4GS9B

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with an inactive benzoxadiazole antagonist
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
PTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Development of Inhibitors of the PAS-B Domain of the HIF-2 alpha Transcription Factor
pubmed doi rcsb
molecule keywords Endothelial PAS domain-containing protein 1
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4gs9B01
2W0NA 4R38A 5HDSA 1UGUA 2D02A 1D7EA 5I5LA 2PD7A 4NXEA 3ULFA 2GJ3A 2I9VA 1S67L 4JGQA 3MXQA 1MZUA 3MFXA 5TBMA 2INWA 1TS7A 2L0WA 4JGPA 4GS9B 4EW7A 1XFNA 4HNBA 1S1YA 4HH3A 3P7NA 1OJGA 4GS9A 3H82A 3B33A 4HH2A 4R6LA 5F6AA 3NOPC 1XJ2A 2Z6CA 1T1CA 4HP4A 2V0WA 2ZBBA 4MN5A 3IS2B 4WUJA 2H28A 4GCZA 1T1AA 5IS1A 3UB8A 1V9ZA 3EEHA 3IS2A 4R70A 2L1MA 2VLGA 3PYPA 5F68A 1D06A 2WKRA 5EFWA 3NJAA 5IU1A 4L9EA 1LL8A 2WKQA 4EERA 1XJ3A 3IBRA 4L9FA 2P7JA 4I5SA 3UB9A 2VV8A 1WA9A 3A0VA 4JGRA 2A24A 2PD8A 5F5YA 1JNUA 1Y28A 3RH8B 1XJ4A 2VV7A 4HP9A 3NOTC 4WF0A 5HD5A 4WL9A 3LIDA 4GW9A 1UWNX 3A0SA 5HDCA 2QJ5A 2B02A 1X0OA 3F1PA 3A0RA 4H6JB 4L9GA 4WN5A 4K08A 4LPZA 3K3DA 4H6JA 3H9WA 4MN6A 2L4RA 4NXFA 3K3CA 4KUKA 1LT0A 4EXOA 3GDIA 3UMDA 2KX6A 2ZOHA 2WKPA 4I3AA 1DP9A 3LIFA 3C2WA 5DJTA 1OTIA 3EWKA 5HWTA 2KDKA 2JN7A 3MR0A 1S4SA 4PKYA 1LSXA 2HV1A 1DP8A 3HJKA 1DRMA 1GSXA 3UB6A 3UB7A 4EETB 4EEPA 1OTBA 3ZQ5A 3HJIA 2QJ7A 3H7WB 4HJ4A 2M1CA 4DJ3A 3CWFA 1XJ6A 5HDDA 3E4QA 3LIBA 1N9OA 2CMNA 3H7WA 1F9IA 3LYXA 2PHYA 2V1AA 1LSVA 1P97A 5AVFA 2QHKA 3RTYA 1P0ZA 3LICA 4HHDA 1TS0A 3LUQA 4BBVA 5DKLA 3LI9A 4KUOA 3VE3A 2V1BA 1OJ5A 1F98A 1G28A 3BY9A 4HQAA 4E04A 4WLAA 4M4XA 3T50A 4EQ1A 2OOLA 2VEAA 3F1OB 1GSVA 3CAXA 1LSWA 4DJ2A 3LI8A 2Z6DA 1ODVA 5A8BA 4HI4A 4I39A 1BYWA 3BWLA 2YKHA 4HY8A 3FC7A 3LIAA 1T19A 1N9NA 2J80A 1GSWA 1S4RA 1OTAA 4LRXC 5DJUA 2JHEA 5HD3A 5HZHA 2V9AA 1DP6A 1KOUA 4BBTA 3SW1A 4EEUA 1N9LA 4GHIB 3CLOA 1TS8A 1TS6A 3GECA 4GHIA 5KIZA 3UE6A 1V9YA 5TBMB 2W27A 4HJ6A 2QWSA 4JGOA 4I3IA 4KQDA 5J7EA 4I3JA 3PHYA 5DKKA 4BBUA 3ICYA 3FG8A 4HOIA 1XFQA 3H82B 3F1NB 5HWVA 3LIEA 2BASA 4YWZA 3VOLA 5J4EA 3NHQA 4LRYC 2PR5A 3F1NA 2OWHA 2R78A 4EESA 2PDRA 1OT6A 4B9OA 2YKFA 1UWPX 2VV6A 4HIAA 4PKYG 4LRZE 5F69A 5G4YA 3C8CA 2PYPA 4XT2B 2ZOIA 3E4OA 4NXBA 3BY8A 3VE4A 1OTEA 3MQQA 3D72A 4XT2A 1VB6A 1EW0A 5HSQA 4I38A 1T1BA 2V0UA 2A24B 3E4PA 2OWJA 5G4ZA 5J3WA 3UMEA 2EA9A 1NWZA 1OTDA 3KX0X 1OT9A 1S1ZA 4LLOB 3G6OA 2PYRA 3F1OA 4R3AA 4F3LB 3F1PB 5AVEA 3OLOA 2PR6A 3MQOA 4NXGA 4RQ9A 4F3LA 2QKPA 1T18A 4HJ3A 1S66L 2K7SA 5HWWA 3MJQA 2D01A 3NOUC
chains in the Genus database with same CATH superfamily
3V3RA 5TJJA 4QHCA 3CITA 3M6HA 4YFMA 4BENA 2D02A 3KSIA 3UE3A 1ERQA 4WELA 3LEZA 2MJ6A 2HZ5A 5IHVA 5F82A 4BJPA 4HBUA 4CLCB 2IWCA 3O3VA 5L09A 3VSKA 1CQAA 1ES2A 3S4XA 5E2FA 3PBQA 2FFFB 3T12B 1FSWA 2XROA 2VKSA 4KZ3A 1NJ4A 2XA7M 3HLDA 1NYMA 1S1YA 1H8ZA 1K54C 4GS9A 1J9MA 4WEJA 1S6RA 3Q7VB 4LENA 4X1LA 5F6AA 2QPNA 4UEYA 2HP5A 2Z2LB 2Z6CA 3T1RA 4OOLA 3TW8A 3UPPA 3PTEA 4MN5A 3KYZA 4GCZA 1MWUA 2KLIA 2WGIA 1XGJA 2PT7A 3EEHA 3C4PA 4R70A 2VLGA 3C4OA 1D06A 2ZM0A 1G6OA 3LY4A 3WWXA 1HLUP 1K4EA 2K2NA 1KDWA 4EUVA 1Z6FA 3VFHA 5CHMA 3ZG9B 4JXVA 3D3OA 4KZ9A 4L9FA 2VGKA 3UB9A 3K2NA 3MMHA 1WA9A 3B47A 4EUZA 2ZC6B 3A0VA 4UAAA 4FD8A 5F5YA 2Y2HA 3UPNA 2XGNA 1Y28A 5FSRA 1IYQA 1XJ4A 4HP9A 5IT5A 3G35A 1PYYA 3IXGA 4IJGA 3A0SA 2VGLM 2BLSA 1MC0A 5DTSA 4Q0JA 3LR4A 4E3LA 5HAQA 4WEKA 1MY8A 5F83A 4LPZA 3NECA 2Y2GA 3C5AA 2ZL1A 4H6JA 3H9WA 3C38A 2FFYA 4S2JA 3T4QA 3MS6A 3LFVA 3NDGA 1TEMA 1I2WA 1G68A 4E3OA 2ZQ8A 1H0MA 1W5DA 4DXCA 2C5WB 4GB7A 4ETZA 2XR0A 1CI9A 1GHPA 4EXOA 2WKPA 1L0EA 1DP9A 4FUWA 4I3AA 5FAOA 3BQ8A 1ALQA 3C2WA 3FPWA 3N8LA 1OTIA 4X1MA 2WYXA 3SS4A 2ZC5B 3W8KA 3UDXA 1HVBA 3MR0A 1S4SA 4B88A 1LSXA 2H0YA 1IOUA 5L2FA 4JF6A 2GZAA 1VEUB 1JWPA 5EE8A 4KQQA 2A2LA 1GSXA 2H0TA 4RA7A 4O0PA 4H8RA 5CGSA 1E3UA 4JXSA 1OTBA 1ZKJA 3ZQ5A 3HJIA 2V1ZA 2DMWA 3H7WB 4HJ4A 1XA1A 4R3JA 1XXMA 2EX8A 4BQMA 4QU3A 4R4RA 2J3TD 3WS4A 2PBDP 2HJ9C 2WUQA 1H3QA 2JKFA 1F9IA 2J9OA 3IXDA 2PHYA 2Y79A 5E2GA 4GD6A 4PAUA 1LL9A 2OAP1 1PWGA 2QHKA 2WZXA 3QP4A 1VETB 1K55C 1GHIA 3PBRA 2Q9NA 5CGWA 5DKLA 1PW1A 2OAQ1 3GTCA 3NDEA 5GHZA 5HARA 1SDEA 4P6ZS 1LHYA 2VA0A 3S7OA 2IWBA 4BLMA 1BSGA 4S2MA 4U0TA 3EQVA 1O7EA 3HVFA 3TSGA 3HLBA 1CEGA 5KSHA 3BQAA 3T4JA 2VGJA 2OOLA 3R7WA 1L0DA 3CUEC 3OPRA 4JPMA 3CAXA 1KVMA 2H5SA 1ODVA 1BYWA 2GNXA 2YKHA 3UE0A 3N4IA 3IX8A 3EQUA 3LIAA 1N9NA 1MWSA 3CI6A 4GN2A 4LRXC 1G6AA 4QY6A 2JHEA 5DJUA 4F94A 3VV4A 5HZHA 2V9AA 5AJGA 1KOUA 4P0MA 3G32A 1TS8A 4G3KA 4BMWA 4GHIA 1YLYA 1BULA 2EX6A 4PM6A 2DRWA 1Z09A 1YT4A 3VMAA 2W27A 1PI5A 4CLCD 4D2OA 3TOIA 4I3IA 3QP5A 3PHYA 5DKKA 1CJFA 3MKEA 4E3JA 4HOIA 3H82B 5HWVA 5G18A 5GHYA 4YWZA 5J4EA 4LRYC 2V20A 3OPLA 4NEED 4D60A 2QMIA 3MXRA 5DFYA 3LR5A 3NIAA 3IHAA 3O87A 2GX5A 2VV6A 3WRZA 1ES4A 3O5YA 5G4YA 5M1AA 2ZQ7A 3KSFA 3T1XA 2P04A 4P87A 5GLDA 3E4OA 4NXBA 4G3WA 3BY8A 1OTEA 3MQQA 1MKMA 3D72A 3ZGAB 3G30A 5JYPA 3HLGA 4S2LA 1YKDA 1H8MA 1YSPA 3S7PA 3G31A 3HLEA 2V0UA 4ESPA 2A24B 1S0WA 3E4PA 5G4ZA 5BOHA 3WS1A 3NBLA 3MF0A 