4GS9B

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with an inactive benzoxadiazole antagonist
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
PTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title Development of Inhibitors of the PAS-B Domain of the HIF-2 alpha Transcription Factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4gs9B01
2GJ3A 3LIDA 1XJ3A 4E04A 1WA9A 4F3LA 4KUKA 2V1AA 1OTDA 2OWHA 4EQ1A 4EEUA 3MXQA 1OJ5A 2PYPA 2VLGA 2KDKA 4LRZE 1TS0A 4I3AA 3UB8A 1DRMA 4LRXC 4L9EA 5DKLA 4F3LB 5EFWA 5J3WA 5TBMB 3LI9A 1T18A 1OTAA 4EXOA 2K7SA 3SW1A 4DJ2A 3MQQA 3EWKA 2H28A 3K3DA 1NWZA 3P7NA 4EERA 2A24B 3MJQA 3F1PA 4L9FA 5DJTA 4YWZA 4HY8A 4NXFA 4B9OA 1OTIA 1T1BA 3C2WA 2L1MA 4LPZA 3T50A 4NXGA 1ODVA 1N9OA 2YKFA 4HHDA 2PD7A 3LIFA 2JN7A 3A0VA 4HQAA 1S1YA 4HNBA 2PR5A 4I3JA 1P0ZA 3GDIA 4HI4A 3F1OA 5HZHA 5HWWA 1XJ2A 3LYXA 4HH2A 2PR6A 1T1AA 5HD3A 1VB6A 4PKYG 3MFXA 3H7WA 2INWA 2I9VA 1OT9A 3CWFA 4M4XA 1GSVA 4XT2A 3UB9A 2L0WA 4HJ3A 2D02A 4JGQA 3IBRA 2EA9A 3BWLA 4GW9A 3H7WB 3NHQA 4EW7A 4PKYA 1TS8A 2J80A 1P97A 2PHYA 5G4YA 1XFQA 1XFNA 2JHEA 3HJKA 3LI8A 1JNUA 4KQDA 4R38A 3A0SA 5DKKA 5AVFA 3PHYA 1TS7A 1DP9A 3MR0A 1OT6A 1LSWA 3H9WA 4EESA 5HDCA 1N9LA 2HV1A 1S4RA 4WUJA 3MQOA 2CMNA 2PD8A 4GCZA 2WKPA 3OLOA 3BY8A 5A8BA 2R78A 4NXBA 4I39A 5F5YA 4HIAA 4WL9A 3FC7A 3UB7A 4GS9A 1T1CA 4MN6A 2BASA 1DP8A 3F1PB 3GECA 4K08A 1V9YA 3LIBA 3K3CA 4R3AA 2QWSA 1Y28A 3UB6A 3NOTC 2PYRA 2WKQA 1TS6A 5IS1A 3H82A 1LSVA 4L9GA 4R70A 4LRYC 4MN5A 4WF0A 3VE3A 1XJ4A 1EW0A 1S4SA 2QJ7A 2Z6DA 4NXEA 3C8CA 3F1OB 4BBTA 1F98A 2W27A 1D06A 3RTYA 2OWJA 1V9ZA 3H82B 2V1BA 2ZOIA 2YKHA 5DJUA 1LT0A 1LL8A 4EETB 3NOUC 3PYPA 3LIEA 1XJ6A 3LIAA 1UWNX 1GSWA 5HSQA 3FG8A 3VE4A 2KX6A 4XT2B 1KOUA 4HP9A 1BYWA 1DP6A 5J4EA 3RH8B 4GHIA 1MZUA 5I5LA 4WLAA 5TBMA 4BBVA 5IU1A 4LLOB 4EEPA 4H6JA 2QJ5A 3ULFA 4GHIB 3NJAA 5AVEA 2A24A 2Z6CA 2V0UA 4JGPA 2VV8A 1S67L 3ICYA 4H6JB 2L4RA 2PDRA 5F69A 1GSXA 1T19A 5G4ZA 2D01A 2V0WA 1S66L 2V9AA 4HP4A 4I38A 1F9IA 1X0OA 1OTEA 3HJIA 3UMDA 4BBUA 1G28A 3CLOA 5F6AA 3F1NA 4R6LA 5HWTA 4GS9B 5F68A 5HWVA 2OOLA 2QKPA 1N9NA 3VOLA 2ZBBA 4I5SA 3E4PA 5J7EA 3G6OA 2VV6A 3NOPC 5HD5A 4HH3A 2P7JA 3BY9A 2VEAA 2ZOHA 2B02A 3A0RA 3ZQ5A 3F1NB 1S1ZA 3B33A 2M1CA 4KUOA 2WKRA 3E4QA 3IS2A 1UGUA 1LSXA 5HDDA 4HJ4A 2QHKA 1OJGA 4RQ9A 3D72A 3UMEA 4WN5A 5KIZA 4I3IA 3E4OA 5HDSA 4HJ6A 1OTBA 1D7EA 2VV7A 3KX0X 3LICA 1UWPX 3LUQA 3CAXA 3IS2B 2W0NA 4HOIA 3UE6A 4DJ3A 4JGOA 3EEHA 4JGRA
chains in the Genus database with same CATH superfamily
1CF0A 4E04A 2O99A 1WA9A 2Q9MA 3AGEA 3FPVA 1SDNA 2P08A 2V1AA 1OTDA 2XLNA 4Y17A 3B3XA 1CI8A 2XF3A 3O87A 2HDUA 3VSKA 1JVJA 3ZNTA 3T4JA 3QNCA 1FR1A 3UB8A 2XGNA 4LRXC 2V20A 4L9EA 4F3LB 4ZJ2A 1STZA 1YLJA 3LI9A 4Y7PA 4EXOA 5GLDA 2Y2JA 2K7SA 3IF6B 3V3RA 3BEBA 3MQQA 1VM1A 3MXSA 3TRCA 3L9KA 4KZAA 1G68A 3Q82A 4L9FA 5DJTA 4NXFA 3UE3A 2XROA 1G6AA 4LPZA 4P87A 3T50A 4RX3A 3EQVA 2VK3A 1ODVA 5EVIB 2ACGA 1N9OA 5FQQA 3W4PA 2ZL1B 3LR0A 4HQAA 4NEED 3PBTA 2EXAA 3E2LA 3GDIA 3VFFA 4HI4A 2Y59A 3MSHA 5HWWA 3LYXA 2WGWB 3BFEA 4N9LA 1IKGA 3KSFA 2PR6A 4EQIA 3P98A 1OPXA 5HD3A 1VB6A 1KVMA 4PKYG 5KZHA 4RYEA 3V39A 3MFXA 2V8CA 2A2LA 3W4OA 1W7FA 2H5SA 3OPRA 3L7HA 5CTMA 1F5MA 4JGQA 5EOEA 1SCWA 3IBRA 3BWLA 4S2IA 4WEJA 4IBRA 3H7WB 2ZC6B 3JYIA 4EW7A 3EGXC 2EX2A 1CQAA 3E2KA 5G4YA 3G35A 1XFQA 2XA7M 3GMWA 5HAQA 4R3JA 2KOIA 4C6YA 4E3NA 1E4DA 3HJKA 5CRFA 2W3EA 4KQDA 3UE1A 1K56D 4UQIM 3D4FA 1TS7A 4NETA 1DP9A 3IWOA 3TG9A 1FSWA 2ZC4B 1H5XA 2X71A 2FFYA 3DWZA 1N9LA 2W3GA 3HLWA 3QNBA 3MQOA 4KZ9A 4DE2A 2Y2QA 3PBNA 1ALQA 2R78A 4NXBA 4HIAA 2V1ZA 3G31A 2X02A 4WL9A 3B42A 4EV4A 2O9CA 3FC7A 3KYZA 1HLUP 2GDNA 3UB7A 1T1CA 2IWCA 5AJGA 5L2FA 3F1PB 1FOFA 3G32A 1V9YA 3ZG9B 4GZBA 4UHUA 3VMAA 4Q0JA 1ES2A 4R3AA 2QWSA 5C5KA 3T4TA 5FASA 5FQIA 3TE8A 4E3IA 1TS6A 3CJMA 4LCMA 1LSVA 1PW1A 1XA7A 1E3UD 1NRJA 3LEQA 2EFXA 5CTNA 4JKTA 4KZ4A 3VE3A 4E3MA 2Y2KA 3ZHHA 4PM9A 2W27A 2ZMFA 3RTYA 1ZHHB 3LFVA 2OWJA 4OPZA 2ZOIA 2V2FF 5EM0A 2P04A 3MQ0A 4FD8A 1RGZA 2V8FA 2R9XA 1ES4A 4XT2B 2KLIA 1GA0A 2EX9A 2BTFP 2X01A 4Q0IA 3OCNA 4MCWA 4OP5A 2EX8A 2Y4AA 3O5YA 3PBSA 2JKFA 5EUAA 2HP9A 3NBLA 4LLOB 3PAEA 1TDGA 1O7EA 4H6JA 2P9VA 2W1TB 3V5MA 3BFDA 4R3BA 3ZVTA 4KG5A 3T1XA 1K4EA 5AVEA 2PBYA 3JPUA 3T4QA 3N7WA 5A90A 1E25A 1S67L 1FILA 3G30A 2VA0A 1LLBA 4N92A 4FUWA 4GB7A 1T19A 3VV4A 3S7PA 3NY4A 2D01A 3SS4A 3C38A 3UN7A 2G2WA 1YLTA 3DW0A 4OVDA 4G3KA 4I38A 3LEZA 5KSHA 2I72A 1G28A 2ZQDA 3CLOA 3IF5A 3QP8A 5FL3A 1L0DA 1O07A 4GS9B 5HWVA 4IBXA 3PTEA 4DE0A 1MWUA 4ETZA 3IHBA 2ZBBA 3IXDA 2WAFA 3QP1A 3UNWA 2JKTM 2HJEA 2C6WB 5HD5A 2K2NA 1OMEA 3BY9A 4HH3A 3ZYTA 2B02A 2JKTI 1BTLA 4K0WA 3A3DA 2GNXA 1DY6A 4KUOA 3E4QA 1JWZA 5HDDA 1W63M 3UMEA 5TJJA 4G3VA 2QMIA 4EWFA 5FA7A 5DTSA 5FSRA 3S22A 1BLPA 2WK0A 5HDSA 3JVUA 2IWBA 1BLCA 1OTBA 3KX0X 1UWPX 3SH7A 2J9OA 4E3KA 4OQ0A 2QYBA 4JGOA 3LIDA 3VSLA 1XP4A 3T4SA 1TVFA 4CLCC 2WAEA 3GTCA 4KUKA 2OWHA 1K6RA 3UB5P 2HGVA 5K5BA 4EQ1A 3LR4A 4EEUA 4UA7A 3MXQA 1SZVA 2PU2A 2OV5A 2Y79A 1XA1A 2PYPA 4IHQA 2KDKA 2R9WA 2Y91A 3RJUA 2J3TC 4DN0A 