4GS9B

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with an inactive benzoxadiazole antagonist
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
109
Chain Sequence
PTRFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title Development of Inhibitors of the PAS-B Domain of the HIF-2 alpha Transcription Factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4gs9B01
4EEPA 2VEAA 1DP9A 4B9OA 2W0NA 4JGOA 1DP6A 4BBTA 2Z6DA 1S66L 2M1CA 5AVFA 3BY9A 3MXQA 3LIBA 3NOPC 4KQDA 5DKKA 2OOLA 3ICYA 3H82A 2ZOIA 3HJKA 2WKRA 1XJ6A 4HNBA 3NOUC 2QWSA 3LIFA 3CAXA 3H9WA 5G4ZA 4PKYG 3UB6A 2QJ7A 4M4XA 4GHIB 1OTDA 1UWNX 3NOTC 5AVEA 1XFQA 4WL9A 5HDDA 2A24A 3FG8A 4YWZA 1GSVA 1GSXA 4WF0A 3IS2B 4KUKA 1LSVA 3G6OA 1D06A 2PYRA 2GJ3A 3K3DA 3UB8A 4JGPA 3FC7A 3F1NA 3UMDA 3B33A 4EQ1A 1S4SA 3PHYA 1XJ3A 1GSWA 1T1BA 5A8BA 3F1PB 4HOIA 1VB6A 4NXGA 1TS7A 4LLOB 1ODVA 4I5SA 2QHKA 2P7JA 3IS2A 3RH8B 2PHYA 1JNUA 4HH2A 4HP9A 2V0WA 1OTAA 3C8CA 3GDIA 2OWJA 2K7SA 2OWHA 4HIAA 5DKLA 4I3AA 4JGRA 5DJTA 5HD5A 1OTEA 1G28A 2D02A 4R38A 3ULFA 1V9ZA 3LIAA 4HP4A 4HJ4A 4LPZA 3P7NA 2H28A 3UE6A 3LICA 5I5LA 3RTYA 3MQOA 5KIZA 3D72A 1N9LA 3F1OB 3VE4A 1OJGA 3A0RA 3NJAA 4R70A 1NWZA 4MN6A 3PYPA 3LIEA 3LI8A 3A0SA 2INWA 3VOLA 1OT9A 3MR0A 4HJ6A 1LSXA 3E4OA 3VE3A 4HI4A 4I38A 4F3LB 3C2WA 4EETB 1P97A 5IS1A 2QKPA 1S4RA 5EFWA 3LIDA 1MZUA 1OTBA 1TS0A 4GS9B 4WUJA 2BASA 4EESA 4KUOA 2B02A 3ZQ5A 4LRZE 1S1ZA 1T1AA 1LT0A 5TBMB 4GW9A 1OTIA 5HWTA 1DP8A 2VV6A 4GHIA 3H7WB 5J3WA 3CLOA 3F1OA 3MFXA 3OLOA 2R78A 2ZBBA 2VLGA 2PYPA 3HJIA 3E4PA 4DJ3A 2WKQA 1TS8A 4XT2B 4MN5A 1WA9A 1V9YA 4HHDA 5DJUA 4DJ2A 3H82B 5HWVA 4I3IA 1UWPX 3BWLA 5TBMA 1XJ2A 4WLAA 1BYWA 4HH3A 2Z6CA 1S67L 1S1YA 5J4EA 3EWKA 4EW7A 5F5YA 1KOUA 2VV7A 4NXBA 1LL8A 1F98A 2D01A 1UGUA 4GCZA 3F1PA 3CWFA 4RQ9A 1XJ4A 1T18A 2VV8A 2A24B 4HQAA 4NXEA 4BBVA 4XT2A 2V9AA 3E4QA 3LI9A 2L1MA 4BBUA 5F69A 3IBRA 5F68A 1N9NA 2L4RA 2EA9A 2V0UA 2QJ5A 2YKHA 4H6JB 5J7EA 1Y28A 4R3AA 5F6AA 1OJ5A 1DRMA 2J80A 1P0ZA 3F1NB 4LRYC 5IU1A 2JHEA 1T1CA 4L9EA 3UB9A 4E04A 4HY8A 4EEUA 3MQQA 4PKYA 3K3CA 4R6LA 4I3JA 5HDCA 3UMEA 1F9IA 5HSQA 2HV1A 2I9VA 3SW1A 2PD8A 2PR6A 3LUQA 1XFNA 5HWWA 1LSWA 2PDRA 2WKPA 4L9GA 4L9FA 1X0OA 4H6JA 2KDKA 2PD7A 3T50A 2KX6A 3LYXA 4EERA 3MJQA 5HZHA 1T19A 3GECA 1OT6A 1D7EA 5G4YA 4F3LA 4HJ3A 2W27A 2YKFA 4K08A 4EXOA 2CMNA 3A0VA 4GS9A 4NXFA 3BY8A 3EEHA 1N9OA 2L0WA 3NHQA 3UB7A 4JGQA 5HD3A 2V1BA 1TS6A 2PR5A 3KX0X 3H7WA 4LRXC 1EW0A 2ZOHA 4WN5A 5HDSA 2V1AA 4I39A 2JN7A
chains in the Genus database with same CATH superfamily
4EEPA 4E3JA 1L0EA 2IA2A 3BLSA 4B9OA 5E2FA 2Z6DA 4KZ4A 5CXWA 3BY9A 2XROA 3IHAA 2VGLS 3VMAA 3BEBA 3S1YA 3E0YA 3PBOA 2ZOIA 4BLMA 2EFXA 5A91A 4KZ7A 2WKRA 1XJ6A 3PTEA 5FAPA 5CEBA 3LIFA 3T1QB 1K55A 4JKTA 3KYQA 3VSKA 4WZ5C 1W63M 3VP0A 4R3JA 2XK1A 3R7WA 3C7UA 3HBRA 3RFBA 3WRZA 1AXBA 1SKOA 4Y0TA 4R4RA 2IWDA 4JF5A 5FI2A 3FG8A 5CTNA 1GSVA 1GSXA 4OQIA 1LSVA 4MEZA 1Z6FA 4UA6A 2EX2A 3BM6A 3CPTA 3UB8A 4K0XA 3Q82A 3MZEA 3IH9A 4JGPA 3B33A 3S7OA 5GHZA 5IT5A 5TGFA 3S7NA 3IWIA 4DE2A 1YLPA 2Y55A 1GSWA 1ALQA 5EVIA 1LL5A 1T1BA 3IBJA 5EV0A 3M2KA 4NXGA 1BLHA 2WAFA 5U47A 2WUQA 4K91A 5L07A 1JTGA 4BWIA 4HP9A 2EX8A 3GDIA 4P0MA 3UPNA 2OWJA 1IYOA 2K7SA 1E4DA 5DKLA 5DF9A 2RCXA 1AWIA 1MWTA 2VX8A 2XFTA 4KZ6A 3ULFA 1JWZA 1XGIA 4LV1A 1NLZA 3WS0A 5DF8A 1H8MA 4JXSA 4C3QA 1XX2A 3FKVA 2ZC6B 1W63Q 4YOFA 3ZG8B 3RTYA 2WYXA 1H8YA 2ZMFA 2Y2KA 3VOZA 2M7VA 1LLBA 1CI9A 3S7QA 3QP5A 2W1TB 4Y2FA 4GLQA 3N6IA 4E3IA 4S2NC 3OZHA 4MBKA 3CG5A 3FPWA 4GDNA 1RGYA 1K0KA 3P01A 3OBFA 2HJ9C 3A0SA 1PW8A 3AGFA 4U3TA 3B3XA 3OOVA 2V1ZA 4HJ6A 4YFMA 3VE3A 5F82A 1K56A 4EETB 2G7UA 5IS1A 1S4RA 1TS0A 2OV5A 2B02A 3ZG9B 3ZQ5A 3Q81A 2AVXA 4LRZE 1T1AA 3IXBA 1LT0A 3C30A 3IXHA 4MBFA 5DTSA 4GW9A 1FILA 5HWTA 2VGLM 1N4OA 4OPRA 4GN2A 2DNSA 1XKZA 3CLOA 4PHTA 5HARA 5F83A 1GHMA 1RCJA 4DE3A 2R78A 2PU2A 4KZ3A 4JXWA 1BT5A 4QPRA 1IYSA 4LFUA 2WKQA 3OPLA 3HVFA 3MSHA 5HAQA 5EVEA 5HPIA 3FPVA 2WK0A 4OONA 4EQIA 3E2KA 2ZLYA 1NRFA 4DJ2A 4O0PA 5A90A 3SH8A 4I3IA 4WBGA 1UWPX 1KVLA 4CPKA 4N1XA 2V20A 2G2UA 3LGOA 4WLAA 4HH3A 2P08A 5J4EA 4EW7A 3WS1A 4NXBA 1LL8A 4D2OA 2WADA 2HJEA 3UNWA 3F1PA 3CWFA 1KVMA 1H5XA 1PWDA 3SS4A 4XUZA 2A24B 4OOYA 4ETXA 4NXEA 3T4JA 4XT2A 3LR3A 1CJFA 4HEFA 3TOIA 2BLSA 3LI9A 1MBLA 4IEDA 1GA0A 2L1MA 3PBQA 4ZBEA 1HD8A 4OQGA 5GLBA 3V67A 2OLUA 1KE3A 4H6JB 4LV2A 5F6AA 3IT9A 5CECA 1P9RA 3L7HA 3F1NB 1KDSA 3ZNTA 1BTLA 2EWVA 2XDMA 1BZAA 3UB9A 4E04A 2H10A 3K3CA 4JF4A 1FQGA 1D1JA 4WZ5A 2BTFP 2ZQ7A 5TFQA 3UMEA 1K4FA 3IQAA 2EXBA 4JF6A 1J3WA 1CF0A 3ISGA 1HLUP 3LR0A 2HV1A 2I9VA 4X6TA 4H8RA 4S2KA 5D3OA 1LSWA 1TVFA 2WKPA 5DVAA 4RVAA 1BSGA 3VP3A 2XR0A 1BLSA 2PT7A 5DTTA 3K2NA 3T50A 4C6YA 1SZVA 3SS3A 3LYXA 4EERA 5HZHA 1YLYA 5FEFA 1ONGA 3QP2A 4F3LA 3I7JA 1XXMA 1NJ4A 2W27A 5EM1A 4K08A 4EXOA 3MXRA 2IWBA 3BY8A 4Y3IA 3ZCZA 2L0WA 3NHQA 2ZJ9A 4IJGA 3HLWA 3NI9A 3UO9A 1PNEA 4BQMA 1VM1A 4E3NA 2J3WA 1HZOA 3IH8A 2V1BA 1BUEA 2WZZA 3H7WA 5LBRA 3WRTA 1G5UA 5CEDA 2ZOHA 3UN7A 4E3KA 4NETA 3RXXA 2C6WB 2JN7A 1FR6A 4PM9A 1DP9A 4JPMA 4BL2A 4JGOA 