3VP2A 3IWQA 5D3OA 1YMSA 3B42A 4P85A 4JF5A 4R3AA 3N8RA 3WS0A 4Q8IA 3F1PB 5AVEA 3OLOA 1DY6A 3MQOA 2Y2IA 1BUEA 3SS5A 5FQQA 4NXGA 5FEGA 4E3IA 3BJNA 4F3LA 4ETXA 2EX2A 3EOIA 1PWCA 2QKPA 1W79A 1JWVA 2K7SA 3MJQA 4KQOA 3NOUC 2PAVP 4OQIA 5HDSA 5K5BA 1H8YA 4B93A 4Y5FA 3ZNTA 5I5LA 4WYYA 3ULFA 1K57A 2OLUA 2XH9A 4PHTA 2GJ3A 4JGQA 3UPOA 3MFXA 1O07A 1BLCA 5TBMA 1W8QA 4JGPA 2EFUA 5AQBA 4EW7A 3SH8A 2M7UA 1TF1A 1NRJA 4HH3A 5EV0A 2UV0E 3BECA 3E2LA 3S7QA 3T4SA 1K57C 2XEPA 4R6LA 1SKOB 3QP1A 4QB8A 1KE3A 5GHXA 5J8XA 1JWZA 1T1CA 2FH5A 4CLCC 2V0WA 3BM6A 3QNBA 4WUJA 4U0XA 2ZJ9A 1BTLA 4X68A 2DCFA 3UB8A 4IVIA 2HDQA 5HAPA 2I72A 1LL5A 4LFUA 5F68A 4S2NC 5U47A 4KZ8A 2WKRA 4Y0OA 4Y13A 3ZNYA 5EFWA 3NJAA 1MWRA 1YLJA 2W1TB 1ZC2A 2VV8A 4PM9A 3T4LA 3WRTA 4OONA 4P6ZM 2J8YA 3E2KA 3IF6A 4IBXA 5FEFA 3MZFA 3RH8B 5HD5A 3NOTC 4WL9A 3HLWA 2E8IA 4C6YA 3PBNA 3UB5P 1XKZA 3LGOA 5EUAA 2P9VB 2Y8HA 2C6WB 2BTFP 1RGZA 2LB5A 2B02A 2Y2PA 1YLWA 3A0RA 5DTTA 4L9GA 1HD8A 3NY4A 4WN5A 1QMEA 4K08A 1NYYA 3RFBA 3KSGA 1JVJA 3ZG8B 3K3DA 5HX9A 1I5QA 2A49A 3QP2A 3PBSA 1K54A 1YPRA 3BEBA 3UN7A 4MN6A 2W3EA 4CPKA 4R3BA 2R9WA 3OOVA 4FH4A 4O7DA 4QWOA 1FCMA 1IELA 4EU0A 2WGWB 1LT0A 3JYIA 4NG2A 3NC8A 3GDIA 1ZG4A 2KX6A 4K0WA 4N9KA 4PPRA 5DF9A 5DJTA 4BL3A 3EWKA 4Y2FA 1RP5A 5HWTA 2JN7A 4DDYA 4PKYA 2VZWA 4ID4A 4S2KA 2VJWA 2ZQDA 3UB6A 3Q81A 5EECA 2ACGA 4MDZA 4RX2A 1VEUA 4MCWA 5AQAA 1TDGA 2M1CA 3CWFA 5HDDA 3E4QA 4Z9QA 4Q0IA 1N9OA 1K56A 4Y7PA 3DTKA 2CMNA 3H7WA 3LYXA 3IT9A 4EBNA 2V1AA 2WAFA 3IH9A 1P97A 2OSUA 3EGXC 5EOEA 5AVFA 3BFDA 3W4OA 2WKIA 1KGGA 3LO7A 3BRMA 2Y2LA 3LICA 4HHDA 3FZCA 1J3WA 4Z1WA 4KQRA 3LUQA 4BBVA 3P98A 1Q2QA 2Y2KA 2Y2QA 2ZMVA 3LI9A 4S2OA 5CX7A 3VE3A 3A3DA 2V1BA 1OJ5A 3ZCZA 3A3FA 3M2JA 3FYZA 3GVBA 1G28A 1L0FA 5FI6A 3S22A 5FL3A 3PR6A 4WLAA 1M40A 3M2KA 4ARZB 2VEAA 3ITAA 3F1OB 2EWVA 1TD5A 3UE1A 3LI8A 3Q7ZA 4HY8A 1JTDA 3FC7A 3ISGA 4XXRA 1T19A 3VFFA 1YAXA 4G3VA 2W3HA 1DP6A 1K4FA 3TRCA 1SHVA 3CLOA 2WKHA 1XPBA 5L10A 4OPQA 3U2AA 1W7FA 3HL9A 3MXSA 2HDRA 4JGOA 4HJ6A 3FKVA 2ZQ9A 3ZG5A 2X71A 1F2KA 3WS2A 4BBUA 2ZC3B 3ICYA 3W4PA 3ZDJA 4N1XA 1E25A 1K55A 2BASA 3A3JA 3G2YA 3BLMA 2O99A 2ZD8A 2PDRA 1K6SA 4Y15A 2ZLYA 4PKYG 4K0XA 3UY6A 2XQZA 4GD8A 3MSHA 2PRFA 4LCMA 2R9XA 1STZA 4OLDA 3C8CA 1KE0A 1BLSA 2ZOIA 3CUEA 2QYBA 5GL9A 5FAQA 1EROA 2B18A 3PBTA 3FKWA 3Q82A 3DW0A 1VB6A 4FOFA 1T1BA 1PZPA 2RCXA 4LV1A 1KDSA 3QP8A 2EA9A 1NWZA 5AQ9A 4UA6A 2XRNA 1A0KA 4LV3A 1OT9A 2H10A 5E2EA 2GDNA 2ZC4B 4ZJ1A 4LLOB 5KZHA 4ZDXA 4UA7A 3ZYTA 2XSSA 3G6OA 2Y91A 2W3GA 3KYEA 2PR6A 2QZ6A 5HPIA 4JKTA 2Y2NA 4HJ3A 1PNEA 3BFFA 1DJCA 1S66L 2D01A 3MQ0A 3CHWP 2ZQCA 4GNUA 2IA2A 4RYEA 4AFIA 4RVAA 4R38A 4MN7A 1UGUA 4WMCD 4NETA 2PD7A 4NXEA 1Y4OA 4N92A 4N1HA 3QHYA 3G34A 1S67L 3MXQA 3OCLA 4HBTA 2Q9MA 5FQJA 5EM0A 5EVEA 2INWA 1TVFA 1ACFA 4BD0A 2XD5A 3LR0A 5TR7A 3N7WA 2O9AA 4ZAMA 1IEMA 1NLZA 1OJGA 5FQMA 3NCKA 5DTKA 4XUZA 2WAEA 3Q07A 3OCNA 2ZQAA 1BLPA 4CLCE 5MC7A 1P9RA 1XJ2A 1EWZA 4Y0UA 4HP4A 1SKOA 3IS2B 1FR1A 5KSCA 5HFOA 5IS1A 1FR6A 2J9PA 4MBFA 1V9ZA 4DE3A 4X55A 2EX9A 3O86A 2LB9A 4QY5A 2WZZA 3FWLA 5IU1A 4L9EA 1LL8A 2J3TC 4O01A 3BW6A 4QPRA 3MBZA 5M19A 2P7JA 3KO6A 1RGYA 2XD1A 3PAGA 3ITBA 4C3QA 4DMZA 3DTMA 3TJZC 1ERMA 2PD8A 2W1TA 4PM8A 5HL6A 1JNUA 3AGEA 4PM5A 1FOFA 5HPFA 2VV7A 1BZAA 4R23A 5C5KA 4GW9A 5EVID 5HL1A 1PW8A 1ZHHB 3FV7A 3G4PA 5HDCA 2J7VA 1OMEA 1CF0A 3G2ZA 4JBFA 1X0OA 3P01A 2P9VA 4KZAA 4DF6A 1IKGA 4ZJ2A 4EV4A 3DTIA 5F1FA 5FDSA 1Q2PA 1K25A 1FCNA 2JKTI 3RJUA 1M6KA 2L4RA 1CI8A 1W63Q 3ZVTA 3HLCA 5LBRA 4K91A 4BWIA 5KMWA 2HP9A 2HDSA 2PBYA 4NXFA 3K3CA 4KUKA 2JCHA 1GA9A 4S2IA 5GLCA 1YLTA 2O0YA 3BFCA 4CLCA 2JKTM 2WGWA 3LIFA 5CECA 3IQAA 2E8JA 1Y54A 1KVLA 4Q0HA 4A5RA 4IEDA 4S2NA 4GOGA 3KSHA 1PIOA 2HV1A 1FIKA 4E6XA 3V3SA 1DP8A 1ES3A 2B95A 3B3XA 3VOZA 1H5XA 3Q7VA 4KZ4A 2G2UA 2OV5A 2QJ7A 1WYCA 4DJ3A 1XJ6A 1SCWA 3IHBA 3N6IA 1GA0A 4X25A 1P9WA 3W2ZA 3O88A 4BD1A 3T4TA 1ONHA 4GJ4A 1LSVA 3GR2A 4JXGA 3VSLA 2EFXA 3IX3A 3ZG0A 1XA7A 3RTYA 1JTGA 4KZBA 4DN0A 3R4KA 4ZRRA 1YLPA 4E3NA 1LLBA 4KUOA 2KOIA 5AQ7A 4E6WA 4QJGA 2HP6A 1WE4A 3P09A 2ZMFA 4OQHA 1CK3A 4HQAA 5EM1A 3ZHHA 3NI9A 4ZBEA 4M4XA 4EQ1A 1K38A 5FATA 1WYBA 1LSWA 4DJ2A 1YM1A 1N9BA 4L0LA 4ARZA 3L9KA 4II7A 2Z6DA 1KGFA 2Y2JA 1D1JA 2Y4AA 3BLSA 4OP8A 2UWXA 3MFDA 2WK0A 1QMFA 2J80A 2JKRI 2Y2MA 1YQSA 5EVIC 5HD3A 2V8FA 5A93A 4X53A 3VP0A 3SW1A 4EEUA 1N9LA 2WKEA 2XK1A 2Y55A 1CEFA 3QNCA 1MXOA 2NUPC 1F5MA 5GLAA 4OOMA 1TS6A 4DDSA 5KIZA 1V9YA 2K31A 4IBRA 5EVLA 2JKRM 4MMNA 3DAVA 5TBMB 2QWSA 4OOYA 4RX3A 2AVXA 4I3JA 3CG5A 3A3EA 3DWZA 4JLFA 2EWWA 3DWKA 2G7UA 3PAEA 3MKFA 1ZG6A 2WADA 3BFEA 1XFQA 3A3IA 4IUHA 3F1NB 1XP4A 4EBLA 3LIEA 4LCLA 3MZDA 3C7VA 2PR5A 3HREA 2JKGA 2OWHA 2R78A 2V2FF 4B4ZA 3CMZA 1IYSA 4QD4A 4OPYA 1E3UD 3DBAA 1UWPX 1KE4A 1FCOA 4WM9A 3PBOA 5A91A 5FI7A 1U60A 3QP6A 5A92A 1ONGA 4UQIS 5DF8A 4XT2B 4UHUA 2O9CA 4X56A 2B5RA 4R1GA 3IX4A 1L3LA 1VETA 1LI9A 3HCYA 3HUMA 2HDUA 2V8CA 4OLGA 1ESIA 2X02A 1SZVA 5EVIB 2OWJA 3WS5A 3IF6B 4KENB 3UMEA 4MEZA 3IXHA 3KX0X 1S1ZA 3VP1A 3SZTA 1NXYA 3OPPA 3GSGA 2PYRA 3ZVWA 2BG1A 4R4SA 2JE5A 