4GSDH

H5.3 fab structure
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
VQLQESGPGLVKPSGTVSLTCAVSGGSISSSYWWSWVRQPPGKGLEWIGEIYHSGNTNYNPSLKSRVTISVDKSKNLFSLKLSSVTAADTAVYYCARVALFDILTGGWFDPWGQGTLVTVSSAGTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human antibodies that neutralize respiratory droplet transmissible H5N1 influenza viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords H5.3 Fab Light Chain
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2012-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gsdH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4gsdH01
3FQTB 4APQC 4LSTH 4F57H 4EUPB 4JFFD 1YEFH 5I8KL 4R2GD 3BN3B 5D7IA 4QNPF 4PRBA 4QHKJ 5B8CB 5GS0L 5L0QC 4NNXA 2IFFL 5I66A 3FT3A 4KQ3H 1E6JH 1IGML 3O8XB 3FOLA 5KS9E 2BXZA 3LN5B 3QQ9C 4ZSOA 3X14A 2ESVD 3ARDB 4MNQD 3ZL4L 3WHE0 3IF1B 4PYGA 1W0WA 2EO1A 5FO8B 1FRGH 1ORSA 3CVHA 2A73A 2XZCL 1WZ1H 2GJ6A 3C6LC 1NAMA 4BM7A 2W92A 5DJ2B 1INDL 2NCMA 2AJXL 3BXNA 2OS7A 3B2VL 2QTEA 4Z0BH 4C83A 2BNQD 3C2SA 4U7MA 4OZFH 3KHOA 4EOWL 2EDDA 3TVMA 1I8MA 1NANH 2VISA 3MO1A 5T3XL 3NABL 4IRSB 4LFHD 4KH2A 1X5GA 3QCTL 2EYTA 2C1OB 2VABA 3K0WA 3H0TB 2D7PA 5GS1B 3VGGA 4G43A 2ZCLL 3E8UH 1ZHNA 2ITDB 1T6WA 2EDYA 1OAZH 1T2JA 4IRSA 1N0XH 4PB0H 1VPOH 4X6EB 4H0GA 4DN3L 5L7XH 1YZZA 3MJ9L 4J8RB 2DLFL 5CKAA 1QVOB 3PGDB 1LD9A 4WI6A 4YC2B 1UCBH 4OCMC 1JWUA 2YBRB 1SEBA 4JFYA 1AQDB 4OF5A 2VLKB 4MAYD 1DVFC 2OQJB 2NR6C 3F12A 5K9OB 1HH6A 3S3SA 4RZCB 3MV8A 5EO1B 1CFTA 2VWEC 5E6IC 3DYOA 3CXDH 3KPOA 4P2YA 1RVFL 2ADIB 5TH2A 3F58L 1NL0H 5FUOL 4UILL 3LEVL 5KANG 4AZ8A 2APWA 4JRXD 3REVA 1PX3A 4Y88A 4YGVB 5MENB 3IFPB 1A6WL 1R24B 4ZD3H 3QO1B 5IHUL 5KAQG 3JTSB 5FM4A 1IILE 5E9DB 4NGHL 3H7LA 5DLMH 2PTUA 4MJ2A 3H3PL 3LD8C 2IAND 4OB5H 4K8RD 4RX4A 5K93A 5A2KH 2GK0A 5LGHL 2F19H 4PJBE 1JGVH 1UZ6F 3MBXH 4JKMA 1QBMH 5HYJB 4XWGH 4WI3A 1GOHA 1U8JB 1URLA 1A7RL 1W0VB 1YA5A 1ZE3C 2CIIB 2DWEA 3HCVB 5IEHA 4UQ3A 3MXVH 3WIHH 4MXQC 2J3SA 2EZ0C 3T04D 1U58A 3X13B 3RBGA 4FQLL 4R7NA 1WBXA 3ARGC 3X3FH 1RUPH 3MBED 4XCFH 4RAHA 1C12B 2OBGA 1XGTA 3JWNC 1AR1C 1QFHA 3BGFC 3V4UH 1S5HB 1CDJA 2QKIB 4MSWA 5FK9B 1Y6KR 4EDWL 3T0AA 2DQDH 3LH2L 4UDUB 1A6TB 3CFCL 1D5ZB 4X5WA 3GJFK 2MJWA 5C70A 5DK3A 4YXKL 2XYCA 1KYOJ 3D0VA 1ACYL 4KQ4L 2KUTA 2YPVL 4QOKD 3QFDA 4XBPA 5KN5B 1A6VH 4LSUL 3SQOH 3VXSD 4O2CB 1VHPA 1FJ1B 1J8KA 2O61A 2DYPA 4P0DA 2FO4A 4JFPA 2HT3D 5C0AB 1IZKA 2I27N 2X9YA 2XI9A 1W72L 3ZKMD 3AB0C 3UTSA 4XC3H 3SDDB 2QQNL 1CLCA 3W0WA 1SBBA 4FXGB 3I50L 4NYLB 1FZMA 2KQNA 1L6ZA 3TH3T 2PYFB 1U8PA 3W0WE 3HI6L 4TUKH 3FB6A 4IDJL 5CJQL 3QNYA 4D3CL 4K9EC 3S96B 3VXSE 3T0ED 3WIFA 3MLUH 3GEWB 5BV7C 4XP5H 4RISL 3STZB 3C09B 1WC7A 2VDQH 4OBSA 3WJJA 4LSQH 5DMIH 1HKLH 1P4LA 2IQ9L 3VI4E 3GSNA 3HC0B 4QRUA 3VXNB 2X4OB 5T1LD 1IEBA 5J9PB 5CBAA 3DRQA 4UBDD 4XCYB 5BW7A 2VC2H 4M7JH 2DTMH 4EXPX 3B43A 2VL5A 4HMDA 5CSZA 4ZFGL 1MH5A 4OLXL 3TN0D 5C0IB 3X3GL 3FHAA 1V3KA 2EDJA 4X4YA 3PGDA 1KELH 3OHXB 1WT5C 3TH2T 4HIXH 4TSAH 4L4TD 1BJMA 2Y07H 1RULL 1J9CT 2BVYA 2GFBA 4LLVA 3CSYA 3T3ME 2OP4L 3D1MC 4U1LA 5F1NA 3O6FD 1HOCA 1KENH 4XZUB 5I1DB 4HEME 4NBZB 1I1CA 2ZJSL 1BJ1J 2QL1A 4N90D 4QXTB 4QWWD 1ZA6A 3I3DA 3HE7C 3FN3A 5JPNB 4JQVA 1KSRA 2OXHA 1GZPA 5ISZA 1I8MB 3PL6C 1MVUA 4LCUA 2A6JA 3ZT5A 3VW3L 3N85H 1H5BC 2XXMB 4YZFF 2Q3ZA 3EOBB 1AGDB 2FD6H 4PUBL 5CILH 3L5JA 2K7PA 4ZFFA 3KPSD 3FT2A 4H25B 3MNWB 4DW2H 12E8H 3UTOA 1ORSB 4KJYA 1T0MA 4KFZC 5TE6H 2YPLA 3RY4A 3QHZH 1MCSA 4HPOH 3X11A 8FABB 4HBCL 4CMMB 1XIWA 2IBGA 1DUYB 4FFWD 4HEPG 1KTLA 3S4SA 4JREC 2EC9U 1IM3B 4M1DH 4OFYA 4K3HA 5DJ0B 3ZTNH 3NCJL 5D71L 3FOLB 2GW5A 4P9MH 2HYMA 1L6XA 5HYSG 1MI5D 3KPTA 3NIGE 1GCFA 4RDQG 3EDKA 3VG0L 5ADPH 3KYNB 2E7MA 3NCMA 4O58L 1T0MB 3TO4C 5KOVC 3BKCL 1FN4B 4ODVL 2B1HL 3SN6N 3TBYA 4TTDC 1YQVH 1DBAL 1UXWB 3ARQA 1I7ZA 4JB9L 4JDZB 1FPTL 4CRPA 2QSVA 1Z9OA 3SPVB 1E4WH 5BMFH 4YAQA 1U41A 5D6CA 3TCLA 1MJUH 2NY4C 4XMKL 4JKKA 5BS0D 1R0AH 3WFEH 1F58L 3SE8H 4OCXH 3MGTB 4M48L 1U8NB 1B0RA 3HNSH 3O3DB 4DQOL 3C5JB 4HS6A 3U4EB 2XWTA 5HHVH 4LPCA 4ZFOL 3GKWH 4I48A 1CGTA 4HJGB 2R29L 5INDA 2B7DT 5C0EA 2G2RA 5KW9H 4JDVB 4CN6A 3PIQB 1FO0A 3VXSB 3W2DH 5L2KB 4LSTL 4P99A 2CMRL 5CGTA 4X7DC 5DJDA 1JYNA 5K9QI 3RZWA 3V9FA 1IGIL 3ZE1E 2FX8L 4OLUH 4YK4B 4LCCC 2V17H 1EHLL 4OZIE 4HV8A 5JR1H 1MRDL 1OSPH 2EDOA 4G6KH 4R4BB 3V8CA 5JW5A 3Q0HA 1QO3A 2J6EL 3GSNB 3HC0A 3WYRA 3FMGH 1CVRA 4ONHB 3OQ3B 4DKEL 1RZJC 2HLFD 3DO3A 1CD1A 3MQIA 2AKRA 5I19H 2FZ3B 4MD0A 3WDIA 4FTVE 2P5EA 2H9GA 4NNPL 5HYQB 4DWHA 1CG9A 1A7PL 4H1LA 4MA3A 4KJPD 3RTQD 2PW1A 3D69B 1BFTA 5E94A 2WQRA 3C5ZA 2NY5H 4DUVA 3QFJE 5TE4L 5DJYA 2YR3A 3QEUB 4U3XA 5CP7B 5MERB 5LXGH 2YK1L 2G5BA 1B4JH 4HUWA 3T1FB 3QDMB 5BO1L 5J12C 3LPGA 2VITB 4QRTB 1DQDH 4YO0A 3IDNA 4NHUA 5HI4D 15C8H 4LPVA 5C0DB 3B8YA 1WIOA 1UA6L 4NO0A 1IE5A 4V2BA 3SJVE 2CIKB 3BIBX 1N0XL 2FX9H 2O61B 3PABB 1XZ0A 2JIXA 3N06B 4MNQA 2MCPH 4QHLA 1MVFA 5ENWA 1JK8A 4LCWE 3A6OA 3WE6A 5HGAB 1CICA 4HF5H 1OAUH 3RVWC 3CDFA 2IPKB 2R2BB 4A6YA 1LNUB 5E6YA 2R39A 2VUYA 3FOMA 1ZGLP 4HWEL 1GPOH 3CLEL 1E4JA 1N0LA 4L8CA 3L1OH 4GXUN 1WCBB 2EXWD 4OGYL 2ZSWB 