4GSKA

Crystal structure of an atg7-atg10 crosslinked complex
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
603
structure length
570
Chain Sequence
SERVLSYAPAFKSFLDTSFFQELSRLKLDVTSQPLTVNLDLHNIPKSADQVPLFLTNRSFEKHNNKRTNEVPLQGSIFNFNVLDEFKNLDKQLFLHQRALECWEDGIKDINKCVSFVIISFADLKKYRFYYWLGVPCFQRPSSTVLHVRPEPSLKGLFSKCQKWFDVNYSKWVCILDADDEIVNYDKSIIRKTKVLAIRDTSTMENVPSALTKNFLSVLQYDVPDLIDFKLLIIRQNEGSFALNATFASPDMKVSGWERNVQGKLAPRVVDLSSLLDPLKIADQSVDLNLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAWGVRKITFVDNGTVSYSNPVRQALYNFEDAGKPKAELAAASLKRIFPLMDATGVKLSIPMIGHKLVNEEAQHKDFDRLRALIKEHDIIFLLVDSRESRWLPSLLSNIENKTVINAALGFDSYLVMRHGQLGCYFCHRTLDQMCTVTRPGVAMMASSLAVELMTSLLQTKYSGSETTVLGDIPHQIRGFLHNFSILKLETPAYEHCPACSPKVIEAFTDLGWEFVKKALEHPLYLEEISGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/ligase
molecule keywords Ubiquitin-like modifier-activating enzyme ATG7
total genus 182
structure length 570
sequence length 603
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
A PF16420 ATG7_N Ubiquitin-like modifier-activating enzyme ATG7 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gskA02
3V1UA 3PIDA 4EEZA 1LC0A 3H9JA 3EAGA 5A4DA 5LDGA 1QV7A 3ROQA 3JQCA 2ZYAA 1OC2A 1UH5A 2OBYA 3JD3A 4II3A 4R16A 3TSCA 3BAZA 1YWGO 4L4SA 3BMQA 5G0SA 3ADPA 4FR5A 3RUCA 4WNIA 2PR2A 3DOCA 1Y5MA 4YT4A 3Q2IA 3A4VA 4W7HA 3HNPA 1JKFA 1ZSYA 4PG7A 1KBZA 2JHFA 5JC8A 4R1TA 2E6UX 2VT3A 2I99A 2W8ZA 2YDYA 4OMUA 2VTDA 3DBLA 4TVOA 5AYVA 4E5NA 3B1JA 1GL3A 1U28A 3OHSX 4GX2A 3LT0A 3WJ7A 3ZW9A 1CQJA 5IDQA 5MDHA 3RJ5A 4FDAA 3FWNA 1EEHA 3JYNA 2DPHA 4CM3A 2C20A 4J4BA 1ISFA 2JFGA 3R3JA 2B5VA 1OZAA 1WZEA 3GVCA 1DIBA 3T7CA 3GGGA 4EW6A 5TIIA 3UHAA 2DAPA 5GZ1A 4IGEA 5ITVA 5DULA 1NQAO 3EVNA 5L7YA 3GDGA 1D7OA 4KUHA 1GV0A 3ST7A 2AQKA 3FR8A 5EQFA 3HWRA 4DQVA 1ONOA 3PGJA 4E5YA 5ILGA 1YQGA 3DC2A 1XG5A 2R00A 1P33A 3P7MA 2PZMA 4IDDA 1U2DA 5TX7A 1LU9A 4RZIA 1WAMA 1H94A 2VZ0A 3P5SA 1W4ZA 1X1TA 1FF9A 4BNYA 3GUYA 1EBUA 3JTMA 1LUAA 3W8DA 5CP8A 5LC1A 3NGLA 4XYLA 3C7DB 4NBRA 4PZEA 1AGNA 1ULSA 1DC5A 4RGBA 3GDFA 2G1UA 4ITUA 3R0IA 4LMRA 1PJQA 4IQ8A 4W9NC 2WJPA 1Z82A 4NBTA 5JC1A 5KKAA 3EC7A 2GD1O 3CSDA 3PLNA 3GC6A 3PHHA 3RC1A 2WEKA 4GKVA 3AOEC 1EQUA 4ALNA 3KYCA 2FPPA 3C85A 4BO6A 1EUDA 4YAKA 2UAGA 2BMAA 3WGHA 4W4TA 3K96A 2ZYDA 1E7MA 1L7EA 4CLOB 3RKRA 1BXGB 3VPFA 1DRVA 4LVUA 3LT4A 4D79A 4N7RA 1I01A 4ILKA 1EE2A 2D0IA 4PVDA 2B4TO 4WOKA 5DCUA 3D5QA 1FMCA 3I52A 3JD4A 4GQAA 2BHLA 3GMSA 5A5FA 1VPDA 4UEOA 1UAGA 4UUOA 3FN4A 3FRJA 4ZGWA 1HLPA 2E4AA 3ZWBA 4M55A 1IB6A 4J1SA 4EZBA 3UCFA 1WZIA 2GNAA 2NTNA 5FFFA 1KVRA 1UP6A 3WQQA 4AJHA 4BNWA 1S7CA 1BW9A 3PQFA 2NVUA 3PZBA 2G76A 4CQLA 4ID9A 4DA9A 4L8VA 3L4BC 3PHGA 2Y0EA 3ZV4A 4FSHA 3KYBA 3OA2A 4Q9NA 3V1TC 4IZIA 1TLTA 3GN1A 5DT9A 1K0UA 4R51A 3DOOA 1NX6A 4OXKA 1H2HA 4H15A 4WEOA 5DCYA 2AA3A 1UXGA 2R6JA 4BOYA 3WWZA 2HQ1A 4DPLA 1XKQA 1ZK2A 4O6VA 4I8XA 1PJ4A 2C7GA 2DTEA 3JQ9A 3WMWA 2C07A 4HKTA 4ALIA 1W73A 2D8AA 3DZFA 4E30A 1BSVA 1DFHA 4E2WA 4UUPA 4KMSA 4CMBA 4BGUA 2HDHA 1AHIA 3JCZA 1P9LA 4BNHA 3W8EA 1BXGA 1V35A 3TZQA 4DL9A 5C37A 4WASA 3GA0A 4QFDA 3I9OA 1C14A 1DIAA 1KY4A 5EIOA 4DIOA 2H9IA 1O9BA 2BGLA 4TKLA 4NJMA 2YV3A 5CAEA 5F3RA 2QW8A 4BUCA 1NR7A 2AMFA 3GZNB 3NUGA 5B37A 3RROA 3W6ZA 5CEFA 2DBQA 3G1UA 5L40A 1XLTA 3AFMA 3WICA 1U3TA 1RM0A 4R1NA 5BNTA 4YAGA 4A26A 3SLGA 4E4YA 1O95A 2HMSA 2B35A 4RCVA 4ZN6A 2LDBA 1A9ZA 3PLRA 5A9TA 5KVVA 1KEUA 3ZI0A 2JD2A 4R5HA 1NQOA 4AG3A 1U7TA 3JD0A 3PK0A 3GK3A 3WTCA 1P44A 4CQMB 3V2GA 5T5QA 2FHSA 2HKIA 1QMGA 3P19A 3EDMA 3JQ8A 1KEPA 1WMBA 3VC7A 3FNHA 1G0OA 4IJWA 4A73A 4DLLA 4R41A 4XIJA 4UVEA 1DBVO 2GO1A 2HAEA 3BA1A 5A1TA 1YOVB 4FCCA 1MGOA 1CDOA 5HRUA 4CL8A 1JQBA 3ZH2A 3RJ9A 3U49A 2PKQP 4A5OA 3DTYA 3S2FA 1LX6A 5ER6A 3KVOA 3VH3A 2BRUA 4HUJA 4LRTB 4QUKA 2FMUA 1QKIA 1ZXBA 2Y1EA 3GT0A 3K5PA 2J6IA 2OOSA 3MOGA 4TRJA 2C82A 1O0SA 3L6EA 4EJ0A 5THKA 4UUMA 2EIHA 2GERA 3AUTA 1SCUA 1XYGA 3JQAD 3F1KA 4GX1A 4PLCA 1MX3A 4J49A 3Q9NA 5TQVA 2NU8A 4CMCA 5JS6A 1HL3A 2FWMX 2NNLD 3AI3A 3JYPA 3MEQA 2LDXA 3P2OA 4WEQA 3JQ8B 2EP7A 3IAHA 4ALKA 4FOOA 1O94A 2Q46A 4IPTA 1IHXA 3NJ8A 4J1TA 1NAIA 3ZWYA 4BO1A 3W4IA 4DYVA 1XHLA 4XGKA 4BNKA 2DFDA 3U62A 4BNJA 3FNEA 2JKVA 4L76A 3DAFA 1HZZA 4OKIA 3KB6A 5AXBA 2EKPA 2IYPA 1N8KA 3DFUA 1DPGA 5I9MA 1KVQA 3PI7A 5I7EA 2FRDA 4LK3A 3Q3CA 4Q39A 3DBRA 2Q3EA 4NQZA 3Q0EA 4BNIA 5CG2A 3NT2A 1YBVA 2BFMA 3B70A 4MVJA 4GX0A 4PLGA 1MFPA 5TLSA 2P9EA 3GUCA 3NT5A 4XJTA 2PH3A 4WCFC 4DC0A 5BSFA 1QG6A 4ZRMA 5T64A 3DQPA 1GY8A 2VWQA 5A06A 4GGOA 3VOSA 1EZ4A 3D3WA 3ZNOA 5I8WA 1I2CA 4DYDA 1CEQA 4DGSA 3NAQA 3GGPA 1HETA 2FN7A 4K1LA 4DLAA 3B6ZA 3KLMX 4F6CA 3RU7A 2ZTVA 3DBHA 3E82A 2DT5A 4IS3A 1I36A 2W2KA 5IDYA 4PZDA 5EERA 4EUHA 2Q1WA 1GU7A 2GN4A 5BR7A 1PJBA 3UOGA 3GY0A 2VHXA 4E5KA 1LDYA 1J6UA 3F5SA 4GWKA 2BH9A 1A72A 4RVSA 1HDYA 3S55A 1E7SA 3JQAB 3PHJA 4NMHA 4Z9YA 4DIBA 4WKGA 5U1PA 2OGUA 4FN4A 4KUEA 5BNIA 4Y6SA 2WD8A 1DHTA 1MXHA 4P4LA 3EUWA 2ZTMA 2DFVA 2I6TA 3C3XA 4DC1A 1NAHA 4PLTA 3QWBA 4ZQFA 4A27A 1BGVA 2NTVA 3IKVA 5EINA 5C5IA 3IP3A 1PJTA 1YS4A 4BO4A 4B8ZA 4ND1A 4U6QA 1XIVA 3ZU4A 4M86A 1GZ6A 1YONA 3CMCO 5DBFA 3H5RA 3GRKA 4MIOA 3V5NA 2HCTA 3ZV6A 