4GS9B

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with an inactive benzoxadiazole antagonist
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
PTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Development of Inhibitors of the PAS-B Domain of the HIF-2 alpha Transcription Factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
total genus 28
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4gs9B01
3MXQA 5F69A 3E4OA 4EESA 1VB6A 2L1MA 3CLOA 5EFWA 4GHIB 5HDDA 4L9GA 4BBTA 3CAXA 3OLOA 1XJ2A 4PKYG 4EQ1A 3F1PA 4LRXC 5HWWA 1P97A 2A24A 3A0RA 1DP9A 3GDIA 4I5SA 4DJ2A 4HJ4A 1F98A 1LSXA 2A24B 3F1NA 4F3LB 3ICYA 4WL9A 4E04A 4NXBA 3VE4A 5J4EA 1NWZA 1XFQA 1T18A 1S4SA 1OTBA 4BBUA 3LYXA 2JHEA 2VV7A 2W27A 4HH3A 1N9OA 2EA9A 4HIAA 5HD3A 5HD5A 5KIZA 2M1CA 3CWFA 1TS7A 3PYPA 3F1PB 3K3DA 1T19A 5F68A 2BASA 2PR5A 3RTYA 5HSQA 3ULFA 2V1BA 5DJTA 3F1NB 4F3LA 1OTAA 2B02A 2KX6A 2R78A 3HJKA 2JN7A 3NOTC 3IS2B 2J80A 2WKPA 3IBRA 4I38A 2YKHA 5HDSA 3UMDA 3T50A 4GW9A 4R3AA 2H28A 1UWPX 2D01A 4HP4A 4KQDA 3ZQ5A 3GECA 2INWA 5F6AA 3B33A 3C2WA 2V0WA 2ZBBA 4R70A 1OTDA 2Z6CA 4HY8A 4M4XA 2QJ5A 4EEUA 5HWVA 2V9AA 3LIFA 3H9WA 4GCZA 4EERA 1V9YA 5AVEA 5G4ZA 2QWSA 1GSWA 3MJQA 4LRYC 1S67L 4R6LA 1GSVA 4I3JA 2D02A 3BY8A 3E4QA 3LI9A 3NOUC 4JGQA 2CMNA 1KOUA 2I9VA 1XJ4A 4DJ3A 1LL8A 3LI8A 1LSVA 1T1CA 4I3IA 2VV8A 2KDKA 3A0VA 4PKYA 4EW7A 1JNUA 1OJGA 3MQOA 3SW1A 1OT6A 1N9NA 2PD7A 5IU1A 4LRZE 4BBVA 1TS6A 1N9LA 2QKPA 3NHQA 1V9ZA 2QHKA 3FC7A 3E4PA 3LICA 1DP8A 4GS9B 4WUJA 4HP9A 5IS1A 1OTIA 1DP6A 5F5YA 3LIDA 3MFXA 5TBMB 1UWNX 4H6JB 3PHYA 4B9OA 2YKFA 3H7WB 3IS2A 4K08A 3H82B 4HJ3A 1ODVA 4LLOB 1S66L 1XJ3A 4L9FA 3C8CA 5DKLA 1S4RA 3VE3A 3UB8A 4HJ6A 4NXFA 3UB7A 2PHYA 2ZOIA 5HZHA 3EEHA 2VEAA 2Z6DA 2L4RA 3LIBA 2GJ3A 1P0ZA 3D72A 2PYPA 4GHIA 2HV1A 4EEPA 5A8BA 5HDCA 4R38A 2OWHA 3K3CA 4KUOA 3LIEA 3UB6A 1D06A 1WA9A 2ZOHA 5DKKA 5J3WA 3VOLA 1BYWA 4MN5A 1XFNA 4EXOA 4HOIA 1F9IA 2VLGA 1Y28A 1MZUA 3FG8A 3H82A 4KUKA 4LPZA 4XT2A 4YWZA 4WF0A 5J7EA 1GSXA 2VV6A 3G6OA 4HHDA 4L9EA 2V0UA 2OWJA 1DRMA 4XT2B 3HJIA 2WKQA 5G4YA 1XJ6A 3UMEA 3P7NA 5HWTA 4WLAA 4NXGA 1X0OA 1S1ZA 2OOLA 1D7EA 2PR6A 3LIAA 3RH8B 5AVFA 3UB9A 3EWKA 1T1AA 4HH2A 1EW0A 4HNBA 4I39A 1G28A 1OT9A 2PD8A 4RQ9A 2L0WA 3BWLA 1UGUA 3F1OB 1LSWA 5I5LA 2K7SA 3UE6A 4WN5A 3NJAA 4JGOA 2PDRA 1S1YA 2PYRA 4HQAA 4GS9A 4I3AA 1OJ5A 3A0SA 4JGPA 3BY9A 3MR0A 5TBMA 3MQQA 4H6JA 2WKRA 4JGRA 2P7JA 4EETB 3LUQA 1TS8A 1T1BA 2QJ7A 3KX0X 1TS0A 3H7WA 1OTEA 1LT0A 3NOPC 5DJUA 4MN6A 2V1AA 4NXEA 2W0NA 3F1OA 4HI4A
chains in the Genus database with same CATH superfamily
3MXQA 3MSHA 2DCFA 4BL3A 5HDDA 2PBDP 3P01A 4LRXC 1FIKA 2VA0A 2J3TC 3PTEA 3CZDA 1MKIA 2NUPC 2EX9A 4R4RA 3VOYA 1CF0A 5GLAA 1IKGA 3IS2B 4KZ5A 4IUHA 5EVID 4OH0A 4NEED 4S2MA 3QHYA 1VETA 3BLSA 3B33A 4DDYA 5G4ZA 1LI0A 3BFEA 4R0QA 4Y15A 2UV0E 4H8RA 5E2FA 3A3FA 5FQJA 2J9OA 4HESA 3OBFA 2ZC5B 2XA7M 5CEDA 4GB7A 3UDXA 3RXXA 3IWIA 4K91A 3VSLA 1IKIA 3UB5P 4JF5A 2Y2QA 4L0LA 3VP3A 2PYPA 3B3XA 3UB6A 1K57A 2OSUA 1F9IA 3RJUA 3G32A 4Q0HA 1GSXA 4HHDA 2V0UA 3JVVA 3IF6A 1S1ZA 2OOLA 4Y3IA 4P85A 2Q9NA 3Q7VB 2X02A 2RL3A 3CHWP 5DTKA 4N92A 1UGUA 3LEZA 3OC2A 1BLCA 4Z1WA 5A91A 3A0SA 3MQQA 5TGFA 5FASA 2QJ7A 5EVEA 1OTEA 3SW1A 1YSQA 4HI4A 1RGYA 5FAQA 4Y5FA 4KZ7A 3RFBA 2W3DA 2WUQA 4LV3A 3W4OA 3GDIA 1DP9A 4U0TA 4JXVA 5AQAA 1S0WA 4S2OA 2XSSA 3Q7VA 3HUOA 1JTGA 5DJTA 3LR0A 1BLPA 2B18A 2JN7A 5HDSA 3IXBA 1FCNA 2Q9MA 4GCZA 4IVIA 1V9YA 3NDGA 2ZD8A 2O9BA 1IYQA 4I3IA 1BULA 2EXAA 3IF6B 3W4PA 3M2JA 1FQGA 3IX3A 3Q81A 3HLDA 2WAFA 1S66L 1KGEA 1STZA 5HZHA 3ZQ5A 3C7UA 5A8BA 2HV1A 2ZM0A 4F94A 2VZWA 2XA7S 1E3UA 4KQOA 5MC7A 3LY3A 1SKOB 1HTZA 2QYBA 2GZAA 1BZAA 3O88A 5GHXA 1N9BA 4G3KA 2DNSA 1WYBA 1I5QA 2L0WA 2WKHA 2EX2A 5F82A 4LFUA 1OJ5A 5CERA 3HL9A 5FAOA 2H0YA 1XJ2A 4PKYG 1PZOA 3TRCA 3MS6A 5HWWA 1KGFA 1P97A 4KQQA 1FCOA 4O7DA 1LSXA 5J4EA 5EVIC 5HL1A 2JHEA 4ETZA 5KSCA 2M1CA 1XXMA 3VSKA 2J9PA 4AFIA 2Y2KA 4B88A 3ULFA 1PWGA 4X1LA 2V1BA 5DF9A 2B02A 2EFUA 1YAXA 1CEFA 4ARZA 1RGZA 3T50A 4GKUA 2PT7A 1M6KA 4DN0A 4U0XA 5FQMA 2QJ5A 3CG5A 3ZG0A 4G3WA 4CLCC 2QWSA 4X25A 1CEGA 2W3GA 4WZ5C 1ONHA 3HLBA 4YOFA 1T1CA 2H10A 2ZQDA 1SKOA 4S2IA 1TEMA 2VGJA 3LICA 5DF7A 1W5DA 5HX9A 1OTIA 1UWNX 3LEQA 5DTSA 1LI9A 1GCEA 3H82B 1G6AA 1D1JA 3MFDA 3FKVA 4CLCB 4CQHA 1DY6A 3R7WA 2ZQ7A 3CUEC 3FYZA 4KUKA 1K54C 4MMNA 4KG2A 3WS2A 2PR6A 1ES2A 3QP1A 4Q0JA 3UE6A 5EVIB 1S1YA 4RA7A 1K4EA 1DJAA 3OPLA 4HEFA 3PBQA 3BLMA 5IS1A 3U2AA 2R9WA 4GDBA 3SH8A 4E3LA 4BBTA 4Y13A 5EOEA 3KYEA 2VGLS 3S4XA 4HJ4A 2WGVA 2ZLYA 2EWWA 1VEUA 4Q0IA 1NWZA 4B4ZA 3ZCZA 5D3OA 2BASA 4F3LA 1MWSA 5HAIA 2HP6A 2VX8A 4HY8A 3IXGA 1PFLA 5CRFA 3CPTA 2Y2PA 3ZVWA 3IT9A 2PU2A 4JGQA 1LL8A 1YQSA 2HDSA 3MKEA 1H8YA 2Y91A 2PAVP 4EW7A 3WS5A 4HBTA 4WUJA 1BLSA 5EUAA 4WZ4A 3MFXA 4LV0A 1CK3A 4L9FA 4MNRA 1OMEA 4ETXA 1KVLA 2JKTM 4QPRA 3LR5A 3S7OA 4ZBEA 4EXOA 1YMXA 4GDNA 5HFOA 1VM1A 3FG8A 1W63M 1XX2A 1YLWA 5G4YA 4S2NC 5FA7A 3WS4A 1HVBA 5CHJA 4KZ3A 1H8ZA 4EUVA 2PD8A 5GLCA 5A93A 2K7SA 1PZPA 3DW0A 5A90A 3DTIA 2WGWB 2EFXA 3VFHA 5DJUA 3JPUA 1G68A 