4GSNA

Crystal structure of gste2 zan/u variant from anopheles gambiae
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
219
structure length
219
Chain Sequence
b'SNLVLYTLHLSPPCRAVELTAKALGLELEQKTINLLTGDHLKPEFVKLNPQHTIPVLDDNGTIITESHAIMIYLVTKYGKDDSLYPKDPVKQARVNSALHFESGVLFARMRFTFERILFFGKSDIPEDRVEYVQKSYELLEDTLVDDFVAGPTMTIADFSCISTVSSIMGVVPLEQSKHPRIYAWIDRLKQLPYYEEVNGGGGTDLGKFVLAKKEENAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metabolic and Target-Site Mechanisms Combine to Confer Strong DDT Resistance in Anopheles gambiae.
pubmed doi rcsb
molecule keywords Glutathione S-transferase E2
source organism Anopheles gambiae
molecule tags Transferase
total genus 84
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4gsnA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gsnA01
5CRGA 4E8EA 10GSA 3FY7A 1TRSA 4KE3A 2LQQA 2HT9A 3M3MA 5DJLA 2RLIA 3PPUA 1DE1A 5C04A 2LSTA 1N8JA 3TRQA 2R6KA 1G0TA 5G31A 2HRKA 3M1GA 3EU4A 3CSJA 2VLTA 3IXRA 4BA7A 5AIXA 2JU5A 4P3YB 1A8LA 1M0UA 2V6KA 5IPGA 3RAZA 2IMIA 3O6TA 1MDKA 1FOVA 4BVXA 5CREA 3G7IA 5HFGA 2VD0A 3ZREA 1JZWA 2AYTA 5B6MA 1PA3A 4GSNA 1I9DA 1SJZA 5D9TA 3D21A 4N30A 1BEDA 2LRNA 2LTKA 4IQ1A 3GHAA 2YPMA 5IMDA 3F6DA 2FUG2 4N0VA 1GSDA 4K0NA 1EZKA 1SJ6A 3GSSA 4O5RA 1DUGA 4J56E 3I69A 3US3A 3VI5A 3RDWA 4PURA 1Z3EA 4OO4A 2RIIA 5J41A 5KN2A 1A2JA 1KTEA 2LNTA 2FLSA 3EMPA 2DIZA 2QKEA 1A24A 4PNFA 2PERA 1TRWA 1XOBA 3BCIA 2CX4A 4G0IA 5DAKB 1ERWA 1U3IA 2JZSA 3KJYA 2KLXA 1SJIA 3DEXA 1U6TA 2F9SA 3KD0A 5H5QA 1E6BA 2HSNB 2MMAA 5EVOA 1MDJA 4DVCA 1ILOA 12GSA 4GRFA 3H1NA 2H1DA 2V32A 22GSA 3FHKA 2WS2A 5A4WA 3IR4A 4HUAA 3D6IA 3GIXA 1TP9A 2AHEA 2FNOA 5IMZA 4X0XA 1GTIA 3GH9A 4V2LA 3QDNA 4FYCA 4YAPA 2VUPA 3WGDA 1LBKA 2OE3A 3DYRA 5LNKe 1TW9A 2V2GA 4AJ8A 1B48A 3EINA 5H5SA 4HJ2A 2HZEA 3UAPA 2LQOA 2HRFA 4MZBA 1BQ7A 2YJ7A 4K7IA 4WKWA 1Q98A 2B5YA 3GL5A 2C0GA 4HOJA 1MD4A 2H6XA 1SENA 4JRRA 4L8EA 4MCUA 3GTUB 4JBBA 4ACSA 2K6VA 3HJPA 3VWVA 3D4MA 2VLVA 3FKFA 4KX4A 2DJKA 2HI7A 1FB6A 3DD3A 2H01A 5ECLB 3TUEA 3LXZA 4EVMA 2OJLA 3TJKA 1PMTA 2I81A 4MDCA 5KN0A 5ECMB 4O7HA 1YDKA 2H74A 1YKCA 3Q19A 4MMMA 1GUHA 3HVSA 4PQHA 4OCFA 3HXSA 1AQVA 1U88A 2YV9A 2NDOA 4ZL7A 3DGQA 2HNLA 1XWGA 1O81A 2PGTA 3BCKA 4V1Ag 5FHIA 4ML6A 2JACA 4KDXA 2K18A 2VD1A 5ELGA 2DJ0A 3TDGA 2Z9SA 4TVEA 3F4SA 2GDRA 2JSYA 1EP7A 3FR6A 4D73B 1M2AA 5J9BA 1ZGNA 3TKRA 4J57E 3C1SA 2HRKB 1KBNA 2B5EA 1KNGA 5KN1A 3TGZA 3PH9A 2R3XA 3LSZA 5DDLA 4KH7A 4ISDA 4NAXA 1TDIA 1F6MC 5HFIA 1K3LA 4RQXA 4IVFA 4HQSA 2L59A 4WBRD 4PGTA 1TXXA 4I5QA 1SK2A 5GZZB 1PD21 2FA4A 3L9SA 4IHUA 1SD9A 1XW9A 4EKZA 1CQGA 1TK5B 3WYWA 1GUMA 4CW9A 2P0GA 3F4RA 2FWHA 3G7YA 2H76A 2JZTA 5A5KA 2CAQA 1PL2A 2HE3A 3DXBA 3FK8A 3TKQA 2VOCA 1J9BA 3D22A 5JCUA 3QOUA 5AGYA 1AXDA 3C73A 1O8XA 1H75A 2PMTA 5ELAA 5D93A 5DAKA 1WE0A 4TRXA 1XPVA 3CRTA 3IAS2 1EEJA 1XW5A 1V9WA 3IHQA 2VL2C 2C0EA 3QFAC 1GTUA 3CSHA 3HA9A 2JL4A 2E2GA 5E59A 3O76A 2DIYA 2IIYA 4L0WA 1GUKA 1AW9A 2WZ9A 1YQ1A 4DSQA 2GQKA 4IP1A 2XC2A 5J4UA 4OWYA 2L6CA 2LKUA 4RQRA 4IJ3A 13GSA 1T3BA 5GSTA 1OYJA 3HY2A 1X5DA 1NHYA 1QFNA 1UVZA 1WIKA 3HYPA 5H5RA 3GN3A 5CAXA 4DEJA 3UJ1A 1K0DA 2H19A 2K8VA 3ERFA 2DJJA 1XCCA 3GV1A 2AV4A 3D0ZA 1Z5YE 3APSA 3TKSC 2C3QA 3VWXA 3TKSE 1WRYA 1WOUA 2VM1A 4F0BA 4NWYA 5IPHA 2IMEA 5ECPB 4YQMA 4POKA 1V58A 4MABA 2CAIA 3H93A 3GTUA 3TB2A 1EOGA 3ERWA 2HRAA 3FW2A 3HVXA 5F8BA 2L5OA 2MBSA 1ABAA 3ZFBA 3FZ9A 5CP1A 5F05A 3LXTA 4KSOA 1SYXA 2H1AA 4NV2A 4LMWA 3UBKA 5ECKB 3FZ4A 4TR3A 3A5WA 2C0DA 3DWVA 3PGTA 4I97A 2IN3A 4ZXGA 4HZ2A 2ALBA 4XHMA 1OAZA 2MMNA 4F0CA 1CQHA 4MJAA 2YNXA 1X0RA 4IW9A 4BVYB 6GSSA 2OE0A 3QCPA 3K8NA 2C4JA 3CRUA 2LJRA 1B9YC 7GSSA 4ZIJA 1BAYA 3DVXA 3RHCA 2N5FA 3ZMLA 1S3AA 1OE8A 3RPPA 3KXOA 2D2ZA 1T4YA 1Z9HA 4KAEA 1XVWA 1W89A 2PWJA 1LU4A 1C72A 1E2YA 3KTBA 2XPEA 1Z6MA 2P5RA 1JZOA 4K2DA 4N11A 1A2LA 1ST9A 5D9VA 4D73A 4TR1A 1FAAA 3Q18A 5HFKA 2JSZA 2E2MA 1A2MA 4LMVA 1OC3A 1ZL9A 4QL9A 2HXKA 1ERTA 2IMDA 3ZFLA 6GSTA 2VIMA 3TJBA 2FWEA 2OBKA 3ME7A 5D8IA 4XCSA 3ZIVA 5HR1A 18GSA 4Q5NA 4CDOA 5F07A 2DJ1A 1F37A 3IA1A 1QQ2A 1ERVA 1OVNA 4I2UA 1XWAA 2OE1A 2LS5A 1PKWA 1WWJA 4OFTA 5G30A 2FWGA 4GSTA 1SU9A 3GKNA 4IJIA 2PU9C 4GXZA 5F06A 3FZAA 3KIJA 1AC1A 1XOAA 2VAFA 5HR2A 1GTBA 4G0KA 1T1VA 4KUNA 2GZYA 2CX3A 1PL1A 5DBQA 2YANA 2O89A 4PUAA 1THXA 1F3BA 3QMXA 2VL9A 2H75A 3HCZA 3GMFA 1YF1A 5B7CA 3TRPA 3BJ5A 2VCQA 2TRXA 1WPIA 2GT6A 1T4ZA 2PVOC 4HU9A 4OFMA 4YQVA 4EDYA 1K0CA 4HS1A 2O85A 4TXOB 1M9BA 3E3EA 3VURA 3L9VA 3LG6A 4WETA 1GLQA 3UBLA 3N5OA 2L6DA 4F03A 3PINA 1WP0A 1UC7A 3NZNA 1Q4JA 1EGRA 2IMKA 4HDEA 2R2JA 3M8NA 4ECCA 1SKWB 3I6AA 3RHBA 1QK8A 5G5FA 1A23A 1SKRB 4XRAA 4KDYA 1JZRA 1G7OA 3A3TA 1OKTA 4ILFA 3IK7A 4RI7A 2FA8A 4NHWA 4TN8A 3I9V2 4HEA2 4PTSA 2L4CA 1WJKA 4BWSA 2H8LA 4KF9A 3S9FA 1GTAA 2CVDA 4XRDA 5FT3A 4ZL9A 4ZBBA 3SWLA 3DRNA 4PX1A 1ACVA 2LNSA 4MPGA 5JWQB 4K0GA 2VM2A 2L4QA 2OADA 1OC9A 5DQYA 1Z7RA 2YCDA 1B4QA 1NW2A 3D4TA 4FH8A 1VF3A 1MD3A 1NSWA 1K0AA 5JCGA 1Y25A 2H1GA 5IIZA 2NTOA 3MWHA 4FIWA 1VF4A 5INYA 1OKDA 3H4KA 3W6GA 2C3TA 2O87A 2I4AA 3KCMA 2B6MA 3C71A 1DE2A 4PXOA 2H6YA 3DKSA 3IPZA 1SYRA 4L5OA 3APQA 1B8XA 4MF6A 4TW5A 3VFIA 2DJ2A 1PN9A 1XXUA 1V2AA 4YAVA 2IFQA 3L78A 1HNBA 3KEBA 5CRDA 5ECOB 3LORA 4BVYA 3ZL5A 4YH2A 2A2RA 1MEKA 1J0FA 3H8QA 4JU5A 2GSSA 2ES7A 2ON5A 3VPQA 5ID2B 2F3MA 2RUFA 4TXVA 1THOA 1QXHA 3R3EA 3CTFA 5IO2A 3CTGA 1GSEA 2KP1A 4EXJA 2I3YA 2A4VA 1T8EB 2FY6A 2PN8A 1TK0B 4MF5A 3PR8A 5IMFA 2V1MA 4WR5A 4TR1B 4N0ZA 2H66A 2OBIA 2DMMA 3AY8A 1M7TA 2X8HA 2H0IA 1GRXA 5D9XA 4GWRA 4PNGA 5JWOB 2PBJA 1GSQA 2LJAA 1M9AA 3VK9A 1XVQA 1HYUA 2H72A 2GGTA 4USSA 1JLWA 2PPTA 3GFKA 5A4UA 1FB0A 3TCOA 3TJFA 3GKKA 5G5EA 3GURA 2L57A 9GSSA 4I6XA 3WGEA 3KMOA 2DJ3A 3MNGA 1GH2A 3UL3A 3HVVA 3A2XA 5AIVA 1FO5A 3IE3A 2KUCA 1V98A 2GSTA 1DSBA 3F4TA 3IAM2 5EY6A 4KCAA 1XIYA 3ZTLA 3ZYWA 4MF7A 3F6FA 2MZCA 3A2VA 3GX8A 2GVPA 2JADA 3CSIA 2AJQB 5IOWA 2BJXA 3HZ4A 4XS6A 4CHSA 3DVWA 1HNCA 2RUEA 3IOSA 4MK3A 5LCZA 4F82A 2GZPA 1S3CA 1R26A 4ZBDA 4F9ZA 1X9MB 1SK0A 2X64A 1TI3A 4MJBA 3QPMA 4FO5A 4OFNA 4K9ZA 1AIUA 3EMXA 2CV4A 2M46A 1K3OA 1VGLA 1YY7A 4KNDA 2DSAA 3QR6A 4WBJA 2H30A 4TXOA 3ZMKA 2IJYA 1A8YA 3TJGA 1BYEA 3EYTA 3CYNA 4WF5A 4MJEA 4LA1A 2IL3A 2X8CA 5ECSA 2NVLA 1XWCA 1NM3A 5CRHA 5IM9A 2BTOT 4GCIA 5DJMA 2GSRA 3IC4A 3KM6A 3G9BA 3P7XA 1YJ6A 4WXTA 1A0RP 1EGOA 1GP1A 3V1WA 3TRXA 2KHPA 3KGKA 2YWIA 4XIHA 4RI6A 3MSZA 3WT1A 4ID0A 4MZWA 2PUKC 4EF0A 1U3AA 4G9HA 2DBCA 5AISA 1GWCA 4GQFA 2G2QA 1K0NA 1HD2A 1AAZA 3UARA 4HU7A 1UA5A 3GKXA 1V57A 4MLYA 1OC9B 4DSSA 1QGVA 4KGIA 1FW1A 2DMLA 2QSIA 1IYIA 3LYPA 1ZZYA 1PKZA 1JZDA 2FGXA 16GSA 6GSUA 4MA9A 2YV7A 3U5RE 2YJHA 3U6VA 1F3AA 1O7UA 1TRUA 3JCML 1H4OA 1BG5A 3EVIA 2BMXA 4I2TA 3MDKA 5DQSA 3GA4A 1ZYEA 2FHEA 2R5GA 2O8VB 2VCTA 2JZRA 3VI7A 4V2NA 1UN2A 2DLXA 2NPBA 2C3NA 1BJXA 4TOPA 1AQWA 2E0QA 2IFQB 5DVBA 3KZQA 4AGSA 2YWMA 3QAWA 3G7JA 1KEBA 1QMVA 2X99A 3KTLA 3CXGA 4G2EA 1AUCA 1XW6A 2CQ9A 3HD5A 5ID2A 1M99A 1NHOA 5CNWA 2HRNA 4EDZA 2AB6A 1R5AA 4IBPA 5G1LA 1EOHA 1B4PA 4ZILA 5ECRB 1TTZA 1YEPA 3UVTA 3VWWA 3GH6A 3IDVA 2XPDA 2L5LA 4V2MA 1T7PB 3P90A 3RPNA 5EPFA 2TRCP 1TU7A 3C1RA 4F2IA 1TU8A 3BD2A 1K0BA 1ZCPA 1GL8A 4TR4A 3ZLPA 5L71A 4BPYA 2XBQA 4WEYA 8GSSA 3WGXA 2C0FA 1SD8A 4L0UA 4XS4B 3SBCA 3LGCA 3TOTA 1USBA 1AQXA 2H6ZA 3FYGA 1PGTA 2NBSA 4HJMA 2CVKA 4IGJA 3RBTA 2VCWA 3KMNA 4KB3A 1VRSD 19GSA 3UVHA 5JWRB 3EC3A 1PSQA 1GSFA 1V40A 2VL2A 2HSHA 1X9WB 3F9UA 5ENUA 4FYUA 4OD7A 1O73A 2YN1A 4EO3A 4KW6A 2LJKA 3MAKA 2GLRA 4EUYA 3L4NA 4AJ7A 2X8GA 4MPFA 5D73A 5B8BA 2WJUA 4N10A 5ECQB 1YEXA 3ZIJA 2AUVA 3M9JA 4J2FA 1ZYQB 3L0HA 6GSVA 3FR3A 3P2AA 3E0UA 1YKAA 2GQMA 3HZ8A 2ON7A 2ZNMA 2V41A 2H73A 4POMA 1G6YA 4JR4A 4K8MA 1BX9A 2J9HA 3UIWA 1FG4A 3TKSA 2PVQA 1Y6EA 1B9XC 3GRXA 2P31A 2N5AA 2B3SA 4KA0A 1XWBA 2UZ8A 3DMLA 4WR4A 4JR6A 3P8WA 2IPAA 4V1Ap 5D96A 1FHEA 3FR9A 1GSSA 5AN1A 1GULA 1ERUA 4MH2A 4WF4A 3ZRDA 5IMAA 1ML6A 4HI7A 2GZZA 3C8EA 2FD3A 5A4VA 4X43A 5CYYA 4GSSA 2N5BA 1XBSA 2C1YA 4O32A 2GQLA 1JHBA 11GSA 3TOUA 4DSSB 3QAVA 2MBTA 5COHA 2FCHA 4JE1A 5GAPD 3E9JB 3HHVA 2HSMA 17GSA 4IELA 1X5EA 2HYXA 2YWNA 1G6WA 2H71A 2ZUPA 1EEMA 2DC5A 4L5LA 1G7EA 3C7MA 4AF2A 5HR0A 1U87A 4XS1A 2WCIA 2R37A 4KDUA 5G1KA 5EL8A 4NPBA 4ZBAA 4DSRA 5JCWA 1HQOA 2IWTA 3QAGA 2CZ3A 2XBIA 3BOAA 4K7OA 5BMUA 2G0FA 3ERGA 4ZB6A 1K0MA 2EC4A 2WB9A 2YWOA 2HQTA 5DALB 4I8BA 3GX0A 2EIQA 4ML1A 4ZB8A 4X1UA 3GNJA 2XHFA 1SKSB 3UMAA 4NHZA 3N9JA 2E7PA 3ED3A 1GSUA 4JZQA 2MMOA 5ABRA 3ZZXA 3EE2A 2YP6A 3LYKA 3LWAA 1YZXA 3BBYA 3VPTA 5HR3A 5J5NA 1SL0B 2A2SA 5IQYA 2CZ2A 4O92A 2RM6A 4BL7A 1I5GA 2MMZA 1PRXA 3GUSA 1M2BA 14GSA 4EE0A 1M2DA 5GSSA 2WDUA 4OCEA 2I1UA 4KSMA 4K1FA 4Z7XA 2C8UA 4GQCA 2B1LA 4TKYA 4KCEA 3UOMA 2QGVA 2F51A 3I43A 2QC7A 3HKRA 3TJJA 20GSA 6GSXA 3KH9A 1OC8A 1YF0A 3KP9A 2F8FA 4Q5QA 2VCVA 5IMVA 3W8SA 1URMA 3J7Yk 1LJRA 1SL2B 2RM5A 3D5JA 4XS4A 1GNWA 1TK8B 2YOIA 4POBA 5D9WA 3GL3A 3APOA 4NMUA 3A2WA 2H1BA 4HZ4A 3ZITA 4BVXB 1IYHA 1TOFA 3GKMA 4Q5FA 4FYBA 3EU3A 5IOXA 1JFUA 5B8AA 3Q6OA 