4R9RA 4H3VA 4DWVA 1TT7A 3B1FA 2GF2A 2FPGA 3OEYA 4J9UE 2HRBA 2PH5A 4FFPA 1LLQA 4R68A 1O6ZA 3PVZA 1MV8A 4E5MA 1ENOA 3VPXA 1ULUA 2B5WA 1R6DA 1T2CA 3TZ6A 1RPNA 3K92A 3UCXA 3DB2A 4NFHA 4FIZA 4H7PA 3FTNA 2HK8A 4TROA 3QV1A 3R6DA 3BTOA 1XSEA 5ENVA 3RBZA 3ORFA 1GAEO 4XCVA 2E48A 1DJNA 1YBAA 4YQYA 5HWSA 4WLEA 1P31A 2CDAA 4IJVA 2QRLA 1Q2XA 1PX0A 1UJMA 4JP3A 3DZGA 3RC2A 3E6AA 3HN7A 1B16A 1N5DA 3DZJA 4BO7A 4NNJA 3I3OA 4BS9A 4WLOA 4CV0A 1N1GA 2IZ1A 1G1AA 1SPXA 3LZ6A 4JX8A 3RUEA 1CYDA 2X9VA 3TPCA 1J49A 1MG0A 1HKUA 1XDWA 3WLFA 4CMKA 1UDBA 4JP2A 4HNHA 2HMVA 5CDGA 3S2EA 1LLDA 5G4KB 1NQ5A 4XEHA 2CUKA 3D0OA 2NVBA 1LSOA 2Q1SA 2VWPA 3MJEA 2A94A 2W2LD 3VKUA 4RV9A 1HE2A 4J3FA 1Z74A 3EYWA 3PFFA 4GLLA 3WNVA 3GN2A 1YOVA 1XEAA 4XKJA 4CM7A 3HG7A 3KSUA 4IQGA 4INAA 5IZ4A 3Q11A 5H82A 2J5KA 1NPTO 1JU9A 3OP4A 5COQA 4TQGA 5EL0A 1C0LA 4J7XA 3KEQA 5JDIA 1A71A 1NWCA 3R1IA 4XA8A 5C3MA 2FZWA 2RIRA 3SX2A 3GPDG 1HDCA 1IHYA 3IS3A 4LSWA 4RVHA 4TZTA 3ZWNA 4FFMA 1HYHA 5I7VA 1E1MA 5JDIC 3UVEA 1A27A 3INRA 2PD6A 4IDFA 4U8GA 1OAAA 1FK8A 4R54A 3SJUA 4YRAA 1PGJA 5K6AC 2Y1OA 4WE3A 1PZEA 1EFKA 4NBUA 4RDHA 5IAAA 3U0BA 1LDBA 1X7GA 4QT0A 2XPCA 3U5TA 2IODA 4U0KA 1YL5A 4TZKA 1F06A 4WOJA 2WWRA 1E1NA 4UULA 4A10A 1ZCJA 4PLYA 3VH4A 4PGFA 5C7OO 3WBBA 5IXYA 2JD1A 5B4VA 1YDWA 3DMTC 5BSEA 4XJSA 3E48A 3GEDA 1XELA 5IF3A 5A9SA 3CXRA 3GQVA 5TJHA 3L9WA 1SC6A 5JY1A 1UXKA 4BQPA 4DIFA 4UVIA 2EV9A 2BLLA 4JJGA 3SBOA 3QQPA 1WWKA 1X0VA 1Y9AA 2DTDA 2V65A 3MJTA 4MVJE 4MOWA 3LT2A 4JGBA 1KERA 4RPLA 1RWBA 4G81A 3QSGA 1JLLA 3FBGA 4GGPA 5FF9A 2EHDA 1RM3A 1R0KA 1QV6A 4XQCA 4HFNA 3IJRA 4HWKA 3OA0A 3TL2A 5TRTA 3JD1A 2DUUA 1NHWA 3GMDA 2DU8A 5ER9A 2GZ3A 2WDZA 1HLDA 4RPHA 4FFLA 4BO9A 2O3RA 1I10A 4J2HA 1P0FA 3KM0A 1LLCA 2XXJA 5HBRA 4B4WA 4J43A 1MB4A 4K6FA 3WQRA 4QEDA 4Z0TA 4HX5A 2NSDA 2HSDA 3ETDA 1I3NA 2A9FA 3M2TA 2AE2A 2BFOA 3ZDFA 4PG4A 2YQ5A 4N5LA 1Q1NA 2PGDA 3SLKA 1LTHR 3WR5A 4W9NA 3MTJA 4AJKA 1KEVA 4RPGA 5GY7A 3WYBA 4QTZA 4RL6A 2GPTA 4RQUA 2IZZA 4CM4B 1X7DA 3D3WB 4LVCA 1LSJA 2Q4EA 1GUZA 2ZYGA 1NASA 2ZJ0A 7MDHA 4ALMA 2BF7A 3ZHBA 4ND4A 4BMSA 3PQDA 4LSMA 4WLUA 2G0TA 4CV2A 3K8ZA 4FOSA 4I08A 2NM0A 2JCYA 5MGBA 3MJVA 3WTBA 5JCJD 3AFNA 1DSSG 1ZZEA 2IXAA 4YBZA 4M49A 1BDMA 3BHJA 1MC5A 1EMDA 3EMKA 2VCYA 3A1NA 1M75A 1P1HA 1H9AA 2QX7A 2BFAA 3IC5A 4TSKA 1GPDG 4MIYA 2CF5A 1NWHA 4BNZA 3WS7A 1I3LA 1JAXA 1HDRA 4YJGB 3PIIA 3S1LA 2Z5LA 4GBJA 3RKUA 5CDTA 1HT0A 2PZJA 2X23A 1YL7A 2GZ1A 1XCBA 2PKQO 1EBFA 4IDCA 5DP2A 2W2LA 2V6FA 3HSKA 2X4GA 4H16A 5AOVA 2X0JA 5T8KA 4CR7A 5CG1A 3LF2A 1ZH8A 2NQTA 2WYWA 3VTZA 4U5QA 4EJ6A 3HJAA 1E7WA 4RORA 4R9SA 2RAFA 4RZHA 3NGXA 5B4TA 1ZBQA 1X7HA 1H2BA 5T8KC 1E5LA 1RKXA 4YRDA 1NBOA 2IDZA 1B15A 3QE3A 4DRYA 2GYYA 5TC4A 2YHIB 5KJ1A 5L51A 3ASVA 3ZV5A 2VZ9A 4EI2A 2XAAA 3ON5A 2CVQA 3TNLA 5JXWA 1QRRA 3S8MA 5EJ2A 3KOUA 1T2FA 1OMOA 5IDXA 1L7DA 1E3SA 4YDRA 4PRLA 1GYQA 3JQ7A 4MKRA 4EITA 1TXGA 4JN6B 3ZNPA 2V6MA 2HUNA 1UZLA 2WE7A 3E8XA 3KYDA 5G0UA 4YR9A 5I7SA 1R4NA 1LSUA 1ZK3A 1EFLA 3DWFA 2OFPA 4TMFA 2Q2WA 2VHZA 2O48X 4LMPA 3C7CB 4J6FA 5EN4A 3DZIA 4YT8A 5G4LA 1HYEA 6ADHA 1J5PA 1YXMA 3JQBA 4EYEA 2JCVA 2WYVA 3Q9UA 1B14A 3BZUA 3WB9A 5HM8A 3C24A 1B3BA 1VKOA 3M2PA 4DUPA 2YYYA 3KLPX 2DC1A 2JAHA 2BFPA 3H8VA 4I1IA 4E32A 1E3EA 4CUZA 4NBVA 2P2SA 2CFCA 4BMVA 3ANLA 1M6WA 4K26A 3A06A 5TSDA 4BKUA 2G82A 3RUDA 1ISJA 4CMEC 4PIVA 4YQZA 1Z7EA 4R01A 1Y81A 1KC1A 1UP4A 3KEOA 4LCJA 4B4UA 5I9NA 2OO5A 2CDBA 1IZ9A 3H7AA 3KETA 3SEFA 2AEFA 1GEEA 2ZIZA 4QO7A 3NEPX 4XQ9A 4BO5A 5F1OA 2X5JO 4BKOA 4FQ8A 3PJGA 4WCFA 5KVQA 3ZNNA 1GV1A 3D4PA 4QX6A 1U2GA 4DTIA 4GMFA 4WLFA 2G5CA 3AUUA 2X7HA 3ANMA 3OJ0A 4I5FA 4FGWA 1FDUA 3OH8A 1MXFA 1YH3A 4IBOA 3FNFA 2QRKA 1DC3A 1EUZA 1MP0A 1MLDA 4XDZA 3ZWOA 2GN8A 4M1QA 2Q49A 1UXJA 5BQFA 1LSSA 4PFJA 1VI2A 2CDCA 1P0CA 1F17A 3EZLA 2PD3A 5T57A 1LDGA 1PGPA 4NDNE 2IE0A 2JD0A 4L74A 3RAJA 3PWZA 2A92A 2Y93A 4AJPA 2V7PA 2P9CA 3C1OA 2IXBA 2ZB7A 1T4BA 2PY6A 3IJPA 3K9QO 4JBGA 1LNQA 4S1VA 3TZHA 3WQSB 5CDUA 4CLRB 2HJSA 3NYWA 3WG9A 5IFLA 2DKNA 2VRCA 5GZ3A 2B37A 3KYCB 4OIMA 3IIEA 2X58A 1CIVA 2FSVA 4YRBA 2B4QA 3OEWA 2PKRA 1J4AA 1YL6A 2VZ8A 1VSUA 1O5IA 1X15A 4GSLA 3BMNA 3FBTA 4I9HA 4S3MA 1H6BA 3RFVA 4R5MA 4NU6A 3QVOA 1Z45A 4XWYA 3I9MA 1VSVA 3W4JA 3D5TA 3GAFA 2J5RA 2DPGA 3L6DA 4YT5A 3U4IA 4CM8B 2NU7A 3CINA 1PTJA 5JYEA 1GCUA 5L7WA 1H9BA 4YB8A 5T6BA 1Z7BA 1EVIA 5ENDA 4D7AA 1U3UA 3GVIA 2C29D 1E6WA 4O5OA 3WGOA 4BNNA 4JJIA 4OH1A 1IOLA 4KOAA 5U9CA 2OUIA 4C7JA 4IM7A 3K73O 3TF5A 3UFXA 2Q1UA 3JQAA 3W4KA 4Y6PA 1U5AA 5ITWA 3D1LA 3NDRA 5A9SB 2RHCA 4X54A 2GDZA 4W6ZA 3F9IA 4AJIA 4QECA 5DF1A 3BMQB 4KTVE 4E31A 4N54A 4Z0HO 2QZ9A 1MC4A 4J1QA 5H81A 3SJ7A 3RU9A 3VZRA 3DZBA 4P38A 2TMDA 4FJ1A 4HNGA 1K6XA 1PGOA 2TMGA 3G17A 3VVCA 4GSKA 3F3SA 1GADO 2D5AA 3QRWA 3QIVA 4E2XA 3DMYA 3TDKA 3AI2A 2P9GA 4XGIA 2VYVD 1NM5A 1QORA 1ZMOA 4R1UA 4F46A 3QA9A 1WPQA 4HXYA 2P5UA 4B4OA 2HK9A 3U4DA 1Q7BA 3C1TA 4NI5A 1OOEA 2AQIA 1GQ2A 3SC6A 3X2FA 4CMIB 4XD2A 4EJMA 2FP4A 1QYDA 2BD0A 3VPHA 3ZNQA 3C8MA 2FPIA 3PJEA 2VUSA 2EW8A 3BMNB 3K2EA 5DNAA 3W6UA 3G3EA 2BI7A 1T24A 3WSVA 4GKBA 3W8FA 2YW9A 3OJEA 5U4QA 3WIDA 1NYTA 1NTOA 2BGMA 3ZHZA 2ZK7A 3JQEA 4YJFA 1PGQA 4OM8A 1DC6A 1BHSA 