5M1AA 2WKIA 2V8CA 3SZTA 1IYPA 2MJ6A 3B42A 4QY5A 5AVFA 3MXQA 4JXVA 4CLCB 4BD1A 5DKKA 2OLVA 3H82A 5DTKA 3HJKA 4FD8A 3QP6A 3NOUC 1Z09A 1W7FA 3VP1A 3CAXA 3H9WA 5EVID 3LEQA 1SDNA 3A3IA 1SHVA 4M4XA 2WAEA 3GSGA 4GHIB 1OTDA 3DAVA 1G68A 1CK3A 5A93A 2ZC3B 5AVEA 3CI6A 4P87A 4WYYA 1YAXA 3MZDA 4HBUA 3PXPA 4S2NA 4F94A 5HDDA 1K38A 2O99A 4UQIS 4KG5A 4OOLA 4IUHA 4WF0A 3VP2A 3MFDA 4OQHA 4DXBA 1L0DA 4MCWA 5GLCA 2XSSA 1VETA 3MBZA 3S22A 3V3RA 4B4XA 3GV9A 3BFDA 1ES2A 1PWCA 1FCMA 1DY6A 3FC7A 2J7VA 2JKFA 4LV3A 2WGWB 5TJJA 2FH5A 4PPRA 3QP1A 5FATA 2IWCA 2JKTM 1BLPA 1VB6A 4N9LA 3IF6C 1MY8A 4I5SA 4KG6A 2ZQDA 2JKRM 3DTKA 4DE1A 2PHYA 4UAAA 2DRWA 2OAP1 2V0WA 1YLJA 1MWRA 3PBTA 3D3OA 4PMAA 4EV4A 3N4IA 3CHWP 4ARZB 3BFFA 3OCLA 3Q1FA 5EPHA 4OKPA 4I3AA 1K56D 3TRCA 4EWFA 4QU3A 1OTEA 2J3TC 4R38A 1V9ZA 5E2GA 5MC7A 4PM7A 2H28A 3OCNA 4WZ4A 5I5LA 2HGVA 3QP8A 4EBPA 2GDNA 4P6ZS 3O86A 1ONHA 1PW1A 5CRFA 4E3LA 1RP5A 3E2LA 5L10A 4OH0A 5L2FA 1QMFA 2HP6A 3N7WA 1OJGA 4GB7A 2EFUA 4IHQA 3G30A 4R70A 5GLDA 4CLCC 1NWZA 4MN6A 4WEJA 2XD5A 4X68A 1LL9A 3VFFA 3T1SA 3LIEA 4O8GA 3UY6A 3VOLA 4UEYA 1IKGA 3WS4A 3E4OA 1TDLA 4DDYA 3HCYA 5AQBA 3ZHHA 3UPOA 3CJMA 1O7EA 3GQZA 1HVBA 4MN7A 1W5DA 2P04A 5TBMB 4WELA 2Y4AA 3OPRA 2NUTC 3OPHA 5FI6A 1MWSA 4RX2A 3IF5A 2FFFB 2W1TA 5DFXA 5DF7A 4EU0A 5J3WA 3G2YA 1YSQA 3MFXA 5F1GA 4FCFA 3IHBA 2ZBBA 5E2HA 5J8XA 1L2SA 1ZKJA 4Y15A 4DJ3A 3C5AA 4KZ8A 1PI4A 1G6OA 2ZC5B 3ZVWA 2Y2PA 4DRTA 3A3JA 4P85A 1SKFA 2XD1A 5HWVA 4UQIM 3BWLA 1I5QA 3DBAA 4HESA 1E3UA 3HLFA 1NLYA 1SDEA 3TW8A 1BYWA 2Z6CA 3OPPA 3EWKA 1MWUA 3MQ0A 3Q7ZA 1UGUA 4ZTKA 3KYZA 4X25A 3A3DA 3GVBA 1I2WA 4OLGA 4HQAA 4BBVA 5FEGA 1IYQA 1F5MA 3R4KA 3V5MA 3FWLA 3VOYA 1L3LA 3E4QA 3AGDA 4DF6A 4KZBA 5K5BA 5G18A 3PBSA 4BBUA 2XFSA 1PZOA 5KMWA 3IBRA 3JVVA 3NCKA 5F68A 1N9NA 4QD4A 3V39A 2Z2LB 1JTDA 4IVKA 2V0UA 2EA9A 2HP9A 5J7EA 3HUNA 1OJ5A 1DRMA 3T12B 5EVLA 4II7A 5EUAA 2JHEA 4PAUA 3ZNYA 2Y2QA 4ME4A 4R3BA 1KGGA 4HY8A 1MPLA 2VA0A 5EVIB 3PBRA 1F2KA 4KQOA 4R6LA 3W4QA 2Y2JA 2HZ5A 4X1MA 2JCHA 3EQVA 4KZ5A 4EBNA 4S2MA 4NKPA 2O9AA 3CMZA 1XPBA 3C7VA 3FV7A 2ZM2A 2J9OA 3LO7A 3G32A 1K57C 4OPYA 5FASA 2J8YA 1X0OA 4H6JA 4P6ZM 2PD7A 2V8FA 2E8JA 5FQMA 3NDGA 3LY3A 3MJQA 3NECA 3N8RA 4R0QA 1WYCA 4KG2A 5GHYA 3BFEA 5AQ7A 4DKIA 1ZG4A 1YSPA 2Q0OA 4ZAMA 1ES3A 1D7EA 5FDHA 3M6BA 1XA7A 4IBRA 3MKEA 2CMNA 3O5YA 4GS9A 4OPZA 2Y2NA 3IXGA 5E2EA 4JGQA 1XA1A 5HD3A 2ACGA 1TS6A 3KX0X 4RX3A 1K6SA 1H8ZA 3IF6A 1H3QA 1EROA 2EX6A 3UE1A 4ZJ3A 2HF6A 1J9MA 2VJWA 1XGJA 5A92A 1ZHHB 2W0NA 3UDXA 4QJGA 2ZL1B 1S66L 2NUPC 1MC0A 5FQJA 4GNUA 3LIBA 4KQDA 2OOLA 3BFGA 2ZQCA 2RL3A 3T4TA 1YMXA 4WMCA 4JBFA 4HNBA 4DN0A 4N1HA 2HDRA 2UWXA 5CHMA 2QJ7A 2G2WA 3GR2A 4D60A 4QY6A 2XQZA 1YPRA 2ZQ9A 2PAVP 4LCMA 3KSFA 2LB9A 2XGNA 4WL9A 2JKGA 1BLCA 4FTXA 5HL1A 5BOHA 3P09A 3BECA 1VQQA 2C5WB 3IS2B 3A3FA 5M19A 3G6OA 3SOIA 4CLCA 1W8YA 4O01A 2PYRA 2GJ3A 4C75A 3DW0A 5JYPA 1KDWA 4XXRA 4ZDXA 4ESPA 3TJZC 1ZG6A 1P9WA 3ZYTA 4OQ0A 4RYEA 3LR4A 3Q7VA 4FH4A 3UMDA 4S2IA 4EQ1A 3KSHA 2ZM8A 4Z9QA 1XJ3A 3PBNA 1O07A 4RA7A 3RXWA 3F1PB 3NY4A 5CGXA 4HOIA 4S2JA 1TS7A 5HFOA 4LLOB 3AGEA 3UB5P 2W3EA 4KQRA 2A3UA 3IX4A 3IX8A 3N8SA 4U0XA 3ZFZA 1JNUA 1CEGA 1NYMA 1IEMA 3HUOA 2B5RA 4UA9A 1IFQA 1PRQA 4HIAA 3ZG0A 2GNXA 4LGWA 5HD5A 5HPFA 3BLMA 2D02A 3HREA 1M6KA 4X56A 1VHMA 4HP4A 3VFHA 2O9BA 4HJ4A 4BJPA 2A2LA 3P7NA 2X01A 1Y4OA 1LI9A 3GMWA 2P9VA 1PYYA 3TE8A 1C3BA 1CEFA 3D72A 4Q0JA 4EBLA 4EUZA 3F1OB 2Q9MA 1ESIA 3VE4A 3A0RA 1CI8A 4R1GA 3U2AA 4OP5A 5CGSA 1OT9A 3MR0A 3CUEC 1LSXA 4HI4A 2A49A 5L8MA 4F3LB 3C2WA 1SCWA 4Y5FA 1TDGA 3BYDA 2GZAA 3LIDA 1OTBA 1XP4A 3W4PA 4WUJA 2BASA 4EESA 4KUOA 1S1ZA 3FKWA 1GHPA 1YT4A 4AFIA 2R9WA 2VKSA 3HUMA 3DTIA 1DP8A 4YNRA 2ZQAA 1RGZA 2VV6A 3H7WB 1W79A 3FYZA 3O87A 2HP5A 4OLDA 1EWZA 5EOEA 5KSHA 1FSYA 3OLOA 4BMWA 1CQAA 2PYPA 2PBYA 3HJIA 3E4PA 1MKIA 4X55A 1LI0A 1K57A 3VP4A 1PIOA 4MN5A 1WA9A 4OVDA 1V9YA 1GCEA 3QNBA 5AJGA 4S2PA 2PU4A 3H82B 2EX9A 3DWKA 1W8QA 5TBMA 1XJ2A 4X53A 4ZJ2A 2KLIA 5EOOA 1S1YA 5F5YA 1OMEA 2O9CA 3PAGA 1F98A 2D01A 3UDFA 1IOUA 2H0TA 3FZCA 5L09A 5HAIA 1JWPA 2DCFA 4RQ9A 4LCLA 3D9YA 4L0LA 5EECA 5FI7A 5KZHA 1KGFA 4G3KA 3PAEA 1PFLA 3HLDA 1VEUB 1VETB 1YKDA 5F69A 2QMIA 4LENA 3ZDJA 4WEKA 3ZG5A 1NYYA 1LHYA 2QJ5A 3JYIA 4K0WA 1TEMA 5E43A 3EOIA 4R23A 5EE8A 4S2LA 4R3AA 2BG1A 2Y2IA 2ZQ8A 1L0FA 5IU1A 2ZMAA 1T1CA 1KGEA 4L9EA 3BJNA 3BQ8A 3LCEA 2EXAA 3MQQA 4PKYA 4EEUA 2WKEA 4I3JA 4NG2A 5HDCA 1MKMA 1F9IA 4DXCA 5HSQA 2UV0E 3SW1A 1PWGA 2QYBA 2W1RA 2VK3A 4OP8A 3T4LA 5HWWA 1N9BA 4JLFA 3JPUA 4X1LA 4L9GA 1OPXA 4L9FA 3EGXC 3EGDC 4GJ4A 2KX6A 1PI5A 3B47A 2H5SA 1ZC2A 2QZ6A 3TG9A 3NC8A 2XRNA 1T19A 3GECA 2J3TD 3HLEA 3LFVA 1GHIA 1KE4A 4WMCD 3T4QA 2YKFA 4E3MA 2HDUA 1K4EA 4NXFA 3EEHA 1N9OA 1K25A 4CLCE 4KZAA 3NDEA 3MS6A 4DE0A 3HLGA 4G3VA 2PR5A 3C38A 1EW0A 3QNCA 5M18A 5HDSA 1ES4A 4ID4A 3R7WB 5JYOA 4XUXA 4I39A 4Z1WA 3BQAA 2VEAA 3BFCA 5HW3A 2PBDP 1K54C 1SKOB 4CLCD 2VGJA 2W3FA 1DP6A 4S2OA 5FL3A 3WWXA 4EUVA 4BBTA 2XEPA 2OSUA 3MF0A 3MXSA 4UHUA 2M1CA 2W3GA 1G6AA 2LB5A 2J9PA 3NOPC 3OC2A 4IUKA 3ICYA 3TSGA 5AQ9A 2QPNA 3CPTB 