4GSDH

H5.3 fab structure
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
VQLQESGPGLVKPSGTVSLTCAVSGGSISSSYWWSWVRQPPGKGLEWIGEIYHSGNTNYNPSLKSRVTISVDKSKNLFSLKLSSVTAADTAVYYCARVALFDILTGGWFDPWGQGTLVTVSSAGTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H5.3 Fab Light Chain
publication title Human antibodies that neutralize respiratory droplet transmissible H5N1 influenza viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2012-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gsdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gsdH01
1A3QA 1KPRB 1PAMA 3BESR 4LPTA 4PJHE 1KJ2A 1MFNA 2IALA 5DJ0A 1EA9C 5J11B 1R3HB 1OTTC 5DUMH 2AXHA 3T0VA 5LBSL 2RR3A 2FZ3B 5DVKA 1Z2KA 2BNRD 5SWQA 4D0BB 3ARGC 1D9KB 2R0WH 1VPOH 4ONGH 3J8F7 5TFSH 3MFFB 3P4MA 2CK0H 1D5ZA 4AL8H 2VLLA 2VXUL 3QHFL 4YHNA 5F9OL 1WTLA 4BA8A 1MY7A 4FXGB 2EXWC 3ZTJH 2BDNL 3HUJB 3SKJH 1DBJL 3BD5A 2XFXB 4AIXA 1DBBL 4R96B 2E5EA 4HFWB 5C8JA 5I71B 2H32A 4HBCH 4ENED 2E3VA 2NNAB 4FZEL 5EU6B 3S3JA 1G9MH 4QGYA 3HI1A 3BDYH 4GKOA 1MCPH 1JMXA 3VXPB 5GRXG 5I8OL 1NFDF 4K3EH 3DX9B 2GUOB 4M48H 4J3SA 3KJ6H 1KTRL 3MUGB 4YZFF 3JV4A 1EEQA 1EEZA 4PR5A 3EOYG 4QF1B 4M62L 5C09D 2B1HH 1PW3A 1OF2A 5BV7C 4L5FH 1PD6A 5LGKA 3RWHB 1OAKH 5EZLA 4E41E 4LHJB 2E6QA 4GQPH 5GGVL 3IFPB 4NUJB 1QVOA 1XEDA 2QKIB 5CINL 5D9SB 4X7FC 2AEQL 4IRJD 4FOMA 1UEMA 2VQTA 2X4RB 3AAZA 3U30B 3EJZD 4NNYA 4MD4B 2R2BB 3ARGA 4O4YH 1BLNA 1AI1L 2DQDH 3C08H 5D6CB 2BNRE 1RUAH 1VGEL 3AREC 1XMWA 4PP1D 2A38A 3QPQC 1F58H 4KHTH 4XAWH 4JPVL 5GGQL 2W91A 5I17B 3GBLA 5GGUA 4G42A 3LN9A 4M5ZH 1MI5D 1HI6B 2EZ0C 5FYKL 1ZT4A 4QTHB 5K9QG 4GMTH 3QNXB 4X6EB 2P5EA 3X14B 3MRHA 3DRQA 1D6EA 2YPVH 4OGYL 5IFAL 5C0ND 4QT5B 2ZSVB 2KPNA 1CE1H 2W92A 4O00A 3VXNB 4AQ1B 5J13B 4JRXB 2MQ0A 1BFTA 5DQDH 2BJMH 4JN1H 4OIIH 5CBAA 3GB7A 2Z35B 5DA0B 1KJMB 2I07A 3S4SA 4N0CC 3L6FB 4R97B 1A0QH 2F8XC 2WINB 1RZFL 3U2SB 3IAQA 2F74A 5ENWB 1P7QA 1OARH 3MRNB 4S1SH 3VXSD 4O2CA 3P9LA 3I6LD 4IRSD 1JUFB 3CK0H 4RMRA 3S37L 1JGUH 3T77B 5D7IE 2NYYC 3LKQA 3P77B 4Q6IC 4MS8C 2E27L 4Y19B 5BS0D 3W11D 1JI1A 3DOSA 1N2RB 2B39A 5EIIA 5CIPH 3U9PL 5IK3A 5E00B 4YE4L 2HFEB 1RFDL 4XXDA 1MH5B 1U8KA 4K7PY 2A9ML 4QHKJ 1BD2B 1ZHKA 2GK0A 3FOLB 3AREA 3G5ZA 4PJDA 4X6CE 4R0LC 1JZ6A 5GRVK 3WJJC 3QUXC 5JIHA 1JIBA 2A0LC 1CICD 3BIKA 2FX9L 3HR6A 3ZE0E 4UT9L 3S35L 2H26B 5F88B 3V4VH 4X98B 4QRTB 1EBAA 3T04D 2BVYA 3LSOA 5CIPA 4MDIA 3HI6L 2BXYA 2P45B 1KJ2B 2DKSA 2IALB 3F7YA 3QO1A 5DK2A 5DJ0B 2FATH 2YKLL 2QJDA 4B0MM 1MFAH 4PLKD 2VN7A 2DQGH 3RWDA 3VGGA 5SWQB 1UKQA 1FIEA 4EI6B 1MCQA 1SJVA 1UYWH 2D7TL 5D71L 4LSUL 2BNQA 5GSVB 2MCPH 3L3HA 1IRAY 3PGDA 1D5ZB 4ZAKD 2VLLB 2B2XL 4YHNB 5ICYA 3VXSE 2I27N 4G3YH 3O6LH 3ARDD 2FWOA 2QADB 3BD3A 3I6LE 4Q6IA 3Q2CA 3THML 1JP5A 4DWHA 4KJQC 5C8JB 6FABL 4DN3L 2H32B 5BS0E 4CVUA 4A2LA 2QQLH 2YEZB 1HSAA 2P48B 4U6VL 3RZWA 3HI1B 3PWLB 1BZ7A 1DE4A 5D72L 1OAZL 5F72S 5JLZA 1AY1H 4LCWA 4Q7DA 1QBML 4R0LA 1I3RA 2EDFA 4NQSA 3WJJA 3QUXA 2K7QA 1EEZB 4PR5B 4JO2H 4L8SC 3RWJA 4AM0A 2BSED 1OF2B 4HS6B 4WV1C 4TNVF 5EZLB 4TSBL 1GAFH 1FE8L 2V17L 3S3SA 3MC0A 2OK0H 1UJTA 5C0EA 3AS2A 3KPQA 1QVOB 4UOJA 4S1QH 3SBWC 3FB7B 3D3VD 3OMZA 3STLA 5LCVH 2WM0A 2YMXL 3LEXA 3AAZB 4NNYB 3T3PF 4Z76A 3ARGB 1BLNB 1PZUB 3QRGH 5EDXA 1T04A 3WO3B 3ALWA 5GGUB 1VEOA 1LEIA 1J0YA 3LKNA 3P0YL 1ZT4B 3LPGA 1QUNA 5F7FA 1RZKL 4Z7OF 1XR8B 2P5EB 4TUKL 1RIUL 3MRHB 3DRQB 1D6EB 1D9KD 3MTRA 1N8ZA 2EIZA 2HVKA 1A1NA 5CLWA 2XZCH 4DAGH 1RIHL 4OLWH 1U8HA 2VAJA 4WFGD 5GRWA 3GB7B 5CBAB 2I07B 3S4SB 3L5XL 4HWEH 3BEVA 3D25A 5EBMA 3HZYA 2A77H 1P7QB 4L8SA 5BV7B 5EU6D 1DDHA 3CUPA 3P9LB 4WV1A 5DJXA 2KBGA 2VISA 2EC9U 3LKQB 4U1GC 3Q6FA 3CGTA 3MRRA 1NQBA 2G75A 1MFDL 5FYKD 3OB8A 5EIIB 5IG7A 3NN8A 3SBWA 5IK3B 1LEGA 1KYOK 5IMOB 1SJEA 4JPWH 3NIDF 4XXDB 3D3VE 1T0NA 3Q3GA 2J8UE 1U8KB 5GISL 3WMSA 3DSNA 3GIVA 1BVKA 3EKCA 4M3JA 5IVXA 15C8L 4OBSA 1ZHKB 2GK0B 4PJDB 1IQDA 3H7BB 3MACL 1JF5A 1RK0A 5ESVA 1Y18A 3IS1X 4YBLC 1A9BA 1OHQA 4X5XA 3BIKB 5F7MC 4OM0L 3ZTNL 3IFLH 1KCVL 4KKNA 3KYKL 3FT4A 1RHFA 3LSOB 5CIPB 4M7ZC 1P6AB 5DMKA 4MDIB 5ITFA 1BF8A 2YR3A 5GSRA 1KN4H 4Z78A 1T03L 3QO1B 5DK2B 3O4LB 3SQOL 3BW9A 4UTAH 2BVPA 1YC8A 1QACA 3IGAA 3RWDB 3WFCL 3O6KH 1RV6X 1KN2L 4WFGE 5I1AA 5EWIH 2BNQB 5SWSA 3L3HB 1DFBL 3U4EA 2QSQA 3PGDB 4TQEL 1CLYH 4DGVH 2EC9T 1J0KA 1X3DA 1NUNB 2IF7A 4PJEF 4AQOA 3ARSA 4EJ1C 3QWQB 4KJYA 1E4XH 5EU6E 4JRXD 2FWOB 4Q6IB 4HIJA 5IEKB 3LV3A 1NMAL 2Q76A 3HFMH 4LSVH 4ALAH 2WQ8A 5FYKE 1HSAB 3V7MA 2BX5A 4M00A 3UPAA 1BZ7B 1DE4B 3LQZB 1T5WA 2FNBA 5B3NA 1EX0A 1CG9A 4JDZA 4LCWB 5FUZL 1J1OH 4R0LB 4NQSB 5E7BA 3QUXB 3S36H 4DUWA 3H0TA 4Y19D 2B0SL 1TZGL 4NWUL 3KDMA 3RWJB 1BX2A 4DKAA 4AM0B 4XMLH 1N0XH 4MA3A 4JO3L 4P5TC 3RL1B 5LXGH 2N1KA 4ZUSA 2MTPA 4DKDC 3GIZL 4YGVA 5C0EB 4LSSH 4TTDD 5F7WC 4XPFH 1IL1A 3H8NA 3KPRA 1BD2D 3ZE1E 4FQLL 5C9KA 2ZUSA 5GS0D 1A7OH 4NKOA 5EORH 3STLB 5JW3L 4PS4H 5C08A 3LEXB 4PRAA 2XXCB 3I3EA 5KANI 4NBXB 5I18L 5SX5K 2ZJSH 1JGDA 1O0VA 1JGLH 1R5IA 1CE6A 4ZOBA 7CGTA 1T04B 2HRLA 1Q72L 3RAJL 2VABA 5FO9A 3HPJA 2BRRL 5BOPA 1LEIB 1BOYA 3LKNB 5EU3A 2HKHL 4W6YB 3GFUA 