4GSDH

H5.3 fab structure
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
VQLQESGPGLVKPSGTVSLTCAVSGGSISSSYWWSWVRQPPGKGLEWIGEIYHSGNTNYNPSLKSRVTISVDKSKNLFSLKLSSVTAADTAVYYCARVALFDILTGGWFDPWGQGTLVTVSSAGTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H5.3 Fab Light Chain
publication title Human antibodies that neutralize respiratory droplet transmissible H5N1 influenza viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2012-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gsdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gsdH01
4YK4C 5KSAD 4QOKD 2HLAA 1OCWL 3JV4B 2ATPA 5IOPB 3WDHA 4GG6F 4OF5A 5LGHH 3WS3A 3LN9A 1MCEA 2IFFL 3RVXD 2HT4D 2HKHH 3V4PL 1O0VA 1MFDH 1CWVA 2ICWB 2ZG2A 3WL9A 4AZ8A 1RUAH 1BVLB 2NY0C 2YKLH 1F02I 3FFCD 5C09E 4I3RH 3EOAB 5CJXC 3UBXA 3AVEA 4DOHB 4E41E 3S34H 3FFDA 1GHFH 3BP7A 5TQ0H 4E41A 1PJ9A 3FT4A 3RVWD 3KXFA 4QEGA 4RIRA 2E7BA 5CINH 4K94C 5C0BB 4HK0B 5EUOE 2RFXA 1B9ZA 2FIKB 4LU5L 4P23C 4J3OC 3SQOL 2JJVA 3WNKA 4DKEL 1QYGH 4NZTH 1C5DA 1U58B 1VPOH 5BMFH 1I1AB 4LSQH 4GRMB 3SKMB 1KIRA 2Y06L 4JZJB 3MYJA 3QXTA 1KPUA 1T0MA 1NMAH 4NNXB 1AO7E 4Z7WB 1AO7A 1PEZA 3ARXA 2Z4QA 2UY6A 1OAQL 4HUUA 5CZXC 4GXVH 1AGFA 4FNLH 5F3BA 2DI9A 4ONFL 5TDNA 4BM7A 3QXAA 4JHWL 3U0PB 3UTTA 4WWKD 2QADD 2BY0A 1MI5B 1N5YL 4MJ2A 3BISA 4MJIE 3DVFA 2K7QA 3GNMH 3OKKB 2PO6C 4NQTA 1QHOA 5D7JB 1CFVH 4MA8L 1T3FA 2HJKB 1V3LA 1JRHI 3HS0A 4JY5L 4RDQG 5A3IC 4CU8A 4XAWL 5ADOH 2V9RA 2JJWA 2I60L 3QP3A 1ZLWH 4EI5A 1LGVA 3MMEB 3TYFA 4J6RL 5C0AE 5IMLB 3MCG1 4HBCL 2EECA 3WD5H 5K93A 4LIQL 2NY1C 2KL6A 5C0AA 5C1MB 3ULUE 1JTOA 4WHYH 4FG6D 4YHOH 3KYAA 3ARDB 3PWLB 1A6TA 2DM7A 1YDPA 4BZYA 1DBBH 1EO8L 3IRPX 1J8HE 3MLZH 4MAYA 3GZKA 1ZLSL 4XB8A 3G5XB 5GHWL 1ROWA 3OG6B 1G9MH 1F3DJ 1OAZH 3V4VL 3QFJB 1GAFH 3OR7A 4KKAD 1CD8A 3P4OA 1CF8H 2Z8SA 4LCYB 4X5LA 3TPUA 1AHWB 4HWEH 5DK0A 4OKVA 4JFDB 5E5MB 3VG0L 1TPXC 4P2RD 1CFSB 1I7RA 2VUOA 1MVUB 3C5ZA 2EDEA 4PP1D 1J8KA 5JIIA 2J5LC 4O9HL 4LLVB 5FYJH 1D9KD 3LHPL 2Q7YB 2ZG1A 2DLFL 4JPIA 4MD0B 3DSFL 1DBKH 2HTKC 2KBGA 3FRPG 4HD9A 4ELKB 4MJ6A 1T1ZA 4NKOB 3PXHA 4N0YL 2F8XC 1XGPB 1UEMA 1I7ZA 5IJVB 4FQIH 4F7CB 3SDDB 3U83A 2M2DA 1JGLH 1IMHC 3STLA 3ARUA 4FFYL 4L3CA 1A21A 3O6KH 4IRSD 4PJ5E 3RKDD 4QRPA 1S7UA 3RRQA 1JNLL 5F8RC 5JPMB 4JQXA 5J8OA 4JDZB 1WEJH 4O2FA 1UCBL 5JQ6L 3T0EB 1S7TA 1XIWC 3OPZH 4K3DH 2VH5H 3UTZB 4Z7UF 1I1FB 2HMIC 2N56A 1HHGB 3ZSTA 3KYOB 2EDDA 4WY7H 1FO0A 4PJDA 5E4IA 4J2XA 1BOGA 5DRWB 4P2YA 4B53A 2J88L 4D8PA 4GG6E 1S7RA 2B5IB 4R4FL 3VXRD 1XCQA 2LAAA 2HRPL 3EZJB 1MCIA 5HD8D 2ZCHL 4ZUTB 3SDCB 3CFKB 2N7BA 1QBML 5FYLD 3U7AA 3UYRL 4GKSB 5HI3D 1HYRC 2P8MB 4HIJB 4M93B 4M6MH 4IS6B 3MR9A 1A3RL 5C0GB 1DVFA 5F9OH 2COQA 1U9KA 3VXUD 4XBGB 1WSST 3ZKXB 2BOCB 1UACH 4MX7B 3ROOB 5BS0D 4KK8D 3ARSA 3IVKB 4OSUL 3IU4L 4NWUH 1R3KA 3L3JA 2D9CA 4LQFH 4U6YA 5T3ZE 2F53D 2C4FU 4Y5XB 2ZCLH 4MDJA 4UINL 5HBBA 2DM2A 1C16B 1SMAA 4F7MB 3PHQA 2CUHA 4Q58C 4OFDA 4JFHD 3L6FB 2OTUA 1CFBA 5BW7A 1MREH 2W9EH 2G75B 1FE8H 3G5ZB 1IEAA 3CSGA 1TQBC 3BP6B 1C5BH 1NUFA 4Z0BH 1J05B 25C8L 4JFPA 2V5MA 1SYSB 4QXTA 1ZLVK 3QSKB 3K74B 4G6KH 3I02A 3RNKA 1JZ7A 2X44D 3CXDL 3DYPA 5T1MB 4UAOC 5C0RL 5MEQA 3FO1A 2LAGB 3O2VL 3QB7C 1XF4A 1B88A 3TA3D 1H0DA 2W9DL 1MSPA 2OCFD 1OP3H 2BVPB 1HSBB 3GSUA 5L0QC 5I73B 3G5VA 2ZJSL 4J8RB 4PRPA 3T0WA 3CFBA 4KI5C 5C0DA 4YHPA 4TOYL 1NGPH 5IROC 4KHTL 3W2DH 1UM6L 3T08A 1IL1B 3CSBA 4WGWB 3X3FH 3DNKA 4D9LH 1I9IH 3RWHA 5TE7H 1DANT 1YN6A 3VFTB 3CFDA 1K4DA 2NX5E 4UT7H 3QAZB 1FLRH 2C3HA 3MV9A 4FQCH 3HG1D 1T2XA 4P46C 2WWKT 5IB3B 4ODUB 4BFGA 5HVFB 5JOFB 1G7QB 5SWZA 1QRKA 3V5KB 4UTBH 2DJUA 3ZT5A 1WC7B 1Q38A 3AREA 3QQ4B 5F97E 1T7ZA 1X7QA 3U9UA 2KPNA 2DDQL 1AD0A 3TEUA 4AIXA 4ZTOH 2EDXA 2VN4A 2UZIL 1N4XL 2IAMA 3E6FB 3NPZB 1ORQB 3R06B 4JN1L 2YA0A 3N9GL 4I77L 2CDGA 4XCFH 2F54E 43C9A 3KLHC 1WFUA 1XF5B 3P4MA 1T66C 2JJTC 1A1OB 2NW2B 4OUUA 1I3GH 4Q74A 5DUBA 2OL3B 3G6DH 5HDLA 4RFNB 1E6JL 4LSRL 3O2DH 4HV8A 5K9QG 3QQ9C 1ERNA 1VENA 4LPVA 3F58L 4YDKL 2VZSA 4LLMB 2IH3B 3HAEA 3EDDA 5FYKL 3V95A 1NGXA 3NCFB 4WHTA 2UZXB 2NNAA 2VXQL 3QEQE 3WSQH 2EEAA 5E5UB 1OAXH 1MHEA 2VLKE 1IE5A 1JGEB 1HHIB 2VLKA 4Y1AA 4Z7UE 4DVRL 1KELL 1MRFH 2KH2B 4OD2A 3OR6A 1KTRL 4S2SB 4NFCA 4WEUD 1QA9A 2WUBL 3FHAA 4OLEA 1CG9B 5ESAA 3LKQB 2ESVB 3EGSB 3H3BC 5CKGA 2OXHA 5DYOA 4KFZC 3KPNB 3L3IA 4XGZB 1CU4L 4JFOB 3V7AG 5DJYA 3OKNB 1PYWB 4PJBF 5CEYB 1REIA 1U92A 1YMHB 1ZT4B 1KB5A 5CJ5A 5IEHB 4QRUA 3NFPB 3B9KC 3VGGA 4RGND 4MDIB 1UZ8B 3VXPB 3FO0L 4HIIB 4ZMAT 4GXUM 1NFIB 4G8IB 3LEVL 1RVFH 1T03H 3QDHA 3V5HA 4V1DE 2E8ZA 4MWFB 4JGJA 3WDJA 3PGDB 5FO8A 4PRNA 5CD3A 4UNVA 2P47B 4G7YH 4DEPB 4GAYB 1JJUA 3E2HC 5EOTB 1OTUD 1MF2L 1OCWH 1CICA 1KCRL 3EFFB 4QOKE 5KSAA 4QOKA 4FHBD 4PGDB 3PHSA 3PWPB 3QA3A 1WBXB 4LVNC 1QLRA 3V4PH 4JRWA 3RU8L 3AY4C 1YY8B 4L8CB 1BEYL 1Q9OA 2RAMA 5C6WH 1FNEA 4RQQA 5DMYA 3GB7A 1FVEA 2HLAB 1X5KA 4P2QD 3MV7D 4RGOL 1X9QA 4F9LA 3VW3L 3MOBL 4PV9A 3WIHL 4XZUA 4PGZA 3FFCA 3WS3B 5ETUA 2GK2A 4EZMA 5MEOB 1S7XA 1W72A 2QQLL 1RIHH 2PXYD 1HE7A 2PCPA 3LRHA 5KOVC 1HHJA 4LU5H 2MKLC 4DKEH 3SQOH 5HY9A 4WI6A 5HI5D 