1J87A 5I71B 4NPYB 5C8JB 4G3YH 4FTVB 4YHML 4P5KB 3EFFA 2CDFA 5FKAA 4Z7WF 1A6WH 4PRDA 4ZNEA 4CL7A 5E08L 4OLEA 4LNVA 2NW2B 4LKXA 3KPNA 1VFBB 1I9RL 3KYMB 1JGVL 1WZKA 2F5BH 6FABH 4M93C 4JN1H 1IEAA 4YQXH 1MQKL 3GIZL 2GYSA 1C16A 3BH9A 3OGCA 3VDAA 2GI7A 1KIQB 4WFGE 3BMWA 1KJVA 5KSBB 4EZMA 4NFCA 4NKDB 5C0RL 2AXGA 1RUPL 4H0HB 4TVPD 3PWJB 2VR4A 3FB5A 2EE6A 2CDEA 2B2XH 1GJIA 1HWGB 5DRZA 4U2ZA 3G6DH 5DVOA 2GHWB 2A9MH 3FQXB 2JCCF 1RZ8A 1T4KA 1P7KA 3MJ9A 4YLQT 3CX2A 5AAWA 4MNQE 5B39B 1BFOB 3DO7B 1C08A 2R1YA 4H1LG 5HGBB 1AFVL 1FP5A 3M17B 4LPXA 5FHBH 2Z8VC 4MJ6B 5DC4B 2GT9A 1JNJA 4LSVL 2OTWB 5ESVA 3NTCL 4FFYH 4QKXB 3SQOL 1FO0B 1QACA 2YD4A 1KIUA 4IRJC 5DD3H 3TA3C 4ZDHB 4XNZB 5FCUL 3TPUA 4G9FA 2XZQH 3FN0L 1MCJA 4HD9A 4ZOCA 2FEDD 4Y4KB 4FQ1H 1MHCB 1F42A 2CKBB 3ARFD 2VLLB 4G9FE 1WCQA 2R8SL 1C5DA 3K2UH 5A1AA 4NZRL 5IGXH 3DYPA 4Q9BA 4X6DE 4PRPD 4XAKE 4YAQB 1MCFA 2L7JA 4LIQL 4KKNA 4NO5A 5C7XL 4JZOA 4C83B 4PGBA 1T20B 3IETA 2V5SA 5IVXE 3VMPA 4ZUSA 4JZNB 3PHQA 1BQSA 1G1YA 1F4HA 3R06A 3CZFB 2Y7QA 1P6FA 2AK4A 5JIHA 1YMHA 1GRWA 3P4OA 5F96H 3AREA 4GW5B 4MNHB 4BYHA 4EN3C 3DXAE 1I1FA 2EC8A 5C0CE 3KPMB 1WVZA 2B0SL 2ZPKL 4O2FA 3IXAB 2F8VA 5KG9A 4LCWB 5GGSY 4WTXA 4GG6E 1CGVA 4NNXB 2DBJA 1IM3A 4OFKA 4Z5RB 4XVJL 1GGTA 3ABZA 2X42A 4LEOA 4GG6A 1WUNT 5TE7L 3ULSA 5IB5B 5E2TL 2R4RL 4PV9A 3C6LD 4I5BB 5C6TL 4J1UB 4BZYA 3WIIL 1UH3A 1X6LA 3HZYB 3VGEA 5F89A 5DJCB 4R0LA 2NTFB 2NLJB 1Q9WA 3UO1H 1NGZB 5I76B 1H3PH 5CJOL 1OB1B 4GLRH 5C8JA 3MA7B 4EN3D 1ZHBB 1U2CA 4PJHE 3L3HB 3N85L 3OAZK 2AEWA 1EAPA 3W9DA 1MREH 1EA9C 2P24B 4UAOB 4XBEL 1N59A 1KB9J 4H5SB 3BJLA 3V0AC 2MOVA 4GAYA 4H0IA 3NBNA 3GKZA 3JTTA 1PG7X 2BP3A 2APTA 1KNOB 1IGYB 1KGCD 1T1WB 3PHOA 4POZC 2E7HA 5D7IE 3ZTNL 1L0XA 3FO0L 4UIKH 1II4E 5JXAL 4HWBA 4MA7H 5LVEA 5E2VH 4QRUB 2YZ1A 4JLRA 4WFHD 3TIEB 5ANMA 4JFDB 1P1ZA 3QDMA 4PJXE 4EDXA 4UT9L 5E5MB 1MLBA 1OT2A 1N7MH 3HAEB 2C4FU 2FIKB 4HZAA 2RFXA 1YQ2A 3P77A 3SKJL 3Q48A 3MUZ1 5GRUL 2A1WL 3HE7B 2X5PA 2ZKHH 1FNHA 1LO3L 4UT6L 5GGVH 1AIFB 4OZIF 1AXTL 3CLFH 3CMOH 5IQ9A 3ZKNC 4U6VH 3I02A 5DUPH 5C3TA 4UV7L 5MHSE 4JKLA 4HAGA 4HJJL 2DKMA 3CSPA 2BX5A 4MGXA 1SBSH 4OLVL 3CC5B 3KPPB 4GRMA 4HCRH 3VXPB 2VZOA 4NRZB 4PJHB 1KPVB 4OV5B 4X6DB 4Q9QH 4CU7A 3BKYH 2VDKH 1IC7L 1CD9B 4Y8DC 4R4BA 1QPXA 4P23D 3V95A 3KLHC 3HC3H 3RY5A 2ATPB 1NMCC 1XF3A 4G8GD 2DYPB 3CZJA 1XR8B 1K6QL 5GS0D 2KPNA 1NMAL 4PY7B 4APQB 2WUCH 2YBRA 1MCPH 3EJYC 4YDJA 3VFMB 1LEIB 5DJXB 4Z7WB 2CMRH 4J8RA 3HG1E 2B1AL 1G7JA 4JVUA 4X6FB 5ECJE 4JHAH 5HDLA 3VD5A 4I48B 3EYVA 1A1MA 1QR4A 1F00I 8CGTA 1U6AL 3GSQA 2NY1B 2V7NA 2ZOKB 4O02L 2XKNA 4LVOB 4U6XA 3SDAD 3OWEA 1S3KL 4LVHC 5KSAC 1AGCA 4LMQE 1OSZA 3Q6FA 1T0PB 1DBJL 4AG4L 2UVFA 5CGMA 3IS0X 4HDIA 4XP1H 5FYLL 2EIZB 5H2BA 5JIKA 2MPAL 2FECL 5F3HB 1IKFH 2YRZA 1FZKB 4AL8L 2ICWJ 4LASH 4JO1H 2FB4L 5GQBA 3IDJA 1RUQH 1U3JA 3ULUL 1NAMB 1MCKA 4QRPB 4Q0XH 1IMHC 5J0BA 3QUYC 1TCRB 4OQTA 3CH1B 5CP3A 1FAIH 3WXWH 4NC0B 3DV4B 3OAUH 3DMMB 2NW3A 3MNZB 4LVNC 1U8OB 4CVXB 2HLAA 1KN2L 4YZFE 1A2YB 1XH3A 3FT3B 2EDNA 1A3LL 1LP9F 3W11C 3HUJB 2HH0H 1FFPB 2EE3A 4PRBB 2X4QA 1PFCA 5F7DB 2XPGA 2DM3A 1P9MA 5JOFB 1MI5E 2V5YA 3F12B 3KNBA 1MCQA 2VR9A 2JB6B 43CAB 3RZCC 1INDH 4LQFH 4KI5F 4OUUA 3ARFB 5IW1A 3WL9B 1VCAA 2B8OT 3PV7A 4RFOL 3PWNB 1VADA 2GJJA 3T65B 1MLCA 4QHKI 3MV9A 3WNLA 1XT5A 3BI9X 2PF6A 3CNKA 2H6PB 1P5VA 2HP4A 5D8JH 5I9QB 5BV7L 3M1BA 4X6CB 3NABH 2JIXD 1HIMH 2HRPH 3VH8A 4WW2A 4DUXA 1HHHA 2BVOA 1JPGA 3V0VB 4BSVA 2HJFA 4NOBA 4YUEH 4FQXD 5B4MD 1N64H 1BAFH 3RGVD 5IMKB 2J5LB 3SE3C 1YYLL 4QOKB 3MO1B 4XP6L 4AENA 2AXFA 5IBUG 3JWDH 4QXGL 4F9LC 3V6FA 4UTAL 3EJJX 3ZYOA 4OKDA 3QIUB 3DRTA 1UCBL 3H7BA 1IAII 4M1GL 4MD5B 1UKQA 4NQED 4W6WB 1IAOA 2X4RB 4XPBH 5IMLB 2WSKA 2CKBH 2XN9B 4NWTH 5CJ5A 4K8RC 5HYJD 4Q2ZB 5CEZD 2UWEE 2WINA 5IB4A 4Z7NF 2EO9A 3AXLA 1T1ZA 5GJSH 4TNVK 2IPTL 3JWDC 3MRFB 1EFXA 4WTZG 1F6LL 4M5ZL 1N6UA 1KPRA 4O2EB 1TXKA 2GY7B 5F7HA 5E5RB 1JPSL 1JE6A 1BJ1H 1ZVSB 3NTCH 4FFYL 3QDGA 1E6JL 1I9EA 3ZTJH 5IVZB 1KLUA 5E6ID 1QBML 3MRHA 1ES0B 1F2XK 4POUB 1KCUH 4PJFF 4XWOC 4Y5VA 4XBGB 5FB8B 1A7RH 4YC2C 5CGYD 3QFJD 3S5LG 3WHE1 3T2NL 1FRGL 1KPUA 5KZCD 4MCYA 5I8CA 1H8OA 3U0PA 2Z8WC 3AM8C 4OD2A 1V3JA 4XP9H 4J23A 1S8DB 3T8XB 4QYOA 4ORZC 4Z78B 4XVTL 4WEMB 1ZLWH 1G0XA 5JNYB 1FGVH 1ZVSA 3DROB 4LRNH 2DQDL 3LH2H 1V8HA 3NCYP 4HXBL 1FG2B 1RZFL 4PJFB 5FO7A 1D5BB 1D5MB 2X70A 4D0CA 4UDUA 3R0NA 3MRPB 3NZHH 3I6KB 1IQDB 3E8UL 1TIUA 1B3JA 3EKCA 3KXFA 4F3FB 3BQUD 3CFJB 3JV4B 2DLIA 1X5HA 1ZA3B 3ULVD 3PWUA 3OF6D 5F3BB 1UACH 5L7XL 1VFMA 3QEGH 1N5AA 3JUYA 4OGXL 2BNQB 4CUCA 3NCBB 2PTTB 5D70L 2Q7YB 4XVJH 3MOAL 3SGJC 3F5WB 2H1PH 2OL3L 5J06A 4RWYL 2BOCB 1IFHL 3ARVA 1AD0B 2ARWA 1LO0H 1NSNL 4PRHA 4FABL 5JHLL 2EYSB 2YD6A 3EHBC 5IB5A 1MFBL 2IFGA 3QUZB 4ZPVB 5EWIL 2DM4A 2XTJC 1JMZA 1A7OH 5JPMB 5HGGS 5I73C 4G6FD 4LAQH 1WEJL 5HGDA 1NL0L 2RB8A 3L3GA 4UBDC 1NGYA 2LV4A 4HUKB 4O9HL 2ENSA 5EH1A 2PYEA 4N0CD 4JFZH 1WTLA 1K8DA 1UWEL 4PJIB 3GSOB 3TT3L 1N3NA 1ULVA 3KJ4B 4JEGB 4AIZB 4P2QE 4BUGA 2CRIA 4JFYB 4K94H 4ZFOA 1U8HB 1SEBB 1YUHA 3BESR 3MRHB 5HVHB 1X44A 2VH5H 5DVNA 4OCWH 2OI9C 5LBSL 