1TEMA 4JBFA 4KZ6A 1QMEA 3G34A 3VP4A 3SW1A 1D1JA 4KQRA 4CPKA 5EVID 3IX3A 2BLSA 5F1FA 3FZCA 5M18A 3OPPA 3SOIA 3P7NA 4EERA 3EOIA 2A24B 1FCNA 1XPBA 4B9OA 5FEGA 5MC7A 2L1MA 3W8KA 3BRMA 2ZMVA 4E3LA 2ZLYA 4LENA 1P9RA 2YKFA 4HHDA 4KZ7A 1JWVA 1K38A 1L3LA 2XEPA 3A0VA 1KGEA 4LCLA 4O7DA 3ZGAB 2WKHA 3DTIA 5U47A 3OPHA 3N8SA 4EBNA 3F1OA 3FWLA 3WS5A 5E43A 2ZQ9A 4ETXA 4X68A 2E8IA 5E2HA 3G2YA 3W4QA 1PYYA 1Z09A 1PWDA 2VZWA 3WS1A 3OCLA 2A49A 2INWA 2W3HA 4PPRA 1ZKJA 2K31A 1CI9A 4CQHA 1BT5A 4FH2A 1A0KA 5HARA 3UB9A 2L0WA 3ITAA 4JF5A 3OC2A 3IXGA 4KQQA 4WELA 5HX9A 5FEFA 3M2JA 3UPOA 3U2AA 1HZOA 1SKFA 4OOMA 1K25A 3ISGA 1MBLA 2EXBA 4K91A 1W63Q 1BZAA 3Q07A 3A3EA 1H8YA 5GL9A 3GVBA 2MJ6A 2Z2LB 4WMCA 4OH0A 1P9WA 2JHEA 3Q7VA 1U60A 1N9BA 3QP2A 4Y13A 4Q8IA 1RCJA 1H8MA 3FV7A 2Y2LA 5J8XA 2UWXA 2ZC7A 4YOFA 2OLVA 3EQUA 4EESA 4S2PA 5HDCA 4E6XA 3TJZC 4N1XA 1HTZA 2JKRM 2CMNA 2PD8A 2J9PA 4ARZA 1KGFA 4ZBEA 2WKPA 2JKRI 4P85A 3BY8A 4I39A 4GOGA 5CGSA 5AQBA 1PRQA 3HVFA 4HEFA 2WKEA 3PXPA 4R0QA 5CXWA 2BASA 2ZM2A 2ZQ7A 2H0YA 1PI5A 3BQ8A 5FQJA 1Z6FA 1WYBA 4X53A 1VETA 2ZC3B 2WKQA 3A3IA 3C4OA 3MZFA 5D3OA 1CK3A 3HLFA 4L9GA 2JC7A 3CZDA 2J3WA 1MPLA 4ZDXA 1XJ4A 1S4SA 4OOLA 4CLCA 2Z6DA 1NYYA 3UPNA 4BBTA 5AQAA 3C7VA 3V3SA 1YLZA 4DXCA 2Z2MB 2HJ9C 5IHVA 4GLQA 1V9ZA 2V1BA 3C5AA 1Y54A 4RX2A 3CUEA 3ZFZA 3N8LA 3PYPA 3LIEA 1J3WA 2ZJ9A 1K54C 4QWOA 3UY6A 3WWXA 5CHMA 4HP9A 4P6ZS 1BYWA 2O9BA 1DP6A 1W79A 5GHXA 3HLCA 5J4EA 3S7QA 2IA2A 4JXWA 4JF6A 3MBZA 2XD1A 2WKIA 2WZZA 4OPQA 3MZDA 5IU1A 4PHTA 4GD6A 1M6KA 3HCYA 4UEYA 4O01A 1GHPA 2PU4A 1S0WA 3ULFA 2OSUA 4MBFA 1GHMA 3S7OA 5HW3A 4Y2FA 3IH9A 3W2ZA 1ZC2A 1YLPA 3VFHA 4JGPA 1W8QA 2O9AA 1ESUA 5L07A 4H6JB 2WZXA 4KQOA 2NUPC 5HPFA 3CITA 2EWVA 3TOIA 5JYOA 3Q1FA 2ZL1A 3VP3A 3G2ZA 5F1GA 2V9AA 4HP4A 3NC8A 2JBFA 1VEUA 2JKGA 3HJIA 5FQ9A 1L0EA 1NY0A 5HWTA 2WGWA 5F68A 5E2FA 2QKPA 4MEZA 3VOLA 1MWSA 4JXGA 1GCEA 1KE4A 1JTDA 3G6OA 2WGIA 2VV6A 2VGJA 4KZ8A 3TSGA 3ZNYA 2AVXA 3ZQ5A 3FPWA 3B33A 1YMSA 2M1CA 2WKRA 4PMAA 2ZQCA 3IS2A 5L10A 3D9YA 2VGLM 1LSXA 4RVAA 1YSPA 3IXBA 5EE8A 5EPHA 4C3QA 3DWKA 4I3IA 4DDSA 5DF9A 2XDMA 4X69A 3S4XA 3E4OA 2B18A 4D2OA 3Q81A 4OPYA 1D7EA 3T4LA 3GR2A 2VV7A 3CAXA 4OONA 4QD4A 1NXYA 3UE6A 2EFUA 4YFMA 4JGRA 4N1HA 4D60A 5GLAA 5A92A 3I7JA 1BLSA 3O86A 5HAPA 2HDSA 2Y2NA 5CHUA 3BJNA 3NDEA 2HPBA 4QY5A 2OAQ1 3HL9A 3LY3A 4M3KA 2OAP1 1NZUA 2VLGA 3ZCZA 1WE4A 1FCMA 3IT9A 4I3AA 5HL1A 5EFWA 4OQHA 4EU0A 5J3WA 5TBMB 2EX6A 4IEDA 4MMNA 2DMWA 4S2NA 5DFYA 2RCXA 4GN2A 4O0PA 2VKSA 2GX5A 4L0LA 3R7WA 3MJQA 3F1PA 1EROA 3HLGA 4YWZA 4HY8A 4EUZA 2DNSA 3WRZA 5BOHA 4QHCA 1MXOA 1T1BA 3C2WA 1SKOA 1H8ZA 1ACFA 3MXRA 4KZ5A 4BL2A 5KSCA 4QY6A 4LV1A 2PD7A 3T4OA 2XA7S 1H3QA 3M6HA 1HD8A 3GRJA 3JVVA 1I2SA 4HNBA 4I3JA 3S1YA 3FYZA 1P0ZA 5GHYA 1K54A 4UQIS 5HZHA 1LI0A 3PBOA 1PI4A 3M6BA 4N9KA 2VGKA 1XJ2A 3RFBA 4EBPA 2WUQA 4IUKA 5M1AA 1PW8A 2PAVP 4WM9A 1T1AA 4CLCD 1W8YA 3MMHA 5CEBA 1S6RA 4BENA 2GZAA 3LGOA 4S2JA 5G18A 1LHYA 4X1LA 4MBHA 3CWFA 4M4XA 4EUVA 3AGDA 3FKVA 1GSVA 4WZ4A 4XT2A 4Z9QA 1FQGA 2J3TD 2XFTA 4HJ3A 5F82A 2D02A 4B4ZA 4QJGA 4II7A 5IT5A 1ERMA 5M19A 2Y2HA 3PR6A 3NHQA 2M7UA 4PKYA 3UPPA 1TS8A 1Y4OA 4BJPA 1P97A 2LB9A 1PZOA 3VP0A 4AFIA 3DTMA 3R4KA 1TDLA 2W1TA 2J7VA 3P09A 1XFNA 4UAAA 5HPIA 4E3JA 3OBFA 3DTKA 5CX7A 5DF8A 3CUEC 1ZG4A 1BLHA 4FSFA 3HBRA 3IQAA 5DKKA 5AVFA 3PHYA 1DJCA 1ONHA 3MR0A 1EI5A 3Q7VB 4Z1WA 2HV1A 1PFLA 1XGIA 4WUJA 3C30A 4LGWA 2UV0E 1K6SA 1G6OA 2JE5A 4GCZA 3OLOA 5A8BA 1YLYA 1JTGA 3U4LP 1QMFA 4JF4A 5F5YA 1YM1A 3CPTA 4WYYA 4P0MA 4PM6A 3IF6C 3VP2A 4GS9A 4GKUA 1GHIA 4LFUA 4ARZB 4MN6A 3IWQA 1DP8A 3LCEA 1MKIA 2EWWA 1IYOA 3GECA 4K08A 4PM5A 2Q9NA 4X25A 4R4RA 4Q0HA 2W3DA 3OZHA 4XUXA 3RXWA 3A3FA 3NOTC 4LV0A 2PYRA 5IS1A 5EVIC 3H82A 4Y5FA 3BLMA 4MN5A 2PBDP 4WF0A 1E3UA 3P01A 1K57C 2QJ7A 4MN7A 3C8CA 4X56A 1M40A 4FTXA 1D06A 1JWPA 2E8JA 3HUMA 2A3UA 2DRWA 5AQ7A 3N6IA 5FAQA 3SS3A 4B4XA 1LT0A 3NCKA 1LL8A 3T1QB 3NOUC 4CLCB 1XJ6A 3LIAA 1UWNX 3T1SA 1YKDA 4JLFA 3KSGA 2C5WB 4DE1A 3VOZA 2ZD8A 3VE4A 3O3VA 3UDXA 3ZVWA 3LY4A 2KX6A 4BLMA 1ONGA 4U3TA 4KZBA 1DJAA 4OLGA 1NZOA 3SH8A 4IVKA 1K55C 3RH8B 5L09A 4BMWA 4GHIA 4S2OA 5I5LA 2Y8HA 1BUEA 4IJGA 5FAOA 4GD8A 3AGFA 2QJ5A 2WGVA 1CEGA 3D3OA 3LO7A 1IOUA 1L2SA 4R23A 2A24A 2Z6CA 3MKEA 2B95A 1MKMA 5CGXA 5TGFA 1YQSA 1KE3A 2Y2MA 3T4KA 2CC1A 1TF1A 3SH9A 3FKWA 2L4RA 3V50A 4CLCE 4S2LA 4ZTKA 1TD5A 5F69A 5EVLA 3HLEA 4BL3A 2VX8A 1FCOA 4RA7A 5G4ZA 4E6WA 1YAXA 3MZEA 2V0WA 4WZ5A 4KENB 1S66L 4JPMA 3DTEA 4EBLA 3K2NA 4O8GA 1X0OA 4ZAMA 4JXVA 1H0MA 2PRFA 4BBUA 3QHYA 3M2KA 5DTTA 5CGWA 5F6AA 3F1NA 5I94A 5CEDA 3HREA 5HAIA 4S2NC 5A91A 2O0YA 2OOLA 2Y2OA 1YLWA 3HUOA 3BFGA 2FH5A 5TFQA 4X6TA 4I5SA 5FQKA 1IEMA 3E4PA 4ESPA 3NOPC 1VEUB 2VEAA 3LR5A 2ZOHA 3VP1A 1VHMA 1S1ZA 5DFXA 5EM1A 3C7UA 4GJ4A 1C3BA 1CJFA 5CECA 5DF7A 1MWRA 1NLYA 4HJ4A 2QHKA 4RQ9A 4WN5A 3UDIA 2XRNA 1IFQA 4HESA 3BLSA 4B88A 3QP5A 3IHAA 4DDYA 4QU3A 1BSGA 1KDSA 1IYQA 3LICA 3IS2B 4KZ3A 2W0NA 3UO9A 4IUHA 4HOIA 1N4OA 2G2UA 3NDGA 4DJ3A 3EEHA 2XK1A 4A5RA 2GJ3A 1XJ3A 3E98A 4F3LA 3NULA 5GLBA 2Y2IA 2W1RA 2DCFA 