3ARBA 4G6KH 5E5UB 3EYOB 3D39B 2BOBA 1I1YA 4P4KA 1R5IA 2UWEA 2CDGB 1G6VK 4JFXB 1E27B 3HE6A 3QIWC 3UC0H 1VESA 1M6OA 4HK3N 5F3HB 4K7PX 2Q3ZA 1OAKH 2NLJB 4L3CA 4HC1H 4OD3H 2E7LC 5F9OL 4I0PA 2G5BA 4PRHE 3SCMC 4FXGB 3IYLW 1NH6A 2ZWLT 1LEIA 3LQZA 4LF3B 2YS4A 5DR5H 5FGCE 3BJ91 5B8CC 4PV8A 4P2RE 4WI6A 5E8OB 2W0KA 2YD3A 1JJUA 1FO0B 2BVYA 1T0PB 4GS7C 2IALB 2Z92B 4JHWL 4LOUD 4PJGA 4D0DA 1G7HB 4MJ5B 3RUGB 2WWMD 1F8TH 3U30B 1IGTA 1RMFH 3Q2CA 4LCCA 4PJAA 3PGCA 3V0VA 3VG0L 1RZJC 3HNTH 5A2KH 1J05B 3SDCA 2XRAL 4ZO9A 1RZKL 4NPYB 5HHPA 4PIRF 1OLLA 3GNMH 3T08A 4BZ2H 3GMLB 1TJHH 1LMKA 4PRPD 3PWUB 1S7RA 3IFPA 2FH6A 1CE6A 4PRPB 3R0MA 1IVLA 3HPLA 4H1LB 1YQVH 1OGTB 4DCQB 2VLRD 3KPSE 4MCZB 4RIRA 1Z0MA 3RL2B 3IDJA 2VLRB 3AROA 1ZT1A 5CMAB 1XAUA 2EDOA 4M7KH 2YXMA 4TTDC 4MJ4A 4Y19D 4GRWF 4EI5D 3VXQA 2NX5D 1VEOA 5KVDL 3U0PB 4EUPG 4Y19B 3MJ8A 1KJ3H 3DX8B 4OI8A 4UAOC 4HGMA 2BK8A 1ZGLB 2NX5B 1W2KT 3PWLB 3QJFB 1QBBA 1WFOA 2VDPL 3QCTL 1TQCB 4LAQH 4S0SD 4UINL 1U8MA 4LVEA 4G9FD 4GRLA 1MFDH 2NY1C 4KAQL 4G9FB 3ULVF 4OLYH 1XH3A 2ILLA 3RY6A 2CIKB 5B39A 3VH8B 2R29H 2IH3A 5GJSL 5I1EH 1F90L 1BFOA 3D5OF 3G5ZA 5D7JC 5HJ3A 4HS8L 2C3HA 2G60L 5AG9A 4YDLB 2VISB 5CEZE 3FCTA 1LK3L 1VFAB 5HI5C 2D31A 3NAAL 3D25A 1EJOH 5ESQA 2IPTH 1PBYA 5FUZH 1IKFH 4RFNB 1K3ZA 1C1EL 1D7FA 5DI8B 4F9LC 4XC1L 4HCRL 2AK4A 4S11A 4MYWB 4XB7A 5AAWA 2FB4L 3U46A 1EXUA 3HZVA 1U8NB 3K3QA 2FSEB 3NGBC 4OD2B 3B9KD 4QHUA 2Z0BA 4M6OL 5C08E 5D71L 1F6LL 3UO1L 3MLPA 3B9KB 5FYLD 5T3XD 2VL5A 1UCTA 3LKRA 4TYUA 1DVFD 5ANMB 4UV4L 4NKOA 1I9RH 1N3NA 4OSUH 3MOBL 4QOKE 3TBYA 1FVEB 4PTUB 4ZDHA 1DVFB 1AGDA 4L9LB 3WMSA 3T1FB 3D3VD 4PP1C 3UPCA 2E8YA 3MBED 4MAYA 1ZVYA 4PRBB 2F53A 4V1DE 3VXOB 3D3VB 4DTGH 4FQQB 2OLDA 1OP5K 4WCYL 4JLRB 4N0CC 5T1KD 5IKCA 2H26A 1OQXA 3BEWB 3CSBA 3S4SG 4HD9A 2PYFA 2DBLH 5T1KB 4GAJH 5T1DL 5JHDD 5TDPA 3LEXA 1QSED 1X5AA 5CINL 3OKYA 1PG7W 3TN0D 3RVXC 4TOYH 2YUWA 3NZ8A 1OL0A 5DS8A 3WJJA 1ZT4A 1PFCA 5ICXB 4IIQC 4HWBA 3H9HA 4LVHB 3E8UL 3OKNB 2QV2A 4P5MA 4JFYB 2UZIH 1NBYB 4NQCE 1IC4H 3WJLA 4H20L 3DSFL 1MQKH 1BOGA 4NWUH 4D3CL 5TF1H 2XA3A 3BI9X 1T2QL 4ZFZB 4FFZL 4IM8A 2WK2A 3VXUD 3QEUA 4XP6L 2VRAA 3QO1B 4JHZA 3D39E 4UTBL 5BQ7A 3VWJA 5HI3D 4XBPA 3VXUB 3NIGE 4MQ7B 3V8CA 4D9LL 3MO1B 4JDVA 4YXHH 3IAGC 5C0CB 4KJQD 4AG4H 4HZAA 3WNPA 1Z3GL 3LPFA 1T0NA 3NIFE 4FQIL 5DMGC 2P42B 3R8QA 4OTXL 3GSXA 4X5WB 3P0GB 3RDTA 4XBGA 5GRWA 4U31A 3WIFA 4PGEA 2R69L 3IJYA 5L0QB 2W65B 1LDSA 4X8JB 5DLMH 4QNPE 1DDHA 5F71A 1KCSL 3MRBA 4YHZL 4PBWD 3VG0H 1A0QL 2IQAB 3EJYC 3RUGE 1JRHL 2A6JB 4PJCB 4HIIA 4NKIL 4IEFB 3KPTA 3Q3GB 3B6SB 4XBEH 1RZKH 3ULVD 3TGXA 3STLB 4NP4L 1S9VB 2CUIA 4LDEB 3QPXH 1NC4B 3O41B 4Y4FC 5CD5D 1HHIA 2Y06L 3MUHL 2CKNA 1OD9A 3VFRB 3V6BR 2HJFA 4KJPC 3O2VL 1PKQA 5HBBA 1FV1A 4YXLL 1FL5B 1CFQB 4NQDB 2FYYA 5HDQL 4Q9CA 4DFHA 5CEZL 1AGCB 3L5IA 3V2AR 3HRZA 3OKMA 5ACZA 5KVDH 2AEIT 3HZYA 2VLRE 5JIIA 3G6JF 4YK4B 2BSSB 2RR3A 3NFNA 5JMRA 3WKML 1MAJA 3P4OA 5FDYA 5D6DA 3RTQD 3QDGA 4PGDA 1ADQA 4UINH 4Y19E 1JV5B 1X5KA 3PHQB 3M17B 4KAQH 1QRND 2NX5E 4ZUVB 1A7QL 2HKFL 2YHGA 2C1OB 3MOQA 1A14H 1AI1H 3OAZH 1J88A 2IWGA 2Y36L 1R3HB 5EO9A 3OMZA 5E7BA 1F90H 1P7HL 4HS8H 1MHHB 1VB9A 2VQUA 3EYQC 4BA8A 5L8KB 4R96A 2DICA 2DLGA 1LK3H 4EDWL 4ERSH 1G9MC 5D1XA 3NAAH 4Y4KD 3WHE1 4QLRA 5EUOF 4WI7A 5IB4A 4K71B 2ZCLL 3P0VL 1C1EH 5KN5B 3QQ9C 1KJ2A 5EBWB 3AY4A 4RMSA 4MMXC 5DUBA 2BVTA 2O5XL 1OT2A 1CTOA 4WEUD 3MUGB 2C3VA 4YEEA 1J86A 4M6OH 5D71H 2W9EL 3UO1H 1CZ8H 4JKPH 4OZFH 5D70L 1AD9A 4JAMB 2ZCHL 3MOBH 1FNEB 