3UF0A 4E0BA 2UV8A 2J3KA 2Y68A 1R16A 2B69A 4FGSA 3VKVA 1SZJG 5KCZA 4JK3A 1HDZA 3HFGA 3AY6A 4HFJA 3DZHA 5ES3A 4R69A 3QVXA 2YHIA 2ZB4A 3LC7O 3L4BA 1T1SA 1YRLA 1PQPA 1E6UA 3TFOA 2VHWA 1DHRA 4NHEA 7ADHA 3OIGA 2AW5A 3ONFA 2GN9A 2D59A 5EPOA 5JPIA 1PS8A 4ND2A 3AM4A 4JBHA 4Y6RA 1B26A 4TRNA 3DHEA 3NT4A 1Q7GA 2VWGA 4RF2A 3I6IA 1UR5A 4W99A 4QFCA 3F1LA 4AJ2A 5KVSA 3PRJA 3AU9A 4AL4A 3NDIA 1R0SA 1NFRA 3BMOB 3I6QA 4F3YA 4UUNA 4ALJA 1Y7TA 3PWKA 2B36A 4ONEA 3ZWAA 3PYLA 2O3JA 1HDXA 2QQ5A 3E03A 1FJHA 3IUSA 5A5EA 3QVWA 2JCXA 2O3QA 1OFGA 1CQIA 4U0JA 4RVUA 2B0JA 4MVJM 2QYSA 2NUAA 3AOEA 4BNUA 1PQUA 2VUTA 1TB4A 3GG9A 5IN5A 3WLEA 2RCYA 2YDXA 4MO2A 4Y9DA 3U4HA 3ZWCA 1T2DA 3WSWA 1LXCA 1NPYA 1XU9A 1IZ0A 4NZ9A 2GR9A 2P4QA 4PRKA 1HTBA 2PLAA 3V2HA 1B8UA 4NH4A 1DOHA 3L9XA 3OM9A 3OSUA 4CMHA 1E7YA 2NWQA 3MOIA 3Q6IA 3ZCXA 4YJHA 5JYDA 2I66A 2D5CA 2CNBA 2ZTUA 4OSOA 2VOEA 1ZK0A 1ZJYA 2J3IA 2BGKA 2X9GA 4E3ZA 3HB4X 3E9MA 4FC6A 2FY8A 5L95A 4XQEA 2J3HA 1E77A 3DBLB 3CTMA 4YVFA 1U1IA 3KUXA 2W4QA 1OC4A 4WNCA 1W6UA 3QY9A 3T4EA 2D4AA 1KY5A 2Q45A 1ORRA 3LYLA 4MJLA 3CKYA 2VYVA 5I7FA 3IKTA 4GL4A 1IUKA 2JJYA 4YA6A 3DZKA 4D3FA 3BIOA 1VLLA 5ADHA 4Z0PA 3QLJA 1JKIA 1GZ4A 4P8RA 3I1JA 1NFFA 1H6CA 3VDQA 2YY7A 1H0KA 4E12A 1QP8A 1ISGA 1WDMA 1GYRA 4BO3A 3TJRA 3F47A 4DPMA 3DXFA 1X14A 4J7UA 1UDAA 2ZCVA 3LC1O 3U9LA 1YGYA 2A35A 2D3TA 3MTGA 1A9YA 3TZKA 2Y1FA 1PZHA 4RPJA 3VPGA 2PGJA 3GF4A 4LN1A 2SCUA 1LDNA 3WDSA 4HFMA 3G0OA 4DMLA 5HS6A 1D1TA 4OYRA 1E1LA 2I65A 3FF4A 1O89A 4HFRA 3CUKA 3KXDA 4Q3CA 1MG5A 1U4SA 2VHVA 3PQEA 3ASUA 4YJGA 3O4RA 5KOIA 4NJMB 5JMWA 3TN7A 4HP8A 2ZB8A 3L6OO 1DIRA 1I3KA 1ZK4A 4JJFA 4J2OA 5T67A 1PR3A 1PJ3A 4CR6A 1M76A 5GMOA 2UVDA 1DB3A 2D1YA 3HN2A 2X0NA 5GZ6A 4JCOA 4E33A 1SEPA 2Y99A 4BV8A 2WMDA 1K5HA 1UZMA 4NU5A 3D64A 3RSHA 3NTQA 3PHIA 3VHRA 1M6HA 1BVUA 4TKMA 3PDJA 4ZQHA 1AN9A 1LRLA 2I9PA 2RBEA 3KO8A 3BTUA 1M2WA 2C54A 3LDHA 2E37A 5L4LA 3WXBA 3WIEA 3RUHA 1C0PA 1ZXLA 4CUKA 5FI5A 4B79A 1JA9A 1PR9A 5IZCC 4UEJA 1GZ3A 3INTA 1JTVA 3H3JA 1Y8RB 5G0VA 1TA4A 3UICA 4O59O 2NU6A 2VYND 1CRWG 3BMOA 5A3JA 5ICMA 5FEUA 3PFWO 1K6JA 2EERA 1I33A 2GZ2A 4ALLA 3I9JA 3VZQA 1PJSA 1E7RA 1LI4A 2G17A 4PLVA 2YUTA 3RFXA 3K2BA 4ZRNA 5L4NA 1SNYA 3MZ0A 1PL7A 3HB5X 4TRMA 1QYWA 5THQA 4Z9XA 3UKOA 2Q99A 4BV9A 5A02A 1YJ8A 4G5HA 3ZU5A 4P4NA 4IZHA 3CE6A 4B7XA 2WSBA 1SOVA 4II2A 1S6YA 3WYCA 5FWNA 4ND5A 3EVTA 2RH4A 1C1DB 4YACA 4FS3A 5AXAA 1TT5A 1M66A 6LDHA 1C3VA 1H6DA 3BMCA 4ZA2A 3AUAA 2J3JA 1ZK1A 5CPBA 3ITKA 3F4BA 4KWIA 4UVGA 1DAPA 1PWZA 4CR8A 3I4FA 4YT2A 2AE1A 1Q0LA 3HADA 4CLHA 3LSYA 3OETA 3QHAA 3D3EA 2W2KB 2IEDA 5JCJA 1ENPA 4YAEA 3F4LA 4LRSB 3X2EA 3UCEA 3AK4A 2I3AA 2DUWA 3HDJA 3IUPA 2O4CA 4D44A 1R0LA 3H9UA 1Y8QA 1ZVMA 1K3TA 3WWYA 2E49A 4YXFA 3TL3A 4YPOA 1M67A 4OGWA 4YEDA 4CODB 3N58A 1X0XA 1P77A 4Z3DA 4N18A 1R15A 1WVGA 3LF1A 2NVUB 2DQ4A 5JO9A 2YV1A 4RVDA 4CPDA 5JBIA 1KVTA 1P1RA 1WLYA 3E1KA 3COSA 5B4UA 3MJ4A 3UW3A 4GLOA 2VRBA 4BNFA 3LVFO 2ZQZA 3INGA 1DAOA 1ZSVA 2GGSA 4YAIA 1JVBA 4CLXA 1GUYA 1LJ8A 4FC7A 2X9NA 1Y1PA 2HU2A 3QVTA 4LISA 3DBHB 1U8XX 3H2SA 2X6TA 1XWFA 1JKJA 3GZ4A 1LRKA 4IDEA 1ARZA 1A5ZA 3L07A 3E9NA 4I9UA 4E13A 4GMGA 1BVRA 4B8WA 2UDPA 3I9KA 3OIFA 1K6IA 1ZSNA 2R00C 1LC3A 3IDSA 4A7PA 3WBFA 3WNQA 1CJCA 5BSHA 3GHYA 3BHMA 3ZWPA 2AEJA 4RDIA 5JW6A 3BXXA 4Z6KA 4R1SA 4NFYA 1ADBA 3H6KA 1KVUA 3VZPA 1DDOA 3VPSA 3UAGA 3AI1A 3F46A 1IL0A 3KV3O 4J9VA 1ENYA 4Z9FA 3ENKA 3AM3A 4MVJP 1D3AA 3QWFA 4YJDA 1O8CA 2C5EA 2P91A 1VC2A 4L4XA 3WFJA 4RLSA 2BKAA 2WD7B 2UYYA 4CQMD 2NTJA 4XB1A 4BB6A 5JAMA 2H5LA 5DBIA 2POQX 1UUFA 2BELA 3I5MA 4CLOA 3DAPA 4YJHB 2IZ0A 1PZGA 2QG4A 4PLHA 4DVJA 3HDYA 4GH5A 4I5GA 1Y9EA 1BWSA 3H9QA 1FDWA 1ZEMA 4O63O 1P3DA 4ZJUA 1MA0A 4EUEA 4LW8A 3HFSA 4EUFA 2Q50A 1HE5A 4Q3DA 4DPKA 4P4GA 5DP1A 3RBXA 3PHLA 3QWHA 2DBRA 5TNXA 5DOVA 1SOWA 3PZRA 3GLQA 3JQBC 3I9NA 2O50A 3KRTA 4AJLA 4NK4A 4Q3BA 2Y0CA 3IP1A 3VH2A 1E1KA 3K30A 1DFIA 3ROPA 3GOHA 2RH8A 5BT9A 3T7EA 1PL6A 4P22A 1C0KA 3ZU3A 5AVOA 2EJWA 3NTRA 5G0TA 3LLSA 1FDTA 3A14A 5KJFA 4ZVVA 1B3RA 4OQYA 5JO0A 5CPFA 1C1DA 3D7LA 2FSSA 4K6CA 2PZKA 1PQWA 3OJLA 1N92A 4MVJD 1U4OA 1YE3A 3MWDB 5JAIA 3TQHA 2WD7A 4L4RA 1R66A 4CLDA 4MP3A 2X8LA 1NP3A 3UUWA 5JE8A 3PTZA 1H5QA 3BTVA 1C1XB 1ONPA 4IXTA 2VUUA 4J0FA 3ANNA 3AWDA 1PSDA 1DO8A 5JSFA 3AY7A 1DRWA 2AG8A 4U6SA 5G4KA 3I9LA 5TJ9A 4IUYA 3OQ6A 1V0JA 3GAZA 4J16A 3GVPA 1I2BA 3ROMA 3A9WA 3P2YA 2OHXA 2OBNA 2HK7A 2E82A 4KUGA 4OJNA 4YTEA 4URFA 1N1EA 2O23A 3H5NA 4J91A 3L4SO 1F12A 3O26A 3PPIA 4DXHA 4CJXA 4NJOA 3WJAA 1VJ0A 4BNLA 4UREA 1GUFA 2PK3A 5IDWA 4IS2A 4UAGA 1Z75A 1N7GA 3Q2KA 2FR1A 1K2WA 3JQDA 3PYMA 3GFBA 2Q2QA 4XR9A 5AXCA 5JLAA 4BVAA 4PN3A 2GN6A 3JQGB 1LQTA 1F8GA 1HDGO 3EW7A 4BIIA 3G1TA 4K9DA 5EMHA 2PZLA 4U7WA 1LRJA 4I5EA 1YB4A 2O3TA 2OXIA 1EQ2A 3K31A 3SXPA 4UEKA 2NQ8A 2C2XA 4J4TA 3RBVA 2NV6A 3V1YA 4WCDA 3HZZA 3PWSA 2B4RO 2VYNA 2FZEA 2WM3A 1N2SA 3MJSA 4AJJA 4B3HA 5LDHA 4BNTA 2EF1A 2AG5A 1RM5A 2GCGA 1YKFA 3VDRA 3GH3A 3JSAA 5JDCA 1C1XA 2HMTA 1PEDA 3ICPA 5A05A 1ZJZA 1KYQA 3GRPA 4IIVA 2HJRA 4DREA 1V6AA 2X22A 2PD4A 3PP8A 2EKLA 1X13A 1LQUA 3DONA 1V9LA 2IEBA 1HDOA 3SC4A 2JFHA 4FJ2A 3GVXA 5F5NA 1B2LA 1AXGA 3OFSA 4IJUA 1DRUA 1GD1O 2Z1MA 