4QXUL 3UBXB 4FA8A 3BP7B 4NQXA 2X2YA 3C08L 4E41B 1JYXA 2APTA 4PUBH 2LVEA 3KPLA 5DC4B 4HH9A 4RIRB 2Y06H 5IHZA 1TMCB 4NQVB 1M1SA 1DZBA 5IVXF 3V0AC 5E8EA 1G7HA 5EU3A 3BQUA 3QUYB 4P99A 5GS3A 2RFXB 5EUOB 5MP6L 2VKXA 2HT2C 3L5WB 4G43B 1OAQH 4NN5B 1PQZB 1C5DB 3AS1A 4Q6YA 1MCWM 1KT2B 2W9LA 4ONFH 4R6UA 2LU4A 1DQMH 2WIMA 3FQUA 3O3UN 4TRPL 4ZNEE 1DBJL 5DHXB 1KIRB 1PW3A 4MB4A 1N5YH 1T0MB 5IFHL 4GW1B 3BPLB 1IVLA 3SGDH 4WWKA 4I0CC 1AO7B 5JOEA 4AEHL 4R96A 2BNUB 3RWDB 1K5NA 3VWJC 1AGFB 1I9RL 4Y4KB 5IMOA 2HRLA 1SEQL 2R23A 3VH8A 3NFSL 5TDNB 1T7VA 3B9AA 4XAWH 3AM8A 4LSPL 1NLDL 1LEGB 2VZ3A 3BPNC 4K7PL 5DD0L 4LIQH 1F4WH 3BZEA 3RA7L 1VFBA 3FO2B 2AP2A 1HEZB 2A6JB 4O51A 5HI4C 1B6UA 1T3FB 3T3PF 3HS0B 4U3HA 4G9FE 2E6JA 1EO8H 5DVLA 5EO9A 1WBYB 5FUCE 1ZLSH 5GHWH 4EI5B 3DO3A 5ITFB 1MQ8A 5I1GL 5C0AB 9CGTA 3A67L 3V4VH 1BX2A 3BPCA 4XNMA 2Y23A 3TFKD 3VGDA 4P4KA 4MA1C 2P49B 5SV4A 2Q20A 5J57B 1OOAA 1A6TB 1FCGA 1YDPB 3AU1B 3FRUA 3X13A 5CGMA 3RI5F 3MV11 4OZFB 3D87B 3RX7A 5C7XL 1J8HB 2DLFH 4KK5C 3UTPD 5I2IA 1K3IA 4P2RA 1ZLVH 1JWSA 2Z8WC 3DSFH 1CVRA 2OR9L 2CKBA 1D9KA 2CLVA 3OR7B 4K3EL 4N0YH 1KJMA 4PJBE 2NY5L 5KZCB 4YO0B 5DK0B 4OKVB 3SCMC 2XY1A 4QHLA 2FGZA 2V2TB 1I7RB 4LBEA 1RY7B 4FFYH 4U1JB 1EO5A 3C5ZB 5FKAA 1MJ7L 3A6BL 5EORL 1FFPB 1JNLH 2X4UB 2NY6B 5DZNA 1R5IB 3AS3A 2ZOLA 1JN6B 1FSKC 4IRSA 4JZJC 1UCBH 2X4PB 4MD5B 5JQ6H 4UUJA 2X5PA 4YBLB 4XXCC 3DX9B 3Q3GA 4S0TD 3H42L 5GGSA 1JK8B 4L3CB 2CGRL 3L5HA 1S7UB 2IPKA 5A2KH 1CLZL 4PJ5B 4GQ9L 5ID0A 5J1AA 2J88H 3CLFH 4ODXB 2HRPH 4U2YA 2PN5A 2EIBA 2GJZA 1QBAA 1Z5LB 3VXRE 2AV1A 2ZCHH 1S7TB 3CZFA 3VXRA 4V2CB 1JNHA 4TQEL 3D25A 1QBMH 2DIBA 2JKXA 4L5FL 4XNUL 1FO0B 2Z8VC 2DN7A 5FUOL 3WYRA 2XTLA 4DQOL 5FYLE 4YC2C 2B7DT 1UJTA 1S7RB 1A3RH 1XCQB 3TNNA 4GG6B 4NKDA 4XCYA 3F7PC 2G2RA 4X7DC 5L9DL 1W0VA 1NKRA 4MA7L 4C59B 4I4WB 4OSUH 5F89A 3VXUA 1DEEB 2ED9A 2WIIA 5BS0A 4HJJH 1DR9A 2FR4A 3TYGL 5IF0A 1JPST 1NC4D 2F5AH 4UINH 2F53E 1B0RB 2YUVA 1YA5A 2F53A 4LVEA 2W0LA 2FGWL 3CVHB 2VZTA 3UTOA 2XOTA 5IVXE 1EX0A 3VFVB 5IVXA 4QTIH 3LB6D 4JFHE 5D71L 5CAYB 1S5HA 2CDEB 5DXWA 3L3JB 25C8H 4Z7QF 5TF0A 4LGPB 4F9PC 2CXGA 2C3WA 1AH1A 4H25A 1JRHL 2XTJD 3CXDH 5ADPL 4NGHL 5C0RH 2NXZD 3O2VH 3K8KA 2C4XA 4YHZL 3V0WL 3TVMD 1Z6JT 3PHQB 5L8LB 2W9DH 1KEGH 1WZKA 4E5XB 3FB8A 3MPCA 4P4RA 2ZJSH 3TA3A 2BVQB 5J1TC 1IEAB 1E4KC 2KZWA 5JIKA 4QXTB 4P5KA 3I02B 2QL1A 4KHTH 1A8JH 4IMLA 2DOCA 1T83C 5MEQB 1UM6H 3FO1B 4UDUA 1P4IL 4G8EB 1XF4B 1SQ2N 3C2SA 3WLWD 1RK1A 5L88L 3T0EC 1BWWA 4R0LB 2H45A 1T6WA 5EZLA 3QG7L 4YHPB 1X5AA 2ATKA 3BEWA 3T3PE 2YPLE 3HG1E 5IW6B 3HG1A 4NRYA 4PJ8D 4HUNB 3CSPA 4LL9A 4R2GD 5DJDA 3LIZL 4Y16D 4GBXB 3BXNA 4LQ1A 3CFDB 1Q94A 3RWCB 2DDQH 1GC1C 2BNQD 3C5JA 3MV9B 3VXSE 4HH8A 3E0GA 1N4XH 4ZNCD 4HIHA 5HVHB 1BQHG 4W4OA 4QHNB 2YD1A 4WNQA 4BJLA 4JN1H 3N9GH 4I77H 4HUMB 3PP3K 3HB3C 2FIRT 4JZNB 3LQAL 2XPGB 2OR7A 3HE6D 1WIOA 3U9UB 1IEBB 1AD0B 5IW1A 1JBJA 3U36A 1E6JH 3L3OA 4LSRH 1DANU 4HLJA 1OLZA 2B4CL 2WBJC 3BSZL 2PUQT 2AKRB 3F58H 5ALBH 4YDKH 5A40E 1W2KT 1J9CT 5FK9A 4KK9D 3OBAA 1IQDA 4ZAKC 43C9B 4UOW0 5FYKH 1TNNA 2WWKO 2F54B 2VXQH 5F1SA 3MBED 2W0FA 4PJCF 3QIUD 4OZFG 3EBAA 5F88A 5D1XB 4DVRH 4QTHA 4HV8B 1KELH 2XXMB 3F65A 3ZL4L 5GRYA 4EN3C 1U8PA 2WUBH 3LKOB 3LKPB 3WN5C 5EZJA 3PNWA 4BKLB 1YEGL 3HAEB 4KWUA 1OD9A 4ZO7A 1CU4H 3QO1A 1WCQA 2NNAB 4XHQA 5KBNC 2C1OA 1EH9A 3ESVF 3QEQB 5CEXA 1F3RB 3NCCB 2VLKB 4Y1AB 5HHQA 2BNRD 5IIEA 1JF1B 4OD2B 3OR6B 4Z7UB 3QEHB 3RBSA 3FO0H 3O41A 4EI6B 3KPOB 3LEVH 4RGNE 5DYOB 1HI6B 3L3IB 5CWSA 5DJ2B 2VZOA 5TDPA 1DQLL 5CSBA 1FC2D 2DM4A 1U92B 3QAZC 1KB5B 5DO2C 3TH2T 1HQRA 3C2AL 1MF2H 1KCRH 1AQKL 3LPGA 5GRJL 2A9ML 1ZSDA 3R1GL 3MUHL 3V5HB 1GPOH 3QUZB 2H41A 5FO8B 15C8L 4PRNB 5F9WB 5CD3B 1BD2D 3KVQA 3VXME 1BEYH 4KUZH 2EDRA 4YLQT 1CICB 4RGOH 1G7JB 4Z7QE 5DK3A 3EYQC 5FIEA 3MOBH 3WIHH 1PG7L 4QOKB 8CGTA 4QXWA 5EU6A 3MV7E 3WFEL 4OF7A 5EOCJ 2X4RA 4P2QA 3MV7A 1GGCL 2QQLH 1J0KA 5E8NB 2WMPA 1Q9OB 1QRND 3EJYC 1SEBB 2PXYA 1FNEB 3GB7B 1FVEB 4ZPVA 1WBZA 4RFNC 4QXUH 4LCWE 2YN5A 4FFWD 4ZUUA 3C08H 1EEUA 4M9PA 4HK3J 3L3DB 1S9XA 5JORA 5J06A 5EBWB 1MOEA 5ETUB 3DVNA 3MRCA 5HGHB 1S7XB 1Q0XH 5C6TL 1A2YA 1BBDL 3WV0A 1HHJB 3SKNB 1V3KA 2XQBL 4FP8L 5HY9B 4EXPX 2J8UF 1EMTL 1IFHL 3KPMA 4Z7OF 4ODBD 4TRPH 4HH9B 4L4TA 2DL2A 3UEZA 4HS8H 2C5DC 2NZ9C 5IFHH 4HUXA 1IGTA 1G7HB 1TQCB 5EU3B 2WLYA 5CBEA 3X14B 1GIGL 1N64L 2EO1A 5TFSL 1FVCA 1I9RH 1NCCL 3QNXA 3IU3B 1A1NB 1KC5L 3S3PA 2HT3D 3FQUB 3IFOA 3PWNA 3RY6C 3S36L 5E1AA 1NLDH 2QSCL 5HHNB 4K7PH 2MWCA 1HH6A 3EYFB 5CILL 4YBHA 3RA7H 3VI3F 2O5ZL 4WWKB 4NP4L 2QADB 4WHDA 3DRQA 4R96B 4DEPC 1MCHA 1K5NB 5SX5K 4P2OD 1UEYA 3VH8B 5IMOB 1JIBA 5GRVL 3BOVA 3UBXI 4XNXL 1IQWL 5IWLA 4MZ3A 5CIPA 35C8L 4PD4J 3E3QC 4XVSL 3UAJC 3W0WD 5I1GH 3CXHJ 2H8PA 1NEZG 1QNZL 1KNOB 3A67H 3BZEB 4G9DA 1LE9B 1RZFL 2DTMH 4O51B 3I85A 5I1DA 4PJCE 2PR4L 4UQ2B 3PWUB 4TTDD 4G5ZL 5EO9B 4HX1B 4PJEE 4DGYL 5C7XH 4C57C 2MJWA 2V2WB 4UNTA 3H3PL 1KIUA 4F37F 3UTPE 1BX2B 4HMDA 3BPCB 4XNMB 3BD3A 4RA0C 3QXDA 1F90L 2Q3ZA 3PUCA 4LSUH 4K3EH 4M5YL 2NY5H 1UQSA 1QVOA 2NYYC 3FRUB 4N8VG 1D3CA 4XC1L 1EEQA 3M17A 3A6BH 