3AB0B 1X5ZA 3BKML 5F88A 1IE5A 4NZRH 3QWOA 4PJIF 1FVDB 5ISZD 4Z7OF 2OMBA 1KULA 3PWNB 5ANME 5FYLE 2YPLD 4NUGL 4PJFB 5T3XE 4WCYH 2CO6B 4P23C 1DE4B 3EYVA 5A43C 3OPZH 1RK1B 4IOIA 1PQZB 2O5ZH 3D3VE 5FUCC 4ODTL 4S2SA 1KEML 3MLUL 1MH5A 3GO1L 4BSWB 5D7LA 5IG7B 3TZVB 3VRLF 2H1PL 2CDFA 1VSCA 4LLVA 1INDL 4U1GC 5H37G 4OF3A 4U33A 1FNFA 3E8UH 4XZUB 1WISA 4PPTA 2G2RA 4ACPA 4U1LA 1ZA6B 4PBVC 5CWSA 4H20H 4R7NB 4TRPL 3BN9D 3D0LB 5JO5A 3W9DB 1Q0XL 1LK2B 2DIBA 4FFZH 2J6EA 1BQSA 4UTBH 5AWNL 3CVHH 3WDHA 3NVQA 4OF7A 1IGIH 1KC5L 3DYOA 4D9LH 3PNWB 2R56H 4LVNB 4LAJH 1W0VA 1FP5A 4OI7A 3VFVA 2ZSWA 3GMOA 4U6TA 1A64A 5DHYB 3VXUE 5B3JE 1FNGA 3MRPB 5D2NA 4OTXH 3WFZA 1CDIA 2K1MA 4JQVC 4RGND 4U6XB 3R0NA 1YZZA 5C0CE 2VE6A 1F5WA 2WINB 3FTGA 4RGNB 3VFMB 4DOHB 5E7FA 1H5BC 1G7JA 2W59A 5E8PA 1S7UA 5C0DB 4G8EA 1OP3K 4ZG1A 5DT1H 3RZCC 1BZ9A 3L7FA 1KCSH 3MRKA 3RIFF 4MXVF 4KJWC 5DMKB 4LCUB 1YUHB 2VUOA 2BRRL 1S3KL 1HOCB 3OF6A 2V7NB 3ARDC 5H2BA 1JRHH 5H37H 4EQ3A 4BZ1L 2H2SD 1KTRL 4NKIH 5LGHL 1INQB 3U4EB 1M7IB 3MUZ1 1C5DB 4X6BA 3MLXL 4NP4H 3WFDL 3OKLB 4YC2B 1I1FB 4JM2A 4PJCE 3MA9L 1CD8A 1WQVT 2GCYA 4PLKC 3L5WB 2A74B 5K9QI 2ZKHL 1GYAA 1U8KA 3P77A 3QNZA 3BH8A 3DO3A 4BH8A 2V5YA 4PYGA 2Y06H 3A67H 3QDMA 1NUNB 1YY8B 4MDIB 3KPQA 2BSED 3EO1B 4JO1H 4YXLH 4PJBB 1OM3L 2FJFB 4I2XA 43CAB 5CEYB 5EWIH 3RX8A 5JIHA 1KT2A 4PY8J 5HDQH 4E42B 3Q48A 2KL6A 1PG7X 4CMMB 3F5WB 4J4PC 4KRNA 1AGEB 4L4VD 5E6IC 2AJUH 2OMNA 5CBEA 4NCC1 5CKGA 4QF1B 3GRWA 3VGAC 5GSRA 4NQDE 3TNNB 2DWDA 3N1GC 2HTKC 4GW5A 1IT9L 4QT5B 5EIQA 3C5SB 4JREC 5DFVD 1CQKA 3SDXA 3S3SA 3LS5H 2QADD 5LWYL 2HKFH 2V2WA 1H3WM 1VFOA 5IROA 5L6YL 3QXTA 1U58A 3G04A 2QADB 1QPPA 2Y36H 4O4YH 4KI5D 3X11B 3AREC 4HS6B 4YHNB 1RZ7L 2XICA 1NFIA 4MD0A 3PL6A 2VXSL 4TSCH 4LQFL 4MLIA 4KPHL 4YO0B 3SY0A 3EYFB 4L4TA 1G7LB 4OCXL 1JZ2A 3WDIA 3LQMA 4ISVB 3P0VH 3H9SD 5GIRB 4YBLC 4F9PA 2DI8A 2E9JA 3QUMH 4Q58C 4CU6A 3BGMA 1WV7T 3H9SB 2ICWA 5IESH 5L2KA 2O5XH 1EVTC 3NCYP 1N5AA 1CLCA 1LP9F 4ONHB 4QXUL 1TIUA 5ALBL 5E2WL 2W9EH 5DUPL 2EH7L 5EO0A 4JGMA 5FM5O 1U3HA 1IFHL 5E4IA 3H3PH 4CGTA 4WGVB 3I75A 4U1SA 1XF4A 2ESVD 4D0CB 5LJYH 2G5RA 2ZCHH 2ESVB 4HWUA 5DEFB 1OOAA 1MCEA 4R0LC 4GW1B 3QWRA 5F6HI 3VGBA 3QISA 1BWWA 3T0XA 3ARSA 4NUGH 4K2UL 1GGBL 3B2UC 1XF3A 2KDGA 4IRJD 1EH9A 4UQ3B 1CYGA 4NC0B 5FHBL 2YUVA 4L8DB 3OKDB 2P5ED 1SYVB 2KQMA 3L6FB 4GMTL 4PJFE 4ODTH 4NQEA 4DKFH 4K7FA 3VG9C 1ZHKB 5E5MB 2P8LA 3NFPB 3VRIA 4C83A 4R2GB 3WUZA 2H1PH 2DQIL 3OTTA 1KV3A 1MFAL 3WS6A 12E8L 4HLZH 3T0BA 1O7SA 4JY6B 4IMLA 5MEOA 3U6RA 5CFHA 1ORQA 2ICWI 2RIKA 4RFEA 3KPPB 1QSZA 2YPKB 4HZLB 3DUUB 5F7NC 4FMFA 2HKHH 3IU4L 2C3WA 1FO0H 5AWNH 4NWTL 1KC5H 3KYAA 4HXBL 3SE3A 1BVLB 4C58B 1A47A 3LDBC 5I0ZA 4BKLA 2F8XC 3B43A 4K3HA 5CZVL 4L8CB 1X5IA 5DJXA 4MD4B 1DBJL 3K2UH 2LVEA 3QG6A 1Q9WA 3QIBC 1JF1B 1HHGB 1T89C 3L5HA 7CGTA 2WIIB 1QVOB 4BQ8A 1I9JL 4GAFB 1INEL 1NFDA 1BLNB 3L3HB 25C8L 1CLOL 4LLQA 1JGDB 3EO9H 3N06B 4H1LH 4DOHE 4RGNE 2ITDA 4FQ1H 2WBWB 3CUPA 2BRRH 2YD4A 1E6JL 3E6FA 3MRMB 2OP4H 3BZDA 1G7QA 4NSKB 5LGHH 4Z0XA 2QQKH 3H7LA 3QAZC 5JOEA 3BW9A 3MLXH 1RHFA 5IFAH 3E6HA 3BPCB 4NKDB 1RJLA 3IU3A 3MA9H 2IADB 5I18H 1ZK9A 4K3EL 3B5GA 5FHAH 3BQUA 3QYCA 2VERN 4HFUH 2ARJB 5I1JL 3BDYL 1NGZA 5IF0B 1RQ5A 3C9NB 2XTJB 5FCSH 3MNZA 3B8SA 3FFCD 4QXWA 2AV1B 3INUH 4JGJA 3OKKA 4PJBE 3N50A 3MX0A 5GGQH 3FFCB 5IB2B 5KSUB 4YHIB 4NZTL 5DRWA 3P73B 2XFXB 3EFDL 4UDUB 5HI4C 3RGVA 3MRLB 1IT9H 4HIHA 5KSVA 2ZG2A 2P47B 4W68A 2BHZA 3RJQB 2ZCKH 3ZHKA 3JV4A 5DJCA 2NXZB 1A6ZB 1DFBL 1NCCH 1QZ1A 