3KSDO 1LLUA 2VNAA 1TI7A 2Y05A 2ET6A 1HWYA 1V3UA 4Q3EA 3FCOA 4IDGA 3ZWMA 2ZTLA 3RD5A 1HRDA 1C0IA 4PG6A 1HSZA 3TOZA 1F14A 4J90A 4AJOA 3CIFA 2Z1NA 1RM4A 4AJ1A 4JNKA 4CV1A 3EZYA 4CQLB 3JQGA 4N5NA 3KTDA 3ZGYA 3KSZO 3RCBA 5DN9A 3DBRB 4D0RA 2IYOA 3AOGA 2XXBA 1I3MA 1UP7A 1WNTA 1EUCA 1N9GB 2NACA 2PFGA 3OIDA 4WLVA 3TRIA 3TOXA 3DL2A 4BNGA 4EDFA 2EP5A 1YQDA 1QLJA 3H9EO 4YCAA 1U8FO 3ITDA 3IMFA 2CZCA 2VNSA 1AE1A 1R4MA 4I9NA 4ZQBA 4E2ZA 1IY8A 3HE3A 3QP9A 3VZSA 1X1EA 3BMCB 4FJ0A 2EGGA 2O4UX 3ROKA 1LDMA 1PJ2A 5A9RA 3WOHA 3I83A 3O9ZA 4L75A 1B8VA 1EVYA 1QYCA 2HLPA 2J5QA 4FB5A 3DO5A 4D41A 4CMJA 1ZW1A 2ZCUA 3HQ4O 2OP1A 3F6YA 3FSRA 2DTXA 1SEVA 4W7IA 4XGNA 2VHYA 4Q3AA 3RUFA 4BO2A 1GQYA 4JQCA 4QQRA 2EW2A 1BXKA 4FPXA 1YB1A 3GNQA 1TEHA 2XF8A 2ZATA 1JW9B 5JY6A 4ROSA 1W0CA 4J1NA 1HSOA 4EEXA 4DMMA 3JYOA 4JLWA 1TVEA 1I30A 2O3UA 1IE3A 5C7IO 3B1KA 4GWGA 3GDOA 1DEHA 4CMEA 2Y66A 3QVSA 4YJFB 4XYGA 4F6LA 4WECA 1LDEA 1PWXA 3JQFA 4QXMA 5J23A 4B4VA 1IYZA 1GYPA 2FR0A 4C4OA 3ZN2A 1VKNA 1YBMA 3F5QA 4ZQGA 1HE4A 1Y5RA 1ISMA 4IINA 5CEEA 5EESA 4BGEA 3KYDB 3GFGA 1UXHA 1VL8A 1D1SA 3FHLA 2C2YA 3K6JA 1KS9A 3NRCA 4BMNA 3ABIA 4BHTA 4E21A 4NFSA 5CDSA 3KZVA 1VJ1A 2ZJ1A 3O38A 3H5AA 3ZU2A 3DMTA 4KWHA 1H6AA 4OOFA 1PJLA 4OOEA 4D45A 4QO8A 3RFTA 2YFHA 1CF2O 4RF3A 2V6BA 1LBEA 4PLPA 2ILTA 2X5KO 3KHUA 5A03A 5G2OA 1I32A 5CDYA 3HHPA 5CFZA 1E0DA 4B3JA 4BKRA 3UXYA 1U7HA 2HRZA 3OMLA 1KVSA 2Y1GA 3O03A 2WE8A 3GHHA 2C5AA 4TVBA 5B1YA 1L1FA 3WGTA 5JFOA 1NFQA 3OQ1A 1DXYA 2NADA 3MJCA 3VH1A 5KJ6A 2Y1CA 2EG9A 3ETEA 4MKXA 1ML3A 4WJZA 1DFGA 4DQUA 4YWJA 5HA5A 4RF5A 4A03A 1T25A 3RVDA 1B7GO 4M8SA 4MPDA 5FYDA 4AFNA 1I8TA 1GEGA 2R2GA 1T26A 4Y8VA 1FDSA 4A2CA 3NTOA 1P45A 1SB8A 4MVJG 3WFIA 4PCVA 2GRAA 3TWOA 3QW2A 1ZIDA 1PZFA 3OICA 2GLXA 1CETA 1SB9A 1CWUA 1ZNQO 3ONEA 1MUUA 4PG8A 4JROA 1GDHA 3NKLA 5KNLA 5TT1A 2CSUA 4E6PA 1ONNA 3B20A 3PYXA 5JMPA 3CPSA 4MKZA 3ZWXA 4DLBA 2QRJA 2CF6A 5AXDA 3ONDA 1GPJA 4YYZA 3ULKA 4MVJF 4FFOA 9LDBA 4TWRA 3LQFA 3V8BA 3FWZA 1A4IA 4IMRA 2CVZA 2WYUA 3CMMA 3WGZA 2UUOA 3WX0A 2W90A 2UUPA 3LK7A 2Q1TA 3GR6A 1BG6A 1NVMB 1QYVA 1YO6A 1QYXA 2Y1DA 3MWEB 1BXZA 4IDBA 1DJQA 4XRRA 4CM4A 2AQHA 4LCEA 1ISHA 3AJRA 1P74A 4L0QA 2DBZA 4B7UA 4Y98A 3G79A 4PLFA 3H3FA 2F00A 5F1PA 4AICA 4MP8A 3W1VA 1ZMTA 1U5CA 3RC9A 3N7UA 4CLRA 1E3WA 4KDFA 4CMAA 4BB5A 3WGIA 2FR8A 1V3TA 4MVJH 1BDBA 4O1MA 2PTGA 1E6EA 4YAJA 1RYEA 4IQ0A 1SO8A 4IIUA 3ZHXA 1JN0A 4OL9A 1ZEJA 4FBGA 4MINA 4Z3KA 4CUJA 4WLNA 3VTFA 1B0AA 2P4HX 2I67A 3WGQA 3RC7A 3JD2A 3UN1A 3E9QA 3OF2A 1V8BA 1J0XO 1U3VA 3M6IA 5COBA 4L9RA 1T2AA 1SBYA 4MVJI 1Q0HA 2AQ8A 1D4FA 4TRRA 2I3GA 1G6KA 1GCOA 5L45A 5DCWA 2OMEA 2F1KA 3IL2A 8LDHA 4NIMA 3E5RA 1VE9A 1PS9A 3H2ZA 2O2SA 2C0CA 4OHUA 2AXQA 2J8ZA 3T4XA 4OSPA 3ZHYA 5K9ZA 1K89A 4CM1A 2P68A 4O0LA 4GAEA 4K28A 2IRWA 1E7QA 1Z73A 2D2IA 3U4CA 4D42A 2QZZA 1KIFA 3EGOA 2DLDA 2AEMA 4NG5A 2VRCD 3TZCA 3FPCA 1JVSA 1E92A 1I24A 3OJFA 4IY1A 1QLHA 3CH6A 1PIWA 4CLEA 2CY0A 1YDEA 2P5YA 1HZJA 3I4CA 3RUIA 4CV3A 5CEJA 2DM6A 2XOXA 3NJ4A 1JWBB 3RUAA 1Y6JA 1VJTA 4D0SA 2HO5A 3IQDB 3LT1A 2VOJA 4RJTA 3VVBA 2ZKLA 4BNMA 3PJDA 1E5QA 4MDHA 1NNUA 4WGGA 1GFSA 4XDYA 4F45A 3GZNA 2JAPA 3ZW8A 1HF3A 1NQTA 3BTSA 5F1KA 5L3ZA 1A7KA 4GVLA 4CM9D 3ADOA 5JAQA 3AU8A 1G0NA 2Q4BA 4HADA 4KDEA 4D3SA 4L73A 2Q2VA 1BMDA 1F8FA 2EXXA 4NBWA 4ZD6A 4ZHSA 1NVGA 4AJNA 5AQ1A 3S2GA 1BW9B 3H4VA 3H9GA 3OQBA 5JCXA 1U9JA 1BTOA 3WGYA 4M87A 2NVWA 1T1RA 2OL4A 4UVDA 4BKQA 2X1HA 1BRMA 5JAZA 2Y67A 2YZ7A 3OBBA 1MFZA 2I5PO 3RASA 5G0WA 4XYBA 2I76A 3QWIA 1FDVA 1HYGA 3DTTA 1EVZA 3GVHA 4JBIA 4RPKA 1P1IA 2OORA 3O8QA 4ESOA 4HV4A 5KWEA 2X0RA 1TT5B 4XRGA 2FOIA 1B8PA 2H6EA 3G49A 2CD9A 1RYDA 4KZPA 4PLZA 1HEUA 2HMUA 2GASA 1XA0A 2EEZA 1DC4A 3UGKA 1DIGA 3LC2O 4KQWA 1WDKA 3C7AA 2VN8A 4NK5A 2QIOA 4C7KA 4AJEA 1I5RA 3HDQA 3AY3A 4XQGA 3PXXA 5BNFA 3DHNA 4OO3A 3ETGA 5H83A 4D3DA 2ZQYA 1GTMA 4XX0A 4A0SA 1R12A 4OXNA 1ZUD1 2YHUA 3EY4A 5LCXA 2C7VA 4GX5A 1ID1A 2X86A 3EK2A 4R3NA 3LLVA 2PA3A 1A4UA 1I0ZA 2BI8A 1ADFA 4PG5A 1E3LA 5COAA 2Y0DA 3MCVA 1DLJA 3DR3A 4RQTA 4MP6A 1XQ1A 4M89A 2X0IA 5FI3A 4NR0A 5TGDA 3UH1A 3I23A 3WGGA 3ZWVA 1LA2A 5F5LA 1WMAA 1DIHA 1YVEI 4G2NA 3PDUA 3PGXA 1WW8A 3E5MA 4EBFA 1ZFNA 1XQ6A 1UDCA 4B7CA 1SMKA 4UVHA 3BYZA 1YQXA 3WYEA 3GG2A 3Q1LA 5KIAA 5F21A 2YQ4A 4JXKA 4D46A 4CMIA 2PV7A 1ZO8A 4FD3A 1VL6A 3RQSA 3U09A 2PGLA 1EVJA 3N74A 1ENZA 2YV2A 5TT0A 3A28A 3GNSA 5L7TA 4OQZA 1T4DA 2O7QA 1AUPA 4FFRA 1UZNA 4DQXA 3RIHA 5A3VA 5KJCA 3GEGA 1PGNA 4KP7A 4IMPA 2OZPA 3DOJA 1F0YA 1N9GA 4XB2A 2C59A 5I9LA 2ZB3A 3PEFA 1FXSA 1AXEA 2NLOA 3GEMA 3GNTA 2GSDA 1JAYA 1QR6A 1R4NB 4DBVO 3FNGA 1N7HA 3PJFA 1PJCA 5DDIP 3M1LA 4D43A 3QWAA 2JFFA 4E2YA 2O2YA 4G65A 2EWMA 5JDCC 3AM5A 3HUDA 1ADCA 1WXDA 5KJEA 4BKPA 1IPEA 1OI7A 5JNLA 3AW9A 2V6GA 5A04A 1HXHA 4RLHA 4BO8A 4ZU3A 1NPDA 4CM8A 4GPD1 4WK6A 3KBOA 3HDHA 2NU9A 4N5MA 1E3JA 3V2UA 2A4KA 2QYTA 2QHXA 3JYLA 2Z95A 5IN4A 3E18A 4GVXA 5IXSA 3DFZA 4RVFA 3RI3A 4PVCA 5DZSA 5IZCA 1H93A 5EQDA 1OBFO 3ENNA 4I5DA 4EGFA 2PWZA 3JQ9C 4AVYA 1EDZA 1NXQA 2RHRA 2DVMA 4FW8A 5DOZA 1P1JA 1KOLA 3JQ7B 2CMDA 1IULA 2B83A 2EJVA 1UAYA 5TS3A 5CHEA 4OXYA 1JDJA 3TFQA 3VAZA 4BL5A 5HTOA 3NDJA 1EK5A 4CM9A 5L9AA 3O8QB 