1AXBA 3IF6A 3A3JA 2BG1A 1OJ5A 2WYXA 4MBKA 3KYEA 1PZPA 1YPRA 4MLLA 3EEAA 4LRZE 1TS0A 2NUTC 1DRMA 5DKLA 3S7NA 3MS6A 1L0GA 1T18A 1OTAA 3IH8A 3WRTA 4DJ2A 2P9VB 3EWKA 2H28A 3NIAA 1FSYA 4OOYA 1K0KA 2ZQAA 1ERQA 2J8YA 3K3DA 1IELA 5EVIA 4MNRA 4G3WA 2HP6A 1NWZA 2WADA 1GA9A 1IYSA 4YNRA 1NYMA 2FFFB 1K57A 1OTIA 4ME4A 1NRFA 4E3OA 2JCHA 3KYQA 2XR0A 4DMZA 4U0XA 1DJBA 3PBRA 5E2GA 3BW6A 4NXGA 4Y15A 1XX2A 3BQAA 3LIFA 2M7VA 2JN7A 3R7WB 4BWIA 3ZG8B 5GHZA 2HP5A 1S1YA 2PR5A 1SKOB 4XUZA 2XFSA 5LBRA 4GDBA 1MWTA 4ZJ3A 1ZG6A 4GDNA 4UA9A 1PIOA 4HH2A 1K55A 3BYDA 4MDZA 5FDHA 3H7WA 2I9VA 2QPNA 1HVBA 3ZG5A 5FI6A 1OT9A 2G7UA 1XKZA 4WBGA 1YMXA 4IVIA 3SZTA 1CEFA 3ZG7B 2EA9A 4PM7A 4GW9A 1KDWA 1MC0A 1PWCA 3T12B 5TR7A 2J80A 4U0TA 1AWIA 1YT4A 2PHYA 4X1MA 4WMCD 2ZM8A 4OKPA 1VQQA 3QP4A 4P6BA 4C75A 3LI8A 4S2MA 4ID4A 1JNUA 3CG5A 4FCFA 1FIKA 1LL9A 4R38A 3MKFA 2FZ0A 2XD5A 2Y55A 3A0SA 2XSSA 2H0TA 3E0YA 5CERA 4DF6A 4DKIA 1I5QA 2XQZA 1OT6A 5F83A 1LSWA 3HLDA 3EGDC 3H9WA 1J9MA 3QP6A 1SHVA 1XXMA 3NI9A 1IYPA 1S4RA 4CJNA 3DBAA 2P74A 4PAUA 1ES5A 4Y3IA 1KGGA 2LB5A 4OQGA 4Y0UA 1Q2QA 2Y2PA 4K0XA 2ZMAA 4ZJ1A 3V67A 3MF0A 4QB8A 4FH4A 5CHJA 1XGJA 3LIBA 3KSHA 1L0FA 3K3CA 2ZQ8A 3CPTB 5EV0A 2W3FA 3HLBA 1Y28A 3UB6A 3MFDA 4ZRRA 5FATA 2OLUA 1ESIA 5FDSA 4R70A 1RP5A 4LRYC 4WZ5C 5FI2A 1W5DA 1EW0A 2PT7A 4NXEA 3NECA 3F1OB 1F98A 1NLZA 1BULA 2Y2GA 5GLCA 2HDRA 1ES3A 3LR3A 4DE3A 3H82B 4GNUA 5DVAA 3BECA 2YKHA 5DJUA 3BM6A 3KO6A 4EETB 1YSQA 3Q7ZA 3SS5A 2VJWA 4UA6A 1GSWA 1Q2PA 5HSQA 3DAVA 5DTKA 3FG8A 4HBTA 4R1GA 1KOUA 2HDQA 4OP8A 4OQIA 4OPRA 1IKIA 1K4FA 1MZUA 1PWGA 3GV9A 4YINA 2QZ6A 4WLAA 1KVLA 3ZDJA 5TBMA 3IXHA 5E2EA 4BBVA 1G5UA 3N4IA 3UE0A 4EEPA 3ZG0A 1K56A 4FOFA 2ZC5B 4Y0OA 4PM8A 3GQZA 5EVEA 5HL6A 4OLDA 3KSIA 5L8MA 4H8RA 3C4PA 2VGLS 3IX4A 4DXBA 4B93A 3NJAA 2Q0OA 4GHIB 4WEKA 2V0UA 3T1RA 1LI9A 3O88A 2VV8A 4BQMA 5HFOA 3ICYA 1KE0A 2PDRA 3CI6A 4KG6A 3N8RA 1PNEA 1GSXA 2IWDA 1I2WA 1NJ4A 5FAPA 5JYPA 4DRTA 3IWIA 3OOVA 4R4SA 1F9IA 3ITBA 1OTEA 5EOOA 3G4PA 5FQMA 3UMDA 4NK3A 1EWZA 3WS0A 4LV3A 4R6LA 4BD0A 4P6ZM 5KMWA 1N9NA 5J7EA 5EECA 1LL5A 3UDFA 3WS4A 2P7JA 4X55A 2RL3A 3IX8A 3A0RA 2HZ5A 4HBUA 5AQ9A 4NG2A 3F1NB 1VETB 3BFFA 3VOYA 1WYCA 3CHWP 1UGUA 5FI7A 4S2KA 1OJGA 4QPRA 2ZM0A 3PAGA 3D72A 3B47A 4F94A 4XXRA 5KIZA 4LV2A 5A93A 3BFCA 2XH9A 1F2KA 1RGYA 1FR6A 2H10A 4KG2A 3RXXA 3GSGA 3HUNA 3PBQA 1ZTUA 4HJ6A 3WS2A 4BD1A 2B5RA 3IBJA 2HF6A 4Y0TA 4JXSA 3LUQA 3CMZA 1MY8A 4NKPA 3TW8A 1SDEA 3OPLA
chains in the Genus database with same CATH topology
2GJ3A 3LIDA 1XJ3A 4E04A 3T4SA 2O99A 3E98A 1WA9A 4CLCC 3FPVA 4F3LA 4KUKA 2P08A 2V1AA 1OTDA 3BJNA 2OWHA 2HGVA 2W1RA 4EQ1A 3LR4A 5K5BA 4EEUA 2OAQ1 3MXQA 1OJ5A 2Y79A 2OAP1 2PYPA 2VLGA 4IHQA 2KDKA 3EEAA 4LRZE 1TS0A 3T4JA 2J3TC 4DN0A 4I3AA 3UB8A 2NUTC 1DRMA 4LRXC 4L9EA 5DKLA 3S7NA 5EFWA 4F3LB 4EU0A 5J3WA 5TBMB 1STZA 3LI9A 1T18A 1OTAA 4EXOA 4MMNA 2K7SA 3SW1A 4DJ2A 3MQQA 3EWKA 2DMWA 2H28A 5DFYA 3TRCA 3K3DA 4O0PA 2VKSA 4G3WA 1NWZA 2GX5A 3P7NA 4L0LA 4EERA 3EOIA 2A24B 3R7WA 3MJQA 4YNRA 3F1PA 4L9FA 5DJTA 4YWZA 4HY8A 4NXFA 3UE3A 2XROA 4B9OA 1OTIA 1T1BA 3C2WA 4ME4A 5MC7A 2L1MA 4LPZA 3KYQA 3T50A 2ZMVA 4DMZA 3PBRA 3BW6A 3EQVA 4NXGA 1ODVA 1P9RA 1N9OA 2YKFA 4HHDA 2PD7A 3BQAA 3T4OA 2XA7S 1H3QA 3LIFA 2M7VA 2JN7A 3R7WB 3A0VA 4BWIA 3LR0A 4HQAA 3JVVA 4NEED 1S1YA 4HNBA 2PR5A 3PBTA 4I3JA 1P0ZA 3GDIA 4UQIS 4HI4A 3F1OA 5HZHA 3PBOA 5LBRA 4ETXA 5HWWA 1XJ2A 3RFBA 3LYXA 4IUKA 4HH2A 3KSFA 2PR6A 1T1AA 1OPXA 4MDZA 4CLCD 5HD3A 1VB6A 4PKYG 3MMHA 2VZWA 3MFXA 3OCLA 3H7WA 2INWA 2I9VA 2GZAA 2W3HA 2K31A 4CQHA 1OT9A 2G7UA 3CWFA 4M4XA 4EUVA 2A2LA 1GSVA 4XT2A 3UB9A 2L0WA 2J3TD 4HJ3A 1F5MA 2D02A 3OC2A 4JGQA 3IBRA 2EA9A 3BWLA 5IT5A 4II7A 4WELA 4WEJA 4GW9A 1MC0A 3PR6A 3H7WB 3U2AA 3NHQA 2M7UA 4EW7A 4OOMA 4PKYA 1TS8A 2J80A 3EGXC 4BJPA 1P97A 2LB9A 2PHYA 4AFIA 1W63Q 5G4YA 3R4KA 2MJ6A 1XFQA 2W1TA 1P9WA 1XFNA 2JHEA 2XA7M 2KOIA 5HPIA 3OBFA 3HJKA 3LI8A 1JNUA 2W3EA 4KQDA 5CX7A 4R38A 3CUEC 2FZ0A 1H8MA 3A0SA 4FSFA 5DKKA 5AVFA 2XSSA 3PHYA 3E0YA 4UQIM 1TS7A 1DP9A 3MR0A 1OT6A 1LSWA 3EGDC 3H9WA 4YOFA 3EQUA 4EESA 5HDCA 1N9LA 2W3GA 4Z1WA 3TJZC 2HV1A 1S4RA 4WUJA 3DBAA 3C30A 3MQOA 2JKRM 2CMNA 4PAUA 2PD8A 4ARZA 1G6OA 4GCZA 2WKPA 4Y3IA 2JKRI 3PBNA 3OLOA 3BY8A 5A8BA 2R78A 4NXBA 4I39A 2LB5A 5F5YA 4HIAA 4WL9A 3B42A 2O9CA 3FC7A 3KYZA 3UB7A 4GS9A 1T1CA 3PXPA 5AJGA 4MN6A 4ARZB 2BASA 1DP8A 3V67A 2EWWA 3F1PB 3MF0A 3GECA 4K08A 1V9YA 4Q0HA 3BQ8A 3LIBA 3KSHA 3K3CA 2W3DA 4Q0JA 2W3FA 4R3AA 2QWSA 1Y28A 5C5KA 3T4TA 3UB6A 4ZRRA 3TE8A 3NOTC 2PYRA 2WKQA 1TS6A 5IS1A 3H82A 1LSVA 4L9GA 2J3WA 1NRJA 4R70A 4Y5FA 4LRYC 4MN5A 4WF0A 3VE3A 1XJ4A 3P01A 1EW0A 1S4SA 2PT7A 4OOLA 2QJ7A 4CLCA 2Z6DA 4NXEA 4MN7A 3C8CA 3F1OB 4BBTA 1F98A 1NLZA 2W27A 1D06A 2ZMFA 3RTYA 2HJ9C 1ZHHB 3LFVA 4GLQA 2OWJA 1V9ZA 3LR3A 3H82B 2V1BA 2ZOIA 2YKHA 5DJUA 3KO6A 1LT0A 1LL8A 4EETB 1YSQA 3CUEA 3NOUC 3PYPA 3LIEA 4CLCB 2VJWA 2P04A 1XJ6A 3LIAA 3MQ0A 1UWNX 1GSWA 5HSQA 1YKDA 3KSGA 3FG8A 3VE4A 2KX6A 4XT2B 1KOUA 4HP9A 4P6ZS 2KLIA 1BYWA 2O9BA 1DP6A 5J4EA 3S7QA 2IA2A 3RH8B 4Q0IA 3OCNA 4GHIA 