4GS9B

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with an inactive benzoxadiazole antagonist
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
PTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Development of Inhibitors of the PAS-B Domain of the HIF-2 alpha Transcription Factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
total genus 28
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4gs9B01
4WF0A 5A8BA 1T1CA 1OTAA 3LI9A 4HY8A 4LRYC 2ZOIA 3OLOA 4I38A 5HZHA 1P97A 2ZOHA 5AVEA 1DP8A 3E4QA 5J3WA 3UB6A 1N9NA 5HDSA 1OTDA 3VE3A 4EESA 4GHIB 4HOIA 5HD5A 4EXOA 5J7EA 2VV7A 1LSWA 5HDDA 2A24B 4HJ6A 4R3AA 5DKLA 4KQDA 3UB8A 1N9LA 4XT2A 2ZBBA 3P7NA 1WA9A 1LT0A 1T1BA 1MZUA 3MXQA 4DJ2A 4EW7A 3LIDA 3A0VA 2YKFA 1LSVA 2QHKA 1DP9A 3BWLA 3GDIA 3H7WA 4GS9A 4I3JA 5DJTA 2HV1A 2PD7A 5EFWA 2KDKA 2H28A 1XJ4A 2QWSA 2D02A 3FC7A 1JNUA 3H7WB 1X0OA 2L0WA 1XJ2A 2GJ3A 3C8CA 3NOUC 4HJ4A 2PR6A 4WN5A 4HP9A 4BBTA 2PYPA 2VLGA 5HWVA 3F1NA 4M4XA 4JGQA 1S66L 3F1OA 4LRXC 2PDRA 5HWWA 1D7EA 3CAXA 4R38A 5F68A 5I5LA 3NOPC 3F1OB 3ICYA 3PYPA 5F69A 4EETB 5AVFA 2INWA 2KX6A 1LSXA 1UWNX 1TS6A 3BY9A 1DRMA 3KX0X 1F9IA 3NHQA 4I39A 4NXBA 1TS0A 4F3LB 3F1PA 1UWPX 3LICA 5KIZA 3E4OA 4HH3A 4HIAA 4WL9A 1VB6A 4JGRA 2R78A 4HQAA 3MFXA 5F5YA 3MR0A 3NOTC 2CMNA 3H82B 1OTEA 2JN7A 3A0RA 4XT2B 3IS2A 4KUKA 2JHEA 3C2WA 4GCZA 4I3AA 4RQ9A 3UMDA 3IBRA 3K3CA 1S4SA 3CLOA 4H6JA 5TBMA 3RTYA 3CWFA 3A0SA 4PKYA 4HI4A 1Y28A 4EEPA 4HJ3A 4WLAA 1V9ZA 3LYXA 2V1BA 1BYWA 1T18A 1S67L 3RH8B 2VV8A 1DP6A 4JGPA 3UMEA 3NJAA 4K08A 4LRZE 1XJ3A 3D72A 2OWHA 2VEAA 1UGUA 1ODVA 2V0UA 2J80A 3LUQA 4HH2A 4NXFA 2EA9A 2WKQA 4GW9A 4H6JB 2I9VA 2PYRA 4YWZA 3K3DA 4MN6A 5HSQA 3H82A 4WUJA 3VE4A 1OJ5A 3EWKA 2OOLA 5F6AA 1N9OA 2WKPA 3PHYA 3SW1A 2M1CA 2PR5A 3F1NB 4R6LA 1TS8A 2BASA 3F1PB 2L4RA 3UB9A 5IS1A 1OTIA 4HHDA 5IU1A 2QJ5A 3ULFA 2D01A 5HD3A 3LI8A 4L9EA 2PD8A 4PKYG 4EQ1A 3G6OA 1S4RA 1KOUA 4LLOB 5G4ZA 2YKHA 3UE6A 4EERA 4F3LA 1OJGA 3LIAA 5DKKA 5HDCA 2P7JA 2K7SA 3UB7A 4BBUA 4BBVA 2A24A 2Z6CA 2B02A 3ZQ5A 3EEHA 4E04A 2L1MA 2V0WA 1TS7A 2OWJA 4GS9B 2V9AA 2QJ7A 3E4PA 2VV6A 2Z6DA 3HJIA 4I3IA 1S1ZA 1T19A 1XJ6A 3IS2B 4KUOA 2PHYA 1OTBA 2QKPA 3MJQA 4MN5A 4NXGA 3MQOA 3VOLA 4GHIA 4DJ3A 1OT9A 3B33A 3FG8A 3T50A 1S1YA 3GECA 4R70A 4LPZA 4B9OA 5HWTA 1OT6A 1T1AA 5G4YA 1F98A 1P0ZA 4HP4A 4L9FA 4EEUA 3HJKA 3MQQA 1EW0A 2W27A 3H9WA 3LIFA 1XFQA 3LIEA 2WKRA 4I5SA 4L9GA 4NXEA 5J4EA 1GSWA 5TBMB 5DJUA 1GSXA 1LL8A 1XFNA 4JGOA 3BY8A 1G28A 3LIBA 1V9YA 1GSVA 2W0NA 1D06A 2V1AA 1NWZA 4HNBA
chains in the Genus database with same CATH superfamily
1FCMA 4WF0A 1ZKJA 4B4ZA 4G3WA 1KVLA 4K0WA 4Y17A 1W8YA 1N9LA 1H0MA 3A3DA 1T1BA 3CITA 2QHKA 3ITBA 5DJTA 4BJPA 2B5RA 3DWZA 2K2NA 3Q7ZA 1CK3A 5DVAA 1N4OA 2GZAA 1MXOA 4FH2A 3LICA 4EU0A 3MFXA 2HF6A 2Y2KA 4DE0A 3TOIA 3C2WA 3V67A 4N1XA 4WLAA 1SKOB 3MMHA 4WYYA 3BECA 3IX3A 1PZOA 3B3XA 5HARA 4CLCB 2ZJ9A 1ESUA 5TGFA 1FSWA 2PU2A 4DDYA 3D4FA 4IHQA 4OLGA 1MWTA 4KZ5A 2DRWA 2IWDA 3ULFA 1IKGA 4OOLA 3OPRA 2V20A 3TRCA 3UE1A 5JYOA 2P7JA 4OPZA 4D60A 1MC0A 1ERMA 4E04A 1GCEA 2EFXA 2OWJA 1NJ4A 2V9AA 4GS9B 2JCHA 1GHMA 4X1MA 4WZ5C 4YNRA 4JF5A 4JBFA 5FAPA 3MZFA 3EGXC 3OBFA 2J9OA 2Y2HA 3ZNYA 4F94A 2FH5A 3LY4A 5GHZA 5GHYA 1D06A 3TSGA 5MC7A 3DTEA 1OMEA 3AGEA 2ZOIA 4I38A 4FSFA 5FAOA 3MSHA 2XR0A 1K0KA 3VP1A 3A0VA 4CLCE 5HX9A 3VP4A 2QWSA 4MCWA 3UMEA 3BQAA 1BULA 1S66L 3F1OA 3CJMA 4OLDA 5F68A 5CHJA 3PYPA 4X56A 2GX5A 1U60A 1JWZA 3I7JA 2X01A 1HZOA 1TS0A 5L8MA 3G2YA 1BLSA 3M6BA 5CEBA 2JN7A 1IEMA 2JKTI 3BLSA 3IBRA 3LEZA 3RTYA 4MDZA 3UO9A 3SZTA 4LRZE 3HLCA 4Q0IA 4FH4A 1XXMA 1O7EA 2WKQA 1VQQA 2EX8A 2I9VA 4KENB 3HCYA 3BJNA 1OTIA 4RVAA 2G2UA 4RX3A 4Y3IA 3ZG9B 4E3KA 1CQAA 4BBUA 3KYEA 2H0YA 1YAXA 4QJGA 4NXGA 4DJ3A 2XEPA 1BSGA 3A3FA 3QNCA 4FCFA 1F98A 2WZZA 4MNRA 1MPLA 2P9VB 2XFTA 2WGWA 4DXCA 5DF8A 4P6ZM 4MLLA 3ZNTA 3IT9A 1FCNA 2I72A 4GD6A 4C6YA 1SZVA 5FDSA 3BW6A 4Y5FA 5HDSA 1XA1A 2P08A 3UPOA 2R9XA 1K54C 1P9RA 5FL3A 3OOVA 1DJBA 4Y0TA 4DJ2A 4JLFA 2YKFA 4O7DA 2Q9MA 5EFWA 2H28A 3FC7A 1ONHA 2GJ3A 3NOUC 4X53A 5L2FA 3SS3A 5FEFA 3IXDA 2Q9NA 4R38A 2XGNA 3NOPC 3UB5P 3SOIA 5KIZA 3UPNA 1KDWA 3BFGA 1I5QA 2H10A 2Y4AA 5FQ9A 4O01A 3KYZA 4K08A 1NLZA 2Y2GA 4NXFA 2EA9A 2FFFB 2Y2MA 4ARZB 1NXYA 3NCKA 5F1GA 3GMWA 2ZM2A 1PW8A 2PR5A 4EBLA 1I2WA 3F1PB 3SH9A 5EVEA 3O3VA 4GKUA 3S7QA 4DE3A 1JWVA 4PMAA 3KO6A 1DJAA 2QYBA 5J3WA 3FG8A 4X1LA 3LR3A 3FPVA 3HVFA 5CXWA 4EEUA 1L2SA 3KSGA 4NXEA 1G6AA 2DMWA 4CLCA 5E2GA 3SH7A 4KQOA 4B88A 5E2EA 1JTDA 4NKPA 3LI9A 4N92A 2ZOHA 2A49A 2HDQA 3OCNA 1N9NA 4E3LA 1LSWA 4EUVA 1ZG6A 2WGWB 1YSPA 1HVBA 4F3LB 3NULA 3H7WA 2XROA 1ZHHB 4R3JA 1K55A 4UA6A 3T4KA 3S22A 2WKIA 4S2JA 4PPRA 3MBZA 5I5LA 3G2ZA 1MBLA 2KX6A 3NHQA 3CZDA 3W4QA 1BLHA 1SDEA 5GLBA 4HESA 1A0KA 2WKEA 4PHTA 4KUKA 2KOIA 3Q7VB 1SHVA 5CECA 3PAEA 1W7FA 2HDUA 1BYWA 1WYBA 2J7VA 1S67L 3GR2A 1XJ3A 3LGOA 2XD1A 2MJ6A 2ZC7A 4WUJA 2OOLA 3Q81A 2VA0A 3TW8A 2UV0E 4UA9A 2PBDP 3T1QB 4X6TA 1ESIA 4L9EA 1H8MA 1S4RA 3GSGA 2K7SA 2B02A 2ZMFA 3JVVA 3T4LA 1YLYA 3MQOA 4DE2A 4HEFA 3ZGAB 5HAPA 2W3DA 4PM5A 