5EORH 3MLWH 1RUQL 3V2AR 3UP1A 5I2IB 1JWSB 5FKPA 4MAUL 2BXZA 2DQEL 2YXFA 2A6IA 4HS6B 3WNLA 5EOQL 2CKBB 1YYML 1D9KB 1KEML 4YFEA 3RDTD 1X4ZA 1KJMB 1Z3GL 3MLYL 3WFHA 4ODSL 4NO3A 4PJBB 3FN0L 4ODTH 2QJDA 4NN5C 4QHLB 2JIXD 4LBEB 2CGRH 1W8OA 2E6QA 5IK3B 2OK0L 4CAGA 1CLZH 1WQVT 4P59L 3DGGA 2VUYA 4WFHE 2ZOLB 3ULVH 4UDTA 1UWEL 4IRSB 4BH7A 1TCRB 5BXFA 3EOTL 2IADA 1BFOA 3BPLC 1QFWI 3DXAD 5GGSB 4L5FH 3VFSA 4N8PA 4XNUH 4X6EA 3UJTL 1F11A 5IBTL 4DQOH 2IPKB 3REWA 4YHMH 5ID0B 5J1AB 5HYSA 1P4LA 4TVPL 5IBUB 1U6AL 3ARFA 3ZSSA 3G6JF 3JWDH 1INEL 4H0IA 4QHMA 5L9DH 3CZFB 1RSFA 1GZQA 3VXRB 1L9NA 4MA7H 1JNHB 3D25B 3PP3H 1EIBA 5GRVK 3VGHA 3ARRA 1U8NB 2G5RA 4IEFB 3TYGH 1AGCB 5E8OB 3MUY1 3OAYK 3TNNB 4PLJC 4XCYB 3MUGA 3OKLA 2FGWH 3DROB 1NC4A 5CLTA 1W0VB 2G5BA 4DGVL 5D71H 2EYTB 4HWZA 1J1XL 1MFEL 2FL5A 5F89B 3VXUB 2J8UE 1SJEA 2LTQB 2IH1A 2WIIB 4XP9H 2J8UA 1JRHH 5ADPH 2FR4B 4Z7OE 5C3LD 2GTZA 4MAYC 2J8OA 3GMOB 4G7VH 4YHZH 3V0WH 4JDTL 2O5YL 3MRRB 2YMXL 2F53B 3IDNB 5D1QB 3N1FC 4M48L 4XVJL 4OLUH 3DYMA 5IVXB 3TVMA 5JLZA 4KTDL 6FABL 3HPLA 2XNAA 5I1AA 3P77A 4MVBD 1QLFB 2E27L 4LKCA 5AAWA 3C5ZC 4HXAL 3ZLQC 1H3XA 5D6CA 1E27A 1XH3A 3RIAK 1P4IH 4WU7A 1LO0H 2NY6C 3Q6FB 2DQIL 3NA9L 4MQXD 5FFLA 3LQZB 5GSVA 1KGCE 1ZT1B 1NBZA 3MNWA 5L88H 3MRLA 4K8RD 3VI3E 4P4RB 5KVFL 1CLOL 4U6HA 5ESVA 3TA3B 4JCLA 1FL5B 1MCWW 4BFIB 4Q6IA 3QG7H 4FZEL 3GHEL 1JTTA 1UCTA 4P5KB 1F2QA 3DBXA 1FL3A 3AAZA 4ODHH 1RJLB 5D1ZB 1PBYA 4JQXC 4BSVA 4ZS6D 4ZQKA 1IGCL 1P6FA 3LIZH 5EN2B 1RK1B 1X5LA 4PJ8A 4PJXA 5I30L 1R3HB 5AYUL 5GS0D 2H26A 3BWAA 1FQ9C 1G6RA 3VRIA 2J6EL 3JTSB 3RQ3A 2P43B 2BVEA 4KMTL 2ATKB 5INCA 4NRZA 3GIVA 3C6LA 1J88A 2BNQE 1T5WB 2YPLB 5C08A 3U82B 2BNQA 3HG1B 4WEBL 3CLEL 3O45A 5K59F 4LFHD 4EQ2A 1FYHB 5DJDB 3BXNB 3H0TA 5J6GA 3UPRA 4MD4A 2XWBB 4X6FA 1ULVA 3FCTA 4KTYA 5L2KD 3C5JB 4YEEA 5AD0A 1NDGA 4F2MB 3VXSB 3HE6A 3FZUD 5CP3H 2B4CH 4HIHB 3BSZH 4WW1A 1C12A 4LCCA 4C56D 1KBGH 5DWUL 3GJFA 1DVFC 4HC1A 4X8JA 3NFNB 5JNYA 3I6GA 1RZKL 4U7KA 3X17A 1I1YA 2X9YA 3L3OB 3TPKA 2QQNL 1T20B 3MBEA 3ZL4H 1ZLUK 2VXSL 4AEIL 3QIUA 5C0CA 1ED3A 2WV3A 4XNQB 4U7MA 1YEGH 2NY0D 1IQDB 4OD1H 5KAQG 2W0FB 3M8OL 4RAUA 2JB5L 2P5EE 5CD5D 4KGLA 4PY8J 4FXGA 1CT8A 5IQ7L 1E28A 4PLNC 2BNRE 4FQLL 3LV3A 4P23D 4CDHA 1J7VR 5EZJB 3AXLA 3LQAC 2V5RA 5DHYA 3G6JE 1DQLH 1QHPA 3G6JA 5CEXB 3P4LA 1H3VA 4WEMB 1W8NA 5J13B 3T2QA 3C2AH 5HHQB 3UJIL 5IIEB 4TNWF 3RWFA 1V7NL 2DKMA 1AQKH 5GRJH 1JP5A 2HWZL 2HG5A 3R1GH 1SHMA 5CWSB 4C4KT 4RGNB 5CZXD 3GMLA 4BSWA 1M4KA 4H0HB 1U93A 5TDPB 15C8H 4KKLD 1I7TA 3AB0B 1DDHA 5DJXB 4NBYB 4HMEA 1HQRB 1BD2E 5IEKA 5IBUG 5HHVL 3OKYA 1Q8MA 3RPKA 4NFBA 2PO6D 3GM8A 1PG7H 2FH6A 1ZSDB 3HMWL 5HVHC 2CD0A 4WI7A 3S3SA 3WFEH 2UZYB 1GGCH 5IBLC 2VSCA 5DJAA 2LV4A 3AREC 4D0BA 3JV0A 3QEGH 1AKJB 4JFFD 3WNNA 3VXMB 2CIKB 4G80A 1TVDA 3QHTC 3EOYG 4QKXB 4Q9RL 1QRNE 3CDCA 1IKFL 4XAKD 4F3FA 3WIFB 3SDYL 4NHCL 2IAMC 4R26L 1X4XA 4TVSa 2E7MA 4P2QB 3MV7B 1DUZB 5AG8A 3HI6H 2VDQH 2UWEF 5C6TH 2AQ1A 5T33L 1BBDH 1WWCA 4TNVK 5FDWA 3VXOA 1FAIL 3O3EB 1B2WL 1WCBA 3HMXA 3M1BA 5KS9F 5EU7E 4FP8H 3D2UB 2PXYB 4QRTB 1NEZA 3IKCA 1EMTH 4ZPVB 4YAQA 1WBZB 1IFHH 4MLSA 2JJUA 3BZFA 5BO1L 4NUJA 3BPOB 4IDJL 4LCWB 1R24A 1Q72H 1QR1B 1YEHL 1NFKA 1MWAB 2J12B 1A14L 4H1LH 4P5MA 3MJ8A 2GYSA 4G3YL 1A2YB 4CADB 4JCMA 5DFTA 2JELL 3TBWA 1N64H 4LGSB 5TFSH 3PL6A 5DD6B 5C2UB 1IT9L 1NCCH 5AWNL 1KCVL 3KPMB 5GIRA 1MCPL 5DSCA 1KC5H 5CEZE 1C5CL 1G7PA 3S36H 2QSCH 2ZWLT 5L2JA 4N8VA 1M7XA 5K59E 1WF5A 2CLZA 4WFGD 2XYCA 2J2ZA 3DO7A 5I1CL 2O5ZH 1IGTB 1BBJA 5CBEB 5KW9L 4Y4FC 4NP4H 3STZA 2ADJA 1D7FA 3C8KA 2L7JA 4WTXA 1MELA 3QULA 3CCHB 1JI2A 3HZKB 4XNXH 5D96C 1XIWD 2OMBA 3PWNB 1IQWH 2H32A 35C8H 4CMMA 4XVSH 3LPFA 4I0PC 4N0CD 1HH6B 3O4LE 2E9IA 1QNZH 3GSRA 4PRBB 3WFDH 3VD9A 1RZFH 3W0WE 2F19L 3W0WA 4LLYA 2PR4H 4HS3B 3ZE2E 2I25N 4G5ZH 1QFUL 4YXLL 1CICC 3K7UA 3W9DA 5EG6C 4WI9A 2YD2A 4KKCC 5KSAC 5T1KD 3H3PH 1P7KB 2H8PB 3G08B 4RAVA 2P46B 1K8IA 3BP4A 3WXVL 5FYJD 1TZGL 1SYVA 4HWUA 5DMIL 4M5YH 2KDGA 1A1MA 4AK1A 4Y4HD 3O6LL 2HT4C 4PJCB 5JPNA 4XC1H 4NQEA 5IFJA 3V4UL 4L4VE 2W0PA 12E8L 1RUQH 4F9LC 3ABZA 2Q8BL 3UTSD 4W6XB 4MAUH 1FFRA 2DQEH 4X9BA 3G04A 5EOQH 4ZOBA 3T4YA 1YYMH 1KEMH 1FIGL 3QXDB 3GSNA 4R4BA 1H3TA 1Z3GH 3MLYH 1UQSB 1QVOB 4ODSH 4OLVL 5FOJA 3FN0H 4KRMB 5ENWA 4W81A 3M17B 3RDTA 5D2LF 2J8HA 1ORSB 4RMUA 3PE9A 4P59H 2W1NA 2JIXA 3W5MA 4I2XE 2Y25A 5FCUL 4WENB 2EE9A 5IKCA 1TQCC 3U6RB 3BQUC 5GGTA 1TJIL 3WFHB 3OKOB 5TF1L 3D85A 3SOBL 1JVKA 5IBTH 5JHDE 3DXAA 1A7NL 2HP4A 2VOTA 3KG5A 4TVPH 4OZ4B 2IBZX 1U6AH 3EUUA 3FQRA 5BXFB 3DTXA 1NL0L 2IADB 1INEH 1BFOB 4MYWB 3RIFK 4PYHA 4WWKC 1RZIA 1D6VL 3VFSB 3HR6A 1XGTB 4X6EB 2JB6A 1F11B 3QEUA 5HHPB 5FUZL 3REWB 4J3VA 3LD8B 5DJ0B 5HYSB 3AM8C 1P4LB 1A6UL 3I50L 2FRGP 3C60A 1QACA 4P46D 1U3ZA 4YIQB 1ADQA 4QHMB 2UWEE 1GZQB 3DHMA 4K7PX 3QXWA 4DGVH 3GMPA 4ZTPL 5GQBA 1B0GA 4GKNA 1J1XH 1MFEH 3WNPA 5KS9E 1NGZA 5KS9A 3OTTA 3ALWA 5MEPA 4FG6C 1T7YA 1F3DH 3TO4D 4BQBA 2VXUL 1ZLUH 4PB0L 4JDTH 2O5YH 2YOCA 1OY3B 1J86A 2YMXH 3OKLB 3E8UL 5DVNA 4XVJH 4M48H 1NC4B 2G5BB 2BVUA 4P4KC 3P2TA 4KTDH 3O6FC 4HWZB 3QJHA 2FL5B 