4MCWA 4BMWA 1MZUA 3O5YA 5I5LA 3PBSA 4WLAA 5TBMA 2Y8HA 4BBVA 4IJGA 5IU1A 4LLOB 4EEPA 4PHTA 4FOFA 4H6JA 2QJ5A 3HCYA 4UEYA 4O01A 3ULFA 2W1TB 5HL6A 3S7OA 3KSIA 5L8MA 3D3OA 4Y2FA 2VGLS 4B93A 3NJAA 4GHIB 1IOUA 3W2ZA 5AVEA 2A24A 2Z6CA 1MKMA 4WEKA 2V0UA 3T4QA 4JGPA 3T4KA 2O9AA 2VV8A 1S67L 3ICYA 1TF1A 2VA0A 4H6JB 2L4RA 2PDRA 4KQOA 4CLCE 3CI6A 2NUPC 1TD5A 5HPFA 5F69A 3CITA 1GSXA 2EWVA 1T19A 3VV4A 3S7PA 2VX8A 5G4ZA 2D01A 1YAXA 2V0WA 3C38A 1S66L 2V9AA 4HP4A 4G3KA 3OOVA 3K2NA 4I38A 4O8GA 1F9IA 1X0OA 1OTEA 3HJIA 5KSHA 3UMDA 4BBUA 1G28A 3CLOA 5F6AA 3F1NA 4R6LA 5FL3A 4P6ZM 5HWTA 4GS9B 5F68A 5HWVA 2O0YA 2OOLA 4ETZA 2QKPA 1N9NA 2FH5A 3VOLA 2ZBBA 4I5SA 3E4PA 5J7EA 2JKTM 3G6OA 2HJEA 2VV6A 3NOPC 5HD5A 2K2NA 3BY9A 2P7JA 4HH3A 3ZYTA 2VEAA 3LR5A 2ZOHA 2B02A 1VHMA 2JKTI 3A0RA 3ZQ5A 3FPWA 3F1NB 1S1ZA 5DFXA 4GJ4A 3B33A 2GNXA 2M1CA 4KUOA 2WKRA 3E4QA 1NLYA 3IS2A 1UGUA 2VGLM 1LSXA 5HDDA 4HJ4A 2QHKA 1OJGA 4QPRA 1W63M 4RQ9A 3D72A 3B47A 4WN5A 5TJJA 1YSPA 3UMEA 5KIZA 4G3VA 4I3IA 5DF9A 2XRNA 1IFQA 3E4OA 2B18A 5HDSA 3PBQA 1ZTUA 4HJ6A 3JVUA 3IBJA 1OTBA 1D7EA 2HF6A 3T4LA 2VV7A 3KX0X 3LICA 1UWPX 3LUQA 3CAXA 3IS2B 2W0NA 4IUHA 4HOIA 3UE6A 2QYBA 4NKPA 3TW8A 4DJ3A 4JGOA 3EEHA 4JGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GJ3 A;  3LID A;  1XJ3 A;  4E04 A;  1WA9 A;  4F3L A;  4KUK A;  2V1A A;  1OTD A;  2OWH A;  4EQ1 A;  4EEU A;  3MXQ A;  1OJ5 A;  2PYP A;  2VLG A;  2KDK A;  4LRZ E;  1TS0 A;  4I3A A;  3UB8 A;  1DRM A;  4LRX C;  4L9E A;  5DKL A;  4F3L B;  5EFW A;  5J3W A;  5TBM B;  3LI9 A;  1T18 A;  1OTA A;  4EXO A;  2K7S A;  3SW1 A;  4DJ2 A;  3MQQ A;  3EWK A;  2H28 A;  3K3D A;  1NWZ A;  3P7N A;  4EER A;  2A24 B;  3MJQ A;  3F1P A;  4L9F A;  5DJT A;  4YWZ A;  4HY8 A;  4NXF A;  4B9O A;  1OTI A;  1T1B A;  3C2W A;  2L1M A;  4LPZ A;  3T50 A;  4NXG A;  1ODV A;  1N9O A;  2YKF A;  4HHD A;  2PD7 A;  3LIF A;  2JN7 A;  3A0V A;  4HQA A;  1S1Y A;  4HNB A;  2PR5 A;  4I3J A;  1P0Z A;  3GDI A;  4HI4 A;  3F1O A;  5HZH A;  5HWW A;  1XJ2 A;  3LYX A;  4HH2 A;  2PR6 A;  1T1A A;  5HD3 A;  1VB6 A;  4PKY G;  3MFX A;  3H7W A;  2INW A;  2I9V A;  1OT9 A;  3CWF A;  4M4X A;  1GSV A;  4XT2 A;  3UB9 A;  2L0W A;  4HJ3 A;  2D02 A;  4JGQ A;  3IBR A;  2EA9 A;  3BWL A;  4GW9 A;  3H7W B;  3NHQ A;  4EW7 A;  4PKY A;  1TS8 A;  2J80 A;  1P97 A;  2PHY A;  5G4Y A;  1XFQ A;  1XFN A;  2JHE A;  3HJK A;  3LI8 A;  1JNU A;  4KQD A;  4R38 A;  3A0S A;  5DKK A;  5AVF A;  3PHY A;  1TS7 A;  1DP9 A;  3MR0 A;  1OT6 A;  1LSW A;  3H9W A;  4EES A;  5HDC A;  1N9L A;  2HV1 A;  1S4R A;  4WUJ A;  3MQO A;  2CMN A;  2PD8 A;  4GCZ A;  2WKP A;  3OLO A;  3BY8 A;  5A8B A;  2R78 A;  4NXB A;  4I39 A;  5F5Y A;  4HIA A;  4WL9 A;  3FC7 A;  3UB7 A;  4GS9 A;  1T1C A;  4MN6 A;  2BAS A;  1DP8 A;  3F1P B;  3GEC A;  4K08 A;  1V9Y A;  3LIB A;  3K3C A;  4R3A A;  2QWS A;  1Y28 A;  3UB6 A;  3NOT C;  2PYR A;  2WKQ A;  1TS6 A;  5IS1 A;  3H82 A;  1LSV A;  4L9G A;  4R70 A;  4LRY C;  4MN5 A;  4WF0 A;  3VE3 A;  1XJ4 A;  1EW0 A;  1S4S A;  2QJ7 A;  2Z6D A;  4NXE A;  3C8C A;  3F1O B;  4BBT A;  1F98 A;  2W27 A;  1D06 A;  3RTY A;  2OWJ A;  1V9Z A;  3H82 B;  2V1B A;  2ZOI A;  2YKH A;  5DJU A;  1LT0 A;  1LL8 A;  4EET B;  3NOU C;  3PYP A;  3LIE A;  1XJ6 A;  3LIA A;  1UWN X;  1GSW A;  5HSQ A;  3FG8 A;  3VE4 A;  2KX6 A;  4XT2 B;  1KOU A;  4HP9 A;  1BYW A;  1DP6 A;  5J4E A;  3RH8 B;  4GHI A;  1MZU A;  5I5L A;  4WLA A;  5TBM A;  4BBV A;  5IU1 A;  4LLO B;  4EEP A;  4H6J A;  2QJ5 A;  3ULF A;  4GHI B;  3NJA A;  5AVE A;  2A24 A;  2Z6C A;  2V0U A;  4JGP A;  2VV8 A;  1S67 L;  3ICY A;  4H6J B;  2L4R A;  2PDR A;  5F69 A;  1GSX A;  1T19 A;  5G4Z A;  2D01 A;  2V0W A;  1S66 L;  2V9A A;  4HP4 A;  4I38 A;  1F9I A;  1X0O A;  1OTE A;  3HJI A;  3UMD A;  4BBU A;  1G28 A;  3CLO A;  5F6A A;  3F1N A;  4R6L A;  5HWT A;  4GS9 B;  5F68 A;  5HWV A;  2OOL A;  2QKP A;  1N9N A;  3VOL A;  2ZBB A;  4I5S A;  3E4P A;  5J7E A;  3G6O A;  2VV6 A;  3NOP C;  5HD5 A;  4HH3 A;  2P7J A;  3BY9 A;  2VEA A;  2ZOH A;  2B02 A;  3A0R A;  3ZQ5 A;  3F1N B;  1S1Z A;  3B33 A;  2M1C A;  4KUO A;  2WKR A;  3E4Q A;  3IS2 A;  1UGU A;  1LSX A;  5HDD A;  4HJ4 A;  2QHK A;  1OJG A;  4RQ9 A;  3D72 A;  3UME A;  4WN5 A;  5KIZ A;  4I3I A;  3E4O A;  5HDS A;  4HJ6 A;  1OTB A;  1D7E A;  2VV7 A;  3KX0 X;  3LIC A;  1UWP X;  3LUQ A;  3CAX A;  3IS2 B;  2W0N A;  4HOI A;  3UE6 A;  4DJ3 A;  4JGO A;  3EEH A;  4JGR A; 
#chains in the Genus database with same CATH topology