1NRJA 1XGJA 3E2KA 3GTCA 1MY8A 2H0TA 4YOFA 4B93A 1F2KA 1YKDA 3KSIA 4OH0A 1Y4OA 4N9KA 1T1CA 3ZDJA 1FR6A 2P74A 1BT5A 4XXRA 3C4OA 4OQGA 5J7EA 4HOIA 3BM6A 5HDDA 5EOEA 3UN7A 3BWLA 5LBRA 5L07A 2HGVA 1VETB 2V8CA 3C8CA 4MBKA 1TDGA 2ZC4B 4E3IA 2Y8HA 2HDRA 3UE0A 1D7EA 3C30A 5FQMA 3BY9A 1NYMA 5HPFA 1G68A 4LV1A 3V5MA 3B47A 1OTEA 4ETXA 5TBMA 4HI4A 4PM6A 4WEJA 3IXGA 4JGPA 3D72A 2WUQA 2ZC6B 1ODVA 4BENA 1Z6FA 4GW9A 2VZWA 1RCJA 4Q0HA 5TR7A 5HSQA 3G30A 3VE4A 2NUPC 1ZC2A 3SW1A 2ZQCA 2VJWA 4RYEA 1YMSA 3ZVTA 4HHDA 1FQGA 3NBLA 1BLCA 3R4KA 3S4XA 1XA7A 3WS5A 1WYCA 4ZJ1A 4JF6A 5DFXA 3HJIA 1LLBA 2O99A 3HLDA 4BLMA 3NI9A 3HLEA 3DBAA 3LR0A 1OT6A 1DJCA 3H9WA 4ZDXA 3ZHHA 5FQIA 3A3EA 2ZQ9A 1LL8A 4GOGA 1ONGA 2Q0OA 2E8IA 3OPHA 3GQZA 3RFBA 4OVDA 4KZ8A 3VSLA 5EECA 4QD4A 5EV0A 5DKLA 2LB9A 1LT0A 4I3JA 1VEUB 3UB8A 1HLUP 2VLGA 3UPPA 4JGQA 2ZQ7A 3FWLA 5CTMA 3KX0X 4I39A 1YMXA 4UEYA 4NXBA 5CRFA 1K4FA 3NOTC 1PFLA 4Y0UA 3IS2A 4ID4A 2XF3A 1CJFA 2Y2OA 4OOYA 4P87A 4JXGA 2XH9A 5E2HA 1F5MA 3TE8A 4H6JB 3M2JA 2WKPA 1LI9A 2XK1A 1PWGA 4N1HA 3OPPA 1D1JA 4ZRRA 3A3JA 3FYZA 2M7UA 2ZLYA 3T12B 1SKFA 2ZC3B 5DKKA 2XFSA 1K55C 1L0EA 1ZTUA 2A24A 3HLFA 1S0WA 2K31A 1E3UD 3UNWA 3VV4A 4R3AA 3G32A 4I3IA 3CHWP 4HBUA 3W8KA 1K4EA 1K56D 2ZMVA 3MQQA 1H3QA 2A2LA 3TJZC 4ZJ2A 3PR6A 4JGOA 4BWIA 2VGLS 3E0YA 4KZ4A 1GSVA 2EX6A 3CPTB 3QP8A 5FAQA 2W0NA 1G6OA 2FZ0A 4JKTA 5IS1A 4DE1A 1Y54A 4E6XA 1YLTA 4LRYC 5HZHA 3OZHA 1XPBA 5AQAA 2W3GA 2V8FA 3G4PA 3UDIA 1PYYA 3SH8A 2W3HA 1JNUA 3QP2A 4OP5A 5HL1A 4ZJ3A 5AVFA 3RXWA 2EFUA 3AGDA 1IYPA 1UWNX 2VK3A 3MZDA 4JXVA 3F1PA 4C75A 3ZG5A 4S2KA 5DFYA 4KZBA 3UY6A 3K3CA 3WS0A 4EEPA 1Y28A 4R4RA 1DP6A 4NETA 4GLQA 5U47A 2J80A 3IH9A 3FZCA 4GD8A 2Z2MB 3EWKA 2Y2LA 2JE5A 5FDHA 4UAAA 3GVBA 5FEGA 1GHIA 3PBNA 2IA2A 3W2ZA 4P0MA 2Y2PA 2JKGA 4BBVA 2XDMA 3ZG0A 1W63Q 3EEHA 5F1FA 2QJ7A 2PHYA 3DTMA 3VP3A 2WGVA 2ZM0A 4JF4A 3IF5A 1RGYA 1Z09A 2EX2A 3BEBA 4LGWA 1ES2A 5C5KA 4NK3A 5CGWA 3VFFA 2XLNA 5EVIC 4RX2A 5FASA 1TD5A 3VFHA 3RJUA 4HJ6A 5HFOA 3WWXA 5DTTA 5GHXA 4EW7A 3LIDA 3GDIA 2PD7A 5D3OA 4OONA 2D02A 3MXRA 4HJ4A 2XSSA 4B4XA 3QP1A 4PM8A 3ZCZA 4P85A 2EX9A 3CAXA 1XP4A 2J3TC 3UE3A 4LFUA 3P01A 2ZQAA 1W63M 2BG1A 2O9CA 1GHPA 2CMNA 3UMDA 4GDNA 4PKYA 3WS4A 1IYQA 2B95A 1CF0A 1KGFA 4X69A 3OC2A 1FSYA 1UGUA 3QP5A 4R0QA 5G18A 4BD0A 3H82A 2ZQDA 1XGIA 1OJ5A 4KQRA 4H8RA 1QMEA 5EPHA 3C7VA 5AJGA 1AXBA 4R6LA 2BASA 2PBYA 2QJ5A 4UQIM 5HD3A 4QWOA 4LLOB 2CC1A 1OJGA 3UB7A 1MWSA 2JBFA 3ZQ5A 2NUTC 1IKIA 1TS7A 1FCOA 4MMNA 3UB9A 3EQUA 3Q07A 3VOLA 4LCMA 4WMCA 2W27A 1NYYA 3V50A 1HD8A 5IHVA 3LIBA 1TF1A 2VGKA 1PIOA 3A3IA 3M6HA 3QHYA 3G34A 4IVKA 3K2NA 1ZG4A 3BFEA 5HD5A 1LL9A 4CLCD 4CQHA 2IWCA 3T4TA 3O5YA 1E3UA 5FI6A 2HV1A 4GS9A 1XKZA 4JPMA 3PTEA 4DDSA 3DW0A 3CG5A 2PYPA 5EVLA 1PW1A 2PDRA 5HWWA 2WYXA 3S7OA 3S7PA 2P04A 1DRMA 1HTZA 1KGEA 1K25A 3P98A 2WAEA 4QY5A 3HREA 5FA7A 2HP6A 5EOOA 4GCZA 4PM9A 4KG5A 3CWFA 3NDGA 3DTKA 1YSQA 3Q82A 3LYXA 3U4LP 4DXBA 2V2FF 4QB8A 2O0YA 1MKMA 3LCEA 4YWZA 2EWVA 1N9OA 4DMZA 2M1CA 4BD1A 4FTXA 2L4RA 4CJNA 3PAGA 4KZ9A 3LI8A 2HJ9C 2W1TB 3L9KA 3SS4A 2X71A 5EUAA 2HZ5A 3UDXA 1T19A 2OSUA 4EETB 4MN5A 5HAQA 3B33A 3T50A 3GECA 3O88A 1JWPA 1EW0A 3HUOA 4OQ0A 3IQAA 3MQ0A 5TBMB 1H5XA 4BL2A 1NWZA 5A8BA 1YLPA 1H8YA 1SCWA 3W4OA 1EI5A 4EESA 1OTDA 4OKPA 4G3VA 5HAIA 3DTIA 4RA7A 3T1SA 4G3KA 3RXXA 1IOUA 5HWVA 1YLJA 4IUKA 3R7WB 2W1TA 2INWA 1LSXA 3IH8A 3N7WA 5GLAA 1H8ZA 1MKIA 1OPXA 1C3BA 3PBTA 1L0DA 1G5UA 5AQ9A 1AWIA 4XT2B 5E43A 4RQ9A 4PM7A 1BLPA 1IYOA 3EQVA 2V1BA 3MF0A 3G31A 4R23A 1J3WA 1SDNA 2OWHA 5KZHA 4KZ7A 3CI6A 1I2SA 2PD8A 4DN0A 3G6OA 2HP9A 2J3WA 2QMIA 3BQ8A 1NRFA 2Z6DA 4E3JA 2QKPA 5M1AA 3JVUA 2BLSA 4B9OA 4LPZA 1P0ZA 4P6BA 1MWRA 1XFQA 4I5SA 2WKRA 5CHUA 4UQIS 2W3EA 4O8GA 1JTGA 3AGFA 4E6WA 4K0XA 2V1AA 1K6RA 4GZBA 2ZM8A 4GNUA 5AQBA 3N8LA 5DTSA 5HL6A 3IWIA 1P97A 3E4QA 1K54A 2VV7A 3CUEA 3DWKA 4MBFA 4EBPA 5CERA 4II7A 3IWQA 5HDCA 4IUHA 1X0OA 2L0WA 1XX2A 4X55A 4BBTA 2R9WA 1GA9A 3E98A 4M4XA 5J8XA 5F69A 4Y0OA 4XUZA 1TS6A 1NY0A 1E4DA 1L3LA 3S7NA 4UHUA 1TVFA 3M2KA 3IXBA 1S4SA 3A0SA 1IFQA 1M6KA 3RH8B 3CUEC 2PRFA 5AQ7A 4FD8A 2VEAA 1LHYA 3T4QA 4Q8IA 2A3UA 1ERQA 3PHYA 3F1NB 4K91A 4R1GA 3UE6A 4OQHA 5K5BA 1YPRA 2L1MA 3E4PA 3W4PA 5IT5A 1S1ZA 4ZTKA 2EWWA 3NY4A 4R70A 2VGLM 4S2IA 5HWTA 3UDFA 4HP4A 3NDEA 4LENA 4PAUA 2PT7A 4Z9QA 4P6ZS 3C38A 3IS2B 4HY8A 4Z1WA 5AVEA 1DP8A 1MWUA 2RL3A 3UB6A 4EWFA 1EWZA 1PI4A 3FV7A 5E2FA 4S2LA 4OQIA 3ZVWA 4YFMA 1WA9A 1O07A 3MXQA 2J8YA 3QP4A 1K56A 2WGIA 1PZPA 2JKRM 3F1NA 1BZAA 3GRJA 2WADA 3ICYA 5GLCA 3PBRA 5CX7A 3QP6A 3LEQA 3IXHA 3PBQA 3ZG7B 2JKRI 3E4OA 4HIAA 4KQQA 1VB6A 4R3BA 4Y13A 3N8RA 2R78A 3E2LA 4CLCC 1WE4A 5FQQA 2JHEA 3N4IA 2Y2NA 4ME4A 3O86A 5HW3A 1DY6A 4Q0JA 4OOMA 1BTLA 2XRNA 2V0UA 3V39A 3LUQA 4HH2A 3N8SA 5CTNA 3T4JA 3BYDA 5FQJA 3P09A 1NZOA 3QNBA 5TFQA 2VX8A 1PWDA 4PKYG 3U2AA 2DNSA 2W1RA 5CEDA 3ISGA 2YKHA 3BFDA 3BLMA 3NECA 3R7WA 1GA0A 2HJEA 4MBHA 3IHBA 3FKWA 1OT9A 1NZUA 1S1YA 4AFIA 1RGZA 3HJKA 4Y15A 1CI9A 4EV4A 1XFNA 3IF6A 4WEKA 2V1ZA 5GLDA 1YLWA 3JYIA 2OLUA 4KG2A 2QZ6A 2HDSA 5DTKA 3D9YA 1LI0A 2B18A 