3HA0A 3L3OB 5SWZA 4HMCA 3LKNA 3GUTB 1S5HA 1RZ7H 4A6YA 4LKXB 2KH2B 5F7MC 4FQHB 2VXSH 3LZFH 5ID0A 1ULVA 1TVDA 2DQCL 4KPHH 3PF2A 4MNGA 3HAEA 1OY3B 4L8BB 5AZ2L 4NKMB 2H9GA 5FYLH 2EE3A 1YNTB 5J9PA 1HYSD 1I7ZB 3MGOB 5T3XH 1U95A 4KI5E 4PJ8A 2P8MA 3HC3H 3MLTB 4XAKE 4J3SA 1T03H 4K3DL 1EGJH 5KS9F 2CK2A 2WP3O 3ULSA 4HKXA 4DGIL 1HHKB 1CK0L 1UB6A 5I8CB 4OGAC 1KN4H 4LU5H 5ALBH 5I8OL 1FZJB 5ITBL 3MJ7B 1A3RL 4KRPC 4MS8D 2ICES 4P49A 2VSCA 3H9SE 3RVVD 1F3JB 3HE7B 1DANT 1DBMH 3DXAB 4X6DB 3DMMD 1YECL 1AJ7L 3KPRD 4DEPC 3JTTB 1NEUA 3FB7A 3T0AA 3QUZD 1C5BL 3CC5A 1HKLL 4NM4L 3OKOB 3QUZB 5D93C 1JF5A 5JXEA 2ESVE 5FHBH 4DK6A 3WL9B 1MFEL 4N8VA 4XVUC 4GMTH 5D2LB 4HS3B 5JR1L 2MCPH 5IHZB 4XWGL 1KTKE 1OAQH 4MD5B 2Q87A 2YN3A 3SDAB 2IPKA 4X98A 5F70A 12E8H 3OX8B 2V2XB 3KYOA 4GJTB 4BFEA 3UTSA 3PHSA 4AIZA 2OTUB 3QQNA 4I3RL 2AV7B 5IJKC 4CVZA 2PCPB 2APBA 1YPZB 2X41A 2NY4D 4LMQE 2YN5A 1YEJH 3ZDYF 2IAMD 3FOLB 2LU4A 4YHPA 1OSPH 1P7QD 4M7LH 3PDOB 2D3VA 2IAMB 2Q20A 5T3ZL 1P7QB 3O3UN 5CSZB 1CFSA 2IFFL 1T5XA 4WU7A 3UTZA 4HXBH 4QYOB 4L29B 4P2QA 3LKPA 3MRHB 5E99L 3WN5B 4U05A 1FZMA 4IHOB 3KDMB 3DETD 4PGCA 1OT1A 4C4KT 2M26A 2YEZA 3L3GA 1A9EB 4YGAB 2D2OA 1RJZA 3WD5L 3MNVB 4HGWA 1FAIL 2GKIA 1REIA 5JA9A 4HFWA 5J89A 1U8PA 4WNQB 1OP5H 1MCIA 4PB0L 4HH8A 1EO8H 1UYWH 3FRUB 3GI8H 4POUB 4P3CH 5TDNB 1R6VA 2WM0A 3QPQD 5B22A 2CDEB 1FFQA 1UACL 4Z5RB 4X6FB 3NIGF 2ZG3A 3HLAA 2FL5B 1TQBC 1X44A 5FUOL 3ROLA 3WE6B 1E6JH 1WWWX 3O4LA 1HHJB 1Q94B 1G9NC 3CZJA 2QQNH 3QUXD 1TZHB 1ND0B 4OZHF 3EYUL 3N1FC 4JFDB 3O8XD 1OAUH 3EOBB 2DQJL 2UUDH 3ISWA 4XI5D 1OGAB 5J11C 5I1LA 4J2XA 4PJXB 1KIQB 4IDJL 5EC1B 1U91A 3CU1A 5HPOA 2DF3A 2EE2A 1WAAA 5GGTH 4RGOL 1KCVH 1AP2B 1XIWC 4WI9A 4IJ3B 5A1AA 4QNPF 4WEBH 1E4XH 1NC2D 1RUAL 2QQLL 5DD6A 1QTYT 5FKAB 5E9DD 2IANA 3DNKA 4FQXB 1MCCA 4AY0A 4P5TB 3KXFD 4M4PA 4DJMA 5E9DB 3FFDA 4Y5XC 5EBMB 3KXFB 2IQ9L 5E8NA 2D7TH 4Y4HB 4UILL 1BD2B 4FNLL 4UV7L 5CP7A 3ABZA 4G8FB 5IK3B 3MR9B 1MUJB 4LLUA 2XTJE 4KTDL 5LAXB 3EFDH 3MNWB 4HUNB 1OD7A 2DTML 4I5BB 2GJZB 4RQQB 4HJ0D 2DL9A 1AE6H 4ZPTB 4XPBL 3SKJL 2OS7A 5LGJB 5KOVC 4HPOH 4O2FB 4R97C 3V6OE 2AXHA 1YJDC 2XKNA 4Z7VB 1DFBH 3BX7C 5D6CB 1S7SB 1KGCD 5K93A 3ZTJH 5DJ8A 3RI5K 1EEZA 4N9GB 5DSCA 5ADOL 4YXKL 2EH8H 3TCLB 4G8GD 5T5NF 3SDDB 4HKJB 4DVBB 4F2MA 1DBKL 4MZ2A 2A73A 3S5LA 4MCYB 4G8GB 1JYXA 3J8F7 2GITA 5J56B 3GMNB 3V7MA 3DWTA 1AC0A 1DQQB 2DYPB 4JFEA 4K3DH 1N0LA 3W39A 4UUJA 2VDRL 1NAMA 4DGIH 2PUQT 2YMXH 3TBWA 3NZHH 5I8OH 2HJLB 5CZXC 3UTQB 1JMZA 2YRPA 1F4XL 4D8PB 2K7PA 4OCSH 1YDPA 4JHBA 4X4ME 2NY6C 4GKSB 4ZYKA 1UH3A 4NO3A 1A7OL 4NGHL 1IGMH 4O2CB 4YZFF 3DVNA 1NL0H 4CUCA 3V5KA 3N1MC 4NQSA 1MIMH 1C5BH 2FZ3A 2GUOB 4NM4H 4ZSOB 3DXAE 3UDWC 2AXJA 4L4JA 4X6DE 4M93C 1CFTB 3QRGH 3SQBA 3C60A 4LVOB 4U1MA 3CH1A 2HTLC 3EOYG 5KG9B 1A4KA 1MFEH 4ODVH 2ADGB 2VXVL 2YD9A 1PEZA 4MQTB 4RGMC 3ME0A 1I3RB 4WFHE 4XNZB 3MV9D 2Q6WB 5KTEH 3X14B 1IEBA 4XWGH 5BW7C 4EN3C 3GEWB 3EO0A 5DFWH 5D2LE 4ZAKB 2X2YA 2Y6SD 1K4CA 5IT2H 4JZJB 2X09A 1CTNA 1CGYA 4I3RH 1GC1C 3IFLH 1IL1B 1EO7A 5JLZA 1S9YB 4P4KC 1CCZA 1K9TA 1P7KA 1GGYA 1HQ4B 3T8XB 2SEBB 1MCPH 1J8KA 1KJMB 5H35B 2Q76A 1Q9LA 1MFCL 3QEQD 4YHML 4I13B 1F2QA 3GGWB 1S8DB 2BMKA 1YPZE 4YBQD 5CP3H 4GBXD 1UZ8B 4GSDL 3EJJX 3BH9B 4XCEA 3ZHLA 5K59F 5CHNA 4I0PC 3I6KA 4Y7MA 2DI9A 4U1KA 3QDJD 1X5LA 4H26A 3D69B 4M1DH 4GBXB 1I7TB 3DTXB 3C09B 3CDCA 4KGLA 4FZ8L 1M05A 2YOCA 1NGXB 2A83B 2MNUA 5E6YA 4DK3A 3WD5H 1CG9A 1H3UA 3SPVA 3S96B 3BWAA 3BIAX 4OCNC 1I9IH 3LKQB 4KJYA 4CN4A 2F5AH 4LKCA 2NW3B 