4GRWF

Structure of a complex of human il-23 with 3 nanobodies (llama vhhs)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
125
structure length
125
Chain Sequence
VQLVESGGGLVQPGGSLRLSCAASGFTLDYLAIGWFRQAPGKEREGVSCVSSSGQYTYYADSVKGRFTISRDNAESTVYLQMNSLKPEDTAVYYCATDPECYRVRGYYNGEYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neutralization of Human Interleukin 23 by Multivalent Nanobodies Explained by the Structure of Cytokine-Nanobody Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Interleukin-23 subunit alpha
total genus 28
structure length 125
sequence length 125
chains with identical sequence J
ec nomenclature
pdb deposition date 2012-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4grwF00
3O6FA 4Z95L 3P9LB 4LHUB 5E99H 3IRZA 2R1WA 1AJ7H 4WI2A 5C92A 5ELIA 5CS7A 3NFNB 4M00A 3X12B 1NC2D 1YYMH 1TETH 5T5FL 3G08B 3CFDB 4FABH 2OTUA 4E5XA 4RGMB 1T0MB 2WUBH 4XVSL 2P8PB 2Z35B 5FUCE 5GRXG 4FA8A 5FYLH 4G9DA 2YD4A 2QTEA 5ESQB 1CE6A 5MHSE 3K81A 3N1QC 1W72L 5DEGB 1G9MC 4JB9L 3NMEA 1E4JA 4GRWF 4XX1E 3THML 1CDYA 2FH8A 3L3HB 5DD3L 5BRZA 2R0WL 2VIRB 1JNLL 1JFQH 5CCKL 4DGVH 2AEPH 5JNYB 1KGCD 5MERA 5FCUH 3RVTC 4P3DB 4UQ2B 5EN2B 4LVOC 3O4LE 4YQXL 3BRFA 2DQJL 3GJFA 5C86A 2CGRH 5ALBL 2J2ZA 3VWKA 1TNMA 4NQCB 3MZTA 2X1XR 2LU7A 1OAUH 5M7QA 1V3LA 3RWDB 4FFYL 3BRDA 1BVLB 3D25A 4P57B 1I1AA 4PLJC 1KJ2B 3RVTD 4JPVH 5H94A 5A2FA 4U7MA 2P45B 4MAUH 1B2WL 1BVKB 5JDSA 2FEDC 1HOCA 3O6KL 5KSBF 1FQ9C 3CFIC 1WCBA 4NBXB 3UTZA 1KCKA 1BZ7A 1DEEA 2J1KA 5LCVH 3FB5A 2UUDK 5HI4C 2YWZA 5CBEA 4U6VH 3ZMRA 1ZSDA 2DLTA 3O2DA 2ZUXA 3VXOB 1ZHBA 1GGIH 2XNAB 3O0RL 1WV7T 1CGSH 3VE0B 4NHCH 2Q8BH 2R2BA 4A6YA 1U8JB 3SN6N 3VI3F 3HA0A 3RDTB 1MIML 1RUPL 5FYLL 2ATPB 2Z8VC 3W82A 3MV9A 4JN1H 4EI6B 4FMKA 4OD3L 4LMQI 4KV5E 2NTSP 4OCRH 4S2SA 1A4JB 1QPXA 4UB0L 1CBVH 3Q2CA 2CRMA 4RA0C 5FYKE 5ANMB 2YOCA 3CVHH 4D0BB 3SKJH 3PGCB 5BQ7B 3EGSB 1BHGA 2EXWD 1VFMA 1MELA 1IMHC 2HJLA 5I73B 4Y5YB 4GRWH 1MRFH 4RRPA 4GMSH 3RX5A 4XHJD 4PJGB 1YMMA 2LE9A 4QXUH 1AD9A 1GZQA 3O9WA 1MFBH 3W0WD 3QNZB 4L4JA 3RPIB 4XAWL 1EHAA 2A9MH 2DLGA 1OAXH 3MNVA 4CBPA 1HI6A 3PP4L 3RWEA 1A0QL 1I3UA 3CFKA 4UUJA 4IMLA 4NQDA 4XHJC 2H6PB 2YKLL 1ZTXH 5E6IA 5EBWB 3UYOD 4XCFH 2I07A 4OIIH 4XC1L 3AM8A 2R1XA 3GSNA 5T1DH 2VXTL 4NKIL 4HCRL 3VW3H 4WU7B 4PJDB 2RCSH 4U3XA 43CAA 5TDNB 3CCHA 1QO3A 4OF3A 2EE2A 2C4XA 1EEYA 4U4BA 3O3BA 1T7VA 1F3DJ 5CEXB 2NY1B 3C8KB 4N8VA 4CKVX 4OD3H 1RZ7L 3HC0B 1AP2B 1G7PA 5D96B 1IARB 2PNDA 5EZIL 4YHZH 1UFUA 4LEOA 2VLKE 3DWTA 3FB7B 3QQ3A 1X4ZA 1ZGLP 4OCWL 4XT1C 3IU4L 4S10A 3T08A 5EORH 5AD0A 2BJML 2AK1H 2K7QA 4NP4L 4JFHD 1JHLL 1KYOK 1C5DA 5HDLA 1DDHA 4OZHF 3DUSA 3SKMB 5D5ME 3UO1H 1JPSH 3WUZA 2NXZC 1LEIB 3OZ9L 1TIUA 1I3RA 3DI2B 3UMTA 4PB9H 2ZJSH 4ZXBD 3KG5A 1BVLA 4OCYL 4G3YL 5IB4B 1C5CH 4G7YH 3SO3C 2GJ6E 5F9JA 4UV7L 1NBZB 1KUMA 5KSAC 4NNXB 3DX9B 3RZWA 5DEFB 3UPRA 5CP7A 4YHML 4FQJL 4YBLC 2FX8L 3O45B 4MNGB 1NCUA 2EDTA 3O3DA 1QFWH 1OF2A 2AJVL 4LSRL 3T2OA 3GMNB 5D5MA 3DX7B 5DD5H 4KK8D 2E9IA 3D69A 4QTHA 1VENA 5I1HL 3QXDA 1QLEH 2V9RA 2OZ4A 5DJZB 5EWIH 1NFDB 4P23D 5E70A 5C0JA 1XEDA 3BMVA 1XIWC 1OGAB 5CEYA 3CVIL 1LEKB 3PL6B 1VERA 3QQNA 4ONOA 1CLZH 1C12A 4PRAB 1XGUB 4HMEA 1WWCA 1CGYA 4HK3N 2F74A 1GZQB 2CUIA 5KSBA 4HIJB 2OTPA 4IOFC 43C9B 3OB0H 3FTGA 1BEYL 3CUPB 1CFBA 4MXWH 3MYJB 4L3ED 3VG9B 2CRZA 1B0WA 5MEPA 2A38A 2DWEB 1A02N 3SGJA 3QIWD 1RIVH 1NPUA 1I7UA 1KACB 3B5HA 3B4NA 1A7RH 4MWFA 4YUEH 4IRJD 5F1SA 4HKBA 3FQTB 2XWTA 1X5KA 5BJTA 4NYLA 4NQXA 2Q20A 2A74B 3MC0A 1DUZB 4FQLL 4WW2C 2DM2A 4ZXBB 4H1LA 3SKOB 4DGVL 1DUYA 1CK0H 5TDPB 3JV4B 1MCRA 4XC3L 5A3IC 3NZ8A 4KKBD 5E7BA 1A64A 3H7BA 4GLRI 1MCLA 1FFOA 4PJAE 5JHLH 4GAJH 4FTVB 2MKWA 1VSCA 2W9LA 4G8GE 4NDMA 3KPMB 4J6RH 1A8JH 1WICA 4MD0B 5E8DH 2DI7A 3BVNA 1VGKA 3PDGA 4R96B 1ZHKA 1VEMA 1T1YA 4H88H 2EDOA 4R3SB 3TH4T 1AGBB 1H8OA 1G9ML 1GGTA 6FABH 3VRIB 1G0YR 2QKIA 1NDMB 4TSAH 1DL7L 1HCFX 5GS2D 3Q3GB 4JO4H 5IV2B 2R4SL 5GISH 1MLBB 1VCAA 2IADA 1EDQA 5DO2D 1E27B 1JMXA 1KN4H 4LBEA 4Q9RH 2E7HA 3AM8C 3U7WL 1W0VA 4Q9QH 4FQXA 5D70H 2J8OA 5LQBH 1MCHA 4Q0XH 5I19L 4F33A 3CX2A 3IDMB 3I02B 1T89C 2NY2B 3FQUA 5JIIA 3JTTA 3VH8G 3SE4A 1KIQB 1A1NB 3GKWH 2WUBL 1Z2KA 3ALPA 4HUUA 3V6BR 2Q1EA 1HH9A 1SVZA 2K9UA 2FR4A 4I0PB 3V6OA 2X41A 3K3QA 3DXAA 3B9KD 5C0DB 1YPZB 4D8PB 5JQ6L 5FYKH 3ARGD 3ARRA 1E28A 1KFAH 2ZSWB 4TULL 1H15A 1RZJL 2I9LA 4HJJL 2XY2A 4TOYL 5DUML 5I2IA 1RHHA 4HPYH 3VWJD 4MD5B 3EO9L 3DJ9A 3FFCD 3IDYB 4HUVA 2CDGA 3QG6A 2X09A 4NPYB 5JHDA 1EAJA 4N9GA 3OJDA 2APWA 4WW2B 5J6HB 4LPCA 2EKJA 4J6RL 3IFNH 3BDYH 4KMTH 4QOKB 5F7NC 1ZTXL 3IJHB 4IOIA 1PAMA 1CVRA 1OGAA 5CEYB 4PJFB 4R7NA 2W60A 2XN9B 5BOZG 1AO7A 2C9AA 3DX8A 4AIXA 4YNYB 3GSWA 4KZEL 2EEBA 5E5UB 2BP3A 4F7EA 3PJSB 6FABL 4LARL 5DMIL 2B4CC 5IK3B 1AR1C 5DEGA 1TVBB 3VMOA 2NW3B 2I60H 5DS8A 5C0FB 4J1UA 4QHMB 2IGFH 3MRCA 1OSPH 1OQXA 4H5SB 2DQDH 1HHJB 4XGZA 1S9VA 1PYWA 4LLVA 3OSKA 1FJ1A 2VABA 4L5FH 5DMGD 3QULB 5EUOE 3QG7L 1DUZA 2VZSA 2GYSA 4PP1D 1ETZA 5D7LE 1V8HA 4JY4B 3U2SA 3GSNL 1P69B 3KPRE 2OX5A 5D7IE 2A73B 2DIJA 3HFML 3IJSA 3LQZA 2GTWA 3PL6C 3LD8C 4OM0H 1TZHB 1XGQB 