2M7VA 3CPTB 4OP5A 1AXBA 4WBGA 1BT5A 3GV9A 4NK3A 4RQ9A 5I94A 1FQGA 3HUOA 3BFGA 3UO9A 5DF7A 1W63M 1T18A 3AGDA 3NULA 3TG9A 4EQIA 4MBKA 5HWWA 1PFLA 3IH8A 4NKPA 2W0NA 4EWFA 2VX8A 1D7EA 3FPVA 5CEBA 3HUNA 5TFQA 4O8GA 2HF6A 1N4OA 1NY0A 2I9VA 4P6BA 5CGXA 2CC1A 1MZUA 2PU2A 3OZHA 1E4DA 1TS7A 2L0WA 2NUTC 1NRFA 1IYPA 2PU4A 1ESUA 1NZUA 4GS9B 5L07A 3PXPA 4JXWA 1XFNA 4HNBA 3P7NA 3H82A 3RXXA 3SH9A 4FSFA 5L8MA 4E3KA 3B33A 4KG5A 4HH2A 5DVAA 2Y59A 1I2SA 2JBFA 3T4OA 2EXBA 3NOPC 5DFXA 4JF4A 5CTNA 2ZBBA 1G5UA 2H28A 1T1AA 4X69A 4DE1A 3CJMA 4GDBA 1ES5A 4MBHA 3OPHA 1ZTUA 3BYDA 3IS2A 4FTXA 2L1MA 3PYPA 1K6RA 3VP4A 2XF3A 1KGEA 1L2SA 4KG2A 3V50A 4WZ4A 4N9LA 3D4FA 3VP3A 4FCFA 2WKQA 4EERA 1XJ3A 4ZJ3A 3IBRA 3HBRA 5FQIA 4I5SA 3LY3A 4DRTA 3EGDC 3LCEA 3T1QB 4JGRA 2A24A 3I7JA 3T4KA 4LV0A 4WF0A 1YSQA 3LIDA 4U3TA 4B4XA 4YNRA 4GLQA 1IYOA 3SS3A 1UWNX 4DE0A 1PI4A 1VQQA 5HAIA 4KZ6A 2QJ5A 4OPRA 3F1PA 2O9BA 4ZTKA 1DJAA 3UNWA 2ZL1B 4H6JB 2ZM2A 4CQHA 3C30A 4FH2A 1AWIA 3UDFA 5CTMA 2XFTA 2Q0OA 4GKUA 3C7UA 2RL3A 4LGWA 3UMDA 2ZOHA 4S2PA 4GZBA 4Y17A 1EI5A 3E98A 1GCEA 2XA7S 5CEDA 2KDKA 2OLVA 4OQ0A 1L0GA 4HEFA 4KG6A 1HTZA 1LI0A 1PZOA 3HJKA 1DRMA 2X01A 1TDLA 3UB7A 4EETB 5EPHA 1SKFA 4EEPA 4EBPA 3ZG7B 1XGIA 3LIBA 3JPUA 3IBJA 2P08A 4WZ5A 1XX2A 5FQ9A 3AGFA 4OQGA 2G2WA 3OBFA 3JVVA 1P0ZA 2W1RA 4UQIM 1TS0A 1HZOA 1W8YA 4KZ7A 5JYOA 4OKPA 3ZFZA 2J3WA 5FAPA 3MZEA 3JVUA 4WZ5C 1F98A 3BY9A 1GHMA 3R7WB 4E04A 1SDNA 3T50A 2VGLS 4ME4A 2HGVA 3S1YA 1GSVA 1IFQA 5CHUA 5A8BA 4HESA 4HI4A 4I39A 2FZ0A 3BWLA 1FILA 1FSYA 3IWIA 2ZM8A 2P74A 4MLLA 4PM7A 1OPXA 1GSWA 1S4RA 1OTAA 5A90A 4OVDA 2HPBA 5CXWA 4BBTA 4WMCA 4GHIB 1NLYA 2XDMA 4OH0A 4LV2A 5CHJA 3GECA 4PMAA 2HJEA 5E2HA 2IWDA 3UE6A 4M3KA 3IXBA 2W3DA 5FDHA 2Y2OA 4IHQA 3M6BA 4BL2A 2WGVA 4KQDA 5J7EA 2W3FA 1MKIA 2A3UA 3VOYA 2JC7A 3IWOA 3LR3A 3FG8A 3L7HA 5EOOA 3UDIA 3GMWA 2VK3A 3D9YA 4UA9A 3VOLA 3NHQA 5E43A 5M18A 2ZC7A 3F1NA 1PWDA 4EESA 3T1SA 1RCJA 3Q1FA 4OPZA 3SOIA 1OT6A 2Z2MB 4B9OA 1MWTA 2YKFA 5F1GA 3CZDA 4HIAA 2XLNA 1IKIA 4LRZE 5F69A 3V39A 4Y0TA 1VM1A 3GQZA 4KZ5A 3V67A 1K56D 4C75A 1MPLA 2PYPA 4MNRA 4YOFA 2ZMAA 3SH7A 4IVKA 3VE4A 3W4QA 3TE8A 2DNSA 4XT2A 1YLZA 4DXBA 5FASA 1MBLA 1EW0A 3DTEA 3EEAA 5HSQA 4I38A 3S7NA 3LEQA 3OC2A 4E3MA 5FA7A 3E0YA 4Y3IA 3N8SA 1DJBA 5HW3A 5J3WA 3HLFA 1OTDA 1VHMA 1NZOA 5EVIA 1K0KA 3U4LP 3RXWA 1YMXA 4X6TA 5FQKA 3IF5A 5CRFA 5FI2A 5CERA 5GLBA 3F1OA 4GDNA 4XUXA 4F3LB 2XFSA 3GRJA 4CJNA 3CPTA 3V5MA 3KYQA 4IUKA 4YINA 4DE2A 1C3BA 3IF6C 2EXAA 4R0QA 4DKIA 5TGFA 1BLHA 1PRQA
chains in the Genus database with same CATH topology
4NKPA 2W0NA 5TJJA 3CITA 4R38A 5HDSA 4MN7A 5K5BA 1UGUA 2VX8A 2D02A 3KSIA 1D7EA 3FPVA 3UE3A 4Y5FA 4B93A 4WELA 5I5LA 2PD7A 2MJ6A 4NXEA 3ULFA 4O8GA 2HF6A 4PHTA 2GJ3A 4BJPA 4CLCB 2I9VA 1S67L 4JGQA 3MXQA 3OCLA 1MZUA 3MFXA 5TBMA 2INWA 3PBQA 1TS7A 2L0WA 2NUTC 4JGPA 2XROA 2VKSA 3LR0A 4GS9B 3PXPA 2XA7M 2O9AA 4EW7A 1XFNA 4HNBA 2M7UA 1S1YA 1TF1A 1NRJA 4HH3A 1NLZA 3P7NA 1OJGA 3S7QA 4GS9A 3H82A 4WEJA 3T4SA 4FSFA 5L8MA 3B33A 4HH2A 4R6LA 3OCNA 5F6AA 3T4OA 4CLCE 5MC7A 3NOPC 1P9RA 1XJ2A 4UEYA 5DFXA 2Z6CA 1T1CA 4HP4A 2FH5A 4OOLA 2V0WA 3TW8A 4CLCC 2ZBBA 4MN5A 3IS2B 4WUJA 2H28A 3KYZA 4GCZA 1T1AA 5IS1A 2KLIA 3UB8A 1ZTUA 2PT7A 1V9ZA 3EEHA 3IS2A 4R70A 2L1MA 2VLGA 3PYPA 5F68A 1D06A 1G6OA 2WKRA 2LB9A 5EFWA 2K2NA 3NJAA 4EUVA 5IU1A 4L9EA 1LL8A 2J3TC 4O01A 2WKQA 4EERA 1XJ3A 3BW6A 3D3OA 3IBRA 4QPRA 4L9FA 2P7JA 4I5SA 3UB9A 2W1TB 3K2NA 3EGDC 3KO6A 2VV8A 3MMHA 1WA9A 3T4LA 3B47A 4DMZA 3A0VA 3TJZC 4JGRA 4P6ZM 2A24A 2PD8A 2W1TA 5F5YA 5HL6A 3T4KA 1JNUA 1Y28A 3RH8B 1XJ4A 2VV7A 4HP9A 3NOTC 4WF0A 5HD5A 5HPFA 5IT5A 4WL9A 1YSQA 3LIDA 5C5KA 4GW9A 3PBNA 4YNRA 4GLQA 1UWNX 4IJGA 1ZHHB 2Y8HA 3A0SA 5HDCA 2VGLM 2QJ5A 1MC0A 2LB5A 2B02A 1X0OA 3P01A 3LR4A 3F1PA 3A0RA 4Q0JA 2O9BA 4H6JB 4L9GA 4WN5A 4WEKA 4K08A 4LPZA 3KSGA 3RFBA 3K3DA 4H6JA 3H9WA 3C38A 2JKTI 3PBSA 4MN6A 2W3EA 3T4QA 4CQHA 2L4RA 3LFVA 3OOVA 3C30A 1W63Q 5LBRA 4BWIA 4EU0A 4NXFA 3K3CA 4KUKA 1LT0A 4ETZA 4EXOA 3GDIA 3UMDA 2KX6A 2ZOHA 2O0YA 2WKPA 4CLCA 4I3AA 1DP9A 2JKTM 3BQ8A 3LIFA 3C2WA 3FPWA 5DF9A 5DJTA 1OTIA 3E98A 3EWKA 4Q0HA 4Y2FA 5HWTA 2XA7S 2KDKA 2JN7A 3MR0A 1S4SA 4PKYA 1LSXA 2VZWA 3KSHA 1IOUA 2HV1A 2GZAA 1DP8A 3HJKA 2VJWA 2A2LA 1DRMA 1GSXA 3UB6A 3UB7A 4EETB 4MDZA 4O0PA 4MCWA 4EEPA 1OTBA 3ZQ5A 3HJIA 2DMWA 2QJ7A 3H7WB 4HJ4A 2M1CA 4DJ3A 3CWFA 1XJ6A 5HDDA 3E4QA 2J3TD 3LIBA 4Q0IA 1N9OA 2CMNA 2HJ9C 3H7WA 1P9WA 1H3QA 3W2ZA 3IBJA 1F9IA 2P08A 3LYXA 3T4TA 2PHYA 2V1AA 2Y79A 4GJ4A 1LSVA 1P97A 4PAUA 3EGXC 5AVFA 2OAP1 3OBFA 2QHKA 3RTYA 3JVVA 1P0ZA 2W1RA 3LICA 4UQIM 4HHDA 1TS0A 4Z1WA 3PBRA 3LUQA 4BBVA 4DN0A 3R4KA 5DKLA 4ZRRA 2OAQ1 2ZMVA 3LI9A 4KUOA 2KOIA 2J3WA 5CX7A 4P6ZS 3VE3A 2V1BA 3JVUA 2VA0A 3S7OA 1OJ5A 2ZMFA 1F98A 1G28A 3BY9A 4HQAA 3R7WB 4E04A 3EQVA 5FL3A 3PR6A 4WLAA 5KSHA 3BQAA 4M4XA 3T4JA 3T50A 4ARZB 4EQ1A 2VGLS 2OOLA 3R7WA 2VEAA 3CUEC 3F1OB 4ME4A 2EWVA 2HGVA 1GSVA 1TD5A 3CAXA 1LSWA 4DJ2A 4L0LA 4ARZA 3LI8A 4II7A 2Z6DA 1IFQA 1ODVA 5A8BA 4HI4A 4I39A 1BYWA 2FZ0A 3BWLA 2GNXA 2YKHA 4HY8A 3FC7A 3EQUA 3LIAA 1T19A 