 1CF0 A;  4E04 A;  2O99 A;  1WA9 A;  2Q9M A;  3AGE A;  3FPV A;  1SDN A;  2P08 A;  2V1A A;  1OTD A;  2XLN A;  4Y17 A;  3B3X A;  1CI8 A;  2XF3 A;  3O87 A;  2HDU A;  3VSK A;  1JVJ A;  3ZNT A;  3T4J A;  3QNC A;  1FR1 A;  3UB8 A;  2XGN A;  4LRX C;  2V20 A;  4L9E A;  4F3L B;  4ZJ2 A;  1STZ A;  1YLJ A;  3LI9 A;  4Y7P A;  4EXO A;  5GLD A;  2Y2J A;  2K7S A;  3IF6 B;  3V3R A;  3BEB A;  3MQQ A;  1VM1 A;  3MXS A;  3TRC A;  3L9K A;  4KZA A;  1G68 A;  3Q82 A;  4L9F A;  5DJT A;  4NXF A;  3UE3 A;  2XRO A;  1G6A A;  4LPZ A;  4P87 A;  3T50 A;  4RX3 A;  3EQV A;  2VK3 A;  1ODV A;  5EVI B;  2ACG A;  1N9O A;  5FQQ A;  3W4P A;  2ZL1 B;  3LR0 A;  4HQA A;  4NEE D;  3PBT A;  2EXA A;  3E2L A;  3GDI A;  3VFF A;  4HI4 A;  2Y59 A;  3MSH A;  5HWW A;  3LYX A;  2WGW B;  3BFE A;  4N9L A;  1IKG A;  3KSF A;  2PR6 A;  4EQI A;  3P98 A;  1OPX A;  5HD3 A;  1VB6 A;  1KVM A;  4PKY G;  5KZH A;  4RYE A;  3V39 A;  3MFX A;  2V8C A;  2A2L A;  3W4O A;  1W7F A;  2H5S A;  3OPR A;  3L7H A;  5CTM A;  1F5M A;  4JGQ A;  5EOE A;  1SCW A;  3IBR A;  3BWL A;  4S2I A;  4WEJ A;  4IBR A;  3H7W B;  2ZC6 B;  3JYI A;  4EW7 A;  3EGX C;  2EX2 A;  1CQA A;  3E2K A;  5G4Y A;  3G35 A;  1XFQ A;  2XA7 M;  3GMW A;  5HAQ A;  4R3J A;  2KOI A;  4C6Y A;  4E3N A;  1E4D A;  3HJK A;  5CRF A;  2W3E A;  4KQD A;  3UE1 A;  1K56 D;  4UQI M;  3D4F A;  1TS7 A;  4NET A;  1DP9 A;  3IWO A;  3TG9 A;  1FSW A;  2ZC4 B;  1H5X A;  2X71 A;  2FFY A;  3DWZ A;  1N9L A;  2W3G A;  3HLW A;  3QNB A;  3MQO A;  4KZ9 A;  4DE2 A;  2Y2Q A;  3PBN A;  1ALQ A;  2R78 A;  4NXB A;  4HIA A;  2V1Z A;  3G31 A;  2X02 A;  4WL9 A;  3B42 A;  4EV4 A;  2O9C A;  3FC7 A;  3KYZ A;  1HLU P;  2GDN A;  3UB7 A;  1T1C A;  2IWC A;  5AJG A;  5L2F A;  3F1P B;  1FOF A;  3G32 A;  1V9Y A;  3ZG9 B;  4GZB A;  4UHU A;  3VMA A;  4Q0J A;  1ES2 A;  4R3A A;  2QWS A;  5C5K A;  3T4T A;  5FAS A;  5FQI A;  3TE8 A;  4E3I A;  1TS6 A;  3CJM A;  4LCM A;  1LSV A;  1PW1 A;  1XA7 A;  1E3U D;  1NRJ A;  3LEQ A;  2EFX A;  5CTN A;  4JKT A;  4KZ4 A;  3VE3 A;  4E3M A;  2Y2K A;  3ZHH A;  4PM9 A;  2W27 A;  2ZMF A;  3RTY A;  1ZHH B;  3LFV A;  2OWJ A;  4OPZ A;  2ZOI A;  2V2F F;  5EM0 A;  2P04 A;  3MQ0 A;  4FD8 A;  1RGZ A;  2V8F A;  2R9X A;  1ES4 A;  4XT2 B;  2KLI A;  1GA0 A;  2EX9 A;  2BTF P;  2X01 A;  4Q0I A;  3OCN A;  4MCW A;  4OP5 A;  2EX8 A;  2Y4A A;  3O5Y A;  3PBS A;  2JKF A;  5EUA A;  2HP9 A;  3NBL A;  4LLO B;  3PAE A;  1TDG A;  1O7E A;  4H6J A;  2P9V A;  2W1T B;  3V5M A;  3BFD A;  4R3B A;  3ZVT A;  4KG5 A;  3T1X A;  1K4E A;  5AVE A;  2PBY A;  3JPU A;  3T4Q A;  3N7W A;  5A90 A;  1E25 A;  1S67 L;  1FIL A;  3G30 A;  2VA0 A;  1LLB A;  4N92 A;  4FUW A;  4GB7 A;  1T19 A;  3VV4 A;  3S7P A;  3NY4 A;  2D01 A;  3SS4 A;  3C38 A;  3UN7 A;  2G2W A;  1YLT A;  3DW0 A;  4OVD A;  4G3K A;  4I38 A;  3LEZ A;  5KSH A;  2I72 A;  1G28 A;  2ZQD A;  3CLO A;  3IF5 A;  3QP8 A;  5FL3 A;  1L0D A;  1O07 A;  4GS9 B;  5HWV A;  4IBX A;  3PTE A;  4DE0 A;  1MWU A;  4ETZ A;  3IHB A;  2ZBB A;  3IXD A;  2WAF A;  3QP1 A;  3UNW A;  2JKT M;  2HJE A;  2C6W B;  5HD5 A;  2K2N A;  1OME A;  3BY9 A;  4HH3 A;  3ZYT A;  2B02 A;  2JKT I;  1BTL A;  4K0W A;  3A3D A;  2GNX A;  1DY6 A;  4KUO A;  3E4Q A;  1JWZ A;  5HDD A;  1W63 M;  3UME A;  5TJJ A;  4G3V A;  2QMI A;  4EWF A;  5FA7 A;  5DTS A;  5FSR A;  3S22 A;  1BLP A;  2WK0 A;  5HDS A;  3JVU A;  2IWB A;  1BLC A;  1OTB A;  3KX0 X;  1UWP X;  3SH7 A;  2J9O A;  4E3K A;  4OQ0 A;  2QYB A;  4JGO A;  3LID A;  3VSL A;  1XP4 A;  3T4S A;  1TVF A;  4CLC C;  2WAE A;  3GTC A;  4KUK A;  2OWH A;  1K6R A;  3UB5 P;  2HGV A;  5K5B A;  4EQ1 A;  3LR4 A;  4EEU A;  4UA7 A;  3MXQ A;  1SZV A;  2PU2 A;  2OV5 A;  2Y79 A;  1XA1 A;  2PYP A;  4IHQ A;  2KDK A;  2R9W A;  2Y91 A;  3RJU A;  2J3T C;  4DN0 A;  1TEM A;  4JBF A;  4KZ6 A;  1QME A;  3G34 A;  3VP4 A;  3SW1 A;  1D1J A;  4KQR A;  4CPK A;  5EVI D;  3IX3 A;  2BLS A;  5F1F A;  3FZC A;  5M18 A;  3OPP A;  3SOI A;  3P7N A;  4EER A;  3EOI A;  2A24 B;  1FCN A;  1XPB A;  4B9O A;  5FEG A;  5MC7 A;  2L1M A;  3W8K A;  3BRM A;  2ZMV A;  4E3L A;  2ZLY A;  4LEN A;  1P9R A;  2YKF A;  4HHD A;  4KZ7 A;  1JWV A;  1K38 A;  1L3L A;  2XEP A;  3A0V A;  1KGE A;  4LCL A;  4O7D A;  3ZGA B;  2WKH A;  3DTI A;  5U47 A;  3OPH A;  3N8S A;  4EBN A;  3F1O A;  3FWL A;  3WS5 A;  5E43 A;  2ZQ9 A;  4ETX A;  4X68 A;  2E8I A;  5E2H A;  3G2Y A;  3W4Q A;  1PYY A;  1Z09 A;  1PWD A;  2VZW A;  3WS1 A;  3OCL A;  2A49 A;  2INW A;  2W3H A;  4PPR A;  1ZKJ A;  2K31 A;  1CI9 A;  4CQH A;  1BT5 A;  4FH2 A;  1A0K A;  5HAR A;  3UB9 A;  2L0W A;  3ITA A;  4JF5 A;  3OC2 A;  3IXG A;  4KQQ A;  4WEL A;  5HX9 A;  5FEF A;  3M2J A;  3UPO A;  3U2A A;  1HZO A;  1SKF A;  4OOM A;  1K25 A;  3ISG A;  1MBL A;  2EXB A;  4K91 A;  1W63 Q;  1BZA A;  3Q07 A;  3A3E A;  1H8Y A;  5GL9 A;  3GVB A;  2MJ6 A;  2Z2L B;  4WMC A;  4OH0 A;  1P9W A;  2JHE A;  3Q7V A;  1U60 A;  1N9B A;  3QP2 A;  4Y13 A;  4Q8I A;  1RCJ A;  1H8M A;  3FV7 A;  2Y2L A;  5J8X A;  2UWX A;  2ZC7 A;  4YOF A;  2OLV A;  3EQU A;  4EES A;  4S2P A;  5HDC A;  4E6X A;  3TJZ C;  4N1X A;  1HTZ A;  2JKR M;  2CMN A;  2PD8 A;  2J9P A;  4ARZ A;  1KGF A;  4ZBE A;  2WKP A;  2JKR I;  4P85 A;  3BY8 A;  4I39 A;  4GOG A;  5CGS A;  5AQB A;  1PRQ A;  3HVF A;  4HEF A;  2WKE A;  3PXP A;  4R0Q A;  5CXW A;  2BAS A;  2ZM2 A;  2ZQ7 A;  2H0Y A;  1PI5 A;  3BQ8 A;  5FQJ A;  1Z6F A;  1WYB A;  4X53 A;  1VET A;  2ZC3 B;  2WKQ A;  3A3I A;  3C4O A;  3MZF A;  5D3O A;  1CK3 A;  3HLF A;  4L9G A;  2JC7 A;  3CZD A;  2J3W A;  1MPL A;  4ZDX A;  1XJ4 A;  1S4S A;  4OOL A;  4CLC A;  2Z6D A;  1NYY A;  3UPN A;  4BBT A;  5AQA A;  