2K31A 5FQ9A 2Q9NA 4IVIA 2QWSA 1YLWA 5G4ZA 2DMWA 3GTCA 4PKYG 1IELA 3UB6A 5FQKA 5KSCA 1H0MA 2E8IA 5AQAA 1UWNX 3NOTC 3WS5A 4QHCA 2ZC7A 1XFQA 2H0YA 4HBTA 1MXOA 5GL9A 4KQQA 2A24A 2ZL1A 4YWZA 5GHXA 3LY4A 1L0GA 2FFYA 4KUKA 3CZDA 3EEAA 1NZUA 2OAQ1 1D06A 1I2SA 5EM0A 4MDZA 1FOFA 1NXYA 3IWOA 3K3DA 3CUEA 3W2ZA 1WYBA 4MBHA 4QB8A 4WM9A 2HDSA 3BW6A 2VZWA 3F1NA 2B18A 4P6BA 4NEED 5HL6A 2K2NA 1S4SA 2ZM0A 4PM5A 1JVJA 5FSRA 2XH9A 3PHYA 4B4ZA 5A8BA 3LR5A 2JBFA 3MMHA 1DJBA 4OOMA 3LEZA 3G34A 2O0YA 1ODVA 2QHKA 2P7JA 3IS2A 3U4LP 1YM1A 3O3VA 3RH8B 2HPBA 2ZMVA 2XA7S 3P98A 4E6XA 4FUWA 4HH2A 4PM6A 2W3DA 1OTAA 5DFYA 3GRJA 4Q0IA 1ES5A 3C8CA 4LV0A 2OWHA 1YLTA 4JGRA 5DJTA 5CERA 3Q07A 3BRMA 1G28A 2X02A 2Y2MA 3W8KA 5FAOA 3SH9A 1ESUA 3T1RA 1NY0A 5CHUA 3DTEA 3LIAA 2P74A 3IXDA 1NZOA 2Y8HA 1K55C 4LPZA 3UE3A 3UE6A 3T4KA 3LICA 3MQOA 1E25A 3UPPA 3EQUA 4A5RA 1YQSA 4KENB 1QMEA 3ZGAB 3NBLA 2M7UA 2VGKA 5KIZA 4MLLA 2FZ0A 1N9LA 4Y17A 2I72A 2Y2OA 3D4FA 2Y2HA 5CX7A 3NULA 4X69A 2ZD8A 3ITBA 3NJAA 1KE0A 3M2JA 3PYPA 3S4XA 1DJAA 3LI8A 2INWA 1FSWA 1FCOA 1S6RA 4I38A 3UDIA 1P97A 2Y79A 5HAPA 2QKPA 3C4PA 1ZTUA 5EFWA 1Q2QA 1MZUA 4GS9B 3S7PA 4MNRA 1ACFA 5FAQA 4O7DA 5EVIC 5GLAA 1OTIA 3HLBA 5TR7A 1U60A 3MKFA 3T4SA 4GHIA 2B95A 3IF6B 3G2ZA 3F1OA 2WGIA 2WGVA 3SH7A 3A3EA 1HTZA 2VLGA 4R4SA 5FQQA 2V2FF 3T4OA 3IWQA 4N9KA 4CQHA 1TS8A 3T1XA 4XT2B 2Y2GA 3VV4A 4HHDA 3HLCA 3G35A 5DJUA 4ZRRA 4KZ9A 2PRFA 3ITAA 3DTMA 2KOIA 1FIKA 3DWZA 3PR6A 1GA9A 4YINA 1YMSA 5FA7A 1S67L 3NIAA 2WGWA 5FQIA 1KOUA 2VV7A 2HDQA 4M3KA 4GDBA 2Y91A 1FCNA 1M40A 2Z2MB 4FOFA 4GCZA 2JKTI 2CC1A 1TF1A 4Y7PA 5IHVA 1XJ4A 1T18A 2VV8A 2JC7A 2WZXA 4GD6A 5CHJA 2X71A 4Y0OA 4B88A 3V50A 4G3WA 3KSIA 4MMNA 1FR1A 2V9AA 4ETZA 3ZVTA 5F1FA 2R9XA 3G4PA 3JVUA 1K54A 2JKRI 2EWWA 3CITA 5FDSA 3C4OA 4DDSA 4FH2A 4QWOA 2Y59A 4NK3A 3QP4A 4ARZA 2L4RA 4U0TA 3VSLA 2YKHA 4CJNA 1JWVA 3ZG7B 1Y28A 2XA7M 1TD5A 2J80A 1P0ZA 4GKUA 1WE4A 3IX3A 3Q7VB 4LRYC 4UA7A 3QHYA 4PM8A 5C5KA 4JXGA 1E3UD 3O88A 1ERQA 1Y54A 5CGWA 1NRJA 3UE0A 4B93A 3KO6A 1EI5A 4DMZA 3N8LA 3V3SA 2ZC4B 5I94A 3WS2A 2PD8A 2PR6A 3LUQA 4E3OA 1XFNA 4GOGA 2GX5A 1ERMA 2PDRA 5CTMA 4Q8IA 1VEUA 3HL9A 3MZFA 4BD0A 3E98A 4ZJ1A 2KDKA 3KSGA 4GZBA 3W4OA 1STZA 2Y2LA 1DJCA 1OT6A 5G4YA 1Q2PA 4FSFA 4Y13A 1K6RA 4Y0UA 4HJ3A 3L9KA 3G31A 1PZPA 3A0VA 3M6HA 2WKHA 3SS5A 2P9VB 4Q0HA 4E6WA 1S0WA 3UB7A 1A0KA 1BULA 4OPQA 5HX9A 4IBXA 2XLNA 4GD8A 4N92A 1IKIA 1YLZA 3RJUA 4LRXC 4WN5A 2JE5A 2XF3A 2V1AA 4BL3A 2W3HA 3KYEA 4BENA
chains in the Genus database with same CATH topology
4EEPA 2VEAA 1DP9A 2VJWA 2IA2A 4CLCD 4B9OA 1ZHHB 2W3FA 2W0NA 4JGOA 1DP6A 4EUVA 5FL3A 4BBTA 3MF0A 2Z6DA 2MJ6A 1S66L 3B42A 2M1CA 5AVFA 3BY9A 2W3GA 3MXQA 1MC0A 2NUPC 2XROA 2LB5A 3LIBA 3NOPC 4CLCB 4KQDA 5DKKA 3OC2A 2VGLS 2OOLA 4IUKA 3ICYA 3E0YA 3H82A 3PBOA 2ZOIA 3T4TA 2K31A 3HJKA 2WKRA 1XJ6A 4HNBA 4DN0A 3NOUC 2QWSA 3LIFA 3CAXA 3H9WA 5G4ZA 3KYQA 2DMWA 4PKYG 3UB6A 2QJ7A 4M4XA 1W63M 4GHIB 1OTDA 1UWNX 3NOTC 3R7WA 5AVEA 3CI6A 3RFBA 1XFQA 1YAXA 3KSFA 3PXPA 2LB9A 4WL9A 5HDDA 2O99A 4UQIS 2A24A 3FG8A 4YWZA 4OOLA 1GSVA 1GSXA 4IUHA 4WF0A 3IS2B 4KUKA 3EEAA 1LSVA 3G6OA 4CLCA 2OAQ1 1D06A 4MCWA 4O01A 2PYRA 2GJ3A 2XSSA 4MDZA 3K3DA 3CUEA 3W2ZA 2HF6A 3UB8A 3TJZC 1P9WA 3ZYTA 3BW6A 4JGPA 3FC7A 2VZWA 3F1NA 3LR4A 2B18A 3UMDA 3B33A 3S7OA 4NEED 5TJJA 5IT5A 2FH5A 4EQ1A 5HL6A 2K2NA 3S7NA 3KSHA 1S4SA 2JKTM 3PHYA 1XJ3A 1GSWA 3PBNA 1T1BA 5A8BA 3IBJA 3LR5A 3F1PB 3MMHA 4OOMA 4HOIA 1VB6A 4NXGA 1TS7A 4LLOB 2O0YA 1ODVA 4I5SA 2QHKA 2W3EA 2P7JA 3IS2A 2JKRM 3RH8B 2ZMVA 2XA7S 2PHYA 4BWIA 1JNUA 2OAP1 4HH2A 4HP9A 2V0WA 2W3DA 1OTAA 5DFYA 4Q0IA 3C8CA 3PBTA 3D3OA 3GDIA 2OWJA 1IFQA 4ARZB 2K7SA 2OWHA 4HIAA 3OCLA 5DKLA 5DF9A 4I3AA 4JGRA 3TRCA 2GNXA 5DJTA 5HD5A 1OTEA 2J3TC 2VX8A 5HPFA 1G28A 2D02A 4R38A 3ULFA 1V9ZA 1VHMA 1NLZA 3LIAA 1H8MA 4HP4A 2O9BA 4HJ4A 4BJPA 5MC7A 2Y8HA 2A2LA 4LPZA 3P7NA 3UE3A 2H28A 3UE6A 3T4KA 3LICA 3OCNA 5I5LA 2HGVA 1W63Q 4YOFA 3TE8A 3RTYA 3MQOA 3EQUA 2ZMFA 4P6ZS 2M7UA 2M7VA 5KIZA 3S7QA 3D72A 2FZ0A 2W1TB 4Y2FA 1N9LA 4GLQA 4Q0JA 5CX7A 3F1OB 3FPWA 3VE4A 1OJGA 3A0RA 3P01A 4IHQA 3NJAA 3OBFA 2HJ9C 4R70A 4CLCC 1NWZA 4MN6A 4WEJA 3U2AA 3PYPA 3LIEA 3LI8A 4O8GA 3A0SA 2INWA 3VOLA 1OT9A 3MR0A 3CUEC 4UEYA 3OOVA 4HJ6A 1LSXA 3E4OA 3VE3A 4HI4A 5L8MA 4I38A 4F3LB 3C2WA 4EETB 3HCYA 2G7UA 1P97A 4Y5FA 2Y79A 5IS1A 2QKPA 1S4RA 1ZTUA 2GZAA 5EFWA 3LIDA 1MZUA 1OTBA 1TS0A 4GS9B 4WUJA 3S7PA 2BASA 4EESA 2B02A 4KUOA 3ZQ5A 4LRZE 4MN7A 1S1ZA 1T1AA 2P04A 1LT0A 5TBMB 4WELA 4AFIA 3C30A 2NUTC 2VKSA 4GW9A 1OTIA 5HWTA 2W1TA 2VGLM 1DP8A 4YNRA 3T4SA 2VV6A 4GHIA 3H7WB 5DFXA 4EU0A 5J3WA 3CLOA 3F1OA 4PHTA 1YSQA 3MFXA 5KSHA 3OLOA 4BMWA 2R78A 2ZBBA 2VLGA 2PYPA 3HJIA 4QPRA 3E4PA 3T4OA 4DJ3A 4CQHA 2WKQA 1TS8A 4XT2B 5HPIA 4MN5A 3VV4A 1G6OA 1WA9A 1V9YA 3FPVA 4HHDA 5AJGA 5DJUA 4ZRRA 4DJ2A 4O0PA 3H82B 5HWVA 4I3IA 4UQIM 1UWPX 3BWLA 3DBAA 5TBMA 2KOIA 1NLYA 1XJ2A 3PR6A 4WLAA 1BYWA 2KLIA 3TW8A 4HH3A 2P08A 2Z6CA 1S67L 1S1YA 5J4EA 3EWKA 4EW7A 5F5YA 1KOUA 2VV7A 4NXBA 1LL8A 2O9CA 1F98A 3MQ0A 2D01A 1UGUA 2HJEA 1IOUA 4FOFA 4GCZA 2JKTI 