1PX6A 1FVKA 2WRTA 2MYGA 4ZL8A 2H70A 1T00A 3L9UA 3NIVA 3IV4A 4LL1B 3QFBC 1EV4A 5ECHB 3IRAA 2LRTA 1XFLA 2CVBA 4NV5A 2IMFA 1GLPA 6GSYA 5HQPA 1SK1A 2REMA 2OACA 2K9FA 1PQNA 5F0GA 3QD9A 1F9MA 2ZCTA 1J08A 1X5CA 1HNAA 4IQAA 4E8HA 1TRVA 4GF0A 2LEGA 3ZVJA 2B7KA 3F3QA 2AAWA 4MZCA 2HFDA 5E4WA 4LLRA 4IS0A 4ECBA 4XTSA 3LJRA 3Q74A 4ECIA 2GS3A 2C80A 1WMJA 3H79A 4GTUA 1MDIA 2F8AA 1EWXA 3F3RA 5KEJA 4RUVA 4JEDA 4MJCA 5DCHA 1F2EA 5G2ZA 1DBYA 5B6NA 4YQUA 4K7NA 4MP4A 2B1KA 1TJDA 3CBUA 4HQZA 5CRWA 4LL4B 2WULA 3EURA 2WFCA 2V6OA 5IO0A 5ECIB 4IP6A 2OKAA 2KOKA 2H0HA 4ECJA 4BWQA 2YZUA 1N2AA 5FWGA 3O3TA 4EL1A 5GAND 1TKDB 4G0LA 5CO3A 3LQ7A 1VF2A 3LEFA 1R4WA 2J23A 1VF1A 3LFLA 3KP8A 3HDCA 1QUWA 5DCGA 4QQ7A 3F0IA 1GNEA 2LUSA 3EWLA 3VLNA 1GSYA 2R4VA 3F63A 1EP8A 1O8WA 2GT5A 2VCZA 3WD6A 3GYKA 2VL3A 2HZEB 2LV3A 2OA7A 1XZOA 2HSMB 3OR5A 2VCXA 1TI1A 2GSQA 4IN0A 2EIOA 4IKHA 3DIEA 4POLA 2B7JA 2GTUA 3J7Yb 1EV9A 1K0OA 1Z7PA 1ON4A 1O85A 4NXIA 2YZHA 5ECNB 4ZB9A 1A0FA 3F8UA 1X9SB 2FWFA 3UEMA 3WT2A 4Q5RA 2O7KA 3M9KA 4GLTA 1ZOFA 1RQMA 2EIRA 3CMIA 1ZMAA 1R5PA 2VO4A 1R7HA 5C00A 2K8SA 2HSYA 1XWKA 3KH7A 5IMCA 5LD0A 1SL1B 2P5QA 1OE7A 4G19A 3TKPA 1W4VA 3ME8A 3IBHA 2WGRA 2HLSA 3HJMA 3W8JA 4AJ6A 4QL7A 2B5XA 2TIRA 5DALA 4TR0A 1JLVA 4OMVA 4MH3A 1RW1A 2I9HA 3GSTA 2LRCA 2KP2A 3VWUA 1Z6NA 2CT6A 3ZVJD 4G10A 2M72A 4K6XA 4FQUA 3IK9A 1PX7A 5KN3A 3ISOA 3NOFA 1K3YA 4BL7B 1RK4A 1O6JA 3M0FA 2H0GA 3IC8A 5J3RA 4ULXA 1FVJA 3FEUA 4OO5A 4PUFC 2HZFA 3HJOA 2M80A 4PQ1A 2VLUA 1S3DA 4EC0A 4PQIA 2CA8A 4H86A 3R2QA 5J9CA 6GSWA 3FRCA 1MTCA 3FZ5A
chains in the Genus database with same CATH superfamily
5CRGA 4E8EA 10GSA 3FY7A 1TRSA 4KE3A 2LQQA 2HT9A 3M3MA 2WW0A 2RLIA 5DJLA 3PPUA 1DE1A 2WZSA 5C04A 1M3JA 2LSTA 1N8JA 3TRQA 2R6KA 1G0TA 5G31A 2HRKA 3M1GA 3EU4A 3CSJA 2VLTA 3IXRA 4BA7A 5AIXA 2JU5A 4P3YB 3A5IA 1A8LA 4GDFA 2O5VA 1M0UA 2V6KA 5IPGA 3RAZA 2IMIA 3O6TA 1MDKA 1FOVA 4BVXA 5CREA 3G7IA 5HFGA 2VD0A 3ZREA 1JZWA 2AYTA 5B6MA 1PA3A 4GSNA 1I9DA 1SJZA 5D9TA 3D21A 4N30A 1BEDA 2LRNA 2LTKA 4IQ1A 3GHAA 2YPMA 5IMDA 4EIQA 4PI0C 3F6DA 2FUG2 4N0VA 1GSDA 4K0NA 1EZKA 1SJ6A 3GSSA 4O5RA 1DUGA 4J56E 3I69A 3US3A 3VI5A 3RDWA 4PURA 1Z3EA 4OO4A 2RIIA 5J41A 4YKFA 5KN2A 3CHXC 1A2JA 1KTEA 2LNTA 2FLSA 3EMPA 2DIZA 2QKEA 4CY6A 1A24A 4PNFA 2PERA 1TRWA 1XOBA 3BCIA 2CX4A 2EFHA 4G0IA 5DAKB 1ERWA 1U3IA 2JZSA 3KJYA 2KLXA 1SJIA 3LW9A 3DEXA 1U6TA 2F9SA 3KD0A 5H5QA 1E6BA 2HSNB 2MMAA 5EVOA 1MDJA 4DVCA 1ILOA 12GSA 2WW1A 4GRFA 3H1NA 2H1DA 2V32A 22GSA 3FHKA 2WS2A 5A4WA 3IR4A 4HUAA 3D6IA 3GIXA 1TP9A 2AHEA 2FNOA 5IMZA 4X0XA 1GTIA 3GH9A 4V2LA 3QDNA 4FYCA 4YAPA 2VUPA 3WGDA 1LBKA 2OE3A 3DYRA 5LNKe 1TW9A 2V2GA 4ZB7A 4AJ8A 1B48A 3EINA 5H5SA 1SVLA 4HJ2A 2HZEA 3UAPA 2LQOA 2HRFA 4MZBA 1BQ7A 2YJ7A 4K7IA 4WKWA 1Q98A 2B5YA 1S4BP 3GL5A 2C0GA 4HOJA 4K2XA 1MD4A 2H6XA 1SENA 4JRRA 4L8EA 4MCUA 3GTUB 4JBBA 4ACSA 2K6VA 5J4VA 3HJPA 3VWVA 3D4MA 2VLVA 3FKFA 4KX4A 2WW3A 2DJKA 2HI7A 1FB6A 3DD3A 2H01A 5ECLB 3TUEA 3LXZA 4EVMA 2OJLA 3TJKA 3MYDA 1PMTA 2I81A 4MDCA 5KN0A 5ECMB 3RFRC 4O7HA 1YDKA 2H74A 1YKCA 3Q19A 4MMMA 1GUHA 3HVSA 4PQHA 4OCFA 3HXSA 1AQVA 1U88A 2YV9A 2NDOA 4ZL7A 3DGQA 2HNLA 1XWGA 1O81A 2PGTA 3BCKA 4V1Ag 1ZYPA 5FHIA 4ML6A 2JACA 4KDXA 2K18A 2VD1A 5ELGA 2DJ0A 3TDGA 2Z9SA 4TVEA 3F4SA 2GDRA 2JSYA 1EP7A 4AKXB 3FR6A 4D73B 1M2AA 5J9BA 4K5SA 1ZGNA 1YVLA 3TKRA 4J57E 1SVMA 3C1SA 2HRKB 4HSCX 4N3ZA 1KBNA 2B5EA 1KNGA 5KN1A 3TGZA 3PH9A 2R3XA 3LSZA 5DDLA 4KH7A 4ISDA 4NAXA 1TDIA 1F6MC 5HFIA 1K3LA 4RQXA 4IVFA 4HQSA 2L59A 4WBRD 4PGTA 1TXXA 4I5QA 1SK2A 5GZZB 4PHZC 1PD21 2FA4A 3L9SA 4IHUA 1SD9A 1XW9A 4EKZA 1CQGA 1TK5B 3WYWA 1GUMA 4CW9A 2P0GA 3F4RA 2FWHA 3G7YA 3FMWA 2H76A 2JZTA 5A5KA 2CAQA 1PL2A 2HE3A 3DXBA 3FK8A 3TKQA 2VOCA 1J9BA 3D22A 5JCUA 3QOUA 5AGYA 1AXDA 3C73A 1O8XA 1H75A 2PMTA 5ELAA 5D93A 5DAKA 1WE0A 4TRXA 1XPVA 3CRTA 3IAS2 2R0PA 5KOXA 1EEJA 1XW5A 2HSNA 1V9WA 3IHQA 2VL2C 2C0EA 3QFAC 1GTUA 3CSHA 3HA9A 2JL4A 2E2GA 5E59A 1PN0A 3O76A 2DIYA 2IIYA 4L0WA 1GUKA 1AW9A 2WZ9A 1YQ1A 4DSQA 2GQKA 4IP1A 2XC2A 5J4UA 4OWYA 2L6CA 2LKUA 4RQRA 4IJ3A 13GSA 1T3BA 5GSTA 1OYJA 3HY2A 1X5DA 1NHYA 1QFNA 1UVZA 1WIKA 3HYPA 5H5RA 3GN3A 5CAXA 4DEJA 3UJ1A 1K0DA 2H19A 2K8VA 3ERFA 2DJJA 1XCCA 3GV1A 2AV4A 3D0ZA 1Z5YE 3APSA 3TKSC 2C3QA 3VWXA 3TKSE 1WRYA 1WOUA 2VM1A 4F0BA 4NWYA 5IPHA 2IMEA 5ECPB 4YQMA 4POKA 1V58A 4MABA 2CAIA 3H93A 3GTUA 3HVNA 3TB2A 5J47A 1EOGA 3ERWA 2HRAA 3FW2A 3HVXA 5F8BA 2L5OA 2MBSA 1ABAA 3ZFBA 3FZ9A 5CP1A 5F05A 3LXTA 4KSOA 1SYXA 2H1AA 4YKGA 4NV2A 4LMWA 3UBKA 5ECKB 3FZ4A 4TR3A 3A5WA 2C0DA 3DWVA 3PGTA 4I97A 2IN3A 4ZXGA 4HZ2A 2ALBA 5J40A 4XHMA 1OAZA 2MMNA 4F0CA 1CQHA 4MJAA 2YNXA 1X0RA 4IW9A 4BVYB 6GSSA 2OE0A 3QCPA 3K8NA 2C4JA 3CRUA 2LJRA 1B9YC 4K5RA 7GSSA 4ZIJA 1BAYA 3DVXA 3RHCA 2N5FA 3ZMLA 1S3AA 1OE8A 3RPPA 3KXOA 2D2ZA 1T4YA 1Z9HA 4Z2RA 4KAEA 1XVWA 1W89A 2PWJA 1LU4A 1C72A 1E2YA 3KTBA 2XPEA 1Z6MA 2P5RA 1JZOA 4K2DA 4N11A 1A2LA 1ST9A 5D9VA 4D73A 4TR1A 1FAAA 3Q18A 2EFEA 5HFKA 2JSZA 2E2MA 1A2MA 4LMVA 1OC3A 1ZL9A 4QL9A 2HXKA 1ERTA 1PFOA 2IMDA 3ZFLA 6GSTA 2VIMA 3TJBA 2FWEA 2OBKA 3ME7A 5D8IA 4XCSA 3ZIVA 5HR1A 18GSA 4Q5NA 4CDOA 5F07A 2DJ1A 1YEWC 4CY8A 1F37A 3IA1A 4BIKA 1QQ2A 2WVXA 1ERVA 1OVNA 4I2UA 5KOWA 1XWAA 2OE1A 2LS5A 1PKWA 1WWJA 4OFTA 3TU3B 5G30A 2FWGA 4GSTA 1SU9A 3GKNA 4IJIA 2PU9C 4GXZA 5F06A 3FZAA 3KIJA 1AC1A 1XOAA 2VAFA 5HR2A 1GTBA 4G0KA 1T1VA 4KUNA 2GZYA 2CX3A 1PL1A 5DBQA 2YANA 2O89A 4PUAA 1THXA 1F3BA 3QMXA 2VL9A 2H75A 3HCZA 3GMFA 1YF1A 5B7CA 3TRPA 3BJ5A 2VCQA 2TRXA 1WPIA 2GT6A 1T4ZA 2PVOC 2DKIA 4HU9A 4OFMA 4YQVA 4EDYA 1K0CA 4HS1A 2O85A 4TXOB 1M9BA 3E3EA 3VURA 3L9VA 3LG6A 2A2PA 4WETA 1GLQA 3UBLA 1M3IA 3N5OA 2L6DA 4F03A 2R0GA 3PINA 1WP0A 1UC7A 3NZNA 1Q4JA 1EGRA 2IMKA 5J4YA 4HDEA 4O5QA 2R2JA 3M8NA 4ECCA 1SKWB 3I6AA 3RHBA 1QK8A 5G5FA 1A23A 1SKRB 4XRAA 5A5HA 4KDYA 1JZRA 1G7OA 3A3TA 1OKTA 4ILFA 3IK7A 4RI7A 2FA8A 4NHWA 4TN8A 3I9V2 4HEA2 4PTSA 2L4CA 3EPTA 1WJKA 4BWSA 2H8LA 4KF9A 3S9FA 1GTAA 2CVDA 4XRDA 5FT3A 4ZL9A 4ZBBA 3SWLA 3DRNA 4PX1A 1ACVA 2LNSA 4MPGA 4EIPA 5JWQB 4K0GA 2L4QA 2VM2A 2OADA 1OC9A 5DQYA 1Z7RA 2YCDA 1B4QA 1NW2A 3D4TA 4FH8A 1VF3A 1MD3A 1NSWA 1K0AA 5JCGA 1Y25A 1BG1A 2H1GA 5IIZA 2NTOA 3MWHA 4FIWA 1VF4A 5INYA 1OKDA 3H4KA 3W6GA 2C3TA 2O87A 2I4AA 3KCMA 2B6MA 2WVZA 3C71A 1DE2A 4PXOA 2H6YA 3DKSA 3IPZA 1SYRA 4L5OA 3APQA 1B8XA 4MF6A 4TW5A 3VFIA 2DJ2A 1PN9A 1XXUA 1V2AA 4YAVA 1FOHA 2IFQA 3L78A 1HNBA 3KEBA 5CRDA 5ECOB 3LORA 4BVYA 3ZL5A 4YH2A 2A2RA 1MEKA 1J0FA 3H8QA 4JU5A 2GSSA 2ES7A 2ON5A 3VPQA 5ID2B 2F3MA 2RUFA 4TXVA 1THOA 1QXHA 3R3EA 3CTFA 5IO2A 3CTGA 1GSEA 1BF5A 2KP1A 4EXJA 2I3YA 2A4VA 1T8EB 2FY6A 2PN8A 1TK0B 4MF5A 3PR8A 5IMFA 2V1MA 4X4JA 4WR5A 4TR1B 4N0ZA 2H66A 2OBIA 2DMMA 3AY8A 1M7TA 2QA2A 2X8HA 2H0IA 1GRXA 5D9XA 4GWRA 4PNGA 5JWOB 2PBJA 1GSQA 2LJAA 1M9AA 4PI2C 3VK9A 1XVQA 1HYUA 2H72A 2GGTA 4USSA 1JLWA 2PPTA 3GFKA 5A4UA 2WVXB 1FB0A 3TCOA 3TJFA 3GKKA 5G5EA 3GURA 2L57A 9GSSA 4I6XA 3WGEA 3KMOA 2DJ3A 3MNGA 1GH2A 3UL3A 3HVVA 3A2XA 4AKIA 5AIVA 1FO5A 3IE3A 2KUCA 1V98A 4A5PA 2GSTA 1DSBA 3F4TA 3IAM2 5EY6A 4KCAA 1SVOA 1XIYA 3ZTLA 3ZYWA 4MF7A 3F6FA 2MZCA 3A2VA 3GX8A 2GVPA 2JADA 3CSIA 2AJQB 5IOWA 2BJXA 3HZ4A 4XS6A 4CHSA 3DVWA 1HNCA 2RUEA 3IOSA 4MK3A 5LCZA 4F82A 2GZPA 1S3CA 1R26A 2WW2A 4ZBDA 4F9ZA 1X9MB 1SK0A 2X64A 1TI3A 2UV8G 4MJBA 3QPMA 4FO5A 4OFNA 4K9ZA 3HMJG 1AIUA 3EMXA 2CV4A 2M46A 1K3OA 1VGLA 1YY7A 4KNDA 2DSAA 3QR6A 4WBJA 2H30A 4TXOA 3ZMKA 2IJYA 1A8YA 3TJGA 1BYEA 3EYTA 3CYNA 4WF5A 4MJEA 4LA1A 2IL3A 2X8CA 5ECSA 2NVLA 1XWCA 1NM3A 5CRHA 2O36A 5IM9A 2BTOT 4GCIA 5DJMA 2GSRA 3IC4A 1XG8A 3KM6A 3G9BA 3P7XA 1YJ6A 4WXTA 1A0RP 1EGOA 2EFDA 1GP1A 5A5HB 3V1WA 3TRXA 2KHPA 3KGKA 2YWIA 4XIHA 4RI6A 3MSZA 3WT1A 4ID0A 4MZWA 2PUKC 4EF0A 1U3AA 4G9HA 2DBCA 5AISA 1GWCA 4GQFA 2G2QA 1K0NA 1HD2A 1AAZA 3UARA 4HU7A 1UA5A 3GKXA 1V57A 4MLYA 1OC9B 4DSSA 1QGVA 4KGIA 1FW1A 2QA1A 3CWGA 2DMLA 2QSIA 1IYIA 3LYPA 1ZZYA 4E68A 1PKZA 1I1IP 1JZDA 2FGXA 16GSA 6GSUA 4MA9A 2YV7A 3U5RE 2YJHA 3U6VA 1F3AA 1O7UA 1TRUA 3JCML 1H4OA 1BG5A 3EVIA 2BMXA 4I2TA 3MDKA 5DQSA 3GA4A 1ZYEA 2FHEA 2R5GA 2O8VB 2VCTA 2JZRA 3VI7A 4V2NA 1UN2A 2DLXA 5BMUB 2NPBA 2C3NA 1BJXA 4TOPA 1AQWA 5A1NB 2E0QA 3MIXA 4AI6A 2IFQB 5DVBA 3KZQA 4AGSA 2YWMA 3QAWA 3G7JA 1KEBA 1QMVA 2X99A 3KTLA 3CXGA 4G2EA 1AUCA 1XW6A 2CQ9A 3HD5A 5ID2A 1M99A 1NHOA 5CNWA 2HRNA 4EDZA 2AB6A 1R5AA 4IBPA 5G1LA 1EOHA 1B4PA 4ZILA 5ECRB 1TTZA 1YEPA 3UVTA 3VWWA 3GH6A 3IDVA 2XPDA 2L5LA 4V2MA 1T7PB 3P90A 3RPNA 2EFCA 5EPFA 2TRCP 1TU7A 3C1RA 4F2IA 1TU8A 3BD2A 1K0BA 1ZCPA 1GL8A 4TR4A 3ZLPA 5L71A 2R0CA 4BPYA 2DKHA 2XBQA 4WEYA 8GSSA 3WGXA 2C0FA 1SD8A 4L0UA 4XS4B 3SBCA 3LGCA 3TOTA 1USBA 1AQXA 2H6ZA 3FYGA 2A4HA 1PGTA 2NBSA 4HJMA 2CVKA 4IGJA 3RBTA 2VCWA 3KMNA 4KB3A 1VRSD 19GSA 3UVHA 5JWRB 3EC3A 1PSQA 1GSFA 1V40A 2VL2A 4FXYP 2HSHA 1X9WB 3CQFA 3F9UA 2X49A 5ENUA 4FYUA 4OD7A 1O73A 2YN1A 4EO3A 4KW6A 2LJKA 4Z2TA 3MAKA 2GLRA 4EUYA 3L4NA 4AJ7A 2X8GA 4MPFA 5D73A 5B8BA 2WJUA 4N10A 5ECQB 1YEXA 3ZIJA 2AUVA 3M9JA 4J2FA 1ZYQB 3L0HA 6GSVA 3FR3A 3P2AA 3E0UA 