3E0GA 5A16B 3S7GA 1CLOL 4ZTPL 3WLWD 1OM3L 1MFDH 1A1MA 1AXTH 3CZJA 1MQ8A 3HMWH 1TZIA 3ARUA 4QRRD 5D7LA 4V2BA 1HHIB 4AG4L 4HS6B 4P3CH 3V6FB 1OGAD 3RA7H 1ZEAH 1Z5LA 1UENA 3V4VL 1FV1A 4K3EH 2X4NA 4RRPG 1H15B 4IMLB 1NCDH 1MH5A 3X11A 1F6LL 4G8GD 3MROB 2VDOL 4OUUA 2ZG3A 3GJFH 4PRPA 4LSTH 5IHZA 3D39E 2MSPA 2HRPH 1P2CB 2XTJD 2FATH 4KH2A 1AGBA 2CGRL 1FDLL 2NY4C 1R3KB 5BZWA 4MXVE 1WLHA 1F4YH 2XZAH 4BKLB 4DVBB 1NEZA 5JUEL 3UTSE 4KJYB 2XWBA 2A77L 2EE9A 4J23A 4LNRB 4MJIA 4P9HC 4Z0XA 3RWFB 1HKLH 5T1LD 3IDMA 3GSUA 5T1DL 3RQ3A 1HXMA 4PRBB 5JW3L 2NZ9C 2QLVB 3QUXD 1T83C 4IHOA 3QEHA 4RCAA 2PXYD 5DK3A 1I75A 4OLZH 4TUJB 1MCFA 1BX2A 4F80A 4XNQA 4Y4KC 1W0WB 5JW4R 2BXYA 3CLEL 5DJ8B 1S7VA 3SJVE 5CWSA 5L7XH 3INUH 3ULSB 5JIKA 2FEEL 1U8PA 4G6JH 3CFKB 4U7SA 5ISZD 1IQWL 1YN7A 4PR5A 3CIQA 1I7RB 1DZBA 3VGAC 1S7UB 1PGRB 4DK6A 4LPVA 1GJIA 4GOSA 4GSDH 5L6YH 5E4EC 1Q1JL 3WLBA 5KG9A 5HY9B 1SMAA 3CCHB 3ARBD 1FCGA 1HHIA 4LGSB 1LDSA 4OGAC 4NWUH 3C60C 1J7VR 1SJVA 2WW8A 3RIFK 1YZZA 1R5VA 1Y0LB 5AAWA 2N1KA 3QSKB 5JORB 4LLWA 1RK1B 5I74C 1J12A 2JB6B 3HE7D 3GHEH 1U8KA 5IVXB 2B4CL 3V0VA 3QH3B 2FLBT 3D69B 1PVHA 3G08A 3GDBA 2VC2L 3A6BH 1TETL 4NQVA 1VFAB 3TWCL 1N59A 2ICWI 3GBNL 1DSFH 5IWLA 1KJMB 2CKBA 5CEZH 4KJYA 1WZMA 4EOWH 1QLRB 4PJIE 5ICXB 1S9VB 3MV01 4LLVB 5DZOA 4GUPB 3MRNA 3B9DA 3SJVD 1Q9LA 8FABB 4EI5B 1BWMA 5KBNC 2Y7QA 4U7KA 5I6XB 3ULUF 3MJ7A 4WO4D 5D7KE 4KQ4L 3DYOA 3BGFB 2IQ9L 4LPTA 4NO3A 2AAVA 3LKRA 3IDIB 1JRHI 4N5EC 2D7NA 4Z18A 5HPMA 1FORH 3BKJH 3CLEH 4M6NL 4RGNC 1IQWH 5HJ3A 1WEJL 1NGYB 2DM7A 3VWKB 3VMPA 5BRZB 2FJGA 1ZT7B 4G6JL 1J8HA 4G9FE 5FO8B 5F1NA 4OUUB 2LU4A 3FO2B 3SDCC 4HWBA 1LD9A 3T0EE 4PPTA 3D2UD 1R24B 1W72H 3TZVC 4TTDC 5E2TH 1JRHL 1OARL 4ZOEA 3BUYA 1U8NA 3QDJB 5HHXH 1DN2A 1HOCB 1MFEH 2ITCB 2NY2D 4M7LH 4JG0L 5KSBE 4C83B 1KIPA 5DTFA 2BNUA 1MVFA 1I1AB 1SBSH 2A1WH 3DX6A 3S36X 3U0WH 3CSGA 4LCWD 4EDWH 4OFYD 4RMWA 4LPUA 2BNQE 2OMBA 4L8CA 1F42A 1MRDH 4YXLL 1U8QB 4DKEH 2GW5A 3BJ91 4K8RD 1JTOA 1MCOL 1NBYB 5F3HB 3T1FB 2EYTB 3FMGH 1U8JA 3V0VB 4R0LA 5F70A 4QXGL 1FG9C 1TVHA 2V2TB 1JI1A 2BDNH 3UBXA 4JFFA 2WLZA 1FZOB 4JN2A 3JV6A 5GIRA 4UQ2A 5EN2A 3U7AA 3HUJE 2XIDA 2R0KL 3RDTA 5GS1B 1R3HA 2QHRL 5DEZA 2D9QB 1RUKL 3SKJL 5F9OL 4F2MA 4MZ2A 5EA0L 3VGEA 5EZOH 4YBQC 4M02A 2XN9D 3G6AA 5BW7C 1HQ4A 1YDPB 1OSPL 2DQDL 1F4XL 2HFGL 2ZOKA 3LSOA 3T77B 4Q58C 1ZT4A 1GAFL 2Q8AL 5BO1H 1JBJA 2YN5A 5DHYA 1ZA3A 5LGHH 3BIKB 5HJ3B 2MOVA 1JGEA 2DWDA 1AD9B 5IB5A 4OZIE 3EJJX 1A6WL 5I8EB 1GIGL 5DT1L 3MNVB 3VDCA 1IEBA 1KG0A 2BRRL 1ZKAA 3QZWG 2OI9C 1FYTE 4F9PC 3L3KB 1MFBL 5EO1B 4UBDC 4OCMC 4EI6A 1G9NL 4OIAA 4YHNA 4AENB 4DEPB 3VGAB 4ZYKB 4FXKA 3KJ4B 2Q76B 4WUUA 2XN9A 5F89A 4MGXA 3BKMH 2AJXH 3F58L 1RULH 2X2YA 2DKMA 2O61B 2X9XA 1I9RL 3HZVA 1IBGL 3TV3H 4LLDB 1TVBA 3SKNB 2X4TB 2WMPA 3CFCL 2HH0H 2XTJB 4X6CA 4XGZB 1SM3L 4XCNB 1F4XH 4P4KD 3ULUC 4MZ3A 1A6TB 1ZHLB 4XNMA 3P9MB 2I5YL 5KS9B 4ELMF 3V52L 3RWEB 4JM2B 2V2XA 1RUAL 3FOLA 2XQBH 5F7EL 1XCTA 1LDPH 5EZIH 4WI7A 2P8LB 3VXQB 4C59B 1I9IL 3DRQA 4KUZL 3WIHA 2O93L 3RI5K 2ZOKB 3LSOB 4NPYA 1YY8A 3GMLA 4LDOB 2PW2A 2PXYB 1A3RH 1KTLA 2GK2A 2CKNA 3INUL 3HR5A 4KDTC 2OR8A 4O58L 1T04B 1D5MB 3QUKA 4M5YL 3QDME 3L7EA 5SV4A 1RIHH 2H2PD 3NH7H 5ESVB 3MOQA 1TCMA 3NACH 3QPXL 2GUOB 4ZFOL 2W60B 1CXIA 5CUSH 1JPSL 3MR9B 4R97C 1I1CA 1DBKL 1KBGL 4FP8L 4LSVL 4KHTL 2YD5A 3HCVB 5BV7H 4NC0B 3DO7B 1AGDA 3BP4A 4WFEE 4L4VD 4B5EA 5SWSB 1OWWA 3QCUH 4QHNA 5JPMA 1FRGH 3HPJB 4LPWA 1MCEA 3UJTL 4M43H 4H20L 5F88B 3TYFA 4D94A 5CGMA 3AS1A 1CT8A 5T3ZE 3O2WH 1CCZA 1EO7A 3I6GA 4ONFL 3V9FA 5K9OA 1R5IA 5CZKA 3R1GH 1B4RA 3K46A 5EU6E 1I8KB 2VAAA 1IT9H 3ARGA 4NRXB 5CEZD 3MUJA 2NR6D 3A6CH 2VDMH 3EOBA 1KB5A 4Z7WB 3MBEC 5HYFA 3LQZB 2AJUL 1BFTA 4K55A 4KKLC 4UILL 5K9QI 1V5JA 4FFZL 1A7QH 1KTKE 1PDKA 4HWBH 3K8MA 1YEFH 3MLYL 4FMFA 1TZIB 1KTDB 4PRIB 4Y89A 3U9UB 4G5ZL 2XTLA 4OB5L 1I8IA 1CLZL 2JTDA 2AK4B 5EPMB 3C6LB 4I3RH 2VQTA 4K3JL 2IAMB 5I1GH 4N0UB 3X3FH 4M9PA 5IM7A 1Z0MA 1N7ML 1XR8A 4KJWC 4HCRA 1VHPA 4HEME 3QPQD 4F7CB 3E6FB 1T21A 3VFNB 5DQJA 1T1XA 2AQ2A 2R1YA 2YR3A 3OJ2C 4X9GA 2R0ZH 1RFDH 5DJ2B 1IKFL 1IC7H 5IP4A 3L1OL 2WIMA 4QRUB 2AV7B 4KJWD 4G6FB 4H8WH 3QI9A 3TT1H 1BGXH 2MQCA 1D6EB 2AABL 4L9LB 4ONFH 5DVNA 5IIEB 2AEWA 3R1GL 3DO7A 3SPVB 5MEOB 1S7WA 4PGZA 3DMMC 5IMOB 3L5JA 4BYHA 1OOAA 4R3SA 5AWNL 2HMIC 2KQMA 4NJAL 1BX2B 4YK4B 4IM8A 1MEXL 2D03H 2ZCLH 5D1XB 3HB3C 3ILQD 3WFHB 1BFOB 5CKGA 3MV9D 2P42B 3BE1H 1KGCE 4C56B 1G0DA 3O6ML 3SGKC 5IVNA 4AZ8A 3A6BL 5HGDB 3S36L 1A6TA 4QXGH 5FM5O 2GCYA 1U9KA 3D2UA 3OHXB 1PKQE 4ZFFA 3KJ4C 4QRQB 1II4E 1MIEL 3KPPA 3RP1A 4U1NA 4ZPVA 1TENA 4P48A 3VXPB 5B3JE 1DEEB 4GMTH 4M6AA 4A2MA 1KXQE 4M48H 4H26A 3OKDB 5CMAB 4C57C 4RX4A 4WENB 5DI8B 12E8L 1MCPH 2FJHB 4TSBL 2N56A 4Z7WF 3WHE0 1MCWW 3DYMA 4PRDB 4G8IA 1E4XL 4WEBH 4OFVA 1QR1A 4K9EH 1T03L 4L29B 4A6YB 3W2DH 5C0AB 3ZSTA 3C60B 2A2QT 5IEHA 2VLJB 3SDAC 4ZQKA 3AAZA 3C6LC 5B38B 1EJOH 4DFHA 5JZ7D 4C4KT 1N4XH 5DVKA 5F3BA 4TPRH 1G7HB 4NRZA 1DLFL 4JG1L 2BVOA 4HJJH 1S7SA 3SDDA 4K7FA 4A6YH 2BMKA 4KI5D 5HHMB 4YH6A 1KB9K 3MV7B 2J8HA 5FHAL 1B90A 5JZ7C 2WK2A 3OPZL 5KSUA 1F3JB 4ZS7H 5GISL 3X13B 