4FFVC 3ZDXF 1ZVSB 1KB9K 4JRXE 5HYIA 2CLZA 1HZHH 1K8DB 1N8ZB 2EIZB 2ZG1A 2HVKB 1D5MA 1A1NB 2H41A 1X5XA 1U8QA 4U1NA 4F7PA 4LIQL 4OLVH 4F8QA 1MCLA 1U8HB 4DTGL 3IKCA 2QADD 3BEVB 1VHPA 3GSOB 3D25B 5EBMB 4NDMB 3EZJB 3HZYB 3MUY1 1IGIL 3LKSA 4MX7A 4L8SB 2FJHA 5H2BA 1DDHB 2JJWA 3CUPB 4WV1B 5DJXB 3ULSB 3FO0H 4P5TA 1ADQA 2CDEA 2VISB 4FQXC 3L1OH 4KK6D 1H5BC 2D7QA 3A6BL 3WHE0 4L3EA 3MRRB 2G75B 5FGCB 4NO3A 1YY9C 4U7MA 5IG7B 3HLAA 1BD2E 3U0WH 2ZP0T 1Z0NA 1T0NB 3U4AA 1FH5H 3Q3GB 2VZ1A 3GIVB 5HJ3B 4TYUA 1BVKB 3I9GL 3N9GL 2IFFH 5HYQA 1DUYA 3BP5A 1IQDB 4HXBL 4TPRL 4ZUVA 4YH6A 1RK0B 5ESVB 1DQDH 2E7HA 4P9HH 1A9BB 4X5XB 4QXTA 1OTTD 2L4OA 4C56A 3PJSB 2QQQA 4O58L 2W9DL 4G7YH 1TJHL 3FT4B 3T2PA 4Z7VB 5DMKB 4FABH 5E9DD 3ARGD 3CVHL 3NTCH 5HHOA 5ITFB 3TIDA 2APFA 4JY4A 5GSRB 4Z78B 3L7FA 4L1DA 3BW9B 2BVPB 2ADJA 2DL2A 2R1XA 2YUWA 4TVPD 5E7FA 3DTXA 5IQ7L 1L0YA 1RMFL 3FCTA 3IGAB 1EJOH 4ZS6C 4KY1L 2EXWD 5I1AB 1II4E 2EDQA 1RIVL 3H3PL 1X4YA 4L9DA 5FCUL 3U4EB 2JJTC 2P5ED 5E03A 4UNUA 5CAYB 4M8QA 3EYVB 5MEOA 2EKJA 4PV9B 3IFNL 4K7FA 4KJYB 1RURH 4U6XA 4FQXA 2IQ9H 3QEGL 4U1GB 1H5BA 1U8JA 4HIJB 3RA7L 3BVNA 3LV3B 2W0PA 3QEHA 1FORL 4QRUA 1KCKA 2G5BA 4ZTOH 2Q76B 4NJ9H 1RU9L 4ZOAA 5JQHC 4RFNC 4MWFA 4OQ1A 5CEXA 2GJZA 1LO4L 3CDYA 5AEAA 4Q0XH 4OI8A 4YHMH 3QFJB 3GI9L 3QNZA 1ZS8B 4K2UH 4MXWH 1P7QD 1ORSA 4IMLB 4O02L 1CL7I 2EYSA 3BWAB 3U83A 2W38A 1G0XA 1CG9B 4JDZB 1A7QH 5HYEA 2Q3ZA 4UOW1 3H0TB 1SY6L 4YBLB 5L2JA 5EBLA 3P30L 4ZO6A 3KDMB 4JG0H 1BX2B 4O5LH 1FRGH 1P4LA 4MA3B 1RJYB 4NC2B 3KGRA 4P59H 4M7ZB 3VXUA 4U2ZA 4YGVB 4UTBH 3RU8L 1IL1B 3KPRB 3MGTA 1DBMH 1CFSA 1F4XH 3QPQD 2AJUL 4NKOB 3WXWL 3NFSL 4ZDHA 2HH0L 1IC5L 1K2DA 1LO0H 5C08B 4PRAB 1C08A 1NBVH 1WIOA 4TVPE 2EZ0D 4ERSH 1PLGL 4UV7L 1JWMA 4UT7L 1JGDB 3MLRL 1ZLVH 2EEBA 4IOFC 1R5IB 4QNPF 1CE6B 4KFZC 3C2AH 2DBJA 2JJTA 3V4UL 2VABB 5FO9B 3HPJB 1EFXA 2P5EE 3CFBA 4PD4K 4YHKH 3O4LD 3ZTJG 2W59A 5EU3B 5EIQA 1Q0XL 3WIIH 3KLSA 3MNZA 3IKKA 4OCXL 2XRAL 2EH8H 1YY8A 1MHCA 2CLZB 3G9VA 1FZJA 4N0CD 1D5MB 4HGMA 2BNQD 4M1GL 2R1WB 4U1NB 4F7PB 1WBYA 2J5LC 1JTOA 5D7LA 4OCMC 3OWEA 3IKCB 5DJAA 5J89A 3GKWH 2NYYD 2WP3O 3DUUA 4MS8D 4AYFA 1LK2A 1WFUA 1GVIA 1KELL 5AYUL 4OUOA 3WXVH 4XP9L 3ARZA 4OZIF 3LKSB 4MX7B 4ZFFA 2FJHB 5H2BB 4PGBA 3QI9C 1NBZA 1QLRB 4CADA 4P5TB 5FUCC 2CDEB 3TWCL 2KH2B 2YA2A 1XR9A 5DUPH 4L3EB 3UXFA 4NO3B 1HNFA 2DF3A 4JKPL 4LCWD 1J10A 1XGPB 5DR5L 3HLAB 3QUXD 4PJDE 2A0LD 3MRJA 5TE4H 3HNVH 3B4NA 1IAMA 5HYQB 3S4SG 3BP5B 1TLKA 4GG6A 4ZUVB 4A6YL 2WANA 2HLFC 1J1XH 1WT5C 4ORZC 4C56B 4LARL 5D7KD 2B8OT 1X7QA 1JYWA 5DC4B 1YEJH 3MJ8A 5HHOB 4N8CL 3N50A 4JY4B 3C8HA 3MOAH 3L7FB 2CXGA 5EUKA 1CQYA 2R1XB 2ADJB 4R9HA 2PYEB 5DHXB 2BNQE 3EDFA 3WFDL 3OJMB 3DTXB 4CN1A 1FYTA 3TJHC 4MA8L 2PR4L 3KPLA 1RJZB 3WUWA 4RDQF 4RAUA 3MV11 4Z0XA 4DGYH 4KJQD 5SX4I 2AVGA 4M8QB 5CEZL 4YDLC 4AZ8A 4JRWA 5MEOB 2RGSA 1KFAL 3QEUA 3QI9A 4K7FB 2FYYA 5B3JE 4FQPA 4U6XB 1AKJA 1QLEH 5TQ2H 4FQXB 4GAGH 1H5BB 1U8JB 3KLAA 3O3UN 4DN4L 3ARBC 3BVNB 3MNVA 2AEPL 4MDJA 3L3GA 2OTUA 3QEHB 4QRUB 4BK4A 2G5BB 4XHQA 1LDSA 5B4MC 3SGEH 2C3HA 4MWFB 1ES0A 1IKNC 5JXAH 1MIMH 2GJZB 5CEXB 4LCWE 1AXSB 1FC1A 1JGVL 3QNZB 4YFEA 3AS1A 1ORSB 5C6TL 3OKEA 3MLZL 1IQWL 5GRJH 4JFHD 4Q9CA 2EYSB 3EUUA 1MJJB 3TCXA 2NMSA 2E6PA 4JHAH 4LIQE 1GC1H 5C0DB 5L2JB 4B53A 5EBLB 1DTUA 1U8PA 1WT5A 2DS4A 4NKIH 2R4SL 2RCSH 1P4LB 4ZFOL 2R0ZH 3HNTL 4KVCL 1DEDA 2AJZA 3QQ3B 3K46A 4HF5H 2PUQT 3VXUB 2ZSWA 5D7KE 4XCCH 4IRZL 3GJFH 2YRPA 2UV3A 3MGTB 4MJ6A 1CFSB 3TO4C 2EE9A 5HVHC 4EUPA 1T1ZA 4ZDHB 4F9PC 3M17A 1K2DB 3QWRA 4H8WH 5FOBB 1C08B 3C6LB 1FNSH 3P0VL 1JWMB 4OFVA 3WFEH 4HS8H 1MFBH 1CK0L 4NGHH 1ETZA 3OL2A 1AR1C 5DD3H 3G5YA 1EFXB 3CFBB 1FLTX 3PG2A 1OL0A 4X7SH 4M02A 1FNLA 3MNZB 4G6MH 3ARBA 1A4JA 4YDKH 2H45A 4PRBA 1YY8B 1D5IL 1MHCB 4RFNB 1ZKAA 3LN5A 2NY5H 1IKNA 4HJ0C 3UC0L 1PZ5A 3ZYIA 1MHHA 3BPOC 3VU2A 1T83C 2UWEA 3VFMA 4J3XA 1CFTA 4NHCH 5D7LB 2VQ1B 1EERB 2F58L 5DJAB 4JFHE 4Z7WF 1EH9A 3SO5A 3DUUB 2EDRA 1LK2B 1OLZA 1AGBA 3RY4A 1F2QA 4ZFFB 3C8DA 1RY7B 5FGCE 4PGBB 3V6OC 4MD0A 2HKFL 1NBZB 3IDXL 3QFJD 5K33A 4CADB 4KMQA 3CJJA 1MUJA 4HLZH 4KC3B 1D5XA 3PV7A 3AMKA 3MCLH 3BKML 3BKYL 1U58A 3V79C 4U1LA 4TSCH 3K1DA 5AZEH 2Y1VA 2H1PL 3SDAC 1S7RA 1XF3B 4F9PA 2DWDA 2IPKA 4Y2OA 5T3ZD 4V1DA 4G6JL 4KU1A 3O3DA 4LHQB 4GQ9L 4JQVC 1OAUH 3QIBC 4GG6B 1FBIL 1N0LA 4FTVA 4R8WH 2DICA 2AK1H 3VI4E 4MB5A 3SOBL 3KPRD 5FGSA 5E2VL 1ODAA 3LQMA 3DETC 1LO3H 1BM3H 5C08D 2YBRA 1CGTA 2NW2A 3FO9B 1S7TA 3MJ8B 2APVA 4PJFF 1CL7L 2JELH 3LMJH 5EUKB 5LWYL 1T83A 4HKZB 5DQJA 5DMYA 4K3JH 3RJDA 5HI3C 1MFEL 2QQKH 5SWSE 5BJTA 1U8LA 1FYTB 1H3VA 5C0GA 3V8OA 3TF7C 5IUSA 2ZUWA 3WKMH 3KPLB 2GI7A 5EULV 3WUWB 1A5FH 4RAUB 1K3ZA 3VFSA 4Z0XB 2NTSP 3PDGA 1FIGL 3UAJC 2V9RA 5GQBA 2VZOA 4ODHH 2O26U 2XZZA 3R0NA 4XPBL 2DMBA 4DK3A 3QI9B 2FYYB 5I1KH 1AKJB 1G7IA 3I50L 4PJBA 3KLAB 5T1DL 3L3GB 2OTUB 1NMCC 4IOIB 2A1WH 4RAHA 3SDAA 1ES0B 1TPXC 3FQTB 3VH8A 4Q6YA 4YHOL 1OP3H 2XNAA 2DQUH 3OKEB 2VLJA 5FXCH 5T3ZE 1EAPA 4JQVA 1EFQA 1UXWA 2FD6L 1NAML 2UZXB 3QIBA 4P5TD 2WW8A 4OCRL 4X80H 2VZ3A 4JQIH 4L3ED 2E7MA 4K7PL 2EDKA 5JIPA 4LLMA 3LB6C 