4AJ4A 1V3VA 1Y8QB 2YFQA 5C7LO 2O3SA 2JL1A 4IJKA 3GPIA 1VL0A 4R4JA 4HY3A 4BGVA 4E5PA 4XIYA 1PS0A 1SAYA 4RF4A 3JYQA 1NVTA 3DAGA 3DEYX 4WPGA 1QXSA 3DBVO 4WCFB 1ZKMA 2CVOA 1IPFA 1A7AA 4NPCA 1D8AA 1JWAB 2VQ3A 3AUSA 4GI2A 4IDAA 1Q0QA 2DBVO 1YB5A 1P1KA 4FFNA 1U3WA 2PNFA 2VTEA 4IGFA 3EHEA 2VT2A 4BGIA 3C1AA 2EKQA 1E3WB 2W98A 3CZMA 3GGOA 4PZCA 4RO0A 4M54A 4BNXA 1Y8RA 3WMXA 1T2EA 3S2IA 1R4MB 4IXWA 3SVTA 1KC3A 1Z6ZA 4BNVA 4XZ3A 4BO0A 2VWHA 2OP0A 5K6AA 2H63A 1Q7CA 3FPLA 2GUGA 1P1FA 1GQQA 4XYEA 2AHRA 1NHGA 3BHIA 4RVGA 4J4HA 3CZRA 5K0ZA 5HS4A 4CQMA 1I2ZA 2O7SA 4J0EA 4MIEA 3L0DA 3U3XA 1QSGA 2HMWA 3QJ5A 5KVCA 1VM6A 4J7CA 4CM6A 4ZQEA 4KQXA 4CL3A 1GR0A 1KEWA 5BSGA 3JQFC 5KTKA 1DLIA 5B12A 8ADHA 1R37A 3FI9A 3NV9A 5L53A 5DBGA 4JIGA 4Q3NA 4XYMA 5ICSA 1XR3A 3D4NA 3FR7A 1KETA 2WTBA 4HBGA 1E3IA 4R3WA 2EGHA 3ZZNA 1WP4A 1XGKA 3JQ6A 5IG2A 1PU2A 1VRWA 5IJZA 5KKCA 4DBZA 5L4SA 3ICCA 1LEHA 1NR1A 1UXIA 5TF4A 3FD8A 2YJZA 4CMGA 3RWBA 1EDOA 1W8DA 3DHYA 3LU1A 1AHHA 3R3SA 2X5OA 4PLWA 1ADGA 3L77A 1RJWA 1WDLA 3D4OA 3FTPA 3OECA 3H65A 3JV7A 4OKNA 1HE3A 3NX4A 3CEAA 4Y67A 3ZWWA 4KTTE 4LGVA 1PL8A 3IOYA 3ZV3A 4BQRA 4XR4A 3DDNA 1YJQA 4OAQA 5ILOA 4ZICA 2JHGA 1XU7A 4B3IA 9LDTA 4WUVA 3STHA 4QSMA 3M1AA 1EK6A 1CERA 4ND3A 4W82A 1ISIA 2H1SA 4CM5A 1EE9A 5I8ZA 3OJOA
chains in the Genus database with same CATH superfamily
4RK7A 5K51A 5GV8A 2KWIA 4C5CA 4EEZA 3EAGA 3FTDA 1Y9ZA 1RXVA 5A4DA 3CLRD 3ISVA 2R5FA 5LDGA 3RRFA 5ILQA 5IKXA 4RK1A 4II3A 2OBYA 5JTTA 4WT7A 4TYNA 5G0SA 3ADPA 3IB3A 1EHIA 1CUJA 4CGZA 3TDNA 3JR3A 1Y5MA 1XZCA 4MVWA 1XDDA 3Q2IA 4KZKA 2AUMA 2OUKA 2CXUA 2YYSA 3LQ1A 5JC8A 4WKCA 1M1XB 2WF6A 2YX1A 2ZU0C 4MLDA 4R1TA 4EAQA 1RJ9A 3FZYA 1RAHA 4LYGA 2PMKA 3C48A 2P90A 4F5EA 5F77A 3TEMA 3JRWA 1CNMA 1U28A 3OHSX 4GX2A 1VG0B 4XCQA 2ZBFA 5MDHA 4P9NA 1U0GA 2ZSUA 3AG6A 4DR6B 3I1YA 1IXKA 2G9VA 5IVKA 1L4FA 1X2EA 3O3MB 1EEHA 2KE5A 2YFYA 5FLXA 1J24A 1L5WA 5B3AA 1TVKA 1H5UA 4YWHA 3K8OE 1J70A 3K1TA 3CLSC 3GLIA 3N8GA 3SQMA 3KZCA 4HYQA 4K6OA 3UHAA 5TIIA 3H1PA 4FU0A 8MHTA 1M83A 3EA5A 4G5XA 4YV1A 4U39A 5AOBA 2IUYA 1KJNA 2XKBA 2R1TA 4GE3A 4KUHA 1XTBA 1GV0A 1W85B 5C51B 1J2UA 4NBNA 3WMGA 1L7PA 3PWTA 1R0BA 3JXEA 3T4UA 3VC1A 5ILGA 5AK3A 3DC2A 2F2TA 3KJGA 1ULTA 3M4JA 2R00A 1P33A 4HLDA 4IRUB 3P7MA 4RKFA 2M6KA 2K87A 4BZWA 4IDDA 2WTUA 4JXJA 3M70A 1PFYA 4RZIA 4Q34A 3GLTA 3RAGA 3T7RA 4BCDA 4O4LB 2QV7A 2NN3C 2YIMA 4MZXA 2IH4A 4BNYA 2XI4A 3GUYA 4P1ZA 3BF7A 4ARUA 1GKIA 1J0CA 3W1EA 4KWTA 2IYUA 4J0IA 1XA3A 1CTQA 4XYLA 2A5JA 4R6WA 1YKSA 2WIBA 4PZEA 4ZODA 3M3PA 4O4JB 1NBEA 4ITUA 4P3PA 3R0IA 5AVRA 4KGVA 5J5VA 4M8KA 2HWWA 4NBTA 5ALTA 5I9BA 5JC1A 2C7QA 1VI6A 3EC7A 5KOJB 1TL7C 2KB0A 3BD9A 1PVOA 3PHHA 1G18A 1KRHA 1BDJA 1EQUA 4ALNA 3BWMA 2FPPA 3C85A 3E7DA 3I9V6 4EPYA 4D92A 2UAGA 4ZV9A 4DBLE 1L0BA 1TFRA 4JUDX 2ZYDA 2AWOA 4CLOB 4M1OA 1DRVA 1WXGA 1ZNYA 2E5FA 3AFIA 1A04A 3HI6A 4MWBA 4TLCA 3RVPA 5GM2A 1N9KA 1U04A 4AYTA 4R98A 4E5SA 2WYHA 1I01A 1SIOA 4G1EB 4JJ4A 5LOVB 5BV7A 1SOUA 4WOKA 2B4TO 3PC8C 3W8NA 3D5QA 4OEHA 3FRIA 4XWGA 3GFRA 4JOCA 3A32A 4UEOA 2V7TA 1ZM9A 3HWSA 2QX9A 4NECA 4RE6A 1IAQA 1L5HA 1JBQA 3GP8A 4ZHQA 4YS6A 5K3AA 4NH0A 5B6IA 3VZDA 3OAAA 2ZJ2A 2GEDA 4J1SA 5GIPE 3UCFA 3AFOA 2XDWA 1CUZA 2NTNA 4A5SA 3V46A 2QAIA 4AJ9A 3ZDQA 1P81A 3WQQA 3IEKA 1Q74A 2P6UA 2ZFUA 3EIQA 4P83A 4BNWA 4S0ZA 4MPJA 4DVGA 4ZJZA 2G76A 1Q17A 4N0MA 5B1IA 1IIRA 4DJAA 121PA 3PHGA 1CRQA 1TADA 1I7NA 1TLFA 1S2MA 1Y33E 1RTTA 1U80A 3OA2A 4QU9A 1IQ0A 4DB2A 4KLCA 2INGX 3IHLA 1TLTA 1NVKA 2ORWA 4M0LA 5AHXA 4R51A 2WWFA 1NX6A 5AD1A 3AVVA 1KXZA 1JAZA 3H2IA 1HG0A 4JQZA 4BOYA 1EGAA 2OCGA 3QKTA 1XKQA 2O7VA 1RJFA 2P4EA 3WVNA 3CLHA 2WQ6A 2C7GA 3GJSA 3GUHA 2WUWE 3W2HA 1K7SN 3GEEA 1LI5A 3IAFA 1L5HB 1XU4A 4UUAA 3FDFA 2C07A 4OHRA 3W2EA 4F8JA 1N6OA 3VYWA 1RWMA 4A15A 3LX5A 3DZFA 3FB4A 4E30A 3S1SA 1QQ6A 1MOPA 1ST2A 3OKPA 4IILA 5B58C 2XIJA 1D5CA 1ZONA 3K9CA 5BW5A 1AHIA 3OFJA 1WV1A 1RYHA 2OD7A 2R7LA 1OVMA 2X4IA 1R27A 2HN9A 2YUIA 3QX9A 4N9QA 3RS8A 4CR7A 4DL9A 4WASA 2YWCA 3GA0A 4QFDA 1O6CA 1C14A 2ICAA 4ZO4A 5GONF 5LUBA 1TYBE 3BH0A 5FLYA 1XKLA 3GUVA 4RM2A 4Y6LA 4DSZA 3SMVA 4TSFA 4Y7DA 1EKXA 3CT4A 3UGJA 2RI6A 2CBXA 2YCLA 2C88A 2YV3A 1NJ2A 1UC9A 4LXIA 5LQSA 5CAEA 2XMQA 1OH5A 3GRRA 2AMFA 3GZNB 4TYMA 2DWPA 3W6ZA 4ZFNA 4DR2B 4EG8A 4FW9A 1Y6RA 2H48A 3G1UA 5L40A 4YK7A 3FX2A 1N36B 3WICA 2GTHA 1U3TA 5BNTA 3HEAA 2P6MA 2B35A 2GRJA 1ZH0A 2BMDA 3ITNA 1SC3A 4G6ZA 4UNSA 2PGAA 5F4BA 4P5PA 3SC3A 3E4CA 3IDAA 5A9TA 3RRMA 5KVVA 1L5VA 1VPLA 3GV0A 5JRJA 1UC5B 4DR3B 4C4RA 2P0AA 4JBWA 4UBNA 1O95C 1P44A 2XIQA 4YCNA 1CP3A 2PE5A 1KH2A 2Q5JA 2QVLA 5KWIA 5CMLA 2ZJZA 4G37A 3HKCA 2ZUEA 1DQSA 3ESDA 1PZXA 2AVNA 3UV3A 1II8A 4LDNA 5F33A 3HTXA 2FX5A 3RVQA 4WSOA 2ZTHA 1C7JA 1VCIA 3BA1A 4RABA 5A1TA 1YOVB 4BN0A 3NYQA 3HY3A 1FXWA 5NLLA 2F1JA 4G0ZA 4CFZA 4RTLA 1UC4B 1MO6A 1QDUA 3ZH2A 2GM5A 1XROA 3RJ9A 1XTQA 3U49A 4EI7A 4KFSA 3JAKB 5ERGB 2ODAA 2Q9UA 1M8GA 3VH3A 2BRUA 5CLQA 2O8CA 2JGMA 3QM1A 4FFSA 1UBTS 1IY2A 2FMUA 3COVA 1V4NA 1MC8A 1JPJA 2JI6A 4QUKA 2G1KA 1C3JA 3TLMA 3ESQA 5BN4A 5J4LA 2GERA 1L8AA 2OB1A 3P0RA 1XD9A 4KFTA 4L15A 5E38A 3Q9NA 5TQVA 3W6PA 4CMCA 4GP7A 2NNLD 3AI3A 4D4LA 3JYPA 2P2NA 5DRTA 1MJFA 