4Q9CA 3OR7A 2VE6A 3WEXB 1QHPA 4MVBD 3O2DL 3ULUH 3MMEB 5DRXB 1D5IL 2ZG1A 1E4XI 1U8LA 3C6LA 3SCMC 1ACZA 2MNUA 2CDEA 4HIHB 3BT2L 3WYRA 3QQ4A 4RMTA 4V1DE 3MXVL 5J1AB 3D3VA 4GRMB 4M48L 3TPUB 4HUWB 4NO0D 4HG4J 4KWUA 1P7KB 2NY6D 1MCDA 3DURA 4OM0L 3BH9A 4WU7A 4U0RC 5SWSD 3QDGB 4K2UL 1SYSA 1HZHH 3ARFC 5D4QA 4ZG1A 4ZDHA 3OJDB 4PIRF 1B0RB 2FSEB 4R8WL 1RZKH 4YE4L 1U8OB 2G2RB 2H8PA 4P3CL 3R8QA 1Q8MA 1CXEA 4K07A 3GMMB 1MVUA 4XP1L 4NOFA 2P47B 1Q72H 3DTXB 4P9ML 2VKXA 1PY9A 3LV3A 1HEZB 5DJAB 2OZ4H 1J0YA 1JWMB 4OF0A 4WUUD 1EGJH 4LHJB 5BO1L 2DN7A 1OTTC 3NVQA 5GS0C 5DMGC 2G75A 4FTVE 4G8GB 2AQ1A 1SQ2N 1NFDE 5GSRB 1I7TA 3MO1A 4JAMB 3LN9A 3ZZ1A 4UT7L 1KPVA 4ZUSB 1A6WH 4JN2B 5D1QD 5EU5A 3IXAA 4LGPB 3ZHKA 5KVEH 4N0FB 2HA1A 1PZ5B 2P8MA 4YXHL 4R7DB 4FNLH 5IQ9B 3KLAA 4AIZB 3OKYA 2ZUWA 3PIQA 4JRYE 3LN4A 1XF5B 5IVZA 5A16A 1KT2A 1F3DH 1MCSA 4L9LC 4PB0L 5CIPB 3OAUH 4CMHB 5MEQB 3B8YA 1T22B 4HFUH 5EFIB 4M62L 5E94B 2F53E 4KPHL 4DKEL 2V9TA 5MERB 4HZLA 1MAJA 3MRJB 5DGQA 3QHFL 4PJIF 3S88L 1QR1B 4K2UH 1EUTA 4XMPH 1G1CA 1Z5LB 3OAZH 3TV3L 1F45A 3QCVL 1VEPA 4KGJA 5CWSB 2FJHA 3ESUF 5IR1A 4X8JA 5EU4A 2J6EA 3DURB 1EO8L 4TVPH 4M1CD 3SE9L 2JF1A 3LS5H 3CFBB 3HMWL 4XZUB 3BZ4A 5BS0D 3Q0HA 4OB5H 3N1FC 3P77A 5I71C 2VLJA 1HHKA 3CFDA 2PYED 3IDGA 4M8QA 3O2VL 4S1QH 4ZAKD 3GB7B 5SWZB 2BK8A 3T3ME 4MLIA 3KR3L 3JBG7 4OI9A 5TE4L 2EXYC 3QCTH 1HXMB 4FFVD 1GZPA 4XBEL 3F7VA 2DQTL 4PYGA 3CFEB 2EH8L 3HNSH 3KPSD 4PJEE 1L7IH 3KXFD 5JMOC 3V5KA 1FC1A 5IFAH 5CZXC 5FYJE 1FZMB 1IM3B 4OZGE 4X9FA 2E9JA 1IFHL 2D7MA 5ITBH 4U1MB 3AREC 2GEEA 4WVRA 3TBYB 4J3VA 5HYJB 4O02L 1QLFB 4UQ3A 3WNLA 4CVWA 5CJXA 4X6DE 4NKIH 2ERJB 3QJFA 4F7PB 4PJ5D 2NW2A 1FG2B 5INDA 5IHUL 2HVJB 4X4MA 3LKRB 1K8DB 4PR5B 5T5NF 5I8CB 4HXBL 1KCRL 5TGBB 4P2OC 4FQHB 3MLSL 5DUPL 1J8KA 1QBBA 4GQ9H 4X7SH 1HYSC 4PJ9A 4XCCH 5MEQA 1B3JA 1NBQA 4G6KH 4M1DL 4DTGH 3VRLF 3EBAA 3S35H 3T2PA 3BUTA 4EVNB 4RFOL 3IGAA 3NCCB 5ICZA 5T33H 1MJ7L 1L6ZA 2NY5C 4BFBD 3GMRA 4RQQB 4P2OD 5F1OB 3HG1A 1OT1A 2A83B 1XCQA 4GXVL 4YHOL 4UAOC 5HHMD 4DCQB 4OAWA 1JWMA 4EXKA 4GMTL 2IG2L 5T3ZH 4JLRA 3BPOC 5H2BB 2EIDA 2NLJB 4OIBA 3GIVB 4QCIB 5EZLA 2VWEC 3L6FB 4W4OC 1A7OL 1YEJH 1GRWA 2NY1C 4S1DC 2RR3A 2ZOLA 1GYAA 2LTQB 3HI5H 4JO1H 5EOQL 2R0WH 4AH2A 3PNWA 2CDFB 2FDBP 4PTUA 3RY4A 4J12A 4JFDD 4N5ED 4X5XB 1MY5A 5B8CC 2H3NB 5E2TL 4ZO8A 3DNKA 5D70L 2DRUA 4YZFF 4TULH 1MUJB 1LP9E 2DQJH 5CZVH 5I71B 1EAPB 4KTYA 5A43C 1Z0NA 4PJ9D 3GJEB 3TH2T 5HHVL 5B21A 4NNYB 5ICYB 2RB8A 1KLFA 2A6KB 1UWEH 1NLBH 2HFEB 3CFJB 1OAZH 3MRGB 5E9DA 1E4WL 1AFVH 3L7FA 5D6CB 3NN8B 2JELH 3GMPA 3F7YB 2VN7A 3C87A 3MCLH 1WITA 4JDZA 5D2LB 1FN4B 2Z9TA 4MD5A 1FFRA 4TUOA 5LGJB 5JW4M 1FSKB 4X4ZA 3WFDL 3C9NB 3GUTA 1DP0A 4ZO9A 3GIZL 1VDGA 1E28B 2ZSWA 2Z92B 4HD9A 4LVHB 1IAKA 4LASH 2BDNL 3BESR 4JFEA 4X5WB 3NCJH 4ORGB 3VXUA 2ERJC 4DTGL 3S4SG 3GMQB 3PE9A 1S7XB 4HKJA 5DJ2A 4C54A 2YMXH 3K0WA 1JPST 4LEXL 5T33L 2QHRH 3B2UD 4U1GC 2AV7A 1VKXB 2EO1A 3C5SB 4R4BB 4AQ1B 5DK2B 2YZ1A 1CD9B 3VXMD 2E7CA 4U1LA 3NIFF 3OKLB 2BHZA 5JPNA 5KVMC 5EOCL 4FFWD 4HZAA 4LVOB 4QTHB 1FJ1B 4FQQB 4KXZI 1FO0B 5E03A 1QLFA 1R3LA 3DV4B 2Y6SC 5B38A 1MPAL 1FZOA 4ZNEE 4EDXA 5C07D 1CFSB 1N5YL 3QISA 5EBGA 1BQHA 1MI5A 4FZ8L 4WHYG 3C2AL 5E6IC 4X83A 1GHFL 4PJCB 4Y16B 4I5BA 2WBJD 1BM3H 5F89B 5T1KB 3G5ZA 5T1MA 1CFNB 4TQEL 5JR1L 4Q9BA 1CZ8L 1MJUL 4XVUC 1A7NL 3WN5B 4FXKB 3BSZH 7FABL 4U1SB 3PWPB 4W68A 5IUSA 4D9RE 3H9HA 3R4DA 4PJHA 3ZDYF 4PJCF 2VE6B 2PO6A 5KVFH 4P3DA 1ADQA 4NNYA 2E7LC 4QTIH 3QDHA 2VDQH 1KLUA 3S3JA 5TQ0L 5C09D 3D1MC 2R2HA 1JPFB 4NUGL 4LIQL 4GS7B 5DUBB 4ZODA 5CP7B 4OZFA 1BAFL 5SX4H 1X5LA 3FQTA 3V6FA 1B9ZA 2DMCA 3E2HC 1P2CA 2BVUA 4WU5A 1KPRA 4JDVA 5BXFA 2NNAB 1XT5A 3VFPB 4NQUA 4E41E 1MH5B 3X11B 2HH0L 5F9AC 4LVNB 3X14A 5EO1A 3T0DA 3QJHA 4ONHA 4ZSOE 1XF2A 2F19H 5T5FH 3QUML 4UMGA 4YDVA 4MQTB 5I73C 4OCWH 4PP2B 1WFNA 3O3UN 1QZ1A 4Z7QE 1UJTA 2KPNA 4ZSOB 3VI4F 3H9ZA 3HNTL 3LH2H 3B83A 3QEHB 2BNRD 3TO2A 4LQ1A 5C9KA 1RZGB 4WI8A 3GSXA 4JFHE 5FM4A 4TN9A 1HNFA 2CK0L 5I9QB 4NC1E 4PRBA 2PO6D 4OM1L 5E9DB 4CL7A 3ARDB 2BY3A 4Y4HA 4UT6H 4TOYH 3IAPA 1KXVC 4OQ1A 1CICC 4NCC1 1BD2E 2IFFH 3DV4A 1J88A 3BQUC 4X98B 5DYOB 2PCPB 3ARGB 2VLRB 1JWSB 3BN3B 4ODUB 5C2BL 3PWPD 3MRQB 3VA2C 3RFZC 3C5ZA 4X0KA 3IKKA 3KXFE 1DTUA 2DQGH 3SKOA 5I30H 3HUJB 3JTTB 2IPUK 2JB5H 5B8CB 1UKQA 3TCLA 2SEBA 5C09B 1CTOA 5IQ7H 1J0ZA 2GHWB 1SJXA 2O5ZH 1T22A 3VXUB 2FEEI 1M1SA 1Q1JH 1AKJD 5KTEH 5ESVA 2I60L 1RK1A 4K71B 1TCRB 4NWUL 4M7JL 2VTFA 5IBLC 1MWAH 4PRNA 3MLZH 4OSUL 3R06A 5TFSL 1D5XA 3PWVA 4O4YL 2NCMA 4RAUA 4EIGB 3FN3A 5I1AA 1F6AA 4HULB 3PV6A 4JRYB 3X3GH 4PV8A 4LVHC 1IAMA 5JIPA 1ZWIA 4QOKA 2BFVH 2VH5L 4UT6L 2YHGA 4YHLL 3X3FL 1WFTA 3C5ZD 3VXSD 2YD3A 5GGSB 3F7VB 4MHHG 1INEL 1S7QA 3PABA 1AQKL 4ODWA 1X9QA 2L0DA 5H94B 4JM2C 4WY7H 4LCCC 3DROB 4KK9C 3S6CA 1MIMH 2YRLA 4URTB 4QXUL 1S5IL 2C3WA 3WJLA 3QNZA 2YD9A 2F54B 4HS3B 2HG5A 2NX5D 5J3HC 4QYOB 5DHVA 5I18H 5K93A 5FB8B 2YXMA 3QUMA 1UWXH 2BOCA 3F5WB 4I9WE 4X8JB 5EU4B 3HHRB 5BV7C 1XIWB 4F3FA 4OV5B 5D7JA 3UJIL 4JGUA 1G7QA 5TE7H 1A4KB 4GXUN 3BGMA 43CAB 4B0MM 4JKWA 5SWZA 4QRUA 4MNGA 3BWAA 4PLJD 1FV1B 4JVPA 