1PZUB 1DEEA 1M7XA 5M95B 4K23H 1MHEB 4HIXL 4Y4HD 4HUVA 4RA0C 1NEZB 3RU8L 2W0PA 4M6AA 2VZUA 3FO0H 4UIKL 2X1OA 3RAJL 1R3HB 3O4LA 5D7LE 3QXAA 5GJTH 2ADJA 1E6OL 4KKBC 4O2FB 2IANB 5EOQH 2BNRA 1KENL 1V3LA 3HZVA 4KRMB 4TVPH 1B9ZA 1AY1L 1D9KB 4OCLC 2BVEA 3AREB 1A3RH 5IMLA 4YXKH 1IAOB 2X4RA 4XPTL 3WKMH 3MMEA 3RWCB 4HIHA 4YHYB 5HI4C 3MLXL 1TZGL 4P4RB 4K7PX 5KVFL 1KB5B 5GGVL 4YHIA 4BH7A 3QIUC 4J6RH 4BK5A 4NO5B 4Y1AA 1I8LA 1RZ8B 4L29B 2D4DA 4HKXB 4TUJB 1I1AC 1FL5B 4GFTB 4F7MA 4DW2L 1M05B 2A83A 3QJHA 7FABL 1AO7E 4HBCH 2WIMA 4PJFE 3MOBL 3Q6FB 4XC3L 3L6FA 1A6UH 4M9PA 4S0SD 4AEHH 5DEZA 4Q9QL 3EYFB 3QDGE 4ONFL 5GSRB 1ZV5A 1DEDA 4P5TC 5A40E 1V7NH 4KI5E 1BIIA 3OKLA 5HHNB 4X7SH 4UQ2B 4MDJB 1MCPL 3BZDA 3F8UB 4NKMA 4KDTC 1SJEB 1MJ8L 5K9JL 3O4OB 3GB7B 5B8CA 3LS5L 1A4KA 1UYWH 5I0DA 3SY0B 1NAMH 5E9DD 4LARL 2MQ0A 2QQKL 3E6FA 3OX8A 3HZMB 4Z95L 5EOTB 5SWZE 3BP6B 2JB6A 4JHAL 3L7EB 1J0YA 4ZFOB 2AI0H 3GSXA 1NFDF 2VAAB 3RVUC 3FQXA 5JOFA 1MJ7L 3G6JF 1Z9MA 4GT7A 5IHLB 4FNLH 1BZ9B 3QH3B 1QYGH 1O5DT 1KFAL 2BNQE 3O6KL 3GGWB 4RFEB 5IKCA 2HFGL 3HUJA 3WFEL 2Q87A 1HQ4A 2HWZL 3HRZA 3QG6B 1FYTE 3FJTA 3TLRA 4P3CH 4YDLC 3F7QA 1MFAL 5KOMC 2XFXB 5KS9B 3MRBB 5T33L 4QO1A 2EIDA 1I8KA 3AFLA 4X98A 5I1AA 3IU3A 3DXAB 4E5XB 2LTQB 3ILQC 2DRUA 1DDHA 4AIOA 3RVTC 2X1PA 3DX8B 4QRPA 1OP3H 3BPCB 2NZ9D 4JY6A 3RWEB 1AD0A 1NAKL 5DHVH 4QRSA 1J0HA 5DFVC 4F8TA 1ZGLM 4FXKA 2AVGA 3OGOE 3IDJB 4YBQD 2CIKA 5D96B 3LRGA 1IKNA 3UYRL 1CDHA 4KK6C 2YMXL 5E8EA 2WLZA 4NJAH 2EDKA 3ILPB 1L7TH 4MNGA 1OM3H 1FFQA 2VITA 4QRTA 3WBDA 5TFSH 3KDMB 1NC4A 3BJ91 2EEBA 3CPLB 1AH1A 3TA3B 3GMMA 1U8LB 2Z92A 5DF0A 5E99L 4OFYD 1QBAA 4OF8A 5HHQB 3D2UD 5EBLA 5KSUB 1KXQE 4H5SA 4KTDL 3X12A 4A6YB 4Q9CA 3VGAB 4JFXB 3VI3F 3QIUD 5C0BB 1OARH 1GGBL 3VFMA 2Y06L 5TE4H 1HCVA 1BLNA 1FYTB 3ECBB 3VJ6A 4GW4B 3TC9A 3EYUL 4EN3B 1DQDL 1MAKA 1F4WL 5F89B 4XBGA 5FB8A 3HZYA 2AJVL 2C3WA 4Y4HB 3LEXB 1MIML 3OJ2C 3O6FC 1DBKL 3MV7A 3HG1B 1OAUL 1N8ZA 1WISA 3UXFA 1JTPA 1UENA 2FJFB 1JYXA 5BQ7B 3VFTB 1S7UA 2B5IB 2GAZB 3I75B 4PJAA 3TFKD 4TQEH 4L3ED 5EU5B 4WW1B 3HNSL 3MRIA 4DQOH 2QHRL 2Y4SA 3MCLH 4F8QA 4GAJL 4AMKH 2NXYC 1A6ZB 1QP1A 2NX5E 3OAYH 3KJ6H 3X17A 4NWTL 4QTHA 5EIIB 3HS0A 4P49A 1I1YA 5JW5B 2IALA 35C8L 3RIFK 3CZFA 4NHCL 3H3KA 3UPRB 4MD5A 3MNVA 2EIBA 4KTYA 3QZWA 4WTWA 4DZ8B 3R4DA 2EEDA 1YEGL 4ODUA 4EKXA 1BBJB 3B3IA 1OSPL 3UJIL 3GMLB 5DI8A 4XNZC 4JRYE 3W9EB 2WBKA 3RWIA 2EE2A 5C0EB 3FMGL 5TDOB 3IJYA 1FVDB 4XX1E 5EPMA 4X8JB 4BFEA 1DANT 4IOFD 5DHVB 3O3DA 3NMEA 2VLMD 5KVDL 5ADOL 2PTVA 1BECA 2OX5A 3QUXA 1V7MH 3MA7A 3S4SB 5AG8A 3W5MA 4RFEA 3UTQB 4WFED 5D6DA 2B2XL 5C3LD 2O5ZL 1KCLA 3GMOA 1Q9WB 2LAGB 1B4RA 3G6DL 3NCEB 2EDEA 3ZYIA 5HYJE 3QFJB 3PL6A 1XMWA 5C9KA 4PJXF 1B4JL 1L4IA 1T1XA 4R96B 5CMAB 1P7KB 1WV7T 5DVMA 4FQHA 2WMPA 3DSFH 1ND0A 4WUKL 3L5XL 2XRAH 4LPYA 1BEYL 2XTLA 2ITCA 2FX9L 3QUXB 1DLHB 5TQ2H 5D1ZB 3BZFA 5EBGA 3RVTD 1EHXA 3FN0H 3IXAA 4U1LB 4U1KB 5BRZB 2NW3B 3BVNA 4X7CC 2W60A 2D31B 1A9EB 2CK2A 4J3OC 5I1HH 1JHTA 3TIDA 4Z77A 1VACB 3QXDB 4PP2B 3KYOA 1J0JA 4LKXB 1LDPL 2UY6A 4BA8A 3H9SB 3C5SB 3NPSB 4HIJA 3QZWB 4NN7C 1FIGH 1AGDA 2PXYD 4ZUWA 1FGNL 5EU7C 1FZKA 2R0LL 4BZ1H 2FL5A 1I1YB 3VXNA 4MXWH 4YXHH 3BOVA 4M7LH 5C0GA 3ULUD 3C09C 1KIPA 1WAAE 4HFWA 3NIFE 3FTGA 5DJ8B 1Y18A 3OF6A 1OCWL 4ZXBB 4QCIA 2I07A 5A16A 6FABL 2HG5A 1RJLA 3JV6B 4HK3N 1JGEB 2DTSA 4L3EA 1CIUA 2JCCE 3TYFA 4GG6F 4NQVA 4RNRA 5EDXA 5LBSH 3O6MH 2ARJB 4FFVC 4OD1L 1J0ZA 1YPZF 5D1XA 1C08B 2R1YB 5IMOA 3IDYB 4U1JA 3U9PH 4Y4FC 2E3VA 4XMPH 3SBWA 1I85A 3QPQC 3RX8A 2ZG2A 4X4XB 5T1MB 5IW3A 2C9AA 1JGLH 4HAFA 4KAQL 5EOQL 1C8PA 3NN8A 4PBWD 5AWNH 4F7PA 1HSAA 3GJFA 4GQ9L 4HUWB 2YC1B 1TQCB 3T1FA 1LO5A 2R2HB 1ZGLA 4JJHA 2Y9RT 1HINL 4WFFD 4HHAB 5E94B 1HZHL 2EEAA 2NY3D 2BRRH 4GG8A 3JWOL 2JKXA 5FCUH 1JZ4A 2OJZL 1BOGB 1QFOA 3TT1H 2BOCA 2NXZC 4OD3L 4OCRH 1FFNA 1WFUA 3MLRH 5CEXB 4DFHA 2NXZB 4I2XA 1Q72L 4ONFH 3IGAB 3KPSE 1OTSC 4X7SL 5C7XH 3PWUB 1BGXL 1NBZA 4LF3A 1H9VA 3OR7B 4KK9C 4NKOA 4PJEB 4U1MA 4PJXB 1JZ7A 4LDEB 2CIIA 2DWEB 4RIRB 3LS5H 3UTZA 1KC5L 2AQ2A 3VXMD 4HUUA 3QQ4A 3GI8H 4XNQB 5EC1B 2JCCA 5F96L 3H9HA 1UM5H 4PJFA 5FO7B 4J3WA 5DEFA 2M1KA 1QRNA 5AYUH 3VXTB 1R24A 3G04B 4M6OL 4N9GA 4QF1A 1JV5B 5ACLA 1AXTH 3UZEA 2ED8A 5FYLD 5E56A 4L8SA 4JAMA 4ZPTA 3VRJA 2QKIA 1K4DB 4MSWB 1ZHKA 2W38A 5DUPL 3K46A 4HKBB 4Y2DA 4NQEB 4U1MB 2NNAA 1UB5A 2HTKD 2C7UB 5JXEC 1AHWA 1OLLA 1KPUB 4P3CL 2VDKL 5HYFA 1H3WM 1FSKC 5T33H 3BGFB 4U6HA 1E27B 5LGKA 1IC1A 2WBJD 2AV7A 2F54B 3CX5K 4XVSH 1KB5H 5MERA 5ERWB 4XMLL 4NQTA 3NACH 1OW0A 4GSDH 3V6OA 1SM3L 1ODAA 3TA3D 1EEZA 4E41E 1FLRL 3B5GA 5B39G 5DYOA 5T3XE 1NGPL 3BDBA 4CDGC 3U7WL 4G8GE 1Q94A 5MEOB 3N1FC 5DO2C 1LQSR 2DOCA 4LCWA 4NO2A 1CFBA 3S36X 5IB4B 1CVSC 4G7YL 1ZWIB 2AEQL 2GCYA 3ZE1F 4HW6A 3RJDA 2YEZB 3HB3C 5BZDA 2XA8L 3PJSA 3PWPA 3WEXB 3WSQL 4KKLC 2A83B 1NCTA 4XNYH 3FONB 5SX5H 2MPAH 1AO7B 2VSCA 3SKOB 4GBXD 4MHHG 5FYJD 4MCZB 1RZGA 1BP3B 4OJFH 1TITA 4P4RA 1EJOH 4WU7B 5I2IA 3DV6B 2CXGA 1MVUB 1DSFL 4LCUB 4NIKB 1HNFA 2K9UA 4PRPE 1R3IH 3RNKA 3TYFB 4JDVA 4X6EA 3CVIH 4QHNA 5IMKA 2WP3T 4GAFB 3C5JA 4HS6B 4G43B 3BP4A 4IS6A 