3C7V A;  3V3S A;  1YLZ A;  4DXC A;  2Z2M B;  2HJ9 C;  5IHV A;  4GLQ A;  1V9Z A;  2V1B A;  3C5A A;  1Y54 A;  4RX2 A;  3CUE A;  3ZFZ A;  3N8L A;  3PYP A;  3LIE A;  1J3W A;  2ZJ9 A;  1K54 C;  4QWO A;  3UY6 A;  3WWX A;  5CHM A;  4HP9 A;  4P6Z S;  1BYW A;  2O9B A;  1DP6 A;  1W79 A;  5GHX A;  3HLC A;  5J4E A;  3S7Q A;  2IA2 A;  4JXW A;  4JF6 A;  3MBZ A;  2XD1 A;  2WKI A;  2WZZ A;  4OPQ A;  3MZD A;  5IU1 A;  4PHT A;  4GD6 A;  1M6K A;  3HCY A;  4UEY A;  4O01 A;  1GHP A;  2PU4 A;  1S0W A;  3ULF A;  2OSU A;  4MBF A;  1GHM A;  3S7O A;  5HW3 A;  4Y2F A;  3IH9 A;  3W2Z A;  1ZC2 A;  1YLP A;  3VFH A;  4JGP A;  1W8Q A;  2O9A A;  1ESU A;  5L07 A;  4H6J B;  2WZX A;  4KQO A;  2NUP C;  5HPF A;  3CIT A;  2EWV A;  3TOI A;  5JYO A;  3Q1F A;  2ZL1 A;  3VP3 A;  3G2Z A;  5F1G A;  2V9A A;  4HP4 A;  3NC8 A;  2JBF A;  1VEU A;  2JKG A;  3HJI A;  5FQ9 A;  1L0E A;  1NY0 A;  5HWT A;  2WGW A;  5F68 A;  5E2F A;  2QKP A;  4MEZ A;  3VOL A;  1MWS A;  4JXG A;  1GCE A;  1KE4 A;  1JTD A;  3G6O A;  2WGI A;  2VV6 A;  2VGJ A;  4KZ8 A;  3TSG A;  3ZNY A;  2AVX A;  3ZQ5 A;  3FPW A;  3B33 A;  1YMS A;  2M1C A;  2WKR A;  4PMA A;  2ZQC A;  3IS2 A;  5L10 A;  3D9Y A;  2VGL M;  1LSX A;  4RVA A;  1YSP A;  3IXB A;  5EE8 A;  5EPH A;  4C3Q A;  3DWK A;  4I3I A;  4DDS A;  5DF9 A;  2XDM A;  4X69 A;  3S4X A;  3E4O A;  2B18 A;  4D2O A;  3Q81 A;  4OPY A;  1D7E A;  3T4L A;  3GR2 A;  2VV7 A;  3CAX A;  4OON A;  4QD4 A;  1NXY A;  3UE6 A;  2EFU A;  4YFM A;  4JGR A;  4N1H A;  4D60 A;  5GLA A;  5A92 A;  3I7J A;  1BLS A;  3O86 A;  5HAP A;  2HDS A;  2Y2N A;  5CHU A;  3BJN A;  3NDE A;  2HPB A;  4QY5 A;  2OAQ 1;  3HL9 A;  3LY3 A;  4M3K A;  2OAP 1;  1NZU A;  2VLG A;  3ZCZ A;  1WE4 A;  1FCM A;  3IT9 A;  4I3A A;  5HL1 A;  5EFW A;  4OQH A;  4EU0 A;  5J3W A;  5TBM B;  2EX6 A;  4IED A;  4MMN A;  2DMW A;  4S2N A;  5DFY A;  2RCX A;  4GN2 A;  4O0P A;  2VKS A;  2GX5 A;  4L0L A;  3R7W A;  3MJQ A;  3F1P A;  1ERO A;  3HLG A;  4YWZ A;  4HY8 A;  4EUZ A;  2DNS A;  3WRZ A;  5BOH A;  4QHC A;  1MXO A;  1T1B A;  3C2W A;  1SKO A;  1H8Z A;  1ACF A;  3MXR A;  4KZ5 A;  4BL2 A;  5KSC A;  4QY6 A;  4LV1 A;  2PD7 A;  3T4O A;  2XA7 S;  1H3Q A;  3M6H A;  1HD8 A;  3GRJ A;  3JVV A;  1I2S A;  4HNB A;  4I3J A;  3S1Y A;  3FYZ A;  1P0Z A;  5GHY A;  1K54 A;  4UQI S;  5HZH A;  1LI0 A;  3PBO A;  1PI4 A;  3M6B A;  4N9K A;  2VGK A;  1XJ2 A;  3RFB A;  4EBP A;  2WUQ A;  4IUK A;  5M1A A;  1PW8 A;  2PAV P;  4WM9 A;  1T1A A;  4CLC D;  1W8Y A;  3MMH A;  5CEB A;  1S6R A;  4BEN A;  2GZA A;  3LGO A;  4S2J A;  5G18 A;  1LHY A;  4X1L A;  4MBH A;  3CWF A;  4M4X A;  4EUV A;  3AGD A;  3FKV A;  1GSV A;  4WZ4 A;  4XT2 A;  4Z9Q A;  1FQG A;  2J3T D;  2XFT A;  4HJ3 A;  5F82 A;  2D02 A;  4B4Z A;  4QJG A;  4II7 A;  5IT5 A;  1ERM A;  5M19 A;  2Y2H A;  3PR6 A;  3NHQ A;  2M7U A;  4PKY A;  3UPP A;  1TS8 A;  1Y4O A;  4BJP A;  1P97 A;  2LB9 A;  1PZO A;  3VP0 A;  4AFI A;  3DTM A;  3R4K A;  1TDL A;  2W1T A;  2J7V A;  3P09 A;  1XFN A;  4UAA A;  5HPI A;  4E3J A;  3OBF A;  3DTK A;  5CX7 A;  5DF8 A;  3CUE C;  1ZG4 A;  1BLH A;  4FSF A;  3HBR A;  3IQA A;  5DKK A;  5AVF A;  3PHY A;  1DJC A;  1ONH A;  3MR0 A;  1EI5 A;  3Q7V B;  4Z1W A;  2HV1 A;  1PFL A;  1XGI A;  4WUJ A;  3C30 A;  4LGW A;  2UV0 E;  1K6S A;  1G6O A;  2JE5 A;  4GCZ A;  3OLO A;  5A8B A;  1YLY A;  1JTG A;  3U4L P;  1QMF A;  4JF4 A;  5F5Y A;  1YM1 A;  3CPT A;  4WYY A;  4P0M A;  4PM6 A;  3IF6 C;  3VP2 A;  4GS9 A;  4GKU A;  1GHI A;  4LFU A;  4ARZ B;  4MN6 A;  3IWQ A;  1DP8 A;  3LCE A;  1MKI A;  2EWW A;  1IYO A;  3GEC A;  4K08 A;  4PM5 A;  2Q9N A;  4X25 A;  4R4R A;  4Q0H A;  2W3D A;  3OZH A;  4XUX A;  3RXW A;  3A3F A;  3NOT C;  4LV0 A;  2PYR A;  5IS1 A;  5EVI C;  3H82 A;  4Y5F A;  3BLM A;  4MN5 A;  2PBD P;  4WF0 A;  1E3U A;  3P01 A;  1K57 C;  2QJ7 A;  4MN7 A;  3C8C A;  4X56 A;  1M40 A;  4FTX A;  1D06 A;  1JWP A;  2E8J A;  3HUM A;  2A3U A;  2DRW A;  5AQ7 A;  3N6I A;  5FAQ A;  3SS3 A;  4B4X A;  1LT0 A;  3NCK A;  1LL8 A;  3T1Q B;  3NOU C;  4CLC B;  1XJ6 A;  3LIA A;  1UWN X;  3T1S A;  1YKD A;  4JLF A;  3KSG A;  2C5W B;  4DE1 A;  3VOZ A;  2ZD8 A;  3VE4 A;  3O3V A;  3UDX A;  3ZVW A;  3LY4 A;  2KX6 A;  4BLM A;  1ONG A;  4U3T A;  4KZB A;  1DJA A;  4OLG A;  1NZO A;  3SH8 A;  4IVK A;  1K55 C;  3RH8 B;  5L09 A;  4BMW A;  4GHI A;  4S2O A;  5I5L A;  2Y8H A;  1BUE A;  4IJG A;  5FAO A;  4GD8 A;  3AGF A;  2QJ5 A;  2WGV A;  1CEG A;  3D3O A;  3LO7 A;  1IOU A;  1L2S A;  4R23 A;  2A24 A;  2Z6C A;  3MKE A;  2B95 A;  1MKM A;  5CGX A;  5TGF A;  1YQS A;  1KE3 A;  2Y2M A;  3T4K A;  2CC1 A;  1TF1 A;  3SH9 A;  3FKW A;  2L4R A;  3V50 A;  4CLC E;  4S2L A;  4ZTK A;  1TD5 A;  5F69 A;  5EVL A;  3HLE A;  4BL3 A;  2VX8 A;  1FCO A;  4RA7 A;  5G4Z A;  4E6W A;  1YAX A;  3MZE A;  2V0W A;  4WZ5 A;  4KEN B;  1S66 L;  4JPM A;  3DTE A;  4EBL A;  3K2N A;  4O8G A;  1X0O A;  4ZAM A;  4JXV A;  1H0M A;  2PRF A;  4BBU A;  3QHY A;  3M2K A;  5DTT A;  5CGW A;  5F6A A;  3F1N A;  5I94 A;  5CED A;  3HRE A;  5HAI A;  4S2N C;  5A91 A;  2O0Y A;  2OOL