3F5WA 3HMXA 3KPRE 4YHZH 2AJZB 4DQOH 5C08E 2ZSWB 2EDBA 1CD1A 3KS0H 3OGOE 4EUPB 4HFUL 4PJ7A 2BMKA 3NMEA 1T1ZB 3M17B 2BSTA 4P3DA 4HG4K 1KCSL 2BVEA 3UJJH 2BFVL 4C56D 1EZVY 4MAYC 4NZDA 4FFVD 3GBMH 4PGCA 2YN3A 2AJYH 4YDLB 1BOGA 1C7SA 2F8VA 5HHOD 5F1IA 3G5YB 1H15A 5KN5A 2Y9RT 2PYED 4N1HB 4NJAL 3ARBB 1A4JB 4M8VA 3IDUA 3GI8L 1B0GB 1W0VB 4BFBD 3LN5B 4FFWC 1PZ5B 2ZUXA 1MHHB 4KZEH 1FHGA 2UWEB 4LASH 3RVWC 2OJZL 3VFMB 2CLRA 5C70A 1CFTB 1FC2D 2PCPA 4R26H 2YA0A 1PQZA 2FR4B 3RZCC 4FQXD 1JZ2A 5LG1A 1AGBB 5IHZA 3B6SA 1YY9D 4L3EE 4TUOA 1FNEA 2VDKL 2AJVL 2X1WL 5J3HD 1L0QA 4XC3H 1FNHA 1U58B 4U1LB 5EC2A 3TO4B 1UFUA 5HVHB 2VDQH 5I1HL 1VACB 1T2QH 1H8OA 1S7RB 3QUMB 4HKBA 4KPHH 5CZVL 5E8OA 1ZVHA 2DWDB 2IPKB 4KVNH 4V1DB 2R15A 4TNWF 3RPKA 3QO0A 1UM4L 3O3DB 5TE7L 2HFTA 1EHLL 4MAYA 4G5ZH 2EO1A 4C56E 3IAGC 4H20H 4G9FA 5J1TC 1PJ9A 3VXUD 3NVQA 2DQJL 3FRPA 5HHOE 4P57B 5F96H 3VI3F 2YBRB 3C6LD 1S7TB 4JM2F 2AK4A 5HDLA 4ZS6D 5I1IH 4JFYA 1YNTA 3OF6A 5C6PB 4U3CA 1XF4A 2X9YA 3BPOB 5DQJB 4OJFH 5F93C 5BJTB 1EFXD 1U8LB 4WCYL 5T1LD 5C0GB 1YA5A 5KSVA 2JCCA 5CJQH 1KEGH 3RZCA 2F15A 4WDIA 1XH3A 4KWUA 3VFSB 3DGCR 1UH4A 3QUML 1MCKA 3ET9F 2ADFH 3IB4A 3QWOA 4FA8A 4W6WB 4BSWA 4M7KH 3VMOA 2UVFA 4ODSL 3ILPA 4X6BA 5J56B 1G7IB 4PJBB 4PGJA 5D7LD 2CDFB 3WDHA 1UWGL 3MA9H 1F4YL 1K4CA 2ZUVA 2FBOJ 3Q1SL 3SDAB 2DM4A 3B3IB 2GY5A 5C7XH 3JUYA 4KMTL 2OZ4A 2V9QA 3VH8B 1CXEA 2EIDA 2MCG1 2XNAB 2VLJB 3GSNA 1EAPB 1YZZA 1OGTB 1RPQA 1UXWB 2K7PA 3LRGA 4HD9A 3QIBB 1ZLWH 4B41A 2DQHH 1WVZA 4NCC1 5I1CL 5J6GA 1KIQA 1UG9A 4O9HL 2DL9A 4GXVH 3VXUE 4LLMB 3MLPA 3F5WB 4U1KA 1CFVH 3BGFC 3X11A 3FO1A 5HD8C 4TSAH 3I84A 2XKNA 1CD1B 2WZPD 4IOFD 3VD7A 1KBGL 5AZ2H 2CSPA 3RVTC 4PJ7B 2BMKB 4NC1C 1NCAL 1SEQL 2BSTB 3BAEH 4KV5E 4TOYH 1V7MH 2NY2B 2YWYA 1XGRA 2ZUYA 3MBXL 4YDIH 2VR4A 2Q20A 1U2CA 4V2CB 2AERT 4PGCB 3VXOA 4JO4H 4M6OL 1DZBA 1FP5A 4LSQH 4XTRC 1BOGB 3N1FC 2DQEH 5F1IB 5KN5B 1IC4H 2PXYC 1MCOH 4OB5H 4K3DL 1OAYL 3ZE1F 4L8CA 1FYTD 1GSMA 3QPXL 1NMCB 3UO1L 4P2RA 5D7LE 5F9JA 3K2UH 3GSXA 4OLYH 3R4DA 4RGOH 1WUNT 3MSPA 3H3KA 3SDXA 3R06A 1KSRA 1TPXB 2RBLA 4X4XA 1NUFA 3RUGA 4UILL 3U7WL 2CLRB 4S1DC 1MCJA 1ZHBA 3OAYH 4QHLA 2PCPB 4LLUA 4RMVA 4OT1L 3QI9D 3HR5A 5IESH 1R3IL 1AKJD 1XCTA 4EQ3A 1MCWW 1BREA 4LSTH 3SKNA 3VFPA 5IHZB 1RHHB 3JV5A 3B6SB 4TUJA 1OTUC 1BGXH 4TUOB 2Z9TA 5JO5A 3E2HC 1HKLL 1N4XL 1FNEB 1OVZA 1JV5A 4HJGA 1X9QA 2UZIL 4S1RL 4OD1H 2VC2L 5EN2A 2ORBL 4JLRA 5EC2B 3T2NH 4WU5A 1LWRA 3LIZL 4FQ2L 4M5YL 5FFLA 3TBSB 4HKBB 4PY8I 3ISWA 5E8OB 4GG6E 2HLFD 2XN9A 1A6TA 2O5YH 2GIYA 4OFKA 4MAYB 2QQNL 3I6KB 3VFTA 5JW5A 1V7NL 4M6NH 3UYRH 1DQMH 4BSJA 3DROA 2LTQC 1IKFL 2PXYA 3W9EA 1S5IH 3QWRD 2DIJA 4YDVA 3INUL 3TJHD 3NACL 4LBEA 1JGEB 1U8MB 1FYTE 4RBPK 1WEJL 4JFYB 1YNTB 2HFGL 4F7CA 1YNLL 2HA1A 1XF4B 3CFJA 3VD5A 3W2DL 1NGWA 2CRIA 3ZL4H 1T6VN 4P2CG 1IGCL 2AI0H 2J7LA 1IARB 5KSVB 2JCCB 2Y07L 5DD5H 1NAKH 3RZCB 4WDIB 1XH3B 3H3BC 4MCZA 4XRCA 3ARBD 1GZPB 2MPAL 4PJIF 2UUDH 4XVUC 5FUCE 4LU5H 5B4MD 3QWOB 3U36A 2QSCH 4OKVA 1F4AA 2HP4A 4ZD3H 1TJGH 4BSWB 3SE4A 5KBNC 4Z7NF 3ILPB 4X6BB 1M7IA 4FQCL 5F9AC 1YEDA 3NZ8B 3PWPD 1TVHA 4U1IA 3H7LA 1N5YL 1K4CB 2EDXA 4ONGL 1CF8L 5TFSL 1QBLH 4XVJL 4AL8L 1ZVYA 1I7UA 5TE6H 5I1GL 5CD5C 5HGDA 4OLUL 1ACYH 4KJWC 3GSNB 3PABA 2XTJC 4K9EH 3WNNA 4JCMA 3SKJL 3WUWG 1OGAA 2APWA 3BPCB 2BERA 4EN3C 7FABH 5HDOA 1KIQB 4JB9H 3TO4D 1G9ML 4BM7A 4U1KB 3V4PH 1AD0B 4XX1E 3X11B 1J7VR 4N5EC 1MCPL 5HI4C 3FO1B 4NM8H 4V1DD 2NY4C 2EEDA 2XKNB 4JM4L 4UT6H 3KJ4C 4X9GA 3CXHJ 2D7OA 3UTZA 1CCZA 1IAOB 1PG7L 4KROC 3WNMA 3F65A 2BOBB 1AR1D 5C1MB 1XGRB 3V6ZA 4L5FL 2PO6C 1CR9L 1SVCP 3S34H 3D85A 3ZLQC 5JTWA 1BFVL 1ZA3A 2QSTA 3S37X 3P0GB 3VXOB 3HC0A 1E4XI 1F6AA 4LQFL 3Q5TA 4HJ0D 3QCVL 3EOTH 1G6RB 5IV2A 1I8MA 1J0JA 5FKPA 4L8CB 2UWEE 4KKLC 1OPGH 4OF3A 4P2RB 5ADOL 1RUAL 8FABA 5F9JB 4UDTA 1I8LC 1WAAF 1F58L 3GSXB 5HYFA 2IBZX 4KHTL 4XAWL 4XX1G 4Y5XC 2D7NA 3SDXB 3R06B 4EUPG 4X4XB 1SM3H 3RUGB 2R29H 4J3TA 5F1OB 3G04A 1R0AH 3DO7A 1H0DB 1ZHBB 4QHLB 4LLUB 5C3LD 3HR5B 1XCTB 4GMTL 2Z93A 4EN3A 3VFPB 4ELMA 4PJAA 3N0PB 4TUJB 1KTLA 3PHSA 4WWID 3SDAD 4OLEA 3V2AR 3L3KA 3BGFB 3E3QC 3B9EA 1F4WH 3LRSB 1JV5B 1CN4A 5ALBH 2BJML 4JN1L 2VLJD 2O5ZH 2VMFA 2XA8H 2EXYC 4V1DE 4XNQA 3OR6A 4JLRB 3QIBD 4WU5B 1A0QL 1AC0A 3S5LA 3GMLB 4OQTA 1G6RL 4PRIA 2Y4SA 3O6FC 5JQ6H 3EYQC 4S1SL 4FTVE 1FG9C 2PO6A 2XN9B 1A6TB 3FQNA 5GJSL 1QLFB 1ZTXL 1JGUL 3DETD 2X4NA 3CSBA 1AQKH 3VFTB 5JW5B 1S9XA 4EIGB 4FXLA 2WUBH 1Z9SA 4A2MA 1HHJA 4PB9L 3BKJH 3DROB 3NGBC 5FYKU 4KKAD 2PXYB 4JANA 1J18A 3W9EB 2DQFB 3IU3A 4Z9KB 2V5RA 1CGVA 4G7VH 2NY2D 4YDVB 2VUOA 4LBEB 3Q6GH 3DXAA 3T8XA 1OAQL 1I8LA 4F7CB 4Y5XA 3CFJB 1NGWB 4MJIA 3UAJD 2B1AH 4P2YA 2RAMA 1JZ7A 2HRPH 1KXTB 1CIDA 4P4RA 4LCIH 3PGFH 1UCTA 2BHUA 4HZAA 2A6KA 4L3CA 4MCZB 4XRCB 5IBLC 4PJBE 2C26A 5IBTH 1F4HA 2VDOH 4OKVB 1XT5A 3E2HB 2FATL 5TQ0H 4BELD 4EOWH 4HMDA 2R69H 1MFAL 3D9AH 3HHRB 1YEDB 2DQGL 3NPSC 1TVHB 3ULUC 4U1IB 1FO0H 3AVEA 2VLJE 5FECA 2BVQA 2DDQH 5KVDH 1OQOA 3HE7C 1VGKA 1I9JL 3O6FA 5EC1A 5JW4M 3TEUA 1E4WL 2VLKA 4M93C 4TRPH 5HGDB 1RZIA 3G6DH 3LB6D 2YRLA 2QV2A 3PABB 5DTFA 2ZKHH 