2JK5A 4AH2B 3MLRL 3KLHD 1SJEB 2IH1B 2J8UB 4YHKL 2GTZB 3FL7A 4EIGB 2DQIH 1AJ7H 2X1PA 4YDIL 3NA9H 3VG9B 3C6SB 1S3KL 3VCLA 3DRTA 3QQ9D 1PKQE 1TTUA 1CGTA 1ZHBB 1K4CB 5KVFH 2QBWA 3TVMB 5K9KA 1I8MA 3HPLB 2FX7L 5I1AB 3B5HA 4HIXH 1Y6NR 3DV4A 4FZEH 4LKCB 1VB9A 3GHEH 4XNZC 3U0WL 1LMKA 3IJHA 5D6CB 1E27B 1XH3B 5D7LD 1Q9LB 4WU7B 2GFBB 1K2DA 5DURB 5CGYC 4AMKL 4MZ2A 5GSVB 3NABL 3W9EA 5F1NA 3RKDC 1NBZB 1DQQA 3KPSD 1MCCA 4X5XA 3MRLB 3CFIC 5I30H 3BUYB 4U6HB 2Y7QA 5ESVB 5AYUH 1MJJB 3BD4A 2J6EH 4Q6IB 3DBXB 4PGCB 1LO4H 3WEXA 5BCAA 1JL8A 4WEBH 3CLEH 2BY3A 4POYA 4IJ3C 2VO5A 3NCJL 1EFXA 4ZQKB 2Z91A 2YUZA 5EIIA 1HILA 4MNGE 1CTNA 4R2GB 2H26B 4Y16B 5H94B 3VRIB 1DLHA 3LRSA 4WUUE 3UYPA 5HD8C 5IJKA 5L2KE 4NRZB 3GIVB 3SN6N 5FEBA 4U1SB 4DKFL 1BZ9B 3ZTJH 2BNQB 3TBTB 3O45B 5F6IB 3BVNA 3MV8D 1LEKA 2GQHA 1YMMD 5DWUH 4KJPD 5HI3C 4YXHH 5DA4A 3H0TB 4C56E 5J6GB 3QUMA 1M71A 4MD4B 5CUSL 4C56A 2OZ4A 3V8CA 1QFWL 1RK0A 2IBGA 2QV2A 3DURA 1NDGB 3ULUL 2QQNH 1J0JA 1JF6A 4AY0A 3OG4B 2VXSH 4AEIH 3GRWL 2VKWA 4YNYA 1FN4B 2LTQC 3ROLB 3S96B 5D2LE 1BJ1J 4WW1B 1C12B 1GZPB 2FO4A 3MJ9L 4LCCB 5D2LA 1BLNB 4UV7H 1Y0LA 1T22A 2XRAL 4XP1L 4X8JB 1F4HA 3EO1A 1IAKB 4PJ9C 3M8OH 4L3EA 5IMMA 2OTPA 4LSSL 1I1YB 4OCXL 4J4PA 3CUPA 2XN9D 3MBEB 3QIUB 5IQ7H 4P3WA 3DETD 3OKDA 4FQLH 1LHZA 4FTVD 1VEPA 1VADB 4OZGF 1HWGB 3ORJA 4XVUC 1NUDA 2Q76A 2OX5A 4LKXB 3ZMRA 1J11A 3BUTA 1I9JL 2B39A 4JJHA 2P42B 2VDLL 4KPHH 4U1LA 1IBGL 5BRZD 4UQ3A 3JWNC 3LH2L 4M61A 4UNUA 4EUPA 3TT1H 3L5XL 4WV1B 2H9GA 3UJIH 2P5EB 3LSOB 1V7NH 1CT8B 2VSDA 3KDMA 3SY0B 3O3AA 1IZJA 4N9OB 1U0QA 2BNRB 5EC2A 3AXLB 1MFCL 2G9HA 5DHYB 3VXNA 5KTEL 4R8WL 4Y5YC 2M1KA 4DFIA 1RZKC 5F72S 3G6JB 2APXA 1F6AA 3IXAA 1GGUA 1OAKL 3PF2A 4L8DA 3RWFB 5HHVH 1YJDL 3BP5A 1JHLL 4YPGA 4GO6B 1JGVL 2GTWA 4PJGF 3SGEI 2HG5B 3HMWH 3GBMH 5GGVL 1UJ3B 1I1RA 2GJJA 1UH3A 2VXVL 4KJQD 4BSWB 1U93B 3KLAA 2DB8A 2PO6A 4NQCD 4QRQA 1I7TB 4DZ8A 1P7HL 1RUML 1DJSA 2P44B 3SHSA 5A43C 1DQJB 1DDHB 4JKMA 4L8BB 2RR3A 5E2VL 2AK1L 3BW9B 1BD2B 4Q9RH 1IKFH 4CW1A 4JFFA 1W0YT 3SDYH 3CNKA 1UXSA 3ZYJA 2Q7NA 4EDXA 4ZDHA 4R26H 3FB5A 4W4OC 5HI4D 5DJAB 4DK3A 5T33H 3QNYB 1FAIH 1B2WH 5T5NG 4LF3A 4L9LA 4G80B 3CVHL 4Q97A 4C4KO 5KVMC 3IS1X 4JRYD 4GRWF 3DUSA 5BO1H 5J11B 2NY3C 3ARWA 3VGAB 1ES0A 4IDJH 1QRNB 3X3GL 1YEHH 3O4OB 4HG4J 3OB8A 2IAND 3CDFA 2GK0A 5F7NC 1OL0A 4G3YH 4AENA 5T3ZL 5FDWB 2JELH 3VXOB 4KK5D 4XP4L 3FO9B 4X98A 3IKCB 4YAQB 1IT9H 1FYTD 2VDML 5AWNH 3VRJB 3BZFB 3QI9A 1MCPH 4N0RA 4NUJB 4U3CA 1YEKH 1R24B 3VWKD 4P5MB 4K71B 1M6OA 4H5SB 1GGBL 2V2XA 4YFLF 5I1CH 1P7QD 5KN5A 1T7XA 5J9PA 1X44A 4PJAF 1VCAA 5HDQL 2P24A 3F7YB 4ODWA 3HZMA 4R7NB 5JO5A 2VJXA 4Z7VA 5GIRB 4KXZH 5DSCB 1CFQB 5I0DA 2FJHA 3D3VA 2VLJD 2CLZB 3GJFK 3WO4C 3DO7B 1XIWA 4MXVF 3TN0B 5DA0B 2D0GA 2F19H 3STZB 2ADJB 3KYNA 3C8KB 3AMKA 4ONGL 4U33A 5EUKA 2ERJC 1QFUH 4YXLH 3QWQB 3KYKL 1IGYA 4P2OB 2H32B 3D48R 5H8DA 4WJ5B 3FQWA 5F7YC 4YUEL 3L3KA 3GSRB 4ETQA 3WXVH 4HKBA 1TZGH 4OCMC 3CVIL 5T1KA 1X3DA 1J5OL 3W0WB 1V3JA 3LPWA 3A6CL 1IGIL 2AK4D 4KROB 2D7MA 5IB2B 3CH1A 4HZLA 1YZZA 3V9FA 1YNLL 5C8JA 4ZFOB 5EOCL 3V4UH 3FB7A 4Y4HA 1RU9H 1SJVA 4FXKA 1F8TL 4YR6B 2Q8BH 5E7FA 1L7TL 4OZGE 4F7PA 1KUMA 3P0GB 1PG7X 5E8DL 3UTSE 1JNJA 4OLZL 1FIGH 1SYVB 1CS6A 5GJTH 4ONHA 3WHE1 5JPNB 1N6UA 1MLBB 3MFFA 2PXYC 3QDGA 4KJWC 1YPZF 3R0MA 2YBRA 4RX4D 2AEQL 4HJ0D 4PR5A 4P9HL 4JRXD 1WZ1L 5FCUH 3G04B 3V6ZA 4U1HA 1U91B 3BMWA 1O7VA 4OKDA 3ULSA 2FBJL 5KSBE 4JQVA 4GJTB 4R4BB 3P73B 2QQKH 2EKSA 2BVOA 3T0DA 1TJIH 1G9NC 4YE4L 5ENWB 3RDTB 1FZOA 1TJGL 3QIWD 3SOBH 3X12A 1VKXA 4WVRA 2EDOA 1T0PB 3OB0K 1CQYA 1QSFA 3IJYA 4I2XB 4PJGA 1NL0H 1T2JA 2Z31D 5HYFA 1JZ3A 4KI5E 2A38A 5ID1A 1VEOA 3JTTB 1D6VH 2BSED 5SWQA 2EDBA 2FJGA 5DJ6A 5FB8B 2BP3A 5FUZH 2FJFA 3DXAB 3HE7D 5JHDB 5DHVB 1FFOB 1M7IA 1A6UH 3RNQA 3I50H 2X4QB 1XF3A 2AJ3A 2YRPA 3FQRB 2EKJA 3LDBB 3DTXB 2Z0BA 1P5VA 3GSVA 2Z35A 3EYUL 1WWWX 4H0GA 4ZTPH 1RZIB 4P46A 2H3NB 1J12A 4RWYL 1NLBL 2JB6B 4XPGL 3QEUB 4GRWE 4HPOL 1FLTX 2DWEA 4H8WC 4OFPA 3HNTL 4G8GD 1HXYA 2VXUH 5IGXL 2H1PL 1FPTL 4XXDA 5IM7A 3SPVA 4IHOA 4PB0H 2OR8A 1HINL 3SGJA 1QKZL 3E8UH 3OKEA 3TO4A 1DSFL 1J0IA 2BMKB 2DKUA 2UWEB 3MRHA 4GKNB 4LLAA 3K3QA 3MLRH 3VRLF 5KS9B 3TFKC 4S1SL 4D2NA 1R0AL 3D39A 4YHKH 1L9MA 1X5XA 2AI0L 2I07A 4YDIH 2BC4A 1S3KH 3EHBD 2V5TA 5J56B 3WUWA 4LRIA 1YEDB 2CMRL 1EGJL 3GM0A 1FZJA 2OJEA 3VD7A 4XCEB 2FX7H 3QJHB 4ZSOE 4PJAE 5EIVA 5HJ3A 4CU6A 3HI1A 4OQTA 3GI8H 4OZHA 3U0WH 2AW2A 4PP2B 4GOSA 4KZDL 1RIUL 1X5IA 3I9GL 2PF6A 4Z0XA 3ZHDA 1KXTB 4PFEA 1IAOA 4LPYA 5HVWA 3VCLB 1XGRB 3DRTB 3OAZK 2YEZA 5D7LA 1OGAD 1A7OL 1EO7A 1PKQB 3QDJD 1U8IB 4JPKH 4MXVE 5LGJA 1NC2D 2D3VA 3KPSE 3INUL 3D1MC 3DV4B 3KPSA 4XPBL 5EA0H 5IESL 1TTGA 5EWIL 3MRPA 3K80A 4PPTA 5DD3L 2XG5A 1WLHA 5IG7A 4B0MM 3IJHB 5C0JA 1K2DB 3UTQB 4N1HB 4GAGH 5F96L 1B4JL 3W9EB 1XGQB 1DQQB 4MJ4A 1S7WA 2HAZA 1AI1L 3TCXA 5CHNB 4CBPA 5E6ZA 4W68A 5FO9A 5LBSL 3KJ6L 1CXFA 4DKFH 4QXGL 1VSCA 1RZGA 1IGFL 1TVBA 2EC8A 3ARFC 2ADIA 5DO2D 1FRGL 4M1GL 1FH5H 2Z91B 4LNRA 5F3HA 2D2OA 3MV8E 5EIIB 1YMME 1HILB 2HFGL 5F1IB 5CUSH 3BRGC 3MV8A 3O2DA 1YMMA 4E42A 1QPXA 3MOAL 