1N9NA 1YAXA 1OPXA 2J80A 2JKRI 3CI6A 1GSWA 1S4RA 1OTAA 4LRXC 4G3VA 5DJUA 2JHEA 5HD3A 3VV4A 2W3HA 5HZHA 2V9AA 5AJGA 1DP6A 1KOUA 3TRCA 4BBTA 3SW1A 4EEUA 1N9LA 4GHIB 1NLYA 3CLOA 2NUPC 1TS8A 4G3KA 1F5MA 4BMWA 4OOMA 1TS6A 3GECA 4GHIA 2HJEA 5KIZA 3U2AA 3UE6A 1V9YA 2K31A 2JKRM 4MMNA 2W3DA 5TBMB 4IHQA 2W27A 4HJ6A 2QWSA 4JGOA 4CLCD 4I3IA 4KQDA 5J7EA 4I3JA 3PHYA 2W3FA 5DKKA 2EWWA 4BBUA 2G7UA 3ICYA 3LR3A 3FG8A 4HOIA 1XFQA 3H82B 4IUHA 3F1NB 5HWVA 3LIEA 2BASA 4YWZA 3VOLA 5J4EA 3NHQA 4LRYC 2PR5A 2O99A 3F1NA 4NEED 2OWHA 2R78A 4EESA 2PDRA 5DFYA 1OT6A 3LR5A 4B9OA 2YKFA 2GX5A 3DBAA 1UWPX 2VV6A 4HIAA 4PKYG 4LRZE 3O5YA 5F69A 3PBOA 1STZA 5G4YA 3C8CA 3V67A 3KSFA 2PYPA 2P04A 4UQIS 4XT2B 2ZOIA 3CUEA 3E4OA 2QYBA 4YOFA 4NXBA 2O9CA 4G3WA 3BY8A 2B18A 3VE4A 1OTEA 3HCYA 3MQQA 3PBTA 3TE8A 1MKMA 3D72A 4XT2A 1VB6A 1EW0A 4FOFA 3EEAA 5HSQA 4I38A 3S7NA 1YKDA 1H8MA 1YSPA 3OC2A 1T1BA 3S7PA 3E0YA 2V0UA 4Y3IA 2A24B 3E4PA 2OWJA 5G4ZA 5J3WA 3UMEA 2EA9A 1NWZA 1OTDA 1VHMA 2XRNA 3KX0X 1OT9A 1S1ZA 3MF0A 4LLOB 3B42A 3ZYTA 2XSSA 3G6OA 2PYRA 2W3GA 3F1OA 4R3AA 4F3LB 2M7VA 3F1PB 5AVEA 3OLOA 2PR6A 3MQOA 5HPIA 4NXGA 3BJNA 4RQ9A 4F3LA 4ETXA 3EOIA 3KYQA 2QKPA 1W63M 1T18A 4HJ3A 4IUKA 1S66L 2K7SA 5HWWA 3MJQA 2D01A 3MQ0A 4KQOA 2IA2A 4AFIA 3NOUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0N A;  4R38 A;  5HDS A;  1UGU A;  2D02 A;  1D7E A;  5I5L A;  2PD7 A;  4NXE A;  3ULF A;  2GJ3 A;  2I9V A;  1S67 L;  4JGQ A;  3MXQ A;  1MZU A;  3MFX A;  5TBM A;  2INW A;  1TS7 A;  2L0W A;  4JGP A;  4GS9 B;  4EW7 A;  1XFN A;  4HNB A;  1S1Y A;  4HH3 A;  3P7N A;  1OJG A;  4GS9 A;  3H82 A;  3B33 A;  4HH2 A;  4R6L A;  5F6A A;  3NOP C;  1XJ2 A;  2Z6C A;  1T1C A;  4HP4 A;  2V0W A;  2ZBB A;  4MN5 A;  3IS2 B;  4WUJ A;  2H28 A;  4GCZ A;  1T1A A;  5IS1 A;  3UB8 A;  1V9Z A;  3EEH A;  3IS2 A;  4R70 A;  2L1M A;  2VLG A;  3PYP A;  5F68 A;  1D06 A;  2WKR A;  5EFW A;  3NJA A;  5IU1 A;  4L9E A;  1LL8 A;  2WKQ A;  4EER A;  1XJ3 A;  3IBR A;  4L9F A;  2P7J A;  4I5S A;  3UB9 A;  2VV8 A;  1WA9 A;  3A0V A;  4JGR A;  2A24 A;  2PD8 A;  5F5Y A;  1JNU A;  1Y28 A;  3RH8 B;  1XJ4 A;  2VV7 A;  4HP9 A;  3NOT C;  4WF0 A;  5HD5 A;  4WL9 A;  3LID A;  4GW9 A;  1UWN X;  3A0S A;  5HDC A;  2QJ5 A;  2B02 A;  1X0O A;  3F1P A;  3A0R A;  4H6J B;  4L9G A;  4WN5 A;  4K08 A;  4LPZ A;  3K3D A;  4H6J A;  3H9W A;  4MN6 A;  2L4R A;  4NXF A;  3K3C A;  4KUK A;  1LT0 A;  4EXO A;  3GDI A;  3UMD A;  2KX6 A;  2ZOH A;  2WKP A;  4I3A A;  1DP9 A;  3LIF A;  3C2W A;  5DJT A;  1OTI A;  3EWK A;  5HWT A;  2KDK A;  2JN7 A;  3MR0 A;  1S4S A;  4PKY A;  1LSX A;  2HV1 A;  1DP8 A;  3HJK A;  1DRM A;  1GSX A;  3UB6 A;  3UB7 A;  4EET B;  4EEP A;  1OTB A;  3ZQ5 A;  3HJI A;  2QJ7 A;  3H7W B;  4HJ4 A;  2M1C A;  4DJ3 A;  3CWF A;  1XJ6 A;  5HDD A;  3E4Q A;  3LIB A;  1N9O A;  2CMN A;  3H7W A;  1F9I A;  3LYX A;  2PHY A;  2V1A A;  1LSV A;  1P97 A;  5AVF A;  2QHK A;  3RTY A;  1P0Z A;  3LIC A;  4HHD A;  1TS0 A;  3LUQ A;  4BBV A;  5DKL A;  3LI9 A;  4KUO A;  3VE3 A;  2V1B A;  1OJ5 A;  1F98 A;  1G28 A;  3BY9 A;  4HQA A;  4E04 A;  4WLA A;  4M4X A;  3T50 A;  4EQ1 A;  2OOL A;  2VEA A;  3F1O B;  1GSV A;  3CAX A;  1LSW A;  4DJ2 A;  3LI8 A;  2Z6D A;  1ODV A;  5A8B A;  4HI4 A;  4I39 A;  1BYW A;  3BWL A;  2YKH A;  4HY8 A;  3FC7 A;  3LIA A;  1T19 A;  1N9N A;  2J80 A;  1GSW A;  1S4R A;  1OTA A;  4LRX C;  5DJU A;  2JHE A;  5HD3 A;  5HZH A;  2V9A A;  1DP6 A;  1KOU A;  4BBT A;  3SW1 A;  4EEU A;  1N9L A;  4GHI B;  3CLO A;  1TS8 A;  1TS6 A;  3GEC A;  4GHI A;  5KIZ A;  3UE6 A;  1V9Y A;  5TBM B;  2W27 A;  4HJ6 A;  2QWS A;  4JGO A;  4I3I A;  4KQD A;  5J7E A;  4I3J A;  3PHY A;  5DKK A;  4BBU A;  3ICY A;  3FG8 A;  4HOI A;  1XFQ A;  3H82 B;  3F1N B;  5HWV A;  3LIE A;  2BAS A;  4YWZ A;  3VOL A;  5J4E A;  3NHQ A;  4LRY C;  2PR5 A;  3F1N A;  2OWH A;  2R78 A;  4EES A;  2PDR A;  1OT6 A;  4B9O A;  2YKF A;  1UWP X;  2VV6 A;  4HIA A;  4PKY G;  4LRZ E;  5F69 A;  5G4Y A;  3C8C A;  2PYP A;  4XT2 B;  2ZOI A;  3E4O A;  4NXB A;  3BY8 A;  3VE4 A;  1OTE A;  3MQQ A;  3D72 A;  4XT2 A;  1VB6 A;  1EW0 A;  5HSQ A;  4I38 A;  1T1B A;  2V0U A;  2A24 B;  3E4P A;  2OWJ A;  5G4Z A;  5J3W A;  3UME A;  2EA9 A;  1NWZ A;  1OTD A;  3KX0 X;  1OT9 A;  1S1Z A;  4LLO B;  3G6O A;  2PYR A;  3F1O A;  4R3A A;  4F3L B;  3F1P B;  5AVE A;  3OLO A;  2PR6 A;  3MQO A;  4NXG A;  4RQ9 A;  4F3L A;  2QKP A;  1T18 A;  4HJ3 A;  1S66 L;  2K7S A;  5HWW A;  3MJQ A;  2D01 A;  3NOU C; 
#chains in the Genus database with same CATH topology