4G3YL 3C8KA 4O51A 3WIHA 4Y0GA 1VERA 4KI1A 3NA9H 4CUCA 3WNOA 4PREA 4ZTPH 3QZWB 4YXHH 1MJ8H 2FRGP 2HYMA 1CLZL 4MXQC 5GGSA 3CZFA 2QQLL 4JY6A 1WFTA 2LTQB 5CGTA 5D8JL 1B6UA 1FO0A 2KZ1B 4PJ7E 3E6HA 5EUOA 2ZCKL 5I8EA 5IM7A 2Y7QA 1UT9A 2VQUA 1AY1L 4IDJH 4MAYD 5FKAA 3ULUH 2ZG2A 3UTZB 3VH8G 4Q9RL 2CKBA 2EDHA 3V6ZB 2G5RA 1CS6A 2FB4L 1X44A 3D85B 3GHEH 1GAFL 5ACMA 1TXKA 3T0EC 1HXYB 1ZA3B 4ZSOA 4J3VA 4NKDA 1QR4A 1VSCA 3HC0B 3MRMA 2EIBA 1F6AB 4S1QL 2R0KH 3OF6D 2E7BA 1JMZA 1D3CA 1X5IA 2EH7H 1J1PH 2X1XR 4JFEA 5LCVL 4JREC 2AABH 2GSGB 4LLVA 5F21B 3RVWD 2YK1H 5FKPB 2I9LA 1N64H 3QRGL 1OP9A 8FABB 4UDTB 1P84J 3RZCD 3HE7A 4KTEL 4YK4C 1A7NH 4YBQC 1NLBH 4WUKH 3S98A 3BZEA 1BVLA 1J11A 1CDCA 3G04B 4IBLT 1CGWA 3DO7B 4KUCD 5FGBC 1S78C 5DUBA 3BPNC 2XTJB 1NCBH 4ZFGH 4P2QB 3CC5A 3QDAA 4XH2A 5E5RB 5AYQA 4XP5H 5EZOL 3T3ME 4XWGH 1NCCH 2Z93B 4EN3B 4E5XA 4ELMB 2VAAA 3CX2A 4PJAB 4P99A 3LKRA 2DLFL 1H3XA 3O2WH 1KTLB 2XZCL 2OP4H 1LP9B 1BZQK 2AEWA 3L3KB 4H5SA 2W0FA 4OLWL 4JFQA 1CI5A 2NY4B 3UZQA 3KJ4B 3QSKB 4HWEL 4JO1L 4FRWA 2D3VA 4KROB 3S5LB 4PRIB 3SPVA 2W9LA 4G9FE 5ID0A 4HC1A 1S7UA 1XZ0A 2PO6B 3GSQA 3FQNB 2OR8A 1TQCC 2M8XA 3K0WA 3T0EA 1LDPH 2X4NB 1ZWIA 1S9XB 4XCFH 1IILE 4WI7A 1HHJB 4XVTL 3IVKB 4N1EA 3TNMA 5IGXL 3NZHH 2CH8A 3PV6A 2AK4E 5TGBB 3CAFA 4RWYL 4JANB 4JPWL 3IU3B 4U0QB 1NKRA 1T3FB 5GS1C 2QSVA 1UEYA 4KUZL 2P24B 3CSYA 5IVXF 5C0BA 4X7DC 3RIFK 2BXZA 3DXAB 3T8XB 2EDYA 5CCKH 2C7UA 5D1XB 4Y16C 4Y5XB 3V6FA 1WWCA 2JCCE 2E6JA 2VUYA 2Q8AH 4BK5A 1WIUA 4MJIB 1ZLSL 1I8IA 3BISA 5ALCL 4CVXA 3IFLL 5K59E 5FGBA 4P4RB 3QEQA 5FAAA 5EU7E 3PP3K 4GG8A 1I7ZA 3KWWA 5I73C 2F54B 4D9RD 1I9RH 4L3CB 5FUOH 4JPKH 2R0LH 4MMZC 2PN5A 3VJ6A 3MUJA 3MV7A 2ESVA 4P2RD 3ZDZE 5K9JL 3FQRA 1IGTA 1CDJA 3FRPG 5M94B 5FYLL 4JR9L 2X4OA 1T1XB 5D2LA 3A67H 1CVRA 4JQXC 5FECB 3WN5C 3HG1A 1VGKB 1DR9A 1CLYL 3O6FB 5EC1B 5FCSH 4DGVL 3DURA 1KC5H 2VLKB 4XPGH 1RZIB 4RWHA 1E4XL 2DQTL 5DTFB 3F62A 2J1KA 3C8KB 4O51B 3RGHA 1H8SA 3O3AB 4HPOH 5HD8D 4YXLL 3TNNA 4PREB 1RVFL 5KS9F 5T5NF 1IAKA 3F6LA 4Y4KC 4R4NC 4WNQA 3HFML 5GGSB 3NGBB 1NH6A 4ALAL 1MCBA 4JY6B 4XNUH 3OXRA 4AIZB 3RVTD 1FL6A 1G7MB 2H8PA 1VFAA 1WBXA 3DI3B 5GS1A 1MRDL 3E6HB 4QRPA 5I8EB 3NIGE 2UYLA 5IM7B 3UZVB 2XN9D 3GMOA 4GW1A 1J1OL 5FKAB 4Y16A 5B38A 1WZ1H 4KRNA 3LHPH 2VH5L 3OZ9H 2AV7A 2CMRH 4XTRD 2AV1B 1KPUA 2CKBB 3ARXA 2R8SH 4XMLL 3G6JA 3WFZA 2PXYD 1GGIL 3OBAA 4JZJC 4ZSOB 4D9RE 4NKDB 3MRMB 5F70A 1Q0YH 1F11A 4HEME 4LMQE 3EYSL 2DJSA 4P2RE 5EORL 1MCRA 3HPLB 1N6QH 4JFEB 1N5AA 4LLVB 4PS4L 3SGEI 3WIHL 2Z8WC 3SDXE 3B2VH 4HT1H 4S1DD 3NPSB 3RUGE 3ALXA 5ETUA 5JOEA 4JQXA 2ZJSL 3U4BH 1JGLL 4G6AC 3E8UH 3WN5A 1U91B 5DRNA 3HE7B 4M1DH 5CZXD 4NT6A 3BZEB 1BVLB 1PEZA 1YC7A 5K9OA 1OTUD 5TDPA 4M93B 2ZPKH 3MODH 5DUBB 1DN0A 4YHIA 3CC5B 4XH2B 4PBWD 4GBXC 4Y4KA 1HZHL 4E5XB 2VAAB 2ICWJ 3LKRB 1JRHH 4JHWH 1F5WA 3CDCA 2AJXH 4H5SB 4OLVL 1ZK9A 4L4TA 4OLZL 4JFQB 2HAZA 5C0FA 1C7TA 4ISVA 1JTTA 3WLBA 2XN9E 4JFDD 3CDFA 3SPVB 3FO2A 1YQ2A 2UY6A 5I8KH 3EO0A 5ID0B 5MEQA 1S7UB 1OT1A 3MRIB 4P5MA 1XZ0B 3VGAC 4JGJA 2MNUA 1IGYA 4JZJA 5E08L 3T0EB 4YQXH 3L1OL 1E27A 3OB0H 5LGHH 3C09C 1IEAA 3MREB 2P7TA 4HUMB 1S9KC 1UXSA 3TNMB 3QXWA 1YECL 3PV6B 4GKZA 1RUML 3VGHA 4JREB 5IHLB 3BT2H 1VFMA 4WO4C 4PFEA 4QHMA 5DK3A 2IFFL 3CSYB 3CX5K 3UCRA 5C0BB 2QTEA 3ULVH 1TJIL 3D85D 2C7UB 4YK4B 4P48A 4YNYA 5HVGB 3V6FB 4XVUD 4FQHB 3BO8A 1DQDL 5LJYH 4P9HL 4QLRA 4EKXA 1I8IB 3TZVC 4CVXB 3CH1A 4MJ4A 3QEQB 4G8FB 5CGYC 4NBYB 3MX0A 1H3GA 4GG8B 3KWWB 1MRCH 4K94C 1BQSA 4GBXA 1LO2H 1ZOXA 3RGVC 4FABL 1TTGA 3NTCL 3AY4C 2VWEC 2ESVB 1OSZA 2X09A 3FQRB 4KK5C 5EBGA 4RISH 1S7VA 2X4OB 1QRNA 2B4CH 2IAMC 4I13B 3TJEH 5CD5D 2G60L 3MJ9A 2J6EA 2Q7YB 2CXKA 2XTJD 5M95B 4MQ7B 5C0RL 3AFLA 1BQUA 4P2QD 3HG1B 1A7BA 1I7TA 2XV6B 3LEVH 4HKXA 1I85C 4EN3D 1F42A 3K8KA 1OGAE 2VXVH 3RY6C 4JJHA 4MMXC 5DJ2A 1TQCB 1RURL 4N68A 3OKMA 1C5BH 1YYLH 1B90A 2IQ9L 4N5ED 5HI4D 3FTGA 4WHDA 4F57H 2NY4D 3TNNB 4ZTOL 5IKCA 1IAKB 4NJ9L 3ILQC 2FIKA 4WNQB 3VFWA 5FOJA 2IWGA 2EDTA 5J9PB 1MJ7L 3OXRB 4KROD 4PRID 1FL6B 4WO4A 4MXWL 2H8PB 5FV2A 1A6UH 5DVOA 1NCTA 5GS1B 4QRPB 2UYLB 2N7BA 2PO6D 5MHSD 5FYLD 3GMOB 1A7QL 4GW1B 3FHAA 3LQAL 4HCRH 2HTLC 1UZ8A 5E0QA 4Y16B 5B38B 2IBGA 4R4FL 2AV7B 3MYJA 5HPMA 4XWOC 3TZVA 1KPUB 5CBEA 5KG9A 1T0MA 4JG0L 5LGJA 4O5LL 1FRGL 1S3KH 1KPVA 5I73B 3FRUA 4P59L 1PY4A 3RGVA 4UTBL 5D96C 3AY4A 3HE6C 4KKLD 2KQMA 1ZHNA 1DBML 3MNWA 3DXAD 3RQ3A 3V95A 2NY7H 5HHMB 1F11B 1JNJA 5D1XD 3AM8C 2LE9A 1N5AB 1LO0L 1KLGA 2IAMA 4MJID 4RA0C 3HNSH 4KK8C 4KH2A 1W0WA 4J2XA 4HCRA 1IVLA 5ETUB 4EI5B 2ITDA 4K8RH 2VOTA 5I19H 4Z7UF 2QL1A 3WN5B 5DRNB 2F54D 5I76A 3C2AL 4F2MA 2XTJE 4KV5F 4NT6B 1I85A 2E8YA 1EXUA 4IMKC 2PW2A 4K23H 3RWFA 4F58H 5K9OB 3QBTB 5TDPB 4YHKL 2DJ4A 3RY6A 2I9TA 4ELME 5GZOC 4PJAE 5CLTA 2B7DT 3OQ3B 3WIIL 1DN0B 5LQBH 4YHIB 2DJUA 1MEXH 3ZKNC 1QSEA 2EH8L 5EO9A 4Y4KB 1EO5A 4L8DA 1I75A 1YN6A 3LOWA 3FL7A 3MPCA 5HI5C 3O6FD 3EYQD 4XB7A 3TM6A 4L4TB 4PRIE 4GAJH 2VLKD 4KXZH 4KRMB 5C0FB 3GKWL 4ISVB 3WLBB 5KVEL 4PBXA 5MHSE 5ISZA 2P43B 3BYYA 3FO2B 5C3TA 3WXVL 3CH8A 1T6WA 3EO0B 1WCQA 4P5MB 2PYFA 1RZ7H 4JZJB 1JJUA 