5IM5A 1OYYA 1P7CA 2LDXA 1FRQA 3JVVA 2PN1A 2EP7A 4FOOA 4IPTA 2JDIA 4J1TA 1NAIA 2IOHA 3CWZA 4N03A 1T1EA 3X44A 1ESEA 5LA6A 3SBXA 2AJCA 1ZWKA 4PC2A 1SKUA 3U48A 1UMBB 2VAWA 3GFTA 3DFUA 1N8KA 2OG2A 2QTWB 3BD6A 3OE5A 5I9MA 2QSUA 1KVQA 4RA6A 1KYZA 2FR8C 4LK3A 5I7RA 4LGMA 3DBRA 3FXAA 2GRUA 2DSTA 2JVIA 1V9SA 4BNIA 1DUVG 4C29A 3NT2A 2Z58A 3RAPR 3B70A 1NUAA 4X0EA 1JYEA 2UYHA 5L3RA 4MVJA 2IP2A 2MMGA 4PYQA 4RVOA 3NBXX 1ECFA 1YC5A 2P8JA 3DYIA 3FGPA 3NYRA 4XJTA 4B3GA 1NVFA 2WTXA 1ECPA 3JARB 4DC0A 3D5EA 3HU3A 1QG6A 2JFOA 4LXHA 4ZRMA 5T64A 4WY5A 3SZGA 3TSWA 4MS3A 1T1JA 3DLBA 3H04A 5TS2A 2IXTA 4ZO9A 5AM5A 5AI5A 1I2CA 1E1CA 3GQBB 3EX7C 4DGSA 2Q7OE 4KLAA 4OUDA 3VA7A 1G7CA 1I4OA 2CYBA 1ZD5A 1VXRA 3KAQA 1L7MA 3D2LA 3K94A 3GBVA 3LO8A 1G5HA 3I72A 1YIAA 1U6JA 4KE6A 1PT5A 1WXEA 2XRFA 2WTMA 3AVPA 3RU7A 2ZTVA 3DBHA 1HYQA 3E82A 3GYGA 2YJNA 4IS3A 1DINA 5IYZF 2IC5A 3FMOB 5HIJA 4N7JA 4EUHA 4GOOD 3D9QX 2HCFA 2H2AA 4M0EA 4S35A 4E5KA 2F55A 5F98A 2BUBA 2ADOA 4GWKA 3EC1A 3GIDA 2QTVA 1HDYA 2I6GA 4WDRA 2GHRA 4O2LA 3S55A 2HRRA 2PIDA 5I7OA 2Q7XA 3BRWA 3EEFA 4C7OB 3MBOA 5BR4A 4Z9YA 2HSZA 5HGXA 4WKGA 4Q18A 3DFKA 5CH3A 3FWKA 2RK6A 4GDMA 3I04M 5EMNA 2XCTB 3NHSA 5FBRB 2N1BA 5FPQA 4HNSA 4UNPA 1IC6A 3WBKA 1J21A 2WD8A 4BLUA 1QWOA 2EU8A 5BNIA 3V32A 2ZTMA 3X3HA 2I6TA 2H7CA 1WM1A 4WZAE 3EE6A 4PE5B 4MRAA 2EC5A 1NAHA 2I8AA 3QWBA 4PLTA 3IPYA 3QHQA 3E05A 5CNMA 4ZQFA 3UAWA 2HT6A 2WA2A 2Y92A 3SCZA 1DOZA 3IKVA 3GP5A 1E63A 1ZI9A 3B1ZA 1PJTA 3IP3A 4PQGA 1N3BA 4B8ZA 5JBQA 4HGPA 1SQ5A 1EP3B 1K66A 4ND1A 2Q28A 4U6QA 4BO2A 3ZU4A 4AK9A 1YQTA 2J6CA 2AKAB 1YONA 2HYIC 1E99A 5DBFA 3L0PA 2QUAA 4CHTA 1XT6A 8GPBA 2JAXA 2B92A 4OHXA 3B1FA 3OEYA 2GF2A 1WE2A 1KDTA 2FPGA 5IMBA 3NOQA 5HDQA 4B5LA 4FFPA 3IXLA 4JP5A 5HSGA 2H59A 2YIJA 3FNBA 4FGLA 1NBME 4IJ6A 3PVZA 4BLQA 4TLDA 5BV1A 1HEIA 1MV8A 4PX3A 4TSFD 3G2HA 3VPXA 3I2YX 3L1HA 1K86A 3CNHA 3EEIA 2B5WA 2I3ZA 1R6DA 1ECJA 5A7HA 2YBEA 1EI9A 3LBAA 3DB2A 3IQEA 4NFHA 4H7PA 1MHPA 1C8VB 3FTNA 3PSHA 3LYAA 2FW0A 3BTOA 5ENVA 2ZI7A 4JIMA 5ICFA 1NVVQ 4WLEA 1W19A 4BX2A 4MX8A 1PX0A 2Z08A 3WLJA 4E7OA 2QENA 1I3CA 1J2JA 4O1IA 3DZGA 5KYUA 2WZBA 2YOHA 3DMGA 3E6AA 2I87A 3NKVA 3DZJA 3UJBA 1S2IA 4QUJA 1W4BA 4WLOA 4G8BA 3CX6A 4CV0A 2IZ1A 3VJKA 2QE7D 1V5IA 2YC2C 3LZ6A 4KX3A 3BQNB 1ZD8A 3ELUA 1QHYA 1WUKS 1HKUA 3LLUA 4MQFA 5AJYA 4F9TA 3UG7A 3SU8A 3WLFA 3GMIA 5CB4F 4AIRA 4DIMA 4ZEWA 2AC2A 4A3SA 4ZT7A 2B3DA 2XCSB 1QCCA 1MB3A 1R6UA 1DUIA 3CZ9A 1O6GA 3QKWA 3FKSA 3QU4A 4HNHA 4JVNA 4HYTA 4TWBA 1LLDA 2ZYVX 1DRJA 3DOIA 5EUQB 4KN6A 2QTZA 4XEHA 4IOLA 4ABTA 3HXLA 3UCXA 2A94A 3L8ZA 1HPLA 1CQXA 5IVDA 3IOEA 1ECCA 4J3FA 3D7MA 1Z74A 2CK3A 3EYWA 3B1WA 4PTYA 2BFEB 3W5IA 5HCNA 3WNVA 1EWYA 1TJNA 4K7JA 1YA4A 4ZZ3A 1CUAA 3DYVA 3HG7A 3KSUA 3NIFB 4Q4AA 3F7NA 3SAJA 5IVHA 5G3YA 4INAA 4KK4A 3Q11A 4Q05A 2J5KA 3TRDA 2DH6A 3D81A 3BXPA 3ROTA 2HEGA 3CVWA 1GVNB 4LCBA 3WYAA 2QJTA 5E3IA 4L5IA 3WZ2A 1O5TA 2QYOA 4J7XA 3NC0C 1UEIA 5JDIA 1A71A 2GZRA 3G7UA 5KMGA 3HLYA 1YULA 1TM2A 3GJRA 1PLLA 2RIRA 3DE2X 3E27A 3EUAA 3SHWA 3HXQA 4RVHA 1IHYA 4TZTA 4KXXA 3OUTA 2HF2A 3ZS8A 5I7VA 2FZ5A 1RZUA 3HXPA 2A0WA 3AF4A 3DULA 4OTZA 2I6QA 1Z5ZA 1A27A 3INRA 5C8YB 3NANA 3PFBA 4P7GA 2J41A 2PD6A 1Z4MA 4QARA 3AFHA 4U8GA 3UWOA 1YNSA 4MUGA 4KAXA 1QGAA 2HNAA 4Z3OA 4R54A 4S12A 1EVQA 3KPWA 2EFGA 2J3QA 3E2IA 4WBXC 4GKKB 1YR1A 3LP6A 5SYNA 4LEIA 4YJ3A 1NKTA 1PZEA 2LCFA 3SEQA 4RDHA 2NGRA 4ROTA 4QYMA 4EG4A 3U0BA 1D0IA 1X7GA 1DNPA 3MCAA 4JOBA 4Z4IA 3F90A 1G21E 1WXHA 3BB1A 4C6TB 1C29B 1UIMA 3GLGB 3KXKA 2IYNA 3TZLA 5C7YA 2XXAA 1B0UA 4LJ8A 1PR4A 4EB6B 4UULA 4I9FA 4A10A 1ZCJA 4PLYA 1PUIA 1YSCA 4PGFA 4IG9A 5EJ8A 2JD1A 3PT9A 3LDUA 4YRJA 2VF7A 1XZNA 3FCCA 2IY8A 2Q5QA 4YP9A 2O8BA 3GEDA 4ZYVA 1XELA 5FTWA 5GGXA 4D8TA 5IF3A 5CDFE 4XVRA 2JIDA 3A7EA 4NNOA 1Y80A 3ED1A 4B7AA 1Q11A 2WSLA 2BLLA 1OJLA 1UINA 4JJGA 1G5IA 1X0VA 1Y9AA 3MWGA 2JBAB 1Y89A 1TZJA 5E2BA 1SIWA 4ARIA 4MOWA 3LT2A 1EINA 1ULBA 2X14A 2DJ5A 1SRRA 2XDQB 2E85A 3QBEA 4JGBA 1E9AA 4ZAGA 2ZBVA 2DUMA 2C9MA 3SZRA 3PS9A 1ZW6A 1C7FA 3TTSA 3VU3A 5E6RA 1GPNA 1W52X 3ZJVA 3LY8A 5SY4A 3IPRA 1F51E 3WWCA 2CXNA 4AX4A 5HKAA 1U2GC 1Z36A 1NN0A 1KS2A 1CS0A 2YXNA 3QSGA 4GGPA 4OQEA 3LDFA 4QYTA 1RM3A 3ZY5A 1R0KA 1QV6A 2Q1YA 1XVTA 4X7BA 2IT1A 4XQCA 2IHBA 3NASA 2VTBB 4LXYA 3M9XA 2RGRA 4OFXA 4ERNA 5BN3A 3OJXA 2COKA 2H1HA 4H6XA 4R1MA 4LHVA 1TNDA 2E1RA 2AV6A 2GHQA 2RGEA 4G5SA 1N6IA 4Q37A 2PU5A 4RPHA 2NTEA 4L0MA 3OQIA 7YASA 1XHEA 1P0FA 4J3JA 4HVLA 3QVGA 3GJZA 4B4WA 5B7PA 4F4FA 1YQUA 1OWOA 5CVVA 3GXOA 3WQRA 4DV3B 1R3UA 4MSUA 4KNWA 1C9MA 2C7BA 5EJMA 1YS2X 3ETDA 4DMHA 1N0VC 2GAJA 1E4EB 4RWEA 3SG0A 3AR3A 2AE2A 4LE0A 5AVXA 4IIJF 4F84A 3SLKA 4B3CA 3HO6A 4UU0A 3QJGA 4GBMA 4KPGA 4XPIA 3VPCA 4OHFA 1X1CA 2VSXA 4QTZA 3A4NA 4GT1A 4AT1A 3B9RA 4RL6A 4FYMA 2O0MA 4PR3A 2B7LA 4NARA 1USWA 3IBFA 3D3WB 3I73A 3D6NB 3P97A 3SYNA 2HEIA 1EYZA 1GUZA 1K4YA 1PT6A 2YZNA 5EMLA 1DQRA 3RGGA 4JI8B 4KYVA 1W5BA 2OXTA 3ZHBA 1TC1A 2VSQA 4LZZA 3TUZC 1KEKA 3S7TA 2C97A 1GL6A 1SQGA 3TX6A 4N8SA 1RLTA 2MMCA 4IEEA 5T6MA 1I9CA 4U7DA 2F3UA 4I55B 1GKLA 3PE3A 1OIVA 1FUEA 2JCYA 1PJ8A 5MGBA 5JCJD 5KYYA 1ZZEA 1M1ZA 1R9GA 3FZEA 3OPVA 4FZRA 1HL7A 1G8YA 1XCGB 4IV0A 