5E24E 2WUBL 2HLFC 4K07A 5KVMC 1UACH 1G6RB 2YZ8A 4X99B 5HDOA 5GS1A 1JHLL 5FUOH 3SDCC 3PV6B 3IDYC 1QQDB 3NPSC 3X12A 1Q9KB 2DQTH 1TXKA 3G6JA 4YWGL 4JO2H 1JYVA 3BO8A 3EYUH 4YHKL 5HI5D 4Y1AD 2DQJH 4BFIA 4MA1B 4DUWA 3MJ9L 4YUEL 3K81A 3FB6B 1YEEH 3TA3B 3EHBC 1PKOA 2ZNXA 4JFDE 2ID5A 4NQVA 4RGOH 1EAJA 3FL7A 1XR9A 1OGAE 4WY7L 3GMQB 2QQLH 4LSRL 4R4BA 4RMVA 2K3TA 4OUUA 1JPFB 2OJZL 4A2MA 4S0TD 1I8KA 1RZIB 3QUYA 3UJTL 3JBG7 2EKSB 1Y6KR 1UWXH 2IQ9H 3OXSA 5ID1A 4UILH 5IM7B 1NBZB 5MEND 4JRYB 4PP1D 5I76A 5E9DE 5IB5A 4LLYA 3KXFE 1WFTA 4GRLC 4PJCF 1V7NH 1JPTH 1BD2E 2IGFH 4N0CD 3TIDA 1JTTA 5ICZB 1CVSC 1XGQB 1TJIH 5JOPD 1Q9OA 3SKJH 3RY6C 2I27N 3O3AA 4FOMA 4U1NA 2M2DA 3D6GA 4R8WH 1SBSH 3SQOL 4WFFD 5I1AA 1Q1JL 3FQNA 3RVXD 1A6AA 5DEGA 2W60B 2CUHA 3T0ED 1P84J 4G5ZL 3MYZA 1HXMA 4M02A 5JPMB 4Z7VE 1NMCB 3T0EB 1WIPA 3WHXB 5I30L 3FQTB 4R4FL 3QI9B 3FB8A 4NC1E 3VXTA 4GUPA 1UWEH 3BT2L 1MQ8A 3TBSB 5GQBA 3SO3C 3LN4A 2BNUA 2VDRH 3RNQB 2ZOLA 4AEHL 3QHFL 2YD2A 4FXKB 3QIUA 4G8GE 1UM4H 2AABL 3X13A 3BRFA 4G9DB 1V7ML 4ZUUB 1KXTB 4I4WB 1IAKA 4UDTA 1H0DA 1IGYB 1FJ1A 5D7IF 4DAGL 1A7OH 4QHMA 4NGHH 4U1JA 3T2OA 4BUHA 3CDGA 5HXMA 2GK0B 3T77A 4JZNB 2EDXA 3LCYA 3OAUL 4N8CH 4MAYC 2W07A 3I84A 2H3NA 4K55A 1SEQL 2EIZB 3VFUB 2EDYA 1HCFX 3W11C 2QR0A 4OQ1A 5DMIL 3FHQA 4QY8B 1G9NL 1NAKH 3QZWB 5E2TL 1QSFA 2R2BA 3V0WH 3O0RL 2ATPA 4ZSOE 3O6FC 3WNLA 5AD0B 1MJUH 3ZKXB 3K4AA 3WSQL 2CKBB 4FTVB 4X9HA 4GG8B 5J06A 5BJTB 3WJJC 1QEWA 1S7TA 2P8PB 4CW1B 4XRCA 4R26L 3BAEH 3HB3D 5FK9A 5I66B 3LN9A 3TJHC 1MJJA 3EJYD 5IHUL 1ZT7A 4PRIB 1NDMB 1XGUA 4GLRH 3TIEB 1BZ7B 3CFEA 4HBCL 2Z8VC 4ZOCA 3GHBL 5GISH 3HKFA 3MRNA 5J12C 4M1CD 5GZND 2EXWC 4I77L 2X4QA 4OZ4A 4Y4FD 2QSCL 3VWJC 4YHMH 2WBJA 3BIKB 1X5JA 1NUFA 1OVZA 5DZNA 2YRLA 4PRDB 4XPFL 3MRRB 3AS0A 1B4JL 1MWAH 4OFDA 4AMKL 2YPVH 3V95A 4TPRH 4F3FB 3QXUA 1WTGT 4TVPL 2IF7A 1YJDL 1S7WB 1NMAH 1DEEA 5TF0A 5BMFL 5HYJD 4P9HL 3V4PL 3RDTC 1U8QA 5GSVA 5E2VL 3PWVB 5HYJB 4DQOL 2BNQE 1FORL 2ICEB 1PX3A 2H8PA 4PD4J 4ZPVA 5ICYB 1IM3A 2WUBH 3G08A 5HYQB 5DHVA 4AL8H 3KJ4B 4OZIB 4L3AA 3TNMA 1GPOH 3CFKA 4OLWL 5C0IA 4BSVB 4K7PL 1F4YL 2JJSA 1RI8A 4LHUA 1T4KB 1NCDH 3EYQD 4NYLB 1T5WB 4MNHA 4YHKH 1UJTA 1V5JA 5DRZA 1BBDL 3A6CL 5B38G 1UH4A 5ABDE 2BSTA 1B6UA 4CJ1A 3ECBA 3KLHD 2H2PC 4I9WE 1FCGA 3IF1A 1HSBB 1RJYA 2KZ1B 2J8HA 1ZLSH 4WY7H 3PGDB 4UT9H 1KB5B 1EUUA 4OUOA 3I85A 3WNOA 2YD8A 1CVRA 3BGFC 3BKCL 3I9GL 5TPWL 5E8DL 4HMEA 5F89B 5KVFL 1EPFA 5GRJH 4OAWB 3MMEB 4ORZC 2CLZB 4TUJB 1JWSB 2ZUQC 2DI7A 3CZFB 1GZPB 5IVXB 1NCWL 5D6DC 4K3JH 5IJVA 1AR2A 5A3ID 5JA8B 15C8L 3QRFM 2X1PA 5JORB 3IRZA 3DGGA 1LP9A 4I48A 4JRYE 4CBPA 4QCIB 4P23D 3ZKQD 5DJZB 4YAQA 3U7WL 3VFPB 2X1WL 1HH6B 1OTSD 1P1ZA 5L2JA 4JPIB 5MEPB 1Q1JH 2B0SH 4FA8A 1ETZA 4XWOD 3RWGB 2HT4D 4X5XA 2EYRA 4L8SA 1T3FA 4G5ZH 5D1XC 3UTPD 3QT2A 4QRSB 5JOPE 2EEDA 3WFEL 2KUTA 1BQHA 2AXFB 4R4FH 4WFFE 2YK1L 3CVIL 5KVGL 5IUSA 4F7MA 2COQA 1L7TH 3AY4C 2F54D 2C1PA 3BT2H 4R3SB 3S34H 3T2PA 3CNKA 2F54B 1H3VA 1I75A 3QHFH 4PP2B 3DO7A 2R2CA 4YHOH 1EFXD 1V7MH 1I1AA 3WCYA 1P2CA 2UYLB 4NN7C 1HWGB 1MHPL 3MRGB 2XPGB 4HG4J 3B3IA 4S1RL 2AJXH 3FB5B 1LILA 5I8KL 3OAUH 3VXPA 3SE9L 3SE4A 3ARFA 2DDQL 4CN6A 3JV6B 2Q86B 1SEQH 5EORL 4O02H 4TQEL 3QP3A 4HHAA 5CGYC 5DMIH 3G6AA 3HZMB 4P59L 4HCRA 2JK5B 2PNDA 3MRQA 3HMWL 3VDCA 1CICD 4KTEH 3CMGA 5FEBA 1Y18B 3GMPB 3K1KC 4ZS7L 1CICB 5EIIA 1NGQH 2FECL 4OZFA 3STBA 1GZQB 4EOWH 5JDJA 4R26H 1LE9B 4P2OA 1TTGA 4NO2B 4ZO8A 3T1WA 5DQDL 5TE6H 3ARDD 1LNUB 4ELMB 5DJ0B 3KVQA 3I02A 4FTVE 3FQXB 5C0GB 