1YKAA 2GQMA 3HZ8A 2ON7A 3RGBC 2ZNMA 2V41A 2H73A 4POMA 1G6YA 4AKHA 4JR4A 1BX9A 2J9HA 4K8MA 3UIWA 1FG4A 3TKSA 2PVQA 1Y6EA 1B9XC 3GRXA 2P31A 2N5AA 4QMKA 2B3SA 4KA0A 1XWBA 2UZ8A 3DMLA 4WR4A 4JR6A 3P8WA 2IPAA 4V1Ap 5D96A 1FHEA 3FR9A 1GSSA 5AN1A 1GULA 1ERUA 4MH2A 4WF4A 3ZRDA 5IMAA 1ML6A 4HI7A 2GZZA 3C8EA 2FD3A 5A4VA 4X43A 5CYYA 5A34B 4GSSA 2N5BA 1XBSA 2C1YA 4O32A 2O3EA 2GQLA 1JHBA 4W66A 11GSA 3TOUA 4DSSB 3QAVA 2MBTA 5COHA 2FCHA 4JE1A 5GAPD 3E9JB 3HHVA 2HSMA 17GSA 4IELA 1X5EA 2HYXA 2YWNA 1G6WA 2H71A 2ZUPA 3IHGA 1EEMA 2DC5A 4L5LA 1G7EA 3C7MA 4AF2A 5HR0A 1U87A 4XS1A 2WCIA 2R37A 4KDUA 5G1KA 5EL8A 4NPBA 4ZBAA 4DSRA 5JCWA 1HQOA 2IWTA 3QAGA 2CZ3A 2XBIA 3BOAA 4K7OA 5BMUA 2G0FA 3ERGA 4ZB6A 1K0MA 5A1NA 2WB9A 2EC4A 4ICYA 2YWOA 2HQTA 5DALB 4I8BA 3GX0A 2EIQA 4ML1A 4ZB8A 4X1UA 3GNJA 2XHFA 1SKSB 3UMAA 4NHZA 3N9JA 2E7PA 3ED3A 1GSUA 4JZQA 2MMOA 5BRTA 5ABRA 3ZZXA 3EE2A 2YP6A 3LYKA 3LWAA 1YZXA 3BBYA 3VPTA 5HR3A 5J5NA 2WVYA 2A2SA 1SL0B 5IQYA 2CZ2A 4O92A 2RM6A 4BL7A 1I5GA 2OT3A 2MMZA 1PRXA 3GUSA 1M2BA 14GSA 4EE0A 1M2DA 5GSSA 2WDUA 4OCEA 2I1UA 4KSMA 4K1FA 4Z7XA 2C8UA 4GQCA 2B1LA 4TKYA 4KCEA 3UOMA 2QGVA 2F51A 3I43A 2QC7A 3HKRA 3TJJA 20GSA 6GSXA 3KH9A 1OC8A 1YF0A 3KP9A 1TXUA 2F8FA 4Q5QA 2VCVA 5IMVA 3W8SA 1URMA 3J7Yk 1LJRA 1SL2B 2RM5A 3D5JA 4XS4A 1GNWA 1TK8B 2YOIA 4POBA 5D9WA 3GL3A 3APOA 4NMUA 1Y1UA 3A2WA 2H1BA 4HZ4A 3ZITA 4BVXB 1IYHA 1TOFA 3GKMA 4Q5FA 4FYBA 4Z2UA 3EU3A 5IOXA 1JFUA 5B8AA 3Q6OA 1PX6A 1FVKA 2WRTA 2MYGA 4ZL8A 2H70A 1T00A 3L9UA 3NIVA 3IV4A 4LL1B 3QFBC 1EV4A 4MNNA 5ECHB 3IRAA 2LRTA 1XFLA 2CVBA 4NV5A 2IMFA 1GLPA 6GSYA 5HQPA 1SK1A 2REMA 2OACA 2K9FA 1PQNA 5F0GA 3QD9A 1F9MA 2ZCTA 1J08A 1X5CA 1HNAA 4IQAA 4E8HA 1TRVA 4GF0A 2LEGA 3ZVJA 2B7KA 3F3QA 2AAWA 4MZCA 2HFDA 5E4WA 4LLRA 4IS0A 4ECBA 4XTSA 3LJRA 2VKZG 3Q74A 4ECIA 2GS3A 2C80A 1WMJA 3H79A 4GTUA 1MDIA 2F8AA 1EWXA 3F3RA 5KEJA 4RUVA 4JEDA 4MJCA 5DCHA 1F2EA 5G2ZA 1DBYA 5B6NA 4YQUA 4K7NA 4MP4A 2B1KA 1TJDA 3CBUA 4HQZA 5CRWA 4LL4B 2WULA 3EURA 2WFCA 2V6OA 5IO0A 5ECIB 4IP6A 2OKAA 2KOKA 2H0HA 4ECJA 4BWQA 2YZUA 1N2AA 5FWGA 3O3TA 4EL1A 5GAND 1TKDB 4G0LA 5CO3A 3LQ7A 1VF2A 3LEFA 1R4WA 2J23A 1VF1A 3LFLA 3KP8A 3HDCA 1QUWA 5DCGA 4QQ7A 3F0IA 1GNEA 5A34A 2LUSA 3EWLA 3VLNA 1GSYA 2R4VA 3F63A 1EP8A 1O8WA 2GT5A 2VCZA 3WD6A 3GYKA 2VL3A 2HZEB 2LV3A 2OA7A 1XZOA 2HSMB 3OR5A 2VCXA 1TI1A 1S3RA 2GSQA 4IN0A 2EIOA 4IKHA 3DIEA 4POLA 2B7JA 2GTUA 3J7Yb 1EV9A 1K0OA 1ZYNA 1Z7PA 1ON4A 1O85A 4NXIA 2YZHA 5ECNB 4ZB9A 1A0FA 3F8UA 1X9SB 2FWFA 3UEMA 3WT2A 4Q5RA 2O7KA 3M9KA 4GLTA 1ZOFA 1N25A 1RQMA 2EIRA 2X4AA 3CMIA 1ZMAA 1R5PA 2VO4A 1R7HA 5C00A 2K8SA 2HSYA 1XWKA 3KH7A 5IMCA 5LD0A 1SL1B 2P5QA 1OE7A 4G19A 3TKPA 1W4VA 3ME8A 3IBHA 2WGRA 2HLSA 3HJMA 3W8JA 4AJ6A 4QL7A 2B5XA 2TIRA 5DALA 4TR0A 1JLVA 4OMVA 4MH3A 1RW1A 2I9HA 3GSTA 2LRCA 4G01A 2KP2A 3VWUA 4AKGA 1Z6NA 2CT6A 2H1LA 3ZVJD 4G10A 2M72A 4K6XA 4FQUA 3IK9A 1PX7A 5KN3A 3ISOA 3NOFA 4O5UA 1K3YA 4BL7B 1RK4A 1O6JA 3M0FA 2H0GA 3IC8A 5J3RA 4ULXA 1FVJA 3FEUA 4OO5A 4PUFC 2HZFA 3HJOA 2M80A 4PQ1A 2VLUA 1S3DA 4EC0A 4PQIA 2CA8A 4H86A 3R2QA 5J9CA 6GSWA 3FRCA 1MTCA 3FZ5A
chains in the Genus database with same CATH topology
5CRGA 4E8EA 10GSA 3FY7A 1TRSA 4KE3A 2LQQA 2HT9A 3M3MA 5DJLA 2RLIA 3PPUA 1DE1A 5C04A 2LSTA 1N8JA 3TRQA 2R6KA 1G0TA 5G31A 2HRKA 3M1GA 3EU4A 3CSJA 2VLTA 3IXRA 4BA7A 5AIXA 2JU5A 4P3YB 3A5IA 1A8LA 4GDFA 2O5VA 1M0UA 2V6KA 5IPGA 3RAZA 2IMIA 3O6TA 1MDKA 1FOVA 4BVXA 5CREA 3G7IA 5HFGA 2VD0A 3ZREA 1JZWA 2AYTA 5B6MA 1PA3A 4GSNA 1I9DA 1SJZA 5D9TA 3D21A 4N30A 1BEDA 2LRNA 2LTKA 4IQ1A 3GHAA 2YPMA 5IMDA 4EIQA 3F6DA 2FUG2 4N0VA 1GSDA 4K0NA 1EZKA 1SJ6A 3GSSA 4O5RA 1DUGA 4J56E 3I69A 3US3A 3VI5A 3RDWA 4PURA 1Z3EA 4OO4A 2RIIA 5J41A 4YKFA 5KN2A 1A2JA 1KTEA 2LNTA 2FLSA 3EMPA 2DIZA 2QKEA 4CY6A 1A24A 4PNFA 2PERA 1TRWA 1XOBA 3BCIA 2CX4A 2EFHA 4G0IA 5DAKB 1ERWA 1U3IA 2JZSA 3KJYA 2KLXA 1SJIA 3LW9A 3DEXA 1U6TA 2F9SA 3KD0A 5H5QA 1E6BA 2HSNB 2MMAA 5EVOA 1MDJA 4DVCA 1ILOA 12GSA 4GRFA 3H1NA 2H1DA 2V32A 22GSA 3FHKA 2WS2A 5A4WA 3IR4A 4HUAA 3D6IA 3GIXA 1TP9A 2AHEA 2FNOA 5IMZA 4X0XA 1GTIA 3GH9A 4V2LA 3QDNA 4FYCA 4YAPA 2VUPA 3WGDA 1LBKA 2OE3A 3DYRA 5LNKe 1TW9A 2V2GA 4ZB7A 4AJ8A 1B48A 3EINA 5H5SA 1SVLA 4HJ2A 2HZEA 3UAPA 2LQOA 2HRFA 4MZBA 1BQ7A 2YJ7A 4K7IA 4WKWA 1Q98A 2B5YA 3GL5A 2C0GA 4HOJA 4K2XA 1MD4A 2H6XA 1SENA 4JRRA 4L8EA 4MCUA 3GTUB 4JBBA 4ACSA 2K6VA 5J4VA 3HJPA 3VWVA 3D4MA 2VLVA 3FKFA 4KX4A 2DJKA 2HI7A 1FB6A 3DD3A 2H01A 5ECLB 3TUEA 3LXZA 4EVMA 2OJLA 3TJKA 3MYDA 1PMTA 2I81A 4MDCA 5KN0A 5ECMB 4O7HA 1YDKA 2H74A 1YKCA 3Q19A 4MMMA 1GUHA 3HVSA 4PQHA 4OCFA 3HXSA 1AQVA 1U88A 2YV9A 2NDOA 4ZL7A 3DGQA 2HNLA 1XWGA 1O81A 2PGTA 3BCKA 4V1Ag 1ZYPA 5FHIA 4ML6A 2JACA 4KDXA 2K18A 2VD1A 5ELGA 2DJ0A 3TDGA 2Z9SA 4TVEA 3F4SA 2GDRA 2JSYA 1EP7A 4AKXB 3FR6A 4D73B 1M2AA 5J9BA 4K5SA 1ZGNA 1YVLA 3TKRA 4J57E 1SVMA 3C1SA 2HRKB 4N3ZA 1KBNA 2B5EA 1KNGA 5KN1A 3TGZA 3PH9A 2R3XA 3LSZA 5DDLA 4KH7A 4ISDA 4NAXA 1TDIA 1F6MC 5HFIA 1K3LA 4RQXA 4IVFA 4HQSA 2L59A 4WBRD 4PGTA 1TXXA 4I5QA 1SK2A 5GZZB 1PD21 2FA4A 3L9SA 4IHUA 1SD9A 1XW9A 4EKZA 1CQGA 1TK5B 3WYWA 1GUMA 4CW9A 2P0GA 3F4RA 2FWHA 3G7YA 3FMWA 2H76A 2JZTA 5A5KA 2CAQA 1PL2A 2HE3A 3DXBA 3FK8A 3TKQA 2VOCA 1J9BA 3D22A 5JCUA 3QOUA 5AGYA 1AXDA 3C73A 1O8XA 1H75A 2PMTA 5ELAA 5D93A 5DAKA 1WE0A 4TRXA 1XPVA 3CRTA 3IAS2 2R0PA 5KOXA 1EEJA 1XW5A 2HSNA 1V9WA 3IHQA 2VL2C 2C0EA 3QFAC 1GTUA 3CSHA 3HA9A 2JL4A 2E2GA 5E59A 1PN0A 3O76A 2DIYA 2IIYA 4L0WA 1GUKA 1AW9A 2WZ9A 1YQ1A 4DSQA 2GQKA 4IP1A 2XC2A 5J4UA 4OWYA 2L6CA 2LKUA 4RQRA 4IJ3A 13GSA 1T3BA 5GSTA 1OYJA 3HY2A 1X5DA 1NHYA 1QFNA 1UVZA 1WIKA 3HYPA 5H5RA 3GN3A 5CAXA 4DEJA 3UJ1A 1K0DA 2H19A 2K8VA 3ERFA 2DJJA 1XCCA 3GV1A 2AV4A 3D0ZA 1Z5YE 3APSA 3TKSC 2C3QA 3VWXA 3TKSE 1WRYA 1WOUA 2VM1A 4F0BA 4NWYA 5IPHA 2IMEA 5ECPB 4YQMA 4POKA 1V58A 4MABA 2CAIA 3H93A 3GTUA 3TB2A 5J47A 1EOGA 3ERWA 2HRAA 3FW2A 3HVXA 5F8BA 2L5OA 2MBSA 1ABAA 3ZFBA 3FZ9A 5CP1A 5F05A 3LXTA 4KSOA 1SYXA 2H1AA 4YKGA 4NV2A 4LMWA 3UBKA 5ECKB 3FZ4A 4TR3A 3A5WA 2C0DA 3DWVA 3PGTA 4I97A 2IN3A 4ZXGA 4HZ2A 2ALBA 5J40A 4XHMA 1OAZA 2MMNA 4F0CA 1CQHA 4MJAA 2YNXA 1X0RA 4IW9A 4BVYB 6GSSA 2OE0A 3QCPA 3K8NA 2C4JA 3CRUA 2LJRA 1B9YC 4K5RA 7GSSA 4ZIJA 1BAYA 3DVXA 3RHCA 2N5FA 3ZMLA 1S3AA 1OE8A 3RPPA 3KXOA 2D2ZA 1T4YA 1Z9HA 4Z2RA 4KAEA 1XVWA 1W89A 2PWJA 1LU4A 1C72A 1E2YA 3KTBA 2XPEA 1Z6MA 2P5RA 1JZOA 4K2DA 4N11A 1A2LA 1ST9A 5D9VA 4D73A 4TR1A 1FAAA 3Q18A 2EFEA 5HFKA 2JSZA 2E2MA 1A2MA 4LMVA 1OC3A 1ZL9A 4QL9A 2HXKA 1ERTA 2IMDA 3ZFLA 6GSTA 2VIMA 3TJBA 2FWEA 2OBKA 3ME7A 5D8IA 4XCSA 3ZIVA 5HR1A 18GSA 4Q5NA 4CDOA 5F07A 2DJ1A 4CY8A 1F37A 3IA1A 1QQ2A 1ERVA 1OVNA 4I2UA 5KOWA 1XWAA 2OE1A 2LS5A 1PKWA 1WWJA 4OFTA 3TU3B 5G30A 2FWGA 4GSTA 1SU9A 3GKNA 4IJIA 2PU9C 4GXZA 5F06A 3FZAA 3KIJA 1AC1A 1XOAA 2VAFA 5HR2A 1GTBA 4G0KA 1T1VA 4KUNA 2GZYA 2CX3A 1PL1A 5DBQA 2YANA 2O89A 4PUAA 1THXA 1F3BA 3QMXA 2VL9A 2H75A 3HCZA 3GMFA 1YF1A 5B7CA 3TRPA 3BJ5A 2VCQA 2TRXA 1WPIA 2GT6A 1T4ZA 2PVOC 2DKIA 4HU9A 4OFMA 4YQVA 4EDYA 1K0CA 4HS1A 2O85A 4TXOB 1M9BA 3E3EA 3VURA 3L9VA 3LG6A 2A2PA 4WETA 1GLQA 3UBLA 3N5OA 2L6DA 4F03A 2R0GA 3PINA 1WP0A 1UC7A 3NZNA 1Q4JA 1EGRA 2IMKA 5J4YA 4HDEA 4O5QA 2R2JA 3M8NA 4ECCA 1SKWB 3I6AA 3RHBA 1QK8A 5G5FA 1A23A 1SKRB 4XRAA 5A5HA 4KDYA 1JZRA 1G7OA 3A3TA 1OKTA 4ILFA 3IK7A 4RI7A 2FA8A 4NHWA 4TN8A 3I9V2 4HEA2 4PTSA 2L4CA 3EPTA 1WJKA 4BWSA 2H8LA 4KF9A 3S9FA 1GTAA 2CVDA 4XRDA 5FT3A 4ZL9A 4ZBBA 3SWLA 3DRNA 4PX1A 1ACVA 2LNSA 4MPGA 4EIPA 5JWQB 4K0GA 2L4QA 2VM2A 2OADA 1OC9A 5DQYA 1Z7RA 2YCDA 1B4QA 1NW2A 3D4TA 4FH8A 1VF3A 1MD3A 1NSWA 1K0AA 5JCGA 1Y25A 1BG1A 2H1GA 5IIZA 2NTOA 3MWHA 4FIWA 1VF4A 5INYA 1OKDA 3H4KA 3W6GA 2C3TA 2O87A 2I4AA 3KCMA 2B6MA 3C71A 1DE2A 4PXOA 2H6YA 3DKSA 3IPZA 1SYRA 4L5OA 3APQA 1B8XA 4MF6A 4TW5A 3VFIA 2DJ2A 1PN9A 1XXUA 1V2AA 4YAVA 1FOHA 2IFQA 3L78A 1HNBA 3KEBA 5CRDA 5ECOB 3LORA 4BVYA 3ZL5A 4YH2A 2A2RA 1MEKA 1J0FA 3H8QA 4JU5A 2GSSA 2ES7A 2ON5A 3VPQA 5ID2B 2F3MA 2RUFA 4TXVA 1THOA 1QXHA 3R3EA 3CTFA 5IO2A 3CTGA 1GSEA 1BF5A 2KP1A 4EXJA 2I3YA 2A4VA 1T8EB 2FY6A 2PN8A 1TK0B 4MF5A 3PR8A 5IMFA 2V1MA 4X4JA 4WR5A 4TR1B 4N0ZA 2H66A 2OBIA 2DMMA 3AY8A 1M7TA 2QA2A 2X8HA 2H0IA 1GRXA 5D9XA 4GWRA 4PNGA 5JWOB 2PBJA 1GSQA 2LJAA 1M9AA 3VK9A 1XVQA 1HYUA 2H72A 2GGTA 4USSA 1JLWA 2PPTA 3GFKA 5A4UA 1FB0A 3TCOA 3TJFA 3GKKA 5G5EA 3GURA 2L57A 9GSSA 4I6XA 3WGEA 3KMOA 2DJ3A 3MNGA 1GH2A 3UL3A 3HVVA 3A2XA 4AKIA 5AIVA 1FO5A 3IE3A 2KUCA 1V98A 4A5PA 2GSTA 1DSBA 3F4TA 3IAM2 5EY6A 4KCAA 1SVOA 1XIYA 3ZTLA 3ZYWA 4MF7A 3F6FA 2MZCA 3A2VA 3GX8A 2GVPA 2JADA 3CSIA 2AJQB 5IOWA 2BJXA 3HZ4A 4XS6A 4CHSA 3DVWA 1HNCA 2RUEA 3IOSA 4MK3A 5LCZA 4F82A 2GZPA 1S3CA 1R26A 4ZBDA 4F9ZA 1X9MB 1SK0A 2X64A 1TI3A 2UV8G 4MJBA 3QPMA 4FO5A 4OFNA 4K9ZA 3HMJG 1AIUA 3EMXA 2CV4A 2M46A 1K3OA 1VGLA 1YY7A 4KNDA 2DSAA 3QR6A 4WBJA 2H30A 4TXOA 3ZMKA 2IJYA 1A8YA 3TJGA 1BYEA 3EYTA 3CYNA 4WF5A 4MJEA 4LA1A 2IL3A 2X8CA 5ECSA 2NVLA 1XWCA 1NM3A 5CRHA 5IM9A 2BTOT 4GCIA 5DJMA 2GSRA 3IC4A 3KM6A 3G9BA 3P7XA 1YJ6A 4WXTA 1A0RP 1EGOA 