1KXVC 1E27B 3CDGA 4WW2C 1NSNH 1IEAB 1AO7A 3HE6A 2DAVA 4HAFA 4NN6C 3TCLA 5DVNA 2P7TB 1EGJH 3MXVH 1UXSB 5DVMA 4G80A 4QCIA 3KYMA 1FCGA 3DXAE 4TNVK 1HIML 3FN0H 4WTXA 3L3IB 4JEGB 3IDNA 3BSZH 4QHMB 3MOQA 3HNVL 4MJIE 1QFWI 4JFXA 4YNYB 5IBLD 3S5LG 4PJCF 2CD0A 4IMKA 1L7TH 1J1XL 5DJ6A 5H8DA 3LPWA 2DLTA 4JZNB 5T3XD 2DLEA 4JFED 1N59B 1P4BH 3QH3A 1KIPA 4GBXB 4LGRB 3E3QE 5CWSA 3CD4A 3ULUD 1U3JA 3H9SA 4XZUB 1KCUL 1OSZB 3MOAL 4ZUTA 3HE7D 4YHLL 3C6SB 3SDCC 3GRWH 4MHHI 2DMCA 5CMAB 4QRRA 1ZE3C 1DBAL 1QRNB 3MBEC 4JKWA 2X4QA 3MLWH 4Y4FC 4BQBA 2VLKE 1IAIH 4DGYL 4HKXB 1U3HC 1I3VA 5IBUB 4MXQD 3ZE2E 3DX7A 3VGAB 1CXKA 4N5UA 5DJ2B 3OKMB 1QLEL 4C55A 5TQ2L 3S6CA 5DO2C 3X3GH 1EVTC 4GAGL 4FFZH 3BX7C 3C09B 3FTGB 4WW2A 4XVSL 2ICEA 3BH9B 1GIGH 5IKCB 4J3UA 5IFHH 3QXAA 1NEZA 5EUOE 2FIKB 4D9LL 3VFWB 5JXAL 5EO0A 4GAFB 1D5BA 1MIML 3CIQA 3SKOA 3P4OA 5TJWK 1NFKA 4WO4B 4PJXA 4ZUUB 3TFKC 4YDJA 4HMEA 4AIOA 5GRJL 1G7JA 4NZRH 4RGMC 2IPTH 4EBQL 4FFYH 3T0ED 1UZ8B 9CGTA 3MV9A 3UX9B 3MYJB 5HPMB 4ZSOE 3TZVB 4ZOCA 4PJHA 3FHQA 1T0MB 3V9FA 5CBEB 5KG9B 5LGJB 1KPVB 4LCUA 1WCBA 1EO7A 1CLOH 3K3QA 1INEH 5T3XE 3FRUB 4XNYH 4JFEE 2HWZL 4HF5L 3RGVB 4XCCL 5C0BD 1ZHNB 3MNWB 3ULUE 2H3NA 4U33A 3RNKA 3SDCA 1NGQH 1T7XA 4YBQD 3SE3C 4H8WL 1KLGB 2IAMB 3MBEA 1F8TL 1W0WB 4Y4FA 1FNSL 5FYJL 2ITDB 1S78D 3QEQD 2P8MA 2AQ3A 4FN0A 4HS8L 3SDDA 5I76B 4F2MB 2OR7A 1U3HA 4NGHL 3O0RH 3S88H 1SBSH 1EXUB 4MJ2A 5DD3L 2PW2B 2ESVD 4OZHA 2I9TB 3MLSL 3UBXI 4X7SL 4PIRF 1FG2A 1Z3GH 4YR6A 5ACZA 2VE6A 4ACPA 1QSEB 1VFOA 4JDTH 4KQ4H 1HH6A 1IM3A 4L8DB 1JVKA 4AY0A 5MENB 3V5HA 1OY3B 3HG1D 4BJLA 3V0AC 2YPLA 5ECJE 3VDAA 4YUEH 1YQVH 1W72H 3EFFB 4NBZB 1YEIH 1OQXA 5ISZB 1XGYL 2WBKA 3T0EE 5KVGH 4FXKB 4ONHB 1YNKH 3B9VA 1HQRA 5DI8A 3MLVH 2PYFB 5HGAA 2FJFA 5C6WH 3CDGB 4N0FA 4QRPD 1AO7B 3HE6B 3MCLL 5D96B 1JHKH 3TCLB 3JWOC 4D2NA 4IRJC 3W9DA 5IEHA 2OL3H 3H42H 4AMKH 4TSCL 4QCIB 5C0BE 3TBVA 5F9WC 2D31A 3KYMB 4Y16D 3H9ZA 3SE3A 4NYLA 1KB5A 5D1QB 3IDNB 1DQJA 1OT2A 5DGQA 1OTSC 5DSCA 5TH2A 1T1WA 1CD8A 4NPYA 4JFXB 2Y23A 3QEQE 3RX8A 3OGCA 4R8WL 2DLIA 4U49A 4OCWL 3U46A 1MCHA 5H94A 5DJ6B 4PRHA 5HHMD 1WC7A 2ESVE 3MV7E 1LO3L 3ZZ1A 1ZANH 1MAKA 2OL3A 2IANA 5CWSB 5AUMA 2MMXA 2GJ6A 4NKQB 4NN7C 3WHE1 4EI5D 3H9SB 4C54A 5D2LE 1NDGA 3VFGH 4D9QD 2JELL 4HH8A 1BJ8A 3JWOH 4ZUTB 5EOCH 3HG1E 1BFOA 4QRRB 1N7MH 1DSFH 2X4QB 1I1FA 1MVUA 4LSPH 3VD3A 2F8OA 3WKML 1TQBC 1A5FL 2Q86A 5C09A 1IGJA 4OGXH 3B8SA 4Y4KD 4R4ND 1GGBH 5DMIH 4ODHL 3AXLA 3DX7B 3OKDA 4S2SA 5I1KL 1T21A 4L4TD 4WW2B 4NN6B 3G08A 1HCFX 2ICEB 3GSUB 4IRJA 3QXAB 1NEZB 4QRPE 1OW0C 5EO0B 1D5BB 2HT4C 2YZ8A 5D7SL 5DRZA 1RSFA 2QR0A 3NABH 4PJXB 1L7IH 4YDJB 4KKBC 3JV6B 2RFXB 3ESUF 2NR6C 1G7JB 4CGTA 1A47A 1KT2A 4XNXH 2X4PA 1MI5A 5E99H 3G6JE 5GS2D 4BZ1L 3KPOB 4JQIL 4FMKA 3MV9B 1HHHA 5C2BH 2VRAA 1BIHA 4NZTH 3DUHA 4LCUB 1WCBB 5H37H 3K81A 2EDWA 4QXUL 4NUGL 4Y5VC 3Q5OA 4I3GA 3P73A 1GGCL 4G6AD 2H3NB 1T5XB 4XP6H 3DYPA 4JKKA 4G8EA 3RNKB 3QG6A 3SDCB 1F02I 4W6XB 3K8LA 3QCTH 1CXHA 3MBEB 5INDA 1F3DH 3O8XC 2FX8L 4Y4FB 1QRKA 1EEUA 2P8MB 3VXSA 5CSGA 3FZUC 3GBML 5GJTL 4GBXD 5B38G 1U3HB 2P46B 1G1YA 4AG4H 1DBKH 4OZHB 3G5VA 3LCYA 3GK8H 43C9A 2BZDA 1T2JA 3D1MC 1P6FA 1FG2B 1CU4H 2QLVB 1QRND 4YR6B 5ACZB 2VE6B 3TT1L 4DW2L 1G9NL 4L4TE 1HH6B 4RAVA 1IM3B 1OW0A 3DNKA 4PBVC 2VB5A 3V5HB 3S7GA 3OAZK 4KZEL 4LASL 1NCUA 3B9KC 2YPLB 1DVFC 3BZ4A 4R26L 3GZKA 4RGMB 4N90D 2MHAA 5IB5A 5EZIH 3VRLF 4OKDA 3QXTA 3GNMH 4OUUA 3EZ8A 2DBLH 1JCKA 1HQRB 5DI8B 3CFEA 3PQYA 1FYHB 1EO8L 5HGAB 4X4MA 2FJFB 4NFDA 4WO4D 3OXSA 4Y5VA 1RUQH 3RX7A 4RSVA 5E8EA 2NY3C 5FA4A 1L6ZA 3ZO0A 4N0FB 4XC3L 4X6DB 3W9DB 1TTUA 2VDQL 3TBVB 1T2QL 1MELA 4NYLB 2WMPA 1A3RL 1KB5B 4OCSH 5FV1L 5C0AA 3BH8A 1DQJB 1RZJH 1V3LA 3O8XA 3GDBA 3TZVD 2WSKA 1NLDH 2WWKT 2C9AA 5TH2B 1T1WB 5CGYD 1K85A 4PG2C 4NPYB 3ZKSD 3OGCB 3RGVD 3U46B 1VA9A 2V6HA 4ODWA 5H94B 1WFOA 2ATPA 4M43L 4PRHB 4KK5D 3NBNA 1BMGA 1HE7A 1WC7B 3IETB 5J6HA 4OZGF 2FEDC 3QHFH 5F96L 1AP2A 3T4AA 5F9OH 2OL3B 5J57B 2IAMD 2VR9A 2IANB 5AUMB 1D6VH 2GJ6B 1QRNE 1KLFA 5I1IL 2DN7A 1DBJH 1NDGB 2VXSL 5E2TH 5DWUH 5KJRL 1A22B 4XNMB 1IZJA 3ETBF 3B9KA 5D93C 2KUTA 4FZEH 1BFOB 4PV8A 2OCFD 2V2TA 5IVZA 4JN2A 1H3WM 2AKRA 1I1FB 1MVUB 1A8JH 1MIEL 5JPMA 3E1F1 4U7SA 2Q86B 5C09B 1NFDA 2I60H 4N90E 3NOIA 1IGJB 2IGFH 1NCNA 1QSED 1UA6H 4LSDA 2ARWA 4HPYL 4MCYB 2ADFL 3ILQD 1UENA 1NMBH 2APBA 3OKDB 4M7LH 5MEND 2EE2A 4YFDB 1T21B 2EO9A 3ZDZF 3JBG7 1WZLA 5DF0A 3G08B 4HH9A 1AE6L 4I3SL 4D0CA 2XY2A 2HTLD 5GGVH 3VFUA 2IH3A 4OZ4A 5DRZB 5ISZD 2QR0B 3QCUL 2EKSA 2QHRH 1WK0A 2YSSA 5CINH 4XWOD 1NGYA 5KAQF 1KPRA 3RI5F 2X4PB 4PG2A 4NO0A 5EOTB 5HSFA 1AO7D 3HE6D 5IBUG 2FZ3A 4GXVL 2ILLA 1HHHB 2DRUA 2ID5A 4JPVH 5GGQH 2VWEE 1NUDA 2X70B 4NZJA 5I15H 1HWHB 1F6FB 5D1QD 4KK8D 5CEYA 4TSAL 3P73B 5FYKH 1HYSC 3MFFA 4NN7B 5L8LB 4ONFH 2GYSA 3C5ZC 12E8H 2R2HA 4G8EB 1AR2A 2XIDA 3QG6B 4POYA 4FXGA 3DO3A 2C1PA 4J12A 4OGYH 3HUJA 2GW5A 4YDIL 5GZOD 4HFWA 3MFGB 3X3FL 1TQBB 1VFUA 3P4NB 1EDQA 2NNAA 4DVRH 3HRZA 1AIFA 3ZKND 4LSQL 3H9SD 4E0RA 1QSEE 2EYTB 1RZFH 3G5VB 1MCOL 3OHXA 1MY5A 1BJ1H 2GUOA 5HI5D 4QRRD 1FSKC 3CMOH 3B5HA 