1TF1A 3F1PA 3KYZA 3CWFA 4RQ9A 1XJ4A 1T18A 2VV8A 4L0LA 2A24B 4ETXA 4HQAA 4G3WA 4NXEA 3T4JA 3KSIA 4MMNA 3LR3A 4XT2A 4BBVA 1F5MA 3R4KA 2V9AA 4ETZA 3E4QA 3LI9A 3JVUA 4G3KA 5K5BA 2JKRI 2L1MA 3PBQA 3PBSA 2EWWA 3CITA 4BBUA 3V67A 1YKDA 5F69A 3IBRA 3JVVA 5F68A 1N9NA 4ARZA 4WEKA 2L4RA 2EA9A 2V0UA 2QJ5A 2YKHA 4H6JB 3EOIA 5J7EA 1Y28A 2XA7M 1TD5A 4R3AA 1OJ5A 5F6AA 1DRMA 1P9RA 2J80A 1P0ZA 3F1NB 4LRYC 4II7A 5IU1A 2JHEA 2EWVA 1T1CA 4PAUA 4L9EA 4ME4A 3BJNA 5C5KA 3UB9A 4E04A 4HY8A 2VA0A 3BQ8A 4EEUA 3MQQA 1NRJA 3K3CA 3PBRA 4KQOA 4PKYA 4R6LA 4I3JA 4B93A 3KO6A 5HDCA 3UMEA 3EQVA 1MKMA 1F9IA 4DMZA 4NKPA 3LR0A 5HSQA 2HV1A 2O9AA 2I9VA 3SW1A 2QYBA 2W1RA 2PD8A 2PR6A 3LUQA 3T4LA 1XFNA 5HWWA 1LSWA 2GX5A 2PDRA 2WKPA 4L9GA 3E98A 1OPXA 4L9FA 2PT7A 3EGXC 1X0OA 3EGDC 4H6JA 2KDKA 3KSGA 4P6ZM 2PD7A 3K2NA 4GJ4A 2KX6A 3T50A 3B47A 3LYXA 4EERA 3MJQA 5HZHA 1STZA 2XRNA 1T19A 3GECA 2J3TD 1OT6A 1YSPA 1D7EA 5G4YA 4FSFA 4F3LA 3LFVA 4HJ3A 2W27A 3T4QA 2YKFA 4K08A 4EXOA 2CMNA 3A0VA 3O5YA 4GS9A 4NXFA 3BY8A 4Y3IA 3EEHA 1N9OA 4Q0HA 2L0WA 3NHQA 4IJGA 4CLCE 3UB7A 4JGQA 5HD3A 2J3WA 4G3VA 2V1BA 1TS6A 2PR5A 3KX0X 3C38A 3H7WA 4LRXC 5LBRA 1EW0A 2ZOHA 4WN5A 1H3QA 5HDSA 3R7WB 2V1AA 4I39A 4Z1WA 3BQAA 2W3HA 2JN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EEP A;  2VEA A;  1DP9 A;  4B9O A;  2W0N A;  4JGO A;  1DP6 A;  4BBT A;  2Z6D A;  1S66 L;  2M1C A;  5AVF A;  3BY9 A;  3MXQ A;  3LIB A;  3NOP C;  4KQD A;  5DKK A;  2OOL A;  3ICY A;  3H82 A;  2ZOI A;  3HJK A;  2WKR A;  1XJ6 A;  4HNB A;  3NOU C;  2QWS A;  3LIF A;  3CAX A;  3H9W A;  5G4Z A;  4PKY G;  3UB6 A;  2QJ7 A;  4M4X A;  4GHI B;  1OTD A;  1UWN X;  3NOT C;  5AVE A;  1XFQ A;  4WL9 A;  5HDD A;  2A24 A;  3FG8 A;  4YWZ A;  1GSV A;  1GSX A;  4WF0 A;  3IS2 B;  4KUK A;  1LSV A;  3G6O A;  1D06 A;  2PYR A;  2GJ3 A;  3K3D A;  3UB8 A;  4JGP A;  3FC7 A;  3F1N A;  3UMD A;  3B33 A;  4EQ1 A;  1S4S A;  3PHY A;  1XJ3 A;  1GSW A;  1T1B A;  5A8B A;  3F1P B;  4HOI A;  1VB6 A;  4NXG A;  1TS7 A;  4LLO B;  1ODV A;  4I5S A;  2QHK A;  2P7J A;  3IS2 A;  3RH8 B;  2PHY A;  1JNU A;  4HH2 A;  4HP9 A;  2V0W A;  1OTA A;  3C8C A;  3GDI A;  2OWJ A;  2K7S A;  2OWH A;  4HIA A;  5DKL A;  4I3A A;  4JGR A;  5DJT A;  5HD5 A;  1OTE A;  1G28 A;  2D02 A;  4R38 A;  3ULF A;  1V9Z A;  3LIA A;  4HP4 A;  4HJ4 A;  4LPZ A;  3P7N A;  2H28 A;  3UE6 A;  3LIC A;  5I5L A;  3RTY A;  3MQO A;  5KIZ A;  3D72 A;  1N9L A;  3F1O B;  3VE4 A;  1OJG A;  3A0R A;  3NJA A;  4R70 A;  1NWZ A;  4MN6 A;  3PYP A;  3LIE A;  3LI8 A;  3A0S A;  2INW A;  3VOL A;  1OT9 A;  3MR0 A;  4HJ6 A;  1LSX A;  3E4O A;  3VE3 A;  4HI4 A;  4I38 A;  4F3L B;  3C2W A;  4EET B;  1P97 A;  5IS1 A;  2QKP A;  1S4R A;  5EFW A;  3LID A;  1MZU A;  1OTB A;  1TS0 A;  4GS9 B;  4WUJ A;  2BAS A;  4EES A;  4KUO A;  2B02 A;  3ZQ5 A;  4LRZ E;  1S1Z A;  1T1A A;  1LT0 A;  5TBM B;  4GW9 A;  1OTI A;  5HWT A;  1DP8 A;  2VV6 A;  4GHI A;  3H7W B;  5J3W A;  3CLO A;  3F1O A;  3MFX A;  3OLO A;  2R78 A;  2ZBB A;  2VLG A;  2PYP A;  3HJI A;  3E4P A;  4DJ3 A;  2WKQ A;  1TS8 A;  4XT2 B;  4MN5 A;  1WA9 A;  1V9Y A;  4HHD A;  5DJU A;  4DJ2 A;  3H82 B;  5HWV A;  4I3I A;  1UWP X;  3BWL A;  5TBM A;  1XJ2 A;  4WLA A;  1BYW A;  4HH3 A;  2Z6C A;  1S67 L;  1S1Y A;  5J4E A;  3EWK A;  4EW7 A;  5F5Y A;  1KOU A;  2VV7 A;  4NXB A;  1LL8 A;  1F98 A;  2D01 A;  1UGU A;  4GCZ A;  3F1P A;  3CWF A;  4RQ9 A;  1XJ4 A;  1T18 A;  2VV8 A;  2A24 B;  4HQA A;  4NXE A;  4BBV A;  4XT2 A;  2V9A A;  3E4Q A;  3LI9 A;  2L1M A;  4BBU A;  5F69 A;  3IBR A;  5F68 A;  1N9N A;  2L4R A;  2EA9 A;  2V0U A;  2QJ5 A;  2YKH A;  4H6J B;  5J7E A;  1Y28 A;  4R3A A;  5F6A A;  1OJ5 A;  1DRM A;  2J80 A;  1P0Z A;  3F1N B;  4LRY C;  5IU1 A;  2JHE A;  1T1C A;  4L9E A;  3UB9 A;  4E04 A;  4HY8 A;  4EEU A;  3MQQ A;  4PKY A;  3K3C A;  4R6L A;  4I3J A;  5HDC A;  3UME A;  1F9I A;  5HSQ A;  2HV1 A;  2I9V A;  3SW1 A;  2PD8 A;  2PR6 A;  3LUQ A;  1XFN A;  5HWW A;  1LSW A;  2PDR A;  2WKP A;  4L9G A;  4L9F A;  1X0O A;  4H6J A;  2KDK A;  2PD7 A;  3T50 A;  2KX6 A;  3LYX A;  4EER A;  3MJQ A;  5HZH A;  1T19 A;  3GEC A;  1OT6 A;  1D7E A;  5G4Y A;  4F3L A;  4HJ3 A;  2W27 A;  2YKF A;  4K08 A;  4EXO A;  2CMN A;  3A0V A;  4GS9 A;  4NXF A;  3BY8 A;  3EEH A;  1N9O A;  2L0W A;  3NHQ A;  3UB7 A;  4JGQ A;  5HD3 A;  2V1B A;  1TS6 A;  2PR5 A;  3KX0 X;  3H7W A;  4LRX C;  1EW0 A;  2ZOH A;  4WN5 A;  5HDS A;  2V1A A;  4I39 A;  2JN7 A; 
#chains in the Genus database with same CATH topology