2EFDA 1GP1A 5A5HB 3V1WA 3TRXA 2KHPA 3KGKA 2YWIA 4XIHA 4RI6A 3MSZA 3WT1A 4ID0A 4MZWA 2PUKC 4EF0A 1U3AA 4G9HA 2DBCA 5AISA 1GWCA 4GQFA 2G2QA 1K0NA 1HD2A 1AAZA 3UARA 4HU7A 1UA5A 3GKXA 1V57A 4MLYA 1OC9B 4DSSA 1QGVA 4KGIA 1FW1A 2QA1A 3CWGA 2DMLA 2QSIA 1IYIA 3LYPA 1ZZYA 4E68A 1PKZA 1JZDA 2FGXA 16GSA 6GSUA 4MA9A 2YV7A 3U5RE 2YJHA 3U6VA 1F3AA 1O7UA 1TRUA 3JCML 1H4OA 1BG5A 3EVIA 2BMXA 4I2TA 3MDKA 5DQSA 3GA4A 1ZYEA 2FHEA 2R5GA 2O8VB 2VCTA 2JZRA 3VI7A 4V2NA 1UN2A 2DLXA 5BMUB 2NPBA 2C3NA 1BJXA 4TOPA 1AQWA 5A1NB 2E0QA 3MIXA 4AI6A 2IFQB 5DVBA 3KZQA 4AGSA 2YWMA 3QAWA 3G7JA 1KEBA 1QMVA 2X99A 3KTLA 3CXGA 4G2EA 1AUCA 1XW6A 2CQ9A 3HD5A 5ID2A 1M99A 1NHOA 5CNWA 2HRNA 4EDZA 2AB6A 1R5AA 4IBPA 5G1LA 1EOHA 1B4PA 4ZILA 5ECRB 1TTZA 1YEPA 3UVTA 3VWWA 3GH6A 3IDVA 2XPDA 2L5LA 4V2MA 1T7PB 3P90A 3RPNA 2EFCA 5EPFA 2TRCP 1TU7A 3C1RA 4F2IA 1TU8A 3BD2A 1K0BA 1ZCPA 1GL8A 4TR4A 3ZLPA 5L71A 2R0CA 4BPYA 2DKHA 2XBQA 4WEYA 8GSSA 3WGXA 2C0FA 1SD8A 4L0UA 4XS4B 3SBCA 3LGCA 3TOTA 1USBA 1AQXA 2H6ZA 3FYGA 2A4HA 1PGTA 2NBSA 4HJMA 2CVKA 4IGJA 3RBTA 2VCWA 3KMNA 4KB3A 1VRSD 19GSA 3UVHA 5JWRB 3EC3A 1PSQA 1GSFA 1V40A 2VL2A 2HSHA 1X9WB 3F9UA 2X49A 5ENUA 4FYUA 4OD7A 1O73A 2YN1A 4EO3A 4KW6A 2LJKA 4Z2TA 3MAKA 2GLRA 4EUYA 3L4NA 4AJ7A 2X8GA 4MPFA 5D73A 5B8BA 2WJUA 4N10A 5ECQB 1YEXA 3ZIJA 2AUVA 3M9JA 4J2FA 1ZYQB 3L0HA 6GSVA 3FR3A 3P2AA 3E0UA 1YKAA 2GQMA 3HZ8A 2ON7A 2ZNMA 2V41A 2H73A 4POMA 1G6YA 4AKHA 4JR4A 1BX9A 2J9HA 4K8MA 3UIWA 1FG4A 3TKSA 2PVQA 1Y6EA 1B9XC 3GRXA 2P31A 2N5AA 4QMKA 2B3SA 4KA0A 1XWBA 2UZ8A 3DMLA 4WR4A 4JR6A 3P8WA 2IPAA 4V1Ap 5D96A 1FHEA 3FR9A 1GSSA 5AN1A 1GULA 1ERUA 4MH2A 4WF4A 3ZRDA 5IMAA 1ML6A 4HI7A 2GZZA 3C8EA 2FD3A 5A4VA 4X43A 5CYYA 5A34B 4GSSA 2N5BA 1XBSA 2C1YA 4O32A 2GQLA 1JHBA 4W66A 11GSA 3TOUA 4DSSB 3QAVA 2MBTA 5COHA 2FCHA 4JE1A 5GAPD 3E9JB 3HHVA 2HSMA 17GSA 4IELA 1X5EA 2HYXA 2YWNA 1G6WA 2H71A 2ZUPA 3IHGA 1EEMA 2DC5A 4L5LA 1G7EA 3C7MA 4AF2A 5HR0A 1U87A 4XS1A 2WCIA 2R37A 4KDUA 5G1KA 5EL8A 4NPBA 4ZBAA 4DSRA 5JCWA 1HQOA 2IWTA 3QAGA 2CZ3A 2XBIA 3BOAA 4K7OA 5BMUA 2G0FA 3ERGA 4ZB6A 1K0MA 5A1NA 2WB9A 2EC4A 4ICYA 2YWOA 2HQTA 5DALB 4I8BA 3GX0A 2EIQA 4ML1A 4ZB8A 4X1UA 3GNJA 2XHFA 1SKSB 3UMAA 4NHZA 3N9JA 2E7PA 3ED3A 1GSUA 4JZQA 2MMOA 5BRTA 5ABRA 3ZZXA 3EE2A 2YP6A 3LYKA 3LWAA 1YZXA 3BBYA 3VPTA 5HR3A 5J5NA 1SL0B 2A2SA 5IQYA 2CZ2A 4O92A 2RM6A 4BL7A 1I5GA 2OT3A 2MMZA 1PRXA 3GUSA 1M2BA 14GSA 4EE0A 1M2DA 5GSSA 2WDUA 4OCEA 2I1UA 4KSMA 4K1FA 4Z7XA 2C8UA 4GQCA 2B1LA 4TKYA 4KCEA 3UOMA 2QGVA 2F51A 3I43A 2QC7A 3HKRA 3TJJA 20GSA 6GSXA 3KH9A 1OC8A 1YF0A 3KP9A 1TXUA 2F8FA 4Q5QA 2VCVA 5IMVA 3W8SA 1URMA 3J7Yk 1LJRA 1SL2B 2RM5A 3D5JA 4XS4A 1GNWA 1TK8B 2YOIA 4POBA 5D9WA 3GL3A 3APOA 4NMUA 1Y1UA 3A2WA 2H1BA 4HZ4A 3ZITA 4BVXB 1IYHA 1TOFA 3GKMA 4Q5FA 4FYBA 4Z2UA 3EU3A 5IOXA 1JFUA 5B8AA 3Q6OA 1PX6A 1FVKA 2WRTA 2MYGA 4ZL8A 2H70A 1T00A 3L9UA 3NIVA 3IV4A 4LL1B 3QFBC 1EV4A 4MNNA 5ECHB 3IRAA 2LRTA 1XFLA 2CVBA 4NV5A 2IMFA 1GLPA 6GSYA 5HQPA 1SK1A 2REMA 2OACA 2K9FA 1PQNA 5F0GA 3QD9A 1F9MA 2ZCTA 1J08A 1X5CA 1HNAA 4IQAA 4E8HA 1TRVA 4GF0A 2LEGA 3ZVJA 2B7KA 3F3QA 2AAWA 4MZCA 2HFDA 5E4WA 4LLRA 4IS0A 4ECBA 4XTSA 3LJRA 2VKZG 3Q74A 4ECIA 2GS3A 2C80A 1WMJA 3H79A 4GTUA 1MDIA 2F8AA 1EWXA 3F3RA 5KEJA 4RUVA 4JEDA 4MJCA 5DCHA 1F2EA 5G2ZA 1DBYA 5B6NA 4YQUA 4K7NA 4MP4A 2B1KA 1TJDA 3CBUA 4HQZA 5CRWA 4LL4B 2WULA 3EURA 2WFCA 2V6OA 5IO0A 5ECIB 4IP6A 2OKAA 2KOKA 2H0HA 4ECJA 4BWQA 2YZUA 1N2AA 5FWGA 3O3TA 4EL1A 5GAND 1TKDB 4G0LA 5CO3A 3LQ7A 1VF2A 3LEFA 1R4WA 2J23A 1VF1A 3LFLA 3KP8A 3HDCA 1QUWA 5DCGA 4QQ7A 3F0IA 1GNEA 5A34A 2LUSA 3EWLA 3VLNA 1GSYA 2R4VA 3F63A 1EP8A 1O8WA 2GT5A 2VCZA 3WD6A 3GYKA 2VL3A 2HZEB 2LV3A 2OA7A 1XZOA 2HSMB 3OR5A 2VCXA 1TI1A 2GSQA 4IN0A 2EIOA 4IKHA 3DIEA 4POLA 2B7JA 2GTUA 3J7Yb 1EV9A 1K0OA 1ZYNA 1Z7PA 1ON4A 1O85A 4NXIA 2YZHA 5ECNB 4ZB9A 1A0FA 3F8UA 1X9SB 2FWFA 3UEMA 3WT2A 4Q5RA 2O7KA 3M9KA 4GLTA 1ZOFA 1N25A 1RQMA 2EIRA 2X4AA 3CMIA 1ZMAA 1R5PA 2VO4A 1R7HA 5C00A 2K8SA 2HSYA 1XWKA 3KH7A 5IMCA 5LD0A 1SL1B 2P5QA 1OE7A 4G19A 3TKPA 1W4VA 3ME8A 3IBHA 2WGRA 2HLSA 3HJMA 3W8JA 4AJ6A 4QL7A 2B5XA 2TIRA 5DALA 4TR0A 1JLVA 4OMVA 4MH3A 1RW1A 2I9HA 3GSTA 2LRCA 4G01A 2KP2A 3VWUA 4AKGA 1Z6NA 2CT6A 2H1LA 3ZVJD 4G10A 2M72A 4K6XA 4FQUA 3IK9A 1PX7A 5KN3A 3ISOA 3NOFA 4O5UA 1K3YA 4BL7B 1RK4A 1O6JA 3M0FA 2H0GA 3IC8A 5J3RA 4ULXA 1FVJA 3FEUA 4OO5A 4PUFC 2HZFA 3HJOA 2M80A 4PQ1A 2VLUA 1S3DA 4EC0A 4PQIA 2CA8A 4H86A 3R2QA 5J9CA 6GSWA 3FRCA 1MTCA 3FZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CRG A;  4E8E A;  10GS A;  3FY7 A;  1TRS A;  4KE3 A;  2LQQ A;  2HT9 A;  3M3M A;  5DJL A;  2RLI A;  3PPU A;  1DE1 A;  5C04 A;  2LST A;  1N8J A;  3TRQ A;  2R6K A;  1G0T A;  5G31 A;  2HRK A;  3M1G A;  3EU4 A;  3CSJ A;  2VLT A;  3IXR A;  4BA7 A;  5AIX A;  2JU5 A;  4P3Y B;  1A8L A;  1M0U A;  2V6K A;  5IPG A;  3RAZ A;  2IMI A;  3O6T A;  1MDK A;  1FOV A;  4BVX A;  5CRE A;  3G7I A;  5HFG A;  2VD0 A;  3ZRE A;  1JZW A;  2AYT A;  5B6M A;  1PA3 A;  4GSN A;  1I9D A;  1SJZ A;  5D9T A;  3D21 A;  4N30 A;  1BED A;  2LRN A;  2LTK A;  4IQ1 A;  3GHA A;  2YPM A;  5IMD A;  3F6D A;  2FUG 2;  4N0V A;  1GSD A;  4K0N A;  1EZK A;  1SJ6 A;  3GSS A;  4O5R A;  1DUG A;  4J56 E;  3I69 A;  3US3 A;  3VI5 A;  3RDW A;  4PUR A;  1Z3E A;  4OO4 A;  2RII A;  5J41 A;  5KN2 A;  1A2J A;  1KTE A;  2LNT A;  2FLS A;  3EMP A;  2DIZ A;  2QKE A;  1A24 A;  4PNF A;  2PER A;  1TRW A;  1XOB A;  3BCI A;  2CX4 A;  4G0I A;  5DAK B;  1ERW A;  1U3I A;  2JZS A;  3KJY A;  2KLX A;  1SJI A;  3DEX A;  1U6T A;  2F9S A;  3KD0 A;  5H5Q A;  1E6B A;  2HSN B;  2MMA A;  5EVO A;  1MDJ A;  4DVC A;  1ILO A;  12GS A;  4GRF A;  3H1N A;  2H1D A;  2V32 A;  22GS A;  3FHK A;  2WS2 A;  5A4W A;  3IR4 A;  4HUA A;  3D6I A;  3GIX A;  1TP9 A;  2AHE A;  2FNO A;  5IMZ A;  4X0X A;  1GTI A;  3GH9 A;  4V2L A;  3QDN A;  4FYC A;  4YAP A;  2VUP A;  3WGD A;  1LBK A;  2OE3 A;  3DYR A;  5LNK e;  1TW9 A;  2V2G A;  4AJ8 A;  1B48 A;  3EIN A;  5H5S A;  4HJ2 A;  2HZE A;  3UAP A;  2LQO A;  2HRF A;  4MZB A;  1BQ7 A;  2YJ7 A;  4K7I A;  4WKW A;  1Q98 A;  2B5Y A;  3GL5 A;  2C0G A;  4HOJ A;  1MD4 A;  2H6X A;  1SEN A;  4JRR A;  4L8E A;  4MCU A;  3GTU B;  4JBB A;  4ACS A;  2K6V A;  3HJP A;  3VWV A;  3D4M A;  2VLV A;  3FKF A;  4KX4 A;  2DJK A;  2HI7 A;  1FB6 A;  3DD3 A;  2H01 A;  5ECL B;  3TUE A;  3LXZ A;  4EVM A;  2OJL A;  3TJK A;  1PMT A;  2I81 A;  4MDC A;  5KN0 A;  5ECM B;  4O7H A;  1YDK A;  2H74 A;  1YKC A;  3Q19 A;  4MMM A;  1GUH A;  3HVS A;  4PQH A;  4OCF A;  3HXS A;  1AQV A;  1U88 A;  2YV9 A;  2NDO A;  4ZL7 A;  3DGQ A;  2HNL A;  1XWG A;  1O81 A;  2PGT A;  3BCK A;  4V1A g;  5FHI A;  4ML6 A;  2JAC A;  4KDX A;  2K18 A;  2VD1 A;  5ELG A;  2DJ0 A;  3TDG A;  2Z9S A;  4TVE A;  3F4S A;  2GDR A;  2JSY A;  1EP7 A;  3FR6 A;  4D73 B;  1M2A A;  5J9B A;  1ZGN A;  3TKR A;  4J57 E;  3C1S A;  2HRK B;  1KBN A;  2B5E A;  1KNG A;  5KN1 A;  3TGZ A;  3PH9 A;  2R3X A;  3LSZ A;  5DDL A;  4KH7 A;  4ISD A;  4NAX A;  1TDI A;  1F6M C;  5HFI A;  1K3L A;  4RQX A;  4IVF A;  4HQS A;  2L59 A;  4WBR D;  4PGT A;  1TXX A;  4I5Q A;  1SK2 A;  5GZZ B;  1PD2 1;  2FA4 A;  3L9S A;  4IHU A;  1SD9 A;  1XW9 A;  4EKZ A;  1CQG A;  1TK5 B;  3WYW A;  1GUM A;  4CW9 A;  2P0G A;  3F4R A;  2FWH A;  3G7Y A;  2H76 A;  2JZT A;  5A5K A;  2CAQ A;  1PL2 A;  2HE3 A;  3DXB A;  3FK8 A;  3TKQ A;  2VOC A;  1J9B A;  3D22 A;  5JCU A;  3QOU A;  5AGY A;  1AXD A;  3C73 A;  1O8X A;  1H75 A;  2PMT A;  5ELA A;  5D93 A;  5DAK A;  1WE0 A;  4TRX A;  1XPV A;  3CRT A;  3IAS 2;  1EEJ A;  1XW5 A;  1V9W A;  3IHQ A;  2VL2 C;  2C0E A;  3QFA C;  1GTU A;  3CSH A;  3HA9 A;  2JL4 A;  2E2G A;  5E59 A;  3O76 A;  2DIY A;  2IIY A;  4L0W A;  1GUK A;  1AW9 A;  2WZ9 A;  1YQ1 A;  4DSQ A;  2GQK A;  4IP1 A;  2XC2 A;  5J4U A;  4OWY A;  2L6C A;  2LKU A;  4RQR A;  4IJ3 A;  13GS A;  1T3B A;  5GST A;  1OYJ A;  3HY2 A;  1X5D A;  1NHY A;  1QFN A;  1UVZ A;  1WIK A;  3HYP A;  5H5R A;  3GN3 A;  5CAX A;  4DEJ A;  3UJ1 A;  1K0D A;  2H19 A;  2K8V A;  3ERF A;  2DJJ A;  1XCC A;  3GV1 A;  2AV4 A;  3D0Z A;  1Z5Y E;  3APS A;  3TKS C;  2C3Q A;  3VWX A;  3TKS E;  1WRY A;  1WOU A;  2VM1 A;  4F0B A;  4NWY A;  5IPH A;  2IME A;  5ECP B;  4YQM A;  4POK A;  1V58 A;  4MAB A;  2CAI A;  3H93 A;  3GTU A;  3TB2 A;  1EOG A;  3ERW A;  2HRA A;  3FW2 A;  3HVX A;  5F8B A;  2L5O A;  2MBS A;  1ABA A;  3ZFB A;  3FZ9 A;  5CP1 A;  5F05 A;  3LXT A;  4KSO A;  1SYX A;  2H1A A;  4NV2 A;  4LMW A;  3UBK A;  5ECK B;  3FZ4 A;  4TR3 A;  3A5W A;  2C0D A;  3DWV A;  3PGT A;  4I97 A;  2IN3 A;  4ZXG A;  4HZ2 A;  2ALB A;  4XHM A;  1OAZ A;  2MMN A;  4F0C A;  1CQH A;  4MJA A;  2YNX A;  1X0R A;  4IW9 A;  4BVY B;  6GSS A;  2OE0 A;  3QCP A;  3K8N A;  2C4J A;  3CRU A;  2LJR A;  1B9Y C;  7GSS A;  4ZIJ A;  1BAY A;  3DVX A;  3RHC A;  2N5F A;  3ZML A;  1S3A A;  1OE8 A;  3RPP A;  3KXO A;  2D2Z A;  1T4Y A;  1Z9H A;  4KAE A;  1XVW A;  1W89 A;  2PWJ A;  1LU4 A;  1C72 A;  1E2Y A;  3KTB A;  2XPE A;  1Z6M A;  