1M40A 1RP5A 3HBRA 4QU3A 4RVAA 2VGKA 2H5SA 3N8LA 2HGVA 5L10A 3T1QB 5GLBA 4NXBA 5AQBA 1AWIA 4EU0A 2V1ZA 4OQGA 1ZG4A 2V8FA 3SS4A 3A3IA 3PAGA 1PIOA 3IBRA 4IEDA 3UMDA 1ZC2A 4Y0OA 3BJNA 2Y2HA 2C5WB 3A3DA 2VGLM 1GA0A 1EWZA 3N7WA 4OP8A 3OPHA 1GSWA 1GSVA 2D02A 4MCWA 3WS1A 1IEMA 2FZ0A 4G3VA 3HLFA 4FUWA 2VV8A 3E2KA 3GR2A 4PKYA 1JNUA 1OJGA 3O3VA 3E0YA 4XUXA 4LRZE 4ZJ2A 4OKPA 4EWFA 3C4PA 3CI6A 3T4LA 4DE3A 4KZ8A 4O0PA 1ODVA 1FSYA 3UPOA 4WN5A 2Z6DA 3QP2A 4R38A 4JF6A 1YPRA 2OWHA 5AJGA 4OONA 4P87A 3HCYA 4QWOA 1YM1A 4L9EA 4Z9QA 3HJIA 4LENA 5HWTA 3LO7A 3W4QA 4NK3A 3BWLA 1TF1A 4KZBA 3P98A 1LSWA 4UEYA 4HQAA 2W3EA 3ZNTA 4EETB 4X53A 3ZDJA 2PRFA 3R7WB 2O99A 3NCKA 4RX3A 1E3UD 3UPNA 2L1MA 1W8YA 4L9GA 1SHVA 4DRTA 3OPPA 1ZKJA 3MZFA 3S1YA 3IF5A 4BQMA 2HJEA 4IBXA 3TJZC 1KVMA 4HH3A 3FWLA 3AGFA 5GHYA 5F68A 1T19A 3O86A 3RTYA 3C4OA 1Q2PA 2IWCA 4II7A 3V5MA 3O87A 4GW9A 4R3AA 3FV7A 5J8XA 5F6AA 3C2WA 5FI2A 3S7NA 3MJQA 4KZ4A 3JVUA 5TFQA 1JWPA 4OOMA 5JYOA 2W0NA 1HLUP 3AGEA 3MQOA 4GN2A 3KYQA 2HP9A 4Y17A 2Y2GA 5BOHA 3NHQA 2QHKA 2AVXA 1DP6A 3ZG5A 3SH9A 4N1XA 4IJGA 1Z09A 2P9VA 3IH8A 4EBLA 2ACGA 4X56A 4GS9A 1TDGA 1P0ZA 2DMWA 3VFFA 1SZVA 3P09A 2JKTI 4PAUA 2VLGA 2O9CA 3MBZA 3PBRA 1VEUB 1XJ6A 2ZMFA 2QZ6A 2JKRM 2KLIA 4KENB 4XXRA 4HH2A 3PXPA 1G28A 2ZMVA 4CLCE 4IUKA 3PBTA 1BUEA 3GQZA 5EPHA 2HDUA 1QMEA 2ZM2A 4P6ZM 5HAPA 3FPWA 1ALQA 2VJWA 2HDQA 4IHQA 1ES5A 1XGJA 4DJ2A 1U60A 4M3KA 3F1NA 3ICYA 1LLBA 1I2SA 3UE3A 3K3DA 5GL9A 5F1GA 3DTEA 2P74A 4LCMA 3PAEA 2EX6A 1UWPX 4DMZA 4WYYA 2V0WA 4EBPA 4EEUA 5CEBA 1DJCA 4DF6A 4BD1A 3BRMA 2K2NA 2XH9A 3LI9A 4DE2A 5I94A 2NUTC 1N9LA 2E8JA 3OOVA 3M2KA 3KSFA 5FI7A 2V2FF 4D60A 3PHYA 3DTMA 4E6WA 3IX8A 3UDIA 4QY6A 3GTCA 4QB8A 1JVJA 3D3OA 2L4RA 4BL2A 3EOIA 4WEJA 2PBYA 1XFNA 1MZUA 3TOIA 3MXRA 2W1TB 3BM6A 4WLAA 5EM1A 3N8SA 2C6WB 4PM7A 3EWKA 1NLZA 5HAQA 1TVFA 5L2FA 3F1OB 4JGOA 2XROA 1YMSA 3UDFA 3SS3A 4N9KA 4NXEA 5GLDA 3QNCA 2QPNA 3IBJA 4ZRRA 4EQ1A 5E43A 4F3LB 4E04A 1XFQA 2JKFA 5TR7A 3D9YA 3OCLA 5DFYA 3EGDC 4P6ZS 2YKHA 3ZVTA 5CHMA 2WK0A 2D01A 4FH2A 3KSGA 2INWA 3L7HA 1IOUA 2ZJ9A 4DE0A 1KDWA 1LHYA 4M4XA 2Z2LB 5KMWA 1S67L 4I3JA 2WGIA 4KG5A 2CMNA 1KOUA 4UAAA 3LI8A 1KE3A 2KDKA 1SCWA 1H3QA 2HF6A 4FCFA 3W2ZA 4LV1A 4X6TA 2K31A 5CXWA 3T4OA 1GHMA 4JPMA 1L0DA 4B9OA 2E8IA 5EECA 1H5XA 2VK3A 5DF8A 4MBKA 2VEAA 1XGIA 3DAVA 5CX7A 4ZJ1A 1D06A 3T4SA 5M1AA 2OAQ1 4HOIA 4LPZA 3N8RA 4UA7A 4S2PA 4Y0TA 2XF3A 4OLGA 3UB9A 4WBGA 3G31A 1Z6FA 1EW0A 3T4QA 3EQVA 1ONGA 2ZQ8A 4OPYA 3Q7ZA 4JGPA 5CTNA 5FDSA 3BY9A 2ZL1B 3GSGA 4GLQA 2WKRA 2BLSA 3N6IA 3LFVA 2M7VA 2IWDA 4Q8IA 4R1GA 4MN6A 5DKKA 3TSGA 4RYEA 2JCHA 4GHIB 3CAXA 1NRJA 1XP4A 2BG1A 4WELA 4OQHA 5DTTA 1ESUA 4I5SA 4JKTA 4NKPA 4GD6A 3VV4A 1OTBA 2Y4AA 5HD3A 1YLTA 3FZCA 4PM9A 3IWOA 4JBFA 5HARA 4HNBA 3NOTC 5A92A 4I38A 3IHBA 4GD8A 1VETB 1VQQA 3B42A 2EX8A 2JKGA 3SZTA 2Z6CA 3CJMA 1PWCA 3D4FA 2EWVA 5FSRA 1XA7A 2Y2IA 4DJ3A 3S7QA 2G2UA 2XFSA 1N9NA 2XQZA 3EQUA 4ZJ3A 1NXYA 3NECA 1ES3A 2XLNA 3E4PA 3MZEA 4EV4A 3DWKA 3HREA 5FQKA 3L9KA 1K55A 3PBNA 1CJFA 2GX5A 3ITAA 3UB7A 3KSHA 5LBRA 4BMWA 2LB5A 2WZXA 3KSIA 1Y28A 3H82A 2J8YA 5FATA 2WAEA 3NULA 2HZ5A 1PNEA 5FEGA 2W3HA 1D7EA 4YNRA 5HW3A 4BJPA 3V3RA 1F2KA 3Q82A 4OOYA 3EGXC 3BFCA 1TD5A 1ZTUA 4H6JA 2ZL1A 1T1BA 2WKIA 3CMZA 5CGXA 1QMFA 2FH5A 3BW6A 1A0KA 1YT4A 1L3LA 1MC0A 3NBLA 4C3QA 4PM8A 1SDNA 3F1PA 4FOFA 4JXWA 2Y8HA 5CGSA 3A0RA 2G2WA 2Y2OA 3ZFZA 1F98A 1NZUA 3JYIA 1TS7A 4X68A 2PU4A 2HP5A 4B93A 4P0MA 2XK1A 2WKPA 5EV0A 1TDLA 2R9XA 4D2OA 2ZC4B 1L0GA 3LR4A 3MKFA 3OCNA 1K0KA 1L2SA 1K54A 3IWQA 4MLLA 3T1SA 1LSVA 4DE1A 2Z2MB 3KYZA 1OT6A 4GZBA 5IU1A 3QP8A 1SKFA 1TS6A 2OAP1 2X71A 1L0EA 1DP8A 2J3TD 4CLCA 3R4KA 4R23A 2GNXA 4LV2A 4DKIA 5K5BA 4HJ6A 3MQ0A 2H0TA 4QY5A 4EEPA 4OPQA 4X55A 3K3CA 5FQIA 2ZOHA 5J3WA 3TG9A 3GV9A 2XGNA 3S22A 1JTDA 3P7NA 4UA6A 3BFDA 3ZG7B 3UNWA 4XUZA 2JBFA 2WZZA 4MDZA 1FOFA 1L0FA 4Y7PA 3OZHA 4IVKA 3V39A 2O9AA 2PDRA 3T1RA 4K0WA 2JKRI 2P7JA 2EXBA 1K38A 1TS0A 5IT5A 3OPRA 1LL5A 3FKWA 4WMCD 3F1OA 5F69A 3ZGAB 1OPXA 4N9LA 5L8MA 5GHZA 1CQAA 2A3UA 2WGWA 4PHTA 2Y55A 3G4PA 4E3MA 1EROA 1S4SA 4S2NA 4HIAA 2GDNA 2VV7A 2UWXA 4WMCA 5HSQA 4BENA 1P9WA 4FD8A 4C6YA 1MWUA 4K0XA 4S2LA 2V9AA 1ESIA 3LIFA 3QP6A 2ZC7A 4EERA 5AVEA 1BT5A 1HZOA 4UA9A 1GHPA 3IF6C 5HL6A 3T12B 3UN7A 2QKPA 4ARZB 1ERQA 3BEBA 2OLUA 2P9VB 3QNBA 3GMWA 3BQ8A 1MWRA 3H7WB 4K08A 4HJ3A 1YKDA 1S4RA 2PHYA 4CLCD 3A3JA 1IYPA 4GHIA 5HDCA 1W7FA 3Q1FA 3C38A 3VOLA 3MZDA 5CECA 3UY6A 4PPRA 2VV6A 1HD8A 1X0OA 1H8MA 3UO9A 3U4LP 3EEAA 1XKZA 1BTLA 1MXOA 4CJNA 1BLHA 1NJ4A 5I5LA 2PYRA 4I3AA 5EVIA 5TBMA 5EVLA 2XRNA 4QD4A 2B5RA 3NOPC 4N1HA 1N4OA 2V1AA 1XPBA 2XDMA 2JC7A 3NC8A 1VB6A 3CLOA 1MWTA 1FR6A 3SS5A 2WKEA 2A2LA 2Y2MA 1PW8A 4DXCA 4ZAMA 2A24B 4KZ9A 4RX2A 5KIZA 3CWFA 1E25A 3ZYTA 4FTXA 1FR1A 3A3EA 1DJBA 1OTAA 3IXHA 4E3JA 2Y79A 2H28A 4NETA 5FDHA 1EI5A 2V8CA 4KZAA 4BWIA 1WE4A 2Y2JA 3E4QA 3NOUC 2XD1A 4JLFA 1H0MA 2PD7A 1G5UA 4BBVA 1MKMA 3FC7A 4HP9A 4JXSA 3V50A 4H6JB 4MBFA 3C8CA 3VE3A 3CPTB 2ZOIA 2OV5A 4ID4A 4KUOA 1WA9A 4A5RA 4WM9A 4YWZA 3UMEA 4NXGA 3RH8B 5AVFA 3VP1A 1OT9A 