5T1MA 1YEIH 3GHBH 5L88H 1BQLH 4PRIE 1DR9A 2N56A 1F3DJ 4PLKD 3TH2T 2J4WL 4X83A 2QSCH 3SKNA 2W0FB 4H5SB 1FNLA 3BHBB 1J0ZA 1YYLH 4NZUL 3V4VH 1U42A 4QHLB 5DO2D 5SV3A 1QLFA 1X7QA 1MLCA 4FP8L 1VACB 3O2DL 3V5DA 4XPFH 1WTLA 4NO0B 2JF1A 3N0PB 4PRHA 3TV3L 4EVNB 1G6RL 3EDJA 3GK8L 1HH9B 2JIXA 1EUTA 4LIQE 1EV2E 2NY5L 4P2RA 5BMFH 4P9HH 3V4PH 4YDVB 5E2VH 5IEKA 5J1AA 1QFWM 1S9XB 2HTKD 1CL7L 5IQ9A 4HUWA 2MQ0A 4NOFA 1FDLH 4FFWC 1RSFA 1VEMA 1RZGB 2FJGB 1QLRA 1QFHA 5DYOA 3CVHA 5HYJE 4NQUA 1A7RL 4X7SH 5ESVB 2AI0L 4ESKA 5TFSH 1Q0YL 1IGJA 2FR4B 1T7VA 3QQ4A 5HGBB 1SY6H 1IQWL 3L5XH 4G8IA 4OZIE 1KB9K 3CFCL 3TO2B 2R2HB 4JM2C 4ORGB 4JZOB 1TJGL 2FO4B 3A6CH 3GMRB 1N2RA 1UM5H 4YDJB 3VE0B 4X8XA 1BGXL 1D5BA 3QUKA 1KTDB 1AXIB 3AAZA 1DUYB 1IAOA 3GSNL 3KPSA 1SJVA 1VFMA 3BP7B 4LK4A 5SX4H 2DJ4A 3EYSH 4JN2B 4KFZC 4M62H 3DUHA 2LU3A 4MA7H 4YE4L 2VXUL 5CUSH 3BKCH 3I9GH 4I18B 5E8DH 5KVFH 1IRAY 2DLFH 4X5LA 1MRCH 2PXYA 1E4KA 3HS0A 3SJVB 5IV2B 1MREL 4EIZC 5IP4A 3V4UH 3T4YA 4MQXC 4XMPL 1D9KA 3BZ4B 4J8RB 1QPXA 3PHOA 4CVXA 5IROC 1FZKA 2AEPL 1NGYB 3GIZL 5IVXE 3C08L 1NGWA 4JM4L 4LPVA 5DHXB 2RCSL 4RAVA 3KPMB 2G9HB 1MRDL 3GSQA 4Z95L 1XGPB 2EIBA 5GS0L 3PL6C 2R1XB 1HZHL 1BFVL 3NACL 1J1PH 4JJ5B 4U1IB 4OQTL 1HYRC 4U3HA 5L8JB 1GVIA 3QO0A 3DECA 1FN4B 4CJ0A 2HFGL 3WFEH 4WWKA 3TO4C 1T1YB 4F9PC 4NKQB 2Z31A 4LRIA 2BY2A 1C7TA 5IW1A 3GJFK 4LEOA 3UTPE 4JCMA 4CU8A 2OTWB 5C08A 3DBXA 3O81A 4D94A 3ZSSA 1U3HC 1N59B 1JRHI 1N4XH 4DGYL 1P4LB 5JOFA 3SGJC 1F02I 2F54E 4GXUN 2CSPA 4CU7A 3QFJD 4WO4B 1YYML 2CKBL 3ARGD 1BVKB 2FBOJ 2NQCA 3QIWA 3QFJB 4Q74A 4PG9A 2DDQH 4FRWA 4V1DA 2BY0A 4OF6A 4HIXH 4PTTA 3ARGB 5EORH 1BF8A 4RA3A 4TQEH 1U93B 2IEPA 2R0ZL 3AUVA 3QIBD 3QUMA 2X4NA 2YKLH 4HAGA 4P59H 3DURB 3VJ6A 3SCMA 2C9AA 5FA3B 1B0GB 3HMWH 2GT9A 5IB3B 3OWEA 1ZHBB 3S98A 4UT7H 4MA8H 5B8CA 4CNIA 2NY3D 3BXNA 3Q5OA 4PBXA 1A2YB 1D6VL 5HHVL 1D5XA 1VADB 3E2HC 2NY3B 3UZQA 1OLZA 4I0CC 3GSUB 1K85A 3HR5B 3MGTB 4LIQL 3L7EB 5BRZB 5F7DA 1WEJL 2D03L 2G75A 5DDHA 4NQCA 3H42L 3TT3H 3WLWD 4G42B 5IQ7H 1A6VL 4X6DF 4C56B 4JFZH 1MHCB 4ELME 1LEKB 3EJZD 2GSIA 3T2NL 1A1OB 2J4WH 2VLKD 3TT1L 3EYOA 4RX4A 3D39A 1VENA 3MCLL 3NA9H 4UU9B 3SE3C 3LIZL 5KSAB 3WS3A 4W81A 4FP8H 1ADQL 2CDGA 4GXVH 1AH1A 4LNRB 4JFXA 5D1ZD 3TV3H 3STZB 2IG2L 2XN9B 1G6RH 4GOSA 4M5YH 2Z8RA 5DJ6B 4OZHA 3ESVF 5D1ZB 4PRNB 3SDYH 1BAFH 3OB0H 4HX1B 2XT1B 4RBPH 2NLJA 3ZE1F 4HG4K 3P9MB 5GJTH 2NY5H 1PLGL 3OJMB 1T7YA 3B8YA 4FXGA 1T80A 3GJFB 2XWBA 5TDOB 1L7IL 2C5DC 2DQHL 4Z7WF 3G5YB 1CL7H 5TQ2H 2PW1B 2CXGA 5E8OA 2CJUH 4I3SH 2QL1A 2XZQL 3ORJA 1YPZF 2IALA 4KRLB 2Z92A 4M6ML 3UROR 1G7HA 3RWIA 4YGVB 4MJ5A 3RUGA 1Q0YH 2ED8A 2FHFA 5HYSG 3MZGB 3EDDA 1ROWA 4M43L 4ETQB 4WI2A 3U9PL 4N0FB 1YEGH 3CFCH 2WZPD 2HWZL 3K46A 1TJGH 3Q6GL 5D7JA 2FIRT 3VFWA 5F8RC 4NPYA 4W6YB 4NFCA 4NFDA 5C0BB 3GMLA 3BQUC 1FHGA 1U8HA 5I8EB 1YN6B 3PWUA 1KEGH 3SOBH 5HHNB 2OR7A 3VFNB 4OGAD 3ZKNC 3VXMD 4F9LA 4H1LA 4YE4H 4KRPD 1OGTA 4DCQA 4MCZA 3VXMB 1TPXB 2AQ3A 4R4NC 4XMKL 4KVNL 4U6YB 4N0UB 3O6KH 3O45B 2E5EA 3ULUC 2Q8AL 5CMAA 5LQBH 1WICA 3RGVC 1MREH 2J8UB 3U0PA 4NN6B 4MB3A 4ODSL 4Y19A 1WBYB 1VDGA 3DX8A 1OAYL 2IH1B 3RVTC 1ZGLA 2X4SB 4PGZA 4NUJB 3PWLA 3QJFA 5DF0A 4JM4H 3SJVE 1S5IH 4DZ8B 5FIEA 2RCSH 2DIAA 4XVUD 2J88L 3HCVB 1R3IL 2EO9A 4X6CB 3S36H 5GS0H 4J3VA 3HG1B 2YD6A 2A0LD 2IBZX 4KROD 1HZHH 3NACH 5SV4A 4OQTH 1W0YT 2CIKA 1NANH 3W0WB 1HEZA 2WANA 3VDAA 4KROB 4WUUB 4TNVK 3VH8A 3O3BB 3BE1H 1YN7B 3T09A 1SJHB 4U0RC 3KS0J 3H7BB 3MLYL 3QXVA 4PJ5D 4Y5VC 4LGRB 1VFAA 4PJ5B 1CGTA 