2P5R A;  1JZO A;  4K2D A;  4N11 A;  1A2L A;  1ST9 A;  5D9V A;  4D73 A;  4TR1 A;  1FAA A;  3Q18 A;  5HFK A;  2JSZ A;  2E2M A;  1A2M A;  4LMV A;  1OC3 A;  1ZL9 A;  4QL9 A;  2HXK A;  1ERT A;  2IMD A;  3ZFL A;  6GST A;  2VIM A;  3TJB A;  2FWE A;  2OBK A;  3ME7 A;  5D8I A;  4XCS A;  3ZIV A;  5HR1 A;  18GS A;  4Q5N A;  4CDO A;  5F07 A;  2DJ1 A;  1F37 A;  3IA1 A;  1QQ2 A;  1ERV A;  1OVN A;  4I2U A;  1XWA A;  2OE1 A;  2LS5 A;  1PKW A;  1WWJ A;  4OFT A;  5G30 A;  2FWG A;  4GST A;  1SU9 A;  3GKN A;  4IJI A;  2PU9 C;  4GXZ A;  5F06 A;  3FZA A;  3KIJ A;  1AC1 A;  1XOA A;  2VAF A;  5HR2 A;  1GTB A;  4G0K A;  1T1V A;  4KUN A;  2GZY A;  2CX3 A;  1PL1 A;  5DBQ A;  2YAN A;  2O89 A;  4PUA A;  1THX A;  1F3B A;  3QMX A;  2VL9 A;  2H75 A;  3HCZ A;  3GMF A;  1YF1 A;  5B7C A;  3TRP A;  3BJ5 A;  2VCQ A;  2TRX A;  1WPI A;  2GT6 A;  1T4Z A;  2PVO C;  4HU9 A;  4OFM A;  4YQV A;  4EDY A;  1K0C A;  4HS1 A;  2O85 A;  4TXO B;  1M9B A;  3E3E A;  3VUR A;  3L9V A;  3LG6 A;  4WET A;  1GLQ A;  3UBL A;  3N5O A;  2L6D A;  4F03 A;  3PIN A;  1WP0 A;  1UC7 A;  3NZN A;  1Q4J A;  1EGR A;  2IMK A;  4HDE A;  2R2J A;  3M8N A;  4ECC A;  1SKW B;  3I6A A;  3RHB A;  1QK8 A;  5G5F A;  1A23 A;  1SKR B;  4XRA A;  4KDY A;  1JZR A;  1G7O A;  3A3T A;  1OKT A;  4ILF A;  3IK7 A;  4RI7 A;  2FA8 A;  4NHW A;  4TN8 A;  3I9V 2;  4HEA 2;  4PTS A;  2L4C A;  1WJK A;  4BWS A;  2H8L A;  4KF9 A;  3S9F A;  1GTA A;  2CVD A;  4XRD A;  5FT3 A;  4ZL9 A;  4ZBB A;  3SWL A;  3DRN A;  4PX1 A;  1ACV A;  2LNS A;  4MPG A;  5JWQ B;  4K0G A;  2VM2 A;  2L4Q A;  2OAD A;  1OC9 A;  5DQY A;  1Z7R A;  2YCD A;  1B4Q A;  1NW2 A;  3D4T A;  4FH8 A;  1VF3 A;  1MD3 A;  1NSW A;  1K0A A;  5JCG A;  1Y25 A;  2H1G A;  5IIZ A;  2NTO A;  3MWH A;  4FIW A;  1VF4 A;  5INY A;  1OKD A;  3H4K A;  3W6G A;  2C3T A;  2O87 A;  2I4A A;  3KCM A;  2B6M A;  3C71 A;  1DE2 A;  4PXO A;  2H6Y A;  3DKS A;  3IPZ A;  1SYR A;  4L5O A;  3APQ A;  1B8X A;  4MF6 A;  4TW5 A;  3VFI A;  2DJ2 A;  1PN9 A;  1XXU A;  1V2A A;  4YAV A;  2IFQ A;  3L78 A;  1HNB A;  3KEB A;  5CRD A;  5ECO B;  3LOR A;  4BVY A;  3ZL5 A;  4YH2 A;  2A2R A;  1MEK A;  1J0F A;  3H8Q A;  4JU5 A;  2GSS A;  2ES7 A;  2ON5 A;  3VPQ A;  5ID2 B;  2F3M A;  2RUF A;  4TXV A;  1THO A;  1QXH A;  3R3E A;  3CTF A;  5IO2 A;  3CTG A;  1GSE A;  2KP1 A;  4EXJ A;  2I3Y A;  2A4V A;  1T8E B;  2FY6 A;  2PN8 A;  1TK0 B;  4MF5 A;  3PR8 A;  5IMF A;  2V1M A;  4WR5 A;  4TR1 B;  4N0Z A;  2H66 A;  2OBI A;  2DMM A;  3AY8 A;  1M7T A;  2X8H A;  2H0I A;  1GRX A;  5D9X A;  4GWR A;  4PNG A;  5JWO B;  2PBJ A;  1GSQ A;  2LJA A;  1M9A A;  3VK9 A;  1XVQ A;  1HYU A;  2H72 A;  2GGT A;  4USS A;  1JLW A;  2PPT A;  3GFK A;  5A4U A;  1FB0 A;  3TCO A;  3TJF A;  3GKK A;  5G5E A;  3GUR A;  2L57 A;  9GSS A;  4I6X A;  3WGE A;  3KMO A;  2DJ3 A;  3MNG A;  1GH2 A;  3UL3 A;  3HVV A;  3A2X A;  5AIV A;  1FO5 A;  3IE3 A;  2KUC A;  1V98 A;  2GST A;  1DSB A;  3F4T A;  3IAM 2;  5EY6 A;  4KCA A;  1XIY A;  3ZTL A;  3ZYW A;  4MF7 A;  3F6F A;  2MZC A;  3A2V A;  3GX8 A;  2GVP A;  2JAD A;  3CSI A;  2AJQ B;  5IOW A;  2BJX A;  3HZ4 A;  4XS6 A;  4CHS A;  3DVW A;  1HNC A;  2RUE A;  3IOS A;  4MK3 A;  5LCZ A;  4F82 A;  2GZP A;  1S3C A;  1R26 A;  4ZBD A;  4F9Z A;  1X9M B;  1SK0 A;  2X64 A;  1TI3 A;  4MJB A;  3QPM A;  4FO5 A;  4OFN A;  4K9Z A;  1AIU A;  3EMX A;  2CV4 A;  2M46 A;  1K3O A;  1VGL A;  1YY7 A;  4KND A;  2DSA A;  3QR6 A;  4WBJ A;  2H30 A;  4TXO A;  3ZMK A;  2IJY A;  1A8Y A;  3TJG A;  1BYE A;  3EYT A;  3CYN A;  4WF5 A;  4MJE A;  4LA1 A;  2IL3 A;  2X8C A;  5ECS A;  2NVL A;  1XWC A;  1NM3 A;  5CRH A;  5IM9 A;  2BTO T;  4GCI A;  5DJM A;  2GSR A;  3IC4 A;  3KM6 A;  3G9B A;  3P7X A;  1YJ6 A;  4WXT A;  1A0R P;  1EGO A;  1GP1 A;  3V1W A;  3TRX A;  2KHP A;  3KGK A;  2YWI A;  4XIH A;  4RI6 A;  3MSZ A;  3WT1 A;  4ID0 A;  4MZW A;  2PUK C;  4EF0 A;  1U3A A;  4G9H A;  2DBC A;  5AIS A;  1GWC A;  4GQF A;  2G2Q A;  1K0N A;  1HD2 A;  1AAZ A;  3UAR A;  4HU7 A;  1UA5 A;  3GKX A;  1V57 A;  4MLY A;  1OC9 B;  4DSS A;  1QGV A;  4KGI A;  1FW1 A;  2DML A;  2QSI A;  1IYI A;  3LYP A;  1ZZY A;  1PKZ A;  1JZD A;  2FGX A;  16GS A;  6GSU A;  4MA9 A;  2YV7 A;  3U5R E;  2YJH A;  3U6V A;  1F3A A;  1O7U A;  1TRU A;  3JCM L;  1H4O A;  1BG5 A;  3EVI A;  2BMX A;  4I2T A;  3MDK A;  5DQS A;  3GA4 A;  1ZYE A;  2FHE A;  2R5G A;  2O8V B;  2VCT A;  2JZR A;  3VI7 A;  4V2N A;  1UN2 A;  2DLX A;  2NPB A;  2C3N A;  1BJX A;  4TOP A;  1AQW A;  2E0Q A;  2IFQ B;  5DVB A;  3KZQ A;  4AGS A;  2YWM A;  3QAW A;  3G7J A;  1KEB A;  1QMV A;  2X99 A;  3KTL A;  3CXG A;  4G2E A;  1AUC A;  1XW6 A;  2CQ9 A;  3HD5 A;  5ID2 A;  1M99 A;  1NHO A;  5CNW A;  2HRN A;  4EDZ A;  2AB6 A;  1R5A A;  4IBP A;  5G1L A;  1EOH A;  1B4P A;  4ZIL A;  5ECR B;  1TTZ A;  1YEP A;  3UVT A;  3VWW A;  3GH6 A;  3IDV A;  2XPD A;  2L5L A;  4V2M A;  1T7P B;  3P90 A;  3RPN A;  5EPF A;  2TRC P;  1TU7 A;  3C1R A;  4F2I A;  1TU8 A;  3BD2 A;  1K0B A;  1ZCP A;  1GL8 A;  4TR4 A;  3ZLP A;  5L71 A;  4BPY A;  2XBQ A;  4WEY A;  8GSS A;  3WGX A;  2C0F A;  1SD8 A;  4L0U A;  4XS4 B;  3SBC A;  3LGC A;  3TOT A;  1USB A;  1AQX A;  2H6Z A;  3FYG A;  1PGT A;  2NBS A;  4HJM A;  2CVK A;  4IGJ A;  3RBT A;  2VCW A;  3KMN A;  4KB3 A;  1VRS D;  19GS A;  3UVH A;  5JWR B;  3EC3 A;  1PSQ A;  1GSF A;  1V40 A;  2VL2 A;  2HSH A;  1X9W B;  3F9U A;  5ENU A;  4FYU A;  4OD7 A;  1O73 A;  2YN1 A;  4EO3 A;  4KW6 A;  2LJK A;  3MAK A;  2GLR A;  4EUY A;  3L4N A;  4AJ7 A;  2X8G A;  4MPF A;  5D73 A;  5B8B A;  2WJU A;  4N10 A;  5ECQ B;  1YEX A;  3ZIJ A;  2AUV A;  3M9J A;  4J2F A;  1ZYQ B;  3L0H A;  6GSV A;  3FR3 A;  3P2A A;  3E0U A;  1YKA A;  2GQM A;  3HZ8 A;  2ON7 A;  2ZNM A;  2V41 A;  2H73 A;  4POM A;  1G6Y A;  4JR4 A;  4K8M A;  1BX9 A;  2J9H A;  3UIW A;  1FG4 A;  3TKS A;  2PVQ A;  1Y6E A;  1B9X C;  3GRX A;  2P31 A;  2N5A A;  2B3S A;  4KA0 A;  1XWB A;  2UZ8 A;  3DML A;  4WR4 A;  4JR6 A;  3P8W A;  2IPA A;  4V1A p;  5D96 A;  1FHE A;  3FR9 A;  1GSS A;  5AN1 A;  1GUL A;  1ERU A;  4MH2 A;  4WF4 A;  3ZRD A;  5IMA A;  1ML6 A;  4HI7 A;  2GZZ A;  3C8E A;  2FD3 A;  5A4V A;  4X43 A;  5CYY A;  4GSS A;  2N5B A;  1XBS A;  2C1Y A;  4O32 A;  2GQL A;  1JHB A;  11GS A;  3TOU A;  4DSS B;  3QAV A;  2MBT A;  5COH A;  2FCH A;  4JE1 A;  5GAP D;  3E9J B;  3HHV A;  2HSM A;  17GS A;  4IEL A;  1X5E A;  2HYX A;  2YWN A;  1G6W A;  2H71 A;  2ZUP A;  1EEM A;  2DC5 A;  4L5L A;  1G7E A;  3C7M A;  4AF2 A;  5HR0 A;  1U87 A;  4XS1 A;  2WCI A;  2R37 A;  4KDU A;  5G1K A;  5EL8 A;  4NPB A;  4ZBA A;  4DSR A;  5JCW A;  1HQO A;  2IWT A;  3QAG A;  2CZ3 A;  2XBI A;  3BOA A;  4K7O A;  5BMU A;  2G0F A;  3ERG A;  4ZB6 A;  1K0M A;  2EC4 A;  2WB9 A;  2YWO A;  2HQT A;  5DAL B;  4I8B A;  3GX0 A;  2EIQ A;  4ML1 A;  4ZB8 A;  4X1U A;  3GNJ A;  2XHF A;  1SKS B;  3UMA A;  4NHZ A;  3N9J A;  2E7P A;  3ED3 A;  1GSU A;  4JZQ A;  2MMO A;  5ABR A;  3ZZX A;  3EE2 A;  2YP6 A;  3LYK A;  3LWA A;  1YZX A;  3BBY A;  3VPT A;  5HR3 A;  5J5N A;  1SL0 B;  2A2S A;  5IQY A;  2CZ2 A;  4O92 A;  2RM6 A;  4BL7 A;  1I5G A;  2MMZ A;  1PRX A;  3GUS A;  1M2B A;  14GS A;  4EE0 A;  1M2D A;  5GSS A;  2WDU A;  4OCE A;  2I1U A;  4KSM A;  4K1F A;  4Z7X A;  2C8U A;  4GQC A;  2B1L A;  4TKY A;  4KCE A;  3UOM A;  2QGV A;  2F51 A;  3I43 A;  2QC7 A;  3HKR A;  3TJJ A;  20GS A;  6GSX A;  3KH9 A;  1OC8 A;  1YF0 A;  3KP9 A;  2F8F A;  4Q5Q A;  2VCV A;  5IMV A;  3W8S A;  1URM A;  3J7Y k;  1LJR A;  1SL2 B;  2RM5 A;  3D5J A;  4XS4 A;  1GNW A;  1TK8 B;  2YOI A;  4POB A;  5D9W A;  3GL3 A;  3APO A;  4NMU A;  3A2W A;  2H1B A;  4HZ4 A;  3ZIT A;  4BVX B;  1IYH A;  1TOF A;  3GKM A;  4Q5F A;  4FYB A;  3EU3 A;  5IOX A;  1JFU A;  5B8A A;  3Q6O A;  1PX6 A;  1FVK A;  2WRT A;  2MYG A;  4ZL8 A;  2H70 A;  1T00 A;  3L9U A;  3NIV A;  3IV4 A;  4LL1 B;  3QFB C;  1EV4 A;  5ECH B;  3IRA A;  2LRT A;  1XFL A;  2CVB A;  4NV5 A;  2IMF A;  1GLP A;  6GSY A;  5HQP A;  1SK1 A;  2REM A;  2OAC A;  2K9F A;  1PQN A;  5F0G A;  3QD9 A;  1F9M A;  2ZCT A;  1J08 A;  1X5C A;  1HNA A;  4IQA A;  4E8H A;  1TRV A;  4GF0 A;  2LEG A;  3ZVJ A;  2B7K A;  3F3Q A;  2AAW A;  4MZC A;  2HFD A;  5E4W A;  4LLR A;  4IS0 A;  4ECB A;  4XTS A;  3LJR A;  3Q74 A;  4ECI A;  2GS3 A;  2C80 A;  1WMJ A;  3H79 A;  4GTU A;  1MDI A;  2F8A A;  1EWX A;  3F3R A;  5KEJ A;  4RUV A;  4JED A;  4MJC A;  5DCH A;  1F2E A;  5G2Z A;  1DBY A;  5B6N A;  4YQU A;  4K7N A;  4MP4 A;  2B1K A;  1TJD A;  3CBU A;  4HQZ A;  5CRW A;  4LL4 B;  2WUL A;  3EUR A;  2WFC A;  2V6O A;  5IO0 A;  5ECI B;  4IP6 A;  2OKA A;  2KOK A;  2H0H A;  4ECJ A;  4BWQ A;  2YZU A;  1N2A A;  5FWG A;  3O3T A;  4EL1 A;  5GAN D;  1TKD B;  4G0L A;  5CO3 A;  3LQ7 A;  1VF2 A;  3LEF A;  1R4W A;  2J23 A;  1VF1 A;  3LFL A;  3KP8 A;  3HDC A;  1QUW A;  5DCG A;  4QQ7 A;  3F0I A;  1GNE A;  2LUS A;  3EWL A;  3VLN A;  1GSY A;  2R4V A;  3F63 A;  1EP8 A;  1O8W A;  2GT5 A;  2VCZ A;  3WD6 A;  3GYK A;  2VL3 A;  2HZE B;  2LV3 A;  2OA7 A;  1XZO A;  2HSM B;  3OR5 A;  2VCX A;  1TI1 A;  2GSQ A;  4IN0 A;  2EIO A;  4IKH A;  3DIE A;  4POL A;  2B7J A;  2GTU A;  3J7Y b;  1EV9 A;  1K0O A;  1Z7P A;  1ON4 A;  1O85 A;  4NXI A;  2YZH A;  5ECN B;  4ZB9 A;  1A0F A;  3F8U A;  1X9S B;  2FWF A;  3UEM A;  3WT2 A;  4Q5R A;  2O7K A;  3M9K A;  4GLT A;  1ZOF A;  1RQM A;  2EIR A;  3CMI A;  1ZMA A;  1R5P A;  2VO4 A;  1R7H A;  5C00 A;  2K8S A;  2HSY A;  1XWK A;  3KH7 A;  5IMC A;  5LD0 A;  1SL1 B;  2P5Q A;  1OE7 A;  4G19 A;  3TKP A;  1W4V A;  3ME8 A;  3IBH A;  2WGR A;  2HLS A;  3HJM A;  3W8J A;  4AJ6 A;  4QL7 A;  2B5X A;  2TIR A;  5DAL A;  4TR0 A;  1JLV A;  4OMV A;  4MH3 A;  1RW1 A;  2I9H A;  3GST A;  2LRC A;  2KP2 A;  3VWU A;  1Z6N A;  2CT6 A;  3ZVJ D;  4G10 A;  2M72 A;  4K6X A;  4FQU A;  3IK9 A;  1PX7 A;  5KN3 A;  3ISO A;  3NOF A;  1K3Y A;  4BL7 B;  1RK4 A;  1O6J A;  3M0F A;  2H0G A;  3IC8 A;  5J3R A;  4ULX A;  1FVJ A;  3FEU A;  4OO5 A;  4PUF C;  2HZF A;  3HJO A;  2M80 A;  4PQ1 A;  2VLU A;  1S3D A;  4EC0 A;  4PQI A;  2CA8 A;  4H86 A;  3R2Q A;  5J9C A;  6GSW A;  3FRC A;  1MTC A;  3FZ5 A; 