A;  2Y2O A;  1YLW A;  3HUO A;  3BFG A;  2FH5 A;  5TFQ A;  4X6T A;  4I5S A;  5FQK A;  1IEM A;  3E4P A;  4ESP A;  3NOP C;  1VEU B;  2VEA A;  3LR5 A;  2ZOH A;  3VP1 A;  1VHM A;  1S1Z A;  5DFX A;  5EM1 A;  3C7U A;  4GJ4 A;  1C3B A;  1CJF A;  5CEC A;  5DF7 A;  1MWR A;  1NLY A;  4HJ4 A;  2QHK A;  4RQ9 A;  4WN5 A;  3UDI A;  2XRN A;  1IFQ A;  4HES A;  3BLS A;  4B88 A;  3QP5 A;  3IHA A;  4DDY A;  4QU3 A;  1BSG A;  1KDS A;  1IYQ A;  3LIC A;  3IS2 B;  4KZ3 A;  2W0N A;  3UO9 A;  4IUH A;  4HOI A;  1N4O A;  2G2U A;  3NDG A;  4DJ3 A;  3EEH A;  2XK1 A;  4A5R A;  2GJ3 A;  1XJ3 A;  3E98 A;  4F3L A;  3NUL A;  5GLB A;  2Y2I A;  2W1R A;  2DCF A;  1AXB A;  3IF6 A;  3A3J A;  2BG1 A;  1OJ5 A;  2WYX A;  4MBK A;  3KYE A;  1PZP A;  1YPR A;  4MLL A;  3EEA A;  4LRZ E;  1TS0 A;  2NUT C;  1DRM A;  5DKL A;  3S7N A;  3MS6 A;  1L0G A;  1T18 A;  1OTA A;  3IH8 A;  3WRT A;  4DJ2 A;  2P9V B;  3EWK A;  2H28 A;  3NIA A;  1FSY A;  4OOY A;  1K0K A;  2ZQA A;  1ERQ A;  2J8Y A;  3K3D A;  1IEL A;  5EVI A;  4MNR A;  4G3W A;  2HP6 A;  1NWZ A;  2WAD A;  1GA9 A;  1IYS A;  4YNR A;  1NYM A;  2FFF B;  1K57 A;  1OTI A;  4ME4 A;  1NRF A;  4E3O A;  2JCH A;  3KYQ A;  2XR0 A;  4DMZ A;  4U0X A;  1DJB A;  3PBR A;  5E2G A;  3BW6 A;  4NXG A;  4Y15 A;  1XX2 A;  3BQA A;  3LIF A;  2M7V A;  2JN7 A;  3R7W B;  4BWI A;  3ZG8 B;  5GHZ A;  2HP5 A;  1S1Y A;  2PR5 A;  1SKO B;  4XUZ A;  2XFS A;  5LBR A;  4GDB A;  1MWT A;  4ZJ3 A;  1ZG6 A;  4GDN A;  4UA9 A;  1PIO A;  4HH2 A;  1K55 A;  3BYD A;  4MDZ A;  5FDH A;  3H7W A;  2I9V A;  2QPN A;  1HVB A;  3ZG5 A;  5FI6 A;  1OT9 A;  2G7U A;  1XKZ A;  4WBG A;  1YMX A;  4IVI A;  3SZT A;  1CEF A;  3ZG7 B;  2EA9 A;  4PM7 A;  4GW9 A;  1KDW A;  1MC0 A;  1PWC A;  3T12 B;  5TR7 A;  2J80 A;  4U0T A;  1AWI A;  1YT4 A;  2PHY A;  4X1M A;  4WMC D;  2ZM8 A;  4OKP A;  1VQQ A;  3QP4 A;  4P6B A;  4C75 A;  3LI8 A;  4S2M A;  4ID4 A;  1JNU A;  3CG5 A;  4FCF A;  1FIK A;  1LL9 A;  4R38 A;  3MKF A;  2FZ0 A;  2XD5 A;  2Y55 A;  3A0S A;  2XSS A;  2H0T A;  3E0Y A;  5CER A;  4DF6 A;  4DKI A;  1I5Q A;  2XQZ A;  1OT6 A;  5F83 A;  1LSW A;  3HLD A;  3EGD C;  3H9W A;  1J9M A;  3QP6 A;  1SHV A;  1XXM A;  3NI9 A;  1IYP A;  1S4R A;  4CJN A;  3DBA A;  2P74 A;  4PAU A;  1ES5 A;  4Y3I A;  1KGG A;  2LB5 A;  4OQG A;  4Y0U A;  1Q2Q A;  2Y2P A;  4K0X A;  2ZMA A;  4ZJ1 A;  3V67 A;  3MF0 A;  4QB8 A;  4FH4 A;  5CHJ A;  1XGJ A;  3LIB A;  3KSH A;  1L0F A;  3K3C A;  2ZQ8 A;  3CPT B;  5EV0 A;  2W3F A;  3HLB A;  1Y28 A;  3UB6 A;  3MFD A;  4ZRR A;  5FAT A;  2OLU A;  1ESI A;  5FDS A;  4R70 A;  1RP5 A;  4LRY C;  4WZ5 C;  5FI2 A;  1W5D A;  1EW0 A;  2PT7 A;  4NXE A;  3NEC A;  3F1O B;  1F98 A;  1NLZ A;  1BUL A;  2Y2G A;  5GLC A;  2HDR A;  1ES3 A;  3LR3 A;  4DE3 A;  3H82 B;  4GNU A;  5DVA A;  3BEC A;  2YKH A;  5DJU A;  3BM6 A;  3KO6 A;  4EET B;  1YSQ A;  3Q7Z A;  3SS5 A;  2VJW A;  4UA6 A;  1GSW A;  1Q2P A;  5HSQ A;  3DAV A;  5DTK A;  3FG8 A;  4HBT A;  4R1G A;  1KOU A;  2HDQ A;  4OP8 A;  4OQI A;  4OPR A;  1IKI A;  1K4F A;  1MZU A;  1PWG A;  3GV9 A;  4YIN A;  2QZ6 A;  4WLA A;  1KVL A;  3ZDJ A;  5TBM A;  3IXH A;  5E2E A;  4BBV A;  1G5U A;  3N4I A;  3UE0 A;  4EEP A;  3ZG0 A;  1K56 A;  4FOF A;  2ZC5 B;  4Y0O A;  4PM8 A;  3GQZ A;  5EVE A;  5HL6 A;  4OLD A;  3KSI A;  5L8M A;  4H8R A;  3C4P A;  2VGL S;  3IX4 A;  4DXB A;  4B93 A;  3NJA A;  2Q0O A;  4GHI B;  4WEK A;  2V0U A;  3T1R A;  1LI9 A;  3O88 A;  2VV8 A;  4BQM A;  5HFO A;  3ICY A;  1KE0 A;  2PDR A;  3CI6 A;  4KG6 A;  3N8R A;  1PNE A;  1GSX A;  2IWD A;  1I2W A;  1NJ4 A;  5FAP A;  5JYP A;  4DRT A;  3IWI A;  3OOV A;  4R4S A;  1F9I A;  3ITB A;  1OTE A;  5EOO A;  3G4P A;  5FQM A;  3UMD A;  4NK3 A;  1EWZ A;  3WS0 A;  4LV3 A;  4R6L A;  4BD0 A;  4P6Z M;  5KMW A;  1N9N A;  5J7E A;  5EEC A;  1LL5 A;  3UDF A;  3WS4 A;  2P7J A;  4X55 A;  2RL3 A;  3IX8 A;  3A0R A;  2HZ5 A;  4HBU A;  5AQ9 A;  4NG2 A;  3F1N B;  1VET B;  3BFF A;  3VOY A;  1WYC A;  3CHW P;  1UGU A;  5FI7 A;  4S2K A;  1OJG A;  4QPR A;  2ZM0 A;  3PAG A;  3D72 A;  3B47 A;  4F94 A;  4XXR A;  5KIZ A;  4LV2 A;  5A93 A;  3BFC A;  2XH9 A;  1F2K A;  1RGY A;  1FR6 A;  2H10 A;  4KG2 A;  3RXX A;  3GSG A;  3HUN A;  3PBQ A;  1ZTU A;  4HJ6 A;  3WS2 A;  4BD1 A;  2B5R A;  3IBJ A;  2HF6 A;  4Y0T A;  4JXS A;  3LUQ A;  3CMZ A;  1MY8 A;  4NKP A;  3TW8 A;  1SDE A;  3OPL A; 
#chains in the Genus database with same CATH homology