2G7UA 4FSFA 4B4XA 4E3NA 2WYXA 3LUQA 3T1XA 2MJ6A 5HPFA 3T4TA 4YFMA 5JYPA 2HPBA 2HDRA 1J3WA 3NY4A 3LR3A 2Y59A 3M6HA 1GA9A 4E6XA 4JF4A 1NRFA 2A49A 4WL9A 3VE4A 1ES4A 3VOZA 4MBHA 1T18A 4BBUA 1CI8A 3LGOA 5FQQA 3PYPA 1RCJA 1O07A 3IHAA 4BD0A 2O0YA 3E2LA 3I7JA 3W8KA 3F1NB 2V20A 4HBUA 2R78A 3UE1A 3WRZA 1ZHHB 4PM5A 3C7VA 4R3BA 1PW1A 2IWBA 4NG2A 5HWVA 3V3SA 3ZNYA 1FCMA 3H9WA 1PYYA 3CUEA 3FPVA 3LY4A 1YLPA 4S2KA 3NIAA 1XA1A 1K4FA 5DVAA 3HLGA 1K56D 3RXWA 3T4KA 1NYMA 1C3BA 1F5MA 3QP5A 4U3TA 5F1FA 5DKLA 3ISGA 1KE4A 1KE0A 3D72A 3ZHHA 4DDSA 4Y0UA 4MN5A 4WF0A 3G6OA 1ACFA 5FL3A 2WKQA 5EE8A 4MN7A 1LL9A 1T1AA 3S7PA 4EUZA 1PWDA 3G35A 2Y2NA 2W1TA 1SDEA 3HLWA 3NJAA 1Y54A 1ZG6A 3HVFA 1LT0A 4CPKA 5AQ9A 4X69A 4EBNA 5C5KA 5EFWA 2VKSA 3SOIA 1PI4A 3K2NA 5F83A 2A24A 5EOOA 1PI5A 5M19A 4UHUA 4QJGA 1N9OA 5HD5A 1K56A 3M6BA 2IA2A 1NLYA 4UQIS 2J7VA 5IHVA 2ZC6B 3BQAA 2WADA 1MPLA 4C75A 2QMIA 3C5AA 3AGDA 5M18A 4WZ5A 2RCXA 2DRWA 4R3JA 3PR6A 1AXBA 1MBLA 3DBAA 2I72A 5EM0A 4KQRA 1V9ZA 5KSHA 4BLMA 1K6RA 3NI9A 3LIDA 1FILA 5TBMB 4YINA 4WEKA 2YKFA 3IS2A 3UB8A 3EEHA 1YSPA 1S6RA 3MF0A 3WS0A 1ERMA 3LIEA 3SH7A 4LCLA 2M7UA 4XT2A 5J7EA 4R4SA 1DRMA 3B47A 4FH4A 1JWVA 3BECA 4OQIA 2OLVA 4Y2FA 4RQ9A 2XR0A 3QP4A 5FQ9A 4OP5A 5FI6A 3MR0A 5L09A 1TS8A 3H7WA 1K25A 2FFFB 3BYDA 3LCEA 3ZG9B 3T4JA 3E4OA 3VP0A 3IH9A 3ZG8B 2CC1A 1IYSA 1K57C 1GHIA 5E2HA 3BFGA 2EA9A 5L07A 2PR5A 3KO6A 1I2WA 2KX6A 4O8GA 1W79A 3O5YA 1G6OA 1O7EA 3GECA 3HLEA 4R70A 2ZBBA 2B95A 2ZM8A 4OPRA 5U47A 4LRYC 4QHCA 3V67A 4ZTKA 1NZOA 3BY8A 4UQIM 5TJJA 1NYYA 1K6SA 4MEZA 3VP2A 5AQ7A 1W63Q 4ME4A 3TE8A 3BFFA 3VMAA 3VP4A 2BTFP 5F5YA 1BSGA 1IFQA 5CGWA 3DWZA 2P08A 3E98A 4NXFA 1W8QA 2GJ3A 1P9RA 2W3FA 4O01A 3G2ZA 3PBOA 1WYCA 4XT2B 1YLZA 4ESPA 5E2EA 1Q2QA 3UPPA 1E4DA 1FSWA 5FAPA 4KZ6A 2KOIA 4JGRA 1VHMA 4P6BA 1K55C 3UE0A 2X01A 1MY8A 4EESA 1JWZA 4E3IA 3IQAA 2Q0OA 3OLOA 4E3KA 4KG6A 2JE5A 1YLJA 2FFYA 2J3WA 4DXBA 3LYXA 2W27A 5E2GA 3F1PB 3HUMA 2Y2LA 3TW8A 3Q07A 3HJKA 2J80A 3G2YA 4IBRA 2ZQ9A 3GRJA 2XEPA 4HP4A 4KQDA 3WRTA 4OVDA 1OTDA 3G34A 2W1RA 5FEFA 4E3OA 3DTKA 4R6LA 3MXSA 5G18A 2ZQCA 1IYOA 2I9VA 1XJ4A 3CITA 4EQIA 3PBSA 5KZHA 3A0VA 4OOLA 2ZMAA 3GVBA 2ZC3B 4PM6A 4OLDA 4GS9B 5CTMA 2P04A 3MMHA 3N4IA 1IELA 1J9MA 4S2JA 4LGWA 5HPIA 4LLOB 1XJ3A 4OPZA 3ITBA 3G30A 2ZQAA 5DFXA 4GJ4A 4GNUA 3LIBA 1CI9A 4JXGA 3NDEA 1BYWA 3IX4A 1KDSA 2XFTA 2OWJA 1YLYA 3WWXA 2HJ9C 5CHUA 2XD5A 3LIAA 1KGGA 1NY0A 4I39A 3C30A 3HUNA 4GOGA 2LB9A 3HLCA 4ZDXA 4OQ0A 1PRQA 3KX0X 1Y4OA 4PMAA 4X1MA 3IXDA
chains in the Genus database with same CATH topology
3MXQA 3LR3A 4GHIB 5HDDA 3CAXA 2HGVA 1NRJA 4WELA 3P01A 4LRXC 2VA0A 2J3TC 4I5SA 4NKPA 4WL9A 4NXBA 3VE4A 1T18A 3VV4A 2NUPC 1OTBA 4BBUA 5HD3A 4EU0A 3PYPA 2O0YA 3F1NB 4HNBA 2R78A 3NOTC 3IS2B 3IBRA 4I38A 4IUHA 1ZHHB 3UMDA 3BJNA 4NEED 3B42A 2VGLM 3B33A 5HWVA 2Z6CA 3H9WA 3CUEA 5G4ZA 3FPVA 2EWVA 1GSWA 1GSVA 2D02A 4MCWA 2FZ0A 4G3VA 4DJ3A 3S7QA 2VV8A 4PKYA 1JNUA 1OJGA 3T4KA 1N9NA 3EQUA 3E0YA 3OBFA 2XA7M 4LRZE 3E4PA 1F5MA 3CI6A 3T4LA 4O0PA 1ODVA 3PBNA 5DKLA 2GX5A 4L0LA 3UB7A 3KSHA 5LBRA 4BMWA 2LB5A 4WN5A 2Z6DA 3D72A 2PYPA 4R38A 5AJGA 2OWHA 3UB6A 3KSIA 3HCYA 4MN5A 1F9IA 1Y28A 3H82A 4WF0A 4Q0HA 1GSXA 3G6OA 4HHDA 4L9EA 2V0UA 3JVVA 5FL3A 3HJIA 2WKQA 5HWTA 2W3HA 1S1ZA 2OOLA 1D7EA 4Y3IA 4YNRA 4MN7A 4BJPA 1T1AA 3S7PA 3BWLA 1TF1A 1UGUA 2W1TA 3EGXC 1LSWA 3OC2A 3NJAA 4UEYA 1TD5A 2W3EA 4HQAA 4Z1WA 3A0SA 1ZTUA 3MQQA 4H6JA 4EETB 1T1BA 2QJ7A 3R7WB 1OTEA 1LT0A 2O99A 2FH5A 3SW1A 1YSQA 3BW6A 4HI4A 5C5KA 2L1MA 4Y5FA 5EFWA 1MC0A 2VKSA 4L9GA 3RFBA 3F1PA 4FOFA 2W3DA 3K2NA 2A24A 2Y8HA 3A0RA 1DP9A 3GDIA 2HJEA 1F98A 3TJZC 4HH3A 1N9OA 5HD5A 1TS7A 5F68A 1T19A 2XSSA 2IA2A 1NLYA 3RTYA 4B93A 4UQIS 5DJTA 3LR0A 4II7A 2B18A 2JN7A 2WKPA 5HDSA 4GW9A 3BQAA 4R3AA 5F6AA 3C2WA 3LR4A 3OCNA 4GCZA 1V9YA 3S7NA 3MJQA 2O9BA 3JVUA 4OOMA 3PR6A 3DBAA 1LSVA 4I3IA 3MQOA 3KYZA 1OT6A 3KYQA 5IU1A 1TS6A 2OAP1 3NHQA 1V9ZA 2QHKA 2J3TD 1DP8A 5KSHA 1DP6A 4CLCA 3LIDA 5TBMB 3R4KA 2GNXA 4WEKA 2YKFA 3IS2A 4IJGA 1S66L 5K5BA 3UB8A 4HJ6A 1STZA 5HZHA 3EEHA 1YSPA 3MQ0A 4GS9A 3ZQ5A 1P0ZA 5A8BA 2HV1A 2DMWA 3MF0A 4EEPA 3K3CA 3LIEA 2ZOHA 5DKKA 5J3WA 2JKTI 2VZWA 4PAUA 2VLGA 2XA7S 2M7UA 4KQOA 2O9CA 4XT2A 5J7EA 5MC7A 3PBRA 1DRMA 3B47A 2QYBA 1XJ6A 3P7NA 2ZMFA 2GZAA 2JKRM 2KLIA 4G3KA 4HH2A 4MDZA 3PXPA 1G28A 4Y2FA 2ZMVA 4RQ9A 2L0WA 4CLCE 2O9AA 4IUKA 2PDRA 3PBTA 1OJ5A 3MR0A 2JKRI 2P7JA 1TS8A 1TS0A 3H7WA 5IT5A 4P6ZM 3F1OA 3T4JA 5F69A 3E4OA 3FPWA 2VJWA 1OPXA 5L8MA 1XJ2A 4IHQA 4PKYG 3TRCA 4PHTA 5HWWA 1P97A 4DJ2A 1LSXA 3F1NA 3ICYA 5J4EA 1S4SA 3UE3A 4HIAA 2JHEA 2VV7A 4ETZA 2EA9A 2M1CA 3K3DA 4AFIA 2PR5A 3KO6A 5HSQA 3ULFA 2V1BA 1P9WA 5DF9A 2B02A 2KX6A 1YAXA 4ARZA 4O8GA 3O5YA 3T50A 1G6OA 1UWPX 2PT7A 4DN0A 4DMZA 3GECA 4R70A 2V0WA 2ZBBA 4EEUA 2QJ5A 2V9AA 3LIFA 4EERA 4G3WA 5AVEA 4CLCC 2QWSA 4LRYC 3V67A 2W3GA 3BY8A 2K2NA 3LI9A 2NUTC 4UQIM 5TJJA 4YOFA 1T1CA 5HL6A 1W63Q 4ME4A 3TE8A 1N9LA 2QKPA 4ARZB 3LICA 3OOVA 1OTIA 3KSFA 5F5YA 1UWNX 3PHYA 1IFQA 3BQ8A 3H7WB 4K08A 2P08A 3H82B 4HJ3A 1YKDA 1S4RA 3E98A 4NXFA 2PHYA 4CLCD 3D3OA 