3PGCA 1T0NB 1RJZB 3QXDB 3CFEA 4QHKI 1LILA 2AI0H 4BZ1L 4Z77B 1KN2H 5F3HA 3T1FA 2VR5A 1G7HA 4AEHL 5DURD 3EZJB 4JJHA 4GXVH 4P5MA 4LP4A 3WMSA 4F2MB 3T4YA 1KC5H 1JHLH 2IPTL 1EEZB 2YD8A 4KY1L 5FCSH 3QRGL 2IFGA 5J06A 1S9XA 1H3XA 3OHXA 3EJZD 3WV0A 4R4FH 5F93C 3VXRA 3U9PH 3VXNB 1FGNL 2X4SA 1U92B 3DRTB 1D5BA 5AYUL 1ZLUH 3RAJH 2OTWA 3FB6B 5DK0B 4XBEH 4P23A 2B4CH 1QRNE 4XPGH 5LJYH 1V3MA 35C8H 2DL2A 3ULSA 4R6UA 3P0YH 3EHBD 3E6HB 4OZIF 1U42A 5DLML 3TBVA 1UWEL 2G9HA 3RTQA 3TO4D 4BH7B 2BVQA 5IFHH 4ZO7A 3KPSA 4I4WB 5ADPL 1B0RA 4JZOA 1ND0B 3ELAT 1S7TB 4WWKD 3NZHH 4UV4H 1MQKL 2FX8H 3QWOB 2X9YA 4FQ1H 4KZDH 4XMLL 3GIZH 5FYKD 1SM3H 1MI5D 1AGEB 1AGFA 1O0VA 5DD5L 4GH7B 4MD4A 2FSEA 4ODWB 3UEZA 4E5XB 3RL1B 4IDJH 1E4KC 3V52H 4AJ0A 4WWKC 1WWAX 4POYA 1OPGL 2R15A 3EDJA 4JPKH 4BZ1H 1I3RB 4UB0H 5EC1B 1NCNA 3MLWL 2F54A 1CE1L 2GFBA 4NRYB 3UTPD 1QLEL 4N0FA 3RRQA 5C09E 3BYYA 1N4XL 2ZP0T 1N59B 4EQ3A 1A6UL 5FOBA 3GGWB 2H26A 2I27N 2VIRA 4MQSB 3HMXA 4WRLA 1QLRA 3TLRA 4JDZB 3IDYC 3IXAB 4APQD 1NCTA 3SDXA 3N0PB 4ZOBA 5CSBA 4U1KB 1MREL 4MDIB 2BVPB 2FRGP 1J5OH 2VQUA 3EZ8A 1DLHB 3OKOA 3MCKA 3HS0A 3H7BB 3OR6B 3QIWB 3PWPE 3U30B 4XC3H 3IFLH 3PWNB 4JHWL 2PW2B 1MVUB 2EDDA 1JZ5A 5FO8A 3U83A 2PW1A 2PYFA 4HC1L 5KJRL 2RCSL 2Y07L 32C2A 5E08L 5JPMB 1K4CB 4PJCE 1PG7W 2FO4B 4NM4L 2WP3T 1P6FA 1HWGB 4XCYA 5IEKA 4NHUB 1HZHL 4UDTB 5DR5H 2AJYH 4WW2A 3KPNB 2B2XL 2W07A 2F8OA 4R8WH 3WCYA 2DWEA 2AXFB 4O9HH 2DF3A 5L9DL 5F88A 3QWOA 4D0BA 3Q48A 4OFPA 5EU3A 5EU7E 5E6ZA 2OZ4L 4P2YA 3QCVH 3OX8B 4GUPA 2UUDH 5BJTB 5FHBH 4FABL 4E0RA 1PG7H 1OPGH 2V5TA 3EW3B 5DJXA 1QSEE 3KLAB 1BBDH 1YMMB 2P48B 4PRIE 5HGAA 4U1SA 3SGEH 1A3LH 1CE1H 5C0BA 4NRXA 1KIQA 4G6AC 1NJ9B 2EDHA 3RL2B 3SGEI 4CNIA 5HSFA 2AK4E 4RIRA 3KLSA 4LPYA 3W11C 1YY9D 1FNEB 4S1QL 1FBIH 1JGDB 2YPLE 3H7LA 2AJ3A 3M17A 4NQSB 4GG6E 3R8BB 1J8HB 4G5ZH 3L3JA 5C9JA 5T3ZD 2XI9A 2FCBA 1CGXA 3JWOC 2NY3D 1N64L 5FYKL 2DD8H 5EZJB 4UV7H 3S35X 1XGTA 3HAEA 5CHNB 4MA8L 1AE6L 4NT6B 4BA8A 3E6HA 3MOAL 1JK8B 1YDPA 3T2NH 1EMTL 1NGZB 4R2GC 4WDIA 1QACA 1UXWA 4FQJH 3QFDA 1QYGL 4BQBA 1CN4A 2DYPD 4XZUA 2CLVA 3V7AG 4PD4K 3SE3A 1A9EB 1AC6A 1JIBA 3E6FA 4KVNH 3TT3L 2ED8A 1WGOA 3NTCL 5FA4B 5JDJA 3GMRB 4X4XB 1BZ9B 2D0HA 4YDVB 2P5WE 1DSFL 5GSVA 3KYNB 3G6JE 1HDMB 4JPWH 4X4YB 2OMNA 3FFCB 2ATKA 5DMYA 5A3ID 2AP2A 2BC4A 1WAAA 1B6UA 5FOBB 4NQCE 2B2XH 4TUKH 4L3EA 3H8NA 1XCQB 5I1AB 1Z3GH 1YEHH 3RVXD 2VL5A 2JIXB 1OT2A 1VA9A 5IMOA 1F02I 4KVCL 4NJAH 4KTEL 3NAAL 4TNWF 2ZUVA 5BMFH 2AW2A 4YDLC 5B38G 2EC9U 5EU3B 3ARDC 1NUDA 3O8XB 5GGRB 5EO9A 1HNGA 5C6WH 1RK0B 4IRJB 2FHCA 4W4NA 3BQUB 2GT9B 4Q6IC 4ALAL 1HQ4B 4PJHF 5IVXF 1RQ5A 3BRGC 3W0WE 1S5HB 4TUJA 1P84K 3V4PL 1YN6A 4L1DA 2JK5A 1INDH 1EH9A 5DHYB 1U8MB 1DQJB 4JR9L 4U1NB 4ZPVB 5D2LA 1GOGA 3NCMA 4JG0H 4DK3A 4DOHB 3CJJA 4OGXH 4EJ1C 1KLGB 4PJFA 3RIAF 4ELME 5HGBA 1RUML 3RU8L 4TRPL 2X4PB 3NN8A 2ZCHH 3LRGA 4G80A 5SX5H 3BAEH 5EZJA 3PWVB 3T0XA 4OCSH 4PRDA 2P5EE 1D3CA 1QYGH 4Y5XB 3TJHC 3U4BH 1S7XA 4K71C 1ZAGA 5HHOD 3VFSB 4Z7UE 3VRJA 1C1EH 1F4AA 4OF5A 1UM6H 3EDFA 4XCYB 5D1ZC 4RMQA 5DC0A 4JFEB 3DIFB 4X5WA 5IG7B 5ABDE 3SDXF 4C56E 1C12B 4PRAA 3BISA 1F5WA 3GO1L 2CQVA 1KJVB 4PTUB 1ETZB 1FL6A 1FYTB 2HP4A 3SO3B 1IZKA 4PTTA 4RFNC 4PJDE 4DKFH 4O2CA 4PJAF 1FDLH 3CUPA 3F8UB 4K7FB 5T3ZL 2FGZA 2MTPA 3DECA 4LCYB 4EEEA 4O2FB 5C0CD 5DZLA 2VDPH 4LSTL 2C7UA 1JGDA 4GKSB 3G6DH 1G6RL 4PRID 2HJFA 4L9DA 4WFHE 2XOTA 5FFLA 4XBGA 2O5XH 2A77H 5J1AA 2V17L 1HXYB 5T1LB 1R5IB 2WIIB 1WVZA 1MWAA 3T4YB 3P9MA 3O0RH 4NN5B 2Z4QB 4XTRC 5LGHL 1BQHB 1MI5B 4NHCL 4YGVA 3C9NA 3JUZA 5E4EB 3IFOB 5EOCH 5FXCH 3QIBC 3RVUC 3IDJA 4XWOC 3HE6A 4NYLB 1EPFA 3O6FD 1NGPH 2R29L 2Q6WB 2V2WA 3DVFA 4B41A 2C3HA 5C7XH 2X4SB 1U36A 4JQIH 4V1DD 2UWEE 4AY0A 3EKCA 3O9WB 3WLBB 1OLZA 3U0PB 1AXSA 5BV7B 3NIDF 1RURL 2KZ1B 3BMWA 3M8OL 4Y2DB 3T0BA 1A7PH 1FVCB 4RNRB 1S3KL 3WFDH 4WO4B 3ZT5A 3KPMA 1T2XA 3L95A 4XP4L 5CD3B 2IAMA 4DQOL 4U1LB 5CCKH 1AHWC 3GO1H 1U8KB 3KYAA 3NIGE 1XH3B 1I7ZA 1Y6NR 5H37H 4QRPA 4EN3C 4P3WA 1JPGB 1JN6A 1ND0A 5CJOL 4YDJB 2VDNH 3DVIA 4IOSD 5ALBH 3RNKB 1XF4B 3EYVB 4XPBH 1L7TH 1RU9H 2M2DA 1T1ZB 1NDMA 5IVXE 5IQ9A 4QWWD 4OLXH 1DQQA 1S7RA 5SWSE 2PYEA 3S96A 3MV8B 1KIRB 4OJFL 4DKFL 4NKMB 5IBTH 3FCTA 1J8HD 3VFVB 1XF5A 4OFKA 5GXBB 4PJ7E 2YUVA 1UT9A 1ACYH 5EC2A 3SBWC 3VWKC 4AK1A 3QG7H 3TBWB 1IKNA 4OM1H 3WO3B 5L2KA 1VESA 3VXNA 4HZLB 4LLMB 2YUXA 3BHBA 5HI3D 4Y19D 4JQVC 1JYNA 3ALXA 3D39D 4BH8B 4M6NH 5C6TL 1JPFA 2I9LB 2H26B 1U8HA 3UAJD 3JXAA 4ZFOB 2DQCH 1T4KB 4WHTA 3DYPA 3QXAA 3W39A 3BP7B 1YPZA 3LCYA 3OL2A 1OAYL 4DVRH 1OVZA 3TBVB 2G9HB 3RTQB 3T04D 5ACZA 3RA7L 3NBNA 1JZ4A 3RWGB 4XNYL 4I3SH 4LOUC 5IMKA 1FBIL 3IKCB 5FYJU 1HHKB 1ZHBB 1P4LA 4QTIL 2ZCKH 4UNTA 3TNNB 3WFCH 5BVJA 4Q6IB 4R90L 3M1BA 3FFCE 2Y36H 5DGRA 2X70B 3PWNA 5JW4N 1ZE3C 4JO2L 4C4KO 1I8MB 1XGPA 4OGYL 4QT5B 3P9WB 4M7KH 5DRZB 2VDKL 5DEFA 3U9PL 2FIKA 5LWYL 2VQ1A 3MJ7B 3L95B 5E1AB 5AEAA 1Z9MA 4WJ5A 4ZS6D 3I75B 1UB5A 1WBXB 5IKCB 4NC2B 2HJKA 1V05A 5IHUH 5F8RC 4YNYA 4HK0A 1UCTA 1LWRA 3MRBB 1J87A 3UPAA 1IFHH 3QUZD 4N68A 1KB5L 4OBRA 3T65B 4HKXA 1ZVYA 1ZT7A 3EFDL 1LMKA 4JKKA 4OLWL 3FO2A 2ZPKL 1LEGB 