4PUBH 4OKVB 2NY2C 3IRPX 4S1SL 2XY2A 1EAPB 5DI8A 1JE6A 1GH7A 1MOEA 1JZ7A 3QR2A 2GY5A 4TULL 3DHMA 1K4DB 4DGYH 2FSEA 4OD2A 1A9BB 5EIVA 5IBLC 3P0YH 2VXQH 1FBIH 3B9KA 1BFSA 2CKBH 3H9YA 4U7KA 3QXDB 1F42A 5I19L 4YIQB 2I24N 4FQ2H 5JXEC 4LLWB 1IGFL 1FVEA 4PTUA 3T1FA 1C7SA 3FQRB 2DAVA 4NJAH 5IWLC 3QFJE 4PRBA 1EGJA 3VXOA 4UOW0 5F6IB 1RD6A 3D3VA 3SBWA 4FQQA 3MFGB 3T3PF 4JLRA 3W82A 1S7VB 1RV6X 4LARL 4EZMA 1JK8B 3BEWA 3D2UD 5MERB 1ZLUH 3EGSA 3UPRB 3VCLB 4TUKL 2APWA 1FPTL 5ERWB 3NTCH 4NBXB 3ZDXE 3ARQA 4LIQH 2AXGA 4DN3L 4KHXH 4JY4B 3H42H 1C12B 3V5HB 5KAQG 5IMLB 1A6VH 1MCDA 4PB9H 3OKNA 5BRZE 3QFDB 4JFYA 1IJ9A 4YDIH 3GRWL 5LG1A 1NBYA 5M95B 1KYOJ 5F96L 3RRQA 3B4NA 1IGCL 2PYEB 1LDPH 1K6QL 1HHHB 3MCLH 3HMXL 5FA4B 1A7BA 3PP4H 4C56E 5F9JA 1AGBA 2YD7A 3VXSB 5HGHB 4ZUSA 4GKOA 4JFHE 4N1HB 4HWZB 4MQ7A 3OHXB 3MO1A 1XF5B 1FZOA 1PLGH 4E41D 4ZFFB 3VMOA 5C0CA 2XN9E 2R0LH 1ZHNB 1C5CL 2VWEC 1A7PL 5BVJB 1N0XH 4G7YH 4WVRA 5D1QB 1HINL 2W91A 5DJYB 2W1NA 3WNMA 1G9MH 4NNPL 1WK0A 4QTIL 3VWKB 1KBGL 3G9AB 4JE4B 4QEGA 1VERA 1FYHB 2W65A 3ARPA 4UIMB 3IGAB 2DQFB 5K9OB 1KB5H 5K9JL 4RCAA 3RI5F 2IMNA 4KRMB 4OLZH 1WJ3A 2IQAA 3OXRB 4BQCA 2A6JA 2DJSA 4OGYL 4PJCA 4LDOB 1ZTXL 1Y6NR 3GB7B 3Q3GA 4M1GH 3B6SA 4LPYA 4JG0H 5IW6B 4MA3B 3DOSA 3BMVA 3STLA 4XP9H 5L7XH 1S9VA 3AC0A 4JO4H 3DYPA 1MNUL 2YD1A 5B21A 1AXTH 3F58H 3MV7E 5IMMA 2DWEB 1FFNA 2F5BL 4JY5L 1NC4A 3O41A 4AIOA 3ALXA 1JNLL 1JPGB 5CZXD 5HSFA 3SKOB 3JWDL 5C0BE 3VFRA 4OFKA 3KPNB 2NY6D 5LBSH 3MQIA 5C09D 1XCQB 1FL5A 1CFQA 2OL3B 4NQDA 3GKWH 5C09B 1AGCA 5GGUB 1MCNA 1J8HB 2XG5A 3VXME 1IARB 4KK8D 2CR6A 2Z35A 4ODSH 4N0UE 5FYKE 3GSOB 2BSSA 3E3QC 2HTLD 5I9QB 1U6AL 5TE4H 5E1HB 1NCUA 2VUYA 3RU8L 1FC2D 1JV5A 4X0KB 3WXVL 1W0WB 3VD7A 3M17A 4ZUVA 4MJID 2UV3A 3MLVH 2C1OA 4IRSB 4EN3D 1R3HA 4MJIB 1V3LA 2XXCB 1KXVC 1DSFL 4X6CE 1OAZH 1T7ZA 1GIGH 5CCKL 1MHHA 4LPTA 3HG1E 1QR1B 2EDTA 3ARBD 1D5ZB 4HJJL 4YHYC 1N6QL 4PJ9D 3OKEB 3W0WE 5FGBA 4P4KD 5T33L 5DD3H 3ARBB 4WUUE 5JXAH 2JLLA 4PJ9B 4KHTH 1A7NL 3TYGH 5GGVL 4KC3B 2B4CC 1H8NA 3HE6D 2CRMA 2UWEB 3EOTH 5KN5A 5EBWA 1LO3L 4Y0GA 4AH2A 4G6JL 2PW2B 1P9MA 1MVUA 3HE6B 4PJ5E 4XCYA 5EU3B 4ZFOB 5JTWA 2V9RA 3VFGL 1KG0B 1Q72L 1GGIL 2VZTA 2BZDA 4MGXA 1NJ9A 2PTTB 4JAMA 4LLDB 5FB8B 3DARA 2GAZB 4M9PA 4EQ2A 2X9XA 4PV9B 4D9QE 5DC9B 1MI5A 4HPYH 1FRGL 1FVDA 2OI9C 1E4XI 3U79A 5BS0E 1DN2A 1CQYA 2CQVA 5C7XL 4PJDB 2FIKA 1OCWH 2OXHA 4R90H 4PJFA 1UWGL 5D7SH 1MAMH 3CFBB 2IPUK 4D0DB 2VZ3A 4LARH 4H8WH 1DE4A 4C4KO 2AGJH 1RK1A 4LSQH 2DQUL 1PQZA 1NBQA 1IGTB 2YXFA 4LCCB 4E5XB 3LPWA 4JQIH 4KDVA 5I2IB 3PGCB 4WI4A 3HR6A 3V0VB 4BSWA 2A6IA 2X4TA 3TZVA 2BXZA 4JFOB 3A6BH 3K8KA 2ZPKH 2LTQB 3UYOD 4FFVC 4G43A 5EB9A 2Q7NA 4XZUA 3BJLA 4QHKI 4EBQL 5D72L 2KKQA 1T2JA 5ILTH 4WUKL 2JKXA 5F96H 3RA7L 1ZA6A 5I1CL 5E03A 5ACLA 1CE6B 4R7NA 1K6QH 2UVEA 3HPLB 3D0LA 3HMXH 3W9DA 1Z9OA 1LK2A 2DQDH 2W9DL 3U83A 3P9WB 4XPAL 4NCC2 2PYEE 1ZT1B 3IFNL 1FLRH 2VIRB 5EU6B 3ZKMC 3PNWA 5I15L 1I8IB 5GPRA 4A6YL 4QWWC 5CGTA 1YMMA 5FDWB 3VXSE 4DN4L 3D87B 1C5CH 4GMSH 1A7PH 4OBSA 5DHYA 4RMWA 3R8BB 4J4PA 4ZOBA 3UP1A 3MRPA 4GRLD 2A9NL 4B5EA 4U6XA 4NNPH 1B0RB 1EHLL 1YEHH 4QTIH 3VFMA 5CP3A 1KBGH 5EZLB 1R24B 3CLEH 3VFOB 1IAIL 4AEIL 5B39B 3O11B 5DMKA 1AFVL 2X7LB 3E3QE 4PG2A 1YUHA 3NN8B 2HLAA 3UTOA 3C5ZC 1HOCA 3FCTB 5INCB 2FO1A 5GGRB 2O26U 4XXCA 4OGYH 3BZEA 3AREA 1ZV5A 5FYKL 5ESQB 5I16A 1ZTXH 4R7DA 4APQD 1INQA 5BOPA 2AK4D 1M7IA 1UFUA 1C5DA 4APQB 4WHTB 1PZUB 4QHNB 1I1FA 3CXHK 1WZLA 1DQMH 3GI9H 4G6FD 5HDBE 3A6OA 4K9EH 4WU5B 2A74A 2F5BH 