2L4RA 2GJ3A 4GHIA 3EOIA 4CLCB 4CQHA 5HDCA 3R7WA 1P9RA 3C38A 4WEJA 3VOLA 2W3FA 1XFNA 4O01A 3CUEC 4KUKA 1MZUA 3PBOA 2VV6A 4XT2B 2W1TB 4MMNA 4WLAA 1X0OA 1H8MA 2PR6A 3EEAA 3EWKA 1NLZA 3F1OB 5I5LA 3UE6A 4Q0JA 2KOIA 4JGOA 1S1YA 2PYRA 4I3AA 2XROA 5TBMA 4JGRA 1VHMA 2XRNA 3PBQA 3NOPC 4NXEA 2V1AA 5IS1A 3U2AA 4EESA 1VB6A 3CLOA 3IBJA 4BBTA 3OLOA 4ZRRA 2A2LA 4EQ1A 2VGLS 2J3WA 4HJ4A 4F3LB 2A24B 4E04A 2EWWA 4Q0IA 1XFQA 1NWZA 3LYXA 2W27A 5KIZA 3CWFA 3F1PB 3OCLA 3ZYTA 2BASA 5DFYA 3TW8A 3EGDC 4P6ZS 4F3LA 1OTAA 3HJKA 2J80A 2YKHA 2Y79A 2H28A 2D01A 4HP4A 4KQDA 3KSGA 2INWA 1IOUA 1OTDA 2VX8A 4HY8A 4M4XA 4BWIA 2W1RA 4R6LA 1S67L 4I3JA 3E4QA 3NOUC 4JGQA 2CMNA 1KOUA 2I9VA 1XJ4A 3CITA 1LL8A 3LI8A 3PBSA 2KDKA 3A0VA 4EW7A 1H3QA 2HF6A 3W2ZA 4OOLA 2PD7A 4BBVA 2K31A 1MKMA 3FC7A 4WUJA 3T4OA 4GS9B 4HP9A 2P04A 3MMHA 3MFXA 4H6JB 4B9OA 5HPIA 4LLOB 1XJ3A 4L9FA 3C8CA 3VE3A 2ZOIA 4GJ4A 5DFXA 4ETXA 2VEAA 3LIBA 2JKTM 4QPRA 3LR5A 5CX7A 3S7OA 4KUOA 1D06A 1WA9A 3T4SA 4EXOA 1BYWA 2OAQ1 4HOIA 3FG8A 4LPZA 1W63M 4YWZA 2OWJA 3UMEA 5G4YA 2HJ9C 4NXGA 3LIAA 3RH8B 5AVFA 3UB9A 1EW0A 4I39A 4EUVA 1OT9A 2G7UA 2PD8A 4FSFA 3C30A 3T4QA 3EQVA 2K7SA 2LB9A 4JGPA 3BY9A 4GLQA 2WKRA 3LUQA 3LFVA 2M7VA 2MJ6A 5HPFA 3KX0X 3T4TA 5DJUA 4MN6A 2W0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXQ A;  5F69 A;  3E4O A;  4EES A;  1VB6 A;  2L1M A;  3CLO A;  5EFW A;  4GHI B;  5HDD A;  4L9G A;  4BBT A;  3CAX A;  3OLO A;  1XJ2 A;  4PKY G;  4EQ1 A;  3F1P A;  4LRX C;  5HWW A;  1P97 A;  2A24 A;  3A0R A;  1DP9 A;  3GDI A;  4I5S A;  4DJ2 A;  4HJ4 A;  1F98 A;  1LSX A;  2A24 B;  3F1N A;  4F3L B;  3ICY A;  4WL9 A;  4E04 A;  4NXB A;  3VE4 A;  5J4E A;  1NWZ A;  1XFQ A;  1T18 A;  1S4S A;  1OTB A;  4BBU A;  3LYX A;  2JHE A;  2VV7 A;  2W27 A;  4HH3 A;  1N9O A;  2EA9 A;  4HIA A;  5HD3 A;  5HD5 A;  5KIZ A;  2M1C A;  3CWF A;  1TS7 A;  3PYP A;  3F1P B;  3K3D A;  1T19 A;  5F68 A;  2BAS A;  2PR5 A;  3RTY A;  5HSQ A;  3ULF A;  2V1B A;  5DJT A;  3F1N B;  4F3L A;  1OTA A;  2B02 A;  2KX6 A;  2R78 A;  3HJK A;  2JN7 A;  3NOT C;  3IS2 B;  2J80 A;  2WKP A;  3IBR A;  4I38 A;  2YKH A;  5HDS A;  3UMD A;  3T50 A;  4GW9 A;  4R3A A;  2H28 A;  1UWP X;  2D01 A;  4HP4 A;  4KQD A;  3ZQ5 A;  3GEC A;  2INW A;  5F6A A;  3B33 A;  3C2W A;  2V0W A;  2ZBB A;  4R70 A;  1OTD A;  2Z6C A;  4HY8 A;  4M4X A;  2QJ5 A;  4EEU A;  5HWV A;  2V9A A;  3LIF A;  3H9W A;  4GCZ A;  4EER A;  1V9Y A;  5AVE A;  5G4Z A;  2QWS A;  1GSW A;  3MJQ A;  4LRY C;  1S67 L;  4R6L A;  1GSV A;  4I3J A;  2D02 A;  3BY8 A;  3E4Q A;  3LI9 A;  3NOU C;  4JGQ A;  2CMN A;  1KOU A;  2I9V A;  1XJ4 A;  4DJ3 A;  1LL8 A;  3LI8 A;  1LSV A;  1T1C A;  4I3I A;  2VV8 A;  2KDK A;  3A0V A;  4PKY A;  4EW7 A;  1JNU A;  1OJG A;  3MQO A;  3SW1 A;  1OT6 A;  1N9N A;  2PD7 A;  5IU1 A;  4LRZ E;  4BBV A;  1TS6 A;  1N9L A;  2QKP A;  3NHQ A;  1V9Z A;  2QHK A;  3FC7 A;  3E4P A;  3LIC A;  1DP8 A;  4GS9 B;  4WUJ A;  4HP9 A;  5IS1 A;  1OTI A;  1DP6 A;  5F5Y A;  3LID A;  3MFX A;  5TBM B;  1UWN X;  4H6J B;  3PHY A;  4B9O A;  2YKF A;  3H7W B;  3IS2 A;  4K08 A;  3H82 B;  4HJ3 A;  1ODV A;  4LLO B;  1S66 L;  1XJ3 A;  4L9F A;  3C8C A;  5DKL A;  1S4R A;  3VE3 A;  3UB8 A;  4HJ6 A;  4NXF A;  3UB7 A;  2PHY A;  2ZOI A;  5HZH A;  3EEH A;  2VEA A;  2Z6D A;  2L4R A;  3LIB A;  2GJ3 A;  1P0Z A;  3D72 A;  2PYP A;  4GHI A;  2HV1 A;  4EEP A;  5A8B A;  5HDC A;  4R38 A;  2OWH A;  3K3C A;  4KUO A;  3LIE A;  3UB6 A;  1D06 A;  1WA9 A;  2ZOH A;  5DKK A;  5J3W A;  3VOL A;  1BYW A;  4MN5 A;  1XFN A;  4EXO A;  4HOI A;  1F9I A;  2VLG A;  1Y28 A;  1MZU A;  3FG8 A;  3H82 A;  4KUK A;  4LPZ A;  4XT2 A;  4YWZ A;  4WF0 A;  5J7E A;  1GSX A;  2VV6 A;  3G6O A;  4HHD A;  4L9E A;  2V0U A;  2OWJ A;  1DRM A;  4XT2 B;  3HJI A;  2WKQ A;  5G4Y A;  1XJ6 A;  3UME A;  3P7N A;  5HWT A;  4WLA A;  4NXG A;  1X0O A;  1S1Z A;  2OOL A;  1D7E A;  2PR6 A;  3LIA A;  3RH8 B;  5AVF A;  3UB9 A;  3EWK A;  1T1A A;  4HH2 A;  1EW0 A;  4HNB A;  4I39 A;  1G28 A;  1OT9 A;  2PD8 A;  4RQ9 A;  2L0W A;  3BWL A;  1UGU A;  3F1O B;  1LSW A;  5I5L A;  2K7S A;  3UE6 A;  4WN5 A;  3NJA A;  4JGO A;  2PDR A;  1S1Y A;  2PYR A;  4HQA A;  4GS9 A;  4I3A A;  1OJ5 A;  3A0S A;  4JGP A;  3BY9 A;  3MR0 A;  5TBM A;  3MQQ A;  4H6J A;  2WKR A;  4JGR A;  2P7J A;  4EET B;  3LUQ A;  1TS8 A;  1T1B A;  2QJ7 A;  3KX0 X;  1TS0 A;  3H7W A;  1OTE A;  1LT0 A;  3NOP C;  5DJU A;  4MN6 A;  2V1A A;  4NXE A;  2W0N A;  3F1O A;  4HI4 A; 
#chains in the Genus database with same CATH topology