3VH8B 5GRUH 3KPRD 5IBLC 3MROA 1MFDH 1OW0C 4MJIE 4OIIL 5BVJB 2Y36H 2EKSB 4TVPE 4XP4H 3TVMB 5EUOA 4WGWB 5BJTA 5I2IB 1X7QB 3M17A 5IWLC 4BFIA 3FHQA 5C09A 2G60L 2M8XA 1YUHB 1JN6B 1A7NL 5C0IA 2VLKE 4MQTB 1UZ8B 4LLUA 4LQFL 5F7EL 4Z77B 1I7RA 4W4OC 3TIDB 1JRHI 2EXYC 2BSED 2VDNL 3V0WL 3GO1H 4YDVA 2VN7A 3PP4L 4LPUA 3HC3L 2IBBA 4I1NB 1FFOB 2H26A 3VGHA 3VWJA 3QXVA 3UTPD 2WQ8A 4FQPA 1G6RH 1ZWIA 2GCYB 4TSCL 3EUUA 1HIML 2HRPL 3DMMC 2AERT 4HUXB 5TQ0H 2FJHB 1J0KA 2OR9H 1X5KA 3LDBC 1MOEA 1B2WH 1MAMH 1MCNA 4JFHD 4DN4H 1RHHB 3RGVC 1OHQA 3P73A 4X7EC 3RL2B 1CDGA 5T5FL 2JF1A 3T3PE 4TTGA 2RR3A 1XFPA 1LK3L 1DQTA 1DQLH 4PJ8B 3O45B 3EOBA 1NPUA 4CNIB 4X99A 3T3MF 1GZPB 2C7UA 3SO3B 1XGQB 2NTSP 3C6LA 1TETH 1YC7A 4WUUB 4EOWH 2NY7L 2IH1A 1NDMA 2YZ8A 3H42H 3QFDB 2D7MA 5IJKA 4Q0XL 5JUEL 4M6MH 5F1NB 1YDPA 1XGRB 3G04A 2XWJB 1A21A 4MS8C 4N9GB 4YBQC 4X6FA 2DICA 5GGQH 3QDGD 1NGWA 1Z3GH 4I9WD 4RMWA 1LP9B 1ERNA 1ZLUH 1ETZB 3LQZA 1AKJD 1BBDL 1I7UA 2A74A 4CW1A 4K8RH 4WHTA 1QKZH 4Z78A 4TPRH 3IVKB 1Z0MA 4M3KB 4RIRA 1AGEA 3NVQA 3LQAL 4PY7A 4APQA 4TSBL 1IGJA 2CO6B 2BSTA 3WLWD 4I0PC 2FRGP 1TJIH 1MFCL 4YHPB 1KEGH 4O5LH 4PJ5D 4WV1C 2HAZA 2L0DA 1EEYA 2FHFA 5DQ9A 5CEXA 3ZYZA 5I1HL 4HK3J 1KLUB 5EZOL 2CJUH 1KGCE 1BWWA 3I02B 5FOJA 3LRSA 2PNDA 2HN7A 3VFSA 1CICD 3ALPA 3SGDI 5DD0L 4P5MB 4S1QH 2UVEA 4PV8B 4D0DB 3NFNB 3UROR 3R8BB 4HHAA 3KLAB 2FZ3A 4ZD3L 1T3FA 1U8MB 2RJMA 3S8WA 1KTDA 1T66C 4M7LL 3UPCA 4YEFA 2YC1A 2FJGA 3P9MA 3P0YH 4H20L 5CS7A 5JORB 3DVGB 4GKOA 3GNMH 3WDHA 3LSOA 1P5UA 1QR1A 3NAAH 1MRCH 2XWBB 3SGKC 3QWQB 3SGEI 4RBPH 3EFDL 4X80L 3MXVL 5JW3L 5GS0C 1K5NB 3O2WL 1VSCA 5GGRY 2VLRE 4LCIH 4KY1L 2AEPL 2Q7NA 2EE9A 3VI4F 1KYOK 1MPAH 3HI1A 5EZJB 2YD1A 3JV6A 1E4KA 2ITDA 4XPFL 5DGRA 2OTUB 3VG9B 4ODWA 5E6IB 1HQRB 4NZTH 1BVKA 1J1PH 3WO4C 1U8NA 1NDMB 2BVQA 4PLKC 4YHZH 3TZVB 1FCGA 4KUZL 1EO5A 2BERA 4XXDB 1OB1A 4JPVL 5ETUB 3CDGA 3ULUF 2LU3A 5KVGL 3T65A 1ZOXA 1T22B 2X4NB 1X5ZA 4CAGA 25C8H 5DJCA 1LGVA 4WUUE 1X5FA 3HC4H 3JWOH 4JHWL 3BPOB 2E6QA 3KYOB 5ICZB 4P2OD 2A73B 2EKJA 4ERSH 1LO2L 4JZJA 4R97B 3K7UA 2ZUSA 2WBJC 4L9LA 4RQQB 1CDYA 3IF1A 3RL2A 1C1EL 2EDRA 2NY1D 4CVWA 1BQHB 1Q72H 3IFPA 1JHKH 2E8ZA 5JXED 3TN0B 1OWRM 1ZVYA 3P4MB 3IDYC 1OD9A 5T3ZE 5ID0B 5EO9B 1XGPB 4OKVA 2YPKB 4M8QB 5HY9B 3G08A 4EUPA 3CSGA 3FAXA 5EFIA 4JDTL 4JZJB 4M61B 1CXKA 2P5ED 4IHOA 5ALBL 4R96A 2EDXA 1HHJB 2V5MA 1TQBC 4YFLI 3AY4C 1YYMH 1MCDA 2ATKA 4PGCA 1LD9B 1U8KA 1QVOA 4U49A 1TQBB 4U4BA 2C26A 3HMXH 2GUOA 2A6JB 2G75B 3N1PC 4OLXH 5E2WL 1SMOA 4XTRC 4PJ7E 3WNOA 4A2LA 3VE0B 3QULA 4B50A 1QBLL 4D9RE 4O51B 4U1SA 2C3VB 2AJSH 3FCTA 2Y07L 1AP2A 5DQJB 1V7NL 3ULUE 3QCVH 5TDOA 4LBEA 1FDLH 1KT2B 3H8NA 2YXMA 2I25N 1KJ2L 4E42B 5K9JH 3WD5H 5F6IC 1ZT4A 2UV3A 3DV6A 2GT9B 4KJQC 1T89A 3I6GA 1LEIA 1G7MA 4LARH 5HVGB 4YPGB 4H88L 3E6HB 5GGUA 2NY5C 3KXFE 4KRLB 1H8NA 3KGRA 4M5YL 3MRKB 3RKDD 1PG7W 1KJ3H 4HJ0C 5E4EB 1MCIA 4QRPE 3LD8B 3GHEL 3PWPE 1K85A 43C9B 4Q97A 3HI5L 3DECA 3KPQB 5T1KD 2NX5A 3PNWA 1BVLB 3BYYA 3MRJB 3HHRB 1YEHH 3V7AE 4NC2B 3V4VH 1GHFL 3MRNA 4MQ7B 1PDKA 3UC0L 1IT9L 5IEKB 1P4BL 2F58L 1Q0YH 2IQAA 4V1DA 3BSZL 3KPSB 1R3JB 3U36A 3FQTA 4IRSC 4ESKA 2YSSB 3DTXB 4P48A 2HRLA 5DC9B 1HH9B 5L9DL 4JO2L 1E6OH 4XHQA 5MEPB 1YNTA 1ZT7B 3OXRA 4U31A 1VA9A 3C5ZD 4P59H 1UFUA 4XGZB 5JLZA 1A3RL 2VDRL 1G0DA 2F74B 1U42A 3M8OL 2OR8A 1N4XH 1A47A 1AHWB 3GMRA 5ETUA 2D4FA 3VJ6B 4DAGH 4XXDA 3SCMA 4GW1A 1V3MA 3SKMB 1MFDL 3DX7B 1Q9LB 1LE9A 1SYVB 1MUJA 4WIQA 4PBXA 4XP4L 1PLGL 1NFKA 4J6RL 3V7AG 5FV1L 4MDIA 5ESAA 1I75A 3AM8A 1HXYB 4X8XA 1ZKAA 3O6LL 1HXMB 1NC4D 1FVCA 2AABL 4ONGL 1U3HD 1A7NH 3UBXG 4NUJA 2EH7L 4G9DA 1OGAB 1KCSL 4LQ1A 4OLZH 1WSST 2VO5A 1LO4L 5ESAB 1DQQB 3VXOA 1EDQA 3GI9L 3GMMB 4R4FL 1OARL 3FQNB 3MPCA 2EDWA 3DX7A 4PJ9C 5KSAD 4Y4KD 5JA8B 4JFED 2V2XA 2W0LA 1T1YA 3HE7D 5DURD 4R7NB 2DIJA 1T04B 2NLJA 3TNMB 2AQ1A 3P11H 5DMGC 3MR9A 1CFVH 5HHOA 3IDIB 3K74B 1QLEL 5DMGD 2HTLD 3HLAA 1ZANL 3P4NA 5SWZB 1F4WH 1D6EA 5E8OB 4HBQA 5DRWA 1HILB 1WK0A 1QA9A 3GMQB 3NPZB 4IIQB 1RIVH 4P5TD 1WBYA 2DQJH 1WTGT 1DQLL 3MRQB 4EI6A 1XF2B 3DXAA 3O3AB 3P9LA 4OZGA 1JWSB 5CIPA 2YA2A 2X1XR 4N8CL 2VUOA 4NNPH 2UUDK 1IGTB 3UX9B 3OTTA 3GMNA 4X9GA 2LAAA 4GKNB 5D5MF 2P43B 1QFWH 5FGCB 5F7MC 5IVOA 3SKUD 3O9WB 1A1OA 4Y19E 5FUCC 1FVEB 2FATH 4QHUB 1P7QD 5ELIA 2QR0B 3D39E 3LIZL 1YEFL 5I8KH 5AD0B 3QUYB 4MZ3A 4L8BA 1HYSD 2QADB 4OZGF 4U1JB 2DF3A 1LHZA 4OIBA 3AU1A 5TF0A 3I6GB 5HHPA 4W6YB 3RWJA 3V7MA 5EUKA 4IMKA 3DX6B 5B38G 1WITA 4R2GC 5E00B 4EUPH 3ZL4H 1IVLA 3S34L 1QLRA 4R4NC 4P3DB 2OJEA 2P45B 3NCYS 4XAKD 3MGTA 3PNWB 4F7CA 2FLRT 4RAVB 5IFJB 3GRWA 2B4CL 5LAXB 3NFSL 1NUFA 4KTDH 3G5YB 5EZOH 3TEUA 1R5VB 1RK0B 2HTKC 4DKDC 3EGSA 4P46C 5IB2B 3L3OB 1I7ZB 3QEQB 1DBML 5IJVB 2ATKB 4MJID 4PGCB 5I1KH 3BN9C 3DRTB 3DO7A 2VIRA 1UQSB 3L5IA 3MLTA 1KN4L 4XHJD 1FN4A 5IVXB 4JO4L 4LSDA 1AE6H 3CCHA 4XCCL 3EYUH 5D93B 3RKDC 2VZ3A 3N0PB 3L5XH 4PJIE 4PJ9D 3P0YL 4H20H 4QXWA 2HMIC 4DGIH 3MV01 3IKCA 4PRNB 1F4AA 5J57B 3FCTB 2DQGL 4NJ9H 3C6SA 4NQXB 1BPVA 1D9KD 4JRYA 4X0KA 3MBEC 1MQKH 3BZFB 3CUPA 4K3EL 4PRPB 3QDJD 1CLYH 3M1BB 3O0RH 3OGCB 1EO8L 5I1CL 1EGJA 