5KS9E 2BSSB 3TBYA 5I8CA 3V7MA 4P2QB 1UACH 5MENB 4FQHA 4LIQE 1GGBL 1U8NB 2ID5A 5I1LA 3T0VA 5IB2B 2H6PA 5JO5B 4F7PA 2FX9H 3MLVH 2HTKC 1NAML 2BVTA 5DRNA 4NO2B 3HN3A 4WW1B 2APFA 15C8H 4ODXB 2DYPA 1IC1A 5ICZB 5GZNC 2BXZA 2FYYB 5EA0H 2AJ3B 3M17B 4NQSA 3CDCA 2XZCH 4HIEB 4PG9A 3E3QC 2CR6A 4L8BB 2BSRA 4RBPK 4FZEH 4MXWL 1C16B 4PJEB 4CDHA 4DEPC 5CEXA 4O51B 3A67H 4GW5A 3HE7B 4C58B 3HR5B 1JF6A 1A4KA 5CFHA 3QDGA 5TQ2L 5K9QG 5ERWA 4K23H 5BW7A 5SV3A 4BSJA 3PNWB 2EDWA 1BQLH 3P4NA 3QNXB 4RWYL 1ZWIB 2WQRA 3FO1B 2CR3A 1DQLH 4HIXH 1S7SB 1U3ZA 5E5RB 1CICB 1ADQH 4X99A 2XTJC 5GGSA 2PUQT 3MQIA 3VFVA 4XAKE 1UB5B 2AEQL 4KK5D 3ES6B 3OR7B 1OGTA 3PXHA 5GJTL 4X7DC 3MMEA 1AHWB 5J8OA 1JZ6A 1HIML 1MAML 1NGWA 1G9NH 2IAMC 1YYLL 4NSKB 1U6AL 1M7XA 1MAKA 3F58H 4MA1C 3RGVD 1WT5A 5FM5M 1PZ5A 2P8MB 5EB9A 3HI6L 2O5YH 4QHUA 4KK5C 5KSAA 2PXYC 1GGBH 1FYTD 2MJWA 4NKDA 3MJ6A 2VZ3A 4JRXE 1UA6H 5CHNA 5D7SH 5KVGL 1PY4A 4GAGH 3FQXB 3BP7A 6CGTA 2J5LB 1NAMH 3WIHH 4YPGA 2R1WB 5J89A 3DRTA 5ENWB 4LCUA 2UWEF 3CVIH 3NIFE 2A6DB 3U1SH 5GRUH 1EA9C 3B5TA 2ZKHL 1JNLH 4NO2A 2IMMA 4XNXH 3RGVC 4IJ3C 3UYRH 5CJ5A 3VGBA 1ZA6B 3HZMB 1HH9B 1CLOH 3G5VB 4HWUA 4ODSL 5JW5B 4PLNC 1BZ7B 3ULVE 4Z7NE 1I3VA 4X9HA 4YBQD 1EJOL 4X6EA 3ZHLA 3MX0A 3RIAK 2R9HD 3MRLA 1WC7B 2LAAA 3G9VA 4RGNB 5IR1B 2GSIB 1O5DT 2H45A 1KBGH 2D4FA 3MXWH 2IPKA 1N6QL 2AEPL 3BXNA 3P4OA 1XZ0B 5HDOA 1FFNA 2FECI 1KYOJ 2VZOA 2AKRA 1KV3A 3TBSB 1S3KH 3IDGB 3J8F7 4OT1H 3MRBA 1D6EA 4HUXB 1KJVA 4LSSH 4U49A 4LLUB 4RBPH 3HAEH 1J0HA 1CICA 4J3OC 5C6PB 2VOTA 5E8OA 1YYLH 2J88L 4CUCA 3VD9A 3CPLA 3KPQA 4CW1A 2P8LA 2IEPA 1Q9KB 3HI6H 1H3VA 5E00B 2CH8A 2EE6A 5JO5A 4MS8C 1HIMH 4UILH 1BBJB 2Z31C 4NO3B 3MRJA 1A9BA 1QG3A 4HDIB 2XYCA 4KRMB 3QRGH 3OG6B 3QIUD 3QI9D 4MDIA 5BXFB 1FVEB 5DWUH 3I2CL 1AGDB 4Y19E 2WINA 3T2QA 1CFTA 2W59A 3R0MA 1MRFL 2Q7NA 2Z31D 5A2IH 1QNZH 4P4KC 5IW6B 3T0ED 3TFKC 4P2RA 2FBJH 2NPLX 4U2ZA 3MGOB 3VXTA 2WUCL 3HZKB 5IBUB 4U6YA 5INCA 3MV7E 4PGEA 1H5BB 1IKFH 1FPTH 2HN7B 4BQ9A 4X8XA 3QJHB 3IGAB 4O00A 3QR2A 3V7AE 5E5MB 4WO4A 2JJWA 5FDWA 4Q2ZA 4EIZC 3BJLA 4JQIL 3ZE1E 3T0EC 3BDBA 3UZEA 1VGEH 4I48B 5E8PB 3BP5B 4DW2L 4F7EB 1N7MH 3AAZB 5F96L 3VWJB 4GKSA 3VXSE 4WFED 3V5DA 1IGMH 1MF2H 2H2PC 3P2TA 4YC2C 5HYIA 2NYYC 2VLRA 4R26L 3K4DA 3EYOA 5T3XE 5ECJE 1VPOL 4Z0BL 5HVFB 1IGYA 3OQ3B 2EZ0D 1EGJA 4LDLB 4CRPA 3DXAB 4M62H 2Q7YB 4QOKD 3K7UA 2FEDD 2AABH 3TPKA 5C0AD 3WUWG 4XXDB 1BQHG 2KBGA 1X5ZA 4KMQA 3MLZL 5K59F 3OWEA 3ZDYE 4YHPB 3GJEA 4POUB 5F71A 4ZOAA 1QFOA 1IGJA 3RY5A 4WFFE 5FEBA 3V0AC 4Z7VE 3QIBB 2COQA 1TCRA 1KELL 2B5IB 4OFYA 3U0PA 1Q9OB 3TH3T 3L3GB 3LQMA 2XRAL 4U1JA 3U0TA 4HW6A 3RWJA 2FGWH 5KN5B 1F00I 3QXAB 2DD8L 2BVYA 1MCJA 2V7NB 1EZVX 5I1DB 1K85A 4U6HB 1ERNA 2QQLL 3DX8B 1BEYH 1UH3A 2FX7L 4P5KB 4MMXC 4F37F 2I25N 3X17A 4YHNB 2VLKB 1S8DB 3UTTA 1BIHA 1VFOA 1BZ9A 4J1UB 4PLOB 5K59E 4DVRL 2DQHL 3TBTB 1S9KC 5JLZA 4KRPB 1YEKH 4U6YB 5C1MB 4B7LA 1VADA 2LAGB 3VFGH 4JVWA 4I3SL 4NO0B 2DIAA 2OTUB 3HZVB 1IGTA 3W11D 4K94H 5IT2L 4HUMB 2XZQL 4A6YL 5HGAB 4U1IB 4U3CA 4LLUA 5LXGH 2ICEA 4UZGA 4K23L 5I1HH 1W0YT 1CL7L 3HLAB 4ZPTB 5DMKA 5KOVC 4J2XA 4WY7L 4LCIH 4X5LA 3SKNA 3GI9L 3EYOB 4K8RH 3ARWA 4Y16A 4G42A 2EDBA 1HILA 2FWOB 2HRPL 3ARFB 3DV6A 4HWEH 3HAEB 5FV2A 5LCVL 1CGWA 5GGRA 1RU9L 4PJGE 5DFVD 3SDDC 4WTXA 4PJHB 4S11A 1B88A 2E6PA 4YGAB 1CIDA 4NOBA 3DRQB 2OR7A 4NGHL 4QHLA 4OQTL 1NSNL 4QRRE 1QVOA 1RMFH 5KVGH 3HC3H 3T4AA 4JREC 1H5BA 3EOTL 4YHKL 1CR9L 2XY1A 2AJZB 3BIAX 4F7MB 1GGIL 2NNAA 3VFPA 3QEQE 3BEWB 5L2KD 4PGCB 3EOAA 3V95A 2P24A 1FGNH 3KGRA 1S78D 1UWXK 2MPAL 1YPZE 4QNPE 1P9MC 2YD2A 1P7QD 1LGVA 1YUHB 1JNHB 1MEXH 4Y5YA 1WSST 1ZV5A 1EEZA 5ESAB 2VAAB 1VEOA 1YN6B 3IAQA 3G5XA 2DMKA 1DBMH 2PR4H 1BJMA 1NFIA 3OJMB 2AXGA 1EK3A 2BSTA 4PJ7A 4HCRH 4M9OA 4Y8DC 1RD6A 3VWJC 4UUJB 1A2YA 4G9FD 1JMZA 2OTWB 2NR6C 5DK0A 2A9ML 4XC1H 5BCAA 3C09C 2HVJA 2BVQB 3MLUH 3LPWA 3S8WA 3TP4A 5AG9A 1UC6A 1LE9B 1LHZA 4HHAB 1HH6B 2NXYC 3GHBL 1EO5A 4GG8A 4LCUB 5AZEL 3HE7A 2R2EB 4LSPL 3QHFH 3Q3GA 5D8JH 3FHQA 4F8QA 4P5TC 4CGTA 3HPLB 1KULA 4OZ4A 1R3IH 3S34L 5FGRA 5IVOA 2PTTB 4OD1L 4NQVB 3U7WH 4D9QD 1RUMH 5E8EA 4FQ1L 4X80L 3O3AB 8CGTA 3H9SA 4XMPL 3VXSB 1EEQA 4X6BB 1QO3B 4F33B 5JOFB 4TPRL 1OWRM 5EO0A 3RNQA 5IMMB 3ARZA 5F6HI 5L8LB 4YIQB 1YC7A 2VXVL 5AD0B 2XZCL 4MNQE 4IEFB 2P7TA 4PP1C 2ZJSL 3FONA 4RDQG 2X4RA 2PYEB 2CXGA 3NGBC 1GOFA 3ILPA 4G3YH 5HYJA 5T1LA 3HNVL 2HVKA 2EDNA 4P2OB 1SY6H 1OTTD 2G60L 3IFLL 4LDEB 1PKQB 1DANU 1CD1A 2GQHA 1BFOA 2WWMC 4JM4H 1OAKH 3W5MA 1OQOA 3KHOA 3DOSA 5L8JB 1IM9B 3Q5OA 5FDYA 4H1LH 3TIEB 3BHBB 1QSFE 3ROLB 5C0NC 3P4MA 3T77A 3DBXA 1T0PB 1SHMA 3TIDA 3VCLA 1S9YB 2BVPA 3UTTE 1YNTA 2JCCA 5DDHB 2WWMD 2WBKA 4Y5XC 4G6KL 3CH8A 1JGEB 3MCKB 1UADC 2R23A 3FQWA 2H2SD 2MCPH 3TZVA 5I1IH 5IB1A 1GZPB 2KL6A 2X7LB 2AJSH 3ROOB 4MQXD 1WWBX 1EVTC 1KNOA 1TTGA 2IF7A 3MBXH 2V6HA 4YEFA 4ZFOA 3MRHA 1E0OB 1P4LB 1G7JA 1Q9WB 4J8RB 4P46B 4ZO6A 2BY1A 3SDCB 1IM3A 3M45A 1KEGL 2R2EA 2ILLA 4Y16C 4Z7VA 4JO3L 2H2SC 2BNRE 4OZ4B 1QFWM 1H3PL 3SDDB 2PTTA 5C08B 1EUUA 3ULUE 4UQ3B 5D1QB 2FO1A 4MJIB 5DJCA 3WIHL 5ILTH 5FGCB 5GIRB 1JWUB 3HRZA 5J1SC 2VQ1B 4I8DA 4PJFE 1R6VA 