5CJOH 3PDDA 4H1LH 3S37H 4RAVB 4PJGF 2E27H 4RGOL 3NIFF 3EYFA 3K4DA 3IXAA 5HVFB 5ISZE 2D7MA 5DDHA 4TN9A 2YD4A 2D4DA 4YE4H 1RFDH 2XT1B 1NPUA 2MHAB 5IESL 2FJGA 4CU7A 4MXVF 5D9SA 1HQ4B 4DKEH 3ZDYF 3F6IA 1B2WH 2DQCL 4Z8FL 1BF2A 2X4RA 4X4YA 1AO7E 1BGXL 1I9EA 3CFEB 3PQYB 4H1LA 3OXSB 2OQJA 4Y5VB 4UT9H 4OD1L 2Y06H 5DD1H 3C5ZA 3VA2C 1J8HB 4GRMA 1AFVH 4WIQA 3BRDA 3QQ4A 4PLJC 3MV9D 1CZ8H 3DV6A 4W68A 5C0AB 3BH8B 2R4RH 3O8XB 3LZFL 1FDLL 2O5YL 3JWDC 5DYOA 3UYRL 1DQML 3MRDA 2DI8A 1B6DA 3M1BA 3HA0A 3C5SA 4ODWB 1CDGA 2ATPB 2ATKA 3H9SE 2NY6C 4HK3J 3SDCD 1YN7A 5J6HB 3CLEH 1BQLH 1AP2B 2XPGA 1ROWA 1S5IL 3T4AB 2YRZA 1JPTL 1QBAA 3MBED 4H0IA 2WINA 1T7ZA 4Y4FD 4QRRE 3ARYA 5ENWA 1AQDA 1YEKL 5GS0H 3MRNA 4AEHL 5GZNC 4IJ3C 3UEZA 1U3HD 3IDJA 3H9YA 2A6JA 3VGDA 3B9KB 3T77A 3ZL4L 3DJ9A 1PG7X 3P77A 4PV8B 3VFRB 2V2TB 1DVFB 2X44D 5IVZB 1MJUH 4CN6A 4JN2B 4U6VH 4Y19A 2AI0L 2AKRB 3KPNA 1EEYA 4U3HA 1PSKL 1GGUA 3GSVA 1NAKL 5DD5L 5JPMB 1OAZH 1NFDB 3JXAA 4LU5L 4Y4HC 1KJ2H 4N0UA 2QSCL 5AWNL 4ZD3L 2GK2A 2OX5A 4ZMAT 3WD5L 1WF5A 2ENSA 2X89A 3TFKD 3F58H 4YIQA 2NY3B 2YPLD 1RZKC 3KPMA 5ID1A 3CFDA 4PJXE 5T1KA 3SGDI 5ERWA 4WHTB 2E8ZA 4HH9B 1YPZF 4L9LC 3SY0B 4D0CB 2V17H 3VFUB 1CWVA 3RNQA 2WNGA 5E5UB 3REVA 4QRTA 4B50A 3O11A 2EKSB 2YSSB 3ROLA 1NGYB 3MV9E 1ACYL 5HHXH 2YD2A 4K9EL 2IMNA 1MSPA 2NQCA 4HUVA 1DQTA 4NO0B 4QHNA 2H32H 7FABL 4PYGA 4JB9L 4OF0A 3D87B 3V4PL 2JJSC 4EI6A 2ZUQC 4LDOB 4KQ3L 4OV6F 4NM8L 5GSVA 5CEYB 2WK2A 3RIAF 1MCIA 2DIBA 5HHVL 4LPWA 2AQ1A 1RZKH 4I3RH 1NEZG 2PTTA 2R2HB 1EVUA 5HHPA 5IF0A 1RIUH 1UM6L 2D4FA 5D93B 2C1PB 4OI7A 4OD3L 2RHEA 4PRHD 3OKYA 3WCYA 1RIHH 5HGBA 3SKMB 3S34L 4OZHE 5DZLA 3GMPA 3HRZB 1NC4A 3BHBA 1AIFB 2IAND 2YEZA 1JPSL 3L5XH 3EJYC 3NCMA 4Y4HA 1KF9B 2GJ6D 2J12B 1OSPH 3PWLA 4E0RB 1DP0A 5ICZA 2LU3A 5E4IA 4WHYH 3OHXB 3WYRA 3BYTA 3K80A 2ICES 3VGFA 1OCWH 2YXMA 2YUZA 5AAWA 4P2OC 2GTWA 2YPLE 4L9LA 4NQUA 4RMQA 5IW1A 5GGRA 4HS6A 4ORGA 4TVPH 1MFDH 1CVSC 3EYFB 3IXAB 1R0AL 5DDHB 3N85L 4KKCC 5CKAA 5DC9B 2YD7A 1OOAA 2UZYB 1XF1A 3LS4H 2FJGB 4OFPA 3UYOD 5DQ9A 1A1MA 3FB7A 1INQA 5BO1H 5J1AA 4IEFB 4X4YB 3MRFA 3KAAA 3JTSA 2JJSA 4JG1H 5E9DA 4H1LB 5ALBL 2OQJB 1YJDL 2DKUA 3ZTNH 2O5ZL 1OTSD 4O2EA 2XA8L 3C5ZB 3DVIA 2YC1B 4GRMB 5F8RC 2EDNA 4Z7QE 1M05A 1R3KA 3QQ4B 5JQ6L 3DV6B 5BV7H 1MHEB 3L3JA 1XR8A 4ZO8A 3WNLA 3O6ML 1HHIB 2EDOA 1G7LA 4PRHE 5HHNA 5I8CB 4QY8A 1ED3B 5DYOB 3MRDB 2WUBL 3ORJA 2Z91A 3M1BB 2IANE 3BKJL 3C5SB 3VG0H 1JHLH 2GJ6E 1DFBH 3T0BA 2Y5EA 2ATKB 1LMKA 1YN7B 3HI5H 2XPGB 4PJEA 1FSKB 2VKXA 1FFNA 4G7VL 1HILA 1RUKH 3WS3A 4P2OA 2RJMA 3Q6GL 1AQDB 1OP5K 2XYCA 1UJ3C 1U8NA 3KHOA 4PP2A 4HMCA 1NMAH 1C1EH 3IDJB 5C09E 3V7AE 2A6JB 2B1AL 4HWZA 1CIUA 5JIIA 4UAOC 1U95A 4YJZL 3PGFL 3KPNB 1XAUA 1EEYB 3FB6A 3GSVB 5E8NA 1SJHA 5IMOA 5IBTL 4N0UB 1DJSA 3T0XA 5JHLL 5TQ0L 5JORA 5IIEA 2HT4D 2B0SH 5IMMA 2R69L 3D9AL 2FGWL 3SQBA 1HOCA 1TZGH 4YIQB 3H7BA 4KKBD 2YS4A 2NR6D 3KPMB 5ID1B 3CFDB 4RNRA 5T1KB 5ERWB 1P5UA 2VYRE 5KVDL 3GIZH 4ZS7H 1FLRH 3SGKC 3RNQB 1MI5E 4LK4A 3REVB 3QB7C 3O3EB 3O11B 3ROLB 4TRPL 4U6YB 2BCKA 2OJEA 1WISA 3G6DL 5SWZA 5JW3H 1LGVA 2ZKHL 3MLYH 3PQYD 4XPAH 4HUVB 5HTSA 3O4LA 1QKZH 3R1GL 3N1QC 3V7AG 4YXHL 4ZTPL 3DVNA 4QHNB 1CFBA 4MA7L 1P7KA 4TNWK 1J8HD 1FAKT 2NY6B 5CD3A 4FQ1L 1CDBA 4LLWA 3RAJH 1KLUA 4GW5A 3BRGC 4LLAA 2DYPA 3QDJA 4YX2H 4MSWB 5EUOF 5C0AD 3O8XD 4QHKI 2QBWA 1V05A 1UJ3A 1CTNA 4IDJL 4IJ3B 3FQWA 2PTTB 3FZUD 5HHPB 5IF0B 1IT9H 2EECA 3RP1A 3R8QA 5E70A 3CVIH 5DJCA 5IEKA 1EHXA 5HGBB 4FNLH 4LIQH 4OZFA 3GMPB 1JPGA 1NC4B 5TDNA 3BHBB 1T89C 2J4WL 4Y4HB 4J7RA 2XI9A 5DS8A 1XF5A 2R0KL 3LQZA 5ICZB 2EH7L 1J1PL 3RY5A 3JWDL 1IGIH 3B9KD 1DVFD 1QYGH 1N64L 2IJ0C 4BYHA 2GTWB 4U1HA 1DLHA 3EYUH 4L9LB 5IW1B 1ZV5A 5GGRB 4ORGB 3LY6A 2EE6A 4QHUB 3HB3C 3PL6C 3RL1A 3FQXA 4UUJA 5DQ9B 3PQYE 3I9GH 2NY3D 1A1MB 4X4ME 4XWGL 1INQB 4JJ5A 1MF2H 3FT2A 1MCCA 5J8OA 2NCMA 3BP4A 4NO2A 5J1AB 4HXBH 3O2WL 1B3JA 5BZDA 3MRFB 5DJDA 5H37G 1H3TA 2OP4L 3JTSB 5E9DB 2ZUQB 4Z5RA 5KSBF 3GSRA 4O2EB 1I7RB 5C0AE 4O58H 2W9DH 4ETYA 4BQ8A 3D18A 2WUCL 3UJTH 4NO0D 1M05B 3CVHH 1R3KB 4HQQH 4HUUB 2CUMA 1ZVSA 2VZUA 3L3JB 1U8OA 1ZMYA 2VSDA 3QULA 3FOMA 2FEDD 1K8DA 1G7LB 5HHNB 4KI5F 4QY8B 1T89A 5HBBA 2KL6A 5E2WH 4X7EC 3ZSTA 4KY1H 2Z91B 3NZHL 1U36A 4JZOB 5FCUH 4U1JA 2FGZA 1NUGA 1Q1JH 2NXZC 4WVRA 4PJEB 1F3RB 1EV2E 1FFNB 1HILB 3GSOA 1HN1A 4HGKC 1A6AA 4NDMA 3WS3B 4P2OB 4NQDD 1E4KC 3CVHA 4P3CH 1LO5A 3QEGH 4YXKL 3RA7H 3I2CH 5CCKL 1HKFA 1U8NB 1R24B 4ODUA 1CBVL 4PP2B 3A6CL 4CNIA 1FORH 1RU9H 2Q8AL 3PL6A 3ULSA 1NFDE 4HWZB 1ONQB 3PXJA 2W65A 2ADGA 1U95B 3RWCA 1KULA 1HSBA 3LS5H 4U6TA 1J0ZA 1AHWC 4YZFE 3FB6B 2F9BT 5E8NB 1I9RL 3LH2L 3C60C 4XMPH 5FUOL 3MRQA 4JPKL 1SJHB 5F89A 3BUTA 2YD9A 5JORB 1GOFA 5HJ3A 2DB8A 5IIEB 1V3MA 5IMMB 3F7VA 3V52L 1HOCB 2F19H 3WO4C 3IDGA 5D2LF 3IF1A 5KSUB 4RNRB 3BJ91 3RU8H 3CSPA 3PJSA 1KC5L 1GJIA 3BKCL 5CJXC 1UC6A 2BCKB 2OJEB 3NFSH 3WXWH 4JGMA 4Z7VA 5SWZB 2HH0H 5FEBA 5T33L 4NQXA 4HPOL 1PLGH 3DVNB 4UV7H 5FHBL 1HYSD 1SY6A 3MLRH 3M07A 1P7KB 3C5ZD 3BFOA 1WQVT 3R0MA 4XNUL 5CD3B 4LLWB 1KLUB 4GW5B 3TA3C 1JBJA 3I6GA 5DHVA 2DYPB 3QDJB 2IBZY 4IS6B 