3VE3A 3Q7VA 4EXOA 3HL9A 1YQSA 2QPNA 5M19A 4MN7A 2WK0A 5EVIB 4NG2A 4Y2FA 4HP9A 4LRXC 3EOIA 5A93A 3HUNA 1F9IA 1UWPX 3KSFA 1ALQA 3VMAA 4S2NC 3WS2A 4HQAA 1TEMA 4GN2A 4DRTA 3A0RA 4R4SA 4BL3A 2W3FA 4KZ6A 4I3AA 5CGXA 1KE4A 2FFYA 3C4PA 2Y91A 3FPWA 1T18A 2XQZA 4WMCD 1FIKA 4OP8A 4WM9A 4WZ4A 4X25A 5FATA 3MZEA 3OPLA 1QMFA 5M18A 5JYPA 5KSCA 5F6AA 3IBJA 4D2OA 4L0LA 4C3QA 2X02A 3FKVA 4S2MA 4EQIA 3OCLA 3SS5A 4E3OA 1KOUA 4M3KA 2M7VA 2IWBA 3IX8A 3V3SA 2V0WA 2Y79A 3ZFZA 5EVIA 3G35A 1OTBA 2C6WB 1VETA 3ITAA 4XUXA 4ESPA 1KE0A 4ETZA 1FR1A 3LR5A 3N6IA 1Q2PA 4L9GA 3LIEA 1P9WA 3HUMA 2Y59A 4JXSA 2ZL1A 2G2WA 4UA7A 1CEGA 3MKEA 2XD5A 4EBNA 3OLOA 3VSKA 1ES3A 2A24B 4KQDA 3JPUA 4XT2A 3P7NA 1TDLA 4WELA 2ACGA 1LSVA 4EQ1A 5CHMA 3KSHA 3T1RA 1XJ2A 4E3NA 2PR6A 1EROA 4LV3A 4IJGA 1Q2QA 1W8QA 2C5WB 5KMWA 3IX4A 4N9LA 1KGGA 3HLGA 2JKFA 4A5RA 5GL9A 4HH3A 3WRZA 2WZXA 3MFDA 4JGRA 2EXAA 5A90A 4IEDA 3NIAA 4U0TA 1BUEA 3MXSA 3CLOA 4LV2A 5CGSA 1JVJA 4U0XA 3NJAA 3CPTA 3EEAA 1CI8A 1KDSA 1K6SA 2J3TD 2XA7M 4DKIA 1PWCA 3VOYA 2ZQ8A 5FI2A 3LR4A 1VM1A 1STZA 3PBOA 1VEUA 2GNXA 4LCLA 2Z2LB 2RCXA 2BTFP 2OAQ1 1L0GA 1VHMA 4EERA 2Y55A 4ZBEA 4OPYA 3WS1A 4HBTA 4KZ3A 1PNEA 3VP2A 3IF6C 4QY6A 3PBSA 3WRTA 3MJQA 4IBXA 2GDNA 1T1AA 1FOFA 2DCFA 2G7UA 2ZC5B 5FSRA 4GJ4A 5J4EA 4KZAA 1GSXA 4MEZA 2EXBA 1G28A 5F82A 3EGDC 1V9YA 4EUZA 5TJJA 4QU3A 3ZG8B 1K57C 2AVXA 3T4OA 1OTAA 3T1XA 3TG9A 3HBRA 4GHIB 4IBRA 3B42A 4QHCA 4ZAMA 2KLIA 1PRQA 1N9BA 1MZUA 3PXPA 2LB5A 4NEED 4YINA 3LFVA 3H7WB 4S2NA 4OPRA 3ZYTA 4WN5A 2WKHA 1ES4A 3F1OB 5EVID 1K38A 1LL5A 2ZMAA 5DJUA 4IVIA 4CPKA 1W79A 3V3RA 3IHAA 4WL9A 1W5DA 4JXWA 5FI7A 5F5YA 3H82B 4X68A 3VOZA 1S6RA 2H5SA 3BFCA 2VV8A 3NC8A 1ACFA 5L10A 3KYQA 2ZD8A 1RP5A 2JC7A 2PYRA 1FILA 4MN6A 3VP0A 4WBGA 4FUWA 3C5AA 1YLZA 2D01A 3L7HA 5EE8A 3S1YA 2Y2QA 5G4ZA 1IYSA 4F3LA 5L09A 1K57A 3LIAA 3Q1FA 5DF9A 2Z6CA 3GV9A 5F83A 3C7UA 3BRMA 1XJ6A 4GB7A 2OLVA 1YM1A 3T4SA 5G4YA 3BFFA 4L9FA 2OV5A 4E3MA 2JKTM 3HLWA 5HPIA 1GSWA 1IELA 3IF6B 3D3OA 4KG6A 3LO7A 1ES5A 5EM0A 2HP5A 4S2PA 2PAVP 1E25A 2ZBBA 2O9BA 3HLBA 1DP9A 4BQMA 4DF6A 5EM1A 5BOHA 2KDKA 1XJ4A 4OPQA 4LV0A 4S2OA 5A91A 3O87A 2OAP1 5KSHA 3DAVA 1NLYA 4ARZA 1KE3A 1CEFA 3MR0A 2Y2IA 2ZL1B 4H6JA 1YT4A 4Y7PA 3LY3A 1M40A 4U3TA 4HJ3A 1V9ZA 1J9MA 2P9VA 5A92A 4QPRA 2PU4A 2Y2JA 2E8JA 4GDBA 4BMWA 2VKSA 3K3DA 5I94A 3MKFA 1TS8A 3IWOA 5IU1A 2J9PA 1PI5A 5FQKA 2HPBA 4WZ5A 4O0PA 2VV6A 4KUOA 2VGJA 1KVMA 2XA7S 2UWXA 2WAFA 4GHIA 3CMZA 3MS6A 1SKOA 2O9AA 3LIFA 5DF7A 4FOFA 3BY8A 4HNBA 1L0FA
chains in the Genus database with same CATH topology
4WF0A 1T1CA 4G3WA 3K2NA 2B18A 3VE3A 5HD5A 4HOIA 5J7EA 4EXOA 4CLCD 5HDDA 4CQHA 1N9LA 3T4TA 3O5YA 1T1BA 3CITA 2QHKA 4MN7A 3BWLA 5DJTA 2HV1A 5LBRA 4BJPA 2HGVA 4GS9A 3C8CA 4Y2FA 2K2NA 4HP9A 2PYPA 2Y8HA 4LRXC 2PDRA 5HWWA 1D7EA 3C30A 3S7OA 3EOIA 3S7PA 2GZAA 2P04A 3BY9A 1DRMA 1F9IA 4EU0A 1UWPX 3LICA 5HPFA 3KSFA 4HQAA 3MFXA 2HF6A 3B47A 1OTEA 3A0RA 2W3FA 4ETXA 3C2WA 4GCZA 4I3AA 3V67A 5TBMA 3CWFA 4HI4A 1YSQA 4WLAA 3LYXA 3FPWA 1T18A 4WEJA 3MMHA 4JGPA 3D72A 1ODVA 4GW9A 2O0YA 1MKMA 2VZWA 4CLCB 4YWZA 4Q0HA 5HSQA 3VE4A 5F6AA 2EWVA 1N9OA 3IBJA 2NUPC 4L0LA 4DMZA 3SW1A 4IHQA 2M1CA 2VJWA 2L4RA 4HHDA 3ULFA 4OOLA 3LI8A 2HJ9C 3OCLA 2W1TB 3R4KA 1KOUA 3TRCA 2P7JA 2M7VA 1MC0A 4E04A 2V0WA 2Y79A 2OWJA 5DFXA 4GS9B 2V9AA 3HJIA 1T19A 4EETB 2O99A 1OTBA 4MN5A 3B33A 3T50A 3DBAA 3GECA 3LR0A 4YNRA 1OT6A 4ETZA 3LR5A 3EGXC 3OBFA 1EW0A 3H9WA 4L9GA 3LIEA 2FH5A 3MQ0A 5TBMB 1LL8A 1P9WA 1D06A 1NWZA 5MC7A 5A8BA 2ZOIA 3OLOA 4I38A 3RFBA 4FSFA 4EESA 1OTDA 4G3VA 2A24B 5DKLA 4KQDA 4XT2A 2LB9A 3P7NA 1LT0A 4WELA 3A0VA 4I3JA 1LSVA 4EQ1A 4CLCE 2QWSA 3KSHA 4G3KA 4MCWA 3UB8A 3UMEA 1XJ2A 3BQAA 1IOUA 2PR6A 2VLGA 5HWVA 4IJGA 4JGQA 1S66L 3F1OA 4IUKA 5F68A 3PYPA 3R7WB 2GX5A 2W1TA 2INWA 3KX0X 1LSXA 4I39A 4UEYA 4NXBA 1TS0A 5L8MA 4HH3A 4JGRA 1OPXA 3PBTA 3NOTC 4XT2B 2JN7A 3IS2A 2JKTI 4RQ9A 3IBRA 3CLOA 3RTYA 3EQVA 4MDZA 2V1BA 3MF0A 3NJAA 4LRZE 3EEAA 2OWHA 4Q0IA 1F5MA 3TE8A 2WKQA 4H6JB 2I9VA 2J3TD 2XA7M 2WKPA 3LR4A 3CI6A 1STZA 3HCYA 3BJNA 1OTIA 3PBOA 4ZRRA 2GNXA 4Y3IA 2PD8A 2M7UA 2OAQ1 3G6OA 4DN0A 1VHMA 4EERA 2J3WA 5DKKA 4BBUA 1ZTUA 2A24A 3BQ8A 2K31A 3VV4A 1YAXA 4R3AA 2Z6DA 3PBSA 4I3IA 3MJQA 4NXGA 2QKPA 4DJ3A 3JVUA 4B9OA 4LPZA 1T1AA 1F98A 1P0ZA 2G7UA 2ZMVA 3MQQA 4GJ4A 1H3QA 1XFQA 4I5SA 2WKRA 2A2LA 4UQIS 3TJZC 5J4EA 3PR6A 1GSXA 2W3EA 4JGOA 4P6ZM 1G28A 4O8GA 4BWIA 2VGLS 3E0YA 3EGDC 1V9YA 1GSVA 2W0NA 1G6OA 2V1AA 2FZ0A 5TJJA 5IS1A 3T4OA 1OTAA 5HL6A 4LRYC 5HZHA 3BW6A 1P97A 3E4QA 4Y5FA 5HDSA 4GHIB 2P08A 2VV7A 3CUEA 2W3GA 3B42A 1P9RA 5FL3A 2KLIA 4II7A 3OOVA 1MZUA 4DJ2A 3PXPA 2YKFA 2LB5A 2W3HA 5EFWA 4NEED 2H28A 3LFVA 5HDCA 3FC7A 3H7WB 1JNUA 4IUHA 1X0OA 2L0WA 2GJ3A 3NOUC 3ZYTA 4WN5A 4BBTA 3E98A 4M4XA 4R38A 3NOPC 3F1OB 5F69A 5AVFA 5DJUA 1UWNX 1TS6A 3S7NA 3F1PA 5KIZA 4WL9A 5F5YA 3H82B 5DFYA 3K3CA 1S4SA 3A0SA 4EEPA 1Y28A 4O01A 1IFQA 3RH8B 2VV8A 1DP6A 3CUEC 3KYZA 4K08A 3KYQA 2VEAA 1NLZA 4GLQA 3T4QA 2J80A 4NXFA 2EA9A 2PYRA 4ARZB 4MN6A 3EWKA 3PHYA 2PR5A 3F1NB 3F1PB 3PBNA 2D01A 2IA2A 3W2ZA 5G4ZA 3UE6A 