 3V3R A;  5TJJ A;  4QHC A;  3CIT A;  3M6H A;  4YFM A;  4BEN A;  2D02 A;  3KSI A;  3UE3 A;  1ERQ A;  4WEL A;  3LEZ A;  2MJ6 A;  2HZ5 A;  5IHV A;  5F82 A;  4BJP A;  4HBU A;  4CLC B;  2IWC A;  3O3V A;  5L09 A;  3VSK A;  1CQA A;  1ES2 A;  3S4X A;  5E2F A;  3PBQ A;  2FFF B;  3T12 B;  1FSW A;  2XRO A;  2VKS A;  4KZ3 A;  1NJ4 A;  2XA7 M;  3HLD A;  1NYM A;  1S1Y A;  1H8Z A;  1K54 C;  4GS9 A;  1J9M A;  4WEJ A;  1S6R A;  3Q7V B;  4LEN A;  4X1L A;  5F6A A;  2QPN A;  4UEY A;  2HP5 A;  2Z2L B;  2Z6C A;  3T1R A;  4OOL A;  3TW8 A;  3UPP A;  3PTE A;  4MN5 A;  3KYZ A;  4GCZ A;  1MWU A;  2KLI A;  2WGI A;  1XGJ A;  2PT7 A;  3EEH A;  3C4P A;  4R70 A;  2VLG A;  3C4O A;  1D06 A;  2ZM0 A;  1G6O A;  3LY4 A;  3WWX A;  1HLU P;  1K4E A;  2K2N A;  1KDW A;  4EUV A;  1Z6F A;  3VFH A;  5CHM A;  3ZG9 B;  4JXV A;  3D3O A;  4KZ9 A;  4L9F A;  2VGK A;  3UB9 A;  3K2N A;  3MMH A;  1WA9 A;  3B47 A;  4EUZ A;  2ZC6 B;  3A0V A;  4UAA A;  4FD8 A;  5F5Y A;  2Y2H A;  3UPN A;  2XGN A;  1Y28 A;  5FSR A;  1IYQ A;  1XJ4 A;  4HP9 A;  5IT5 A;  3G35 A;  1PYY A;  3IXG A;  4IJG A;  3A0S A;  2VGL M;  2BLS A;  1MC0 A;  5DTS A;  4Q0J A;  3LR4 A;  4E3L A;  5HAQ A;  4WEK A;  1MY8 A;  5F83 A;  4LPZ A;  3NEC A;  2Y2G A;  3C5A A;  2ZL1 A;  4H6J A;  3H9W A;  3C38 A;  2FFY A;  4S2J A;  3T4Q A;  3MS6 A;  3LFV A;  3NDG A;  1TEM A;  1I2W A;  1G68 A;  4E3O A;  2ZQ8 A;  1H0M A;  1W5D A;  4DXC A;  2C5W B;  4GB7 A;  4ETZ A;  2XR0 A;  1CI9 A;  1GHP A;  4EXO A;  2WKP A;  1L0E A;  1DP9 A;  4FUW A;  4I3A A;  5FAO A;  3BQ8 A;  1ALQ A;  3C2W A;  3FPW A;  3N8L A;  1OTI A;  4X1M A;  2WYX A;  3SS4 A;  2ZC5 B;  3W8K A;  3UDX A;  1HVB A;  3MR0 A;  1S4S A;  4B88 A;  1LSX A;  2H0Y A;  1IOU A;  5L2F A;  4JF6 A;  2GZA A;  1VEU B;  1JWP A;  5EE8 A;  4KQQ A;  2A2L A;  1GSX A;  2H0T A;  4RA7 A;  4O0P A;  4H8R A;  5CGS A;  1E3U A;  4JXS A;  1OTB A;  1ZKJ A;  3ZQ5 A;  3HJI A;  2V1Z A;  2DMW A;  3H7W B;  4HJ4 A;  1XA1 A;  4R3J A;  1XXM A;  2EX8 A;  4BQM A;  4QU3 A;  4R4R A;  2J3T D;  3WS4 A;  2PBD P;  2HJ9 C;  2WUQ A;  1H3Q A;  2JKF A;  1F9I A;  2J9O A;  3IXD A;  2PHY A;  2Y79 A;  5E2G A;  4GD6 A;  4PAU A;  1LL9 A;  2OAP 1;  1PWG A;  2QHK A;  2WZX A;  3QP4 A;  1VET B;  1K55 C;  1GHI A;  3PBR A;  2Q9N A;  5CGW A;  5DKL A;  1PW1 A;  2OAQ 1;  3GTC A;  3NDE A;  5GHZ A;  5HAR A;  1SDE A;  4P6Z S;  1LHY A;  2VA0 A;  3S7O A;  2IWB A;  4BLM A;  1BSG A;  4S2M A;  4U0T A;  3EQV A;  1O7E A;  3HVF A;  3TSG A;  3HLB A;  1CEG A;  5KSH A;  3BQA A;  3T4J A;  2VGJ A;  2OOL A;  3R7W A;  1L0D A;  3CUE C;  3OPR A;  4JPM A;  3CAX A;  1KVM A;  2H5S A;  1ODV A;  1BYW A;  2GNX A;  2YKH A;  3UE0 A;  3N4I A;  3IX8 A;  3EQU A;  3LIA A;  1N9N A;  1MWS A;  3CI6 A;  4GN2 A;  4LRX C;  1G6A A;  4QY6 A;  2JHE A;  5DJU A;  4F94 A;  3VV4 A;  5HZH A;  2V9A A;  5AJG A;  1KOU A;  4P0M A;  3G32 A;  1TS8 A;  4G3K A;  4BMW A;  4GHI A;  1YLY A;  1BUL A;  2EX6 A;  4PM6 A;  2DRW A;  1Z09 A;  1YT4 A;  3VMA A;  2W27 A;  1PI5 A;  4CLC D;  4D2O A;  3TOI A;  4I3I A;  3QP5 A;  3PHY A;  5DKK A;  1CJF A;  3MKE A;  4E3J A;  4HOI A;  3H82 B;  5HWV A;  5G18 A;  5GHY A;  4YWZ A;  5J4E A;  4LRY C;  2V20 A;  3OPL A;  4NEE D;  4D60 A;  2QMI A;  3MXR A;  5DFY A;  3LR5 A;  3NIA A;  3IHA A;  3O87 A;  2GX5 A;  2VV6 A;  3WRZ A;  1ES4 A;  3O5Y A;  5G4Y A;  5M1A A;  2ZQ7 A;  3KSF A;  3T1X A;  2P04 A;  4P87 A;  5GLD A;  3E4O A;  4NXB A;  4G3W A;  3BY8 A;  1OTE A;  3MQQ A;  1MKM A;  3D72 A;  3ZGA B;  3G30 A;  5JYP A;  3HLG A;  4S2L A;  1YKD A;  1H8M A;  1YSP A;  3S7P A;  3G31 A;  3HLE A;  2V0U A;  4ESP A;  2A24 B;  1S0W A;  3E4P A;  5G4Z A;  5BOH A;  3WS1 A;  3NBL A;  3MF0 A;  3VP2 A;  3IWQ A;  5D3O A;  1YMS A;  3B42 A;  4P85 A;  4JF5 A;  4R3A A;  3N8R A;  3WS0 A;  4Q8I A;  3F1P B;  5AVE A;  3OLO A;  1DY6 A;  3MQO A;  2Y2I A;  1BUE A;  3SS5 A;  5FQQ A;  4NXG A;  5FEG A;  4E3I A;  3BJN A;  4F3L A;  4ETX A;  2EX2 A;  3EOI A;  1PWC A;  2QKP A;  1W79 A;  1JWV A;  2K7S A;  3MJQ A;  4KQO A;  3NOU C;  2PAV P;  4OQI A;  5HDS A;  5K5B A;  1H8Y A;  4B93 A;  4Y5F A;  3ZNT A;  5I5L A;  4WYY A;  3ULF A;  1K57 A;  2OLU A;  2XH9 A;  4PHT A;  2GJ3 A;  4JGQ A;  3UPO A;  3MFX A;  1O07 A;  1BLC A;  5TBM A;  1W8Q A;  4JGP A;  2EFU A;  5AQB A;  4EW7 A;  3SH8 A;  2M7U A;  1TF1 A;  1NRJ A;  4HH3 A;  5EV0 A;  2UV0 E;  3BEC A;  3E2L A;  3S7Q A;  3T4S A;  1K57 C;  2XEP A;  4R6L A;  1SKO B;  3QP1 A;  4QB8 A;  1KE3 A;  5GHX A;  5J8X A;  1JWZ A;  1T1C A;  2FH5 A;  4CLC C;  2V0W A;  3BM6 A;  3QNB A;  4WUJ A;  4U0X A;  2ZJ9 A;  1BTL A;  4X68 A;  2DCF A;  3UB8 A;  4IVI A;  2HDQ A;  5HAP A;  2I72 A;  1LL5 A;  4LFU A;  5F68 A;  4S2N C;  5U47 A;  4KZ8 A;  2WKR A;  4Y0O A;  4Y13 A;  3ZNY A;  5EFW A;  3NJA A;  1MWR A;  1YLJ A;  2W1T B;  1ZC2 A;  2VV8 A;  4PM9 A;  3T4L A;  3WRT A;  4OON A;  4P6Z M;  2J8Y A;  3E2K A;  3IF6 A;  4IBX A;  5FEF A;  3MZF A;  3RH8 B;  5HD5 A;  3NOT C;  4WL9 A;  3HLW A;  2E8I A;  4C6Y A;  3PBN A;  3UB5 P;  1XKZ A;  3LGO A;  5EUA A;  2P9V B;  2Y8H A;  2C6W B;  2BTF P;  1RGZ A;  2LB5 A;  2B02 A;  2Y2P A;  1YLW A;  3A0R A;  5DTT A;  4L9G A;  1HD8 A;  3NY4 A;  4WN5 A;  1QME A;  4K08 A;  1NYY A;  3RFB A;  3KSG A;  1JVJ A;  3ZG8 B;  3K3D A;  5HX9 A;  1I5Q A;  2A49 A;  3QP2 A;  3PBS A;  1K54 A;  1YPR A;  3BEB A;  3UN7 A;  4MN6 A;  2W3E A;  4CPK A;  4R3B A;  2R9W A;  3OOV A;  4FH4 A;  4O7D A;  4QWO A;  1FCM A;  1IEL A;  4EU0 A;  2WGW B;  1LT0 A;  3JYI A;  4NG2 A;  3NC8 A;  3GDI A;  1ZG4 A;  2KX6 A;  4K0W A;  4N9K A;  4PPR A;  5DF9 A;  5DJT A;  4BL3 A;  3EWK A;  4Y2F A;  1RP5 A;  5HWT A;  