2UY7A 4MQXC 3PWNA 3HUJE 3TC9A 3EYVA 5T1MB 1UJ3B 3L5IA 4PV9A 5DVLA 3FQWB 3WJLC 3BRFA 1WZ1L 2V9TA 4UQ2A 4GKSA 2A6DB 3OZ9L 1VKXB 5T3ZH 2JKXA 1IAII 4BQ6A 3ARVA 4UAOB 1ZSDA 5DJCB 2BVUA 3G6JF 1X4ZA 5I30H 4HUWA 1AHWA 2C5DC 3I02A 1JI2A 4FQQA 4R4BA 4OZFB 3C60A 3OSKA 1JPGB 5TDNB 5I1LA 3OG6B 3QFJA 1EUUA 1RJLA 1QR1A 4GMSL 5DS8B 1ZS8A 2PTUA 1Q0YL 1XF5B 3MZTA 4IMLA 5AYUH 1N6QL 3BWAA 1EZVX 1MFCL 1I3GH 2Z0BA 1PYWB 3B2VL 4R90L 4N9OB 1T66C 5KW9L 1ND0A 1X5ZA 3U4BL 4U1HB 1DLHB 3U79A 3TWCH 3TT3L 4M1DL 3REWA 2VKWA 1UWXH 2CIIA 3VA6A 3FQXB 1RJYA 2VNCA 5CJXA 5DR5H 3MODL 4IOSD 2X89D 3CLFL 4UUJB 2Q3AA 1FGNH 4JJ5B 1WICA 5SV4A 3RBGA 3FT2B 5T1KD 3BP4B 4NO2B 2PETA 5BZDB 4JHWL 5DJDB 4WFFD 2YUVA 2AJXL 3TA3A 4PLJD 4A6YH 4KHXH 4Z5RB 1M7DA 4PB0L 4ZPTA 1W8NA 3GSRB 3NCCB 5EBWA 4LARH 5J12C 4X9BA 2XA3A 3WJLA 4LCYB 3D18B 3SE8L 4Y2DC 5I8KL 4G9DA 1U8OB 2NY6D 5FHAH 4OTXH 1EMTL 3QULB 3FOMB 3UTTA 4RMWA 1ADQH 4HUXA 4NFCA 4KTDL 4YQXL 5FK9A 5LGHL 2WWKO 4KDWA 2R1WA 4A6YA 3QDGA 5GZND 2ZNXA 1OAXH 4U31A 1IJ9A 2EIEA 1AXTH 4U1JB 4BFEA 4GOSA 1BFSA 4H1LG 3MJ7A 4JFZL 4L29B 3TPUB 2AXFA 1A6AB 4LVHC 3VGBA 3CVHB 1LO5B 2L0DA 3ULVL 4KMLB 4Y19E 4DN4H 5CJBA 4ODUB 1NC4D 1A21A 1MAMH 4CNIB 2IC2A 1QLRA 2FHCA 3PL6B 2WLYA 4Y4HD 1B9ZA 2P1YA 5I6XC 2W65B 3PWVA 2ADGB 3RWCB 2FH6A 4N0UE 1HSBB 5F6HJ 1ZGLB 1MRCL 1IQWH 1XGPA 3FAWA 3MRQB 5D7JC 1TVDA 5F89B 2JIXA 4L1HA 5J3HC 5KVFH 4KAQH 5I16A 5EOCJ 4Y5YB 5HDQL 4WFFE 3F7VB 2B4CL 3ULVF 3IDGB 3TJEL 4H88H 4M9OA 3IF1B 4L4JA 4OM1H 2R9HC 1J88A 4XCEB 4MZ3A 3DSFL 5JA9A 2EYRA 4I48A 2CO6B 4X7TA 4EDWL 3WSQH 4Y2DA 3EGSA 4IRZH 1WZKA 1AGEB 4G6KL 1ZLUH 1JNLH 1GGTA 3GEWB 3DPBA 1C5BL 4I1NB 4NQXB 4M7JL 4F57L 4LF3A 3P0VH 2D2OA 2PYEA 5KTEH 4YFLI 2VL4A 1QSZA 1CK0H 5E6ZA 3C6LC 1NANI 4Z7OE 1RJZA 2NXZB 3I6GB 5DHVB 1A6UL 1MHPH 3U48A 4ZFOA 5E8PA 1OLLA 2H9GA 4Y7MA 3PWNB 1ZHLA 3WFHA 3U0TA 1TENA 4UQ2B 4GKSB 3HKFA 3EJYD 1N26A 2CDGA 3ZYOA 1ZSDB 5F7YC 1S3KL 4X0KA 4HUWB 1AHWB 3I02B 4FQQB 4R4BB 3WS6C 3OPZL 3LEYL 3C60B 4AENA 4LHUA 5I1LB 3CFCH 5D7JA 4EVNA 1AXSA 1LK3H 4Z7WA 4XXCC 1RJLB 3JTTA 4P2OD 1QR1B 3WFBL 5F97E 4OZIB 1FL5A 1MPAH 1MWAB 3WO4B 1MJJA 3NA4A 3DBXA 3OTTA 1F3DJ 4KKCD 3IJYB 2VDLL 3IDXH 5I0DA 1J8KA 1ND0B 4HS3A 5C0DA 1CD0A 4H0HB 4K8RL 5I19L 3IDIA 3MLUL 3K1KC 3MR9A 3REWB 4NCDA 3UTSA 3UZEA 2CIIB 4F58L 3B5GA 5FO7A 3QQ3A 1JPFA 4ESKA 1Q8MA 4HZLA 1KCRH 1Q9LB 1IEHA 2FL5A 5LQBL 4G6JH 1S5HA 5E9DE 3MA7A 1MEXL 3BE1L 5FOBA 4B7IA 4E42A 3C6LA 3NH7H 4LRIC 3S3PA 3E6FA 3TA3B 1RAMA 1AXIB 1M7DB 2EDJA 1CGYA 4M9PA 4ZPTB 2XKUA 1HWGB 5SWZD 5EBWB 4NNPH 5T1LA 1E6JL 5E2UL 2ZOLA 1MWAL 2DMKA 4OCYL 4PJFA 2P42B 4G9DB 1CL7H 3NCJL 5FM5O 5EH1A 4F7EA 1RZ7L 4YPGB 4X5LA 3TBWA 1MFEH 3EFDH 3UTTB 4HUXB 3WS6A 2DYPD 3QDJD 5FK9B 4D3CH 1NSNL 4PJEE 4XXCA 1SMAA 3QG7H 5GRUH 4A6YB 4WHYG 3QDGB 4Q9BA 2VQ1A 1FIGH 2P4AB 2IPUG 1HYRC 3FN0L 3FONA 1MCFA 3MJ7B 3BSZL 3RPIA 2AXFB 1PGRB 5CP7A 2YD1A 5T1DH 3NCFB 1YEEH 4M4PA 1L7TL 5FM4A 1JK8A 1E6OL 3PWVB 1BJMA 4ZYKB 1BQHA 4YHOH 4CRPA 1AC6A 2FBJL 1FZMA 1V3KA 4IIQC 4QXGL 1XF3A 2A9NH 4S10A 5D5MF 3UTQA 2JIXB 1ORQA 4LRIA 1A6WH 5BCAA 3GRWL 5I16B 4XPHL 3J7HA 3GHBH 5J12B 5FO8A 1IAIL 2EYRB 5SWZE 2Q6WA 4I48B 4X7TB 3WIFA 4JGUA 4Y2DB 5FM5M 2R1YB 3EGSB 5JZ7C 3O4LE 1KXQE 4NQEA 3FO9A 4ZO9A 5GGTL 3TGXA 2LV4A 3X3GL 1NAMA 1KCSH 3B83A 3VW3H 4LF3B 4GXUN 2BFVH 1GIGL 3QDJE 4HKZA 5IFHL 3PWUA 2ZZUT 3S97C 4PJ5A 5A2FA 4S11A 5F7KC 3ZDXE 2CGRL 1Z6JT 4ZFOB 1IM9A 5E8PB 1FV1A 2DLHA 2H9GB 3O2DL 4LVHB 4NZRL 1U3ZA 3MUHL 1ZHLB 3WFHB 2IPTL 2GSIA 4FFYL 5EOQH 3U0TB 5AD0A 5I1EH 3QIUC 4JM2C 1BAFL 5I6XB 2CDGB 4PJHF 4X0KB 5C07A 2E9BA 3MRLA 4IOIA 4XNYL 4IIQA 4WEUD 4OBRA 3HC4L 4AENB 4LHUB 4J6RH 5D7JB 4U0RC 4EVNB 3FQTA 4Z7WB 2COQA 3EBAA 3JTTB 1A6VL 4FP8L 1QNZH 4EUPH 1U8IB 1NGQL 1DL7H 3HB3D 1FL5B 3PL6D 4NZUL 2Q8BH 1NEUA 3DBXB 4TTGA 4WJ5A 3B43A 3W39A 1M71A 4HS3B 2AJVH 3IDIB 3MR9B 5FIEA 5C9JA 1TETL 1QSFA 1YUHA 1SBSL 1WWWX 3UTSB 5FO7B 2DD8L 1JPFB 3DHJA 4HZLB 4WI2A 4GRWH 3NFNA 1BJ1J 2FL5B 1Z3GL 1ZAGA 1S5HB 3MZGB 3MA7B 4OZFG 5TE7H 1EHLH 3QR2A 5SX4H 1HINL 4ZODA 4JDTL 3TV3H 2W0LA 4KQ4L 3O9WC 4QGTA 4E42B 5CGMA 1SJXA 3E6FB 3HMWL 2DQJH 4AJ0A 5DT1H 3CPLA 2H2SD 1QFOA 2K9UA 1HH9B 3BQUC 5KOVC 1VESA 1YQVL 1W72L 1GL4B 1YEIL 3EIFA 5T1LB 3QIUA 4JM2A 3GO1L 1TNMA 2ZOLB 4P9MH 4PJFB 1YNKL 2MJWA 2A83A 4ZG1A 1RUPL 4HIXH 4F7EB 4GRLC 2BK8A 3TBWB 4PRNA 2ITCB 1B0GA 2XXMB 1W0VA 2V7HA 2NXZD 4PGDB 1P9MC 4WCYH 5IVOA 1A6PA 4XI5C 3CNKA 1JHKL 3KLHC 3H42L 1T2XA 3M8OL 4P49A 3ROOA 4AMKL 3PWPA 3QUMH 3WNPA 3FONB 4JFPA 2FR4A 5F7EL 1BWMA 1FGVH 3RPIB 5IT2L 5C0CA 5DD6A 1SVZA 2WBWB 4ODSH 4Z7QF 2DI7A 1UCBL 5E1HB 5CP7B 3C60D 3CXHK 1JK8B 5JNYB 4X9FA 1BQHB 3QXVA 1ZANL 1JZ5A 3TO4A 1I1RA 1FZMB 4MLSA 1VACA 3QUMA 3UTQB 3VFGL 4NP4H 2DWEA 3O9WA 1ORQB 5EOCL 4RGNC 1N7ML 2HT2C 1DSFL 3BQUA 3DGGA 5AG9A 4MNGA 2VDMH 5FO8B 1GZQB 4Z7VE 3TN0C 5BZWA 2Q6WB 3WIFB 2FECL 5D7IF 3O3BA 5HY9A 1WZMA 4GAYA 4OGXL 4P57A 2OTPA 1GGBL 3KYNA 5DMIL 4NQEB 4YFLF 4HBQA 4F15C 1NCAH 1F6LL 1OD7A 4QNPE 2VXTL 1KENH 3P9MA 3TA3D 1CFQA 4NRZA 3ZYJA 5GHWL 1P9MA 35C8H 1NAMB 4KKAC 5GIRA 4GUPB 4MQXD 5IROC 1BHGA 3PWUB 4POZC 4PJ5B 2NY2C 5BOZG 