#chains in the Genus database with same CATH topology
 5CRG A;  4E8E A;  10GS A;  3FY7 A;  1TRS A;  4KE3 A;  2LQQ A;  2HT9 A;  3M3M A;  2WW0 A;  2RLI A;  5DJL A;  3PPU A;  1DE1 A;  2WZS A;  5C04 A;  1M3J A;  2LST A;  1N8J A;  3TRQ A;  2R6K A;  1G0T A;  5G31 A;  2HRK A;  3M1G A;  3EU4 A;  3CSJ A;  2VLT A;  3IXR A;  4BA7 A;  5AIX A;  2JU5 A;  4P3Y B;  3A5I A;  1A8L A;  4GDF A;  2O5V A;  1M0U A;  2V6K A;  5IPG A;  3RAZ A;  2IMI A;  3O6T A;  1MDK A;  1FOV A;  4BVX A;  5CRE A;  3G7I A;  5HFG A;  2VD0 A;  3ZRE A;  1JZW A;  2AYT A;  5B6M A;  1PA3 A;  4GSN A;  1I9D A;  1SJZ A;  5D9T A;  3D21 A;  4N30 A;  1BED A;  2LRN A;  2LTK A;  4IQ1 A;  3GHA A;  2YPM A;  5IMD A;  4EIQ A;  4PI0 C;  3F6D A;  2FUG 2;  4N0V A;  1GSD A;  4K0N A;  1EZK A;  1SJ6 A;  3GSS A;  4O5R A;  1DUG A;  4J56 E;  3I69 A;  3US3 A;  3VI5 A;  3RDW A;  4PUR A;  1Z3E A;  4OO4 A;  2RII A;  5J41 A;  4YKF A;  5KN2 A;  3CHX C;  1A2J A;  1KTE A;  2LNT A;  2FLS A;  3EMP A;  2DIZ A;  2QKE A;  4CY6 A;  1A24 A;  4PNF A;  2PER A;  1TRW A;  1XOB A;  3BCI A;  2CX4 A;  2EFH A;  4G0I A;  5DAK B;  1ERW A;  1U3I A;  2JZS A;  3KJY A;  2KLX A;  1SJI A;  3LW9 A;  3DEX A;  1U6T A;  2F9S A;  3KD0 A;  5H5Q A;  1E6B A;  2HSN B;  2MMA A;  5EVO A;  1MDJ A;  4DVC A;  1ILO A;  12GS A;  2WW1 A;  4GRF A;  3H1N A;  2H1D A;  2V32 A;  22GS A;  3FHK A;  2WS2 A;  5A4W A;  3IR4 A;  4HUA A;  3D6I A;  3GIX A;  1TP9 A;  2AHE A;  2FNO A;  5IMZ A;  4X0X A;  1GTI A;  3GH9 A;  4V2L A;  3QDN A;  4FYC A;  4YAP A;  2VUP A;  3WGD A;  1LBK A;  2OE3 A;  3DYR A;  5LNK e;  1TW9 A;  2V2G A;  4ZB7 A;  4AJ8 A;  1B48 A;  3EIN A;  5H5S A;  1SVL A;  4HJ2 A;  2HZE A;  3UAP A;  2LQO A;  2HRF A;  4MZB A;  1BQ7 A;  2YJ7 A;  4K7I A;  4WKW A;  1Q98 A;  2B5Y A;  1S4B P;  3GL5 A;  2C0G A;  4HOJ A;  4K2X A;  1MD4 A;  2H6X A;  1SEN A;  4JRR A;  4L8E A;  4MCU A;  3GTU B;  4JBB A;  4ACS A;  2K6V A;  5J4V A;  3HJP A;  3VWV A;  3D4M A;  2VLV A;  3FKF A;  4KX4 A;  2WW3 A;  2DJK A;  2HI7 A;  1FB6 A;  3DD3 A;  2H01 A;  5ECL B;  3TUE A;  3LXZ A;  4EVM A;  2OJL A;  3TJK A;  3MYD A;  1PMT A;  2I81 A;  4MDC A;  5KN0 A;  5ECM B;  3RFR C;  4O7H A;  1YDK A;  2H74 A;  1YKC A;  3Q19 A;  4MMM A;  1GUH A;  3HVS A;  4PQH A;  4OCF A;  3HXS A;  1AQV A;  1U88 A;  2YV9 A;  2NDO A;  4ZL7 A;  3DGQ A;  2HNL A;  1XWG A;  1O81 A;  2PGT A;  3BCK A;  4V1A g;  1ZYP A;  5FHI A;  4ML6 A;  2JAC A;  4KDX A;  2K18 A;  2VD1 A;  5ELG A;  2DJ0 A;  3TDG A;  2Z9S A;  4TVE A;  3F4S A;  2GDR A;  2JSY A;  1EP7 A;  4AKX B;  3FR6 A;  4D73 B;  1M2A A;  5J9B A;  4K5S A;  1ZGN A;  1YVL A;  3TKR A;  4J57 E;  1SVM A;  3C1S A;  2HRK B;  4HSC X;  4N3Z A;  1KBN A;  2B5E A;  1KNG A;  5KN1 A;  3TGZ A;  3PH9 A;  2R3X A;  3LSZ A;  5DDL A;  4KH7 A;  4ISD A;  4NAX A;  1TDI A;  1F6M C;  5HFI A;  1K3L A;  4RQX A;  4IVF A;  4HQS A;  2L59 A;  4WBR D;  4PGT A;  1TXX A;  4I5Q A;  1SK2 A;  5GZZ B;  4PHZ C;  1PD2 1;  2FA4 A;  3L9S A;  4IHU A;  1SD9 A;  1XW9 A;  4EKZ A;  1CQG A;  1TK5 B;  3WYW A;  1GUM A;  4CW9 A;  2P0G A;  3F4R A;  2FWH A;  3G7Y A;  3FMW A;  2H76 A;  2JZT A;  5A5K A;  2CAQ A;  1PL2 A;  2HE3 A;  3DXB A;  3FK8 A;  3TKQ A;  2VOC A;  1J9B A;  3D22 A;  5JCU A;  3QOU A;  5AGY A;  1AXD A;  3C73 A;  1O8X A;  1H75 A;  2PMT A;  5ELA A;  5D93 A;  5DAK A;  1WE0 A;  4TRX A;  1XPV A;  3CRT A;  3IAS 2;  2R0P A;  5KOX A;  1EEJ A;  1XW5 A;  2HSN A;  1V9W A;  3IHQ A;  2VL2 C;  2C0E A;  3QFA C;  1GTU A;  3CSH A;  3HA9 A;  2JL4 A;  2E2G A;  5E59 A;  1PN0 A;  3O76 A;  2DIY A;  2IIY A;  4L0W A;  1GUK A;  1AW9 A;  2WZ9 A;  1YQ1 A;  4DSQ A;  2GQK A;  4IP1 A;  2XC2 A;  5J4U A;  4OWY A;  2L6C A;  2LKU A;  4RQR A;  4IJ3 A;  13GS A;  1T3B A;  5GST A;  1OYJ A;  3HY2 A;  1X5D A;  1NHY A;  1QFN A;  1UVZ A;  1WIK A;  3HYP A;  5H5R A;  3GN3 A;  5CAX A;  4DEJ A;  3UJ1 A;  1K0D A;  2H19 A;  2K8V A;  3ERF A;  2DJJ A;  1XCC A;  3GV1 A;  2AV4 A;  3D0Z A;  1Z5Y E;  3APS A;  3TKS C;  2C3Q A;  3VWX A;  3TKS E;  1WRY A;  1WOU A;  2VM1 A;  4F0B A;  4NWY A;  5IPH A;  2IME A;  5ECP B;  4YQM A;  4POK A;  1V58 A;  4MAB A;  2CAI A;  3H93 A;  3GTU A;  3HVN A;  3TB2 A;  5J47 A;  1EOG A;  3ERW A;  2HRA A;  3FW2 A;  3HVX A;  5F8B A;  2L5O A;  2MBS A;  1ABA A;  3ZFB A;  3FZ9 A;  5CP1 A;  5F05 A;  3LXT A;  4KSO A;  1SYX A;  2H1A A;  4YKG A;  4NV2 A;  4LMW A;  3UBK A;  5ECK B;  3FZ4 A;  4TR3 A;  3A5W A;  2C0D A;  3DWV A;  3PGT A;  4I97 A;  2IN3 A;  4ZXG A;  4HZ2 A;  2ALB A;  5J40 A;  4XHM A;  1OAZ A;  2MMN A;  4F0C A;  1CQH A;  4MJA A;  2YNX A;  1X0R A;  4IW9 A;  4BVY B;  6GSS A;  2OE0 A;  3QCP A;  3K8N A;  2C4J A;  3CRU A;  2LJR A;  1B9Y C;  4K5R A;  7GSS A;  4ZIJ A;  1BAY A;  3DVX A;  3RHC A;  2N5F A;  3ZML A;  1S3A A;  1OE8 A;  3RPP A;  3KXO A;  2D2Z A;  1T4Y A;  1Z9H A;  4Z2R A;  4KAE A;  1XVW A;  1W89 A;  2PWJ A;  1LU4 A;  1C72 A;  1E2Y A;  3KTB A;  2XPE A;  1Z6M A;  2P5R A;  1JZO A;  4K2D A;  4N11 A;  1A2L A;  1ST9 A;  5D9V A;  4D73 A;  4TR1 A;  1FAA A;  3Q18 A;  2EFE A;  5HFK A;  2JSZ A;  2E2M A;  1A2M A;  4LMV A;  1OC3 A;  1ZL9 A;  4QL9 A;  2HXK A;  1ERT A;  1PFO A;  2IMD A;  3ZFL A;  6GST A;  2VIM A;  3TJB A;  2FWE A;  2OBK A;  3ME7 A;  5D8I A;  4XCS A;  3ZIV A;  5HR1 A;  18GS A;  4Q5N A;  4CDO A;  5F07 A;  2DJ1 A;  1YEW C;  4CY8 A;  1F37 A;  3IA1 A;  4BIK A;  1QQ2 A;  2WVX A;  1ERV A;  1OVN A;  4I2U A;  5KOW A;  1XWA A;  2OE1 A;  2LS5 A;  1PKW A;  1WWJ A;  4OFT A;  3TU3 B;  5G30 A;  2FWG A;  4GST A;  1SU9 A;  3GKN A;  4IJI A;  2PU9 C;  4GXZ A;  5F06 A;  3FZA A;  3KIJ A;  1AC1 A;  1XOA A;  2VAF A;  5HR2 A;  1GTB A;  4G0K A;  1T1V A;  4KUN A;  2GZY A;  2CX3 A;  1PL1 A;  5DBQ A;  2YAN A;  2O89 A;  4PUA A;  1THX A;  1F3B A;  3QMX A;  2VL9 A;  2H75 A;  3HCZ A;  3GMF A;  1YF1 A;  5B7C A;  3TRP A;  3BJ5 A;  2VCQ A;  2TRX A;  1WPI A;  2GT6 A;  1T4Z A;  2PVO C;  2DKI A;  4HU9 A;  4OFM A;  4YQV A;  4EDY A;  1K0C A;  4HS1 A;  2O85 A;  4TXO B;  1M9B A;  3E3E A;  3VUR A;  3L9V A;  3LG6 A;  2A2P A;  4WET A;  1GLQ A;  3UBL A;  1M3I A;  3N5O A;  2L6D A;  4F03 A;  2R0G A;  3PIN A;  1WP0 A;  1UC7 A;  3NZN A;  1Q4J A;  1EGR A;  2IMK A;  5J4Y A;  4HDE A;  4O5Q A;  2R2J A;  3M8N A;  4ECC A;  1SKW B;  3I6A A;  3RHB A;  1QK8 A;  5G5F A;  1A23 A;  1SKR B;  4XRA A;  5A5H A;  4KDY A;  1JZR A;  1G7O A;  3A3T A;  1OKT A;  4ILF A;  3IK7 A;  4RI7 A;  2FA8 A;  4NHW A;  4TN8 A;  3I9V 2;  4HEA 2;  4PTS A;  2L4C A;  3EPT A;  1WJK A;  4BWS A;  2H8L A;  4KF9 A;  3S9F A;  1GTA A;  2CVD A;  4XRD A;  5FT3 A;  4ZL9 A;  4ZBB A;  3SWL A;  3DRN A;  4PX1 A;  1ACV A;  2LNS A;  4MPG A;  4EIP A;  5JWQ B;  4K0G A;  2L4Q A;  2VM2 A;  2OAD A;  1OC9 A;  5DQY A;  1Z7R A;  2YCD A;  1B4Q A;  1NW2 A;  3D4T A;  4FH8 A;  1VF3 A;  1MD3 A;  1NSW A;  1K0A A;  5JCG A;  1Y25 A;  1BG1 A;  2H1G A;  5IIZ A;  2NTO A;  3MWH A;  4FIW A;  1VF4 A;  5INY A;  1OKD A;  3H4K A;  3W6G A;  2C3T A;  2O87 A;  2I4A A;  3KCM A;  2B6M A;  2WVZ A;  3C71 A;  1DE2 A;  4PXO A;  2H6Y A;  3DKS A;  3IPZ A;  1SYR A;  4L5O A;  3APQ A;  1B8X A;  4MF6 A;  4TW5 A;  3VFI A;  2DJ2 A;  1PN9 A;  1XXU A;  1V2A A;  4YAV A;  1FOH A;  2IFQ A;  3L78 A;  1HNB A;  3KEB A;  5CRD A;  5ECO B;  3LOR A;  4BVY A;  3ZL5 A;  4YH2 A;  2A2R A;  1MEK A;  1J0F A;  3H8Q A;  4JU5 A;  2GSS A;  2ES7 A;  2ON5 A;  3VPQ A;  5ID2 B;  2F3M A;  2RUF A;  4TXV A;  1THO A;  1QXH A;  3R3E A;  3CTF A;  5IO2 A;  3CTG A;  1GSE A;  1BF5 A;  2KP1 A;  4EXJ A;  2I3Y A;  2A4V A;  1T8E B;  2FY6 A;  2PN8 A;  1TK0 B;  4MF5 A;  3PR8 A;  5IMF A;  2V1M A;  4X4J A;  4WR5 A;  4TR1 B;  4N0Z A;  2H66 A;  2OBI A;  2DMM A;  3AY8 A;  1M7T A;  2QA2 A;  2X8H A;  2H0I A;  1GRX A;  5D9X A;  4GWR A;  4PNG A;  5JWO B;  2PBJ A;  1GSQ A;  2LJA A;  1M9A A;  4PI2 C;  3VK9 A;  1XVQ A;  1HYU A;  2H72 A;  2GGT A;  4USS A;  1JLW A;  2PPT A;  3GFK A;  