 2GJ3 A;  3LID A;  1XJ3 A;  4E04 A;  3T4S A;  2O99 A;  3E98 A;  1WA9 A;  4CLC C;  3FPV A;  4F3L A;  4KUK A;  2P08 A;  2V1A A;  1OTD A;  3BJN A;  2OWH A;  2HGV A;  2W1R A;  4EQ1 A;  3LR4 A;  5K5B A;  4EEU A;  2OAQ 1;  3MXQ A;  1OJ5 A;  2Y79 A;  2OAP 1;  2PYP A;  2VLG A;  4IHQ A;  2KDK A;  3EEA A;  4LRZ E;  1TS0 A;  3T4J A;  2J3T C;  4DN0 A;  4I3A A;  3UB8 A;  2NUT C;  1DRM A;  4LRX C;  4L9E A;  5DKL A;  3S7N A;  5EFW A;  4F3L B;  4EU0 A;  5J3W A;  5TBM B;  1STZ A;  3LI9 A;  1T18 A;  1OTA A;  4EXO A;  4MMN A;  2K7S A;  3SW1 A;  4DJ2 A;  3MQQ A;  3EWK A;  2DMW A;  2H28 A;  5DFY A;  3TRC A;  3K3D A;  4O0P A;  2VKS A;  4G3W A;  1NWZ A;  2GX5 A;  3P7N A;  4L0L A;  4EER A;  3EOI A;  2A24 B;  3R7W A;  3MJQ A;  4YNR A;  3F1P A;  4L9F A;  5DJT A;  4YWZ A;  4HY8 A;  4NXF A;  3UE3 A;  2XRO A;  4B9O A;  1OTI A;  1T1B A;  3C2W A;  4ME4 A;  5MC7 A;  2L1M A;  4LPZ A;  3KYQ A;  3T50 A;  2ZMV A;  4DMZ A;  3PBR A;  3BW6 A;  3EQV A;  4NXG A;  1ODV A;  1P9R A;  1N9O A;  2YKF A;  4HHD A;  2PD7 A;  3BQA A;  3T4O A;  2XA7 S;  1H3Q A;  3LIF A;  2M7V A;  2JN7 A;  3R7W B;  3A0V A;  4BWI A;  3LR0 A;  4HQA A;  3JVV A;  4NEE D;  1S1Y A;  4HNB A;  2PR5 A;  3PBT A;  4I3J A;  1P0Z A;  3GDI A;  4UQI S;  4HI4 A;  3F1O A;  5HZH A;  3PBO A;  5LBR A;  4ETX A;  5HWW A;  1XJ2 A;  3RFB A;  3LYX A;  4IUK A;  4HH2 A;  3KSF A;  2PR6 A;  1T1A A;  1OPX A;  4MDZ A;  4CLC D;  5HD3 A;  1VB6 A;  4PKY G;  3MMH A;  2VZW A;  3MFX A;  3OCL A;  3H7W A;  2INW A;  2I9V A;  2GZA A;  2W3H A;  2K31 A;  4CQH A;  1OT9 A;  2G7U A;  3CWF A;  4M4X A;  4EUV A;  2A2L A;  1GSV A;  4XT2 A;  3UB9 A;  2L0W A;  2J3T D;  4HJ3 A;  1F5M A;  2D02 A;  3OC2 A;  4JGQ A;  3IBR A;  2EA9 A;  3BWL A;  5IT5 A;  4II7 A;  4WEL A;  4WEJ A;  4GW9 A;  1MC0 A;  3PR6 A;  3H7W B;  3U2A A;  3NHQ A;  2M7U A;  4EW7 A;  4OOM A;  4PKY A;  1TS8 A;  2J80 A;  3EGX C;  4BJP A;  1P97 A;  2LB9 A;  2PHY A;  4AFI A;  1W63 Q;  5G4Y A;  3R4K A;  2MJ6 A;  1XFQ A;  2W1T A;  1P9W A;  1XFN A;  2JHE A;  2XA7 M;  2KOI A;  5HPI A;  3OBF A;  3HJK A;  3LI8 A;  1JNU A;  2W3E A;  4KQD A;  5CX7 A;  4R38 A;  3CUE C;  2FZ0 A;  1H8M A;  3A0S A;  4FSF A;  5DKK A;  5AVF A;  2XSS A;  3PHY A;  3E0Y A;  4UQI M;  1TS7 A;  1DP9 A;  3MR0 A;  1OT6 A;  1LSW A;  3EGD C;  3H9W A;  4YOF A;  3EQU A;  4EES A;  5HDC A;  1N9L A;  2W3G A;  4Z1W A;  3TJZ C;  2HV1 A;  1S4R A;  4WUJ A;  3DBA A;  3C30 A;  3MQO A;  2JKR M;  2CMN A;  4PAU A;  2PD8 A;  4ARZ A;  1G6O A;  4GCZ A;  2WKP A;  4Y3I A;  2JKR I;  3PBN A;  3OLO A;  3BY8 A;  5A8B A;  2R78 A;  4NXB A;  4I39 A;  2LB5 A;  5F5Y A;  4HIA A;  4WL9 A;  3B42 A;  2O9C A;  3FC7 A;  3KYZ A;  3UB7 A;  4GS9 A;  1T1C A;  3PXP A;  5AJG A;  4MN6 A;  4ARZ B;  2BAS A;  1DP8 A;  3V67 A;  2EWW A;  3F1P B;  3MF0 A;  3GEC A;  4K08 A;  1V9Y A;  4Q0H A;  3BQ8 A;  3LIB A;  3KSH A;  3K3C A;  2W3D A;  4Q0J A;  2W3F A;  4R3A A;  2QWS A;  1Y28 A;  5C5K A;  3T4T A;  3UB6 A;  4ZRR A;  3TE8 A;  3NOT C;  2PYR A;  2WKQ A;  1TS6 A;  5IS1 A;  3H82 A;  1LSV A;  4L9G A;  2J3W A;  1NRJ A;  4R70 A;  4Y5F A;  4LRY C;  4MN5 A;  4WF0 A;  3VE3 A;  1XJ4 A;  3P01 A;  1EW0 A;  1S4S A;  2PT7 A;  4OOL A;  2QJ7 A;  4CLC A;  2Z6D A;  4NXE A;  4MN7 A;  3C8C A;  3F1O B;  4BBT A;  1F98 A;  1NLZ A;  2W27 A;  1D06 A;  2ZMF A;  3RTY A;  2HJ9 C;  1ZHH B;  3LFV A;  4GLQ A;  2OWJ A;  1V9Z A;  3LR3 A;  3H82 B;  2V1B A;  2ZOI A;  2YKH A;  5DJU A;  3KO6 A;  1LT0 A;  1LL8 A;  4EET B;  1YSQ A;  3CUE A;  3NOU C;  3PYP A;  3LIE A;  4CLC B;  2VJW A;  2P04 A;  1XJ6 A;  3LIA A;  3MQ0 A;  1UWN X;  1GSW A;  5HSQ A;  1YKD A;  3KSG A;  3FG8 A;  3VE4 A;  2KX6 A;  4XT2 B;  1KOU A;  4HP9 A;  4P6Z S;  2KLI A;  1BYW A;  2O9B A;  1DP6 A;  5J4E A;  3S7Q A;  2IA2 A;  3RH8 B;  4Q0I A;  3OCN A;  4GHI A;  4MCW A;  4BMW A;  1MZU A;  3O5Y A;  5I5L A;  3PBS A;  4WLA A;  5TBM A;  2Y8H A;  4BBV A;  4IJG A;  5IU1 A;  4LLO B;  4EEP A;  4PHT A;  4FOF A;  4H6J A;  2QJ5 A;  3HCY A;  4UEY A;  4O01 A;  3ULF A;  2W1T B;  5HL6 A;  3S7O A;  3KSI A;  5L8M A;  3D3O A;  4Y2F A;  2VGL S;  4B93 A;  3NJA A;  4GHI B;  1IOU A;  3W2Z A;  5AVE A;  2A24 A;  2Z6C A;  1MKM A;  4WEK A;  2V0U A;  3T4Q A;  4JGP A;  3T4K A;  2O9A A;  2VV8 A;  1S67 L;  3ICY A;  1TF1 A;  2VA0 A;  4H6J B;  2L4R A;  2PDR A;  4KQO A;  4CLC E;  3CI6 A;  2NUP C;  1TD5 A;  5HPF A;  5F69 A;  3CIT A;  1GSX A;  2EWV A;  1T19 A;  3VV4 A;  3S7P A;  2VX8 A;  5G4Z A;  2D01 A;  1YAX A;  2V0W A;  3C38 A;  1S66 L;  2V9A A;  4HP4 A;  4G3K A;  3OOV A;  3K2N A;  4I38 A;  4O8G A;  1F9I A;  1X0O A;  1OTE A;  3HJI A;  5KSH A;  3UMD A;  4BBU A;  1G28 A;  3CLO A;  5F6A A;  3F1N A;  4R6L A;  5FL3 A;  4P6Z M;  5HWT A;  4GS9 B;  5F68 A;  5HWV A;  2O0Y A;  2OOL A;  4ETZ A;  2QKP A;  1N9N A;  2FH5 A;  3VOL A;  2ZBB A;  4I5S A;  3E4P A;  5J7E A;  2JKT M;  3G6O A;  2HJE A;  2VV6 A;  3NOP C;  5HD5 A;  2K2N A;  3BY9 A;  2P7J A;  4HH3 A;  3ZYT A;  2VEA A;  3LR5 A;  2ZOH A;  2B02 A;  1VHM A;  2JKT I;  3A0R A;  3ZQ5 A;  3FPW A;  3F1N B;  1S1Z A;  5DFX A;  4GJ4 A;  3B33 A;  2GNX A;  2M1C A;  4KUO A;  2WKR A;  3E4Q A;  1NLY A;  3IS2 A;  1UGU A;  2VGL M;  1LSX A;  5HDD A;  4HJ4 A;  2QHK A;  1OJG A;  4QPR A;  1W63 M;  4RQ9 A;  3D72 A;  3B47 A;  4WN5 A;  5TJJ A;  1YSP A;  3UME A;  5KIZ A;  4G3V A;  4I3I A;  5DF9 A;  2XRN A;  1IFQ A;  3E4O A;  2B18 A;  5HDS A;  3PBQ A;  1ZTU A;  4HJ6 A;  3JVU A;  3IBJ A;  1OTB A;  1D7E A;  2HF6 A;  3T4L A;  2VV7 A;  3KX0 X;  3LIC A;  1UWP X;  3LUQ A;  3CAX A;  3IS2 B;  2W0N A;  4IUH A;  4HOI A;  3UE6 A;  2QYB A;  4NKP A;  3TW8 A;  4DJ3 A;  4JGO A;  3EEH A;  4JGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...