2EZ0D 5L88L 3SDAB 3Q5TA 2Y72A 4EJ1C 1PX4A 3PWNA 3RTQB 3KYMA 5IG7B 2AJ3A 5F21B 3RPIA 1A6AB 4XPAH 5E8DL 1SJHA 4UIMA 3FT2B 4H25A 2Z31C 5EG6C 1J1XH 3ULVC 5KVEH 3BISA 4HX1B 2VXUH 1R3KA 3F58H 1FIGL 1X7QA 1SY6A 2A9ML 3MREA 2CKNA 3OKNB 3WNNA 35C8H 4DVBB 3FQRB 2H3NB 4NQEA 4M8QA 3TO4A 5FHBL 2YA1A 4MAYA 3UJIH 3GUTA 5CD3B 1PKQE 1UXSB 1SY6H 4K55A 1DQJB 3CSYB 4QHNB 2N7AA 4Z7QE 3UBXB 5KTEL 1B0GB 1QFUL 2FR4A 2HFEB 4FQ1L 4YNYA 3P0VH 4X5XA 5IGXL 1WZ1L 3NA9H 1D5XA 5EULV 5FGBA 3GSNL 3MLYH 4RGMB 3EO0B 1BVZA 4FFWC 1UM4H 2YN5A 3AS3A 4U1GB 5SWQA 4PRAB 3ZHLA 3LSOB 4LLYB 4U1NB 5DZNA 3SCMC 2OL3A 1I9IL 1JGLL 2YEZA 4QTHB 2VXTL 1HNGA 2VL4A 3QEUA 1U8MA 5CP7A 3ULVF 2Z31A 3GIVB 3QXTA 2ADGB 3PL6D 3MYJA 1OP9A 3NIFF 3ZT6A 1LILA 3T0VA 3AS0A 4BK4A 4PJDE 1AKJB 5A43C 1PQZA 3TVMC 1JPST 1D5IL 3QNYB 4HH9B 1IGFL 4GXUM 1K3IA 2X10A 4CVUA 1S5IH 5J11C 2BK8A 3P30L 3RRQA 4ODSL 2H32A 2WM0A 1TVDA 1Z9LA 4OQ1A 3REWB 2VLRB 3QWRD 3F7YA 1MI5A 5HPMA 4X9HA 5I73B 1BZ7B 3VGAC 3QUZC 2L4OA 1LEKA 1X4ZA 4XVUC 3RDTA 5HSFA 1L9MA 2ERJB 1GGYA 3SGDH 3I3BA 4YK4C 3SE4A 1KC5H 3BEWB 3S98A 5C0BA 4PG2A 2ZNXA 5TDPA 5MENE 4P5MA 1AIFA 5JO5B 5JOPD 5INDB 4Y5YC 5GSVB 5K59F 1C7SA 4JVWA 5EBLB 2AJZB 5FA3B 2IQ9H 4NCC1 5AYUL 1YPZE 1N26A 2RFXB 2I07B 2F19L 5LJYH 1AXIB 3O2VL 3UTZB 1FCCA 3MV9D 2EH8L 1YPZA 1C12A 4WUUA 3X3GH 4F7TA 3U48A 4Z7VF 1ZEAL 1WBXB 2J88H 3QNXA 4NNYB 1GHFH 1NJ9B 1IGJB 5D5MA 4BQ8A 1T1WA 3U9PL 2FBJL 2MNUA 4ZYKA 1DJSA 4HWUA 4IOFC 4JY6B 2OP4H 3RWEA 1T2XA 5E1AB 3ULVE 4CW1B 5D72H 4MAUH 1EVTC 3VG9C 4KMQA 4GJTB 5DZOA 3ZO0A 4WFFE 1R5IA 3V5HB 2VXQL 2P24A 1HYSC 2J4WH 4RMQA 1MCHA 3U7WH 4LL9A 3G6JB 3REVB 1MRFL 3OKDB 4KQ4H 4NSKA 1EFXD 4BH8B 4HXAH 2ZKHL 5CJXC 4GMTL 2RIKA 4ZODA 5F88B 3EAKA 5CILL 2ITCB 2ZG3A 4G7VH 4U6VL 3VFWA 2BVTA 3TF7C 3QH3A 2XA8H 5HPOA 4BJLA 5FYKE 1I7RB 2XG5A 1UZ8A 4ONGH 3DVFA 1NKRA 1CR9L 4OUUB 2NXYD 5IW1B 4W4OA 3RTQC 43CAA 1OWWA 2CR6A 4OCRL 4JKPL 1MHHB 4UNTA 1QFWI 1ED3A 4UMGA 4LCCA 4A2MA 4JM4L 4R4FH 4TUKL 5CJQH 5E2JA 3WHXB 1HN1A 5AYQA 2NMSA 5I1EH 1CFSA 4HC1A 5D1QA 1R6VA 3HPLB 3QXWA 4Q74A 2A6DB 1A2YA 4ZQKA 5ICYB 3MLUL 1F02I 3OKEA 3TJEL 4RISH 2J7LA 2DJSA 2PO6D 3BPLC 1ONQA 2DQHH 3L6FB 3DV4A 3FT4B 3ILQD 2OZ4A 3RNKB 4N0FA 4OIIH 1RPQA 4O02H 2DQJL 3BPNC 3DMMD 1FL5A 4KVNL 2F54D 4L29A 4XH2A 4QRRD 4XB7A 4ZFGH 5DURB 4KKCD 2Z8RA 1FH5H 4LSSH 4PTTB 1CE1H 4XP1L 5DJ2A 1OP3K 4OCSL 4XRCA 1IGCH 4PP1D 4DJMA 3VFVB 2EXYD 3MRRB 1NGXA 2HVKA 4JM2A 3RWCA 4JFOA 3VI3E 3PJSB 3PWPB 3WEXA 1UJ3A 3ULUH 4PJIF 4LLAA 5TGBB 3GBML 1S7VB 1AGCB 1ONQB 2DI8A 2Z91A 1YPZB 3LN5A 3A6BL 2PXYA 5F1SA 1X5LA 1G6RL 1MHCA 5D1ZA 4ISVB 3V52H 1SM3H 5I74C 1RURL 3D85B 3OAUL 4PPTA 3WO4B 3I6LE 3CFKA 3S96A 3MLWL 2FX8H 3ARBA 3QZWG 2FGWH 3BWAA 3TZVC 2FBOJ 5D7IB 4FQIH 1IC4H 3W82A 2BVPB 4WUUD 2XZAL 5GRXG 1Q9OB 1NBVH 1E4XL 2HH0L 1KBGH 4G5ZH 4JFDE 4Z8FL 4HG4J 2ATPA 2LABA 1BZ7A 4GXVL 4HGWB 4OQTH 4OAWA 5ID1A 5SWSD 2CUMA 5BRZE 3GSOA 1DR9A 3UTQA 4Y5XB 4C58B 1WFNA 1A7PH 3FB5B 1TETL 4Y5XC 4PR5B 4XCEA 4JQVC 2E7LA 3BYTA 4G6MH 4P9ML 4L8SB 4C56E 3PV6B 1DBMH 1XGYL 5D7KD 1R3IL 3T0XA 4M7KL 2DMBA 2NY2B 5K9KA 2GITA 2YK1H 3CU7A 1J12A 1JTOA 1EBPA 4EI6B 5GIRB 3R8QA 1QSFD 1Z3GL 4NWUH 3N1QC 5FO9A 3O4LE 5HHQA 3QQ4B 3G6JE 5C92A 5I75C 4KKBD 1UJTA 4PJAE 1NFDE 5DRWB 5I75B 3VXUE 4J2XA 1CFQB 3WFBL 4PJEA 3DURA 3H9ZA 4MJIB 5HGHA 3DLQR 4LLWB 1RJCA 3CFEA 3VD3A 3I2CH 1MJUL 1MJJA 5C0BD 5F8RC 1EHAA 2VDPL 3V2AR 1JRHH 2GK2A 1DLFL 3KWWA 4WI7A 1DQQA 3DX9B 3VXOB 5ABDE 5ALCL 4YNYB 3BE1L 4YEEA 3SDXF 1DANU 3GKWL 3PP4H 1OGAA 4JJ5A 1T83C 1CZ8L 1NMCB 4PG9B 3BEWA 5EOCL 3V79C 2G9HB 1ZSDA 5DRNB 3QG6A 1ZGLB 5J6GB 1XZ0B 4FZEL 4LIQE 4CDHA 2V7HA 2W0KA 2QBWA 3FQRA 1JPSH 1LK2B 1NBZB 3ZDYE 5FGCE 2J5LC 3MREB 1Z6JT 2VAAA 5E8PB 1G1CA 4PGDB 3KLSA 2W91A 3C8KB 1P6AB 2NY1C 5IJKC 1P9MC 5CBEA 4EVNB 5IF0A 1IAIH 1Q9OA 3HZMA 5DJYB 3STBA 4LNRB 1HEZB 1YEEL 2DQIL 2F8XC 1ZLWK 3VRIB 4XP9L 3DIFA 1W72B 3P9WB 4Y2OA 4P9HL 3H6JA 1U95B 1IARB 4N5EC 4XPFH 1FGVL 1NEUA 3BDYH 4PJEE 2R2HA 3NOIA 4P2OB 4G8FB 2BMKB 4JZJC 4WO4A 5HJ3B 4G6JH 2Q76A 1RK1A 5IFAH 5F1OB 2V9TA 1M05A 4WWKD 4XNUL 4OFIA 4N0UE 15C8L 5SWQB 4TPRL 4IRZL 4XRCB 4HIEA 3GBLA 4GRLD 1IL1A 5F1KC 4JZOB 1IGFH 1WIUA 1CL7I 1I85C 4C56B 1A7QH 2PETA 3B9AA 2GTZB 5DWUL 3KLHD 2H1PL 2OL3H 4L3EB 2X4TA 2XZZA 3UAJD 2R2EA 4HWEH 3V4PL 4D9LL 5IHZA 1NSNH 5FAAA 5L2JA 3JWOC 1OGTA 2OJEB 3HNVH 5D1QD 4TOYL 5LQBL 1A7OL 2VLKD 4MAYB 1I7TA 1WEJH 4EBQL 5C08D 4J4PA 3CGTA 5B8CC 4G3YL 4DVBA 3S36L 3LRHA 4NN7B 3RGHA 3EBAA 3L95B 4X4ME 3UJJH 1JHLH 3VFOB 3ARFA 4JPWH 3ES6B 1J5OL 5E4EC 2ZOLB 4UV4L 3RWHB 3LKSB 3U82B 2CLVB 3MJ7B 4NZUL 1OP5H 3ARYA 2F5BL 2KZWA 1MHPL 2RCSH 1HHIB 4N0YH 5FHAH 4GS7B 5DRZB 4M7ZB 4OF6A 1JI1A 4PJ7F 1RFDH 3INUH 5JW3H 4C55A 2VH5L 1ZEAH 2AXGB 1XH3B 4FQCH 4NKDA 2HLAB 2HT2D 3OKDA 3EOTL 4PREB 5F7WC 1OGTB 4X8JA 4F15B 5AZEL 3MODL 5C6TH 2JK5A 5DHXB 2FBJH 4OF0A 1QZ1A 3QCVL 3RAJH 2DWDB 5JZ7D 2DS4A 3CD4A 3UTPE 4ONOA 5CINL 5E70A 1OAXL 2VXVL 1Y6MR 2ZG1A 4WNQA 5CJOH 4RX4D 3IDIA 3HN3A 1CXFA 3PL6B 5HHOB 4XPTH 1AFVH 4KK8C 4BZ2L 4X9FA 4C4KT 4QXUH 2X4NA 1JMXA 3EFFB 4RRPG 5KVGH 3IJSB 1CBVH 2YUVA 4I2XE 5JPNA 5EU7E 1OSZB 