5A4U A;  2WVX B;  1FB0 A;  3TCO A;  3TJF A;  3GKK A;  5G5E A;  3GUR A;  2L57 A;  9GSS A;  4I6X A;  3WGE A;  3KMO A;  2DJ3 A;  3MNG A;  1GH2 A;  3UL3 A;  3HVV A;  3A2X A;  4AKI A;  5AIV A;  1FO5 A;  3IE3 A;  2KUC A;  1V98 A;  4A5P A;  2GST A;  1DSB A;  3F4T A;  3IAM 2;  5EY6 A;  4KCA A;  1SVO A;  1XIY A;  3ZTL A;  3ZYW A;  4MF7 A;  3F6F A;  2MZC A;  3A2V A;  3GX8 A;  2GVP A;  2JAD A;  3CSI A;  2AJQ B;  5IOW A;  2BJX A;  3HZ4 A;  4XS6 A;  4CHS A;  3DVW A;  1HNC A;  2RUE A;  3IOS A;  4MK3 A;  5LCZ A;  4F82 A;  2GZP A;  1S3C A;  1R26 A;  2WW2 A;  4ZBD A;  4F9Z A;  1X9M B;  1SK0 A;  2X64 A;  1TI3 A;  2UV8 G;  4MJB A;  3QPM A;  4FO5 A;  4OFN A;  4K9Z A;  3HMJ G;  1AIU A;  3EMX A;  2CV4 A;  2M46 A;  1K3O A;  1VGL A;  1YY7 A;  4KND A;  2DSA A;  3QR6 A;  4WBJ A;  2H30 A;  4TXO A;  3ZMK A;  2IJY A;  1A8Y A;  3TJG A;  1BYE A;  3EYT A;  3CYN A;  4WF5 A;  4MJE A;  4LA1 A;  2IL3 A;  2X8C A;  5ECS A;  2NVL A;  1XWC A;  1NM3 A;  5CRH A;  2O36 A;  5IM9 A;  2BTO T;  4GCI A;  5DJM A;  2GSR A;  3IC4 A;  1XG8 A;  3KM6 A;  3G9B A;  3P7X A;  1YJ6 A;  4WXT A;  1A0R P;  1EGO A;  2EFD A;  1GP1 A;  5A5H B;  3V1W A;  3TRX A;  2KHP A;  3KGK A;  2YWI A;  4XIH A;  4RI6 A;  3MSZ A;  3WT1 A;  4ID0 A;  4MZW A;  2PUK C;  4EF0 A;  1U3A A;  4G9H A;  2DBC A;  5AIS A;  1GWC A;  4GQF A;  2G2Q A;  1K0N A;  1HD2 A;  1AAZ A;  3UAR A;  4HU7 A;  1UA5 A;  3GKX A;  1V57 A;  4MLY A;  1OC9 B;  4DSS A;  1QGV A;  4KGI A;  1FW1 A;  2QA1 A;  3CWG A;  2DML A;  2QSI A;  1IYI A;  3LYP A;  1ZZY A;  4E68 A;  1PKZ A;  1I1I P;  1JZD A;  2FGX A;  16GS A;  6GSU A;  4MA9 A;  2YV7 A;  3U5R E;  2YJH A;  3U6V A;  1F3A A;  1O7U A;  1TRU A;  3JCM L;  1H4O A;  1BG5 A;  3EVI A;  2BMX A;  4I2T A;  3MDK A;  5DQS A;  3GA4 A;  1ZYE A;  2FHE A;  2R5G A;  2O8V B;  2VCT A;  2JZR A;  3VI7 A;  4V2N A;  1UN2 A;  2DLX A;  5BMU B;  2NPB A;  2C3N A;  1BJX A;  4TOP A;  1AQW A;  5A1N B;  2E0Q A;  3MIX A;  4AI6 A;  2IFQ B;  5DVB A;  3KZQ A;  4AGS A;  2YWM A;  3QAW A;  3G7J A;  1KEB A;  1QMV A;  2X99 A;  3KTL A;  3CXG A;  4G2E A;  1AUC A;  1XW6 A;  2CQ9 A;  3HD5 A;  5ID2 A;  1M99 A;  1NHO A;  5CNW A;  2HRN A;  4EDZ A;  2AB6 A;  1R5A A;  4IBP A;  5G1L A;  1EOH A;  1B4P A;  4ZIL A;  5ECR B;  1TTZ A;  1YEP A;  3UVT A;  3VWW A;  3GH6 A;  3IDV A;  2XPD A;  2L5L A;  4V2M A;  1T7P B;  3P90 A;  3RPN A;  2EFC A;  5EPF A;  2TRC P;  1TU7 A;  3C1R A;  4F2I A;  1TU8 A;  3BD2 A;  1K0B A;  1ZCP A;  1GL8 A;  4TR4 A;  3ZLP A;  5L71 A;  2R0C A;  4BPY A;  2DKH A;  2XBQ A;  4WEY A;  8GSS A;  3WGX A;  2C0F A;  1SD8 A;  4L0U A;  4XS4 B;  3SBC A;  3LGC A;  3TOT A;  1USB A;  1AQX A;  2H6Z A;  3FYG A;  2A4H A;  1PGT A;  2NBS A;  4HJM A;  2CVK A;  4IGJ A;  3RBT A;  2VCW A;  3KMN A;  4KB3 A;  1VRS D;  19GS A;  3UVH A;  5JWR B;  3EC3 A;  1PSQ A;  1GSF A;  1V40 A;  2VL2 A;  4FXY P;  2HSH A;  1X9W B;  3CQF A;  3F9U A;  2X49 A;  5ENU A;  4FYU A;  4OD7 A;  1O73 A;  2YN1 A;  4EO3 A;  4KW6 A;  2LJK A;  4Z2T A;  3MAK A;  2GLR A;  4EUY A;  3L4N A;  4AJ7 A;  2X8G A;  4MPF A;  5D73 A;  5B8B A;  2WJU A;  4N10 A;  5ECQ B;  1YEX A;  3ZIJ A;  2AUV A;  3M9J A;  4J2F A;  1ZYQ B;  3L0H A;  6GSV A;  3FR3 A;  3P2A A;  3E0U A;  1YKA A;  2GQM A;  3HZ8 A;  2ON7 A;  3RGB C;  2ZNM A;  2V41 A;  2H73 A;  4POM A;  1G6Y A;  4AKH A;  4JR4 A;  1BX9 A;  2J9H A;  4K8M A;  3UIW A;  1FG4 A;  3TKS A;  2PVQ A;  1Y6E A;  1B9X C;  3GRX A;  2P31 A;  2N5A A;  4QMK A;  2B3S A;  4KA0 A;  1XWB A;  2UZ8 A;  3DML A;  4WR4 A;  4JR6 A;  3P8W A;  2IPA A;  4V1A p;  5D96 A;  1FHE A;  3FR9 A;  1GSS A;  5AN1 A;  1GUL A;  1ERU A;  4MH2 A;  4WF4 A;  3ZRD A;  5IMA A;  1ML6 A;  4HI7 A;  2GZZ A;  3C8E A;  2FD3 A;  5A4V A;  4X43 A;  5CYY A;  5A34 B;  4GSS A;  2N5B A;  1XBS A;  2C1Y A;  4O32 A;  2O3E A;  2GQL A;  1JHB A;  4W66 A;  11GS A;  3TOU A;  4DSS B;  3QAV A;  2MBT A;  5COH A;  2FCH A;  4JE1 A;  5GAP D;  3E9J B;  3HHV A;  2HSM A;  17GS A;  4IEL A;  1X5E A;  2HYX A;  2YWN A;  1G6W A;  2H71 A;  2ZUP A;  3IHG A;  1EEM A;  2DC5 A;  4L5L A;  1G7E A;  3C7M A;  4AF2 A;  5HR0 A;  1U87 A;  4XS1 A;  2WCI A;  2R37 A;  4KDU A;  5G1K A;  5EL8 A;  4NPB A;  4ZBA A;  4DSR A;  5JCW A;  1HQO A;  2IWT A;  3QAG A;  2CZ3 A;  2XBI A;  3BOA A;  4K7O A;  5BMU A;  2G0F A;  3ERG A;  4ZB6 A;  1K0M A;  5A1N A;  2WB9 A;  2EC4 A;  4ICY A;  2YWO A;  2HQT A;  5DAL B;  4I8B A;  3GX0 A;  2EIQ A;  4ML1 A;  4ZB8 A;  4X1U A;  3GNJ A;  2XHF A;  1SKS B;  3UMA A;  4NHZ A;  3N9J A;  2E7P A;  3ED3 A;  1GSU A;  4JZQ A;  2MMO A;  5BRT A;  5ABR A;  3ZZX A;  3EE2 A;  2YP6 A;  3LYK A;  3LWA A;  1YZX A;  3BBY A;  3VPT A;  5HR3 A;  5J5N A;  2WVY A;  2A2S A;  1SL0 B;  5IQY A;  2CZ2 A;  4O92 A;  2RM6 A;  4BL7 A;  1I5G A;  2OT3 A;  2MMZ A;  1PRX A;  3GUS A;  1M2B A;  14GS A;  4EE0 A;  1M2D A;  5GSS A;  2WDU A;  4OCE A;  2I1U A;  4KSM A;  4K1F A;  4Z7X A;  2C8U A;  4GQC A;  2B1L A;  4TKY A;  4KCE A;  3UOM A;  2QGV A;  2F51 A;  3I43 A;  2QC7 A;  3HKR A;  3TJJ A;  20GS A;  6GSX A;  3KH9 A;  1OC8 A;  1YF0 A;  3KP9 A;  1TXU A;  2F8F A;  4Q5Q A;  2VCV A;  5IMV A;  3W8S A;  1URM A;  3J7Y k;  1LJR A;  1SL2 B;  2RM5 A;  3D5J A;  4XS4 A;  1GNW A;  1TK8 B;  2YOI A;  4POB A;  5D9W A;  3GL3 A;  3APO A;  4NMU A;  1Y1U A;  3A2W A;  2H1B A;  4HZ4 A;  3ZIT A;  4BVX B;  1IYH A;  1TOF A;  3GKM A;  4Q5F A;  4FYB A;  4Z2U A;  3EU3 A;  5IOX A;  1JFU A;  5B8A A;  3Q6O A;  1PX6 A;  1FVK A;  2WRT A;  2MYG A;  4ZL8 A;  2H70 A;  1T00 A;  3L9U A;  3NIV A;  3IV4 A;  4LL1 B;  3QFB C;  1EV4 A;  4MNN A;  5ECH B;  3IRA A;  2LRT A;  1XFL A;  2CVB A;  4NV5 A;  2IMF A;  1GLP A;  6GSY A;  5HQP A;  1SK1 A;  2REM A;  2OAC A;  2K9F A;  1PQN A;  5F0G A;  3QD9 A;  1F9M A;  2ZCT A;  1J08 A;  1X5C A;  1HNA A;  4IQA A;  4E8H A;  1TRV A;  4GF0 A;  2LEG A;  3ZVJ A;  2B7K A;  3F3Q A;  2AAW A;  4MZC A;  2HFD A;  5E4W A;  4LLR A;  4IS0 A;  4ECB A;  4XTS A;  3LJR A;  2VKZ G;  3Q74 A;  4ECI A;  2GS3 A;  2C80 A;  1WMJ A;  3H79 A;  4GTU A;  1MDI A;  2F8A A;  1EWX A;  3F3R A;  5KEJ A;  4RUV A;  4JED A;  4MJC A;  5DCH A;  1F2E A;  5G2Z A;  1DBY A;  5B6N A;  4YQU A;  4K7N A;  4MP4 A;  2B1K A;  1TJD A;  3CBU A;  4HQZ A;  5CRW A;  4LL4 B;  2WUL A;  3EUR A;  2WFC A;  2V6O A;  5IO0 A;  5ECI B;  4IP6 A;  2OKA A;  2KOK A;  2H0H A;  4ECJ A;  4BWQ A;  2YZU A;  1N2A A;  5FWG A;  3O3T A;  4EL1 A;  5GAN D;  1TKD B;  4G0L A;  5CO3 A;  3LQ7 A;  1VF2 A;  3LEF A;  1R4W A;  2J23 A;  1VF1 A;  3LFL A;  3KP8 A;  3HDC A;  1QUW A;  5DCG A;  4QQ7 A;  3F0I A;  1GNE A;  5A34 A;  2LUS A;  3EWL A;  3VLN A;  1GSY A;  2R4V A;  3F63 A;  1EP8 A;  1O8W A;  2GT5 A;  2VCZ A;  3WD6 A;  3GYK A;  2VL3 A;  2HZE B;  2LV3 A;  2OA7 A;  1XZO A;  2HSM B;  3OR5 A;  2VCX A;  1TI1 A;  1S3R A;  2GSQ A;  4IN0 A;  2EIO A;  4IKH A;  3DIE A;  4POL A;  2B7J A;  2GTU A;  3J7Y b;  1EV9 A;  1K0O A;  1ZYN A;  1Z7P A;  1ON4 A;  1O85 A;  4NXI A;  2YZH A;  5ECN B;  4ZB9 A;  1A0F A;  3F8U A;  1X9S B;  2FWF A;  3UEM A;  3WT2 A;  4Q5R A;  2O7K A;  3M9K A;  4GLT A;  1ZOF A;  1N25 A;  1RQM A;  2EIR A;  2X4A A;  3CMI A;  1ZMA A;  1R5P A;  2VO4 A;  1R7H A;  5C00 A;  2K8S A;  2HSY A;  1XWK A;  3KH7 A;  5IMC A;  5LD0 A;  1SL1 B;  2P5Q A;  1OE7 A;  4G19 A;  3TKP A;  1W4V A;  3ME8 A;  3IBH A;  2WGR A;  2HLS A;  3HJM A;  3W8J A;  4AJ6 A;  4QL7 A;  2B5X A;  2TIR A;  5DAL A;  4TR0 A;  1JLV A;  4OMV A;  4MH3 A;  1RW1 A;  2I9H A;  3GST A;  2LRC A;  4G01 A;  2KP2 A;  3VWU A;  4AKG A;  1Z6N A;  2CT6 A;  2H1L A;  3ZVJ D;  4G10 A;  2M72 A;  4K6X A;  4FQU A;  3IK9 A;  1PX7 A;  5KN3 A;  3ISO A;  3NOF A;  4O5U A;  1K3Y A;  4BL7 B;  1RK4 A;  1O6J A;  3M0F A;  2H0G A;  3IC8 A;  5J3R A;  4ULX A;  1FVJ A;  3FEU A;  4OO5 A;  4PUF C;  2HZF A;  3HJO A;  2M80 A;  4PQ1 A;  2VLU A;  1S3D A;  4EC0 A;  4PQI A;  2CA8 A;  4H86 A;  3R2Q A;  5J9C A;  6GSW A;  3FRC A;  1MTC A;  3FZ5 A; 
#chains in the Genus database with same CATH homology