3WBDA 4J3OC 4X6CF 3B9DA 4XT1C 2OR9H 1QA9B 3GMQA 3QHTC 1IM9B 2YWZA 4XP1L 1A7PL 1FV1B 3ZE0F 4FMFA 4XNXL 4OCNC 3MOBL 1JYXA 2GSIB 3UTTD 5E99L 4JCLA 1FPTH 4MAUL 5AD0B 3V6OA 3QPXH 5J1SC 3ZKXC 2JF1A 3GUTB 3ES6A 5ITBL 5C2BL 3HMXH 1JHTB 4NZTL 3QDGD 3KHQA 3QFJE 3IRZA 4QOKA 5C07B 2CDFA 3MCG1 3MRLB 4IIQB 3B3IA 4OT1H 1T66D 1WBZA 4YO0A 2EE3A 3FB8B 1R3IH 3W82A 4XP6L 4GH7B 1U93B 1R5WA 3CFIC 1OGTA 3QCTL 4YWGH 3EDDA 4WJ5B 1N4XH 3RJQB 2Z92A 1IFHH 3W39B 1M71B 3TN0A 5C9JB 2VC2H 1QPXA 1QSFB 1YUHB 1BIIA 5CUSH 2AS5M 5BRZA 4AG4L 3SCMC 4M5YH 3LIZH 4FQ2H 5CEZD 2JIXD 1DBKL 2BY1A 2ZG3A 1E28B 3V8CA 2GITA 3GK8L 4LP4A 3NFNB 4QEGA 1MREL 2DOCA 3OJDA 3FFCA 2QQNH 5TPWH 1GHFH 4N9GA 4Y2DD 2D03L 4FHBD 3GM0A 3CPLB 3F7PC 5F1KC 1IGML 1SYSA 5I1JH 1B0RA 2XZQL 1CGSL 5EZIL 3QIUB 3GNML 4JM2B 3UTTE 1BBDL 3H2WA 2DBLL 5CJ5A 1DEEA 2Y5TA 3D2UA 4GRWB 1WEJH 2HFGH 1QPPA 4UV4L 2A83B 1YNLH 1L6XA 2AXJA 4WEBH 3W2DH 3QDGE 3GBNH 4GW4A 4PRNB 3IXTB 2V7HB 1RUQL 4YPJA 4K55A 3FMGL 4RFOL 4U0RB 3BP7A 3HCVA 1VFBA 3ROOB 4PJIA 2MPAH 3PWPB 1A9EA 1G9MC 4M4RA 5SX5H 2XACC 4JFPB 3QA3B 4S0TD 4OCSL 1RZJL 3UYPA 5C0CB 5DD6B 1NLDL 1MNUL 2X7LA 2YPKA 1RHHA 4FQCH 4XCNA 5B21A 4LNVA 1P5VA 4HWBL 4LHUD 1N5YH 4NFBA 5D7JD 1O7SA 3SCMA 1CF8H 4DKFL 1JF1A 5IVNA 5CEZE 2F5BL 1T7YA 4XVJH 6CGTA 1YEHL 4ODVL 5I1GH 4OLUH 2E9WA 4KK9C 2NZ9C 2WAHA 1D6VL 3TBSA 3MXWL 4Q97A 4NC0B 3STZA 2C3WA 2R9HD 1S9VA 4RDQG 4WFHD 5E2TL 5GXBB 5DWUL 2DWEB 3O9WB 1NL0H 2LABA 3O45A 4HK3N 3UTSD 1FQ9C 1ZXQA 3I6KA 5E4EC 2R56H 3BQUB 3DGGB 4MNGB 1BBJA 2N7AA 3MLXL 2I60L 5BZWB 3EO9L 4J3WA 2IGFL 3O3BB 5HY9B 4GAYB 1UA6L 4JM4H 2KDGA 3KYNB 1ZLVK 4BUHA 1P84K 1NMBL 5DZOA 4AT6A 1PG7H 3PHOB 5KZCB 2PYEE 4M7LL 2IMMA 4GRLB 3VXQA 5JW4N 1JGEA 1I1YA 3P9MB 1KJVA 1CFQB 1U8MA 1ZA6A 4NRZB 1CFNA 1QO3B 4TULL 4OSUL 5GIRB 1NGPH 2J8UF 4BZ2H 1CR9H 3WHXA 5IR1B 3STBA 1BFVH 3K74B 4UQ3A 2GQHA 4GT7A 2OZ4H 2ICCA 4AEIH 4K71C 1JNHA 2QHRL 4WY7L 4LQFH 3SJVA 3GMQB 1SMOA 3QCVH 3GSNH 1GZPA 2D7PA 4MD5A 3F7QA 3BUYA 5I1DA 1A3LH 1JNNH 3V5DA 3NCYS 3PDOA 2JLLA 1DUZB 3BOVA 5KANG 5ADOH 1WAAA 4XBEL 1G0DA 3ES6B 3NZ8A 3K4ZA 4Z7WE 1GGYA 1Q38A 4DEPC 4QOKB 3EYOA 4QRQB 5I15L 5A3IC 2R2CA 4ONFL 1WBZB 4YO0B 4HXAL 3KG5A 12E8L 5MERA 2AJSH 2WWMC 5EU5A 2V2WA 3LAFA 1R5WB 4WFHE 1U3YA 3SN6N 2A6IA 4RGNB 3O2VL 3HUJF 3KLDA 3UTSE 2Z92B 3BPCA 4QTIL 3MCKA 1S9WA 3QIWB 5ADPH 3TN0B 4DVRL 4UINL 1FZKA 2Y36L 1AD0A 1BIIB 5BRZB 4ETQA 4F15B 1G6RH 1HHKA 4ZNCD 2GITB 1EPFA 4LAQH 3CMOL 4NSKB 1QFUL 5CJOL 1IAOA 5GJSH 4LHUG 1ZTXH 3OJDB 2BOBA 3FFCB 4WTWA 1L9NA 3ZT5A 4HULB 4ELKA 3WE6A 1TVBA 2X10A 4N9GB 4PB9H 4NQED 5ESAA 2IQAA 1DLFH 1QP1A 4PJFE 1SYSB 1TITA 5E8DL 1B0RB 3KNBA 4DKEL 4URTB 2MQ3A 1G6RA 1B2WL 2L7JA 3P11L 3ZKXB 1DEEB 1OAQH 2Y5TB 3D2UB 2ZCLL 5INCA 4PJ5D 2XQYK 2C3GA 5L8JB 4GW4B 2V5TA 4UIKL 5E2JA 4ODTL 1IM9D 2JB5L 1I9IH 2Y06L 5DD1L 3BP7B 3HCVB 1VFBB 4I2XA 1AFVL 1KIUA 4PJIB 2BY3A 1H0DA 1A9EB 2H2PC 5I0ZA 2UVEA 1CZ8L 3L9RA 4CU8A 2R4RL 5GRZA 4X7CC 5CZXC 1J5OL 5C07D 2X7LB 2YPKB 4EDXA 1EBPA 4XCNB 3GMNA 5L9DL 2AGJL 3SCMB 3LRSA 2VDPH 1JF1B 1I9JH 3P4MB 2VXQH 3CLEL 1BQLL 1E4WH 3ARFC 1KUMA 2ENYA 3KVQA 3GMLA 4FS0A 4U1SA 1CD9B 3DX8A 3STZB 1FFRA 5GS0L 1S9VB 3IJHA 4K3GA 2WLZA 3U7AA 4F33A 3L5HA 1CLZH 3O45B 1QSFD 3QJHA 5JZ7D 1QLFA 3GJFK 1T4KA 1C5CL 1K6QH 1MJUL 4YBHA 5D8JH 1P4IH 4NQEE 1BBJB 4LVOC 4OGAC 4P46C 2ZCKH 2VDNH 1X5HA 1A14H 1KJ2L 2DQFA 5DFWH 1IEBA 3GMRA 4AT6B 1L9MA 3JV4B 3VXQB 1I1YB 4J8RA 1KJVB 1BQHG 1ZA6B 4PJ5E 5SV3A 1CFNB 3F58L 1IBGH 2LVEA 4Q9RH 3QP3A 4XCYA 2FB4H 3RVUC 3WHXB 1MRFH 4OLXH 4XHJC 4UQ3B 1KJ3H 1XIWC 3QIUD 4JM2D 2VZSA 1JNHB 4G8GA 1INDH 4ODBD 1PY9A 3ME0A 4Z0BH 5DLMH 4X83A 4LVEA 3SJVB 4KZDL 5F71A 5HHXL 1PFCA 2HT3C 4LEXH 4MD5B 4N0YH 3BUYB 5I1DB 3V5DB 1GYAA 2PF6A 5C07E 3PDOB 5DUML 4Q9QH 1GRWA 1WSST 4YLQT 2OYPA 4KTEH 3EW3B 3LDBC 3ARFA 2R0WL 4G42B 3EYOB 1VPOL 2W9EH 4LFHD 1YYMH 2CK0L 5C0CD 5A2IH 4I3RL 4YC2C 5MERB 1IC7H 1EIBA 5EZOH 3U9UA 5EU5B 4AEFA 2V2WB 3TH4T 4L4VA 1AD9A 3LVEA 2V5YA 2A6IB 2DLFH 3QDHA 4JFDA 1QSFE 5E4EB 4WI5A 2BVOA 3QZWA 1NGZA 4HBCL 4P46A 4OV5A 3MCKB 1S9WB 3T0DA 4FQIH 2IBBA 1FZKB 5K9KA 4JO1H 1OSPL 3BDYL 4ETQB 1HHKB 3O9WD 2KZWA 2F74B 4K3EL 4YEEA 4M48L 4LLYA 4O2CB 3KJ6L 1OCWL 5LAXA 3BQUD 4WGWB 3VWJC 1XIWA 2APXA 4ELKB 2B1HL 3VI3E 4I77H 3WE6B 1TVBB 4TVPL 4XC1H 4K71B 3HRPA 4XVTH 5IGXH 1OAKL 1A6ZA 2YD8A 5ESAB 1HXYA 2IQAB 4RFEA 1XGUA 4GRWE 5KZCD 4RWYH 4GRLD 5C71A 2LU7A 4K07A 5IW3A 1V8HA 3LS4L 5MP6H 3KNBB 2HJKA 4KUZH 1F45A 4XI5D 5BO1L 3KLHD 3AREB 3G5ZB 2GSGA 4BQ9A 5INCB 4CDHA 1DN2A 4JG1L 4DEPB 4F3FA 4O4YL 3C08L 2DQDL 1ZLSH 3PWPE 1NCDH 5IMLA 5ALCH 5HPOA 4PLOB 4JVWA 5D1XC 5L6YH 3O4OC 5F9DC 4M5ZL 4I2XB 5C0CE 1TFHA 4OQTH 4MNQA 1E0OB 3MMEA 3F7YB 3L9RB 5K9JH 3S35X 5BV7L 4WI8A 4P2QA 1U2HA 3X12A 1KTDA 5FYLH 3RHWF 1H9VA 4JR9H 1GOGA 4QOKD 2YPVL 1OP3K 4EDXB 3GMNB 1CE1L 1LP9A 2DIAA 3HC3H 3VG0L 1JHLL 5DQDL 2AQ2A 4OIIL 5EO1A 3HI5L 4JRYA 3SHSA 1MOEA 2I5YH 3KPSA 4RGND 2HT2D 1UM5H 1RUKL 5ICYB 3MRPA 2XQBH 4U1SB 2DQTH 3VWJA 3IAPA 3DX8B 1OARL 1FFPA 3QIWD 3IJHB 3TN0D 4MNGE 4YXLH 1RVFH 5KS9A 4F33B 1C1EL 3QJHB 3CK0L 1T4KB 5BRZD 4LFHG 5FGRA 1UH3A 1MRDH 3IVKA