4F3LA 3S7QA 3LIAA 5DF9A 4BBVA 3KO6A 2Z6CA 1W63Q 3EEHA 5K5BA 2L1MA 2QJ7A 3E4PA 2QYBA 1S1ZA 1XJ6A 5J3WA 5IT5A 2PHYA 2EWWA 3FG8A 4R70A 2VGLM 3LR3A 5HWTA 3FPVA 3T4SA 5G4YA 4L9FA 4HP4A 4EEUA 2JKTM 3KSGA 4NXEA 5HPIA 5C5KA 1GSWA 4PAUA 2PT7A 4P6ZS 2DMWA 4CLCA 3C38A 4KQOA 3D3OA 3IS2B 4NKPA 3LI9A 4HY8A 1TD5A 4Z1WA 2ZOHA 5AVEA 1DP8A 3OCNA 3UB6A 1N9NA 1LSWA 4HJ6A 4EUVA 1YSPA 2ZBBA 1WA9A 2O9BA 3MXQA 4EW7A 4F3LB 3LIDA 1DP9A 3GDIA 3H7WA 2PD7A 2KDKA 2XROA 1XJ4A 2D02A 1ZHHB 4HJ4A 2XSSA 3T4KA 2JKRM 3F1NA 3CAXA 5I5LA 2OAP1 3ICYA 2J3TC 3PBRA 5CX7A 3UE3A 5KSHA 2KX6A 3NHQA 1NLYA 3PBQA 3P01A 1W63M 2JKRI 3E4OA 4HIAA 4ARZA 1VB6A 2O9CA 2R78A 4CLCC 3MR0A 2CMNA 4PHTA 4KUKA 2JHEA 3UMDA 2KOIA 4H6JA 4ME4A 4PKYA 4HJ3A 1V9ZA 1BYWA 4Q0JA 1S67L 4OOMA 4QPRA 3OC2A 1XJ3A 2XRNA 1UGUA 2V0UA 2MJ6A 3LUQA 4HH2A 4BMWA 2VKSA 3K3DA 3T4JA 3H82A 4WUJA 1OJ5A 2OOLA 2VA0A 3TW8A 5AJGA 2VX8A 4R6LA 1TS8A 2BASA 5IU1A 2QJ5A 4UQIM 5HD3A 4L9EA 4PKYG 3U2AA 1H8MA 1S4RA 2W1RA 4LLOB 2YKHA 1OJGA 2K7SA 3UB7A 4O0PA 3R7WA 2HJEA 3ZQ5A 2B02A 2ZMFA 3JVVA 2NUTC 3T4LA 1TS7A 4MMNA 3UB9A 2VV6A 4KUOA 3EQUA 3MQOA 2XA7S 4GHIA 3VOLA 1OT9A 1S1YA 4AFIA 2O9AA 2W3DA 3HJKA 3LIFA 2W27A 1NRJA 4FOFA 1XFNA 3BY8A 4YOFA 4B93A 3LIBA 1TF1A 4WEKA 1YKDA 3KSIA 4HNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WF0 A;  5A8B A;  1T1C A;  1OTA A;  3LI9 A;  4HY8 A;  4LRY C;  2ZOI A;  3OLO A;  4I38 A;  5HZH A;  1P97 A;  2ZOH A;  5AVE A;  1DP8 A;  3E4Q A;  5J3W A;  3UB6 A;  1N9N A;  5HDS A;  1OTD A;  3VE3 A;  4EES A;  4GHI B;  4HOI A;  5HD5 A;  4EXO A;  5J7E A;  2VV7 A;  1LSW A;  5HDD A;  2A24 B;  4HJ6 A;  4R3A A;  5DKL A;  4KQD A;  3UB8 A;  1N9L A;  4XT2 A;  2ZBB A;  3P7N A;  1WA9 A;  1LT0 A;  1T1B A;  1MZU A;  3MXQ A;  4DJ2 A;  4EW7 A;  3LID A;  3A0V A;  2YKF A;  1LSV A;  2QHK A;  1DP9 A;  3BWL A;  3GDI A;  3H7W A;  4GS9 A;  4I3J A;  5DJT A;  2HV1 A;  2PD7 A;  5EFW A;  2KDK A;  2H28 A;  1XJ4 A;  2QWS A;  2D02 A;  3FC7 A;  1JNU A;  3H7W B;  1X0O A;  2L0W A;  1XJ2 A;  2GJ3 A;  3C8C A;  3NOU C;  4HJ4 A;  2PR6 A;  4WN5 A;  4HP9 A;  4BBT A;  2PYP A;  2VLG A;  5HWV A;  3F1N A;  4M4X A;  4JGQ A;  1S66 L;  3F1O A;  4LRX C;  2PDR A;  5HWW A;  1D7E A;  3CAX A;  4R38 A;  5F68 A;  5I5L A;  3NOP C;  3F1O B;  3ICY A;  3PYP A;  5F69 A;  4EET B;  5AVF A;  2INW A;  2KX6 A;  1LSX A;  1UWN X;  1TS6 A;  3BY9 A;  1DRM A;  3KX0 X;  1F9I A;  3NHQ A;  4I39 A;  4NXB A;  1TS0 A;  4F3L B;  3F1P A;  1UWP X;  3LIC A;  5KIZ A;  3E4O A;  4HH3 A;  4HIA A;  4WL9 A;  1VB6 A;  4JGR A;  2R78 A;  4HQA A;  3MFX A;  5F5Y A;  3MR0 A;  3NOT C;  2CMN A;  3H82 B;  1OTE A;  2JN7 A;  3A0R A;  4XT2 B;  3IS2 A;  4KUK A;  2JHE A;  3C2W A;  4GCZ A;  4I3A A;  4RQ9 A;  3UMD A;  3IBR A;  3K3C A;  1S4S A;  3CLO A;  4H6J A;  5TBM A;  3RTY A;  3CWF A;  3A0S A;  4PKY A;  4HI4 A;  1Y28 A;  4EEP A;  4HJ3 A;  4WLA A;  1V9Z A;  3LYX A;  2V1B A;  1BYW A;  1T18 A;  1S67 L;  3RH8 B;  2VV8 A;  1DP6 A;  4JGP A;  3UME A;  3NJA A;  4K08 A;  4LRZ E;  1XJ3 A;  3D72 A;  2OWH A;  2VEA A;  1UGU A;  1ODV A;  2V0U A;  2J80 A;  3LUQ A;  4HH2 A;  4NXF A;  2EA9 A;  2WKQ A;  4GW9 A;  4H6J B;  2I9V A;  2PYR A;  4YWZ A;  3K3D A;  4MN6 A;  5HSQ A;  3H82 A;  4WUJ A;  3VE4 A;  1OJ5 A;  3EWK A;  2OOL A;  5F6A A;  1N9O A;  2WKP A;  3PHY A;  3SW1 A;  2M1C A;  2PR5 A;  3F1N B;  4R6L A;  1TS8 A;  2BAS A;  3F1P B;  2L4R A;  3UB9 A;  5IS1 A;  1OTI A;  4HHD A;  5IU1 A;  2QJ5 A;  3ULF A;  2D01 A;  5HD3 A;  3LI8 A;  4L9E A;  2PD8 A;  4PKY G;  4EQ1 A;  3G6O A;  1S4R A;  1KOU A;  4LLO B;  5G4Z A;  2YKH A;  3UE6 A;  4EER A;  4F3L A;  1OJG A;  3LIA A;  5DKK A;  5HDC A;  2P7J A;  2K7S A;  3UB7 A;  4BBU A;  4BBV A;  2A24 A;  2Z6C A;  2B02 A;  3ZQ5 A;  3EEH A;  4E04 A;  2L1M A;  2V0W A;  1TS7 A;  2OWJ A;  4GS9 B;  2V9A A;  2QJ7 A;  3E4P A;  2VV6 A;  2Z6D A;  3HJI A;  4I3I A;  1S1Z A;  1T19 A;  1XJ6 A;  3IS2 B;  4KUO A;  2PHY A;  1OTB A;  2QKP A;  3MJQ A;  4MN5 A;  4NXG A;  3MQO A;  3VOL A;  4GHI A;  4DJ3 A;  1OT9 A;  3B33 A;  3FG8 A;  3T50 A;  1S1Y A;  3GEC A;  4R70 A;  4LPZ A;  4B9O A;  5HWT A;  1OT6 A;  1T1A A;  5G4Y A;  1F98 A;  1P0Z A;  4HP4 A;  4L9F A;  4EEU A;  3HJK A;  3MQQ A;  1EW0 A;  2W27 A;  3H9W A;  3LIF A;  1XFQ A;  3LIE A;  2WKR A;  4I5S A;  4L9G A;  4NXE A;  5J4E A;  1GSW A;  5TBM B;  5DJU A;  1GSX A;  1LL8 A;  1XFN A;  4JGO A;  3BY8 A;  1G28 A;  3LIB A;  1V9Y A;  1GSV A;  2W0N A;  1D06 A;  2V1A A;  1NWZ A;  4HNB A; 
#chains in the Genus database with same CATH topology