 4EEP A;  4E3J A;  1L0E A;  2IA2 A;  3BLS A;  4B9O A;  5E2F A;  2Z6D A;  4KZ4 A;  5CXW A;  3BY9 A;  2XRO A;  3IHA A;  2VGL S;  3VMA A;  3BEB A;  3S1Y A;  3E0Y A;  3PBO A;  2ZOI A;  4BLM A;  2EFX A;  5A91 A;  4KZ7 A;  2WKR A;  1XJ6 A;  3PTE A;  5FAP A;  5CEB A;  3LIF A;  3T1Q B;  1K55 A;  4JKT A;  3KYQ A;  3VSK A;  4WZ5 C;  1W63 M;  3VP0 A;  4R3J A;  2XK1 A;  3R7W A;  3C7U A;  3HBR A;  3RFB A;  3WRZ A;  1AXB A;  1SKO A;  4Y0T A;  4R4R A;  2IWD A;  4JF5 A;  5FI2 A;  3FG8 A;  5CTN A;  1GSV A;  1GSX A;  4OQI A;  1LSV A;  4MEZ A;  1Z6F A;  4UA6 A;  2EX2 A;  3BM6 A;  3CPT A;  3UB8 A;  4K0X A;  3Q82 A;  3MZE A;  3IH9 A;  4JGP A;  3B33 A;  3S7O A;  5GHZ A;  5IT5 A;  5TGF A;  3S7N A;  3IWI A;  4DE2 A;  1YLP A;  2Y55 A;  1GSW A;  1ALQ A;  5EVI A;  1LL5 A;  1T1B A;  3IBJ A;  5EV0 A;  3M2K A;  4NXG A;  1BLH A;  2WAF A;  5U47 A;  2WUQ A;  4K91 A;  5L07 A;  1JTG A;  4BWI A;  4HP9 A;  2EX8 A;  3GDI A;  4P0M A;  3UPN A;  2OWJ A;  1IYO A;  2K7S A;  1E4D A;  5DKL A;  5DF9 A;  2RCX A;  1AWI A;  1MWT A;  2VX8 A;  2XFT A;  4KZ6 A;  3ULF A;  1JWZ A;  1XGI A;  4LV1 A;  1NLZ A;  3WS0 A;  5DF8 A;  1H8M A;  4JXS A;  4C3Q A;  1XX2 A;  3FKV A;  2ZC6 B;  1W63 Q;  4YOF A;  3ZG8 B;  3RTY A;  2WYX A;  1H8Y A;  2ZMF A;  2Y2K A;  3VOZ A;  2M7V A;  1LLB A;  1CI9 A;  3S7Q A;  3QP5 A;  2W1T B;  4Y2F A;  4GLQ A;  3N6I A;  4E3I A;  4S2N C;  3OZH A;  4MBK A;  3CG5 A;  3FPW A;  4GDN A;  1RGY A;  1K0K A;  3P01 A;  3OBF A;  2HJ9 C;  3A0S A;  1PW8 A;  3AGF A;  4U3T A;  3B3X A;  3OOV A;  2V1Z A;  4HJ6 A;  4YFM A;  3VE3 A;  5F82 A;  1K56 A;  4EET B;  2G7U A;  5IS1 A;  1S4R A;  1TS0 A;  2OV5 A;  2B02 A;  3ZG9 B;  3ZQ5 A;  3Q81 A;  2AVX A;  4LRZ E;  1T1A A;  3IXB A;  1LT0 A;  3C30 A;  3IXH A;  4MBF A;  5DTS A;  4GW9 A;  1FIL A;  5HWT A;  2VGL M;  1N4O A;  4OPR A;  4GN2 A;  2DNS A;  1XKZ A;  3CLO A;  4PHT A;  5HAR A;  5F83 A;  1GHM A;  1RCJ A;  4DE3 A;  2R78 A;  2PU2 A;  4KZ3 A;  4JXW A;  1BT5 A;  4QPR A;  1IYS A;  4LFU A;  2WKQ A;  3OPL A;  3HVF A;  3MSH A;  5HAQ A;  5EVE A;  5HPI A;  3FPV A;  2WK0 A;  4OON A;  4EQI A;  3E2K A;  2ZLY A;  1NRF A;  4DJ2 A;  4O0P A;  5A90 A;  3SH8 A;  4I3I A;  4WBG A;  1UWP X;  1KVL A;  4CPK A;  4N1X A;  2V20 A;  2G2U A;  3LGO A;  4WLA A;  4HH3 A;  2P08 A;  5J4E A;  4EW7 A;  3WS1 A;  4NXB A;  1LL8 A;  4D2O A;  2WAD A;  2HJE A;  3UNW A;  3F1P A;  3CWF A;  1KVM A;  1H5X A;  1PWD A;  3SS4 A;  4XUZ A;  2A24 B;  4OOY A;  4ETX A;  4NXE A;  3T4J A;  4XT2 A;  3LR3 A;  1CJF A;  4HEF A;  3TOI A;  2BLS A;  3LI9 A;  1MBL A;  4IED A;  1GA0 A;  2L1M A;  3PBQ A;  4ZBE A;  1HD8 A;  4OQG A;  5GLB A;  3V67 A;  2OLU A;  1KE3 A;  4H6J B;  4LV2 A;  5F6A A;  3IT9 A;  5CEC A;  1P9R A;  3L7H A;  3F1N B;  1KDS A;  3ZNT A;  1BTL A;  2EWV A;  2XDM A;  1BZA A;  3UB9 A;  4E04 A;  2H10 A;  3K3C A;  4JF4 A;  1FQG A;  1D1J A;  4WZ5 A;  2BTF P;  2ZQ7 A;  5TFQ A;  3UME A;  1K4F A;  3IQA A;  2EXB A;  4JF6 A;  1J3W A;  1CF0 A;  3ISG A;  1HLU P;  3LR0 A;  2HV1 A;  2I9V A;  4X6T A;  4H8R A;  4S2K A;  5D3O A;  1LSW A;  1TVF A;  2WKP A;  5DVA A;  4RVA A;  1BSG A;  3VP3 A;  2XR0 A;  1BLS A;  2PT7 A;  5DTT A;  3K2N A;  3T50 A;  4C6Y A;  1SZV A;  3SS3 A;  3LYX A;  4EER A;  5HZH A;  1YLY A;  5FEF A;  1ONG A;  3QP2 A;  4F3L A;  3I7J A;  1XXM A;  1NJ4 A;  2W27 A;  5EM1 A;  4K08 A;  4EXO A;  3MXR A;  2IWB A;  3BY8 A;  4Y3I A;  3ZCZ A;  2L0W A;  3NHQ A;  2ZJ9 A;  4IJG A;  3HLW A;  3NI9 A;  3UO9 A;  1PNE A;  4BQM A;  1VM1 A;  4E3N A;  2J3W A;  1HZO A;  3IH8 A;  2V1B A;  1BUE A;  2WZZ A;  3H7W A;  5LBR A;  3WRT A;  1G5U A;  5CED A;  2ZOH A;  3UN7 A;  4E3K A;  4NET A;  3RXX A;  2C6W B;  2JN7 A;  1FR6 A;  4PM9 A;  1DP9 A;  4JPM A;  4BL2 A;  4JGO A;  5M1A A;  2WKI A;  2V8C A;  3SZT A;  1IYP A;  2MJ6 A;  3B42 A;  4QY5 A;  5AVF A;  3MXQ A;  4JXV A;  4CLC B;  4BD1 A;  5DKK A;  2OLV A;  3H82 A;  5DTK A;  3HJK A;  4FD8 A;  3QP6 A;  3NOU C;  1Z09 A;  1W7F A;  3VP1 A;  3CAX A;  3H9W A;  5EVI D;  3LEQ A;  1SDN A;  3A3I A;  1SHV A;  4M4X A;  2WAE A;  3GSG A;  4GHI B;  1OTD A;  3DAV A;  1G68 A;  1CK3 A;  5A93 A;  2ZC3 B;  5AVE A;  3CI6 A;  4P87 A;  4WYY A;  1YAX A;  3MZD A;  4HBU A;  3PXP A;  4S2N A;  4F94 A;  5HDD A;  1K38 A;  2O99 A;  4UQI S;  4KG5 A;  4OOL A;  4IUH A;  4WF0 A;  3VP2 A;  3MFD A;  4OQH A;  4DXB A;  1L0D A;  4MCW A;  5GLC A;  2XSS A;  1VET A;  3MBZ A;  3S22 A;  3V3R A;  4B4X A;  3GV9 A;  3BFD A;  1ES2 A;  1PWC A;  1FCM A;  1DY6 A;  3FC7 A;  2J7V A;  2JKF A;  4LV3 A;  2WGW B;  5TJJ A;  2FH5 A;  4PPR A;  3QP1 A;  5FAT A;  2IWC A;  2JKT M;  1BLP A;  1VB6 A;  4N9L A;  3IF6 C;  1MY8 A;  4I5S A;  4KG6 A;  2ZQD A;  2JKR M;  3DTK A;  4DE1 A;  2PHY A;  4UAA A;  2DRW A;  2OAP 1;  2V0W A;  1YLJ A;  1MWR A;  3PBT A;  3D3O A;  4PMA A;  4EV4 A;  3N4I A;  3CHW P;  4ARZ B;  3BFF A;  3OCL A;  3Q1F A;  5EPH A;  4OKP A;  4I3A A;  1K56 D;  3TRC A;  4EWF A;  4QU3 A;  1OTE A;  2J3T C;  4R38 A;  1V9Z A;  5E2G A;  5MC7 A;  4PM7 A;  2H28 A;  3OCN A;  4WZ4 A;  5I5L A;  2HGV A;  3QP8 A;  4EBP A;  2GDN A;  4P6Z S;  3O86 A;  1ONH A;  1PW1 A;  5CRF A;  4E3L A;  1RP5 A;  3E2L A;  5L10 A;  4OH0 A;  5L2F A;  1QMF A;  2HP6 A;  3N7W A;  1OJG A;  4GB7 A;  2EFU A;  4IHQ A;  3G30 A;  4R70 A;  5GLD A;  4CLC C;  1NWZ A;  4MN6 A;  4WEJ A;  2XD5 A;  4X68 A;  1LL9 A;  3VFF A;  3T1S A;  3LIE A;  4O8G A;  3UY6 A;  3VOL A;  4UEY A;  1IKG A;  3WS4 A;  3E4O A;  1TDL A;  4DDY A;  3HCY A;  5AQB A;  3ZHH A;  3UPO A;  3CJM A;  1O7E A;  3GQZ A;  1HVB A;  4MN7 A;  1W5D A;  2P04 A;  5TBM B;  4WEL A;  2Y4A A;  3OPR A;  2NUT C;  3OPH A;  5FI6 A;  1MWS