4MNGB 4XC3H 1QFWH 5FYKD 3KYMB 1A7BA 3LRSB 3CDGA 3ULUH 3CXHK 4ODVL 4X4XA 1EK3A 3GUTA 4JZOB 3GRWH 5L2KB 1YPZE 3BGMA 1YPZA 4PJHF 5GPRA 4H20L 1G7MA 1LEKB 2PW2B 4OZFH 4C58B 3O3BA 3C09B 4HUKB 5SWSD 1KG0A 1VFAB 2XRAH 4XP1H 2DQCL 1NANI 1EJOL 4PS4H 1ZS8A 5EU4B 4C56B 3EYQD 4D9RE 2VAAA 4LSSH 1UYWL 1RK0B 4OCXH 4QNPF 3EZ8A 3MUJA 7FABL 4PG2A 3T65A 2HYMA 2XN9E 3LB6C 1HYSC 1WGOA 5D2LB 3U7YL 2AERT 3EJYD 4PGBA 1FGNH 1IC4L 5DJCB 4OLYL 4BZ2H 1I9JH 2QKIA 2WBWB 3VG9C 2XTJC 4FTVA 2IPTH 3F7VA 4X4YB 2NXZC 2IFGA 3N1PC 1IBGH 2NY0B 4JO2L 1A64A 3LH2H 5IMMB 4MCZA 5BRZA 3OKDB 2JCCF 1AQDA 2QQQA 4PRID 5IMKA 3CH8A 1MFCH 3NCYS 5DEGB 4CKVX 5KTEH 4R8WH 5B3JF 4KV5F 1IC7L 1Z0NA 2DS4A 4OLWH 4P23B 1AFVH 2HN7A 4U1LB 4UQ3B 4OCRH 2VR4A 4M61B 1OAKH 2H9GB 3WLWC 1YJDH 4Q6IC 3T0AA 3CU1A 4PTUA 3KDMB 1JHLH 1S7SA 1JGVH 3O3AB 4K9EL 1CFTA 2FSEA 3CU7A 2G9HB 4XNYL 3VXNB 2VXVH 4NWTL 3UPCA 5BVJB 3H7BB 1RUMH 2BOBA 1RZ7L 1OB1A 1TENA 5BZWA 4PJ8C 2K9UA 3SJVE 2F58L 1CIUA 3FOMA 4NQCE 4LAQL 5D9SA 3IXAB 5C71A 2X4TB 5ERWA 5E2VH 4CDGC 5BV7C 2AK1H 3BP5B 3TT3L 4YPGB 3C6LC 3VRLE 1J87A 2GTWB 1EZVX 1MJUL 1KCKA 5F6IC 1U42A 5E2UL 5I66A 2B8OT 3N85L 3R0NA 3KLAB 1VGKA 2PO6B 3L9RB 4NC0B 4QRQB 3B83A 2A6DB 5EULV 3VA2C 3KPQA 3CVHH 5HTSA 8FABA 4JFFB 3HE6C 2DMKA 3Q5OA 1UXSB 3X3GH 4JRYE 1ZV5A 2RCSL 3FB5B 4JRYA 5JQHC 2DQUL 4LCCC 2GY5A 1NCBH 2VDNH 2ZUWA 4JJ5A 5T3ZH 2IANE 3HN3A 5IV2A 3BIAX 5FGCB 2IANA 3CSYA 3NACL 3TH3T 3RZCD 1RURL 4LF3B 4KK9C 4XP4H 2DBLL 5B38B 3AS0A 2C7UA 5B22A 1KIPB 2VDMH 3DUSB 1ES0B 3GMQA 3QIUC 1FYTE 1LK3H 1MY7A 1MFNA 3U2SA 4LHUB 1WJ3A 2GK0B 2A73A 1ZGLM 5C0BE 4PGEB 2WZPD 3NZHL 1GGBH 3OB0H 3VE0A 4UT6L 3VWKA 4BFEA 3S5LG 5HDQH 3BAEL 5EDXA 1TPXB 2YKLL 4X98B 3KXFD 1BVKB 5F7FA 1P7QA 2VE6A 1JPGB 3EYOA 3U48A 4LIQE 2F5BL 2OTWA 1BZ7B 1M6OB 4UBDC 1PY4A 1KPRA 1FCCA 2ZUQC 1BIIB 2VLJE 5KN5B 5J9PB 4QHKJ 1X5ZA 4I18A 1U3YA 4YPJA 2X4SB 4ODWB 2NR6D 1CGSL 3CDYA 2J7LA 4ONGH 3TBSA 4WI2A 5BMFL 5KJRL 3VXTA 4FQ2L 3T8XA 3WE6B 1N5AA 3FKUS 2FJHB 3KYKH 1F6FB 3IAGC 4PJHE 4YUEH 1XIWB 4X9IA 1OARL 1X5FA 3HR5A 4AQOA 3QWOA 3CVIH 3KYNB 4D9QD 3BYTA 3SE3A 4S11A 1IGIH 2FDBP 1D5IL 4OAWA 4FNLL 3UTTD 3UXFA 5EUKB 3CMGA 4YGVA 3GFUA 4QNPE 1YNLH 3S97C 4X7TA 2AK4A 5D5MF 3HUJF 1IGYB 3W39A 2GIYA 1F8TH 2X10A 1YUHB 5DQ9B 2C1PB 1L7TH 1OWRM 1J0HA 3AGVA 4ETQB 4TULH 5E8DH 3G6AB 4OLZH 2HFEA 1CI5A 2P7TA 5T1KB 1EHLH 3B9EA 1ND0A 1CFVL 2PYED 3CH1B 1I3RA 1XAUA 3RVUD 4I48A 5C8JB 3JWOC 5ADOL 1FG9C 4WUKH 3FB7B 4Y4HB 4U2ZA 2AEQH 2PTTA 2UY7A 2ZG3A 1QFHA 2JCCE 3CJJA 1WZ1H 2A1WL 3WD5L 4NNYB 2R0LL 4FFWC 2BSSA 4OZGB 5BVPH 2Y5EA 5JOPE 4DN4L 3UTSB 5B3JE 4JRXA 4AIZA 4JFDE 5GSRB 4MHHG 2DLIA 3OAZH 4ONHB 4YE4H 1II4E 3MFFB 4PJFF 1DBBL 1TJGH 4CVUA 2A83A 3KPRD 2YBRB 4HK3N 4UOJA 1F13A 4PR5B 5C0EA 3LKRB 3OQ3B 3QIWA 3V6ZB 1JTPA 2L4OA 2LQRA 2YD5A 4N9GA 1DQDL 2YA1A 2EKSB 1SJXA 3SKOA 1F3JA 4U1MA 5ISZD 3JZ7A 2Z31A 1G0XA 3PL6C 1EJ6A 1FZOB 4XPFL 4HUWB 1P69B 5FO7A 4UAOB 1YQVH 3X12B 4OFYD 1A4JA 1KB5H 2RGSA 5T3XE 1SBSL 2CDFA 2ICCA 3PWJB 3IJYB 4PJGB 4HIEA 3OWEA 3HE7A 5LXGL 2NTFA 4D0CA 1MCLA 5ID1B 1T89A 3EYUH 1I8IA 5J4MA 4XI5D 1EFQA 4ALAH 3OAUL 2FJGB 1A4KA 2C26A 5DJ6B 2IJ0C 5LG1A 3GSXB 4OGAC 4XPGH 1U8HA 4HPOH 1BAFL 4P9HC 2BCKB 2OP4L 3HNTH 3JVGA 4G8FA 4GMSL 5IGXH 2H1PH 1FPTH 2HFTA 4XH2B 2NZIA 3MLUL 1HINH 1QKZH 4G8GA 4U1IA 1DSFH 2Z35B 3GSVB 4NN6C 5SX4I 1CGWA 4P46B 3ARPA 4O02L 2EDFA 3KLDA 4RFEA 1RZJC 4O58L 4S1SH 4KKBD 5JHLL 4GRWB 4NO0A 5IM7B 1GXEA 4XXDB 4BQ6A 2AI0H 2EC9T 3UDWA 3WCYA 2R0ZL 3OKEB 3MYZA 3LKSA 2CMRH 1EGJH 1JWUA 5JA8B 5ELIA 1XR9A 1A5FL 4OM1H 1ZLWK 4ZPTA 1M7DB 1DVFD 1ZXQA 3IDMA 4HWBL 2V9TA 4KZDH 1RIUH 5DZOA 3QR2A 3TBYB 2VDPL 2I07B 4MCYA 4JHZA 3DIFB 1MWAL 2DQFA 3WUWB 1A7OH 3IDJA 1FZJB 2OJEB 4CVZA 1OGAE 3INUH 3QDJE 4XPBH 1OGAA 4PJAB 4ZSOB 4WU5A 5IESH 3QDJA 5EWIH 4LHUG 4EQ3A 5DD3H 3RDTC 5I1LB 3IDIB 1S8DA 2QHRL 1WVZA 4U31A 4Z0XB 4U6TA 1AP2A 3ZTNL 5A16B 2D03L 4TUOB 5F96H 1B4JH 2VDOH 2YEZB 4HGWB 1UFUA 5HXMA 1U36A 5I6XC 3TCLB 1AI1H 5LGJB 1FE8L 3ARVA 4WRLA 5JW4Q 4WTWA 2X9WA 3I2CL 3QZWB 3KPSB 1NSNH 5E6YA 1CYGA 2NTSP 3MRPB 5JUEL 5LBSH 1PZ5A 5IG7B 3Q6GL 4CL7A 4QXGH 1A7RH 5C0JB 3QO0A 4NOBA 5DLML 1IGFH 3GKWL 3HUJE 4JHAH 4CJ0A 1ZT7A 1YYLL 1FRGH 5D5MA 2FECI 1KJ2L 3LDBC 2HFGH 1CD1A 5F7EL 3MOAH 4FOMA 5HYJD 2HVKA 5FGSA 1NGPL 3VU2A 5CFHA 5FO9B 1YNTB 4LASL 5ALCL 2VZVA 4D0DA 1RZGB 4H20H 1TVBB 5ILTL 2ADIB 1INQA 2E7LC 1CDUA 3RGVD 3C60C 5K9JL 1AXSB 4LNRB 1EJOH 3MV8B 3B3IB 1YMMB 3E2HB 5SWSE 3K8MA 4E42B 3I3DA 4JKPL 5DQDH 4ZFFB 4DKDC 5SWSA 2W65A 1A6WL 1UYWH 3PJSA 3D69B 3CDGB 4DN3H 7FABH 1P6AB 4PJFE 4Z95L 1ZHKA 2IQAB 3BGMB 4PJFA 1YPZB 3BN9C 2GW5A 3U7YH 4UILL 5GGVY 4LVNB 4YDJA 5EZIL 1IC4H 2VDRL 3O3BB 4M7ZC 3VA6A 4MXQC 4OLYH 2CK0L 5FECB 2PETA 1RPQA 1ZA3A 2PTVA 5ECJE 1WTLA 3CPLA 1P84J 1U8OA 4PLOB 1XEDA 2IAMD 1AIFA 2IQ9L 3ZO0A 1VA9A 3GKZA 4ZTOL 3O9WC 1ODAA 4NCC2 1R5VA 2AJXL 5DT1H 5EPMB 3T65B 4HJGA 2B1AL 3T04D 2BK8A 2XN9B 4L1DA 2VISB 1FORL 1F6LL 4MVBC 4S1RL 5JZ7D 5DEFB 1CDYA 4WI5A 2QKIB 1JPFB 3MJGX 3F7VB 4PRIA 4HEME 3GMNA 4EVNA 4GW5B 2WK2A 4XWOD 1MVFA 1ETZA 1ZGLA 3T0BA 1WT5A 4EBQL 4MCZB 4HKXB 3VXQA 1OQOA 