2JN7 A;  4DDY A;  4PKY A;  2VZW A;  4ID4 A;  4S2K A;  2VJW A;  2ZQD A;  3UB6 A;  3Q81 A;  5EEC A;  2ACG A;  4MDZ A;  4RX2 A;  1VEU A;  4MCW A;  5AQA A;  1TDG A;  2M1C A;  3CWF A;  5HDD A;  3E4Q A;  4Z9Q A;  4Q0I A;  1N9O A;  1K56 A;  4Y7P A;  3DTK A;  2CMN A;  3H7W A;  3LYX A;  3IT9 A;  4EBN A;  2V1A A;  2WAF A;  3IH9 A;  1P97 A;  2OSU A;  3EGX C;  5EOE A;  5AVF A;  3BFD A;  3W4O A;  2WKI A;  1KGG A;  3LO7 A;  3BRM A;  2Y2L A;  3LIC A;  4HHD A;  3FZC A;  1J3W A;  4Z1W A;  4KQR A;  3LUQ A;  4BBV A;  3P98 A;  1Q2Q A;  2Y2K A;  2Y2Q A;  2ZMV A;  3LI9 A;  4S2O A;  5CX7 A;  3VE3 A;  3A3D A;  2V1B A;  1OJ5 A;  3ZCZ A;  3A3F A;  3M2J A;  3FYZ A;  3GVB A;  1G28 A;  1L0F A;  5FI6 A;  3S22 A;  5FL3 A;  3PR6 A;  4WLA A;  1M40 A;  3M2K A;  4ARZ B;  2VEA A;  3ITA A;  3F1O B;  2EWV A;  1TD5 A;  3UE1 A;  3LI8 A;  3Q7Z A;  4HY8 A;  1JTD A;  3FC7 A;  3ISG A;  4XXR A;  1T19 A;  3VFF A;  1YAX A;  4G3V A;  2W3H A;  1DP6 A;  1K4F A;  3TRC A;  1SHV A;  3CLO A;  2WKH A;  1XPB A;  5L10 A;  4OPQ A;  3U2A A;  1W7F A;  3HL9 A;  3MXS A;  2HDR A;  4JGO A;  4HJ6 A;  3FKV A;  2ZQ9 A;  3ZG5 A;  2X71 A;  1F2K A;  3WS2 A;  4BBU A;  2ZC3 B;  3ICY A;  3W4P A;  3ZDJ A;  4N1X A;  1E25 A;  1K55 A;  2BAS A;  3A3J A;  3G2Y A;  3BLM A;  2O99 A;  2ZD8 A;  2PDR A;  1K6S A;  4Y15 A;  2ZLY A;  4PKY G;  4K0X A;  3UY6 A;  2XQZ A;  4GD8 A;  3MSH A;  2PRF A;  4LCM A;  2R9X A;  1STZ A;  4OLD A;  3C8C A;  1KE0 A;  1BLS A;  2ZOI A;  3CUE A;  2QYB A;  5GL9 A;  5FAQ A;  1ERO A;  2B18 A;  3PBT A;  3FKW A;  3Q82 A;  3DW0 A;  1VB6 A;  4FOF A;  1T1B A;  1PZP A;  2RCX A;  4LV1 A;  1KDS A;  3QP8 A;  2EA9 A;  1NWZ A;  5AQ9 A;  4UA6 A;  2XRN A;  1A0K A;  4LV3 A;  1OT9 A;  2H10 A;  5E2E A;  2GDN A;  2ZC4 B;  4ZJ1 A;  4LLO B;  5KZH A;  4ZDX A;  4UA7 A;  3ZYT A;  2XSS A;  3G6O A;  2Y91 A;  2W3G A;  3KYE A;  2PR6 A;  2QZ6 A;  5HPI A;  4JKT A;  2Y2N A;  4HJ3 A;  1PNE A;  3BFF A;  1DJC A;  1S66 L;  2D01 A;  3MQ0 A;  3CHW P;  2ZQC A;  4GNU A;  2IA2 A;  4RYE A;  4AFI A;  4RVA A;  4R38 A;  4MN7 A;  1UGU A;  4WMC D;  4NET A;  2PD7 A;  4NXE A;  1Y4O A;  4N92 A;  4N1H A;  3QHY A;  3G34 A;  1S67 L;  3MXQ A;  3OCL A;  4HBT A;  2Q9M A;  5FQJ A;  5EM0 A;  5EVE A;  2INW A;  1TVF A;  1ACF A;  4BD0 A;  2XD5 A;  3LR0 A;  5TR7 A;  3N7W A;  2O9A A;  4ZAM A;  1IEM A;  1NLZ A;  1OJG A;  5FQM A;  3NCK A;  5DTK A;  4XUZ A;  2WAE A;  3Q07 A;  3OCN A;  2ZQA A;  1BLP A;  4CLC E;  5MC7 A;  1P9R A;  1XJ2 A;  1EWZ A;  4Y0U A;  4HP4 A;  1SKO A;  3IS2 B;  1FR1 A;  5KSC A;  5HFO A;  5IS1 A;  1FR6 A;  2J9P A;  4MBF A;  1V9Z A;  4DE3 A;  4X55 A;  2EX9 A;  3O86 A;  2LB9 A;  4QY5 A;  2WZZ A;  3FWL A;  5IU1 A;  4L9E A;  1LL8 A;  2J3T C;  4O01 A;  3BW6 A;  4QPR A;  3MBZ A;  5M19 A;  2P7J A;  3KO6 A;  1RGY A;  2XD1 A;  3PAG A;  3ITB A;  4C3Q A;  4DMZ A;  3DTM A;  3TJZ C;  1ERM A;  2PD8 A;  2W1T A;  4PM8 A;  5HL6 A;  1JNU A;  3AGE A;  4PM5 A;  1FOF A;  5HPF A;  2VV7 A;  1BZA A;  4R23 A;  5C5K A;  4GW9 A;  5EVI D;  5HL1 A;  1PW8 A;  1ZHH B;  3FV7 A;  3G4P A;  5HDC A;  2J7V A;  1OME A;  1CF0 A;  3G2Z A;  4JBF A;  1X0O A;  3P01 A;  2P9V A;  4KZA A;  4DF6 A;  1IKG A;  4ZJ2 A;  4EV4 A;  3DTI A;  5F1F A;  5FDS A;  1Q2P A;  1K25 A;  1FCN A;  2JKT I;  3RJU A;  1M6K A;  2L4R A;  1CI8 A;  1W63 Q;  3ZVT A;  3HLC A;  5LBR A;  4K91 A;  4BWI A;  5KMW A;  2HP9 A;  2HDS A;  2PBY A;  4NXF A;  3K3C A;  4KUK A;  2JCH A;  1GA9 A;  4S2I A;  5GLC A;  1YLT A;  2O0Y A;  3BFC A;  4CLC A;  2JKT M;  2WGW A;  3LIF A;  5CEC A;  3IQA A;  2E8J A;  1Y54 A;  1KVL A;  4Q0H A;  4A5R A;  4IED A;  4S2N A;  4GOG A;  3KSH A;  1PIO A;  2HV1 A;  1FIK A;  4E6X A;  3V3S A;  1DP8 A;  1ES3 A;  2B95 A;  3B3X A;  3VOZ A;  1H5X A;  3Q7V A;  4KZ4 A;  2G2U A;  2OV5 A;  2QJ7 A;  1WYC A;  4DJ3 A;  1XJ6 A;  1SCW A;  3IHB A;  3N6I A;  1GA0 A;  4X25 A;  1P9W A;  3W2Z A;  3O88 A;  4BD1 A;  3T4T A;  1ONH A;  4GJ4 A;  1LSV A;  3GR2 A;  4JXG A;  3VSL A;  2EFX A;  3IX3 A;  3ZG0 A;  1XA7 A;  3RTY A;  1JTG A;  4KZB A;  4DN0 A;  3R4K A;  4ZRR A;  1YLP A;  4E3N A;  1LLB A;  4KUO A;  2KOI A;  5AQ7 A;  4E6W A;  4QJG A;  2HP6 A;  1WE4 A;  3P09 A;  2ZMF A;  4OQH A;  1CK3 A;  4HQA A;  5EM1 A;  3ZHH A;  3NI9 A;  4ZBE A;  4M4X A;  4EQ1 A;  1K38 A;  5FAT A;  1WYB A;  1LSW A;  4DJ2 A;  1YM1 A;  1N9B A;  4L0L A;  4ARZ A;  3L9K A;  4II7 A;  2Z6D A;  1KGF A;  2Y2J A;  1D1J A;  2Y4A A;  3BLS A;  4OP8 A;  2UWX A;  3MFD A;  2WK0 A;  1QMF A;  2J80 A;  2JKR I;  2Y2M A;  1YQS A;  5EVI C;  5HD3 A;  2V8F A;  5A93 A;  4X53 A;  3VP0 A;  3SW1 A;  4EEU A;  1N9L A;  2WKE A;  2XK1 A;  2Y55 A;  1CEF A;  3QNC A;  1MXO A;  2NUP C;  1F5M A;  5GLA A;  4OOM A;  1TS6 A;  4DDS A;  5KIZ A;  1V9Y A;  2K31 A;  4IBR A;  5EVL A;  2JKR M;  4MMN A;  3DAV A;  5TBM B;  2QWS A;  4OOY A;  4RX3 A;  2AVX A;  4I3J A;  3CG5 A;  3A3E A;  3DWZ A;  4JLF A;  2EWW A;  3DWK A;  2G7U A;  3PAE A;  3MKF A;  1ZG6 A;  2WAD A;  3BFE A;  1XFQ A;  3A3I A;  4IUH A;  3F1N B;  1XP4 A;  4EBL A;  3LIE A;  4LCL A;  3MZD A;  3C7V A;  2PR5 A;  3HRE