4QHUB 1RVFH 1NCAH 5BV7C 3QUYC 2VSDA 3FONB 1A6PA 1FIEA 3JWDH 2EECA 3BRGC 1YY8A 4MDIA 5T1LD 5I73C 2WWKT 3EO1A 5FCUL 5IMOB 4PJBA 1CDBA 5E0QA 1VEPA 5CEYA 5T1LB 1N3NB 3TBYB 4YDKL 4E42A 4MAYD 4ZDHB 3JWOL 1AGDB 4CMMA 3F5WA 5HVHB 3WXWH 4XVJH 1ACYH 2NMSA 2X1XR 1AGEA 1YQ2A 4MXQC 4QF1A 4K8RL 2XWJA 2QHRL 4P46B 5EA0H 5C09E 2I60L 3TNNA 4R0LA 1J8HE 5IKCB 1X5GA 2I9TB 4QT5A 3RU8H 3C5SA 3CCHB 3PQYB 5JW4R 5CIPA 3WXVH 5JW5A 3LEXB 2HH0H 2OX5A 4M48L 3V52L 1OPGL 4BJLA 4IOSD 1JGVL 3I2CH 4GKNB 1OAXL 4NNYA 1QG3A 4J3OC 2CMRL 4WHCA 5CJ8A 1ZEAH 1C16B 1MCOL 4YHNA 1UCBL 3MJGX 1JNNL 2PO6D 3SE8L 4EUPB 1TZIB 4Z78B 4YO0A 1N6QH 5SWSD 2PO6B 3EYFA 5HHOD 2VZSA 5T33H 1G7LA 5HVGB 1FVCB 2WUCL 4NDMB 4HUXA 1BOGB 4KI1A 5SWSB 4F80A 4ISVA 5HHOB 5GIRA 1IM9D 1IC1A 5BO1L 3H9SA 1U8JB 4H88H 4GAGL 1IM9B 1OWWA 4G6JH 3V7AG 3W2DL 5AYUL 5I74B 3U82B 5BQ7B 3VFGH 1R5WA 4OLVL 1SVZA 1Q72H 1GGIH 1W72B 2VDKH 4NRZA 1L6XA 1RZ8B 4JDVB 4KGJA 3LD8C 4D0CA 2VLJE 3U0WH 1KF9B 5F7EL 3UBXG 1JGLL 2ESVA 4MX7B 3RDTD 3S37L 3GSXB 1FRGH 4GW1A 1F11B 5CS7A 3CX5J 1U8OB 5EUKA 2MCG1 3VGDA 1JPSL 4UQ3A 4WTXA 4KVCH 4L8DA 3ET9F 1FG9C 1CD9B 1T89A 3KGRA 3WFBL 5ADPH 1IC5L 3LEYH 1SYVA 4PJDE 4LSTH 4O58H 4R6UA 3HI1A 3QNYA 1ZHKA 1A1NA 1RURL 2CK0L 1DLFH 2Z4QB 3NFPA 3MREB 4HIIB 1DQDL 4KUCD 5ELIA 3BPNC 1PJ9A 1DBAL 4JY6A 2BC4B 1CE1L 1ZOXA 3D9AL 1BBJB 5F7WC 4KZDH 1QACA 3CMOL 4WUKH 2WBJC 3RA7H 3FMGL 5KW9H 4ZO7A 2FHCA 4WTWA 4FG6C 4LPXA 4HIJA 5DD1H 4Y2DC 2CR3A 3MROB 1JGEB 1KLFA 4HZLA 4F58L 2ATKB 1J5OH 3TVMC 4XVTH 4N5UA 1FV1B 1KENH 5K9KB 4XPAH 1KFAH 4YX2L 4CMHB 3J7HA 1BVLA 4NT6B 3BGFB 5CILL 5I15H 2BCKB 3HRZB 4J3UA 5ACZB 2JB5L 2DMCA 3F6LA 3CPLA 4WV1C 3T0VA 4L8CA 3QDGD 2MMXA 4MD4A 5TQ0H 1YY9C 5EU6E 5F7UA 4RAUB 3WFCL 1JF1A 1HHGA 3QDGB 3C5JB 4LL9A 5DK3A 3WHE0 4DGVH 4N1EA 1FL3B 4J1UB 4JM2F 1BLNA 1XGYL 3ARVA 3L3HA 3R4DA 1IAIH 4AEIH 2JJSC 1JGDA 2VDOH 2B4CL 1F4HA 1MCJA 5D1XD 5IFJA 4R96B 1CF8H 3MRMA 4JN1L 3U1SH 5BZDA 35C8H 5FYKH 2CGRH 4UB0L 3OR7B 2EICA 1WFUA 3VGGA 2VLMD 1V3KA 1KPVB 3BPCA 4NHUA 2M1KA 4NKDA 1RIVH 2O5YL 1Q38A 2IADA 1KIPB 2C3VB 5FGRA 4LCIL 1NGPL 1RUQH 2EDLA 1F45A 4GLRI 1HNFA 5D8JL 4NFBA 1BREA 3SDXF 2ARJA 3KPLB 1RZKC 2AQ2A 1R0AL 4P3DB 4YDKH 5IF0A 3JWOH 1M7DA 3C9NA 4BM7A 3FJTA 2HN7B 3N9GL 1OTTD 4XP1H 5CJQL 2ERJC 2AV1A 5CGYD 4F7CA 2MSPA 3BP4B 4KKLD 5C0JB 3C6LD 3UZVB 1HXYB 3SN6N 5IB2A 4XHJC 5KSUA 1SHMA 4PR5A 4QRUB 4YHIA 2I60H 3RPIB 2VXTL 3P73A 5AYQA 2XFXA 4UDUA 3EYVB 3C6LB 4BFGA 2F58H 1F58H 4YHLL 3MRLA 4PREB 5D7LD 3ZDZE 3WO4C 1HKFA 4L8SC 3P11H 3V52H 1A6ZA 1D5IL 3SEPA 4JB9L 4KKNA 5C0FB 1OAXH 4ZFOL 3BKYH 4LLVB 3L3OA 2CMRH 3PQYE 3GUTA 1QR4A 3VFTB 4AEEA 1JNNH 5EOCJ 3REWB 4FQHA 2J12B 4JPVL 5F7LB 3IDUA 4JDZB 1M1SA 4NKMA 4DKAA 5F3BB 1BJ8A 4MHHG 1YNTA 3MGOA 2WUCH 2AJZB 2YC1A 4L5FH 1I1AC 1NDGB 3MLTA 1F3DH 4WWID 1I1RA 2GJ6B 4X4MA 5E94A 3VD5A 5AYUH 1HHKA 2XXMB 1XMWA 5SWSE 5I8CA 1KUMA 5HHOE 3RWHB 1FZJA 3MJ7A 3G6DL 1UXWB 3SE4C 3ARFC 3FO1B 1T0MB 3L5JA 3UC0L 2NY0C 4OIIL 1W0VB 1F3JA 1KPUB 1OP9A 2FDBP 3HE7A 4HDIB 1A6TB 3UZEA 1ZS8B 3DXAA 4HC1L 4OD3L 4X6DA 5FKPB 5DTFB 3JTTA 1FNGB 2D4FA 4MB5A 2HT3C 5D2NB 3S37H 1CFBA 3E0GA 5C2BL 2QSVA 3OKOA 3QUZA 3O4OC 1AY1H 2JTDA 3N85L 3WL9A 1NQBA 1S7UB 4MAUL 4G8EB 3WFBH 1IC5H 1BZ9B 4P2OC 4ONOA 3C6SB 1AXSA 2ADJA 1UJ3B 4M8QA 4B53A 5D2LA 3LQAL 4HS3A 4ZXBC 5GGVY 2CK0H 1RURH 1ZVSB 4F8QA 5IHZA 4MD5A 3TPUB 3UYRL 3SDAA 4WW2C 1EDQA 2CPCA 3OX8A 2V2XA 4V2BA 4HWEL 1GAFH 1CE1H 3MRDB 1MRFH 4S1DC 2OTUA 2MQCA 4X9IA 3CMOH 1CLYH 5JW4Q 2AV7A 2PCPA 3FMGH 4RRPG 3QDMD 3P40A 