5BRZB 5C9JA 4NUGL 1GVIA 3T2PA 2AJZB 2VRAA 4K9EH 3K0WA 3S3JA 3S4SG 1AQDB 4JQIH 4KU1A 2YZ8A 2KQNA 1CBVL 2MHAA 4NWTH 3MCKB 1D5MA 2AXFB 1RZ7H 1KACB 2F58H 4LAQH 4MB3A 5F9DC 3WIHA 4PTUB 1S7SB 5TE6H 3O11B 3TNMA 1CFTB 1FC1A 2FSEB 3D0VB 1FDLH 2NXYC 4JKKA 1DBAL 4MHHI 4QF1A 4Y4FD 5GS0C 4LNVA 4LDEB 1MJUH 5BJTA 1S7VA 5E2UH 3N85H 2GEEA 3GSQA 2EH7L 2BOBB 5BZWB 1OB1B 2L7UA 3RUGF 4QY8A 3VWJB 2DLGA 3FOMB 3HHRB 5D9SB 3SJVB 5ERWB 4I0PD 4NQCB 2F15A 1AE6L 5IJKC 3E3QE 4MNQD 3ZDYF 1ZVYA 4PLKD 4OF3A 5HPMA 4G6JL 3U30C 1RVFL 3MJ7A 2YRZA 4LEOA 4WDIB 5A2LH 5F7DA 3FZUC 4ORGA 1VGKB 4F8TA 4CRPA 4E9LA 1B4RA 4UT9L 4PJDF 1RURH 4KKCD 4NQDD 2GCYA 3KPQB 2DBLH 8FABB 1RJZA 3IDXL 4QRRD 4HDIA 3SEPA 3RZCA 1KTDA 4QHKI 3KPTA 4JRYB 4BQ8A 4I5BA 2B1HL 2JE8A 3K8LA 3MXWL 3NZHH 4MA1B 4N90E 5HYQA 4OBRA 5F9JB 4UT6H 2IANB 1UG9A 3DX7B 3BAEH 5I1IH 1ONQB 3C87A 4NZRL 3VMOA 4OZIF 2AXGA 2C7UB 4PY7B 4RISL 5E2WL 4J4PC 3U7WL 3OXRB 3LMJL 3GMQB 2F5BH 3KXFE 1MH5A 3Q5YA 2NW3A 4NO2B 2FHFA 4WCYL 4M3JA 1FYTB 4PYGA 4FQ1L 2A73B 5CD5C 1RIHL 1CGYA 1N0LA 4YEFA 5DD5H 1IGJA 2WANA 3UZQA 3HZYA 4F33A 2IMMA 3SCMB 1G7LA 1CGSH 2X70B 3F62A 1P7QB 4U1GB 4QO1A 3ILPA 5L7XH 4MSWA 4X99A 5KJRH 4FQ2H 4WTZG 4OIBA 4PUBL 4U1NA 2OTWB 5J12C 2HJLB 3BQUD 1FSKB 4KGJA 4YDVA 1KTLA 1XCTB 1QFOA 5K33A 1BGXL 4KY1L 3QZWG 1OARH 4TSCL 1DEDA 2VLJB 4H1LG 1H5BA 5I74B 4I18B 3VFWB 1UVQA 1D5IH 1K6QH 3TBSB 4D9QE 4OJFL 1FVDA 4H88L 4KKLC 3VXTB 3MRJB 3T8XB 1DQML 1N0XL 4M6NL 4BQCA 1N5AB 3UTTE 2F9BT 1MCSA 1DCLA 2YZ1A 3QUXD 3LQMA 4PJHB 1NDMB 1BM3L 3OXSA 3HR5B 3KPPA 4NM8L 3QWOB 1DN2A 3P40A 1TZIA 1UB6A 2E7CA 4S10A 4OAWB 1FJ1B 4YC2B 3QBTB 4U0RC 5I8CA 4GXUN 4W4NA 2OYPA 4F58H 2PYEA 4X7SL 2VZUA 3W39B 5DC0A 2CRMA 4B7LA 4N8CH 4JANA 2A1WH 3SGEH 2R0LH 1F4WL 1GJIA 4OV5B 4N0UE 1RIVL 1WUNT 1DL7L 3SDXF 2HFEB 4N0UA 1MHCA 2XZZA 2P7TB 2WW8A 3G9AB 4DN4H 3HPJB 3RKPA 4Y5VA 4V2BA 5TE4L 4L9LC 3BKCL 5I1JH 1I3RB 3EJJX 3I6LD 1N59A 1A02N 4XCCL 4HEPG 4LCUA 5D72L 3NA4A 2ICWJ 2UUDK 3LN5A 1EVUA 1ACYL 4P4KD 2GT9A 3RWJA 3O6FD 3KPRA 2JCCB 1CDCA 1HSAA 4JFZL 2BSSB 4L8SA 2R2HB 5B39A 3WS6C 4PBWD 1DQDH 5CBAA 1NMCC 1PKOA 4TVPD 4AIZB 2DICA 5FM5M 3BN3B 4ISVA 3WHXB 4ESKA 2O61A 3RPIB 3VFRB 2D0HA 1DLFH 3ZKSD 2AQ2A 3ARBD 2A83B 4XPFH 3JSSA 3QI9C 5ISZE 5CSZA 3MRQB 1H15B 5ISZA 4HHAB 5C0EB 1V8HA 1SBSH 2WQRA 3QIWB 3N06B 1XGYL 4OFYA 2YD9A 4O2EB 1JZ5A 5LXGH 4N9GB 3SDAA 1OW0A 4OB5L 3L7FB 4OIAA 4G6FD 3SKOB 1F3JB 2GJ6D 3RUGE 5CGYD 3OAUH 5DGQA 1S78C 4QRPE 3RUGA 2PW1A 3QPXH 1YN7B 1UC6A 1AXIB 1BAFH 2OP4H 1XFPA 2BJML 3ZDYE 3PG2A 4GMSH 3CC5A 3OJDA 4HIEB 3UC0L 1UKTA 3MLUH 3UO1L 2EDTA 3NPSC 3QPQC 5KANI 4R3SA 2NTFB 4X9GA 5SV3A 3JV6A 4O02H 2XWTA 4N0CC 4PJDE 1A4KB 5MENA 4O58H 1U8HB 3WNMA 3GHBL 3MTRA 4YHIA 1LE5B 2R0WL 2OLDA 5JHLH 1G9MC 3CLFL 1CXHA 3V0VA 2OSLA 2R0ZH 4U1IB 1TDQA 5C9KA 5E00A 2P8LB 2R56L 4TUKL 1A5FH 3GIZL 1N8ZB 2EYSB 4OZIE 4HWBH 2ICEA 1XT5A 3QDMA 4HZAA 1G1CA 2DBJA 3RGHA 4OZIA 4Y4HC 3EO0A 4FABL 1NAMB 2VDPH 4LLQB 3RX8A 4LPWA 4RWHA 3VMPA 4K3JL 1OWWA 1MWAH 1SY6L 2YUXA 2O93L 2XQYG 5HGBB 2R8SH 1JWUB 2NY2C 1XR9B 2OQJB 4N5EC 1Y6KR 4XCNA 5JW4M 1G9NH 3IDMB 2WBJB 2BSRA 2M26A 3ARYA 4HJJL 4IOIA 5D70L 1MI5D 1AGDA 3PWVB 4PJ9D 2QHRH 2F5AL 4ZAKB 4XWGL 1TZHA 5HGDA 3OMZA 3ZTNH 4MCYB 1I1CA 2D03H 5FHBL 4DGIL 5KSVA 1DN0A 5D7JD 3MLTA 3GSWA 3H9HB 5F70A 2EC9U 3PABB 4JQVC 4QTIL 1I75A 1CE6A 3QG6A 4XVUD 2OMNA 3I2CH 4EN3B 2F8OA 1OGAB 4APQD 4WU5B 4XB7A 3QDJB 5JUEH 1NC2B 1NGQL 4LMQE 3IB4A 3Q6GH 3D9AL 1S8DB 2I24N 4RDQF 3WN5B 3U4EA 1A9EB 5CGTA 5DLMH 5JDSA 3GKWH 1OGTA 3HKFA 1YYLH 1KJ2H 1QOKA 1KEGL 3V5DB 5CEZL 4MB5A 5GGUB 2GUOA 5I8KL 4PRPE 1ZANH 5F7EH 4OCNC 5CP3A 3H9SD 1FGVL 3T3MF 5H35B 4O2CA 4LASH 1PZ5B 5HYJE 5ALCH 4L29A 5CMAB 2ADGA 1MNUL 1I4FB 5HYJA 2Z93A 3QO0B 4ZFZA 4LPTA 5ILTH 1ZT7B 5D5MB 3HUJB 3TM6A 4S1DD 5K9JH 3V7MA 3B4NA 1A6VL 1NH6A 3MV9E 3SDXE 1CZ8L 4JKPH 3RGVA 3SDXA 4ZUVB 2HVKB 1A6WH 1Z9MA 3TZVA 4OIIH 4YFLI 1RMFL 5E6ID 2XZQH 1HZHH 4P3CL 5SWZE 4Z95H 5TGBA 4Y0GA 5DRZA 4D0DB 2CJUL 1GOFA 4QCIB 4UILH 5C86A 5EZIH 1A9BA 2VDRH 4ZFOL 3GSOA 3PDOA 2CK0H 2X4OA 2FEDC 3LOWA 1PX3A 1AY1L 1FFQA 1V05A 3SDDD 1VFOA 3SGJC 4HAFA 4P48A 3TO4C 4OCSL 4TYUA 5SWSB 2W65B 3ZDXF 3O6ML 2IQ9H 1I3UA 4L9DA 4R4ND 3PHOA 2HVJA 2AJXH 1G7IA 3FT2A 1CFNA 4GS7C 4PG9A 3SO3B 4PJFB 4M62H 2B1AH 2SEBA 2GSGA 1FORH 1N7ML 2JJSC 4S1RH 2E9WA 1BJMA 3ZTJG 1ZA3B 2NY3D 1PD6A 3CPLB 5KSUA 4LRIC 1O7SA 1AIFB 4UI2A 3O2WL 3VMNA 1T04B 4EBQH 4RCAA 1X4YA 4S1QL 5IR1B 4NUGH 1UH2A 4FS0A 5ALBL 2V9QA 1OTSC 3FJTA 1CBVH 3QH3A 4QT5A 4XX1E 2VITB 2GITA 4PRIB 4OFKA 1YECH 2P5WA 4EVNB 4Y1AE 1MUJA 3DI2B 1ZGLB 2CLRA 3VXQB 2AQ3A 3GEWB 3MRGB 5K9OA 5C9JB 3U46A 1KJVA 3D18A 1DBAH 4BYHA 3AMLA 4LRNH 4ZOEA 3PGFL 3MGAA 5IP4A 1K8DA 1MCKA 2MHAB 4OM0L 2EH7H 4Y4FA 5DS8A 2EDNA 1FZKA 4LVOC 4NRXB 1RAMA 4RRPG 1AD9A 1C8PA 1ZK9A 5ICYA 1AE6H 3P30H 5JXED 3QCUL 1BQLL 3TNMB 4G6JH 4I0PA 4OD3L 4LLWA 4KJYB 3TIEB 4MNQE 2VXTL 4MNQA 1D5XB 3GSQB 2D7NA 4UT9H 1U2HA 4QY8B 4KVNH 4NBXB 1NCTA 1A6PA 4U3XA 3IS0X 4KJPC 3IDXH 1BJ1H 4NQDE 2YSSA 4QYOB 4H1LA 4OQ1A 2CKNA 5I1HL 4NQDA 5HPMB 2VWEC 3IFPA 1TLKA 1N3NA 4QRRE 4KDWA 4C83A 3MJ7B 1NCNA 4QRRA 