A;  2JKG A;  2OWH A;  2R78 A;  2V2F F;  4B4Z A;  3CMZ A;  1IYS A;  4QD4 A;  4OPY A;  1E3U D;  3DBA A;  1UWP X;  1KE4 A;  1FCO A;  4WM9 A;  3PBO A;  5A91 A;  5FI7 A;  1U60 A;  3QP6 A;  5A92 A;  1ONG A;  4UQI S;  5DF8 A;  4XT2 B;  4UHU A;  2O9C A;  4X56 A;  2B5R A;  4R1G A;  3IX4 A;  1L3L A;  1VET A;  1LI9 A;  3HCY A;  3HUM A;  2HDU A;  2V8C A;  4OLG A;  1ESI A;  2X02 A;  1SZV A;  5EVI B;  2OWJ A;  3WS5 A;  3IF6 B;  4KEN B;  3UME A;  4MEZ A;  3IXH A;  3KX0 X;  1S1Z A;  3VP1 A;  3SZT A;  1NXY A;  3OPP A;  3GSG A;  2PYR A;  3ZVW A;  2BG1 A;  4R4S A;  2JE5 A;  2M7V A;  3CPT B;  4OP5 A;  1AXB A;  4WBG A;  1BT5 A;  3GV9 A;  4NK3 A;  4RQ9 A;  5I94 A;  1FQG A;  3HUO A;  3BFG A;  3UO9 A;  5DF7 A;  1W63 M;  1T18 A;  3AGD A;  3NUL A;  3TG9 A;  4EQI A;  4MBK A;  5HWW A;  1PFL A;  3IH8 A;  4NKP A;  2W0N A;  4EWF A;  2VX8 A;  1D7E A;  3FPV A;  5CEB A;  3HUN A;  5TFQ A;  4O8G A;  2HF6 A;  1N4O A;  1NY0 A;  2I9V A;  4P6B A;  5CGX A;  2CC1 A;  1MZU A;  2PU2 A;  3OZH A;  1E4D A;  1TS7 A;  2L0W A;  2NUT C;  1NRF A;  1IYP A;  2PU4 A;  1ESU A;  1NZU A;  4GS9 B;  5L07 A;  3PXP A;  4JXW A;  1XFN A;  4HNB A;  3P7N A;  3H82 A;  3RXX A;  3SH9 A;  4FSF A;  5L8M A;  4E3K A;  3B33 A;  4KG5 A;  4HH2 A;  5DVA A;  2Y59 A;  1I2S A;  2JBF A;  3T4O A;  2EXB A;  3NOP C;  5DFX A;  4JF4 A;  5CTN A;  2ZBB A;  1G5U A;  2H28 A;  1T1A A;  4X69 A;  4DE1 A;  3CJM A;  4GDB A;  1ES5 A;  4MBH A;  3OPH A;  1ZTU A;  3BYD A;  3IS2 A;  4FTX A;  2L1M A;  3PYP A;  1K6R A;  3VP4 A;  2XF3 A;  1KGE A;  1L2S A;  4KG2 A;  3V50 A;  4WZ4 A;  4N9L A;  3D4F A;  3VP3 A;  4FCF A;  2WKQ A;  4EER A;  1XJ3 A;  4ZJ3 A;  3IBR A;  3HBR A;  5FQI A;  4I5S A;  3LY3 A;  4DRT A;  3EGD C;  3LCE A;  3T1Q B;  4JGR A;  2A24 A;  3I7J A;  3T4K A;  4LV0 A;  4WF0 A;  1YSQ A;  3LID A;  4U3T A;  4B4X A;  4YNR A;  4GLQ A;  1IYO A;  3SS3 A;  1UWN X;  4DE0 A;  1PI4 A;  1VQQ A;  5HAI A;  4KZ6 A;  2QJ5 A;  4OPR A;  3F1P A;  2O9B A;  4ZTK A;  1DJA A;  3UNW A;  2ZL1 B;  4H6J B;  2ZM2 A;  4CQH A;  3C30 A;  4FH2 A;  1AWI A;  3UDF A;  5CTM A;  2XFT A;  2Q0O A;  4GKU A;  3C7U A;  2RL3 A;  4LGW A;  3UMD A;  2ZOH A;  4S2P A;  4GZB A;  4Y17 A;  1EI5 A;  3E98 A;  1GCE A;  2XA7 S;  5CED A;  2KDK A;  2OLV A;  4OQ0 A;  1L0G A;  4HEF A;  4KG6 A;  1HTZ A;  1LI0 A;  1PZO A;  3HJK A;  1DRM A;  2X01 A;  1TDL A;  3UB7 A;  4EET B;  5EPH A;  1SKF A;  4EEP A;  4EBP A;  3ZG7 B;  1XGI A;  3LIB A;  3JPU A;  3IBJ A;  2P08 A;  4WZ5 A;  1XX2 A;  5FQ9 A;  3AGF A;  4OQG A;  2G2W A;  3OBF A;  3JVV A;  1P0Z A;  2W1R A;  4UQI M;  1TS0 A;  1HZO A;  1W8Y A;  4KZ7 A;  5JYO A;  4OKP A;  3ZFZ A;  2J3W A;  5FAP A;  3MZE A;  3JVU A;  4WZ5 C;  1F98 A;  3BY9 A;  1GHM A;  3R7W B;  4E04 A;  1SDN A;  3T50 A;  2VGL S;  4ME4 A;  2HGV A;  3S1Y A;  1GSV A;  1IFQ A;  5CHU A;  5A8B A;  4HES A;  4HI4 A;  4I39 A;  2FZ0 A;  3BWL A;  1FIL A;  1FSY A;  3IWI A;  2ZM8 A;  2P74 A;  4MLL A;  4PM7 A;  1OPX A;  1GSW A;  1S4R A;  1OTA A;  5A90 A;  4OVD A;  2HPB A;  5CXW A;  4BBT A;  4WMC A;  4GHI B;  1NLY A;  2XDM A;  4OH0 A;  4LV2 A;  5CHJ A;  3GEC A;  4PMA A;  2HJE A;  5E2H A;  2IWD A;  3UE6 A;  4M3K A;  3IXB A;  2W3D A;  5FDH A;  2Y2O A;  4IHQ A;  3M6B A;  4BL2 A;  2WGV A;  4KQD A;  5J7E A;  2W3F A;  1MKI A;  2A3U A;  3VOY A;  2JC7 A;  3IWO A;  3LR3 A;  3FG8 A;  3L7H A;  5EOO A;  3UDI A;  3GMW A;  2VK3 A;  3D9Y A;  4UA9 A;  3VOL A;  3NHQ A;  5E43 A;  5M18 A;  2ZC7 A;  3F1N A;  1PWD A;  4EES A;  3T1S A;  1RCJ A;  3Q1F A;  4OPZ A;  3SOI A;  1OT6 A;  2Z2M B;  4B9O A;  1MWT A;  2YKF A;  5F1G A;  3CZD A;  4HIA A;  2XLN A;  1IKI A;  4LRZ E;  5F69 A;  3V39 A;  4Y0T A;  1VM1 A;  3GQZ A;  4KZ5 A;  3V67 A;  1K56 D;  4C75 A;  1MPL A;  2PYP A;  4MNR A;  4YOF A;  2ZMA A;  3SH7 A;  4IVK A;  3VE4 A;  3W4Q A;  3TE8 A;  2DNS A;  4XT2 A;  1YLZ A;  4DXB A;  5FAS A;  1MBL A;  1EW0 A;  3DTE A;  3EEA A;  5HSQ A;  4I38 A;  3S7N A;  3LEQ A;  3OC2 A;  4E3M A;  5FA7 A;  3E0Y A;  4Y3I A;  3N8S A;  1DJB A;  5HW3 A;  5J3W A;  3HLF A;  1OTD A;  1VHM A;  1NZO A;  5EVI A;  1K0K A;  3U4L P;  3RXW A;  1YMX A;  4X6T A;  5FQK A;  3IF5 A;  5CRF A;  5FI2 A;  5CER A;  5GLB A;  3F1O A;  4GDN A;  4XUX A;  4F3L B;  2XFS A;  3GRJ A;  4CJN A;  3CPT A;  3V5M A;  3KYQ A;  4IUK A;  4YIN A;  4DE2 A;  1C3B A;  3IF6 C;  2EXA A;  4R0Q A;  4DKI A;  5TGF A;  1BLH A;  1PRQ A; 
#chains in the Genus database with same CATH homology