1YPZA 3TWCH 1AO7B 3QNZB 1JHKL 4F58H 4IBLT 3FOLA 4MVBC 4UBDC 1X6NA 2DQGH 3PDOA 2FD6H 1CS6A 3FO2B 1YQVL 4UZGA 4I2XB 1NFDF 5CSZA 4L29A 3MRHA 3QEHB 4IHOA 3KDMA 3BIBX 5F7FA 5J7CC 2FEEI 3ZYOA 3I3EA 1KIUA 1KIRB 5GSRB 5I1DB 1A9EA 1A5FL 3KLAB 1KJ3L 3WFCH 4GW5B 4XAWL 1A6UH 3S35L 3FRUA 3WKNA 2UY7A 5KZCD 4LAQL 2V2WB 1KLGB 4JRXD 5TDNA 1MFDL 5KZCB 5FO9A 1X5YA 2R0KH 2CDEA 3PL6D 4JRXB 4Z5RA 4X6FA 1H8OA 3REVB 2YBRB 2E27H 2FL5A 4MD0B 3ZMRA 3WE6A 4X4ZA 4M7JH 2R29L 3FZUD 5GRVK 4M7ZB 3NBNA 1HHJA 4JN1H 2MKWA 4CAGA 1Q94A 3BPLB 2OL3H 1T6WA 1TZHA 1ND0A 2KZWA 4G3YH 1NEZA 4WHDA 4JFDA 3EOBA 5L2KD 3MACL 4QRQB 2IPTL 1OGAA 2OSLB 3BGMB 5FUZL 1IKFL 3MXWH 1DUZB 1U3HD 2FBJH 5GGSB 1AP2A 2AK1L 3L3DB 5DRXB 2VLME 4PJEB 3I75B 3NCEB 1XF4B 2PXYC 2OQJB 3K7UA 5FKAA 3CGTA 1E4KC 1SY6A 4FQXA 4KK6C 4JFQB 4P5TA 1NMBL 1U3ZA 4PJHF 2B39A 2XZAL 1I9RL 3CU7A 3N9GH 1D9KC 4OSUL 1BD2A 2XZCH 3QSKB 4KUZH 4Y4HA 5CJQH 1SYSB 4G8FA 1L0QA 1MUJA 3GIVA 1D6EB 2VXTH 4LP5A 3MNWA 1FGNL 4WFEE 5LAXA 4DTGL 2R1YB 2FX9H 4OCWL 1H9VA 5F21B 4I5BA 2GJZA 1GC1H 4RQQA 2ADIA 3DX9A 4NQXB 4ZPTA 4PY8I 1JBJA 4M3JA 3B2VH 1G84A 2J5LC 2DBLL 4K7FB 2N7BA 4O2FA 5FGSA 4ZS6C 1D5IH 3RKDC 1B6DA 4Z7VA 5D6CA 1JNHB 4KDTA 2D7OA 3OG6B 1JI1A 3HUJB 2Z31C 5M94B 2A6KA 5F9DC 5T5FH 3MRCB 2NXYD 2VOTA 4X7TA 5BW7A 3TCLA 2E6QA 3SDDA 2NXYB 4DVBA 4RFEB 4G8GA 1GHFL 2UZIL 4MSWA 4X80H 1JWMB 3TESA 2DYPA 3U4AA 5C6TL 2D0GA 1MQKL 4NWUL 4OKDA 3IJHB 2ADFH 3NCJH 3CDYA 5E4EC 1BIIB 5TF1L 4Y5YB 3G6DH 4D8PA 5HGDB 1WZMA 2GJ6E 4OIIH 4GKSA 2XG4A 5I75C 5B39G 5CD3A 1EEUA 4O2CA 5F1OB 4YXHL 1LQSR 2V7HA 4AG4L 1SJEB 4PFEA 3L95A 5SX4I 1Q9WB 2GUOA 5C2BH 2F19H 3RFZC 5EFIB 2AKRB 4MJ6B 4ZSOA 1OW0C 5DK0A 1CU4H 3EOAA 3F12A 1H3XA 3WBDA 1ZSDB 3LSOB 3LB6C 2XACC 3N85H 3QG7H 1B4RA 5KG9A 4MAUH 2ADGA 1P4BH 4X7CC 5FV2A 1I3RA 2ZJSH 5DLML 3CUPB 2EYSB 3LQAH 2HVJA 3DRQB 2Q6WA 3X14A 4U7MA 2RJMA 3UYRH 2P7TA 1MCSA 5DEZA 3P4NB 5IBUG 3MSPA 2DD8H 1WCBA 4HWEH 4ZAKA 4YQXH 2X6MA 3O3DB 4JZJA 4FS0A 5C1MB 4XBEL 1RJLB 4EXKA 1IL1A 2IBBA 1S9YA 1JNJA 1JHKH 4G6AD 4RWYL 1HQ4A 3QPXL 2SEBA 3IDMB 4LP4A 1KJMA 5H35A 5MI0B 5JDSB 5CEXB 1E28B 3GMMA 1S8DA 3KPOB 1AO7E 3HPJB 3BH9A 3V6FA 1J87A 2LABA 4DW2H 3D69A 2L0DA 4GBXA 3MNZB 1I7TA 3DTXA 3ULUD 1FE8H 1I7UA 1ED3B 3OKKB 2EXYD 4I2XE 3PP3H 2BNQA 3D85A 4W70A 5J6GB 4KKAC 1NGXA 2A83A 3U0TB 1YC7A 3EIFA 1A5FH 1EK3A 2FEDD 4EI5B 5HYFA 3S96A 3RVTD 3KWWB 4XAWH 3S35H 1JI2A 3LKQA 3H3KA 4LSDA 1FNSH 1QBMH 2VDMH 4UTAH 4LOUC 3O2DA 4LRNL 1JZ3A 3U30C 1QBLH 3H0TB 1RZFH 3LKNB 1G6RA 1CDUA 4HT1L 4X99A 1WAAF 1A14L 1AI1L 1TITA 3PV6A 1BFTA 1QQDA 1Q9KA 3ES6A 4TNVF 4NHCL 2H9GB 3OJDB 4PJ8D 4JRXE 5DRNB 2XTLA 3KS0H 4ERSL 4Z7QE 1A6WL 4XP5H 4PJ8B 1BJMA 2LAGB 4ZQKB 3MACH 2B20A 4OGZA 2FECI 3ULSB 3FB6A 4OZGB 2NY2D 5E00B 3TA3A 4AENB 4Y89A 4FFYH 5INDB 5F7YC 1EEYB 2Q1EA 2AK1H 3GMQA 4LCWE 2EDEA 4NN5B 1CZ8L 1WGOA 4KMQA 4GG6B 3DV6B 1JPFA 2R1WB 4JKPL 1NMBH 1RZIA 2R15A 4F7EB 4S1QH 2EKSA 3IB4A 2XZAH 3CC5B 4PJEE 5JXED 5IM7A 1NBZA 2YWZA 2D7NA 5MHSD 3KLDA 4NZRL 3UXFA 4XH2B 4JRYA 5EU7E 4EUPH 4XMLL 2VZUA 1TQCC 3GSNA 5DWUH 1FGNH 4OCWH 5HDBF 3MBEB 3PXJA 1RY7B 2ZUSA 5ICZA 4ALAH 3OPZL 1JVKA 4KH2A 4JQXA 2O5ZL 1C8PA 3FO0H 1K5NB 3O6FA 3QDAA 5JHDB 3RWEB 4CRPA 3FN0H 4YDLC 3UTSD 1W72H 2W60A 4H0GA 3QEGH 1QSEB 3TN0B 4FHBD 5D5MB 1CL7I 3ZSTA 3UTSB 2QSTA 4WFGD 3BGAA 5E2UL 3WHXA 2EC9U 3FQTA 4RFNC 2QHLA 3HUJE 3QI9A 1GSMA 1I3GH 1GHFH 2UUDK 1UZ6F 4QRTB 4OV5B 5IBTH 1NLDL 5BOZG 5C6TH 3RNQA 4P2QD 4OF0A 4FXKA 3B9KC 2FNBA 4Q6IB 3UTZB 3DI2B 1BWMA 1T21B 2Y07L 4ZUUA 2YSSB 4I4WA