5E1AA 1RVFL 2Z35A 4HPOH 2F74B 2ZKHH 5AYUH 4P9HL 4UNUA 2XICA 3QEUB 4CVZB 1N64H 4Y0GA 4OF8A 2EYSB 4YIQA 5MEPB 1AD0B 5BZDB 2DQHH 4JVUA 2ZWLT 1VACA 3ARXA 3L3OB 3AGVA 3L3HA 1BBJA 3BFOA 2NY0B 3FT3B 3N50A 4MX7A 4CU6A 3OKEB 2VB5A 5MENA 1O7VA 3HE6C 4B50A 4PLKD 3BN9C 1CK0L 1UM4H 5CJQH 5DRNB 1SEQL 4FXLA 25C8H 3ARPA 4AYFA 2MMXA 4OT1L 5HDBF 5I1IL 1R3KA 1OCWH 3HAEG 1BVKA 1G9MH 3UTTD 1ORQA 4KDWA 4D3CH 4YXKH 4OLWH 3IU3A 3LPFA 1A5FH 3U6RB 5I1JH 4ODXA 3HMXL 4F7TA 2CUHA 1XGPB 1J11A 4QT5A 5DRZA 3X3GL 3TA3B 5JOEA 1T0MA 4PY7A 4FZEL 1A22B 2BVEA 4WV1C 1IC4L 4M6OL 4GW5B 5GRJL 1IL1A 1LK2A 3ARFD 1NFKA 4WUKL 1FO0L 5AYQA 1GC1C 2HJKB 2VDRL 3VWJA 2NY7H 3F62A 3WFCL 4I4WA 4J3TA 1NANH 5TDOA 5L6YL 3H3PH 4YAQB 2G75B 4QGTA 1NANI 1UB6A 3MA9L 2WNGA 5HI5D 4LSDA 4KVCH 3ZE1F 1NCWL 1N5YH 4LEXH 4ZUTA 4U0RB 5DJCB 1RZIB 1JNJA 3GM0A 4KUZH 4OUOA 1TZGH 4G9FB 1E27A 3OAYH 4PJ5A 4MD4B 4NO0A 4JKLA 3QNYB 3GUTB 3VRLE 2VRAA 5FYKU 3QEUA 4CVZA 2R0ZL 5IB2A 5CIPA 4M7LL 5D1QC 5J4MA 1CFVH 1I8LC 1QRNB 3LY6A 1UEYA 4GKNB 4L4VB 4I2XA 3B6SB 1RZJH 3EFDH 3WNNA 5H8DA 2FIRT 1QSEA 4JR9H 1CLCA 5HD8C 4XPAH 2A0LD 3U9UA 5TQ0H 2C1OB 3S37L 1BOYA 5E94A 1T04A 3QUKB 4HKZB 4HX1B 1QFUL 3RU8H 4ZUUA 1IGML 1MF2L 4I18B 5HGDA 1SEQH 4NQDB 2IMNA 3EOYG 5HGBB 1A5FL 2EIZB 1FC2D 4LCIL 3GSOB 3GRWA 3MXVH 5ITFA 1QSFB 5DXWA 4U05A 3STLB 2L4OA 1T1XB 3LKOB 3S4SB 2VLRD 4PJCA 3MLUL 3N06B 3OKDA 4JFDE 2IG2H 4GG6F 4J3SA 4OLEA 4LIQH 1PLGL 2E7LA 2P5ED 4PRHD 4D9RD 3BZDA 3MJ8B 1PFCA 4G8IB 4JFDB 5TF0A 2X05A 1DVFA 1I8KA 1UH2A 2NTFA 1YEFL 1MFEL 4NGHH 5HYQB 2IAMD 4R7NB 2IPTH 4I77L 4F7MA 1NBVL 3HLAA 5C0AE 5DQ9A 2XRAH 4WFGE 4LVEA 1MFAH 4EI5C 3UBXB 3B2UC 3REWA 4JGJA 2GJ6D 1GXEA 1V7NL 2CSPA 4WCYL 1MRCL 4YGVB 3SDXE 4L5FL 2X4OB 1BFSA 3BPOB 4YDKL 4QKXB 4ODUA 4PV9B 3TESA 2GTWB 5E4IA 4WU5B 1L0XA 4DAGH 4EI5D 2B1AH 3MSPA 2Z4QA 1QRND 4O2EB 1V3JA 3QJFB 1U41A 4JDVB 1LEIA 3ARBC 1QRKA 3DROA 1A0QH 3T0AA 1UWGH 3KPPB 1WZ1H 2VWEE 3C60D 4L8SA 3KNBA 2VLJD 4F7CA 5ISZE 4HLZG 4M61B 2IFFL 1MCNA 2JJTA 1M7IA 4R4NC 1IQDA 5DI8A 3VFTA 1L9MA 2N7BA 3JTSB 4JPIA 4U6XA 4HAFA 2K7PA 3EO1B 3VA6A 5IHLB 3OXRB 4QRPB 4LEOB 4KZDL 3QIUB 4TNWK 1FAKT 3QI9B 4RNRA 1F90L 1QSFD 4LLAA 1OF2B 5FKAB 1Y18A 3E1F1 4YR6B 4P2RB 2D03L 1MHEB 2M26A 3GSOA 3MTRA 3SGJC 4Z7UF 3DUHA 3MNWB 1DQQB 1K6QL 4Z7QF 3ZE0F 2CDFA 4X98A 1TJGH 1WBZB 3BEVB 2G5BA 3LS5L 3PDOB 2ESVB 2XPGA 5C70A 2B8OT 5FDWB 1G0XA 4JFOB 1K8IA 2JJTC 3NOIA 2WBJB 3ZE0E 1QRNA 1P1ZB 2HN7A 4L4VA 1YEIL 5ICYA 1UGNA 3FKUS 2Q8AH 1M4KA 3VH8B 4J3WA 1AJ7L 2LQRA 3CNKA 4JKPH 4I48A 1UEMA 3SDCD 1A7NH 5FUOL 2DJUA 5IFJB 2ITDB 4M3JA 2JCCE 4PB9L 1HWHB 1TPXC 1QFHA 1ZVHA 3D9AH 4XP6H 1TQBB 5ANME 3O8XA 5HHNB 4S1RH 1CD1B 1QSFA 1FNAA 3HC4L 2VDQL 4HUWA 1IEBB 4FQXC 3U82B 4ETQA 4I0PC 1CLYH 4ZUUB 1UYWL 1JCKA 2CRYA 3WKML 3GHEL 5TDPA 2DTMH 3GMLB 4GAYA 4XPHH 4KI1A 3KYMA 4NM4H 5BOPA 4KROD 4WNQB 3H0TA 3STLA 2G5RA 4LKXA 5DUPH 3TWCH 3PG2A 3WKNA 5GGTA 4PGDB 1IGJB 4FQXD 2P8PA 3FRPA 1IT9L 4HIJA 1G6RH 4UDUA 3NCYS 5J11C 2VDML 4PJXE 1J1XH 4JFXB 1BJ1J 4MQ7A 3STZA 4OZHA 1A7QL 2AI0L 2NTFB 1PBYA 3MA7B 1SJEA 5ALCL 3QFJB 2GTZA 1W8NA 3QDGD 4XCNA 3B2VL 5JMRA 2WV3A 2DLFL 2XWTB 4H0IA 4P5MB 2HG5B 1KCUL 1EHNA 4UTBL 1ULVA 4D2NA 4AL8L 5CUSL 3LDBB 3VD4A 3TBTA 2V2XB 3FOLB 3PWUA 1FFQA 1HE7A 5ETUB 3UC0L 5A2KH 1ZANL 3I3DA 4HS8H 3O2VH 1FFPB 5JXEC 2DIBA 4U31A 2WBJC 1RZ8B 1RVFH 4HPOL 4WWKA 1VGKB 1FNSL 2DQGL 3S5LA 3GI9H 2EE3A 3QCTL 3P40A 1T7YA 4QRPE 3RAJL 2D7TL 1F97A 3SDXB 1C08B 1IAIH 1Q0XL 5DD0L 1NGYA 3HR6A 1MLCA 4S1SL 2GSGA 4JM2D 1MCIA 3S9DB 4U6HA 5E2VH 5E6IB 5EBWA 1SBSL 5DJAA 3GSRB 3MRHB 1XFPA 3GNML 3LZFL 1MY7A 4NZUH 1T1YB 4F57L 4E42A 1Q9WA 3VD5A 3KPSB 4S0TD 4OLUH 3QNXA 5B3JF 4U1HB 5I15L 1P84J 1QSZA 2MWCA 3KAAA 3OMZA 5IESH 2JJSC 3V5HB 1R0AL 3QQ9D 3MV11 2CIIB 4JRYD 5EU7C 5F7WC 2ADJB 2UYLB 2PYFB 1NMAH 3QZWA 2IADB 5HYJD 1U95A 2FO4A 4P23C 3LRHA 1H3UA 3C8DA 3HG1B 3FO1A 2ENSA 1ZS8B 4XHQA 1IEAA 3U46A 1NGWB 5H2BA 3ULVC 3MRCB 2DLFH 4LKCB 3MRIA 1YEKL 2X1OA 3UJJH 5GS1A 3UC0H 5F7KC 3V4UH 1R3HB 1KSRA 3V4PH 12E8H 4NNPH 5LAXB 4XX1G 3NCFB 2YC1A 5GZOD 4D9LH 3DV6B 4ODHL 4A2LA 1RPQA 4X5XA 1FL3B 1GHFH 3QIWC 1NJ9A 1LP9B 1EFQA 5ID1B 2XG4A 3IAGC 4KUCF 5J6HA 5EUOB 5ACLA 3IVKA 2P44B 1EXUA 1DFBL 3PHQA 1F13A 3MXWL 4L4VE 4I2XB 1N6QH 2IQAB 1WBYA 5LWYH 4HT1H 4K3DH 2D4DA 5GZOC 3C08L 4ZD3H 4Z7UA 1CDCA 4NQEA 4Y4KA 1EEYB 2BSED 1NAKL 3AXLA 1DCLA 1AI1H 5SWQA 2BOBA 3BIKA 2CIKB 2XXMB 4MSWA 3O6KH 3EJZC 3W39B 32C2B 2DKUA 3TJEH 3UTOA 3FT2B 1AP2A 1G7PB 1YA5A 5ID0B 2C3VB 3DGGA 1QA9B 3ZHDA 1XGYH 1D5IH 1KG0B 3V5KB 3CZFA 3L6FA 2YEZB 3BE1L 1D6VH 5C0EB 1DN0B 1JVKA 3M1BB 4UAOB 1RULL 2BVOB 5L9DH 3O11B 5DVMA 1IZJA 1UJ3B 1RZIA 2YN3A 3AREA 1F3RB 4M93C 4UTAL 2BY0A 3I6LE 4JRWA 1Q9KA 2F19L 3CU7A 4GBXA 4AIOA 2WBWB 2LABA 2FJFB 4LFHG 5D1XC 5CD5D 3ZKMD 2Y1VA 4QRPD 2XA8L 5I1CL 2EYRA 3B9EA 3HNTH 1QQDA 3BPNB 5F7EH 1OM3H 3VXPA 3CDGB 4PJHE 3L3IB 2O61A 1TZHA 5EUKA 1NFIB 4XXCC 1A6VH 1JF1A 5DVLA 1MCPL 2FL5A 4NNXA 3AS2A 4JB9H 1F6FB 4NQCA 4OLYL 1BIIB 5D1XD 2YA2A 4MAYB 3IDNA 2BSSA 4RGNE 2UZXB 5DZNA 2HAZA 1BQLL 2LV4A 1NCCH 2ED7A 3I2CH 2X4NB 4KK9D 2P5WA 3OPZH 4ZNEA 3V5HA 3LVEA 3BH9B 2FD6L 3CDFA 