 4NKP A;  2W0N A;  5TJJ A;  3CIT A;  4R38 A;  5HDS A;  4MN7 A;  5K5B A;  1UGU A;  2VX8 A;  2D02 A;  3KSI A;  1D7E A;  3FPV A;  3UE3 A;  4Y5F A;  4B93 A;  4WEL A;  5I5L A;  2PD7 A;  2MJ6 A;  4NXE A;  3ULF A;  4O8G A;  2HF6 A;  4PHT A;  2GJ3 A;  4BJP A;  4CLC B;  2I9V A;  1S67 L;  4JGQ A;  3MXQ A;  3OCL A;  1MZU A;  3MFX A;  5TBM A;  2INW A;  3PBQ A;  1TS7 A;  2L0W A;  2NUT C;  4JGP A;  2XRO A;  2VKS A;  3LR0 A;  4GS9 B;  3PXP A;  2XA7 M;  2O9A A;  4EW7 A;  1XFN A;  4HNB A;  2M7U A;  1S1Y A;  1TF1 A;  1NRJ A;  4HH3 A;  1NLZ A;  3P7N A;  1OJG A;  3S7Q A;  4GS9 A;  3H82 A;  4WEJ A;  3T4S A;  4FSF A;  5L8M A;  3B33 A;  4HH2 A;  4R6L A;  3OCN A;  5F6A A;  3T4O A;  4CLC E;  5MC7 A;  3NOP C;  1P9R A;  1XJ2 A;  4UEY A;  5DFX A;  2Z6C A;  1T1C A;  4HP4 A;  2FH5 A;  4OOL A;  2V0W A;  3TW8 A;  4CLC C;  2ZBB A;  4MN5 A;  3IS2 B;  4WUJ A;  2H28 A;  3KYZ A;  4GCZ A;  1T1A A;  5IS1 A;  2KLI A;  3UB8 A;  1ZTU A;  2PT7 A;  1V9Z A;  3EEH A;  3IS2 A;  4R70 A;  2L1M A;  2VLG A;  3PYP A;  5F68 A;  1D06 A;  1G6O A;  2WKR A;  2LB9 A;  5EFW A;  2K2N A;  3NJA A;  4EUV A;  5IU1 A;  4L9E A;  1LL8 A;  2J3T C;  4O01 A;  2WKQ A;  4EER A;  1XJ3 A;  3BW6 A;  3D3O A;  3IBR A;  4QPR A;  4L9F A;  2P7J A;  4I5S A;  3UB9 A;  2W1T B;  3K2N A;  3EGD C;  3KO6 A;  2VV8 A;  3MMH A;  1WA9 A;  3T4L A;  3B47 A;  4DMZ A;  3A0V A;  3TJZ C;  4JGR A;  4P6Z M;  2A24 A;  2PD8 A;  2W1T A;  5F5Y A;  5HL6 A;  3T4K A;  1JNU A;  1Y28 A;  3RH8 B;  1XJ4 A;  2VV7 A;  4HP9 A;  3NOT C;  4WF0 A;  5HD5 A;  5HPF A;  5IT5 A;  4WL9 A;  1YSQ A;  3LID A;  5C5K A;  4GW9 A;  3PBN A;  4YNR A;  4GLQ A;  1UWN X;  4IJG A;  1ZHH B;  2Y8H A;  3A0S A;  5HDC A;  2VGL M;  2QJ5 A;  1MC0 A;  2LB5 A;  2B02 A;  1X0O A;  3P01 A;  3LR4 A;  3F1P A;  3A0R A;  4Q0J A;  2O9B A;  4H6J B;  4L9G A;  4WN5 A;  4WEK A;  4K08 A;  4LPZ A;  3KSG A;  3RFB A;  3K3D A;  4H6J A;  3H9W A;  3C38 A;  2JKT I;  3PBS A;  4MN6 A;  2W3E A;  3T4Q A;  4CQH A;  2L4R A;  3LFV A;  3OOV A;  3C30 A;  1W63 Q;  5LBR A;  4BWI A;  4EU0 A;  4NXF A;  3K3C A;  4KUK A;  1LT0 A;  4ETZ A;  4EXO A;  3GDI A;  3UMD A;  2KX6 A;  2ZOH A;  2O0Y A;  2WKP A;  4CLC A;  4I3A A;  1DP9 A;  2JKT M;  3BQ8 A;  3LIF A;  3C2W A;  3FPW A;  5DF9 A;  5DJT A;  1OTI A;  3E98 A;  3EWK A;  4Q0H A;  4Y2F A;  5HWT A;  2XA7 S;  2KDK A;  2JN7 A;  3MR0 A;  1S4S A;  4PKY A;  1LSX A;  2VZW A;  3KSH A;  1IOU A;  2HV1 A;  2GZA A;  1DP8 A;  3HJK A;  2VJW A;  2A2L A;  1DRM A;  1GSX A;  3UB6 A;  3UB7 A;  4EET B;  4MDZ A;  4O0P A;  4MCW A;  4EEP A;  1OTB A;  3ZQ5 A;  3HJI A;  2DMW A;  2QJ7 A;  3H7W B;  4HJ4 A;  2M1C A;  4DJ3 A;  3CWF A;  1XJ6 A;  5HDD A;  3E4Q A;  2J3T D;  3LIB A;  4Q0I A;  1N9O A;  2CMN A;  2HJ9 C;  3H7W A;  1P9W A;  1H3Q A;  3W2Z A;  3IBJ A;  1F9I A;  2P08 A;  3LYX A;  3T4T A;  2PHY A;  2V1A A;  2Y79 A;  4GJ4 A;  1LSV A;  1P97 A;  4PAU A;  3EGX C;  5AVF A;  2OAP 1;  3OBF A;  2QHK A;  3RTY A;  3JVV A;  1P0Z A;  2W1R A;  3LIC A;  4UQI M;  4HHD A;  1TS0 A;  4Z1W A;  3PBR A;  3LUQ A;  4BBV A;  4DN0 A;  3R4K A;  5DKL A;  4ZRR A;  2OAQ 1;  2ZMV A;  3LI9 A;  4KUO A;  2KOI A;  2J3W A;  5CX7 A;  4P6Z S;  3VE3 A;  2V1B A;  3JVU A;  2VA0 A;  3S7O A;  1OJ5 A;  2ZMF A;  1F98 A;  1G28 A;  3BY9 A;  4HQA A;  3R7W B;  4E04 A;  3EQV A;  5FL3 A;  3PR6 A;  4WLA A;  5KSH A;  3BQA A;  4M4X A;  3T4J A;  3T50 A;  4ARZ B;  4EQ1 A;  2VGL S;  2OOL A;  3R7W A;  2VEA A;  3CUE C;  3F1O B;  4ME4 A;  2EWV A;  2HGV A;  1GSV A;  1TD5 A;  3CAX A;  1LSW A;  4DJ2 A;  4L0L A;  4ARZ A;  3LI8 A;  4II7 A;  2Z6D A;  1IFQ A;  1ODV A;  5A8B A;  4HI4 A;  4I39 A;  1BYW A;  2FZ0 A;  3BWL A;  2GNX A;  2YKH A;  4HY8 A;  3FC7 A;  3EQU A;  3LIA A;  1T19 A;  1N9N A;  1YAX A;  1OPX A;  2J80 A;  2JKR I;  3CI6 A;  1GSW A;  1S4R A;  1OTA A;  4LRX C;  4G3V A;  5DJU A;  2JHE A;  5HD3 A;  3VV4 A;  2W3H A;  5HZH A;  2V9A A;  5AJG A;  1DP6 A;  1KOU A;  3TRC A;  4BBT A;  3SW1 A;  4EEU A;  1N9L A;  4GHI B;  1NLY A;  3CLO A;  2NUP C;  1TS8 A;  4G3K A;  1F5M A;  4BMW A;  4OOM A;  1TS6 A;  3GEC A;  4GHI A;  2HJE A;  5KIZ A;  3U2A A;  3UE6 A;  1V9Y A;  2K31 A;  2JKR M;  4MMN A;  2W3D A;  5TBM B;  4IHQ A;  2W27 A;  4HJ6 A;  2QWS A;  4JGO A;  4CLC D;  4I3I A;  4KQD A;  5J7E A;  4I3J A;  3PHY A;  2W3F A;  5DKK A;  2EWW A;  4BBU A;  2G7U A;  3ICY A;  3LR3 A;  3FG8 A;  4HOI A;  1XFQ A;  3H82 B;  4IUH A;  3F1N B;  5HWV A;  3LIE A;  2BAS A;  4YWZ A;  3VOL A;  5J4E A;  3NHQ A;  4LRY C;  2PR5 A;  2O99 A;  3F1N A;  4NEE D;  2OWH A;  2R78 A;  4EES A;  2PDR A;  5DFY A;  1OT6 A;  3LR5 A;  4B9O A;  2YKF A;  2GX5 A;  3DBA A;  1UWP X;  2VV6 A;  4HIA A;  4PKY G;  4LRZ E;  3O5Y A;  5F69 A;  3PBO A;  1STZ A;  5G4Y A;  3C8C A;  3V67 A;  3KSF A;  2PYP A;  2P04 A;  4UQI S;  4XT2 B;  2ZOI A;  3CUE A;  3E4O A;  2QYB A;  4YOF A;  4NXB A;  2O9C A;  4G3W A;  3BY8 A;  2B18 A;  3VE4 A;  1OTE A;  3HCY A;  3MQQ A;  3PBT A;  3TE8 A;  1MKM A;  3D72 A;  4XT2 A;  1VB6 A;  1EW0 A;  4FOF A;  3EEA A;  5HSQ A;  4I38 A;  3S7N A;  1YKD A;  1H8M A;  1YSP A;  3OC2 A;  1T1B A;  3S7P A;  3E0Y A;  2V0U A;  4Y3I A;  2A24 B;  3E4P A;  2OWJ A;  5G4Z A;  5J3W A;  3UME A;  2EA9 A;  1NWZ A;  1OTD A;  1VHM A;  2XRN A;  3KX0 X;  1OT9 A;  1S1Z A;  3MF0 A;  4LLO B;  3B42 A;  3ZYT A;  2XSS A;  3G6O A;  2PYR A;  2W3G A;  3F1O A;  4R3A A;  4F3L B;  2M7V A;  3F1P B;  5AVE A;  3OLO A;  2PR6 A;  3MQO A;  5HPI A;  4NXG A;  3BJN A;  4RQ9 A;  4F3L A;  4ETX A;  3EOI A;  3KYQ A;  2QKP A;  1W63 M;  1T18 A;  4HJ3 A;  4IUK A;  1S66 L;  2K7S A;  5HWW A;  3MJQ A;  2D01 A;  3MQ0 A;  4KQO A;  2IA2 A;  4AFI A;  3NOU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...