3HI5H 3HZVB 4JFFB 1A6ZA 1HWHB 4J12A 5FUZH 3D9AL 3U0WH 3B6SA 3Q3GA 4UZGA 3I9GL 2C1PA 1R3HA 3EJZD 1A6UL 2O93L 5EZJA 3FOMB 1G7JB 5F9OH 3ULVL 3T0WA 5TDPB 1JHKL 1G9NL 5F71A 5EUKB 1JK8B 1T2QL 5HD8C 5DMKB 3T2PA 1BBJA 3B3IB 5E2VL 3T8XA 2F9BT 2IADA 3S88H 1XR8A 3QUYA 3ARZA 1XF3B 4NP4H 1QPPA 1FO0H 4EN3A 2X4UA 3VU2A 2AV1B 2HFTA 4JDTH 3F6LA 5JMOC 1Q0XH 3GSVA 5EIIA 2FJGB 3P9MB 4AY0A 3IB4A 1CT8B 2ZPKH 1MEXH 5F7UA 3T09A 2ESVA 1JFQH 3FQUB 3HMXL 5IQ9B 4HH9A 1RUKL 5HHOE 2FSEB 1Z5LA 2UZIL 2H9GB 2OYPA 3AXLB 4U6TA 1IC7H 4MXVE 2J8HA 4LCYB 5AAMA 4JQXA 3SDAC 1MLBB 4JR9H 5CUSL 2BHYA 3U30B 2ILLA 1SVZA 2GJZA 4P2OC 1EEYB 1QO3B 1XGUB 1T03L 1JWMA 3RDTC 4GRLB 1A14H 2QQQA 2YN3A 3SE9L 4L1HA 4JFPB 4PJGB 2BSTB 2P8LB 4IMKC 3KXFD 4PD4J 3W11D 2B1AH 3LKPA 3E6HA 4FXKB 4KHTL 1TJHL 3HE6C 3UYRH 4BSWA 3MC0A 1A5FH 1IQDA 1A1NA 1F8TH 2D0HA 4NRXA 3CVHL 5C0FA 2AXFB 4TNWK 4PLKD 5JHDA 4Y0GA 2MHAB 1F3DJ 4NQDB 3CFIC 1N59B 1JP5A 1XF4A 3VGBA 4YDIL 4OI7A 1YEJL 5LCVL 3QXUA 4GXVH 5GRVK 4KI5C 4K71B 4AQ1B 4TRPH 4BSVB 3B6SB 3WS3A 4PB9L 2IH1B 1HDMA 4I77H 3WN5C 1SYVA 1ZHBA 3VFGH 5T1LB 3QIBC 2H3NA 4YJZL 3C2AH 3GMRB 5D6CB 4F37K 4WO4D 2P46B 1PJ9A 2AJUL 4HGWA 4KTEL 2Y06H 3IJHB 5L9DH 5BVPH 3ISWA 3WUWA 5J8OA 4Y5VB 3TYGL 3RNQA 3U6RA 5T3ZH 3LKOA 3OX8B 4OF7A 5E7BA 4KGJA 1MCEA 4MJ5B 3QDGB 2ZUUA 3MV11 3NFPA 5F44A 2A1WH 1H3XA 1R5WB 2HFFA 3WFBH 4UT6H 3ZYJA 1IQWH 4OZFG 5DFVD 1YY9C 3S6CA 4HS3B 1EUUA 1DTUA 3MRBA 3RI5F 3CMOL 3OKLB 3L9RA 3VFUA 1TZIB 2ZUYA 2VDOL 2OXGA 2PXYB 3JVGC 2DI9A 2EXWC 2ADIA 1F90H 4GRWH 2D0FA 3BIAX 4KMTH 1JRHL 4YE4L 2HJKA 4MA8H 3IDUA 1DLFH 3QJHB 2WBJB 1LP9E 3GBNH 1OGAE 1S9VA 5EO1A 2QHRH 4ZUUA 3T3PF 1LO4H 4FQ2H 3NA4A 3R06B 3KJ6L 2R0KH 4NQDE 1NANI 2VDMH 4D94A 3QEQE 1DBBH 4QGTA 1IL1B 2WUCL 1PG7H 2O5YL 4ZFFB 2Y25A 3L3OA 3QEQA 1YC8A 3IU4H 3L95A 3UDWA 6CGTA 5EUOB 3RVXC 5BJTB 4TNWF 3WO3B 5E03A 2MTPA 4P9HC 4LBEB 1CXLA 4KQ3L 1I3UA 3VXRE 1BIIB 4P4KC 4UB0H 3QXAB 5GS1A 4RMUA 1OGAD 4WW2B 2Y6SD 3GZKA 5SX5K 1CXIA 4EQ2A 2CRZA 3CFBB 2Z4QB 2R2EB 1BREA 5F9AC 2GSIB 4PJGE 1NH6A 4XC1H 4LRIA 4BH7B 4XX1G 4YHIB 3BXNB 1P7QA 3DUUA 4MMZC 3SKOA 3RY6C 5IMMB 3KNBB 4X9IA 2QSCH 4QHUA 2APXA 3S9DB 5T3XH 3ROLA 4ZOEA 5KANI 3AREC 1VEMA 4G8FA 3TBTA 4XNUH 2N56A 4WRLA 5DTFA 5ITFB 3VMNA 1T3FB 3OR6A 1GVIA 3A67H 5C07A 1YECL 3F6IA 1WAAA 3L9RB 4IRZH 1J8HE 1TJGL 1H3GA 2FIRT 1SHMA 3P9LB 4GUPA 4Y4FD 3CFDB 1RAMA 5GZND 4JJ5B 4IRJB 1O7VA 4B7IA 1FIEA 4LVOC 1TTGA 5D2LF 1WBYB 1M7IA 1U8IA 4JY4A 1ZLUK 2I9LB 1F4XH 3KWWB 1Z9SA 2W9LA 3FB7B 3SDDA 3V4PH 4D9LH 1H8SA 5DR5L 2PTTA 1NJ9A 2Q7YA 3GSNH 5D5MB 4PGDA 1T21A 3ARGB 2CDFB 5J13B 3BQUB 4U0QB 5L8JB 1CQYA 5F3HA 3BMVA 1N3NB 5F9WB 1P4IH 4AH2B 3ZDZE 3FFDB 3LN4B 4ZUVB 1AJ7L 1LEGA 3MLVL 4E41D 5J6HA 5L6YL 4HKBA 1K4DA 5T3XD 1HQRA 4ZS7L 4WI2A 4HK0B 1VFOA 2EIEA 3QG7L 1YYLH 4OCYH 4PYHA 5FM5O 2HKHL 2O5XH 3H9SD 4YHOL 3UJTL 1CDUA 4NJ9L 3QEGL 1H15A 2CDGB 3WIHL 4LP4A 4PJXA 4Z7UE 2IGFH 5DJAB 5D70H 2IMNA 3FFDA 3LN4A 4HC1L 1CU4H 3RHWK 3ZE0E 2P8LA 2FNBA 5B22A 4FQLH 5EUOE 2W65A 2DKUA 1OAQH 4NM8L 3IDNB 5C09D 2F74A 3LZFL 1X3DA 4XPBL 2Q1EA 5F3BA 5JHDD 2DLEA 4N0RA 3MUJA 4I0KA 1I8IA 3OB8A 4I5BA 4AEIL 5IVZA 3AS2A 4OM1L 3T0DA 2GK0B 4K7PH 4KDTA 5AWNL 3ZDXE 4O2EA 1KJMB 5CLWA 1J1OL 3OPZL 1G9NC 1A6PA 1F3JA 3FRPG 3VXRB 1TDQA 2P5WD 4JVPA 3DWTA 3FQUA 1OD7A 2NX5B 2D03H 4MLIA 3O2VH 2KDGA 3VWKC 4K94L 1HSAB 5DQ9B 3S35X 3CIQA 5BRZD 1YMHB 3R0MA 2X4UB 3MRRA 5FIEA 3C9NA 4XTRD 2PYED 3RVWD 3FKUS 5IR1A 1WT5A 1E0OB 2ARJQ 3WFHB 1CF8H 2XY1A 1KCVH 1R3LA 1EEQA 5DJDB 2BVPA 2IH3A 4NQVB 4LRNL 3ARUA 3L7FA 4MAUL 2X7LA 2XQYK 1QNZL 5FF6A 5C07D 1XGRA 5GRJL 3BP4B 4ZTOL 2ZUQC 5DJ8A 1T66D 2EYTB 2VABB 1RZ7L 3PP3K 4OFDA 3QUZD 4ZAKA 2AAVA 2V2TA 1XGQA 3HKFA 1P84K 4JHBA 1JNLL 5LWYL 5GGTL 2J8UA 5DK2A 3BX7C 1GOGA 1INEL 3SGEH 4IJ3C 2VOTA 3L5WA 4ODSH 3I85A 5IBTH 3ZKXC 1KELL 3PWLA 4WNQB 5I8OH 1U3HB 4AEHL 3ET9F 5DD5H 3ZKXB 3T2QA 5EFIB 3SBWC 5F7DA 4N0FB 4CGTA 2DWDA 1YEDB 1JNNH 4JM4H 4U05A 3ARDA 3UTTE 4AIXA 1REIA 1KG0A 3R1GH 4NQSB 1FNSL 4JFHE 3VFPB 2GTWA 4ODTL 1TZIA 5D2LE 1NAML 1FHGA 2LQRA 1IAIM 4JFZL 5C9JB 2R69L 3MXWH 4PJ5A 4WWKB 2UYLB 5JDSB 1CD0A 4N8VA 3WFCL 2JELL 5JOEA 3WHXA 1IRAY 3EOYG 3TH4T 5E5UB 4Y19B 4UAOC 4LVHB 9CGTA 3KPNB 2VSDA 1MHHA 3ZE0F 1N6QL 5DHYB 1JN6A 4Y89A 4C59B 1MCOL 4WY7H 4PRDB 5GPRA 4EI5B 5F6HJ 1GXEA 4JCMA 4NNYA 3IDMB 4HLJA 4I18B 2NY4D 4I77L 4FFVD 1UH2A 3V5DB 1KJ2B 5T1LA 3CJJA 1C5DB 1EJOL 4PTUA 4JQIH 1JNHB 1VERA 5IW6B 4JFFE 4NSKB 1DSFH 2AJUH 4RAUB 4PJGF 4ZMAT 3V6BR 2EC9T 1XF5B 1MWAH 5BVPL 1RI8A 3MNZA 2BC4B 2OTUA 2BSSB 4QF1B 3QDHA 2XQYG 3QWOA 3TYGH 1AY1H 5I1JL 3L7FB 3H9HB 2YKLH 2JCCB 4KVCH 5IP4A 3ULUC 3A0OA 1J7VR 4JANB 4KRPC 2GSGB 4YH6A 3W9EA 1XCTA 4ELKB 3OHXA 1IC4L 2J6EA 1RJZB 4WU7A 4GRWB 3AAZB 3AU1B 5IM7B 3M07A 4KI1A 1MIEH 3OXSA 1S7WB 4XNMA 4MA1C 2VL5B 3U7AA 4GKZB 4I0CC 5KSBF 1FV1A 1RZIB 3U46B 1P7HL 1JWMB 1AXSB 1UCTA 5MI0B 1ZS8A 2NQCA 4WO4B 2NR6D 4BQCA 1BOGA 2V7NB 4FQ2L 1UADC 3V0WH 3GSWA 4EQ3A 2BXYA 4G6ML 3VA2C 2VDML 4NN6C 1G0YR 4OZGB 5KW9L 5SWSE 2O5YH 4EIGB 1KLFA 1OAYL 4OT1L 3TWCL 3RA7L 3SHSA 3MRMA 5IBLD 1VGKA 3WIHA 1WFTA 4FXGA 2LFGA 2NW2A 1LO5B 3VXMB 1ZS8B 