 3MXQ A;  3MSH A;  2DCF A;  4BL3 A;  5HDD A;  2PBD P;  3P01 A;  4LRX C;  1FIK A;  2VA0 A;  2J3T C;  3PTE A;  3CZD A;  1MKI A;  2NUP C;  2EX9 A;  4R4R A;  3VOY A;  1CF0 A;  5GLA A;  1IKG A;  3IS2 B;  4KZ5 A;  4IUH A;  5EVI D;  4OH0 A;  4NEE D;  4S2M A;  3QHY A;  1VET A;  3BLS A;  3B33 A;  4DDY A;  5G4Z A;  1LI0 A;  3BFE A;  4R0Q A;  4Y15 A;  2UV0 E;  4H8R A;  5E2F A;  3A3F A;  5FQJ A;  2J9O A;  4HES A;  3OBF A;  2ZC5 B;  2XA7 M;  5CED A;  4GB7 A;  3UDX A;  3RXX A;  3IWI A;  4K91 A;  3VSL A;  1IKI A;  3UB5 P;  4JF5 A;  2Y2Q A;  4L0L A;  3VP3 A;  2PYP A;  3B3X A;  3UB6 A;  1K57 A;  2OSU A;  1F9I A;  3RJU A;  3G32 A;  4Q0H A;  1GSX A;  4HHD A;  2V0U A;  3JVV A;  3IF6 A;  1S1Z A;  2OOL A;  4Y3I A;  4P85 A;  2Q9N A;  3Q7V B;  2X02 A;  2RL3 A;  3CHW P;  5DTK A;  4N92 A;  1UGU A;  3LEZ A;  3OC2 A;  1BLC A;  4Z1W A;  5A91 A;  3A0S A;  3MQQ A;  5TGF A;  5FAS A;  2QJ7 A;  5EVE A;  1OTE A;  3SW1 A;  1YSQ A;  4HI4 A;  1RGY A;  5FAQ A;  4Y5F A;  4KZ7 A;  3RFB A;  2W3D A;  2WUQ A;  4LV3 A;  3W4O A;  3GDI A;  1DP9 A;  4U0T A;  4JXV A;  5AQA A;  1S0W A;  4S2O A;  2XSS A;  3Q7V A;  3HUO A;  1JTG A;  5DJT A;  3LR0 A;  1BLP A;  2B18 A;  2JN7 A;  5HDS A;  3IXB A;  1FCN A;  2Q9M A;  4GCZ A;  4IVI A;  1V9Y A;  3NDG A;  2ZD8 A;  2O9B A;  1IYQ A;  4I3I A;  1BUL A;  2EXA A;  3IF6 B;  3W4P A;  3M2J A;  1FQG A;  3IX3 A;  3Q81 A;  3HLD A;  2WAF A;  1S66 L;  1KGE A;  1STZ A;  5HZH A;  3ZQ5 A;  3C7U A;  5A8B A;  2HV1 A;  2ZM0 A;  4F94 A;  2VZW A;  2XA7 S;  1E3U A;  4KQO A;  5MC7 A;  3LY3 A;  1SKO B;  1HTZ A;  2QYB A;  2GZA A;  1BZA A;  3O88 A;  5GHX A;  1N9B A;  4G3K A;  2DNS A;  1WYB A;  1I5Q A;  2L0W A;  2WKH A;  2EX2 A;  5F82 A;  4LFU A;  1OJ5 A;  5CER A;  3HL9 A;  5FAO A;  2H0Y A;  1XJ2 A;  4PKY G;  1PZO A;  3TRC A;  3MS6 A;  5HWW A;  1KGF A;  1P97 A;  4KQQ A;  1FCO A;  4O7D A;  1LSX A;  5J4E A;  5EVI C;  5HL1 A;  2JHE A;  4ETZ A;  5KSC A;  2M1C A;  1XXM A;  3VSK A;  2J9P A;  4AFI A;  2Y2K A;  4B88 A;  3ULF A;  1PWG A;  4X1L A;  2V1B A;  5DF9 A;  2B02 A;  2EFU A;  1YAX A;  1CEF A;  4ARZ A;  1RGZ A;  3T50 A;  4GKU A;  2PT7 A;  1M6K A;  4DN0 A;  4U0X A;  5FQM A;  2QJ5 A;  3CG5 A;  3ZG0 A;  4G3W A;  4CLC C;  2QWS A;  4X25 A;  1CEG A;  2W3G A;  4WZ5 C;  1ONH A;  3HLB A;  4YOF A;  1T1C A;  2H10 A;  2ZQD A;  1SKO A;  4S2I A;  1TEM A;  2VGJ A;  3LIC A;  5DF7 A;  1W5D A;  5HX9 A;  1OTI A;  1UWN X;  3LEQ A;  5DTS A;  1LI9 A;  1GCE A;  3H82 B;  1G6A A;  1D1J A;  3MFD A;  3FKV A;  4CLC B;  4CQH A;  1DY6 A;  3R7W A;  2ZQ7 A;  3CUE C;  3FYZ A;  4KUK A;  1K54 C;  4MMN A;  4KG2 A;  3WS2 A;  2PR6 A;  1ES2 A;  3QP1 A;  4Q0J A;  3UE6 A;  5EVI B;  1S1Y A;  4RA7 A;  1K4E A;  1DJA A;  3OPL A;  4HEF A;  3PBQ A;  3BLM A;  5IS1 A;  3U2A A;  2R9W A;  4GDB A;  3SH8 A;  4E3L A;  4BBT A;  4Y13 A;  5EOE A;  3KYE A;  2VGL S;  3S4X A;  4HJ4 A;  2WGV A;  2ZLY A;  2EWW A;  1VEU A;  4Q0I A;  1NWZ A;  4B4Z A;  3ZCZ A;  5D3O A;  2BAS A;  4F3L A;  1MWS A;  5HAI A;  2HP6 A;  2VX8 A;  4HY8 A;  3IXG A;  1PFL A;  5CRF A;  3CPT A;  2Y2P A;  3ZVW A;  3IT9 A;  2PU2 A;  4JGQ A;  1LL8 A;  1YQS A;  2HDS A;  3MKE A;  1H8Y A;  2Y91 A;  2PAV P;  4EW7 A;  3WS5 A;  4HBT A;  4WUJ A;  1BLS A;  5EUA A;  4WZ4 A;  3MFX A;  4LV0 A;  1CK3 A;  4L9F A;  4MNR A;  1OME A;  4ETX A;  1KVL A;  2JKT M;  4QPR A;  3LR5 A;  3S7O A;  4ZBE A;  4EXO A;  1YMX A;  4GDN A;  5HFO A;  1VM1 A;  3FG8 A;  1W63 M;  1XX2 A;  1YLW A;  5G4Y A;  4S2N C;  5FA7 A;  3WS4 A;  1HVB A;  5CHJ A;  4KZ3 A;  1H8Z A;  4EUV A;  2PD8 A;  5GLC A;  5A93 A;  2K7S A;  1PZP A;  3DW0 A;  5A90 A;  3DTI A;  2WGW B;  2EFX A;  3VFH A;  5DJU A;  3JPU A;  1G68 A;  1M40 A;  1RP5 A;  3HBR A;  4QU3 A;  4RVA A;  2VGK A;  2H5S A;  3N8L A;  2HGV A;  5L10 A;  3T1Q B;  5GLB A;  4NXB A;  5AQB A;  1AWI A;  4EU0 A;  2V1Z A;  4OQG A;  1ZG4 A;  2V8F A;  3SS4 A;  3A3I A;  3PAG A;  1PIO A;  3IBR A;  4IED A;  3UMD A;  1ZC2 A;  4Y0O A;  3BJN A;  2Y2H A;  2C5W B;  3A3D A;  2VGL M;  1GA0 A;  1EWZ A;  3N7W A;  4OP8 A;  3OPH A;  1GSW A;  1GSV A;  2D02 A;  4MCW A;  3WS1 A;  1IEM A;  2FZ0 A;  4G3V A;  3HLF A;  4FUW A;  2VV8 A;  3E2K A;  3GR2 A;  4PKY A;  1JNU A;  1OJG A;  3O3V A;  3E0Y A;  4XUX A;  4LRZ E;  4ZJ2 A;  4OKP A;  4EWF A;  3C4P A;  3CI6 A;  3T4L A;  4DE3 A;  4KZ8 A;  4O0P A;  1ODV A;  1FSY A;  3UPO A;  4WN5 A;  2Z6D A;  3QP2 A;  4R38 A;  4JF6 A;  1YPR A;  2OWH A;  5AJG A;  4OON A;  4P87 A;  3HCY A;  4QWO A;  1YM1 A;  4L9E A;  4Z9Q A;  3HJI A;  4LEN A;  5HWT A;  3LO7 A;  3W4Q A;  4NK3 A;  3BWL A;  1TF1 A;  4KZB A;  3P98 A;  1LSW A;  4UEY A;  4HQA A;  2W3E A;  3ZNT A;  4EET B;  4X53 A;  3ZDJ A;  2PRF A;  3R7W B;  2O99 A;  3NCK A;  4RX3 A;  1E3U D;  3UPN A;  2L1M A;  1W8Y A;  4L9G A;  1SHV A;  4DRT A;  3OPP A;  1ZKJ A;  3MZF A;  3S1Y A;  3IF5 A;  4BQM A;  2HJE A;  4IBX A;  3TJZ C;  1KVM A;  4HH3 A;  3FWL A;  3AGF A;  5GHY A;  5F68 A;  1T19 A;  3O86 A;  3RTY A;  3C4O A;  1Q2P A;  2IWC A;  4II7 A;  3V5M A;  3O87 A;  4GW9 A;  4R3A A;  3FV7 A;  5J8X A;  5F6A A;  3C2W A;  5FI2 A;  3S7N A;  3MJQ A;  4KZ4 A;  3JVU A;  5TFQ A;  1JWP A;  4OOM A;  5JYO A;  2W0N A;  1HLU P;  3AGE A;  3MQO A;  4GN2 A;  3KYQ A;  2HP9 A;  4Y17 A;  2Y2G A;  5BOH A;  3NHQ A;  2QHK A;  2AVX A;  1DP6 A;  3ZG5 A;  3SH9 A;  4N1X A;  4IJG A;  1Z09 A;  2P9V A;  3IH8 A;  4EBL A;  2ACG A;  4X56 A;  4GS9 A;  1TDG A;  1P0Z A;  2DMW A;  3VFF A;  1SZV A;  3P09 A;  2JKT I;  4PAU A;  2VLG A;  2O9C A;  3MBZ A;  3PBR A;  1VEU B;  1XJ6 A;  2ZMF A;  2QZ6 A;  2JKR M;  2KLI A;  4KEN B;  4XXR A;  4HH2 A;  3PXP A;  1G28 