4MNTA 3M3HA 1CZHA 3S70A 3E61A 3S8YA 4FHZA 2W48A 3NS7A 1CX9B 5KTSA 1M75A 2VTBA 1TKCA 2XE6A 2DCUA 1H9AA 3GO4A 3CUSA 1XVLA 1ZN8A 4MWGA 3SYRA 1D2MA 4TSKA 1ACJA 4RD6A 4R81A 1RFGE 4GR5A 1OLSB 3WS7A 3GLHB 4BNZA 5FBQB 3NVAA 1SG6A 3W04A 2IYEA 3KHSA 4RX1A 1QFZA 4HXFB 2AB0A 4YMIA 2PZJA 3RFFA 4TQUS 3UHFA 4C01A 1YL7A 4C4YA 4LF7B 4YRSA 5IPFA 2PO7A 1U9YA 3QVGB 3B60A 5DP2A 4P86A 4AKEA 1Y4SA 4RV5A 3P9KA 1WL8A 1WPXA 1PUXA 2WKRA 3HSKA 2X4GA 5DASA 1WO8A 5BYKA 5AOVA 2BL4A 1OI2A 1ZCFA 2J9YB 2Q9CA 2X0JA 4OQPA 4UCFA 5E8RA 5GGYA 2NQTA 2X6RA 3F3KA 1GTVA 2WYWA 4U5QA 2RHLA 1ZR2A 5FQNA 4LXUA 3A6FA 4PIPA 2WUDA 3RFUA 3ZQJA 1O3YA 2W6PA 5B4TA 1W7AA 5FAXA 2WD9A 2V0CA 3FCSB 5BV0A 3KB2A 2RGAA 2CLHB 2L2QA 3QE3A 2V74B 3EASA 4URVR 2YHIB 5KJ1A 3E81A 1L4YA 4EI2A 2I8LA 5KTRA 4EYQA 3PLAE 2AKYA 2LIPA 3IILA 4ESEA 3S8MA 5EJ2A 4BVEA 5IDXA 1L7DA 4J8PA 1JTFA 1XUOA 2J6HA 5DHAA 1CEEA 1U3FA 3M6UA 4NQRA 4YI5A 1UZLA 4MRVA 4MW7A 2VF5X 1LVHA 3EZ2A 1ZK3A 3MG9A 3AC0A 1EFLA 2XQVA 5JLJA 1CFJA 4B3BA 1LI7A 1OIWA 2AR7A 2Q8NA 4LMPA 4QUEA 3AVQA 4JT8A 4OHWA 1YXMA 1DAKA 2P0YA 4UTRA 1S4MA 1APBA 4DVJA 2ZUCA 4JHXA 5J2TB 1AJEA 1P91A 1XDGA 2BR5A 2HPAA 3CKLA 3ICVA 3MB5A 3EGDA 1GPAA 3ZR4B 2JAHA 2CFOA 3D6FA 1UQRA 4JT4A 4XFDA 2EFDB 2CL7X 4NBVA 5H1YA 4OI1A 3SJBA 3OLWA 1R5JA 2C9CA 1L7AA 3C1UA 3OMWA 3PC7A 2CFCA 1ZRNA 4G36A 3U7RA 3VU9A 1SVMA 3UBMA 10MHA 1F1BA 1T8TA 1WMSA 4K26A 4EKGA 5BUSA 3A06A 4TWIA 1EWVA 4V0OA 2HBQA 3HKEB 3RUDA 1K6MA 1OFUX 1DKOA 1Y81A 4D9JA 3NLLA 3RTEA 1KC1A 1T3LA 3H9CA 3USES 1UP4A 1E1DA 3KEOA 1HFJA 4A91A 2X1LA 2CNDA 2FEOA 2WHQA 3ENWA 1U7ZA 2IPLA 2QAJA 5FLKA 3MCZA 2D1FA 5CA1B 3BWYA 5KAPA 4HSGA 2CDBA 3ER6A 2WK1A 3KETA 2VH1A 5IC6A 5B1SA 5C3UA 1EGHA 3G0BA 2OVBA 1G20E 3B9QA 3BQMB 3C39A 1NVXQ 3H2HA 4WNAA 3ZGXA 3O1IC 1USKA 2QAGC 2O2GA 4XQ9A 3Q7SA 5F1OA 1RAEA 4BKOA 3PJGA 3AGQA 4OI2A 5KVQA 2QWXA 1L1EA 4NDZA 3FPGA 3MK31 1ZH2A 4GMFA 1UM9B 2Q5HA 1J1UA 3THXB 1FB5A 2BFWA 4DA6A 5DSTA 2BFCA 3LVQE 3B13B 3SR0A 2REQA 3OH8A 4LXTA 1MXFA 2XRMA 3MAAC 4IBOA 4JLVA 3SC2A 2ODEA 4C08A 1INLA 1W2HA 2E4VA 2QRKA 1ZN7A 3A26A 1MLDA 2HV8A 2QMEA 1E2NA 1IDN1 3L05A 3U81A 3ZZMA 3J81k 1JSZA 5TGZA 1RPAA 3HGMA 1M34A 3FFTA 1QONA 5AKEA 3AT1A 1VI2A 3ZGLA 2P2ZA 1BGXT 2G04A 1HO3A 2PX8A 1J9ZA 3FZNA 3HVJA 5ALXA 2PD3A 5T57A 5LP6B 3KXIA 4NDNE 1Q21A 2IE0A 3K70B 1VXOA 2HHCA 1QIFA 3AEZA 4OG2A 4BAGA 2A92A 4ZZ1A 4H77A 4NTZA 4D0NA 5ESWA 3KFLA 4PFSA 1FZTA 2V7PA 2YXBA 2ZANA 1I0IA 2WV9A 2PY6A 3C1OA 3FSGA 3K9QO 3EVCA 3ONNA 4H6WA 2XQKA 2JLQA 3IEXA 3IUNA 3NYWA 3DDSA 4UNNA 4CLRB 4NKRA 5IFLA 4JT9A 1EIWA 5FX2A 4A36A 2VLBA 3MWJA 2HA6A 4H4CA 2YINC 4O4HA 5EGNA 3VOTA 2XHZA 1B6SA 1E8MA 3KYCB 4OQFA 2O2IA 3GCXA 3IIEA 2X58A 4IHJF 2FSVA 4JSTA 4Y2HA 2B4QA 1VIDA 3NHPA 2PKRA 1YL6A 2IBMA 4V0SA 1AKMA 1E2HA 1VSUA 3KALA 3FBTA 4YRRA 5K2OA 2GTIA 4LQ4A 1Q16A 5LUAA 3G1WA 3ZVKA 3I9MA 1JILA 3L6CA 4RD2A 1VSVA 3W4JA 1I4DD 2FPMA 3CUUA 3GAFA 2DPGA 3L6DA 3S1AB 4K9NA 4X64B 3QE4A 3FMVA 4DT1A 1OB5A 1L5GB 3S8EA 2XT6A 1HM5A 2RARA 5T6BA 3S29A 3WLSA 4CU5A 2VA8A 4PGMA 4QVGA 5DGCA 4ZYTA 5JADA 4L4UA 4D7AA 3R7WB 4PCAA 2NNWB 1HV8A 2P9FA 4JJIA 4GXNA 2ZI4A 3ICEA 4C7JA 3FM9A 2DQYA 4IM7A 5AR1A 1Q15A 4C3VA 4MHTA 3W6NA 4ZVKA 3W4KA 2YOGA 4KRGA 5AI6A 4Y6PA 3UO8B 1U5AA 4RANA 4U7JA 3D1LA 1WUIS 1SXIA 3NDRA 1YE5A 4X54A 1DJMA 2J3MA 3F9IA 3A1VA 2W6MA 1AKEA 5DF1A 1T5IA 4M9UA 3UJAA 4E31A 4ESHA 5IHPA 1MC4A 3LCCA 1TCCA 3F2VA 1Y3BE 4IKEA 5A3QA 4L9AA 2VDWA 4J1QA 1T6YA 2ZVQX 5TMDA 1NATA 3SJ7A 3ZDEA 4CTOA 2PRYA 4PYKA 4FJ1A 4HNGA 3SSNA 2TMGA 4GSKA 2VC2B 2D5AA 3FMGA 4XWAA 4DA7A 3DLIA 5AJZA 5HUQA 1M3SA 3CNQS 3II6X 4OUDB 5DYIA 5F3DA 4R1UA 4F46A 1CCWA 2RHJA 3QA9A 5LQKA 1O08A 4YCCA 1WPQA 1XO1A 1IK4A 1M2OA 4LSGA 5AKKA 3V00A 4B4OA 4MV7A 3A37A 2V3WA 4RGVA 2X0FA 5JT1A 4NI5A 3EIHA 3X2FA 1GQ2A 3KKKA 2XUOA 3OZIA 4D98A 3QUSA 2FP4A 3GLFB 1RI5A 1ZD1A 2OV1A 2QZPA 2FLKA 3Q3GE 5DN6A 1NONA 1ULHA 4DR4B 4XI9A 3BMNB 1GG5A 5BW6B 3AYZB 3CZ4A 5HE8A 2BHNA 1SURA 3B3FA 3G3EA 4PC7A 5EQTA 4BQNA 1M33A 5JTUA 1DC8A 1VHLA 1KMMA 1OTYA 1I0LA 3OJEA 1TM4E 4U63A 3W8FA 2I80A 1N5KA 4QJBA 4WOBA 1NYTA 3WIDA 4AB1A 4LHSA 1HQCA 3ZHZA 4TMTA 4EYOA 1U9CA 2ZK7A 2UUAB 1JJ7A 1VPEA 4ZCPA 2FFQA 3V1KA 5ISMA 2H4ZA 3F6SA 4Q9DA 2UV8A 3HKBB 4YCMA 1P73A 5BSMA 1RMYA 2CEAA 1KTVA 2OK7A 2OYCA 3VKVA 1OE0A 5KCZA 3CFYA 4P36A 1HDZA 3GMTA 3AY6A 3K6RA 1OV4A 2EFCB 2HHAA 3QVXA 5AVYA 1KXJA 1NOIA 2JFXA 3HKDB 1IH8A 1RLOA 3KC2A 5E3JA 3HVRA 1Q3TA 3ESAA 4E3WA 4ILEA 5LFAA 4YCJA 5L3SB 1E6UA 3TFOA 1TC2A 1DHRA 1P6XA 5NULA 4YJKA 1VYVA 2AW5A 3U31A 5KNBH 1IM8A 3ONFA 2GN9A 1JSXA 3CZAA 3OESA 4RUKA 4I55A 4JBHA 3FOFC 3WK8A 3F8SA 3MTQA 1B26A 1C9EA 2P2GA 1NSTA 2PKWA 5A62A 3O0DA 2JVJA 3OSZA 3DHEA 1ORVA 1W8IA 3UAOA 2IA5A 1Y1LA 3V55A 1FFXB 2QTGA 3ZVMA 3QBVA 4CIXA 1JPNA 2QM3A 2BPOA 3PRJA 4D9MA 2BM8A 2DPLA 2BJVA 5CLHA 3W5VA 4ND8B 3IGFA 1Y7TA 4X6YA 4LNAA 4ONEA 1T6BY 3LXMA 3N5KA 3ZWAA 3SX4A 1MABB 1SHKA 3E03A 4IIBA 5FIUA 3QVWA 2JCXA 1OFGA 1JZQA 5AQEA 4N0PA 2QTNA 1IHOA 2QYSA 1VJDA 5D51S 3P9RA 1IG3A 1PQUA 2VUTA 4ZEMA 1UC8A 3GG9A 3WLEA 1GN9A 1WBDA 2RCYA 2RHOA 1LF0A 2JEZA 2VDUE 2GCOA 3IOCA 3OZFA 1T2DA 3U4HA 2VRWA 3MIZA 1XZ8A 4M1MA 1XU9A 1Y6ZA 3QTTA 1IZ0A 3W05A 2VNKA 1ZGGA 2GR9A 4NZ9A 5IBPA 