3V6ZA 4JPKH 1QSFA 2BY1A 4U6HB 3BPOC 4YHPA 1LK3H 1T83A 1MJ7H 4F33A 4ZTPH 2VLRA 4MMXC 1QSFE 3ZHDA 4Z7OF 1KFAH 2NNAB 3S5LB 1ROWA 1DL7L 2VRAA 3QEHA 4JM2D 3CC5A 3KPPA 4GRMB 3VXPA 5C6PB 1YMMB 1IGCL 4XBPB 1ZHKB 2JJTC 4R4ND 3U9UA 1UH4A 4QHMB 5ALCH 1OTTC 5I8EA 3BT2L 1QUNA 5DC0A 3QT2A 1G7HB 4YPJA 5IV2B 4B0MM 3UTTB 3M45A 1DCLA 1GOFA 3H42L 3MUGB 4P4KD 4NQDD 5I17A 3QIWA 1CZ8H 4M6ML 3LPFA 2ICWI 5IESL 1QLFA 5EOCH 4EEEA 3V52L 1U8LA 4GAGL 4U6YA 5BO1H 5GGQL 1I3VA 4S1RL 3SKMA 3TIEA 4OLYH 3HE6D 1YEGH 2P8MB 4MX7A 3BRDA 4K8RL 1J18A 4NJAL 5CZVL 4BKLB 4ZAKC 2E27L 2VZ1A 5TFSL 1JUFA 3ZTJG 1H5BB 4KPHH 5MEQB 2J1KA 5CD5C 1KBGL 4G5ZL 1OAKL 4XB8A 4I3RH 4UINH 5DT1H 1I3RB 4LLQA 1FBIL 1MFCH 1M7IB 1PSKH 3ZKMC 1X9QA 4Y1AE 2DLHA 5EN2B 4P23B 4GUPB 4MQ7A 5C9JA 3K4DA 4F37F 4P9HH 2IG2H 4X0KB 4NQXA 4XAWL 5A2LH 1NLBL 2XNAA 1QBBA 1Y0LA 5FA4B 5DJ0A 1XGYH 2MQCA 1U8QB 3OG4B 3KPMA 4P46B 1K2DB 3RWFB 1YEKH 4ODBD 3FO2B 3GJFB 3IDXH 4WHCA 4M62L 4M02A 3P4OB 4QGYA 4G6JL 2AK4B 4OAWB 4ZS7H 5ID1B 2ICEA 2PCPB 5FEBA 1NDGB 4P2RD 2MMXA 4R0LB 2XRAL 3PWLB 4OCYL 4HPYL 2VIRB 4OZIA 3GK8L 3BP6A 5IMOB 1AR1D 1WWWX 1RIUH 2B4CC 3QFJA 5DFWH 5C09B 3T0EC 3VFOA 2SEBA 3T4YB 2CK0H 1MIMH 2DLFH 1FYHB 3SY0A 1A7QL 3GIZH 4RNRB 4ODHL 4KROC 3VXSA 2D3VA 4GG6B 1OTSD 3QB7C 3CAFA 3G5ZA 4HT1L 4PJ7B 3LV3A 1RJLB 5DQDH 2X9WA 1AGBB 5SX4H 2R0WH 1U36A 1U92A 4YXLH 3AC0A 1BQUA 1OAQL 4NM8H 4YBLC 3HNVL 4JCLA 1Y18B 4M7LT 5TGBA 1LDPH 1UJ3B 3BQUC 4JM2C 4N8VG 4C54A 5IVNA 3LCYA 2G75A 4K7PL 3CCHB 1NGXB 4K2UL 3VFVA 3RWJB 4LVNB 1GSMA 1FC2D 1HCFX 4Y1AB 5LKNA 2V6HA 4FZEH 3HE6B 2IFFH 4P3WA 1BFOA 5FYJU 4PY8I 2VDLL 4KDWA 4UV4H 3U4BH 2VQ1B 1FE8L 4AQOA 1U3ZA 3DRQB 4N0UA 5CWSB 5LGHH 2ZP0T 2Q76B 4JHWH 1TNMA 1X6NA 1DFBL 5HI5C 5LAXA 4WHDA 1E4KC 4RAVA 5JZ7C 1S7QB 1CL7H 4M93B 3IRPX 1LVEA 1WBZB 3MRIB 5GRWA 3VFRB 1XAUA 3WIFB 4FQCL 4NZRH 1JWSA 2DQIH 4OD1H 2JB5H 4HS3A 2FGZA 3U79A 3O81A 5DYOB 4ZDHA 4PP1C 3F7RA 3V6OE 1XF2A 4TVSa 4F2MA 2FEDC 4HJ0D 1MFEL 2SEBB 4U1GC 4NYLA 3T4YA 3FO9A 3GMQA 5DSCA 4KAQH 5CMAA 1OP5K 4Q7DA 5INCA 4LCWD 4GQ9H 3J7HA 3LN9A 2DB8A 3DSFL 4WUKH 3BGMB 1UZ6E 5HHXH 4PJBF 3SOBL 4PJBA 1K3ZA 5A2JH 4OV6F 4LSUH 1HZHH 3VFWB 1F6AA 2BRRL 5DUML 4O2CA 2Z93B 2CDGA 2UZYB 5TQ2L 1GIGL 4NCC2 2PYEB 4BH8A 5LWYH 4U2YA 5T5NG 3G5VB 5IT2L 3D0VB 4ODWB 1KIQA 5E6IA 4D2NA 1I4FA 2A6IA 4NT6B 2GFBB 4M43H 3UYPA 3C87A 2IPKA 3GJEB 3ULVH 5C08A 1B0WA 2DL9A 1D6VL 1JNNL 4RCAA 5E8OA 4ZYKB 1J8HB 1LE9B 1RVFH 2VJXA 4ZUTB 1NCAH 5IOPA 3U2SA 3H9SE 4NC1C 3U7YH 3O2DH 1KJ2H 4N1CA 2CXKA 3TNMA 1H3PL 1N5AB 4LPTA 4JO3H 5JOPE 1BM3L 3LEYH 3V6ZB 4NFBA 3PUCA 1V05A 4OZ4B 4ZUTA 3KVQA 5CHNA 4XT1C 1WC7B 5C09E 1N2RB 3QYCA 5EU5A 1HYRC 1JPTH 4OTXH 3RZCD 2AJYH 3GSRA 3JBG7 4NUGH 1FG2A 4NT6A 4JPIB 3RKPA 2CSPA 1O7SA 2XFXA 2UZIH 4YDLB 3N1GC 4G6FB 4QHMA 5A3ID 3E3QE 4AYFA 3MRJA 3O6ML 3ME0A 4OCNC 3LEXA 1YN7B 5AZEH 2QV2A 5TH2B 3BAEH 1TPXC 4ONHA 2Z9TA 1MWAA 2CPCA 2NXYB 3WJLC 1K4CA 4YBHA 1VEOA 4QTIH 3HNTL 3MX0A 2DQCL 5GRYA 1BX2B 1P7QB 2BJMH 4KVCL 1S7RB 5I74B 3E6FB 2DQFA 3Q5OA 1HINH 3OKOA 2GSGA 3VW3H 1NCCH 2GSIA 3RVVD 4E42A 4F2MB 3QUKA 3B9KC 3BRGC 3K81A 2R56H 2PW1B 3O8XC 3CFBA 3GM0A 3QWOB 5KSUA 5DQJA 2DIBA 3MRFA 5GISH 2C1PB 4MD0B 3I9GH 3O3BB 1A02N 4U7SA 5KSAB 3LMJL 2Z92B 3QULB 1IM9B 5L8LB 5J13C 3ALXA 4PS4L 3RQ3A 43C9A 5B38B 1NCBH 4L5FL 3S35L 1UJ3C 4JM2B 1G6RA 1T5XA 2YS4A 4IDJH 4EI5A 3MLZL 1RUML 2FX7H 4NM4L 4KTEH 4KV5F 5IEHB 3C5SA 4HIJB 4NKQB 3CVIL 1ITCA 3ARRA 5DHYA 1G7MB 1OAYH 4MQSB 4OT1H 4IHOB 2IJ0C 3DHJA 5FKPA 5T3ZL 3ZT7A 2UWEF 3MCKA 4Y5YB 4KK5D 1JHTB 3KYNA 5L2KA 1EMTH 5EORL 3IRZA 1ZANH 2F53A 3WFDH 4PJAF 3X14B 1DBAH 4JB9H 1SEQL 3VD7A 3TO2A 1JFQL 2WNGA 3UTTD 4NO0D 2VLJB 4QRRA 4YIQA 1BMGA 4AG4H 4PJDA 4PJ7A 3K3QA 1AGFB 1H0DB 1HE7A 4KMTL 1R5WA 2HFFB 1YEDA 3MV9B 4KI5D 1CWVA 3WLWC 2CLVA 4LLUB 2J8UF 1QSEB 4ZO8A 4JR9L 3ZDYF 2YRLA 5IUSA 4J3SA 4FRWA 1CLOL 5CAYB 1DBBL 3ES6A 1WGOA 5HHMD 3TBYB 3ALWA 4BFIB 5CGYC 1TTFA 4NRYB 3B9EA 2YWYA 1T22A 2CO7B 2ICEB 2PCPA 3SE9H 1D7FA 5BXFA 1INQB 5HY9A 1FZJA 4YHYC 4OLUL 3RWFA 1ZHNB 3QEQD 3RDTD 2NY6C 3WS3B 5CCKH 2UY7A 4G6KL 1PKQB 4X83A 3C60A 3O9WD 3IJYB 5EPMB 5FF6B 1OAKH 1I3GL 5I15L 1NCUA 1T0NB 5DT1L 3D3VD 1CDIA 4YX2L 5HYIA 4HKJB 3PXHA 1TMCB 2FDBP 4HKXA 4TUJA 5EU6A 4X7TB 4ODUB 5JW4N 2DQUH 1RZGB 5FM8A 4OZFA 1Y6NR 5MEQA 4RFOH 4PLJD 2R4SL 2GJ6B 4PD4K 4G8IB 3CVHB 4F15C 1FSKB 1NLBH 4YWGH 3AY4A 1CS6A 2EIZA 4MX7B 1Q38A 5B38A 1CTOA 5EZIL 3HS0B 1RK1B 1ZA6B 1KN4H 2E9IA 4L3EE 4JRWA 4JO4H 4M62H 2IANA 2AEIT 2BHZA 4WDIA 1EZVX 1G7LA 4FFZL 3B5TA 1BBDH 1BAFL 3T0EE 4ODVH 2B1HH 4D0DA 2AXHA 4FQXC 1QKZL 1P84J 3DI2B 2ZUWA 3GK8H 1UWXH 1MCCA 4M6NL 5F1IA 1G7PA 4WFHE 2NY0C 3QUKB 3TM6A 4UDTA 4H26A 2VMFA 5C86A 4XMKH 1R0AL 5FGRA 5IF0B 1S8DA 4CU8A 1EO8H 5CBEB 4HT1H 4OD2B 2DQTL 5IR1B 5AD0A 3PWVB 3CLEH 5IB1A 4HUMB 3L1OL 1IEBB 2CJUL 3MTRA 1KPVA 1BZQK 3QWRA 1F45A 2NY6D 3BEVA 4OIAA 2D7TH 3ZZ1A 3MLVH 4KK8D 5L6YH 4H8WL 1TVBB 4PJ9B 1KTKE 3GSUA 3B9KD 5IWLA 4PG2C 4PV8A 5I30L 2FYYB 3CU1A 1YY8B 2V17L 1EHLH 1EGJH 3MV9E 4KJWD 5T5FH 1EIBA 1N6VA 1YDPB 2XKUA 2HKHH 3VA6A 1ORQA 1FZMB 3LS4L 1GGCH 3FB8B 4JN2A 4B53A 4DKEH 5SWSB 3OR7A 4NKOB 