A;  2ZMV A;  4CLC E;  4IUK A;  3PBT A;  1BUE A;  3GQZ A;  5EPH A;  2HDU A;  1QME A;  2ZM2 A;  4P6Z M;  5HAP A;  3FPW A;  1ALQ A;  2VJW A;  2HDQ A;  4IHQ A;  1ES5 A;  1XGJ A;  4DJ2 A;  1U60 A;  4M3K A;  3F1N A;  3ICY A;  1LLB A;  1I2S A;  3UE3 A;  3K3D A;  5GL9 A;  5F1G A;  3DTE A;  2P74 A;  4LCM A;  3PAE A;  2EX6 A;  1UWP X;  4DMZ A;  4WYY A;  2V0W A;  4EBP A;  4EEU A;  5CEB A;  1DJC A;  4DF6 A;  4BD1 A;  3BRM A;  2K2N A;  2XH9 A;  3LI9 A;  4DE2 A;  5I94 A;  2NUT C;  1N9L A;  2E8J A;  3OOV A;  3M2K A;  3KSF A;  5FI7 A;  2V2F F;  4D60 A;  3PHY A;  3DTM A;  4E6W A;  3IX8 A;  3UDI A;  4QY6 A;  3GTC A;  4QB8 A;  1JVJ A;  3D3O A;  2L4R A;  4BL2 A;  3EOI A;  4WEJ A;  2PBY A;  1XFN A;  1MZU A;  3TOI A;  3MXR A;  2W1T B;  3BM6 A;  4WLA A;  5EM1 A;  3N8S A;  2C6W B;  4PM7 A;  3EWK A;  1NLZ A;  5HAQ A;  1TVF A;  5L2F A;  3F1O B;  4JGO A;  2XRO A;  1YMS A;  3UDF A;  3SS3 A;  4N9K A;  4NXE A;  5GLD A;  3QNC A;  2QPN A;  3IBJ A;  4ZRR A;  4EQ1 A;  5E43 A;  4F3L B;  4E04 A;  1XFQ A;  2JKF A;  5TR7 A;  3D9Y A;  3OCL A;  5DFY A;  3EGD C;  4P6Z S;  2YKH A;  3ZVT A;  5CHM A;  2WK0 A;  2D01 A;  4FH2 A;  3KSG A;  2INW A;  3L7H A;  1IOU A;  2ZJ9 A;  4DE0 A;  1KDW A;  1LHY A;  4M4X A;  2Z2L B;  5KMW A;  1S67 L;  4I3J A;  2WGI A;  4KG5 A;  2CMN A;  1KOU A;  4UAA A;  3LI8 A;  1KE3 A;  2KDK A;  1SCW A;  1H3Q A;  2HF6 A;  4FCF A;  3W2Z A;  4LV1 A;  4X6T A;  2K31 A;  5CXW A;  3T4O A;  1GHM A;  4JPM A;  1L0D A;  4B9O A;  2E8I A;  5EEC A;  1H5X A;  2VK3 A;  5DF8 A;  4MBK A;  2VEA A;  1XGI A;  3DAV A;  5CX7 A;  4ZJ1 A;  1D06 A;  3T4S A;  5M1A A;  2OAQ 1;  4HOI A;  4LPZ A;  3N8R A;  4UA7 A;  4S2P A;  4Y0T A;  2XF3 A;  4OLG A;  3UB9 A;  4WBG A;  3G31 A;  1Z6F A;  1EW0 A;  3T4Q A;  3EQV A;  1ONG A;  2ZQ8 A;  4OPY A;  3Q7Z A;  4JGP A;  5CTN A;  5FDS A;  3BY9 A;  2ZL1 B;  3GSG A;  4GLQ A;  2WKR A;  2BLS A;  3N6I A;  3LFV A;  2M7V A;  2IWD A;  4Q8I A;  4R1G A;  4MN6 A;  5DKK A;  3TSG A;  4RYE A;  2JCH A;  4GHI B;  3CAX A;  1NRJ A;  1XP4 A;  2BG1 A;  4WEL A;  4OQH A;  5DTT A;  1ESU A;  4I5S A;  4JKT A;  4NKP A;  4GD6 A;  3VV4 A;  1OTB A;  2Y4A A;  5HD3 A;  1YLT A;  3FZC A;  4PM9 A;  3IWO A;  4JBF A;  5HAR A;  4HNB A;  3NOT C;  5A92 A;  4I38 A;  3IHB A;  4GD8 A;  1VET B;  1VQQ A;  3B42 A;  2EX8 A;  2JKG A;  3SZT A;  2Z6C A;  3CJM A;  1PWC A;  3D4F A;  2EWV A;  5FSR A;  1XA7 A;  2Y2I A;  4DJ3 A;  3S7Q A;  2G2U A;  2XFS A;  1N9N A;  2XQZ A;  3EQU A;  4ZJ3 A;  1NXY A;  3NEC A;  1ES3 A;  2XLN A;  3E4P A;  3MZE A;  4EV4 A;  3DWK A;  3HRE A;  5FQK A;  3L9K A;  1K55 A;  3PBN A;  1CJF A;  2GX5 A;  3ITA A;  3UB7 A;  3KSH A;  5LBR A;  4BMW A;  2LB5 A;  2WZX A;  3KSI A;  1Y28 A;  3H82 A;  2J8Y A;  5FAT A;  2WAE A;  3NUL A;  2HZ5 A;  1PNE A;  5FEG A;  2W3H A;  1D7E A;  4YNR A;  5HW3 A;  4BJP A;  3V3R A;  1F2K A;  3Q82 A;  4OOY A;  3EGX C;  3BFC A;  1TD5 A;  1ZTU A;  4H6J A;  2ZL1 A;  1T1B A;  2WKI A;  3CMZ A;  5CGX A;  1QMF A;  2FH5 A;  3BW6 A;  1A0K A;  1YT4 A;  1L3L A;  1MC0 A;  3NBL A;  4C3Q A;  4PM8 A;  1SDN A;  3F1P A;  4FOF A;  4JXW A;  2Y8H A;  5CGS A;  3A0R A;  2G2W A;  2Y2O A;  3ZFZ A;  1F98 A;  1NZU A;  3JYI A;  1TS7 A;  4X68 A;  2PU4 A;  2HP5 A;  4B93 A;  4P0M A;  2XK1 A;  2WKP A;  5EV0 A;  1TDL A;  2R9X A;  4D2O A;  2ZC4 B;  1L0G A;  3LR4 A;  3MKF A;  3OCN A;  1K0K A;  1L2S A;  1K54 A;  3IWQ A;  4MLL A;  3T1S A;  1LSV A;  4DE1 A;  2Z2M B;  3KYZ A;  1OT6 A;  4GZB A;  5IU1 A;  3QP8 A;  1SKF A;  1TS6 A;  2OAP 1;  2X71 A;  1L0E A;  1DP8 A;  2J3T D;  4CLC A;  3R4K A;  4R23 A;  2GNX A;  4LV2 A;  4DKI A;  5K5B A;  4HJ6 A;  3MQ0 A;  2H0T A;  4QY5 A;  4EEP A;  4OPQ A;  4X55 A;  3K3C A;  5FQI A;  2ZOH A;  5J3W A;  3TG9 A;  3GV9 A;  2XGN A;  3S22 A;  1JTD A;  3P7N A;  4UA6 A;  3BFD A;  3ZG7 B;  3UNW A;  4XUZ A;  2JBF A;  2WZZ A;  4MDZ A;  1FOF A;  1L0F A;  4Y7P A;  3OZH A;  4IVK A;  3V39 A;  2O9A A;  2PDR A;  3T1R A;  4K0W A;  2JKR I;  2P7J A;  2EXB A;  1K38 A;  1TS0 A;  5IT5 A;  3OPR A;  1LL5 A;  3FKW A;  4WMC D;  3F1O A;  5F69 A;  3ZGA B;  1OPX A;  4N9L A;  5L8M A;  5GHZ A;  1CQA A;  2A3U A;  2WGW A;  4PHT A;  2Y55 A;  3G4P A;  4E3M A;  1ERO A;  1S4S A;  4S2N A;  4HIA A;  2GDN A;  2VV7 A;  2UWX A;  4WMC A;  5HSQ A;  4BEN A;  1P9W A;  4FD8 A;  4C6Y A;  1MWU A;  4K0X A;  4S2L A;  2V9A A;  1ESI A;  3LIF A;  3QP6 A;  2ZC7 A;  4EER A;  5AVE A;  1BT5 A;  1HZO A;  4UA9 A;  1GHP A;  3IF6 C;  5HL6 A;  3T12 B;  3UN7 A;  2QKP A;  4ARZ B;  1ERQ A;  3BEB A;  2OLU A;  2P9V B;  3QNB A;  3GMW A;  3BQ8 A;  1MWR A;  3H7W B;  4K08 A;  4HJ3 A;  1YKD A;  1S4R A;  2PHY A;  4CLC D;  3A3J A;  1IYP A;  4GHI A;  5HDC A;  1W7F A;  3Q1F A;  3C38 A;  3VOL A;  3MZD A;  5CEC A;  3UY6 A;  4PPR A;  2VV6 A;  1HD8 A;  1X0O A;  1H8M A;  3UO9 A;  3U4L P;  3EEA A;  1XKZ A;  1BTL A;  1MXO A;  4CJN A;  1BLH A;  1NJ4 A;  5I5L A;  2PYR A;  4I3A A;  5EVI A;  5TBM A;  5EVL A;  2XRN A;  4QD4 A;  2B5R A;  3NOP C;  4N1H A;  1N4O A;  2V1A A;  1XPB A;  2XDM A;  2JC7 A;  3NC8 A;  1VB6 A;  3CLO A;  1MWT