 1FCM A;  4WF0 A;  1ZKJ A;  4B4Z A;  4G3W A;  1KVL A;  4K0W A;  4Y17 A;  1W8Y A;  1N9L A;  1H0M A;  3A3D A;  1T1B A;  3CIT A;  2QHK A;  3ITB A;  5DJT A;  4BJP A;  2B5R A;  3DWZ A;  2K2N A;  3Q7Z A;  1CK3 A;  5DVA A;  1N4O A;  2GZA A;  1MXO A;  4FH2 A;  3LIC A;  4EU0 A;  3MFX A;  2HF6 A;  2Y2K A;  4DE0 A;  3TOI A;  3C2W A;  3V67 A;  4N1X A;  4WLA A;  1SKO B;  3MMH A;  4WYY A;  3BEC A;  3IX3 A;  1PZO A;  3B3X A;  5HAR A;  4CLC B;  2ZJ9 A;  1ESU A;  5TGF A;  1FSW A;  2PU2 A;  4DDY A;  3D4F A;  4IHQ A;  4OLG A;  1MWT A;  4KZ5 A;  2DRW A;  2IWD A;  3ULF A;  1IKG A;  4OOL A;  3OPR A;  2V20 A;  3TRC A;  3UE1 A;  5JYO A;  2P7J A;  4OPZ A;  4D60 A;  1MC0 A;  1ERM A;  4E04 A;  1GCE A;  2EFX A;  2OWJ A;  1NJ4 A;  2V9A A;  4GS9 B;  2JCH A;  1GHM A;  4X1M A;  4WZ5 C;  4YNR A;  4JF5 A;  4JBF A;  5FAP A;  3MZF A;  3EGX C;  3OBF A;  2J9O A;  2Y2H A;  3ZNY A;  4F94 A;  2FH5 A;  3LY4 A;  5GHZ A;  5GHY A;  1D06 A;  3TSG A;  5MC7 A;  3DTE A;  1OME A;  3AGE A;  2ZOI A;  4I38 A;  4FSF A;  5FAO A;  3MSH A;  2XR0 A;  1K0K A;  3VP1 A;  3A0V A;  4CLC E;  5HX9 A;  3VP4 A;  2QWS A;  4MCW A;  3UME A;  3BQA A;  1BUL A;  1S66 L;  3F1O A;  3CJM A;  4OLD A;  5F68 A;  5CHJ A;  3PYP A;  4X56 A;  2GX5 A;  1U60 A;  1JWZ A;  3I7J A;  2X01 A;  1HZO A;  1TS0 A;  5L8M A;  3G2Y A;  1BLS A;  3M6B A;  5CEB A;  2JN7 A;  1IEM A;  2JKT I;  3BLS A;  3IBR A;  3LEZ A;  3RTY A;  4MDZ A;  3UO9 A;  3SZT A;  4LRZ E;  3HLC A;  4Q0I A;  4FH4 A;  1XXM A;  1O7E A;  2WKQ A;  1VQQ A;  2EX8 A;  2I9V A;  4KEN B;  3HCY A;  3BJN A;  1OTI A;  4RVA A;  2G2U A;  4RX3 A;  4Y3I A;  3ZG9 B;  4E3K A;  1CQA A;  4BBU A;  3KYE A;  2H0Y A;  1YAX A;  4QJG A;  4NXG A;  4DJ3 A;  2XEP A;  1BSG A;  3A3F A;  3QNC A;  4FCF A;  1F98 A;  2WZZ A;  4MNR A;  1MPL A;  2P9V B;  2XFT A;  2WGW A;  4DXC A;  5DF8 A;  4P6Z M;  4MLL A;  3ZNT A;  3IT9 A;  1FCN A;  2I72 A;  4GD6 A;  4C6Y A;  1SZV A;  5FDS A;  3BW6 A;  4Y5F A;  5HDS A;  1XA1 A;  2P08 A;  3UPO A;  2R9X A;  1K54 C;  1P9R A;  5FL3 A;  3OOV A;  1DJB A;  4Y0T A;  4DJ2 A;  4JLF A;  2YKF A;  4O7D A;  2Q9M A;  5EFW A;  2H28 A;  3FC7 A;  1ONH A;  2GJ3 A;  3NOU C;  4X53 A;  5L2F A;  3SS3 A;  5FEF A;  3IXD A;  2Q9N A;  4R38 A;  2XGN A;  3NOP C;  3UB5 P;  3SOI A;  5KIZ A;  3UPN A;  1KDW A;  3BFG A;  1I5Q A;  2H10 A;  2Y4A A;  5FQ9 A;  4O01 A;  3KYZ A;  4K08 A;  1NLZ A;  2Y2G A;  4NXF A;  2EA9 A;  2FFF B;  2Y2M A;  4ARZ B;  1NXY A;  3NCK A;  5F1G A;  3GMW A;  2ZM2 A;  1PW8 A;  2PR5 A;  4EBL A;  1I2W A;  3F1P B;  3SH9 A;  5EVE A;  3O3V A;  4GKU A;  3S7Q A;  4DE3 A;  1JWV A;  4PMA A;  3KO6 A;  1DJA A;  2QYB A;  5J3W A;  3FG8 A;  4X1L A;  3LR3 A;  3FPV A;  3HVF A;  5CXW A;  4EEU A;  1L2S A;  3KSG A;  4NXE A;  1G6A A;  2DMW A;  4CLC A;  5E2G A;  3SH7 A;  4KQO A;  4B88 A;  5E2E A;  1JTD A;  4NKP A;  3LI9 A;  4N92 A;  2ZOH A;  2A49 A;  2HDQ A;  3OCN A;  1N9N A;  4E3L A;  1LSW A;  4EUV A;  1ZG6 A;  2WGW B;  1YSP A;  1HVB A;  4F3L B;  3NUL A;  3H7W A;  2XRO A;  1ZHH B;  4R3J A;  1K55 A;  4UA6 A;  3T4K A;  3S22 A;  2WKI A;  4S2J A;  4PPR A;  3MBZ A;  5I5L A;  3G2Z A;  1MBL A;  2KX6 A;  3NHQ A;  3CZD A;  3W4Q A;  1BLH A;  1SDE A;  5GLB A;  4HES A;  1A0K A;  2WKE A;  4PHT A;  4KUK A;  2KOI A;  3Q7V B;  1SHV A;  5CEC A;  3PAE A;  1W7F A;  2HDU A;  1BYW A;  1WYB A;  2J7V A;  1S67 L;  3GR2 A;  1XJ3 A;  3LGO A;  2XD1 A;  2MJ6 A;  2ZC7 A;  4WUJ A;  2OOL A;  3Q81 A;  2VA0 A;  3TW8 A;  2UV0 E;  4UA9 A;  2PBD P;  3T1Q B;  4X6T A;  1ESI A;  4L9E A;  1H8M A;  1S4R A;  3GSG A;  2K7S A;  2B02 A;  2ZMF A;  3JVV A;  3T4L A;  1YLY A;  3MQO A;  4DE2 A;  4HEF A;  3ZGA B;  5HAP A;  2W3D A;  4PM5 A;  1NRJ A;  1XGJ A;  3E2K A;  3GTC A;  1MY8 A;  2H0T A;  4YOF A;  4B93 A;  1F2K A;  1YKD A;  3KSI A;  4OH0 A;  1Y4O A;  4N9K A;  1T1C A;  3ZDJ A;  1FR6 A;  2P74 A;  1BT5 A;  4XXR A;  3C4O A;  4OQG A;  5J7E A;  4HOI A;  3BM6 A;  5HDD A;  5EOE A;  3UN7 A;  3BWL A;  5LBR A;  5L07 A;  2HGV A;  1VET B;  2V8C A;  3C8C A;  4MBK A;  1TDG A;  2ZC4 B;  4E3I A;  2Y8H A;  2HDR A;  3UE0 A;  1D7E A;  3C30 A;  5FQM A;  3BY9 A;  1NYM A;  5HPF A;  1G68 A;  4LV1 A;  3V5M A;  3B47 A;  1OTE A;  4ETX A;  5TBM A;  4HI4 A;  4PM6 A;  4WEJ A;  3IXG A;  4JGP A;  3D72 A;  2WUQ A;  2ZC6 B;  1ODV A;  4BEN A;  1Z6F A;  4GW9 A;  2VZW A;  1RCJ A;  4Q0H A;  5TR7 A;  5HSQ A;  3G30 A;  3VE4 A;  2NUP C;  1ZC2 A;  3SW1 A;  2ZQC A;  2VJW A;  4RYE A;  1YMS A;  3ZVT A;  4HHD A;  1FQG A;  3NBL A;  1BLC A;  3R4K A;  3S4X A;  1XA7 A;  3WS5 A;  1WYC A;  4ZJ1 A;  4JF6 A;  5DFX A;  3HJI A;  1LLB A;  2O99 A;  3HLD A;  4BLM A;  3NI9 A;  3HLE A;  3DBA A;  3LR0 A;  1OT6 A;  1DJC A;  3H9W A;  4ZDX A;  3ZHH A;  5FQI A;  3A3E A;  2ZQ9 A;  1LL8 A;  4GOG A;  1ONG A;  2Q0O A;  2E8I A;  3OPH A;  3GQZ A;  3RFB A;  4OVD A;  4KZ8 A;  3VSL A;  5EEC A;  4QD4 A;  5EV0 A;  5DKL A;  2LB9 A;  1LT0 A;  4I3J A;  1VEU B;  3UB8 A;  1HLU P;  2VLG A;  3UPP A;  4JGQ A;  2ZQ7 A;  3FWL A;  5CTM A;  3KX0 X;  4I39 A;  1YMX A;  4UEY A;  4NXB A;  5CRF A;  1K4F A;  3NOT C;  1PFL A;  4Y0U A;  3IS2 A;  4ID4 A;  2XF3 A;  1CJF A;  2Y2O A;  4OOY A;  4P87 A;  4JXG A;  2XH9 A;  5E2H A;  1F5M A;  3TE8 A;  4H6J B;  3M2J A;  2WKP A;  1LI9 A;  2XK1 A;  1PWG A;  4N1H A;  3OPP A;  1D1J A;  4ZRR A;  3A3J A;  3FYZ A;  2M7U A;  2ZLY A;  3T12 B;  1SKF A;  2ZC3 B;  5DKK A;  2XFS A;  1K55 C;  1L0E A;  1ZTU A;  2A24 A;  3HLF A;  1S0W A;  2K31 A;  1E3U D;  3UNW A;  3VV4 A;  4R3A A;  3G32 A;  4I3I A;  3CHW P;  4HBU A;  3W8K A;  1K4E A;  1K56 D;  2ZMV A;  3MQQ A;  1H3Q A;  2A2L A;  3TJZ C;  4ZJ2 