2NY4D 2UUDH 3T1WA 2B1HH 3MXWH 1GPOL 4HF5H 5HHXL 2D7QA 3GGWA 4JKWA 4KUZL 1UB5B 4E0RA 4NZRH 2GCYB 5D7IF 5EU6D 5MI0B 1LWRA 4RISH 4CNIA 2ATPB 4YGAB 5E2WH 3U7WH 3HRZA 4PG2C 4HDIB 3LMJH 1P53A 3FFCE 3HRPA 2BDNL 4WCYH 5I76A 4FQ1H 1MFBL 1UENA 4I5BB 1ZKAA 4KJWD 1T21A 1FV1A 3DETC 5I0ZA 3WL9B 2YHGA 3GI9L 1RHHA 2AXJA 3L7EA 4XHJD 2AXGB 1OAUL 1IGML 5I1EH 3FFDB 3T3ME 1U8KA 5FHAL 1MH5B 3FT4B 1JFQH 4JG0L 3KXFB 4Z18A 2DJSA 1I9EA 1CGVA 1Q0XL 2BY2A 1BGXH 4KY1H 1VACA 4F33B 4TSCH 4Z77A 3S35L 4M02A 1BHGA 1AXTH 1UA6L 1Z2KA 4ZXBA 5TPWL 4L4TD 1EEYA 4OJFH 4AEEA 4H88H 4J3SA 2EDQA 4HT1L 1N0XH 4M6NH 4U1NB 3O0RH 1XZ0A 3QISA 4IRZL 1IAII 3MYJB 4YDVB 4WO4A 4HS8L 1M05A 1KPUB 4Q2ZA 2ZPKL 2ZSWA 3LRGA 1BM3H 5M7QA 1IZKA 1ZHLA 4NM8H 2Z4QB 2ICWI 2CK2A 1UVQB 3OHXA 3QUXA 4LDLB 4HUUB 4M8QA 4PV8A 3FRPA 4KJQC 5F3BB 3ZDXE 1JGDA 1FVDB 3QXAB 1MLCA 4X7SH 5E9DD 3UTTB 3N1GC 1WV7T 5GRZA 1SBBA 1NBQA 4Z9KB 1R3LA 2R2BA 2MQ0A 4TNVF 1DE4A 5FCSH 1RIVH 1DL7H 3VD3A 5LQBH 5BOPA 1TZIB 1WWBX 5D2NC 5TE4H 3I75A 3BKCH 4UIMA 3GK8L 4XCCH 5I8CB 1JYNA 5D72H 2I9LA 2PYEB 4WI4A 1ACYH 3TYFB 1U8QA 3PV7A 1HNFA 4JANB 1OTTD 3BKJL 4JFED 4JFZH 1UGNA 1YEIH 5E56A 2DTML 1PSKH 4N0UB 4YDLC 3HLAA 2NLJA 3O6FA 4R97C 4AT6A 2D31A 2X89D 1N59B 5FF6A 4LCUB 3IKKA 3TH4T 4MAYB 3LN5B 4NT6A 4P2RE 2OI9B 4XP5H 4OT1L 1KLGA 2GT9B 3NCYP 3Q2CA 3RWJB 1EPFA 2WUCL 3ARBA 3KPRB 5I17A 1XGYH 3DSNA 1CR9L 2J4WL 5B39B 2Z8RA 4LSUL 2AJYL 5I8EA 3P4OB 4OB5H 5CBAB 5C0FA 4XBPA 3CFEA 3TPUB 4K94L 3VWKC 1L0YA 5I9QC 5C07D 4OCWL 1YEEL 1JCKA 1X6NA 4U1GC 2GJ6E 3JV4A 1UADC 5IOPA 3MLWL 4M03A 2GJ6A 5CSZB 1K85A 5ISZB 3MRBA 2BJMH 4JPIB 32C2A 5FGBA 3CFJA 3UC0H 3UO1H 4MJ6B 1T1ZB 5I74C 1I7ZB 4I18C 2DQHL 4ODTL 3HI5L 5CJBA 3STLB 3RUGB 2PW1B 4QRPB 1HHKA 3GHBH 3TV3L 4XRCA 2R0WH 3AC0A 3ULVL 4LVHC 4Z78A 1TCMA 4O2FB 2EE2A 3CC5B 2CRZA 3OJDB 4R3SB 2I26N 3JV6B 5C09D 2R56H 4TUKH 4LPUA 1OLLA 4H26A 3SE3C 1AC0A 3GIZH 3ARFD 1CCZA 5D7IE 4PJDB 5D7IA 1BOGB 4P49A 4YHML 2VQUA 4D8PB 3V0VB 4FABH 1I1AA 1DUYA 3QUYD 3SKMA 3BHBA 5AZEL 3JWDL 4K3JH 4YBQD 5DGRA 2OSLB 1SY6H 5DJ8A 2XY2A 5AUMA 4NNXA 5E00B 1IM3A 4Z7WA 3VXUE 4A6YL 1GRWA 4HFUL 5BS0E 4OF6A 1IJ9A 5KVGL 2ICEB 1H9VA 5D70H 4OZIB 2MCPL 1BFSA 4A2LA 3U0PA 2DM3A 3P0YL 3MR9B 4HAGA 4XWGH 2EIZA 1DVFB 5FHBH 1BPVA 4DGIH 4F8QA 1MI5A 4PJ9A 3S8WA 4Y4KD 2J6EA 4HJ0C 4M6AA 2ZCKL 4RFOL 3BFOA 4OGYH 1HYSD 3N1MC 1R3KB 5D7JA 2HJKA 4U6YB 4XP9L 2EDKA 1NGQH 3D9AH 3VGEA 2EE6A 2EZ0C 4MDJB 4G7VL 4MJID 4APQA 1TZHB 5HGDB 3MMEA 3ZE1F 3QIWC 1QEWA 5IMLA 5L6YL 5KSVB 1Z9SA 3MLTB 5CEZH 2OTUB 4OLUL 3UBXG 5I8KH 1RI8A 1CE6B 1CDBA 3QG6B 1T1XA 3KWWA 1FGVH 3QNZA 4JFPB 5D8JL 5IW3A 2Z31C 2R1YA 2Y36L 1U8LA 3RNKB 1VESA 4KI1A 3U4EB 4AYFA 1MNUH 3H9SA 4NPYA 3G5XA 3IETA 1LO0L 5CCKH 3TGXA 5JDSB 1CL7I 3ULUD 2NQCA 1R3JA 3K4DA 3ILQD 1OGTB 4Y5YA 2W92A 1H0DB 3ZZ1A 5DFVC 2HKFL 3RL1A 4JY6A 4X6DF 3HE7C 1G0YR 3GSUB 1A6VH 2GUOB 3G5VB 3TESA 1BOYA 4I0KA 1RULL 1T89C 1CZ8H 2HJFA 4LCYA 4PRPB 3CFBB 1AHWA 1J8HD 5EBLA 5C0DB 1RMFH 5E5MA 4P3CH 5C6PB 4AL8L 4JM2D 1H8NA 4L29B 2ADGB 5HYJB 4ZFZB 2CJUH 4ODHL 2Q7YA 5E6IA 3IDGA 3JVGC 4MD0A 1G84A 3RWHB 2DLTA 1AY1H 1YN6B 3B8YA 1K4DB 3C6LD 4KHXL 4NKOA 4D94A 4OCSH 1LEIA 2DLHA 5C08D 3SDXB 4U0QB 3O6MH 1YC7A 5IJVA 2WAHA 3SDDA 1OHQA 3W82A 2BXYA 1ZVSA 4GAJL 5TGBB 3BKYH 3B2UC 5SWZB 2APWA 5JPMA 4RRPA 4LLDA 4EIZC 1N7MH 5F7MC 3PDOB 3AREB 2X4OB 3UDWC 1LP9F 1X7QB 3OJVC 5DJZA 3TO2A 1E0OB 1NMBH 3ESUF 5C92A 3EYSL 4FRWA 3UTZA 3O2WH 4PJ5D 4MQSB 1I1FA 5EO0A 5SX4H 1BVZA 3EHBC 1HHGA 4S1QH 3KYOA 3FT2B 1CFNB 2DYPD 4PG9B 5E2TL 2IAMB 5DRWA 2SEBB 2GSGB 5CLWA 1KBGL 2CDGB 4C55A 3P4MB 4OUUB 2A2QT 5C0CD 2QSTA 4DCQA 4ZODA 5DUBB 5IT2H 3B9DA 2QSQA 5E03A 2C4FT 3UPAA 3RWGA 2P8MA 1QFWM 4HIJA 3PGFH 4OD1L 4QT5B 1NGXB 1H3PL 4WHTB 5DHVH 4OM0H 2GITB 1N26A 5DI8A 1BMGA 3J7HA 4PBVC 1MHEB 1WIUA 3ES6A 4MX7A 3ROOA 5F7HA 2W59A 3DLQR 4UBDD 4HMCA 4FQJL 5K9OB 1MCRA 1QA9B 3BIBX 5F8QC 3QCUH 3D18B 3RY5A 1BQLH 2EIDA 5ESAB 2VC2L 4NKQB 2ENYA 1IILE 4OD3H 4Y5XA 4NM4H 3ZYZA 4LCIH 2C9AA 2VXTH 3EDEA 5JXEA 4X4MA 4LGRB 1C16A 1K8DB 5DJYB 4Y4FB 4D3CH 1LNUA 1FZKB 3M07A 3L6FA 1X5HA 5GRUH 3MREA 2YRLA 2G75A 4QRUB 1TITA 3NVQA 5T3ZD 5D96B 1J05A 1SYSA 3IAPA 5I1HH 2V17L 4I0PB 4M4RA 2ZUXA 5T1MA 4LLWB 1KN2L 4MNQB 4P5TD 3FOLA 4JDVA 5HHXH 3IXTA 1ZA6A 1JNNL 5I8OL 2BVPA 1HSBA 4BK4A 1MHPL 4RGMB 3SGKA 3CFCL 5CP7A 5EU6E 4NQDB 5KSAB 2BDNH 2YPKA 3IFPB 4P2QE 1AGEA 1N3NB 3SO3C 3QA3B 4QRRB 1MFBH 1EXUA 1QLRB 3ZE1E 2DI8A 4YZFF 3L3GA 1BF2A 3QEGL 3NZ8A 3VFTA 4L4JA 3GI9H 4RQQB 4CNIB 2K3TA 1OAUH 1IGMH 1WAAA 4ZO8A 3HRZB 3RJQB 2JF1A 4QRSA 5FHAH 4PV9B 4JG0H 4XZUB 3FFCB 43CAA 1G7QA 4K8RH 4OI7A 3HI6L 2VDQL 1W72B 2PCPB 2NX5D 3T09A 1FV1B 3QT2A 3QQ4A 2Q86A 3S35H 4X6DE 5I15L 5L8JB 2FBOJ 1RHHB 1UA6H 4HQQL 4X6DA 5TPWH 3RVVD 2X1WL 1WT5C 4NQXB 4HT1H 1Q72L 4L4TE 1ZEAL 3SKJH 3KPLB 3E6FA 1T5XA 4IRZH 5IHZB 3R06A 3PL6D 7CGTA 2ZPKH 5E8EB 1QPPA 2VB5A 4Z77B 2V7HA 3BQUB 4I9WD 4URTB 4N1CA 4PB9L 2VQ1A 4KRNA 4M7JL 2IGFH 3V6BR 2AEPL 1FNLA 4Y19D 1MAKA 4R7DA 4IMKA 1NFDF 2LE9A 4OTXH 2F54D 3ZKNC 2R1XA 4LLMA 5H37H 1P4BL 5ACZA 4Q2ZB 4OGAD 5E9DE 3HNSL 1KFAL 4OGXH 3MX0A 5D1XD 3H2WA 5E9DA 