4OM0H 4LF3B 1OQOA 4MD4A 2EICA 5GGTA 2BSRA 3VFNA 4HC1H 3PXJA 3SGJA 1RU9H 1HSBB 4M03A 3MV7D 3NA9L 4KKCC 2AEPH 4S11A 3HB3D 3PE9A 5F9WC 2KZ1B 1S7WA 4JN2B 4ODXA 2VTFA 4NBXB 3RVUD 4X7TA 1H15B 5AZ2H 4LGSB 4Y4FB 2NY5L 1UWGL 4WI9A 5FO9B 1I9IH 5CEZE 4IRJA 4NZJA 2FHBA 1DQJA 4J3TA 2E9JA 4YGVA 5MENA 2E7LC 3NZHL 3SOBH 3QQNA 3TCXA 1YECH 4Z0XB 3OSKA 5D7IF 3E2HB 1UA6H 1OL0A 2QQLH 2RGSA 1LEGB 5J6HB 1AD9B 3LQAH 1F6AB 3MGAA 1NUNB 4ENED 5GS2D 5M94B 1HHIA 4PY8J 1U91B 4ERSL 1LO2H 3O3EA 2MQ3A 3DGGB 1R3KB 2ZOLA 3RWHA 4M43L 5BS0E 4UIMB 2X89D 4K7FA 1A6AA 1CDBA 4Z0BL 4HZLB 5CZKA 5EWIH 3RZCB 1S7TA 1NC2B 5EBMA 5GHWL 5EA0H 4BQ6A 5FGBC 4DGVL 4ELME 1JGEA 1DE4A 4G8EB 4WJ5B 2Z4QA 3VWKD 1FORH 4NKIL 2Q8AH 1EFXB 3CUPB 2VLJA 3QCTH 4DOHE 1NMBH 2I60L 4ZTOH 2X4TB 2H26B 3TT3H 2B0SH 2JJSA 3ARDC 3MV8B 4J4PD 4F7MB 4HIIA 4NZDA 5GZOD 1H3VA 3MRKA 3MJ9H 4JN1L 3EOAA 5E2WH 2LE9A 3LAFA 4NUGL 1ZHLB 2IGFL 3H9SA 4K3DH 4Z7UB 4OCWL 3TV3H 3EDFA 4ELMF 3L3JA 5IB3B 1DUZA 1AQKH 4OUOA 3B4NA 1JJUA 1M71A 2D7NA 3G5YA 5T3ZD 3P40A 2F15A 2P7TA 4QLRA 3AMKA 1AP2B 1YJDC 2A38A 2CKBA 4KJWC 4TUOA 1CDCA 5D72L 2ZOKA 5C2BH 4OM1H 4UILH 1Q1JL 3TESA 5IVXF 2DQCH 5EU6D 3TPUB 1OQXA 4X6CF 1YNKH 3WFCH 5JW4Q 3QUMH 2C3HA 3OPZH 3BFOA 4FS0A 4DFIA 4RWHA 4LCCB 2DQFB 4HZLA 4X6DF 5CJXA 5BS0A 1BQLH 1R3LB 4IOIA 5CFHA 4L3CA 2KH2B 3QI9D 5CZXC 4N8PA 2PYEE 4LHUB 3IJHA 1AO7A 2E5EA 4M61A 4X6BB 4DGYH 4KC3B 4OZHB 1FVEA 4FP8L 3UTSD 1W0WB 2WBJA 4L9LC 2R8SH 1NBQA 3FO2A 1AGFA 1H0DA 3NZ8A 5F88A 4DVRL 3HUJF 1K8DB 4XCFL 4ZSOB 1JZ8A 1VESA 3EJZC 4LIQH 2PUQT 1G7IA 3VXQA 1CYGA 3ZKQD 3G6JA 3O41A 5L8KB 3L3GB 4MZ2A 4NM4H 1FNEB 4L4JA 5D1XD 1C5CL 1MWAL 2AK1H 5EN2A 1J05B 2I5YH 3O3AA 1UYWL 4UTBH 4M00A 4H1LH 1X5YA 4WEUD 3NH7L 4Y5YA 4XPHL 3HAEA 1EMTL 5EORH 2CUIA 1T7VA 3U6RB 4TYUA 5C1MB 3MR9B 1MIEL 2IAMD 5ANMB 1SEQH 4GS7C 1OVZA 3RBSA 2XV6B 4PJGA 4FNLL 5GS3A 4APQD 4P5KA 3IGAA 4ELMB 4HJJH 2VB5A 5E8NA 1YJDL 1JCKA 1FFNB 1RUAL 3FRPA 5TE7H 4RA3A 2KKQA 5I8OL 5E2TH 1MY5A 4JAMB 4DZBA 4AT6A 3U30C 1PKOA 2VN4A 3RUGF 2AJZA 5ISZE 1A0QH 2F53E 1CLOH 5FECA 2FSEA 1NMAH 3O6FA 1BJ8A 4D3CH 2DKSA 4KXZH 2HKFH 5EIQA 5JHDE 4E41A 1HXMA 3SDCC 3GSUB 5GZOC 3PV6A 3UO1L 2VAJA 2ESVB 3ARDD 3TWCH 3RA7H 5EC2A 1S7RA 3HA0A 3TPKA 5FYKU 4W81A 2JELH 5DJ6B 1CFVL 2VDQL 1A7BA 5DUBB 3TBSA 4PJBB 1KJ3L 2Y5EA 3FO1B 4PJ8C 5HHMB 1QSFB 1IZJA 3QIBD 3KJ4C 3F7PC 5J1AA 3WCYA 2DN7A 4GBXC 4O4YH 3CX5J 5E99H 3OG6B 1YN7A 1HH9A 2YD9A 3V4VL 2R0ZH 4LASL 1T5WB 5D5ME 1RUQL 1RULH 1JYVA 1JZ5A 3LRSB 3P77B 1QFWL 2V5RA 4JFQB 3U83A 5JXAH 4MA7L 3VFRA 2E8YA 1WQVT 2KBGA 3KYAA 4G42B 2AGJL 3FTGB 4JO2H 5E5MA 4RDQF 1CFNA 4LLDA 5D93C 4C56D 4FTVD 2ZJSH 4L4VA 2YA0A 2APVA 4PRAA 2DQEL 2R9HC 3U0TA 4RMVA 1MNUL 2VERN 4XNMB 4IMLA 1T20A 3DPBA 3IETB 3EO0A 4QRQB 4ETQA 4PUBH 4P2CG 5DD6B 4DEPB 3D3VA 4UV7H 4AM0B 3NIDF 2HFEA 1FBIH 3FL7A 2Y5TA 5DD1H 4CN4A 3D3VE 3PDOA 4QT5A 3MRLB 2B4CH 4S2SB 2VWEE 5KS9A 4XXCC 4ZSOE 3MCLL 5T5NF 4HMEA 3I6LD 2FLBT 3BHBA 3ARXA 5CD3A 2IG2L 2WZPD 1U92B 1KIPB 4JFFA 4LRIC 3VRLF 4OZGE 2H6PA 2ICWA 1JF1A 3IDXL 3VG0H 4KZEH 1NGZA 2WBWB 1ZTXH 3IDMA 3IFLL 4HLZG 4MJ6A 3MRDB 5I30H 3P11L 3GSXB 3SQBA 1Q9KA 5E1HB 1EGJL 1QLEH 1UB6A 3WLBB 4G9FD 4WW2C 2DMCA 1AR2A 2CK0L 1GGCL 1E4XI 3GB7A 2D31A 1IAMA 2GY5A 1CLYL 5FYLE 4OKVB 5JDSA 4PRPA 4WGVB 2ESVE 1YEEH 1RU9L 1VB9A 3BRFA 1UC6A 2W9DH 2HT3C 4YXLL 1JL8A 4JGMA 3HRPA 3D6GA 4PRNA 4WEBH 1HHKB 5IHZB 3OJDA 4PRIB 4MNHA 4GW5A 1TVHB 1DQMH 3CH1A 4P2QA 4R26L 3BDYL 2VE6B 2FATL 3D3VB 5D7SH 3PHQB 5ICZA 2IPTH 3EO1A 1PYWB 1T1XB 3PGCA 4IMLB 2YHGA 1HK6A 1BFVL 2E6JA 5FKAB 4W4NA 5EBWB 3VGDA 4BKLA 1G6RB 1T5XB 1RIHL 5T1DH 5ACZB 1BWMA 1BEYH 4TNVF 3BUTA 5HHME 1QSVA 1D9KA 4JRYD 3G6AA 2BMKA 1KCUL 4B7LA 4XZUA 3BUYA 3BO8B 1WCBA 2XKNB 3MACL 4XPGL 3GSQB 3O4LB 1IC5L 5DRXB 3P0VL 4HH8A 5C0JA 3WUZA 5CSBA 3MLYL 5JO5A 1FAKT 3MA9H 1VFAB 5LQBH 5D2LA 4PJ8D 3OKOB 4C56A 3RDTB 3QAZB 4Y4HA 4EI5D 3TJHC 4YDJB 1EO7A 1YEKL 3MJ8A 5CSZB 1T4KB 1T6VN 4LFHG 3VWJC 1NDGA 2X4SB 5C08E 3BKJH 4NHUB 3QUXD 4YXHL 2DJUA 1F5WA 2BNRD 2I60H 1S9WA 1U9KA 3QRGL 4GO6B 3VXUA 4HPYH 4KWUA 5FV2A 4P2OA 4XP6H 2DLTA 3E2HC 4LCYA 5A2IH 1WICA 1YN6A 2P1YA 3C5ZB 3QDMD 4D8PA 1Q94B 4MA1B 5ICXB 1TNNA 3O6FB 1Z5LB 4LOUD 1FC1A 4U3CA 5F9JA 1CG9B 4MA3B 2VLJD 4M1GH 1J86A 3MV7B 2R0WL 4NN5B 1AQKL 4AT6B 5IFHL 4DTGL 4PRHB 5I1GH 4XPAL 1GZQB 3ARFC 4JE4B 1D6VH 4XMPL 1OY3B 1PY9A 3VXUB 2IF7A 2VXUL 4JLRB 5E8PA 3U7YL 3O2DL 2CR3A 5F7LB 4Y8AA 2BOBA 2PO6A 3FZUD 1F4YH 2X4SA 4U1HB 4WV1A 1LK2A 1BM3H 1QD0A 5JTWA 4M5ZH 5DJ6A 3HMWL 1CQKA 3BD4A 1AGEB 4WHYG 3P4LA 4QXUL 5DO2D 5L0QB 5IM7A 5E08H 2FEEL 3B9KB 2DYPD 4G8GB 5SX4I 5J6GA 5BV7B 4HWBL 5DRNA 1NCWH 3IKKA 4ZPTB 3VRJB 4L8CB 1I7UB 3QIWB 1ETZA 4R7DA 1D5BA 1D5MA 2CUHA 4YDKL 2GITB 4X98B 2ID5A 4X5WB 1JPTL 3VCLB 1RSFA 3D9AH 5SV3A 1FVCB 1CL7L 2BC4A 2OMBA 3DROA 5FDYA 4FP8H 1LE5B 4DZBB 5FK9A 5JQ6H 2A9NH 5D1QC 5ENWB 4OD3H 3BO8A 3RPKA 2Q6WA 3T4AB 3BUYB 2Z93A 5C0RH 4ZUVA 3QI9C 5CZXD 5C0AD 4AH2A 3S5LA 3Q1SH 3CFEB 1F3DH 4LLWA 4F80A 1BQHG 1T21B 2Y1VA 4XGZA 2NPLX 3S88L 3WXVH 3L7EA 4GRLC 3FB7A 3EO1B 2X2YA 2IBZY 2IWGA 4XPHH 4CADB 2QADC 5DEGB 1A4KB 4WTZA 1T7ZA 2IQAB 4HXA