A;  3PR6 A;  4JGO A;  4BWI A;  2VGL S;  3E0Y A;  4KZ4 A;  1GSV A;  2EX6 A;  3CPT B;  3QP8 A;  5FAQ A;  2W0N A;  1G6O A;  2FZ0 A;  4JKT A;  5IS1 A;  4DE1 A;  1Y54 A;  4E6X A;  1YLT A;  4LRY C;  5HZH A;  3OZH A;  1XPB A;  5AQA A;  2W3G A;  2V8F A;  3G4P A;  3UDI A;  1PYY A;  3SH8 A;  2W3H A;  1JNU A;  3QP2 A;  4OP5 A;  5HL1 A;  4ZJ3 A;  5AVF A;  3RXW A;  2EFU A;  3AGD A;  1IYP A;  1UWN X;  2VK3 A;  3MZD A;  4JXV A;  3F1P A;  4C75 A;  3ZG5 A;  4S2K A;  5DFY A;  4KZB A;  3UY6 A;  3K3C A;  3WS0 A;  4EEP A;  1Y28 A;  4R4R A;  1DP6 A;  4NET A;  4GLQ A;  5U47 A;  2J80 A;  3IH9 A;  3FZC A;  4GD8 A;  2Z2M B;  3EWK A;  2Y2L A;  2JE5 A;  5FDH A;  4UAA A;  3GVB A;  5FEG A;  1GHI A;  3PBN A;  2IA2 A;  3W2Z A;  4P0M A;  2Y2P A;  2JKG A;  4BBV A;  2XDM A;  3ZG0 A;  1W63 Q;  3EEH A;  5F1F A;  2QJ7 A;  2PHY A;  3DTM A;  3VP3 A;  2WGV A;  2ZM0 A;  4JF4 A;  3IF5 A;  1RGY A;  1Z09 A;  2EX2 A;  3BEB A;  4LGW A;  1ES2 A;  5C5K A;  4NK3 A;  5CGW A;  3VFF A;  2XLN A;  5EVI C;  4RX2 A;  5FAS A;  1TD5 A;  3VFH A;  3RJU A;  4HJ6 A;  5HFO A;  3WWX A;  5DTT A;  5GHX A;  4EW7 A;  3LID A;  3GDI A;  2PD7 A;  5D3O A;  4OON A;  2D02 A;  3MXR A;  4HJ4 A;  2XSS A;  4B4X A;  3QP1 A;  4PM8 A;  3ZCZ A;  4P85 A;  2EX9 A;  3CAX A;  1XP4 A;  2J3T C;  3UE3 A;  4LFU A;  3P01 A;  2ZQA A;  1W63 M;  2BG1 A;  2O9C A;  1GHP A;  2CMN A;  3UMD A;  4GDN A;  4PKY A;  3WS4 A;  1IYQ A;  2B95 A;  1CF0 A;  1KGF A;  4X69 A;  3OC2 A;  1FSY A;  1UGU A;  3QP5 A;  4R0Q A;  5G18 A;  4BD0 A;  3H82 A;  2ZQD A;  1XGI A;  1OJ5 A;  4KQR A;  4H8R A;  1QME A;  5EPH A;  3C7V A;  5AJG A;  1AXB A;  4R6L A;  2BAS A;  2PBY A;  2QJ5 A;  4UQI M;  5HD3 A;  4QWO A;  4LLO B;  2CC1 A;  1OJG A;  3UB7 A;  1MWS A;  2JBF A;  3ZQ5 A;  2NUT C;  1IKI A;  1TS7 A;  1FCO A;  4MMN A;  3UB9 A;  3EQU A;  3Q07 A;  3VOL A;  4LCM A;  4WMC A;  2W27 A;  1NYY A;  3V50 A;  1HD8 A;  5IHV A;  3LIB A;  1TF1 A;  2VGK A;  1PIO A;  3A3I A;  3M6H A;  3QHY A;  3G34 A;  4IVK A;  3K2N A;  1ZG4 A;  3BFE A;  5HD5 A;  1LL9 A;  4CLC D;  4CQH A;  2IWC A;  3T4T A;  3O5Y A;  1E3U A;  5FI6 A;  2HV1 A;  4GS9 A;  1XKZ A;  4JPM A;  3PTE A;  4DDS A;  3DW0 A;  3CG5 A;  2PYP A;  5EVL A;  1PW1 A;  2PDR A;  5HWW A;  2WYX A;  3S7O A;  3S7P A;  2P04 A;  1DRM A;  1HTZ A;  1KGE A;  1K25 A;  3P98 A;  2WAE A;  4QY5 A;  3HRE A;  5FA7 A;  2HP6 A;  5EOO A;  4GCZ A;  4PM9 A;  4KG5 A;  3CWF A;  3NDG A;  3DTK A;  1YSQ A;  3Q82 A;  3LYX A;  3U4L P;  4DXB A;  2V2F F;  4QB8 A;  2O0Y A;  1MKM A;  3LCE A;  4YWZ A;  2EWV A;  1N9O A;  4DMZ A;  2M1C A;  4BD1 A;  4FTX A;  2L4R A;  4CJN A;  3PAG A;  4KZ9 A;  3LI8 A;  2HJ9 C;  2W1T B;  3L9K A;  3SS4 A;  2X71 A;  5EUA A;  2HZ5 A;  3UDX A;  1T19 A;  2OSU A;  4EET B;  4MN5 A;  5HAQ A;  3B33 A;  3T50 A;  3GEC A;  3O88 A;  1JWP A;  1EW0 A;  3HUO A;  4OQ0 A;  3IQA A;  3MQ0 A;  5TBM B;  1H5X A;  4BL2 A;  1NWZ A;  5A8B A;  1YLP A;  1H8Y A;  1SCW A;  3W4O A;  1EI5 A;  4EES A;  1OTD A;  4OKP A;  4G3V A;  5HAI A;  3DTI A;  4RA7 A;  3T1S A;  4G3K A;  3RXX A;  1IOU A;  5HWV A;  1YLJ A;  4IUK A;  3R7W B;  2W1T A;  2INW A;  1LSX A;  3IH8 A;  3N7W A;  5GLA A;  1H8Z A;  1MKI A;  1OPX A;  1C3B A;  3PBT A;  1L0D A;  1G5U A;  5AQ9 A;  1AWI A;  4XT2 B;  5E43 A;  4RQ9 A;  4PM7 A;  1BLP A;  1IYO A;  3EQV A;  2V1B A;  3MF0 A;  3G31 A;  4R23 A;  1J3W A;  1SDN A;  2OWH A;  5KZH A;  4KZ7 A;  3CI6 A;  1I2S A;  2PD8 A;  4DN0 A;  3G6O A;  2HP9 A;  2J3W A;  2QMI A;  3BQ8 A;  1NRF A;  2Z6D A;  4E3J A;  2QKP A;  5M1A A;  3JVU A;  2BLS A;  4B9O A;  4LPZ A;  1P0Z A;  4P6B A;  1MWR A;  1XFQ A;  4I5S A;  2WKR A;  5CHU A;  4UQI S;  2W3E A;  4O8G A;  1JTG A;  3AGF A;  4E6W A;  4K0X A;  2V1A A;  1K6R A;  4GZB A;  2ZM8 A;  4GNU A;  5AQB A;  3N8L A;  5DTS A;  5HL6 A;  3IWI A;  1P97 A;  3E4Q A;  1K54 A;  2VV7 A;  3CUE A;  3DWK A;  4MBF A;  4EBP A;  5CER A;  4II7 A;  3IWQ A;  5HDC A;  4IUH A;  1X0O A;  2L0W A;  1XX2 A;  4X55 A;  4BBT A;  2R9W A;  1GA9 A;  3E98 A;  4M4X A;  5J8X A;  5F69 A;  4Y0O A;  4XUZ A;  1TS6 A;  1NY0 A;  1E4D A;  1L3L A;  3S7N A;  4UHU A;  1TVF A;  3M2K A;  3IXB A;  1S4S A;  3A0S A;  1IFQ A;  1M6K A;  3RH8 B;  3CUE C;  2PRF A;  5AQ7 A;  4FD8 A;  2VEA A;  1LHY A;  3T4Q A;  4Q8I A;  2A3U A;  1ERQ A;  3PHY A;  3F1N B;  4K91 A;  4R1G A;  3UE6 A;  4OQH A;  5K5B A;  1YPR A;  2L1M A;  3E4P A;  3W4P A;  5IT5 A;  1S1Z A;  4ZTK A;  2EWW A;  3NY4 A;  4R70 A;  2VGL M;  4S2I A;  5HWT A;  3UDF A;  4HP4 A;  3NDE A;  4LEN A;  4PAU A;  2PT7 A;  4Z9Q A;  4P6Z S;  3C38 A;  3IS2 B;  4HY8 A;  4Z1W A;  5AVE A;  1DP8 A;  1MWU A;  2RL3 A;  3UB6 A;  4EWF A;  1EWZ A;  1PI4 A;  3FV7 A;  5E2F A;  4S2L A;  4OQI A;  3ZVW A;  4YFM A;  1WA9 A;  1O07 A;  3MXQ A;  2J8Y A;  3QP4 A;  1K56 A;  2WGI A;  1PZP A;  2JKR M;  3F1N A;  1BZA A;  3GRJ A;  2WAD A;  3ICY A;  5GLC A;  3PBR A;  5CX7 A;  3QP6 A;  3LEQ A;  3IXH A;  3PBQ A;  3ZG7 B;  2JKR I;  3E4O A;  4HIA A;  4KQQ A;  1VB6 A;  4R3B A;  4Y13 A;  3N8R A;  2R78 A;  3E2L A;  4CLC C;  1WE4 A;  5FQQ A;  2JHE A;  3N4I