3FT4B 4OFDA 3TO4B 5C07E 1QBMH 3UROR 2B39A 2EICA 4E42B 3TNNA 1WBYB 4HJGB 3P4MB 5C07B 2FYYA 1T5WB 4JPVL 1BP3B 4L4TE 4QXTA 5CJOH 4ZFZB 3VI4E 5IB1B 1G7QB 5KANG 5GPRA 5A1AA 4FG6C 1NEZB 4AEEA 3KLHD 1CFVL 3VXSA 2YPVH 3GBMH 1N6VA 3O41A 4JFDA 3RWCB 3ZKXC 4YX2L 3LQAC 1XMWA 3IDXL 1CS6A 3K8LA 4NWTL 4XPHL 1QFWI 5IKCA 2OL3L 4XNQB 1M71B 3LKSB 2Y4SA 2MFNA 2GIYA 4P46D 1QTYT 2E9WA 4NFCA 1LNUA 3RY6C 1KJ2L 3KWWB 1RZKL 1TJHL 4ZAKA 4J8RA 3SDCA 1FNHA 1YNKL 3T65A 4W81A 3WUWA 1I3GH 5C0RH 3MRGA 4YHZL 3QA3A 2R4RH 2EDLA 4K9EC 3WIFB 4PJBE 3SY0A 4E41D 1LK3L 3MODH 4P59H 3UX9B 1UXWB 3KJ6L 5C2UB 4QRSA 2DM4A 4BM7A 2HLAB 2N7AA 4JFED 1RZKC 3H2WA 1QD0A 1EXUB 5J7CC 4OTXL 5TPWH 1MCKA 3PL6D 2G60H 2CK2A 1E6OH 2R23B 2J8UF 4D8PA 2DDQL 5TE4H 5TF1H 1QKZL 4Y16D 2EDYA 2GY7B 2VLMD 3N9GL 5C0CB 4C55A 2FD6H 4HMCA 1YY9C 4UIKL 3WXWL 1N0XL 4OCSL 3MO1B 3PHSA 3OKLA 5JPNB 3DGGB 3VG0L 3P4LA 1OP9A 3NABL 4TRPH 5FM8A 4ZFGH 4UINL 1S8DA 1Q94B 3UTTB 4AEIL 5C07A 1NH6A 3RPKA 1KJMA 5TE7L 4WI6A 1F11B 3I85A 4PP2A 1KJ2H 4HF5H 5I1KL 4F15B 4M5ZH 1Y6KR 1QBLL 1EIBA 3FQUB 5HPMB 1JPGA 2OL3H 1NUGA 2C7UB 4GQPH 3HE6D 3WJJA 3DETC 3BN9D 3ESVF 1M6OB 2OR9H 1NGQL 1K5NB 3FT3A 1J1OL 3GK8H 4J4PA 5D2NB 2Q8BL 1TMCB 1J1XL 4OQTH 2GJZA 1RV6X 4OF7A 2W9EL 5D1ZA 5HHPB 5L2JA 3IU4H 3W9EB 1FAIL 5DUBA 3DETD 3WS6C 4WFFD 5GS2H 2Z31B 4WEBL 3OKOB 3B2VH 1UJ3C 2F9BT 5FO7A 3WIIL 1L9NA 4QHLB 3PWJB 4BSWA 5HPOA 3GSQB 1TDQA 2VLLB 5DA0B 1EZVY 1CDJA 3A67L 4JCLA 4XI5C 5GS0L 4WHTB 1YJDC 4Y2DA 3AS3A 1RMFL 3BPLC 1OTUC 3PWLB 1NBZA 5EIVA 1I85A 1S9WA 5KZCD 4HXBH 5IMKB 1SVCP 1CFTB 2IAND 2I9TA 2BNRA 1YEGH 1OCWL 2HT2C 2QBWA 3ZT7A 2IH1A 5FCUL 4NQEE 5DS8B 4EXPX 4I18A 4ZD3L 2NMSA 1FNGA 3ULVL 4YQXH 2AXHA 2DQFA 3E8UH 3L9RB 3QP3A 2C3GA 5E6YA 4L8DA 5J11B 3B9KB 4JY6B 4DZBB 3WD5L 3TBSA 4XBGB 4FTVD 1ZOXA 2V7HA 1YUHA 3SY0B 4AENA 4LNRA 2VXTH 1C5DB 3VD7A 4LQFH 3MGAA 3MACH 1MWAB 3MV8A 5I30L 1JZ2A 5DC9B 2FNBA 3U36B 4KK8C 3WUWB 1J1OH 2EEDA 3GK8L 3AB0C 5FAAA 1DQMH 4MAUL 2K1MA 2QSTA 1RJLA 3KPQB 3HE6B 3CLFL 3Q6FB 3OXSB 5DFWH 4M4PA 4CVUA 1FE8H 1I1RA 3BIBX 3MREA 4BQ6A 1FLRL 4JHAH 1ZLSH 1OHQA 3GMPB 1J1PL 1MOEA 4APQB 4DUWA 3LKNA 1NGXA 1AKJA 1L0YA 1CDIA 1A6UH 2D31B 4H1LB 5GGUA 5CIPH 5D5MB 4OCNC 2WINB 4RFEB 2B5IC 5HHOA 5K9KB 3B9AA 3VXQA 4JLRB 2ED9A 2X4UB 1DBJH 4NT6A 2DBLL 1NFDA 2X9WA 4FTVA 4RAVB 3HI5L 2VISB 3F6LA 1MRCH 3DTXA 4XTRD 3H9SE 3QFDB 1F6AB 2B1HH 5AZ2L 2CIIA 1EGJL 1BM3L 4IRSC 3JV4A 1HDMA 3AVEA 1C5CL 2VITB 3TCXA 2YD7A 5KN5A 4P9MH 4XWOD 2H3NA 5I0DA 1AIFB 2BCKB 2IANB 3OKNA 4KTDH 4UT7H 3BVNB 4X6BA 2APTA 4Y1AA 5C8JB 1ZGLB 3QEQD 4OGZA 5JNYA 3E8UL 3FO9B 4JZJB 3FL7A 3L5XL 5T3XH 3D18B 5IJVB 2V7HB 1IC5L 2YKLH 3D3VE 4MWFB 4X6CB 2JIXA 1I1FA 1QR4A 1A4JA 5HYEA 2OCFD 4L3CA 4F9PA 4TYUA 5FO7B 2CRIA 1FHGA 5I15H 3KDMB 1LDPL 3RKDC 2Y7QB 1T6WA 5AUMB 4LLYA 3GSQA 4NBZB 4GKZB 5J0BA 3FAWA 4LLQB 2H32H 4X6FA 2ARJQ 5DWUL 1U8IB 5F44A 3L7EB 3BGAA 3DMMA 3VU2A 2WM0A 1KJ2A 4HEPG 4WCYH 1KEML 2ADIA 1D9KA 1QNZL 3TZVB 3RUGF 3LHPH 4OZHE 3D9AL 3MGTB 3MUZ1 1EVUA 3L3GA 4UI2A 4XP6L 4FRWA 2DQIL 3U4EB 2QL1A 2HFTA 1CTNA 3SQOH 1WCBB 3MRKA 4ONGL 1MFCH 1PEWA 5JORA 4PBXA 5AZ2H 2Z93A 5JQ6H 3EJYD 2X1WL 3TYGL 2X4PA 5C71A 2V5YA 1KNOB 1KENL 5K9OB 3SE9H 1YQVL 2PYEE 5SWSA 4JFYA 1CXHA 4RSVA 2YPLD 4JREB 5HDBE 4HJ0C 1R5WB 3G04B 5TQ2H 4GT7A 1EBAA 1DVFC 2FHBA 4QXTB 1D9KC 1UJ3A 3P77B 3E3QE 2EDFA 1BREA 4GMSL 4UBDD 4X6DF 1GC1L 3GB7A 2XA3A 5IROA 4KDTA 5ANMA 4EZMA 1XZ0A 5HGHA 4N8CL 1U93A 4IRSB 5IOPB 4K7PY 5C8JA 1JNNL 4R0LB 1ZGLA 2YUWA 4Y2DC 3QEGH 5C0GA 3QWRD 3QQ3B 1D9KD 2EYSA 1U91B 2IC2A 4PJGA 4RX4D 3SE8H 3TJEL 3EDEA 3D48R 4Y19B 5LGKA 1YPZF 1T7WA 3ARBA 4PJ8A 3ZT6A 4EUPA 3HUJF 2AGJL 2AS5M 4BSVA 4ZS6C 1K8DA 1I4FA 1K3IA 4OSUH 3T3MF 5I76A 5ADOL 5GRVK 4GQ9L 4KRNA 4X7SL 4NUJB 4B53A 3PP3H 4CN4A 3EUUA 3BW9B 3G9AB 4GRLA 3H6JA 5B22A 5F6IC 1DEDA 1KIUA 1KCRH 3RTQD 4Z78B 4ODVL 4HGWA 5LQBL 5C0RL 2ZG2A 1HSBA 3D0VB 1MJ7H 1VFUA 3KPRD 4HFWA 4XNXL 4LMQE 4Y5VC 1BFVL 5F7FA 4H26B 2OJEA 3DX9A 5F6HJ 2W0KA 4LVNC 1MFDL 5I8OH 4ODSH 3MROA 5I8EA 1U8QA 1AGEA 3TN0C 2IH3B 5F97E 3B3IA 3MJ9H 4RISL 3UTQB 1XGTB 3UYRL 3WLWC 2D7PA 1GL4B 4MCZB 2A83A 1UB6B 1MHHA 5GHWH 3MV8E 4C56A 5HHQA 2NX5E 3U4BL 3MUHL 5HHVH 4K7PL 4N0CC 5F7LB 4J4PD 3UTPE 3QWQB 4WI5A 3D2UB 4GKZA 4LCWE 1F58H 4YPJA 2D7QA 1VB9A 4G9DB 1X5AA 3PV7A 2QQKL 5ESAA 3SDYL 4OLUL 3TT3H 4N90D 1A6AB 1ZLWH 1D9KB 4NFBA 5D6CA 4LRIC 2IBGA 5D93B 2E27H 4FQCL 3UPRB 1CGTA 5FV1L 4M5ZL 4ODTH 4X6DB 1JGVL 2ADGA 2BFVL 2VH5H 4HK3J 5ACMA 2AJVH 2HVKB 1A2YB 4JZJC 4QRRB 2F58H 5EU6A 5CEZE 2Z8RA 4YBHA 2C4FT 1NL0L 2B7DT 2VO5A 4TSAL 4CVXB 5E99L 5F21B 3PDDA 2A74A 3ARYA 3O6FB 5DJZA 1JYWA 1NAMA 4GW4B 1YMMD 1FNFA 1BLNB 2IQAA 3NAAH 4OV5A 4KRPC 2ZUSA 4XBPA 4OZFG 3QEQB 4Z78A 1CYGA 1FNSH 3QO0B 3A0OA 3JSSA 5ID1A 3NFSH 3TIDB 3VCLB 1I9JH 2Y23A 1JPTH 3VXUE 4NZTH 2ESVE 2YK1L 5B3NA 4MJID 5CAYB 3QPQC 1NAKH 5F7MC 3SOBL 5F7UA 3MV7A 1P4IH 1QUNA 1JHKH 4XRCB 3P73A 3KJ6H 3MJ9L 2IPUG 1WBXA 2UWEB 3NH7L 4WEMB 4P2RE 5EO0B 1D5ZB 4OCLC 4POZC 1MJUH 1U91A 4BZ2L 3N1GC 4UNVA 3C6SB 1C7SA 3GRWH 2X10A 5J56B 4PY8J 4M6ML 4MCZA 4WJ5B 1ONQA 3C08H 3VJ6B 2B20A 4QLRA 4UT9H 3O11A 1CQYA 1MPAH 5EU5B 