A;  4RX2 A;  3IF5 A;  2FFF B;  2W1T A;  5DFX A;  5DF7 A;  4EU0 A;  5J3W A;  3G2Y A;  1YSQ A;  3MFX A;  5F1G A;  4FCF A;  3IHB A;  2ZBB A;  5E2H A;  5J8X A;  1L2S A;  1ZKJ A;  4Y15 A;  4DJ3 A;  3C5A A;  4KZ8 A;  1PI4 A;  1G6O A;  2ZC5 B;  3ZVW A;  2Y2P A;  4DRT A;  3A3J A;  4P85 A;  1SKF A;  2XD1 A;  5HWV A;  4UQI M;  3BWL A;  1I5Q A;  3DBA A;  4HES A;  1E3U A;  3HLF A;  1NLY A;  1SDE A;  3TW8 A;  1BYW A;  2Z6C A;  3OPP A;  3EWK A;  1MWU A;  3MQ0 A;  3Q7Z A;  1UGU A;  4ZTK A;  3KYZ A;  4X25 A;  3A3D A;  3GVB A;  1I2W A;  4OLG A;  4HQA A;  4BBV A;  5FEG A;  1IYQ A;  1F5M A;  3R4K A;  3V5M A;  3FWL A;  3VOY A;  1L3L A;  3E4Q A;  3AGD A;  4DF6 A;  4KZB A;  5K5B A;  5G18 A;  3PBS A;  4BBU A;  2XFS A;  1PZO A;  5KMW A;  3IBR A;  3JVV A;  3NCK A;  5F68 A;  1N9N A;  4QD4 A;  3V39 A;  2Z2L B;  1JTD A;  4IVK A;  2V0U A;  2EA9 A;  2HP9 A;  5J7E A;  3HUN A;  1OJ5 A;  1DRM A;  3T12 B;  5EVL A;  4II7 A;  5EUA A;  2JHE A;  4PAU A;  3ZNY A;  2Y2Q A;  4ME4 A;  4R3B A;  1KGG A;  4HY8 A;  1MPL A;  2VA0 A;  5EVI B;  3PBR A;  1F2K A;  4KQO A;  4R6L A;  3W4Q A;  2Y2J A;  2HZ5 A;  4X1M A;  2JCH A;  3EQV A;  4KZ5 A;  4EBN A;  4S2M A;  4NKP A;  2O9A A;  3CMZ A;  1XPB A;  3C7V A;  3FV7 A;  2ZM2 A;  2J9O A;  3LO7 A;  3G32 A;  1K57 C;  4OPY A;  5FAS A;  2J8Y A;  1X0O A;  4H6J A;  4P6Z M;  2PD7 A;  2V8F A;  2E8J A;  5FQM A;  3NDG A;  3LY3 A;  3MJQ A;  3NEC A;  3N8R A;  4R0Q A;  1WYC A;  4KG2 A;  5GHY A;  3BFE A;  5AQ7 A;  4DKI A;  1ZG4 A;  1YSP A;  2Q0O A;  4ZAM A;  1ES3 A;  1D7E A;  5FDH A;  3M6B A;  1XA7 A;  4IBR A;  3MKE A;  2CMN A;  3O5Y A;  4GS9 A;  4OPZ A;  2Y2N A;  3IXG A;  5E2E A;  4JGQ A;  1XA1 A;  5HD3 A;  2ACG A;  1TS6 A;  3KX0 X;  4RX3 A;  1K6S A;  1H8Z A;  3IF6 A;  1H3Q A;  1ERO A;  2EX6 A;  3UE1 A;  4ZJ3 A;  2HF6 A;  1J9M A;  2VJW A;  1XGJ A;  5A92 A;  1ZHH B;  2W0N A;  3UDX A;  4QJG A;  2ZL1 B;  1S66 L;  2NUP C;  1MC0 A;  5FQJ A;  4GNU A;  3LIB A;  4KQD A;  2OOL A;  3BFG A;  2ZQC A;  2RL3 A;  3T4T A;  1YMX A;  4WMC A;  4JBF A;  4HNB A;  4DN0 A;  4N1H A;  2HDR A;  2UWX A;  5CHM A;  2QJ7 A;  2G2W A;  3GR2 A;  4D60 A;  4QY6 A;  2XQZ A;  1YPR A;  2ZQ9 A;  2PAV P;  4LCM A;  3KSF A;  2LB9 A;  2XGN A;  4WL9 A;  2JKG A;  1BLC A;  4FTX A;  5HL1 A;  5BOH A;  3P09 A;  3BEC A;  1VQQ A;  2C5W B;  3IS2 B;  3A3F A;  5M19 A;  3G6O A;  3SOI A;  4CLC A;  1W8Y A;  4O01 A;  2PYR A;  2GJ3 A;  4C75 A;  3DW0 A;  5JYP A;  1KDW A;  4XXR A;  4ZDX A;  4ESP A;  3TJZ C;  1ZG6 A;  1P9W A;  3ZYT A;  4OQ0 A;  4RYE A;  3LR4 A;  3Q7V A;  4FH4 A;  3UMD A;  4S2I A;  4EQ1 A;  3KSH A;  2ZM8 A;  4Z9Q A;  1XJ3 A;  3PBN A;  1O07 A;  4RA7 A;  3RXW A;  3F1P B;  3NY4 A;  5CGX A;  4HOI A;  4S2J A;  1TS7 A;  5HFO A;  4LLO B;  3AGE A;  3UB5 P;  2W3E A;  4KQR A;  2A3U A;  3IX4 A;  3IX8 A;  3N8S A;  4U0X A;  3ZFZ A;  1JNU A;  1CEG A;  1NYM A;  1IEM A;  3HUO A;  2B5R A;  4UA9 A;  1IFQ A;  1PRQ A;  4HIA A;  3ZG0 A;  2GNX A;  4LGW A;  5HD5 A;  5HPF A;  3BLM A;  2D02 A;  3HRE A;  1M6K A;  4X56 A;  1VHM A;  4HP4 A;  3VFH A;  2O9B A;  4HJ4 A;  4BJP A;  2A2L A;  3P7N A;  2X01 A;  1Y4O A;  1LI9 A;  3GMW A;  2P9V A;  1PYY A;  3TE8 A;  1C3B A;  1CEF A;  3D72 A;  4Q0J A;  4EBL A;  4EUZ A;  3F1O B;  2Q9M A;  1ESI A;  3VE4 A;  3A0R A;  1CI8 A;  4R1G A;  3U2A A;  4OP5 A;  5CGS A;  1OT9 A;  3MR0 A;  3CUE C;  1LSX A;  4HI4 A;  2A49 A;  5L8M A;  4F3L B;  3C2W A;  1SCW A;  4Y5F A;  1TDG A;  3BYD A;  2GZA A;  3LID A;  1OTB A;  1XP4 A;  3W4P A;  4WUJ A;  2BAS A;  4EES A;  4KUO A;  1S1Z A;  3FKW A;  1GHP A;  1YT4 A;  4AFI A;  2R9W A;  2VKS A;  3HUM A;  3DTI A;  1DP8 A;  4YNR A;  2ZQA A;  1RGZ A;  2VV6 A;  3H7W B;  1W79 A;  3FYZ A;  3O87 A;  2HP5 A;  4OLD A;  1EWZ A;  5EOE A;  5KSH A;  1FSY A;  3OLO A;  4BMW A;  1CQA A;  2PYP A;  2PBY A;  3HJI A;  3E4P A;  1MKI A;  4X55 A;  1LI0 A;  1K57 A;  3VP4 A;  1PIO A;  4MN5 A;  1WA9 A;  4OVD A;  1V9Y A;  1GCE A;  3QNB A;  5AJG A;  4S2P A;  2PU4 A;  3H82 B;  2EX9 A;  3DWK A;  1W8Q A;  5TBM A;  1XJ2 A;  4X53 A;  4ZJ2 A;  2KLI A;  5EOO A;  1S1Y A;  5F5Y A;  1OME A;  2O9C A;  3PAG A;  1F98 A;  2D01 A;  3UDF A;  1IOU A;  2H0T A;  3FZC A;  5L09 A;  5HAI A;  1JWP A;  2DCF A;  4RQ9 A;  4LCL A;  3D9Y A;  4L0L A;  5EEC A;  5FI7 A;  5KZH A;  1KGF A;  4G3K A;  3PAE A;  1PFL A;  3HLD A;  1VEU B;  1VET B;  1YKD A;  5F69 A;  2QMI A;  4LEN A;  3ZDJ A;  4WEK A;  3ZG5 A;  1NYY A;  1LHY A;  2QJ5 A;  3JYI A;  4K0W A;  1TEM A;  5E43 A;  3EOI A;  4R23 A;  5EE8 A;  4S2L A;  4R3A A;  2BG1 A;  2Y2I A;  2ZQ8 A;  1L0F A;  5IU1 A;  2ZMA A;  1T1C A;  1KGE A;  4L9E A;  3BJN A;  3BQ8 A;  3LCE A;  2EXA A;  3MQQ A;  4PKY A;  4EEU A;  2WKE A;  4I3J A;  4NG2 A;  5HDC A;  1MKM A;  1F9I A;  4DXC A;  5HSQ A;  2UV0 E;  3SW1 A;  1PWG A;  2QYB A;  2W1R A;  2VK3 A;  4OP8 A;  3T4L A;  5HWW A;  1N9B A;  4JLF A;  3JPU A;  4X1L A;  4L9G A;  1OPX A;  4L9F A;  3EGX C;  3EGD C;  4GJ4 A;  2KX6 A;  1PI5 A;  3B47 A;  2H5S A;  1ZC2 A;  2QZ6 A;  3TG9 A;  3NC8 A;  2XRN A;  1T19 A;  3GEC A;  2J3T