A;  2Y2N A;  4ME4 A;  3O86 A;  5HW3 A;  1DY6 A;  4Q0J A;  4OOM A;  1BTL A;  2XRN A;  2V0U A;  3V39 A;  3LUQ A;  4HH2 A;  3N8S A;  5CTN A;  3T4J A;  3BYD A;  5FQJ A;  3P09 A;  1NZO A;  3QNB A;  5TFQ A;  2VX8 A;  1PWD A;  4PKY G;  3U2A A;  2DNS A;  2W1R A;  5CED A;  3ISG A;  2YKH A;  3BFD A;  3BLM A;  3NEC A;  3R7W A;  1GA0 A;  2HJE A;  4MBH A;  3IHB A;  3FKW A;  1OT9 A;  1NZU A;  1S1Y A;  4AFI A;  1RGZ A;  3HJK A;  4Y15 A;  1CI9 A;  4EV4 A;  1XFN A;  3IF6 A;  4WEK A;  2V1Z A;  5GLD A;  1YLW A;  3JYI A;  2OLU A;  4KG2 A;  2QZ6 A;  2HDS A;  5DTK A;  3D9Y A;  1LI0 A;  2B18 A;  3VE3 A;  3Q7V A;  4EXO A;  3HL9 A;  1YQS A;  2QPN A;  5M19 A;  4MN7 A;  2WK0 A;  5EVI B;  4NG2 A;  4Y2F A;  4HP9 A;  4LRX C;  3EOI A;  5A93 A;  3HUN A;  1F9I A;  1UWP X;  3KSF A;  1ALQ A;  3VMA A;  4S2N C;  3WS2 A;  4HQA A;  1TEM A;  4GN2 A;  4DRT A;  3A0R A;  4R4S A;  4BL3 A;  2W3F A;  4KZ6 A;  4I3A A;  5CGX A;  1KE4 A;  2FFY A;  3C4P A;  2Y91 A;  3FPW A;  1T18 A;  2XQZ A;  4WMC D;  1FIK A;  4OP8 A;  4WM9 A;  4WZ4 A;  4X25 A;  5FAT A;  3MZE A;  3OPL A;  1QMF A;  5M18 A;  5JYP A;  5KSC A;  5F6A A;  3IBJ A;  4D2O A;  4L0L A;  4C3Q A;  2X02 A;  3FKV A;  4S2M A;  4EQI A;  3OCL A;  3SS5 A;  4E3O A;  1KOU A;  4M3K A;  2M7V A;  2IWB A;  3IX8 A;  3V3S A;  2V0W A;  2Y79 A;  3ZFZ A;  5EVI A;  3G35 A;  1OTB A;  2C6W B;  1VET A;  3ITA A;  4XUX A;  4ESP A;  1KE0 A;  4ETZ A;  1FR1 A;  3LR5 A;  3N6I A;  1Q2P A;  4L9G A;  3LIE A;  1P9W A;  3HUM A;  2Y59 A;  4JXS A;  2ZL1 A;  2G2W A;  4UA7 A;  1CEG A;  3MKE A;  2XD5 A;  4EBN A;  3OLO A;  3VSK A;  1ES3 A;  2A24 B;  4KQD A;  3JPU A;  4XT2 A;  3P7N A;  1TDL A;  4WEL A;  2ACG A;  1LSV A;  4EQ1 A;  5CHM A;  3KSH A;  3T1R A;  1XJ2 A;  4E3N A;  2PR6 A;  1ERO A;  4LV3 A;  4IJG A;  1Q2Q A;  1W8Q A;  2C5W B;  5KMW A;  3IX4 A;  4N9L A;  1KGG A;  3HLG A;  2JKF A;  4A5R A;  5GL9 A;  4HH3 A;  3WRZ A;  2WZX A;  3MFD A;  4JGR A;  2EXA A;  5A90 A;  4IED A;  3NIA A;  4U0T A;  1BUE A;  3MXS A;  3CLO A;  4LV2 A;  5CGS A;  1JVJ A;  4U0X A;  3NJA A;  3CPT A;  3EEA A;  1CI8 A;  1KDS A;  1K6S A;  2J3T D;  2XA7 M;  4DKI A;  1PWC A;  3VOY A;  2ZQ8 A;  5FI2 A;  3LR4 A;  1VM1 A;  1STZ A;  3PBO A;  1VEU A;  2GNX A;  4LCL A;  2Z2L B;  2RCX A;  2BTF P;  2OAQ 1;  1L0G A;  1VHM A;  4EER A;  2Y55 A;  4ZBE A;  4OPY A;  3WS1 A;  4HBT A;  4KZ3 A;  1PNE A;  3VP2 A;  3IF6 C;  4QY6 A;  3PBS A;  3WRT A;  3MJQ A;  4IBX A;  2GDN A;  1T1A A;  1FOF A;  2DCF A;  2G7U A;  2ZC5 B;  5FSR A;  4GJ4 A;  5J4E A;  4KZA A;  1GSX A;  4MEZ A;  2EXB A;  1G28 A;  5F82 A;  3EGD C;  1V9Y A;  4EUZ A;  5TJJ A;  4QU3 A;  3ZG8 B;  1K57 C;  2AVX A;  3T4O A;  1OTA A;  3T1X A;  3TG9 A;  3HBR A;  4GHI B;  4IBR A;  3B42 A;  4QHC A;  4ZAM A;  2KLI A;  1PRQ A;  1N9B A;  1MZU A;  3PXP A;  2LB5 A;  4NEE D;  4YIN A;  3LFV A;  3H7W B;  4S2N A;  4OPR A;  3ZYT A;  4WN5 A;  2WKH A;  1ES4 A;  3F1O B;  5EVI D;  1K38 A;  1LL5 A;  2ZMA A;  5DJU A;  4IVI A;  4CPK A;  1W79 A;  3V3R A;  3IHA A;  4WL9 A;  1W5D A;  4JXW A;  5FI7 A;  5F5Y A;  3H82 B;  4X68 A;  3VOZ A;  1S6R A;  2H5S A;  3BFC A;  2VV8 A;  3NC8 A;  1ACF A;  5L10 A;  3KYQ A;  2ZD8 A;  1RP5 A;  2JC7 A;  2PYR A;  1FIL A;  4MN6 A;  3VP0 A;  4WBG A;  4FUW A;  3C5A A;  1YLZ A;  2D01 A;  3L7H A;  5EE8 A;  3S1Y A;  2Y2Q A;  5G4Z A;  1IYS A;  4F3L A;  5L09 A;  1K57 A;  3LIA A;  3Q1F A;  5DF9 A;  2Z6C A;  3GV9 A;  5F83 A;  3C7U A;  3BRM A;  1XJ6 A;  4GB7 A;  2OLV A;  1YM1 A;  3T4S A;  5G4Y A;  3BFF A;  4L9F A;  2OV5 A;  4E3M A;  2JKT M;  3HLW A;  5HPI A;  1GSW A;  1IEL A;  3IF6 B;  3D3O A;  4KG6 A;  3LO7 A;  1ES5 A;  5EM0 A;  2HP5 A;  4S2P A;  2PAV P;  1E25 A;  2ZBB A;  2O9B A;  3HLB A;  1DP9 A;  4BQM A;  4DF6 A;  5EM1 A;  5BOH A;  2KDK A;  1XJ4 A;  4OPQ A;  4LV0 A;  4S2O A;  5A91 A;  3O87 A;  2OAP 1;  5KSH A;  3DAV A;  1NLY A;  4ARZ A;  1KE3 A;  1CEF A;  3MR0 A;  2Y2I A;  2ZL1 B;  4H6J A;  1YT4 A;  4Y7P A;  3LY3 A;  1M40 A;  4U3T A;  4HJ3 A;  1V9Z A;  1J9M A;  2P9V A;  5A92 A;  4QPR A;  2PU4 A;  2Y2J A;  2E8J A;  4GDB A;  4BMW A;  2VKS A;  3K3D A;  5I94 A;  3MKF A;  1TS8 A;  3IWO A;  5IU1 A;  2J9P A;  1PI5 A;  5FQK A;  2HPB A;  4WZ5 A;  4O0P A;  2VV6 A;  4KUO A;  2VGJ A;  1KVM A;  2XA7 S;  2UWX A;  2WAF A;  4GHI A;  3CMZ A;  3MS6 A;  1SKO A;  2O9A A;  3LIF A;  5DF7 A;  4FOF A;  3BY8 A;  4HNB A;  1L0F A; 
#chains in the Genus database with same CATH homology