A;  1FR6 A;  3SS5 A;  2WKE A;  2A2L A;  2Y2M A;  1PW8 A;  4DXC A;  4ZAM A;  2A24 B;  4KZ9 A;  4RX2 A;  5KIZ A;  3CWF A;  1E25 A;  3ZYT A;  4FTX A;  1FR1 A;  3A3E A;  1DJB A;  1OTA A;  3IXH A;  4E3J A;  2Y79 A;  2H28 A;  4NET A;  5FDH A;  1EI5 A;  2V8C A;  4KZA A;  4BWI A;  1WE4 A;  2Y2J A;  3E4Q A;  3NOU C;  2XD1 A;  4JLF A;  1H0M A;  2PD7 A;  1G5U A;  4BBV A;  1MKM A;  3FC7 A;  4HP9 A;  4JXS A;  3V50 A;  4H6J B;  4MBF A;  3C8C A;  3VE3 A;  3CPT B;  2ZOI A;  2OV5 A;  4ID4 A;  4KUO A;  1WA9 A;  4A5R A;  4WM9 A;  4YWZ A;  3UME A;  4NXG A;  3RH8 B;  5AVF A;  3VP1 A;  1OT9 A;  2G7U A;  4FSF A;  4B4X A;  4E3N A;  2WYX A;  3LUQ A;  3T1X A;  2MJ6 A;  5HPF A;  3T4T A;  4YFM A;  5JYP A;  2HPB A;  2HDR A;  1J3W A;  3NY4 A;  3LR3 A;  2Y59 A;  3M6H A;  1GA9 A;  4E6X A;  4JF4 A;  1NRF A;  2A49 A;  4WL9 A;  3VE4 A;  1ES4 A;  3VOZ A;  4MBH A;  1T18 A;  4BBU A;  1CI8 A;  3LGO A;  5FQQ A;  3PYP A;  1RCJ A;  1O07 A;  3IHA A;  4BD0 A;  2O0Y A;  3E2L A;  3I7J A;  3W8K A;  3F1N B;  2V20 A;  4HBU A;  2R78 A;  3UE1 A;  3WRZ A;  1ZHH B;  4PM5 A;  3C7V A;  4R3B A;  1PW1 A;  2IWB A;  4NG2 A;  5HWV A;  3V3S A;  3ZNY A;  1FCM A;  3H9W A;  1PYY A;  3CUE A;  3FPV A;  3LY4 A;  1YLP A;  4S2K A;  3NIA A;  1XA1 A;  1K4F A;  5DVA A;  3HLG A;  1K56 D;  3RXW A;  3T4K A;  1NYM A;  1C3B A;  1F5M A;  3QP5 A;  4U3T A;  5F1F A;  5DKL A;  3ISG A;  1KE4 A;  1KE0 A;  3D72 A;  3ZHH A;  4DDS A;  4Y0U A;  4MN5 A;  4WF0 A;  3G6O A;  1ACF A;  5FL3 A;  2WKQ A;  5EE8 A;  4MN7 A;  1LL9 A;  1T1A A;  3S7P A;  4EUZ A;  1PWD A;  3G35 A;  2Y2N A;  2W1T A;  1SDE A;  3HLW A;  3NJA A;  1Y54 A;  1ZG6 A;  3HVF A;  1LT0 A;  4CPK A;  5AQ9 A;  4X69 A;  4EBN A;  5C5K A;  5EFW A;  2VKS A;  3SOI A;  1PI4 A;  3K2N A;  5F83 A;  2A24 A;  5EOO A;  1PI5 A;  5M19 A;  4UHU A;  4QJG A;  1N9O A;  5HD5 A;  1K56 A;  3M6B A;  2IA2 A;  1NLY A;  4UQI S;  2J7V A;  5IHV A;  2ZC6 B;  3BQA A;  2WAD A;  1MPL A;  4C75 A;  2QMI A;  3C5A A;  3AGD A;  5M18 A;  4WZ5 A;  2RCX A;  2DRW A;  4R3J A;  3PR6 A;  1AXB A;  1MBL A;  3DBA A;  2I72 A;  5EM0 A;  4KQR A;  1V9Z A;  5KSH A;  4BLM A;  1K6R A;  3NI9 A;  3LID A;  1FIL A;  5TBM B;  4YIN A;  4WEK A;  2YKF A;  3IS2 A;  3UB8 A;  3EEH A;  1YSP A;  1S6R A;  3MF0 A;  3WS0 A;  1ERM A;  3LIE A;  3SH7 A;  4LCL A;  2M7U A;  4XT2 A;  5J7E A;  4R4S A;  1DRM A;  3B47 A;  4FH4 A;  1JWV A;  3BEC A;  4OQI A;  2OLV A;  4Y2F A;  4RQ9 A;  2XR0 A;  3QP4 A;  5FQ9 A;  4OP5 A;  5FI6 A;  3MR0 A;  5L09 A;  1TS8 A;  3H7W A;  1K25 A;  2FFF B;  3BYD A;  3LCE A;  3ZG9 B;  3T4J A;  3E4O A;  3VP0 A;  3IH9 A;  3ZG8 B;  2CC1 A;  1IYS A;  1K57 C;  1GHI A;  5E2H A;  3BFG A;  2EA9 A;  5L07 A;  2PR5 A;  3KO6 A;  1I2W A;  2KX6 A;  4O8G A;  1W79 A;  3O5Y A;  1G6O A;  1O7E A;  3GEC A;  3HLE A;  4R70 A;  2ZBB A;  2B95 A;  2ZM8 A;  4OPR A;  5U47 A;  4LRY C;  4QHC A;  3V67 A;  4ZTK A;  1NZO A;  3BY8 A;  4UQI M;  5TJJ A;  1NYY A;  1K6S A;  4MEZ A;  3VP2 A;  5AQ7 A;  1W63 Q;  4ME4 A;  3TE8 A;  3BFF A;  3VMA A;  3VP4 A;  2BTF P;  5F5Y A;  1BSG A;  1IFQ A;  5CGW A;  3DWZ A;  2P08 A;  3E98 A;  4NXF A;  1W8Q A;  2GJ3 A;  1P9R A;  2W3F A;  4O01 A;  3G2Z A;  3PBO A;  1WYC A;  4XT2 B;  1YLZ A;  4ESP A;  5E2E A;  1Q2Q A;  3UPP A;  1E4D A;  1FSW A;  5FAP A;  4KZ6 A;  2KOI A;  4JGR A;  1VHM A;  4P6B A;  1K55 C;  3UE0 A;  2X01 A;  1MY8 A;  4EES A;  1JWZ A;  4E3I A;  3IQA A;  2Q0O A;  3OLO A;  4E3K A;  4KG6 A;  2JE5 A;  1YLJ A;  2FFY A;  2J3W A;  4DXB A;  3LYX A;  2W27 A;  5E2G A;  3F1P B;  3HUM A;  2Y2L A;  3TW8 A;  3Q07 A;  3HJK A;  2J80 A;  3G2Y A;  4IBR A;  2ZQ9 A;  3GRJ A;  2XEP A;  4HP4 A;  4KQD A;  3WRT A;  4OVD A;  1OTD A;  3G34 A;  2W1R A;  5FEF A;  4E3O A;  3DTK A;  4R6L A;  3MXS A;  5G18 A;  2ZQC A;  1IYO A;  2I9V A;  1XJ4 A;  3CIT A;  4EQI A;  3PBS A;  5KZH A;  3A0V A;  4OOL A;  2ZMA A;  3GVB A;  2ZC3 B;  4PM6 A;  4OLD A;  4GS9 B;  5CTM A;  2P04 A;  3MMH A;  3N4I A;  1IEL A;  1J9M A;  4S2J A;  4LGW A;  5HPI A;  4LLO B;  1XJ3 A;  4OPZ A;  3ITB A;  3G30 A;  2ZQA A;  5DFX A;  4GJ4 A;  4GNU A;  3LIB A;  1CI9 A;  4JXG A;  3NDE A;  1BYW A;  3IX4 A;  1KDS A;  2XFT A;  2OWJ A;  1YLY A;  3WWX A;  2HJ9 C;  5CHU A;  2XD5 A;  3LIA A;  1KGG A;  1NY0 A;  4I39 A;  3C30 A;  3HUN A;  4GOG A;  2LB9 A;  3HLC A;  4ZDX A;  4OQ0 A;  1PRQ A;  3KX0 X;  1Y4O A;  4PMA A;  4X1M A;  3IXD A; 
#chains in the Genus database with same CATH homology