1HEYA 1SHJA 4LYFA 2F90A 2AS0A 4NH4A 4KMOA 3L9XA 3ZZ1A 5BSWA 1E7YA 1DEOA 2NWQA 3Q6IA 4V0ME 1L4HA 2MCFA 4AF8A 4YJHA 3C7TA 1P0QA 1TRHA 3NBKA 4WN3A 5JYDA 1W6RA 4V2IA 4D4MA 2D5CA 2FKNA 3C43A 4HQKA 1DGQA 4EZIA 3IOBA 1OT3A 3O4FA 3IUYA 3KFVA 2DLCX 4PZZA 1L5KA 4CF6A 5EE3A 4D97A 4BLTA 5EYPA 1GL9B 4DILA 1PNQA 1B00A 1H2EA 2J3IA 2X9GA 4I3HA 2YZ2A 3HB4X 4TKVB 2FOXA 1G4UR 1KBQA 4CKCA 2RGDA 2NQ2C 1RCUA 3B6MA 1JF8A 3EFBA 3EVFA 4DN6A 3JRXA 4HCJA 4D9FA 1E3MA 3DBLB 2PUAA 4F3RA 2YS7A 1B2RA 3G68A 2FE1A 3B2NA 3CKMA 1OC4A 4JAVC 5IBCA 2AC7A 4EARA 3QY9A 4KVFA 4JJAA 5J1TB 1PN3A 3K5IA 1HMPA 1ORRA 3O8OB 2CJWA 1CUYA 1WZNA 1X86B 2EJCA 2VYVA 2ZBGA 3INNA 3IKTA 5EKSA 1R5OA 3EZGA 1GZDA 3RV4A 3O82A 5ADHA 2JCSA 4Z0PA 3U44A 2H1LA 2P2LA 3AHIA 4ODIA 2QTHA 3AP1A 3WLRA 3QOXA 2QI9C 4P8RA 4F96A 1BCSB 2IQ5A 3HBJA 5FOSA 2G5GX 4KPFC 4G0UA 4PGAA 4Y3UA 1H0KA 1T3HA 3F5DA 3NTLA 3V4RA 5GPBA 3RO7A 4HAZA 1XTIA 4K3VA 3TJRA 1C9JA 1O1YA 2HA3A 1NNSA 3E2MA 4UPDA 3PVSA 2ZCVA 2ADFA 4BJHB 2D3TA 4W8HA 3E0XA 1C3XA 1PZHA 3AMVA 3IBSA 3CISA 2PGJA 3Q7RA 4H1VA 4LN1A 5DWQA 4CKBA 2ODPA 1YI1A 3WDMA 1IWPB 2PWYA 1Q44A 1KZ7B 4HFMA 5AICA 1AZWA 1FEZA 1D1TA 4BMCA 1W2WB 2OT3B 1K8QA 1QTIA 3JWGA 4CTJA 4ZYLA 1O89A 3MIIA 5E0KB 3ZG6A 4NYMQ 3DXYA 4OUKX 3VJLA 3EARA 3KXDA 1RADA 1U4SA 3WMEA 1X87A 1G3RA 5KOIA 2P67A 1UPUA 1W34A 1ZI6A 1VG9B 1OH8A 1SHTX 1ZK4A 2JGDA 2PGXA 4J2OA 1PR3A 5C4GB 1PJ3A 3NBYC 3A4YA 2PX2A 1OZGA 2D74A 2VPZA 2XUDA 1DB3A 3O3CA 1IB0A 3ZD9A 4H6VA 1B6GA 3IEIA 3TBKA 2X0NA 4FYXA 4E33A 2Y99A 3OZDA 5HKKD 2VJYA 4JD5A 2BSXA 4MRSA 1UZMA 4NU5A 2JZCA 2P40A 1UPTA 5AOAA 4ZAXA 3D3NA 3RSHA 1F7VA 3LQ4A 2O07A 1Q3KA 3N0XA 4MAMA 4L3WA 5IF9A 1FZQA 2WF7A 4C05A 1AN9A 3KO8A 5JJLA 2XQFA 3PL5A 2C2ZA 3LOUA 4Q15A 4XVQA 3UWMA 3IVRA 1M2WA 3F6BX 4ZI2A 2E37A 6AT1A 4OLAA 4CG3A 5L4LA 2ZR8A 4HB4A 2BEUA 4CUKA 3MB8A 3V6LA 2K6GA 3RYHA 4B79A 5DM60 2PUDA 4UEJA 1U94A 1A8SA 4JB3A 3VO2A 4BQSA 5G0VA 2QOEA 4L02A 1HDIA 1TA4A 4LKOA 3KPVA 2NU6A 1RHMA 5DH9A 3T3GA 1CRWG 2PQ0A 3KEGA 1U2SA 5A3JA 4Y9UA 2Z2ZA 4AXXA 1NV8A 1PD0A 2G0AA 1I33A 2GZ2A 4LWZA 3WNZA 1V7PC 3OWOA 4PLVA 4ZYUA 4DJDC 2JAOA 3W9BA 3MZ0A 2NZ2A 1RFLA 3MRVA 1QGUB 3EN0A 2PRJA 1DVRA 1XCJA 1QYWA 2VT7A 4TRMA 4ZQCB 1WHSA 1FCJA 5THQA 5IULC 4AY6A 1GZSA 2ACEA 2Q99A 4BV9A 5LMZA 2EFYA 2GBGA 3SI7A 5DM70 3AL0C 4DM4A 1TU3A 2XVMA 1TYAE 3HCNA 3WKAA 4B7XA 2WINI 2H4YA 2PT6A 2WSBA 3BK1A 3GCGA 4IVQA 4II2A 5JCOC 4EG1A 1PFQA 3EVTA 2IYRA 2RH4A 4MGIR 4QUBA 4CIBA 1C1DB 4KXVA 4B4DA 1KJIA 3HEMA 4FS3A 5AXAA 4H1WA 1C3VA 4AG6A 4XPZA 5AVSA 1M72A 3ZDCA 2J3JA 4RQAA 3ITKA 4MRPA 2IBSA 5DO9A 1KRXA 4KWIA 4GO1A 4B48A 1DAPA 1A2QA 1J33A 3TR6A 1L6IA 2W11A 4HHEA 3DNPA 3H2KA 1SK8A 1BEZA 1AH2A 2OAEA 3FLBA 5JCJA 4YAEA 3FCAA 4AY2A 1DZIA 3O95A 3P2MA 4TMZA 2I3AA 3WKCA 1V5WA 2I6UA 4N1AA 1Y1KE 2O4CA 2AOTA 3QMVA 5DLQC 2E4ZA 3SNKA 4OP1A 1SHZA 1Y8QA 1K3TA 1ZOIA 3TL3A 2MJLA 2WF9A 1V11B 4UHBA 3FYDA 3WB0A 3I30X 4YEDA 1J2EA 1EFHA 3CF4A 1EAYA 1NMEA 1KI3A 1P77A 1W47A 2GD0A 4BPBA 2JA2A 2O8DA 1R15A 3LF1A 1JJIA 5C8ZA 4EAAA 5JO9A 1N2HA 4TMVA 4EKDA 1ZMRA 4UD6A 1KVTA 4KN9S 2AOUA 1C4OA 4B6SA 2HSEA 3COSA 5H3HA 4U7FA 4ZZIA 3Q3EA 3IE2A 2GD2A 4BNFA 5CDGA 3MBIA 2WYOA 2DHCA 3N53A 1QVZA 3IHTA 3SM9A 3AYXB 3A4LA 2I7VA 2ZP1A 3RU2A 2GGSA 2IF2A 2IKQA 1RVV1 2A7QA 2UYOA 1JVBA 1NYRA 5TB5A 5TPZA 4FZJA 3QVTA 2OBMA 4M1YA 3ZI4A 4E4TA 2LBPA 2JAWA 4NONA 4ZOEA 3DJFA 3O7WA 3Q5GA 4EB3A 1QBKC 4LF6B 5B7NA 3GZ4A 1C30B 1BKYA 2DLNA 1SU4A 4E13A 4Q03A 1JP7A 1UZUA 1Z63A 1SUPA 2JLRA 1KSFX 2IXEA 3CNEA 3I9KA 2NO9A 3IPCA 2UVQA 3U4AA 3VR4H 1N34B 2V8OA 2PBRA 3L0OA 4A7PA 1MEEA 1WCIB 2E4WA 3L7CA 3WBFA 2FEAA 1GGJA 5GM1A 3JWHA 3WNQA 3E22B 5AESA 1VKRA 3COWA 3BE5A 4IVPA 4NLLA 3ZWPA 2GMWA 1KI6A 4AMBA 3WDLA 3CVJA 4U7HA 5K6TA 5F78A 4Z6KA 3U7FB 1UK6A 2QI9F 5CU7A 4FWTA 2I9KA 5EPEA 2ZJAA 1COZA 1JHMA 2BW0A 3OCYA 3W5UA 3VZPA 3UAGA 5ALSA 2VPWA 3HB7A 4BZPA 2BWJA 1IL0A 3UENA 2VBFA 3ENKA 1P7VA 3REQA 3SYTA 1D3AA 1YZUA 1DXHA 2J67A 2PJDA 3QWFA 4H7IA 1VC2A 2BKEA 3TAUA 1TAQA 2C2MA 1SVOA 5FBWB 3WFJA 5FTJA 2GCEA 1S3FA 4L51A 5K8CA 4LJ6A 4QEZA 3W5HA 3TD2A 2V4MA 4BB6A 4EMBA 2POQX 1V1RA 3D6UA 3MPUA 4I19A 3U0VA 2HF7A 2XD4A 2HI0A 4G5OA 4IXNA 4RFSB 3E4DA 5JI2E 3I5MA 4CG2A 1POWA 4FGJA 2IZ0A 3FUTA 4PLHA 2JC3A 4Q1BA 2JI4A 5FTNA 2QVZX 3MGGA 1IUPA 3RRZA 3NTVA 3H5LA 3L1KA 2GB4A 3E53A 4L2IA 3WGKA 1BWSA 4MWOA 4QUAA 2ZYHA 4NU8X 4O4IF 1Y6GA 4O63O 1P3DA 3CN7A 2XUGA 4M0KA 4KHZA 4EUEA 4JDUA 5AJUA 4UM9B 3V9AA 2VPTA 2A0FA 5AKLA 3QWHA 2DBRA 4G5RA 1RYFA 3FAZA 4CW7A 3V6MA 5DOVA 1VB5A 1SOWA 2C9OA 3O3OB 2J30A 1V7QA 5HQJA 3WE7A 4W9MC 4Q3BA 1H0SA 2RFLA 4KLZA 1DPFA 4RTRA 3K30A 1N5RA 1DFIA 2H7XA 2OCDA 4W1RA 1JH9A 3ICOA 1MPTA 3T7EA 2HCJB 3SZOA 4P22A 3LBYA 3PHBE 1JXOA 1UKAA 2JJ1A 1N25A 2B4AA 3MTIA 4GZ6A 4EFLA 1CEYA 4HNAA 1FDTA 5HGJA 5C1IA 4V1CA 2M1ZA 1WZ2A 2A2ZA 1B3RA 5HHTA 1Y5LA 1JHAA 3GRVA 3U40A 2PX0A 3K5WA 3I0MA 1CUBA 2PZKA 2ZAOA 3GJQA 2C1XA 3DAYA 4HLCA 4K6CA 4BFTA 1N92A 4GUDA 4UNIA 4ZVSA 2OTCA 2I22A 4QSHA 3TQHA 3PU6A 2WD7A 1ZRSA 4DUYB 1R66A 1XEXB 3A1SA 2H51A 4B3MB 4R0VA 4PNZA 2FPXA 4DV7B 3AXTA 5A4AA 3EIEA 2GVZC 5JE8A 3T3NA 4H1UA 4HRVA 3U7EB 1HTWA 3WYGA 3BTVA 4QDJA 3ZHUA 1T91A 4B31A 1WD5A 3AWDA 1PSDA 5IEJA 2VJPA 1G1MA