 4WF0 A;  1T1C A;  4G3W A;  3K2N A;  2B18 A;  3VE3 A;  5HD5 A;  4HOI A;  5J7E A;  4EXO A;  4CLC D;  5HDD A;  4CQH A;  1N9L A;  3T4T A;  3O5Y A;  1T1B A;  3CIT A;  2QHK A;  4MN7 A;  3BWL A;  5DJT A;  2HV1 A;  5LBR A;  4BJP A;  2HGV A;  4GS9 A;  3C8C A;  4Y2F A;  2K2N A;  4HP9 A;  2PYP A;  2Y8H A;  4LRX C;  2PDR A;  5HWW A;  1D7E A;  3C30 A;  3S7O A;  3EOI A;  3S7P A;  2GZA A;  2P04 A;  3BY9 A;  1DRM A;  1F9I A;  4EU0 A;  1UWP X;  3LIC A;  5HPF A;  3KSF A;  4HQA A;  3MFX A;  2HF6 A;  3B47 A;  1OTE A;  3A0R A;  2W3F A;  4ETX A;  3C2W A;  4GCZ A;  4I3A A;  3V67 A;  5TBM A;  3CWF A;  4HI4 A;  1YSQ A;  4WLA A;  3LYX A;  3FPW A;  1T18 A;  4WEJ A;  3MMH A;  4JGP A;  3D72 A;  1ODV A;  4GW9 A;  2O0Y A;  1MKM A;  2VZW A;  4CLC B;  4YWZ A;  4Q0H A;  5HSQ A;  3VE4 A;  5F6A A;  2EWV A;  1N9O A;  3IBJ A;  2NUP C;  4L0L A;  4DMZ A;  3SW1 A;  4IHQ A;  2M1C A;  2VJW A;  2L4R A;  4HHD A;  3ULF A;  4OOL A;  3LI8 A;  2HJ9 C;  3OCL A;  2W1T B;  3R4K A;  1KOU A;  3TRC A;  2P7J A;  2M7V A;  1MC0 A;  4E04 A;  2V0W A;  2Y79 A;  2OWJ A;  5DFX A;  4GS9 B;  2V9A A;  3HJI A;  1T19 A;  4EET B;  2O99 A;  1OTB A;  4MN5 A;  3B33 A;  3T50 A;  3DBA A;  3GEC A;  3LR0 A;  4YNR A;  1OT6 A;  4ETZ A;  3LR5 A;  3EGX C;  3OBF A;  1EW0 A;  3H9W A;  4L9G A;  3LIE A;  2FH5 A;  3MQ0 A;  5TBM B;  1LL8 A;  1P9W A;  1D06 A;  1NWZ A;  5MC7 A;  5A8B A;  2ZOI A;  3OLO A;  4I38 A;  3RFB A;  4FSF A;  4EES A;  1OTD A;  4G3V A;  2A24 B;  5DKL A;  4KQD A;  4XT2 A;  2LB9 A;  3P7N A;  1LT0 A;  4WEL A;  3A0V A;  4I3J A;  1LSV A;  4EQ1 A;  4CLC E;  2QWS A;  3KSH A;  4G3K A;  4MCW A;  3UB8 A;  3UME A;  1XJ2 A;  3BQA A;  1IOU A;  2PR6 A;  2VLG A;  5HWV A;  4IJG A;  4JGQ A;  1S66 L;  3F1O A;  4IUK A;  5F68 A;  3PYP A;  3R7W B;  2GX5 A;  2W1T A;  2INW A;  3KX0 X;  1LSX A;  4I39 A;  4UEY A;  4NXB A;  1TS0 A;  5L8M A;  4HH3 A;  4JGR A;  1OPX A;  3PBT A;  3NOT C;  4XT2 B;  2JN7 A;  3IS2 A;  2JKT I;  4RQ9 A;  3IBR A;  3CLO A;  3RTY A;  3EQV A;  4MDZ A;  2V1B A;  3MF0 A;  3NJA A;  4LRZ E;  3EEA A;  2OWH A;  4Q0I A;  1F5M A;  3TE8 A;  2WKQ A;  4H6J B;  2I9V A;  2J3T D;  2XA7 M;  2WKP A;  3LR4 A;  3CI6 A;  1STZ A;  3HCY A;  3BJN A;  1OTI A;  3PBO A;  4ZRR A;  2GNX A;  4Y3I A;  2PD8 A;  2M7U A;  2OAQ 1;  3G6O A;  4DN0 A;  1VHM A;  4EER A;  2J3W A;  5DKK A;  4BBU A;  1ZTU A;  2A24 A;  3BQ8 A;  2K31 A;  3VV4 A;  1YAX A;  4R3A A;  2Z6D A;  3PBS A;  4I3I A;  3MJQ A;  4NXG A;  2QKP A;  4DJ3 A;  3JVU A;  4B9O A;  4LPZ A;  1T1A A;  1F98 A;  1P0Z A;  2G7U A;  2ZMV A;  3MQQ A;  4GJ4 A;  1H3Q A;  1XFQ A;  4I5S A;  2WKR A;  2A2L A;  4UQI S;  3TJZ C;  5J4E A;  3PR6 A;  1GSX A;  2W3E A;  4JGO A;  4P6Z M;  1G28 A;  4O8G A;  4BWI A;  2VGL S;  3E0Y A;  3EGD C;  1V9Y A;  1GSV A;  2W0N A;  1G6O A;  2V1A A;  2FZ0 A;  5TJJ A;  5IS1 A;  3T4O A;  1OTA A;  5HL6 A;  4LRY C;  5HZH A;  3BW6 A;  1P97 A;  3E4Q A;  4Y5F A;  5HDS A;  4GHI B;  2P08 A;  2VV7 A;  3CUE A;  2W3G A;  3B42 A;  1P9R A;  5FL3 A;  2KLI A;  4II7 A;  3OOV A;  1MZU A;  4DJ2 A;  3PXP A;  2YKF A;  2LB5 A;  2W3H A;  5EFW A;  4NEE D;  2H28 A;  3LFV A;  5HDC A;  3FC7 A;  3H7W B;  1JNU A;  4IUH A;  1X0O A;  2L0W A;  2GJ3 A;  3NOU C;  3ZYT A;  4WN5 A;  4BBT A;  3E98 A;  4M4X A;  4R38 A;  3NOP C;  3F1O B;  5F69 A;  5AVF A;  5DJU A;  1UWN X;  1TS6 A;  3S7N A;  3F1P A;  5KIZ A;  4WL9 A;  5F5Y A;  3H82 B;  5DFY A;  3K3C A;  1S4S A;  3A0S A;  4EEP A;  1Y28 A;  4O01 A;  1IFQ A;  3RH8 B;  2VV8 A;  1DP6 A;  3CUE C;  3KYZ A;  4K08 A;  3KYQ A;  2VEA A;  1NLZ A;  4GLQ A;  3T4Q A;  2J80 A;  4NXF A;  2EA9 A;  2PYR A;  4ARZ B;  4MN6 A;  3EWK A;  3PHY A;  2PR5 A;  3F1N B;  3F1P B;  3PBN A;  2D01 A;  2IA2 A;  3W2Z A;  5G4Z A;  3UE6 A;  4F3L A;  3S7Q A;  3LIA A;  5DF9 A;  4BBV A;  3KO6 A;  2Z6C A;  1W63 Q;  3EEH A;  5K5B A;  2L1M A;  2QJ7 A;  3E4P A;  2QYB A;  1S1Z A;  1XJ6 A;  5J3W A;  5IT5 A;  2PHY A;  2EWW A;  3FG8 A;  4R70 A;  2VGL M;  3LR3 A;  5HWT A;  3FPV A;  3T4S A;  5G4Y A;  4L9F A;  4HP4 A;  4EEU A;  2JKT M;  3KSG A;  4NXE A;  5HPI A;  5C5K A;  1GSW A;  4PAU A;  2PT7 A;  4P6Z S;  2DMW A;  4CLC A;  3C38 A;  4KQO A;  3D3O A;  3IS2 B;  4NKP A;  3LI9 A;  4HY8 A;  1TD5 A;  4Z1W A;  2ZOH A;  5AVE A;  1DP8 A;  3OCN A;  3UB6 A;  1N9N A;  1LSW A;  4HJ6 A;  4EUV A;  1YSP A;  2ZBB A;  1WA9 A;  2O9B A;  3MXQ A;  4EW7 A;  4F3L B;  3LID A;  1DP9 A;  3GDI A;  3H7W A;  2PD7 A;  2KDK A;  2XRO A;  1XJ4 A;  2D02 A;  1ZHH B;  4HJ4 A;  2XSS A;  3T4K A;  2JKR M;  3F1N A;  3CAX A;  5I5L A;  2OAP 1;  3ICY A;  2J3T C;  3PBR A;  5CX7 A;  3UE3 A;  5KSH A;  2KX6 A;  3NHQ A;  1NLY A;  3PBQ A;  3P01 A;  1W63 M;  2JKR I;  3E4O A;  4HIA A;  4ARZ A;  1VB6 A;  2O9C A;  2R78 A;  4CLC C;  3MR0 A;  2CMN A;  4PHT A;  4KUK A;  2JHE A;  3UMD A;  2KOI A;  4H6J A;  4ME4 A;  4PKY A;  4HJ3 A;  1V9Z A;  1BYW A;  4Q0J A;  1S67 L;  4OOM A;  4QPR A;  3OC2 A;  1XJ3 A;  2XRN A;  1UGU A;  2V0U A;  2MJ6 A;  3LUQ A;  4HH2 A;  4BMW A;  2VKS A;  3K3D A;  3T4J A;  3H82 A;  4WUJ A;  1OJ5 A;  2OOL A;  2VA0 A;  3TW8 A;  5AJG A;  2VX8 A;  4R6L A;  1TS8 A;  2BAS A;  5IU1 A;  2QJ5 A;  4UQI M;  5HD3 A;  4L9E A;  4PKY G;  3U2A A;  1H8M A;  1S4R A;  2W1R A;  4LLO B;  2YKH A;  1OJG A;  2K7S A;  3UB7 A;  4O0P A;  3R7W A;  2HJE A;  3ZQ5 A;  2B02 A;  2ZMF A;  3JVV A;  2NUT C;  3T4L A;  1TS7 A;  4MMN A;  3UB9 A;  2VV6 A;  4KUO A;  3EQU A;  3MQO A;  2XA7 S;  4GHI A;  3VOL A;  1OT9 A;  1S1Y A;  4AFI A;  2O9A A;  2W3D A;  3HJK A;  3LIF A;  2W27 A;  1NRJ A;  4FOF A;  1XFN A;  3BY8 A;  4YOF A;  4B93 A;  3LIB A;  1TF1 A;  4WEK A;  1YKD A;  3KSI A;  4HNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...