 3MXQ A;  3LR3 A;  4GHI B;  5HDD A;  3CAX A;  2HGV A;  1NRJ A;  4WEL A;  3P01 A;  4LRX C;  2VA0 A;  2J3T C;  4I5S A;  4NKP A;  4WL9 A;  4NXB A;  3VE4 A;  1T18 A;  3VV4 A;  2NUP C;  1OTB A;  4BBU A;  5HD3 A;  4EU0 A;  3PYP A;  2O0Y A;  3F1N B;  4HNB A;  2R78 A;  3NOT C;  3IS2 B;  3IBR A;  4I38 A;  4IUH A;  1ZHH B;  3UMD A;  3BJN A;  4NEE D;  3B42 A;  2VGL M;  3B33 A;  5HWV A;  2Z6C A;  3H9W A;  3CUE A;  5G4Z A;  3FPV A;  2EWV A;  1GSW A;  1GSV A;  2D02 A;  4MCW A;  2FZ0 A;  4G3V A;  4DJ3 A;  3S7Q A;  2VV8 A;  4PKY A;  1JNU A;  1OJG A;  3T4K A;  1N9N A;  3EQU A;  3E0Y A;  3OBF A;  2XA7 M;  4LRZ E;  3E4P A;  1F5M A;  3CI6 A;  3T4L A;  4O0P A;  1ODV A;  3PBN A;  5DKL A;  2GX5 A;  4L0L A;  3UB7 A;  3KSH A;  5LBR A;  4BMW A;  2LB5 A;  4WN5 A;  2Z6D A;  3D72 A;  2PYP A;  4R38 A;  5AJG A;  2OWH A;  3UB6 A;  3KSI A;  3HCY A;  4MN5 A;  1F9I A;  1Y28 A;  3H82 A;  4WF0 A;  4Q0H A;  1GSX A;  3G6O A;  4HHD A;  4L9E A;  2V0U A;  3JVV A;  5FL3 A;  3HJI A;  2WKQ A;  5HWT A;  2W3H A;  1S1Z A;  2OOL A;  1D7E A;  4Y3I A;  4YNR A;  4MN7 A;  4BJP A;  1T1A A;  3S7P A;  3BWL A;  1TF1 A;  1UGU A;  2W1T A;  3EGX C;  1LSW A;  3OC2 A;  3NJA A;  4UEY A;  1TD5 A;  2W3E A;  4HQA A;  4Z1W A;  3A0S A;  1ZTU A;  3MQQ A;  4H6J A;  4EET B;  1T1B A;  2QJ7 A;  3R7W B;  1OTE A;  1LT0 A;  2O99 A;  2FH5 A;  3SW1 A;  1YSQ A;  3BW6 A;  4HI4 A;  5C5K A;  2L1M A;  4Y5F A;  5EFW A;  1MC0 A;  2VKS A;  4L9G A;  3RFB A;  3F1P A;  4FOF A;  2W3D A;  3K2N A;  2A24 A;  2Y8H A;  3A0R A;  1DP9 A;  3GDI A;  2HJE A;  1F98 A;  3TJZ C;  4HH3 A;  1N9O A;  5HD5 A;  1TS7 A;  5F68 A;  1T19 A;  2XSS A;  2IA2 A;  1NLY A;  3RTY A;  4B93 A;  4UQI S;  5DJT A;  3LR0 A;  4II7 A;  2B18 A;  2JN7 A;  2WKP A;  5HDS A;  4GW9 A;  3BQA A;  4R3A A;  5F6A A;  3C2W A;  3LR4 A;  3OCN A;  4GCZ A;  1V9Y A;  3S7N A;  3MJQ A;  2O9B A;  3JVU A;  4OOM A;  3PR6 A;  3DBA A;  1LSV A;  4I3I A;  3MQO A;  3KYZ A;  1OT6 A;  3KYQ A;  5IU1 A;  1TS6 A;  2OAP 1;  3NHQ A;  1V9Z A;  2QHK A;  2J3T D;  1DP8 A;  5KSH A;  1DP6 A;  4CLC A;  3LID A;  5TBM B;  3R4K A;  2GNX A;  4WEK A;  2YKF A;  3IS2 A;  4IJG A;  1S66 L;  5K5B A;  3UB8 A;  4HJ6 A;  1STZ A;  5HZH A;  3EEH A;  1YSP A;  3MQ0 A;  4GS9 A;  3ZQ5 A;  1P0Z A;  5A8B A;  2HV1 A;  2DMW A;  3MF0 A;  4EEP A;  3K3C A;  3LIE A;  2ZOH A;  5DKK A;  5J3W A;  2JKT I;  2VZW A;  4PAU A;  2VLG A;  2XA7 S;  2M7U A;  4KQO A;  2O9C A;  4XT2 A;  5J7E A;  5MC7 A;  3PBR A;  1DRM A;  3B47 A;  2QYB A;  1XJ6 A;  3P7N A;  2ZMF A;  2GZA A;  2JKR M;  2KLI A;  4G3K A;  4HH2 A;  4MDZ A;  3PXP A;  1G28 A;  4Y2F A;  2ZMV A;  4RQ9 A;  2L0W A;  4CLC E;  2O9A A;  4IUK A;  2PDR A;  3PBT A;  1OJ5 A;  3MR0 A;  2JKR I;  2P7J A;  1TS8 A;  1TS0 A;  3H7W A;  5IT5 A;  4P6Z M;  3F1O A;  3T4J A;  5F69 A;  3E4O A;  3FPW A;  2VJW A;  1OPX A;  5L8M A;  1XJ2 A;  4IHQ A;  4PKY G;  3TRC A;  4PHT A;  5HWW A;  1P97 A;  4DJ2 A;  1LSX A;  3F1N A;  3ICY A;  5J4E A;  1S4S A;  3UE3 A;  4HIA A;  2JHE A;  2VV7 A;  4ETZ A;  2EA9 A;  2M1C A;  3K3D A;  4AFI A;  2PR5 A;  3KO6 A;  5HSQ A;  3ULF A;  2V1B A;  1P9W A;  5DF9 A;  2B02 A;  2KX6 A;  1YAX A;  4ARZ A;  4O8G A;  3O5Y A;  3T50 A;  1G6O A;  1UWP X;  2PT7 A;  4DN0 A;  4DMZ A;  3GEC A;  4R70 A;  2V0W A;  2ZBB A;  4EEU A;  2QJ5 A;  2V9A A;  3LIF A;  4EER A;  4G3W A;  5AVE A;  4CLC C;  2QWS A;  4LRY C;  3V67 A;  2W3G A;  3BY8 A;  2K2N A;  3LI9 A;  2NUT C;  4UQI M;  5TJJ A;  4YOF A;  1T1C A;  5HL6 A;  1W63 Q;  4ME4 A;  3TE8 A;  1N9L A;  2QKP A;  4ARZ B;  3LIC A;  3OOV A;  1OTI A;  3KSF A;  5F5Y A;  1UWN X;  3PHY A;  1IFQ A;  3BQ8 A;  3H7W B;  4K08 A;  2P08 A;  3H82 B;  4HJ3 A;  1YKD A;  1S4R A;  3E98 A;  4NXF A;  2PHY A;  4CLC D;  3D3O A;  2L4R A;  2GJ3 A;  4GHI A;  3EOI A;  4CLC B;  4CQH A;  5HDC A;  3R7W A;  1P9R A;  3C38 A;  4WEJ A;  3VOL A;  2W3F A;  1XFN A;  4O01 A;  3CUE C;  4KUK A;  1MZU A;  3PBO A;  2VV6 A;  4XT2 B;  2W1T B;  4MMN A;  4WLA A;  1X0O A;  1H8M A;  2PR6 A;  3EEA A;  3EWK A;  1NLZ A;  3F1O B;  5I5L A;  3UE6 A;  4Q0J A;  2KOI A;  4JGO A;  1S1Y A;  2PYR A;  4I3A A;  2XRO A;  5TBM A;  4JGR A;  1VHM A;  2XRN A;  3PBQ A;  3NOP C;  4NXE A;  2V1A A;  5IS1 A;  3U2A A;  4EES A;  1VB6 A;  3CLO A;  3IBJ A;  4BBT A;  3OLO A;  4ZRR A;  2A2L A;  4EQ1 A;  2VGL S;  2J3W A;  4HJ4 A;  4F3L B;  2A24 B;  4E04 A;  2EWW A;  4Q0I A;  1XFQ A;  1NWZ A;  3LYX A;  2W27 A;  5KIZ A;  3CWF A;  3F1P B;  3OCL A;  3ZYT A;  2BAS A;  5DFY A;  3TW8 A;  3EGD C;  4P6Z S;  4F3L A;  1OTA A;  3HJK A;  2J80 A;  2YKH A;  2Y79 A;  2H28 A;  2D01 A;  4HP4 A;  4KQD A;  3KSG A;  2INW A;  1IOU A;  1OTD A;  2VX8 A;  4HY8 A;  4M4X A;  4BWI A;  2W1R A;  4R6L A;  1S67 L;  4I3J A;  3E4Q A;  3NOU C;  4JGQ A;  2CMN A;  1KOU A;  2I9V A;  1XJ4 A;  3CIT A;  1LL8 A;  3LI8 A;  3PBS A;  2KDK A;  3A0V A;  4EW7 A;  1H3Q A;  2HF6 A;  3W2Z A;  4OOL A;  2PD7 A;  4BBV A;  2K31 A;  1MKM A;  3FC7 A;  4WUJ A;  3T4O A;  4GS9 B;  4HP9 A;  2P04 A;  3MMH A;  3MFX A;  4H6J B;  4B9O A;  5HPI A;  4LLO B;  1XJ3 A;  4L9F A;  3C8C A;  3VE3 A;  2ZOI A;  4GJ4 A;  5DFX A;  4ETX A;  2VEA A;  3LIB A;  2JKT M;  4QPR A;  3LR5 A;  5CX7 A;  3S7O A;  4KUO A;  1D06 A;  1WA9 A;  3T4S A;  4EXO A;  1BYW A;  2OAQ 1;  4HOI A;  3FG8 A;  4LPZ A;  1W63 M;  4YWZ A;  2OWJ A;  3UME A;  5G4Y A;  2HJ9 C;  4NXG A;  3LIA A;  3RH8 B;  5AVF A;  3UB9 A;  1EW0 A;  4I39 A;  4EUV A;  1OT9 A;  2G7U A;  2PD8 A;  4FSF A;  3C30 A;  3T4Q A;  3EQV A;  2K7S A;  2LB9 A;  4JGP A;  3BY9 A;  4GLQ A;  2WKR A;  3LUQ A;  3LFV A;  2M7V A;  2MJ6 A;  5HPF A;  3KX0 X;  3T4T A;  5DJU A;  4MN6 A;  2W0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...