4EKXA 3UO1L 25C8L 3LN5A 3O2WL 1V7NH 2RIKA 3GJFB 4NUJA 5I18L 4KKBC 2VXQH 5E2JA 1L7TL 1C8PA 1RIHL 2PF6A 1UZ8B 4K3HA 2NY6B 2YRPA 4NJ9L 3AREB 1JHTB 1HSBB 1FVDA 1IGIH 4F3FB 3QUZC 4NKOA 2VLKD 2HRLA 3KS0J 1A6AA 1X5HA 2GJJA 3IFNL 3O8XC 1AD0A 4QO1A 3DBXB 5BZDA 3V4UL 1UA6L 4HQQL 5EFIA 4Z7OE 5AZEH 4L8SB 1D5MA 4NQEB 1HILB 1QPPA 3S37X 1LO2H 3DXAD 5GRUL 3RWJB 2JCCF 4ODHH 4WUUE 3VGGA 3RWIB 1EV2E 2P4AB 3H3PL 1A47A 1M7IB 5I1EL 3HG1E 4NIKB 5I2IB 5KSVB 1Q72L 4OQTA 4BH7A 3CC5A 4RGND 3X14B 3FB8B 3TNMB 1MLBA 3NFPA 1QBML 3BPLB 4PJBA 1AXIB 3HI1A 1URLA 3QUMH 1G7MA 3CD4A 1OB1B 2Q3AA 1C5BH 2CK0H 2W65B 4OCRL 1DJSA 4D0DA 3KPOA 4JAMA 4S2SB 4FN0A 1IGCL 5CSGA 1VADB 1OLLA 4M3KB 3TZVD 3PP4H 4Q74A 1UZ6F 2Y5EA 1Q9LB 1E6JL 5EOTA 2ESVA 5K9JH 4GRWE 3TFKD 4OIIL 5B39G 5TE6H 2XZQH 4HUUB 5GS0H 4P4RA 2XT1B 4UOJA 4Y8AA 3VGHA 3B9VA 4UV4L 1MJ8H 5JOPE 1FCCA 4TVSa 4YDJA 3RNKA 4XPGL 4L4TA 2HJFB 4V1DB 1CFQA 4QHKJ 2Z91B 3ARDA 4Y4HB 1KJ3L 2ADFH 2LVEA 2QSCL 4MX7B 2OXGA 3CAFA 1SEBA 3CVHA 3IS1X 1CDHA 1AGCA 2X4QA 4L3CB 3RJDA 3SO5A 2H32B 3IDUA 4JY4A 5GS3A 2Y06L 2UY7A 3MODL 5B8CA 5L0QC 3EYUL 4QHUB 1ODAA 4AMKL 4OF6A 3RKPA 2NYYD 2FLRT 4KXZH 3RZCB 1G9NC 3OKKA 5JQHC 5KTEL 3ZTNL 2W92A 3B6SA 5IQ7L 4LCWA 1MWAL 1KEGH 4NC1C 5IF0A 5HYSA 4XB8A 5C09A 1GAFH 3EO0B 4IDJL 4TSCL 5DMIH 2NX5A 1Z6JT 3NPSB 1YECL 5DD6A 3VI3E 3K4AA 2DQUH 3CMOH 1XR9A 5DVOA 1HHJA 1N2RA 5IEKB 3UDWA 2O5XL 3QDGE 1D5XB 4P9HH 4L4TD 3VG0H 5TDOB 1WZLA 2F5AH 5IK3A 4HV8B 5GS0D 1PX3A 2EDXA 2AXFA 2X89D 3D18A 1VFBB 4ENEC 4H5SA 1S7RB 1SYVA 5MP6L 4NM8H 3GSUB 1IAIL 1Q0XH 4IMKC 3DUSB 3IDXH 2ZCKL 1INQB 2R0LH 2ZUUA 1T80A 4LRNH 5C0BB 4MJ6A 3QB7C 1WFOA 1MJ8L 1M6OA 1UXSA 1AY1L 4MXQD 3HRPA 1JHTA 4RFNB 1R3JB 4TNVF 1JF5A 2HLAA 1CU4H 4FS0A 4KKCD 4Y4HD 2A6KA 2HFEA 5DUMH 4P49A 1GC1H 3VFRA 2Z91A 5HHPA 5L2JB 3TO4C 3MJ9A 1R0AH 2E8YA 2UZYB 4HF5L 2E5EA 3JWDL 1QBAA 2YS4A 5DF0A 4JPWL 4TUOB 1BBDL 3D85A 4MXQC 4YEEA 4P59L 2PR4L 1G7MB 5DR5L 1ZHLA 3AU1B 1MCCA 1LO3H 4XNMB 1J10A 4QCIA 2Z8SA 2OJZH 3IJYA 1IAKB 1N6UA 2GAZA 4YFLF 4Y1AD 1KCVL 3AY4A 3ZDZE 4YBLB 3HZKA 4I3RL 5DHXB 1D7FA 3ZKXB 5KVDL 4YDIH 3PGDB 3QUXC 1A9EA 2QQNL 2DQUL 3CMOL 4G43B 1F8TL 2NLJA 2VR4A 4ZYKA 3RZCC 1ES0A 1S9WB 5I17A 2Q76A 4Y4KD 3FQNB 3BO8B 3P11L 3MA9H 1KN2L 3MRRB 3OGCB 2IQ9H 3VXOA 2R69H 4EUPH 5IJKA 1GSMA 1FZKB 4AH2B 5FECA 3FFCA 3WIIH 1DVFB 3IETB 1Z9SA 1F4WH 2DQFB 4L4TB 1A21A 1WEJH 4N1CA 4OFIA 3ZKSD 2KH2B 4JANA 3HCVA 1ZS8A 3SBWA 3WSQH 1FNEA 1IAIM 4HV8A 5C3TA 3QAZC 2CKBB 2G5BB 3PDOA 4OGXL 2NXZD 4JN1L 1W0WA 1H3TA 5DHVH 5EO9B 1HHHB 1AO7D 3VG9C 4ELMB 2QR0A 1AI1L 2EO9A 3SJVA 3CVHB 1YEGL 4WI4A 4OI7A 1TVDA 3WDIA 1L4IA 3PWJA 3QIBA 1ZXQA 3DPBA 4KVNL 1BPVA 1OTUD 3WD5H 1ZHNB 3GMOA 5L2KE 5C08D 5EIIA 5D7IF 3PGFH 5BRZD 2Z8WC 5I16A 5DK2A 1MCOH 2EDEA 4HKJB 3BGFC 4XCFL 5D71H 1HHGA 5IVXA 4AM0B 4HIEA 2GK0A 1ZHKB 4WGVB 3UTQA 4JZOB 5JUEH 4GW1A 5H35A 2QHLA 1BJ8A 4XPFL 2IH1B 3P11H 5C0EA 2ICES 4JPKL 3ORJA 1I1AD 1RUAH 2QKIB 4Y1AE 1CDGA 3FONB 5D7JD 3TN0B 1XGYL 4CDGC 2X4RB 2I07B 4HXAL 4WFGD 2DM3A 2R8SL 4PJAB 3VFNA 3G5VA 1JWUA 3HRZB 1PKQA 5KAQF 1KFAL 1U3HC 1OP5H 3GZKA 1P53A 2DI8A 2VXUL 2UWEA 3AFLA 1P6AB 1I1AC 5D2NC 5EC1A 4UU9A 3EGSA 3MRNB 5FK9B 4NBYB 3RI5F 1C5BL 4PJXA 1C1EL 5EUKB 4YAQA 4MQ7B 3STZB 3VH8A 1T66D 5HHOE 4IRJC 3NPSC 3MLPA 2EYRB 5I74B 3GI8L 4CN1A 4G42B 3HTLX 4F57H 3QULA 5FYLD 4R2GD 2H9GB 5FKPA 1UZ8A 4WHYH 1P4BL 4OCYH 3VDAA 4NUGH 2BNUB 1DLHA 4GKNA 2JKXA 3U4AA 1C16A 4JHWH 1T21B 3OZ9H 1T7XA 2IGFL 4K8RC 4M4RA 4U1KA 1JGLL 4QRTA 5DJ6B 1EHLL 5TDNA 1ZA3B 1NC4B 3LEXB 3MRPA 5DFVC 4RFOH 4JY5L 4AM0A 5C0ND 3RVXC 4CU8A 4O5LH 4XWGH 3STBA 1FVEA 2VZ1A 1LK2B 2EKSA 1JI2A 1DBJL 4OAWB 3TNMA 4RAUB 3BX7C 1MCQA 1O7SA 5I1JL 4HH8A 3AB0B 2Z93B 2VDRH 2B1HL 3DX7A 4M7ZC 1JUFB 2I5YH 4JRXD 4NHUA 1J9CT 4KAQH 2YPLB 4DN4L 4QXWA 4LAQH 5D7SL 4MNQD 1L6XA 1YNKH 3KWWA 3VWKD 2X6MA 4NFDA 3G6AB 4YHIA 1GVIA 4JFPA 4NKMA 1N3NA 1RSFA 3QNYA 4LSUH 1J05A 4R9HA 5E8OB 5EDXA 5GGRY 3GEWB 1MUJA 5FYJL 3WS3A 1ZHNA 3GMOB 1T2QH 3TT1L 5EBMB 1EJ6A 3PABB 3Q6GL 5DD1L 3QEGL 4WV1A 5C2BH 5M95B 3MOAH 1U8LB 1JHKL 4PJXF 1OAKL 2XFXB 3SE8L 4OD2B 3WS6A 2Y36L 1UYWH 4Q6YA 1F3JA 3X13A 3L5WA 4ZS7L 4OLVL 1OY3B 5KS9F 2BRRH 5C3LD 1XGRB 1A7RL 2FZ3B 3MRFA 4LU5L 1FYHB 5A2LH 3H3BC 3TVMC 4KPHH 1N5AB 1QFUH 4NZDA 5ACZB 2J6EH 4ZTOH 3FN0L 4XNUL 4Z7VF 1DVFD 5D6DA 2VMFA 3FQRB 3QDMA 5D9SB 5F7DB 4EDWL 4Y5VA 4U1GB 2CJUL 2DS4A 1CG9A 2IPKB 3BW9A 1WAAE 4X4XA 1YJDL 1L0QA 4D0DB 5D96C 4MD0A 1MCWM 3L3KA 5F9WC 1CD8A 1YEEL 4ONGH 3S96B 2QV2A 3S37H 3WNMA 4N90E 2ATKB 5ESQA 4R4BA 3WO4C 2AQ3A 1Y18B 4YR6A 1KCVH 4CMHC 3EDDA 2IWGA 5AAMA 5CSZA 1OP3K 1PZUB 4Y4FA 4JO4L 5GSVB 1JZ8A 1X44A 1OP5K 1TQCC 3KPTA 4HS3A 1KPUB 3QDJD 2VLME 4JRXB 1CE6B 4Q9RL 2BY2A 3ISWA 1KF9B 3W2DL 1PQZA 5CJ8A 4K7PH 1F2XK 1I7UB 2NXYB 1U8HB 4MAYD 2VDLL 1NMBH 1F58L 3I02A 1XIWA 1WT5C 4OZFH 4XNYH 4OZGB 2OSLA 3I6KA 1UCBL 2Y25A 3THMH 5GZND 5FB8A 1DR9A 5C0BE 2AVGA 7FABH 5IFJA 2D7OA 4WW1A 2ZZUT 3BOVA 3LEXA 5BVJB 4HFWB 5D7JB 3TN0D 5KG9B 1B4JL 2H8PB 1FGVH 1OAQH 1KTDA 3MCG1 4PRIA 1E4KA 2B1AL 1LO4L 1RHHB 1NL0H 5EPMA 1X4XA 1Y0LA 3ARFA 4D3CL 2QQKH 1BD2D 3VFSA 3WDJA 5HYSG 4MDJB 5JHDB 3EAKA 4QWWC