D;  3HLE A;  3LFV A;  1GHI A;  1KE4 A;  4WMC D;  3T4Q A;  2YKF A;  4E3M A;  2HDU A;  1K4E A;  4NXF A;  3EEH A;  1N9O A;  1K25 A;  4CLC E;  4KZA A;  3NDE A;  3MS6 A;  4DE0 A;  3HLG A;  4G3V A;  2PR5 A;  3C38 A;  1EW0 A;  3QNC A;  5M18 A;  5HDS A;  1ES4 A;  4ID4 A;  3R7W B;  5JYO A;  4XUX A;  4I39 A;  4Z1W A;  3BQA A;  2VEA A;  3BFC A;  5HW3 A;  2PBD P;  1K54 C;  1SKO B;  4CLC D;  2VGJ A;  2W3F A;  1DP6 A;  4S2O A;  5FL3 A;  3WWX A;  4EUV A;  4BBT A;  2XEP A;  2OSU A;  3MF0 A;  3MXS A;  4UHU A;  2M1C A;  2W3G A;  1G6A A;  2LB5 A;  2J9P A;  3NOP C;  3OC2 A;  4IUK A;  3ICY A;  3TSG A;  5AQ9 A;  2QPN A;  3CPT B;  2K31 A;  5FQ9 A;  2Q9N A;  4IVI A;  2QWS A;  1YLW A;  5G4Z A;  2DMW A;  3GTC A;  4PKY G;  1IEL A;  3UB6 A;  5FQK A;  5KSC A;  1H0M A;  2E8I A;  5AQA A;  1UWN X;  3NOT C;  3WS5 A;  4QHC A;  2ZC7 A;  1XFQ A;  2H0Y A;  4HBT A;  1MXO A;  5GL9 A;  4KQQ A;  2A24 A;  2ZL1 A;  4YWZ A;  5GHX A;  3LY4 A;  1L0G A;  2FFY A;  4KUK A;  3CZD A;  3EEA A;  1NZU A;  2OAQ 1;  1D06 A;  1I2S A;  5EM0 A;  4MDZ A;  1FOF A;  1NXY A;  3IWO A;  3K3D A;  3CUE A;  3W2Z A;  1WYB A;  4MBH A;  4QB8 A;  4WM9 A;  2HDS A;  3BW6 A;  2VZW A;  3F1N A;  2B18 A;  4P6B A;  4NEE D;  5HL6 A;  2K2N A;  1S4S A;  2ZM0 A;  4PM5 A;  1JVJ A;  5FSR A;  2XH9 A;  3PHY A;  4B4Z A;  5A8B A;  3LR5 A;  2JBF A;  3MMH A;  1DJB A;  4OOM A;  3LEZ A;  3G34 A;  2O0Y A;  1ODV A;  2QHK A;  2P7J A;  3IS2 A;  3U4L P;  1YM1 A;  3O3V A;  3RH8 B;  2HPB A;  2ZMV A;  2XA7 S;  3P98 A;  4E6X A;  4FUW A;  4HH2 A;  4PM6 A;  2W3D A;  1OTA A;  5DFY A;  3GRJ A;  4Q0I A;  1ES5 A;  3C8C A;  4LV0 A;  2OWH A;  1YLT A;  4JGR A;  5DJT A;  5CER A;  3Q07 A;  3BRM A;  1G28 A;  2X02 A;  2Y2M A;  3W8K A;  5FAO A;  3SH9 A;  1ESU A;  3T1R A;  1NY0 A;  5CHU A;  3DTE A;  3LIA A;  2P74 A;  3IXD A;  1NZO A;  2Y8H A;  1K55 C;  4LPZ A;  3UE3 A;  3UE6 A;  3T4K A;  3LIC A;  3MQO A;  1E25 A;  3UPP A;  3EQU A;  4A5R A;  1YQS A;  4KEN B;  1QME A;  3ZGA B;  3NBL A;  2M7U A;  2VGK A;  5KIZ A;  4MLL A;  2FZ0 A;  1N9L A;  4Y17 A;  2I72 A;  2Y2O A;  3D4F A;  2Y2H A;  5CX7 A;  3NUL A;  4X69 A;  2ZD8 A;  3ITB A;  3NJA A;  1KE0 A;  3M2J A;  3PYP A;  3S4X A;  1DJA A;  3LI8 A;  2INW A;  1FSW A;  1FCO A;  1S6R A;  4I38 A;  3UDI A;  1P97 A;  2Y79 A;  5HAP A;  2QKP A;  3C4P A;  1ZTU A;  5EFW A;  1Q2Q A;  1MZU A;  4GS9 B;  3S7P A;  4MNR A;  1ACF A;  5FAQ A;  4O7D A;  5EVI C;  5GLA A;  1OTI A;  3HLB A;  5TR7 A;  1U60 A;  3MKF A;  3T4S A;  4GHI A;  2B95 A;  3IF6 B;  3G2Z A;  3F1O A;  2WGI A;  2WGV A;  3SH7 A;  3A3E A;  1HTZ A;  2VLG A;  4R4S A;  5FQQ A;  2V2F F;  3T4O A;  3IWQ A;  4N9K A;  4CQH A;  1TS8 A;  3T1X A;  4XT2 B;  2Y2G A;  3VV4 A;  4HHD A;  3HLC A;  3G35 A;  5DJU A;  4ZRR A;  4KZ9 A;  2PRF A;  3ITA A;  3DTM A;  2KOI A;  1FIK A;  3DWZ A;  3PR6 A;  1GA9 A;  4YIN A;  1YMS A;  5FA7 A;  1S67 L;  3NIA A;  2WGW A;  5FQI A;  1KOU A;  2VV7 A;  2HDQ A;  4M3K A;  4GDB A;  2Y91 A;  1FCN A;  1M40 A;  2Z2M B;  4FOF A;  4GCZ A;  2JKT I;  2CC1 A;  1TF1 A;  4Y7P A;  5IHV A;  1XJ4 A;  1T18 A;  2VV8 A;  2JC7 A;  2WZX A;  4GD6 A;  5CHJ A;  2X71 A;  4Y0O A;  4B88 A;  3V50 A;  4G3W A;  3KSI A;  4MMN A;  1FR1 A;  2V9A A;  4ETZ A;  3ZVT A;  5F1F A;  2R9X A;  3G4P A;  3JVU A;  1K54 A;  2JKR I;  2EWW A;  3CIT A;  5FDS A;  3C4O A;  4DDS A;  4FH2 A;  4QWO A;  2Y59 A;  4NK3 A;  3QP4 A;  4ARZ A;  2L4R A;  4U0T A;  3VSL A;  2YKH A;  4CJN A;  1JWV A;  3ZG7 B;  1Y28 A;  2XA7 M;  1TD5 A;  2J80 A;  1P0Z A;  4GKU A;  1WE4 A;  3IX3 A;  3Q7V B;  4LRY C;  4UA7 A;  3QHY A;  4PM8 A;  5C5K A;  4JXG A;  1E3U D;  3O88 A;  1ERQ A;  1Y54 A;  5CGW A;  1NRJ A;  3UE0 A;  4B93 A;  3KO6 A;  1EI5 A;  4DMZ A;  3N8L A;  3V3S A;  2ZC4 B;  5I94 A;  3WS2 A;  2PD8 A;  2PR6 A;  3LUQ A;  4E3O A;  1XFN A;  4GOG A;  2GX5 A;  1ERM A;  2PDR A;  5CTM A;  4Q8I A;  1VEU A;  3HL9 A;  3MZF A;  4BD0 A;  3E98 A;  4ZJ1 A;  2KDK A;  3KSG A;  4GZB A;  3W4O A;  1STZ A;  2Y2L A;  1DJC A;  1OT6 A;  5G4Y A;  1Q2P A;  4FSF A;  4Y13 A;  1K6R A;  4Y0U A;  4HJ3 A;  3L9K A;  3G31 A;  1PZP A;  3A0V A;  3M6H A;  2WKH A;  3SS5 A;  2P9V B;  4Q0H A;  4E6W A;  1S0W A;  3UB7 A;  1A0K A;  1BUL A;  4OPQ A;  5HX9 A;  4IBX A;  2XLN A;  4GD8 A;  4N92 A;  1IKI A;  1YLZ A;  3RJU A;  4LRX C;  4WN5 A;  2JE5 A;  2XF3 A;  2V1A A;  4BL3 A;  2W3H A;  3KYE A;  4BEN A; 
#chains in the Genus database with same CATH homology