1ZHLB 4CVWA 1LP9E 3OHXB 3QUXB 5B8CA 1LP9A 2XZCL 4M8QB 4PV8B 1NUNB 1OP9A 2R23B 3GK8H 3REVA 1F4YL 4HLZG 4NBZB 1Z0MA 4DVBA 4JM2F 1CG9A 3LKQA 2OBGA 3BKJH 4PJXF 2R2BB 5B21A 1VFBB 1Z9LA 4JFOA 1HCVA 3WFDL 4KRLB 2ZUVA 4JFEE 1PYWA 4JPWL 3ZDZF 4JFEA 1ZT4A 5BQ7A 4JEGB 5MI0C 3NFPA 3V6OA 1P84K 2I9LB 2D4FA 3A6OA 1UZ8A 4MDIA 4HIIA 5INDA 3RZCC 4OT1H 1U8QB 3S37L 2X89A 1NFIA 4G8IA 2WUCH 3IAQA 3P9WB 1CR9H 1FL6A 2J4WH 3OZ9L 4NQED 4P4KB 4MWFA 2AJYH 4W6YB 4OF8A 4P3DA 3HLAB 2NLJB 3O6FB 3WUZA 4K94H 3MROA 1NAKL 2D31B 4OCWH 3W5NA 3X13B 1YEEH 2VABA 2AEWA 5C07E 4RZCA 5DQJA 2WWMD 4NT6B 5C07A 2E9BA 1QP1A 4V1DD 1KLGB 4P2RB 3MZGB 1NCAL 3ARBB 3PWPA 5I17B 5E4EC 4CVXA 2CLVB 3HC3L 3IF1A 5C0FB 4XBPB 3CFEB 1IKNA 1KYOJ 1UKQA 5IB5A 2DQHH 1FNGA 3HI5H 2Q8AH 4MGXA 4XNZB 5FKAB 5CZVL 1KV3A 3HAEG 1VFMA 4G6FB 3TV3H 2EXYD 1DFBL 2GJ6B 4XX1G 3MRBB 32C2B 2NR6C 3CFJB 3CX2A 3WJLA 4UUJB 5MEOA 3D85D 3DMMD 5E08H 5GISH 3EAKA 3WFCL 3Q3GB 3PDDA 2ED8A 1ZTXL 4KK6C 1H5BC 5GGRY 3RZWA 2X1OA 2D4DA 2DQGL 2A0LC 3ME0A 1HHKB 1R5WA 2F8VA 4XRCB 4Y7MA 5C09A 3MV01 4IJ3B 4Z78B 1NEUA 5ANME 2EICA 2GJZB 1IAMA 5ANMA 2Z9TA 1LO2L 4NQVA 5AZEH 2AV1B 4ZUWA 2NY5C 4QWWD 4YZFE 3QUYA 4M1CD 3S88L 5EUOA 3THMH 4A6YH 3L5WA 4G43A 4H26B 2PTUA 2X1QA 4KC3B 4HFUH 1PQZA 5KVGH 3C60D 5D7IB 4NQUA 1KT2A 2MCPH 3MRDA 3P0YH 1YY9D 2FEEI 1F2XK 1DUYB 3IT8D 2VR9A 4NKDB 3RVUC 5JXAH 3BHBB 1F97A 4PTTA 1IAIL 2G2RB 5DJ8B 4GW1A 5AUMB 2ZCKH 4RFOH 2DLEA 1IM3B 3PDGA 3BN9D 4Y5VC 5JR1L 3RWDA 2BNUA 5I1KL 3O8XD 4MXQD 4Y4KA 5BS0B 4Q0XL 3ULVC 2YN3A 5IF0B 5E99L 3HFML 2OI9C 4PRDA 4ACPA 2EIZB 1LEGA 5ACLA 2XTJE 3S9DB 3O9WD 5L6YH 4PJ9B 1BQHA 4L8SC 1RJYA 3FO2A 3LEXA 4MJIA 1HEZA 2A6JA 4NCDA 2N7AA 4OCLC 1S5HB 4FMKA 1E6OH 5D8JH 4HKJA 2Y36H 3Q1SL 4H25B 3UMTA 1WBYA 1NFDE 2ZP0T 3UZEA 5EZOL 4APQB 1AJ7L 1NFDA 3JWDC 1QEWB 5ITFA 2XT1B 2P1YA 2K7PA 3FQNA 3U4BL 2HKFH 5HGGS 3FB8B 3BT2L 2RBLA 4WIQA 1OW0C 3SDAC 1RULH 1T1XB 3KWWB 2DF3A 3B6SA 3GRWA 4G9FD 4HIXL 3QNZB 3AU1A 2R1YB 1FG2A 1U8LB 3MJ9A 4GMTL 4AL8H 4IMLB 4OZFA 3F8UB 4UDUB 3H9SB 3WMSA 4NPYB 1J8HA 4XI5C 3IETB 3BJLA 1R3JB 2CXKA 4F15C 3DGCR 4O5LL 4Y5YB 4JM2A 4JB9L 1QBLL 2MTPA 1JZ4A 4PJXE 3RL1B 4JY6B 3TLRA 1ZHNA 2C3XA 3BX7C 4KHXH 2ZNXA 3AS2A 3LS5L 2NXYD 2HJFB 5GZND 3BJ91 3ZDZE 2DQJL 4YO0A 5EBLB 3OGOE 2W38A 5EZLB 3BEWB 4K07A 3SE4A 5C08E 2V2TA 4U1JA 4GAJH 1EFXD 1LO4L 4GQPH 1FFPA 4NRYB 4XMKL 2Q3AA 1GOHA 2X4UA 5E6IB 3IDGB 3NGBB 1R5IA 1JN6A 5A2JH 5D7SL 2X4PA 4KKBC 4MD5A 2YUWA 3VH8G 1K9TA 1Q94B 5FGRA 1LEIB 3DX9A 4NO5A 3EYSH 3LN4A 4I3SL 1VEMA 4M7LL 1JK8A 4KUCD 3DUUA 2XQYK 5FM5O 1ZVSB 4DKAA 2DMBA 5E2TH 2QEJA 2P4AB 1RUPL 4PJ5A 5F1KC 5I75B 4LLDB 3BEVA 4WNQB 3O81A 4LMQI 4ODXA 2BX5A 2DYPA 4YXHL 1Z5LA 1C08A 4MXWL 5DJZB 2YWYA 3TO2B 5IW1B 4GRLD 3U36B 5A2FA 4P57A 5EO0B 2NY3B 5C0CE 1YC8A 3BO8A 3FN9A 5DMGC 4F57L 5C0IA 4L3ED 5FK9B 1OSZA 4UV7L 5CKAA 2FO1A 1VERA 4GG6A 1H3PH 4J4PD 4HSQA 4Z8FL 1DQTA 1OSPL 1MCOL 3HC4L 4DCQB 5F88B 4LEXL 5TDOA 1RJCA 4I4WA 4QTHB 5FDYA 4FQJH 4DW2L 1DEEA 1U8PB 3RWGB 2VC2H 3PNWB 1F4XL 4MJ5A 3QO1B 1OD7A 1B0RA 5DI8B 2C1OB 5T3XL 3CVHA 2YR3A 4KPHL 5LGKA 3ES6B 4NC1C 1J10A 3TT1L 3VFVA 2Y6SC 1S7QA 2B4CC 2CDEA 3RTQC 1BQUA 3O41B 1QUNA 1T0NA 2V17H 4J23A 5D1QD 5E95B 5J3HC 3AFLA 2LFGA 3WO4B 3MC0A 4UIKL 1KN2H 4GRWH 1CGXA 1LNUB 1I3VA 1JNNH 5I8OH 4E5XA 1D5BA 3MREB 1MHPH 2ENSA 2H2SC 2BVQA 3X11A 4P5TA 1TVHA 3HCVA 2ERJB 3RGVC 3TZVC 1GC1L 2IBZY 3CFCH 2XWJA 2OJZL 2ILLA 1JV5A 4X80L 1DP0A 1Q1JH 3GBML 4G8EA 2APFA 3RWEA 1CL7L 3FOLB 4JDVB 3NAAH 3IXTB 1NAML 1ZA6B 2ZOKA 2WBKA 3QWRA 2NY4B 4R0LA 3MLSH 1CTOA 3MLXL 3MGOA 5CP7B 3DVGA 5D1ZD 4U7SA 2N1KA 1KCSL 4Q9QL 4ONOA 4HCRL 2CRIA 5E2JA 3MACL 2YPKB 1AGEB 2MPAL 5EU6B 5IW6A 2X4RB 2X09A 2NY7H 4OQTH 4K7PY 1EXUB 2ZZUT 2ARJQ 3KNBA 3L3GB 4GBXA 3NZ8B 2ZNWA 3RFZC 5T1LD 4TPRL 5I15H 3RWCA 4B41A 5JZ7C 4HQQH 1E4WL 2NX5A 2YPLD 1VHPA 5CJQL 4ZUUB 4MS8D 4K23L 4QRSB 4N0FA 1S9XB 5JORB 1ZEAH 3FMGL 4XWOC 43CAB 3DVNB 4QHNA 3MRCB 4ZD3L 5DEZA 3RHWK 4JZNA 2OS7A 2Q86B 2XPGA 3QI9D 3DPBA 3H3KA 3VXSD 4J1UA 1IEBA 4X6DB 4PB9H 2EDLA 5DZLA 4I9WE 4M7JH 2AEPH 1OAYH 3MNVA 1YEKL 3DX8A 4X9FA 4Y19E 1JUFA 2EDHA 4L4TB 2AKRA 1T5XB 4Y19A 1S78D 1P4BH 4HUXB 3HNSH 1KFAH 2V7HB 2F54A 5DD1L 2BFVL 3BIKA 3NH7L 1FVCB 2XZCH 2VQ1B 2AABL 3E6HA 3MRKA 4POZD 3D3VD 3QNXB 5CZKA 5D1XA 4DK6A 1RFDL 4R7DB 5C2BL 4U6XA 1F4YH 3QPQD 4FN0A 4JG1L 3IFOB 3LKOA 3U4AA 5E1AB 3LKPA 3UX9B 1PEWA 2R1XB 4BKLA 5ACZB 1KIQA 4FFVC 4PLKC 5E9DB 3IDYC 4QGYA 4Z5RA 5KAQF 2RHEA 4JPWH 4MMZC 5B8CB 3QEQA 4X8XA 1LP9B 3DRQB 1VDGA 1CXKA 1LDPL 4RGMC 4RMTA 2ITCA 1JF1A 3REVB 2FD6L 4Z7UA 3QEHA 3DARA 4DVBB 1ZVHA 1NCDH 3CD4A 4G6AD 4EI6A 5CIPB 3S37H 3KPOA 1HI6A 5D7KD 2D7TL 2IPUG 5DJ2A 3OZ9H 4G9DB 3HA0A 5HSFA 1D6EA 5I1DB 4JFEB 4NQEE 1NAKH 5BQ7B 1U8MA 4ZG1A 4KUCF 4O00A 2OL3L 1RU9L 5INDB 3IFLL 2IF7A 4WFED 2NY2D 2P48B 4IIQA 1NCAH 1SVZA 2BERA 1FL6B 4N5ED 4RBPK 3GMRA 3S6CA 3QDGD 2WP3T 3HC3H 4KQ4L 3QUZA 2ICES 4V1DA 4P3DB 1JPTL 2FH8A 5GJTL 5LAXA 3MROB 5EH1A 3IGAA 2VABB 5CZVH 1NCWL 2NMSA 4RZCB 5DQJB 1DFBH 1G7JA 5DVOA 5C07B 2MFNA 5LVEA 1A6AA 5FKPB 1JF5A 2A6IB 1AKJD 4CN6A 3T2OA 2IFFH 3VXMD 4KZEL 4CVXB 3WFCH