 4EEP A;  2VEA A;  1DP9 A;  2VJW A;  2IA2 A;  4CLC D;  4B9O A;  1ZHH B;  2W3F A;  2W0N A;  4JGO A;  1DP6 A;  4EUV A;  5FL3 A;  4BBT A;  3MF0 A;  2Z6D A;  2MJ6 A;  1S66 L;  3B42 A;  2M1C A;  5AVF A;  3BY9 A;  2W3G A;  3MXQ A;  1MC0 A;  2NUP C;  2XRO A;  2LB5 A;  3LIB A;  3NOP C;  4CLC B;  4KQD A;  5DKK A;  3OC2 A;  2VGL S;  2OOL A;  4IUK A;  3ICY A;  3E0Y A;  3H82 A;  3PBO A;  2ZOI A;  3T4T A;  2K31 A;  3HJK A;  2WKR A;  1XJ6 A;  4HNB A;  4DN0 A;  3NOU C;  2QWS A;  3LIF A;  3CAX A;  3H9W A;  5G4Z A;  3KYQ A;  2DMW A;  4PKY G;  3UB6 A;  2QJ7 A;  4M4X A;  1W63 M;  4GHI B;  1OTD A;  1UWN X;  3NOT C;  3R7W A;  5AVE A;  3CI6 A;  3RFB A;  1XFQ A;  1YAX A;  3KSF A;  3PXP A;  2LB9 A;  4WL9 A;  5HDD A;  2O99 A;  4UQI S;  2A24 A;  3FG8 A;  4YWZ A;  4OOL A;  1GSV A;  1GSX A;  4IUH A;  4WF0 A;  3IS2 B;  4KUK A;  3EEA A;  1LSV A;  3G6O A;  4CLC A;  2OAQ 1;  1D06 A;  4MCW A;  4O01 A;  2PYR A;  2GJ3 A;  2XSS A;  4MDZ A;  3K3D A;  3CUE A;  3W2Z A;  2HF6 A;  3UB8 A;  3TJZ C;  1P9W A;  3ZYT A;  3BW6 A;  4JGP A;  3FC7 A;  2VZW A;  3F1N A;  3LR4 A;  2B18 A;  3UMD A;  3B33 A;  3S7O A;  4NEE D;  5TJJ A;  5IT5 A;  2FH5 A;  4EQ1 A;  5HL6 A;  2K2N A;  3S7N A;  3KSH A;  1S4S A;  2JKT M;  3PHY A;  1XJ3 A;  1GSW A;  3PBN A;  1T1B A;  5A8B A;  3IBJ A;  3LR5 A;  3F1P B;  3MMH A;  4OOM A;  4HOI A;  1VB6 A;  4NXG A;  1TS7 A;  4LLO B;  2O0Y A;  1ODV A;  4I5S A;  2QHK A;  2W3E A;  2P7J A;  3IS2 A;  2JKR M;  3RH8 B;  2ZMV A;  2XA7 S;  2PHY A;  4BWI A;  1JNU A;  2OAP 1;  4HH2 A;  4HP9 A;  2V0W A;  2W3D A;  1OTA A;  5DFY A;  4Q0I A;  3C8C A;  3PBT A;  3D3O A;  3GDI A;  2OWJ A;  1IFQ A;  4ARZ B;  2K7S A;  2OWH A;  4HIA A;  3OCL A;  5DKL A;  5DF9 A;  4I3A A;  4JGR A;  3TRC A;  2GNX A;  5DJT A;  5HD5 A;  1OTE A;  2J3T C;  2VX8 A;  5HPF A;  1G28 A;  2D02 A;  4R38 A;  3ULF A;  1V9Z A;  1VHM A;  1NLZ A;  3LIA A;  1H8M A;  4HP4 A;  2O9B A;  4HJ4 A;  4BJP A;  5MC7 A;  2Y8H A;  2A2L A;  4LPZ A;  3P7N A;  3UE3 A;  2H28 A;  3UE6 A;  3T4K A;  3LIC A;  3OCN A;  5I5L A;  2HGV A;  1W63 Q;  4YOF A;  3TE8 A;  3RTY A;  3MQO A;  3EQU A;  2ZMF A;  4P6Z S;  2M7U A;  2M7V A;  5KIZ A;  3S7Q A;  3D72 A;  2FZ0 A;  2W1T B;  4Y2F A;  1N9L A;  4GLQ A;  4Q0J A;  5CX7 A;  3F1O B;  3FPW A;  3VE4 A;  1OJG A;  3A0R A;  3P01 A;  4IHQ A;  3NJA A;  3OBF A;  2HJ9 C;  4R70 A;  4CLC C;  1NWZ A;  4MN6 A;  4WEJ A;  3U2A A;  3PYP A;  3LIE A;  3LI8 A;  4O8G A;  3A0S A;  2INW A;  3VOL A;  1OT9 A;  3MR0 A;  3CUE C;  4UEY A;  3OOV A;  4HJ6 A;  1LSX A;  3E4O A;  3VE3 A;  4HI4 A;  5L8M A;  4I38 A;  4F3L B;  3C2W A;  4EET B;  3HCY A;  2G7U A;  1P97 A;  4Y5F A;  2Y79 A;  5IS1 A;  2QKP A;  1S4R A;  1ZTU A;  2GZA A;  5EFW A;  3LID A;  1MZU A;  1OTB A;  1TS0 A;  4GS9 B;  4WUJ A;  3S7P A;  2BAS A;  4EES A;  2B02 A;  4KUO A;  3ZQ5 A;  4LRZ E;  4MN7 A;  1S1Z A;  1T1A A;  2P04 A;  1LT0 A;  5TBM B;  4WEL A;  4AFI A;  3C30 A;  2NUT C;  2VKS A;  4GW9 A;  1OTI A;  5HWT A;  2W1T A;  2VGL M;  1DP8 A;  4YNR A;  3T4S A;  2VV6 A;  4GHI A;  3H7W B;  5DFX A;  4EU0 A;  5J3W A;  3CLO A;  3F1O A;  4PHT A;  1YSQ A;  3MFX A;  5KSH A;  3OLO A;  4BMW A;  2R78 A;  2ZBB A;  2VLG A;  2PYP A;  3HJI A;  4QPR A;  3E4P A;  3T4O A;  4DJ3 A;  4CQH A;  2WKQ A;  1TS8 A;  4XT2 B;  5HPI A;  4MN5 A;  3VV4 A;  1G6O A;  1WA9 A;  1V9Y A;  3FPV A;  4HHD A;  5AJG A;  5DJU A;  4ZRR A;  4DJ2 A;  4O0P A;  3H82 B;  5HWV A;  4I3I A;  4UQI M;  1UWP X;  3BWL A;  3DBA A;  5TBM A;  2KOI A;  1NLY A;  1XJ2 A;  3PR6 A;  4WLA A;  1BYW A;  2KLI A;  3TW8 A;  4HH3 A;  2P08 A;  2Z6C A;  1S67 L;  1S1Y A;  5J4E A;  3EWK A;  4EW7 A;  5F5Y A;  1KOU A;  2VV7 A;  4NXB A;  1LL8 A;  2O9C A;  1F98 A;  3MQ0 A;  2D01 A;  1UGU A;  2HJE A;  1IOU A;  4FOF A;  4GCZ A;  2JKT I;  1TF1 A;  3F1P A;  3KYZ A;  3CWF A;  4RQ9 A;  1XJ4 A;  1T18 A;  2VV8 A;  4L0L A;  2A24 B;  4ETX A;  4HQA A;  4G3W A;  4NXE A;  3T4J A;  3KSI A;  4MMN A;  3LR3 A;  4XT2 A;  4BBV A;  1F5M A;  3R4K A;  2V9A A;  4ETZ A;  3E4Q A;  3LI9 A;  3JVU A;  4G3K A;  5K5B A;  2JKR I;  2L1M A;  3PBQ A;  3PBS A;  2EWW A;  3CIT A;  4BBU A;  3V67 A;  1YKD A;  5F69 A;  3IBR A;  3JVV A;  5F68 A;  1N9N A;  4ARZ A;  4WEK A;  2L4R A;  2EA9 A;  2V0U A;  2QJ5 A;  2YKH A;  4H6J B;  3EOI A;  5J7E A;  1Y28 A;  2XA7 M;  1TD5 A;  4R3A A;  1OJ5 A;  5F6A A;  1DRM A;  1P9R A;  2J80 A;  1P0Z A;  3F1N B;  4LRY C;  4II7 A;  5IU1 A;  2JHE A;  2EWV A;  1T1C A;  4PAU A;  4L9E A;  4ME4 A;  3BJN A;  5C5K A;  3UB9 A;  4E04 A;  4HY8 A;  2VA0 A;  3BQ8 A;  4EEU A;  3MQQ A;  1NRJ A;  3K3C A;  3PBR A;  4KQO A;  4PKY A;  4R6L A;  4I3J A;  4B93 A;  3KO6 A;  5HDC A;  3UME A;  3EQV A;  1MKM A;  1F9I A;  4DMZ A;  4NKP A;  3LR0 A;  5HSQ A;  2HV1 A;  2O9A A;  2I9V A;  3SW1 A;  2QYB A;  2W1R A;  2PD8 A;  2PR6 A;  3LUQ A;  3T4L A;  1XFN A;  5HWW A;  1LSW A;  2GX5 A;  2PDR A;  2WKP A;  4L9G A;  3E98 A;  1OPX A;  4L9F A;  2PT7 A;  3EGX C;  1X0O A;  3EGD C;  4H6J A;  2KDK A;  3KSG A;  4P6Z M;  2PD7 A;  3K2N A;  4GJ4 A;  2KX6 A;  3T50 A;  3B47 A;  3LYX A;  4EER A;  3MJQ A;  5HZH A;  1STZ A;  2XRN A;  1T19 A;  3GEC A;  2J3T D;  1OT6 A;  1YSP A;  1D7E A;  5G4Y A;  4FSF A;  4F3L A;  3LFV A;  4HJ3 A;  2W27 A;  3T4Q A;  2YKF A;  4K08 A;  4EXO A;  2CMN A;  3A0V A;  3O5Y A;  4GS9 A;  4NXF A;  3BY8 A;  4Y3I A;  3EEH A;  1N9O A;  4Q0H A;  2L0W A;  3NHQ A;  4IJG A;  4CLC E;  3UB7 A;  4JGQ A;  5HD3 A;  2J3W A;  4G3V A;  2V1B A;  1TS6 A;  2PR5 A;  3KX0 X;  3C38 A;  3H7W A;  4LRX C;  5LBR A;  1EW0 A;  2ZOH A;  4WN5 A;  1H3Q A;  5HDS A;  3R7W B;  2V1A A;  4I39 A;  4Z1W A;  3BQA A;  2W3H A;  2JN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...