 5CRG A;  4E8E A;  10GS A;  3FY7 A;  1TRS A;  4KE3 A;  2LQQ A;  2HT9 A;  3M3M A;  5DJL A;  2RLI A;  3PPU A;  1DE1 A;  5C04 A;  2LST A;  1N8J A;  3TRQ A;  2R6K A;  1G0T A;  5G31 A;  2HRK A;  3M1G A;  3EU4 A;  3CSJ A;  2VLT A;  3IXR A;  4BA7 A;  5AIX A;  2JU5 A;  4P3Y B;  3A5I A;  1A8L A;  4GDF A;  2O5V A;  1M0U A;  2V6K A;  5IPG A;  3RAZ A;  2IMI A;  3O6T A;  1MDK A;  1FOV A;  4BVX A;  5CRE A;  3G7I A;  5HFG A;  2VD0 A;  3ZRE A;  1JZW A;  2AYT A;  5B6M A;  1PA3 A;  4GSN A;  1I9D A;  1SJZ A;  5D9T A;  3D21 A;  4N30 A;  1BED A;  2LRN A;  2LTK A;  4IQ1 A;  3GHA A;  2YPM A;  5IMD A;  4EIQ A;  3F6D A;  2FUG 2;  4N0V A;  1GSD A;  4K0N A;  1EZK A;  1SJ6 A;  3GSS A;  4O5R A;  1DUG A;  4J56 E;  3I69 A;  3US3 A;  3VI5 A;  3RDW A;  4PUR A;  1Z3E A;  4OO4 A;  2RII A;  5J41 A;  4YKF A;  5KN2 A;  1A2J A;  1KTE A;  2LNT A;  2FLS A;  3EMP A;  2DIZ A;  2QKE A;  4CY6 A;  1A24 A;  4PNF A;  2PER A;  1TRW A;  1XOB A;  3BCI A;  2CX4 A;  2EFH A;  4G0I A;  5DAK B;  1ERW A;  1U3I A;  2JZS A;  3KJY A;  2KLX A;  1SJI A;  3LW9 A;  3DEX A;  1U6T A;  2F9S A;  3KD0 A;  5H5Q A;  1E6B A;  2HSN B;  2MMA A;  5EVO A;  1MDJ A;  4DVC A;  1ILO A;  12GS A;  4GRF A;  3H1N A;  2H1D A;  2V32 A;  22GS A;  3FHK A;  2WS2 A;  5A4W A;  3IR4 A;  4HUA A;  3D6I A;  3GIX A;  1TP9 A;  2AHE A;  2FNO A;  5IMZ A;  4X0X A;  1GTI A;  3GH9 A;  4V2L A;  3QDN A;  4FYC A;  4YAP A;  2VUP A;  3WGD A;  1LBK A;  2OE3 A;  3DYR A;  5LNK e;  1TW9 A;  2V2G A;  4ZB7 A;  4AJ8 A;  1B48 A;  3EIN A;  5H5S A;  1SVL A;  4HJ2 A;  2HZE A;  3UAP A;  2LQO A;  2HRF A;  4MZB A;  1BQ7 A;  2YJ7 A;  4K7I A;  4WKW A;  1Q98 A;  2B5Y A;  3GL5 A;  2C0G A;  4HOJ A;  4K2X A;  1MD4 A;  2H6X A;  1SEN A;  4JRR A;  4L8E A;  4MCU A;  3GTU B;  4JBB A;  4ACS A;  2K6V A;  5J4V A;  3HJP A;  3VWV A;  3D4M A;  2VLV A;  3FKF A;  4KX4 A;  2DJK A;  2HI7 A;  1FB6 A;  3DD3 A;  2H01 A;  5ECL B;  3TUE A;  3LXZ A;  4EVM A;  2OJL A;  3TJK A;  3MYD A;  1PMT A;  2I81 A;  4MDC A;  5KN0 A;  5ECM B;  4O7H A;  1YDK A;  2H74 A;  1YKC A;  3Q19 A;  4MMM A;  1GUH A;  3HVS A;  4PQH A;  4OCF A;  3HXS A;  1AQV A;  1U88 A;  2YV9 A;  2NDO A;  4ZL7 A;  3DGQ A;  2HNL A;  1XWG A;  1O81 A;  2PGT A;  3BCK A;  4V1A g;  1ZYP A;  5FHI A;  4ML6 A;  2JAC A;  4KDX A;  2K18 A;  2VD1 A;  5ELG A;  2DJ0 A;  3TDG A;  2Z9S A;  4TVE A;  3F4S A;  2GDR A;  2JSY A;  1EP7 A;  4AKX B;  3FR6 A;  4D73 B;  1M2A A;  5J9B A;  4K5S A;  1ZGN A;  1YVL A;  3TKR A;  4J57 E;  1SVM A;  3C1S A;  2HRK B;  4N3Z A;  1KBN A;  2B5E A;  1KNG A;  5KN1 A;  3TGZ A;  3PH9 A;  2R3X A;  3LSZ A;  5DDL A;  4KH7 A;  4ISD A;  4NAX A;  1TDI A;  1F6M C;  5HFI A;  1K3L A;  4RQX A;  4IVF A;  4HQS A;  2L59 A;  4WBR D;  4PGT A;  1TXX A;  4I5Q A;  1SK2 A;  5GZZ B;  1PD2 1;  2FA4 A;  3L9S A;  4IHU A;  1SD9 A;  1XW9 A;  4EKZ A;  1CQG A;  1TK5 B;  3WYW A;  1GUM A;  4CW9 A;  2P0G A;  3F4R A;  2FWH A;  3G7Y A;  3FMW A;  2H76 A;  2JZT A;  5A5K A;  2CAQ A;  1PL2 A;  2HE3 A;  3DXB A;  3FK8 A;  3TKQ A;  2VOC A;  1J9B A;  3D22 A;  5JCU A;  3QOU A;  5AGY A;  1AXD A;  3C73 A;  1O8X A;  1H75 A;  2PMT A;  5ELA A;  5D93 A;  5DAK A;  1WE0 A;  4TRX A;  1XPV A;  3CRT A;  3IAS 2;  2R0P A;  5KOX A;  1EEJ A;  1XW5 A;  2HSN A;  1V9W A;  3IHQ A;  2VL2 C;  2C0E A;  3QFA C;  1GTU A;  3CSH A;  3HA9 A;  2JL4 A;  2E2G A;  5E59 A;  1PN0 A;  3O76 A;  2DIY A;  2IIY A;  4L0W A;  1GUK A;  1AW9 A;  2WZ9 A;  1YQ1 A;  4DSQ A;  2GQK A;  4IP1 A;  2XC2 A;  5J4U A;  4OWY A;  2L6C A;  2LKU A;  4RQR A;  4IJ3 A;  13GS A;  1T3B A;  5GST A;  1OYJ A;  3HY2 A;  1X5D A;  1NHY A;  1QFN A;  1UVZ A;  1WIK A;  3HYP A;  5H5R A;  3GN3 A;  5CAX A;  4DEJ A;  3UJ1 A;  1K0D A;  2H19 A;  2K8V A;  3ERF A;  2DJJ A;  1XCC A;  3GV1 A;  2AV4 A;  3D0Z A;  1Z5Y E;  3APS A;  3TKS C;  2C3Q A;  3VWX A;  3TKS E;  1WRY A;  1WOU A;  2VM1 A;  4F0B A;  4NWY A;  5IPH A;  2IME A;  5ECP B;  4YQM A;  4POK A;  1V58 A;  4MAB A;  2CAI A;  3H93 A;  3GTU A;  3TB2 A;  5J47 A;  1EOG A;  3ERW A;  2HRA A;  3FW2 A;  3HVX A;  5F8B A;  2L5O A;  2MBS A;  1ABA A;  3ZFB A;  3FZ9 A;  5CP1 A;  5F05 A;  3LXT A;  4KSO A;  1SYX A;  2H1A A;  4YKG A;  4NV2 A;  4LMW A;  3UBK A;  5ECK B;  3FZ4 A;  4TR3 A;  3A5W A;  2C0D A;  3DWV A;  3PGT A;  4I97 A;  2IN3 A;  4ZXG A;  4HZ2 A;  2ALB A;  5J40 A;  4XHM A;  1OAZ A;  2MMN A;  4F0C A;  1CQH A;  4MJA A;  2YNX A;  1X0R A;  4IW9 A;  4BVY B;  6GSS A;  2OE0 A;  3QCP A;  3K8N A;  2C4J A;  3CRU A;  2LJR A;  1B9Y C;  4K5R A;  7GSS A;  4ZIJ A;  1BAY A;  3DVX A;  3RHC A;  2N5F A;  3ZML A;  1S3A A;  1OE8 A;  3RPP A;  3KXO A;  2D2Z A;  1T4Y A;  1Z9H A;  4Z2R A;  4KAE A;  1XVW A;  1W89 A;  2PWJ A;  1LU4 A;  1C72 A;  1E2Y A;  3KTB A;  2XPE A;  1Z6M A;  2P5R A;  1JZO A;  4K2D A;  4N11 A;  1A2L A;  1ST9 A;  5D9V A;  4D73 A;  4TR1 A;  1FAA A;  3Q18 A;  2EFE A;  5HFK A;  2JSZ A;  2E2M A;  1A2M A;  4LMV A;  1OC3 A;  1ZL9 A;  4QL9 A;  2HXK A;  1ERT A;  2IMD A;  3ZFL A;  6GST A;  2VIM A;  3TJB A;  2FWE A;  2OBK A;  3ME7 A;  5D8I A;  4XCS A;  3ZIV A;  5HR1 A;  18GS A;  4Q5N A;  4CDO A;  5F07 A;  2DJ1 A;  4CY8 A;  1F37 A;  3IA1 A;  1QQ2 A;  1ERV A;  1OVN A;  4I2U A;  5KOW A;  1XWA A;  2OE1 A;  2LS5 A;  1PKW A;  1WWJ A;  4OFT A;  3TU3 B;  5G30 A;  2FWG A;  4GST A;  1SU9 A;  3GKN A;  4IJI A;  2PU9 C;  4GXZ A;  5F06 A;  3FZA A;  3KIJ A;  1AC1 A;  1XOA A;  2VAF A;  5HR2 A;  1GTB A;  4G0K A;  1T1V A;  4KUN A;  2GZY A;  2CX3 A;  1PL1 A;  5DBQ A;  2YAN A;  2O89 A;  4PUA A;  1THX A;  1F3B A;  3QMX A;  2VL9 A;  2H75 A;  3HCZ A;  3GMF A;  1YF1 A;  5B7C A;  3TRP A;  3BJ5 A;  2VCQ A;  2TRX A;  1WPI A;  2GT6 A;  1T4Z A;  2PVO C;  2DKI A;  4HU9 A;  4OFM A;  4YQV A;  4EDY A;  1K0C A;  4HS1 A;  2O85 A;  4TXO B;  1M9B A;  3E3E A;  3VUR A;  3L9V A;  3LG6 A;  2A2P A;  4WET A;  1GLQ A;  3UBL A;  3N5O A;  2L6D A;  4F03 A;  2R0G A;  3PIN A;  1WP0 A;  1UC7 A;  3NZN A;  1Q4J A;  1EGR A;  2IMK A;  5J4Y A;  4HDE A;  4O5Q A;  2R2J A;  3M8N A;  4ECC A;  1SKW B;  3I6A A;  3RHB A;  1QK8 A;  5G5F A;  1A23 A;  1SKR B;  4XRA A;  5A5H A;  4KDY A;  1JZR A;  1G7O A;  3A3T A;  1OKT A;  4ILF A;  3IK7 A;  4RI7 A;  2FA8 A;  4NHW A;  4TN8 A;  3I9V 2;  4HEA 2;  4PTS A;  2L4C A;  3EPT A;  1WJK A;  4BWS A;  2H8L A;  4KF9 A;  3S9F A;  1GTA A;  2CVD A;  4XRD A;  5FT3 A;  4ZL9 A;  4ZBB A;  3SWL A;  3DRN A;  4PX1 A;  1ACV A;  2LNS A;  4MPG A;  4EIP A;  5JWQ B;  4K0G A;  2L4Q A;  2VM2 A;  2OAD A;  1OC9 A;  5DQY A;  1Z7R A;  2YCD A;  1B4Q A;  1NW2 A;  3D4T A;  4FH8 A;  1VF3 A;  1MD3 A;  1NSW A;  1K0A A;  5JCG A;  1Y25 A;  1BG1 A;  2H1G A;  5IIZ A;  2NTO A;  3MWH A;  4FIW A;  1VF4 A;  5INY A;  1OKD A;  3H4K A;  3W6G A;  2C3T A;  2O87 A;  2I4A A;  3KCM A;  2B6M A;  3C71 A;  1DE2 A;  4PXO A;  2H6Y A;  3DKS A;  3IPZ A;  1SYR A;  4L5O A;  3APQ A;  1B8X A;  4MF6 A;  4TW5 A;  3VFI A;  2DJ2 A;  1PN9 A;  1XXU A;  1V2A A;  4YAV A;  1FOH A;  2IFQ A;  3L78 A;  1HNB A;  3KEB A;  5CRD A;  5ECO B;  3LOR A;  4BVY A;  3ZL5 A;  4YH2 A;  2A2R A;  1MEK A;  1J0F A;  3H8Q A;  4JU5 A;  2GSS A;  2ES7 A;  2ON5 A;  3VPQ A;  5ID2 B;  2F3M A;  2RUF A;  4TXV A;  1THO A;  1QXH A;  3R3E A;  3CTF A;  5IO2 A;  3CTG A;  1GSE A;  1BF5 A;  2KP1 A;  4EXJ A;  2I3Y A;  2A4V A;  1T8E B;  2FY6 A;  2PN8 A;  1TK0 B;  4MF5 A;  3PR8 A;  5IMF A;  2V1M A;  4X4J A;  4WR5 A;  4TR1 B;  4N0Z A;  2H66 A;  2OBI A;  2DMM A;  3AY8 A;  1M7T A;  2QA2 A;  2X8H A;  2H0I A;  1GRX A;  5D9X A;  4GWR A;  4PNG A;  5JWO B;  2PBJ A;  1GSQ A;  2LJA A;  1M9A A;  3VK9 A;  1XVQ A;  1HYU A;  2H72 A;  2GGT A;  4USS A;  1JLW A;  2PPT A;  3GFK A;  5A4U A;  1FB0 A;  3TCO A;  3TJF A;  3GKK A;  5G5E A;  3GUR A;  2L57 A;  9GSS A;  4I6X A;  3WGE A;  3KMO A;  2DJ3 A;  3MNG A;  1GH2 A;  3UL3 A;  3HVV A;  3A2X A;  4AKI A;  5AIV A;  1FO5 A;  3IE3 A;  2KUC A;  1V98 A;  4A5P A;  2GST A;  1DSB A;  3F4T A;  3IAM 2;  5EY6 A;  4KCA A;  1SVO A;  1XIY A;  3ZTL A;  3ZYW A;  4MF7 A;  3F6F A;  2MZC A;  3A2V A;  3GX8 A;  2GVP A;  2JAD A;  3CSI A;  2AJQ B;  5IOW A;  2BJX A;  3HZ4 A;  4XS6 A;  4CHS A;  3DVW A;  1HNC A;  2RUE A;  3IOS A;  4MK3 A;  5LCZ A;  4F82 A;  2GZP A;  1S3C A;  1R26 A;  4ZBD A;  4F9Z A;  1X9M B;  1SK0 A;  2X64 A;  1TI3 A;  2UV8 G;  4MJB A;  3QPM A;  4FO5 A;  4OFN A;  4K9Z A;  3HMJ G;  1AIU A;  3EMX A;  2CV4 A;  2M46 A;  1K3O A;  1VGL A;  1YY7 A;  4KND A;  2DSA A;  3QR6 A;  4WBJ A;  2H30 A;  4TXO A;  3ZMK A;  2IJY A;  1A8Y A;  3TJG A;  1BYE A;  3EYT A;  3CYN A;  4WF5 A;  4MJE A;  4LA1 A;  2IL3 A;  2X8C A;  5ECS A;  2NVL A;  1XWC A;  1NM3 A;  5CRH A;  5IM9 A;  2BTO T;  4GCI A;  5DJM A;  2GSR A;  3IC4 A;  3KM6 A;  3G9B A;  3P7X A;  1YJ6 A;  4WXT A;  1A0R P;  1EGO A;  2EFD A;  1GP1 A;  5A5H B;  3V1W A;  3TRX A;  2KHP A;  3KGK A;  2YWI A;  4XIH A;  4RI6 A;  3MSZ A;  3WT1 A;  4ID0 A;  4MZW A;  2PUK C;  4EF0 A;  1U3A A;  4G9H A;  2DBC A;  5AIS A;  1GWC A;  4GQF A;  2G2Q A;  1K0N A;  1HD2 A;  1AAZ A;  3UAR A;  4HU7 A;  1UA5 A;  3GKX A;  1V57 A;  4MLY A;  1OC9 B;  4DSS A;  1QGV A;  4KGI A;  1FW1 A;  2QA1 A;  3CWG A;  2DML A;  2QSI A;  1IYI A;  3LYP A;  1ZZY A;  4E68 A;  1PKZ A;  1JZD A;  2FGX A;  16GS A;  6GSU A;  4MA9 A;  2YV7 A;  3U5R E;  2YJH A;  3U6V A;  1F3A A;  1O7U A;  1TRU A;  3JCM L;  1H4O A;  1BG5 A;  3EVI A;  2BMX A;  4I2T A;  3MDK A;  5DQS A;  3GA4 A;  1ZYE A;  2FHE A;  2R5G A;  2O8V B;  2VCT A;  2JZR A;  3VI7 A;  4V2N A;  1UN2 A;  2DLX A;  5BMU B;  2NPB A;  2C3N A;  1BJX A;  4TOP A;  1AQW A;  5A1N B;  2E0Q A;  3MIX A;  4AI6 A;  2IFQ B;  5DVB A;  3KZQ A;  4AGS A;  2YWM A;  3QAW A;  3G7J A;  1KEB A;  1QMV A;  2X99 A;  3KTL A;  3CXG A;  4G2E A;  1AUC A;  1XW6 A;  2CQ9 A;  3HD5 A;  5ID2 A;  1M99 A;  1NHO A;  5CNW A;  2HRN A;  4EDZ A;  2AB6 A;  1R5A A;  4IBP A;  5G1L A;  1EOH A;  1B4P A;  4ZIL A;  5ECR B;  1TTZ A;  1YEP A;  3UVT A;  3VWW A;  3GH6 A;  3IDV A;  2XPD A;  2L5L A;  4V2M A;  1T7P B;  3P90 A;  3RPN A;  2EFC A;  5EPF A;  2TRC P;  1TU7 A;  3C1R A;  4F2I A;  1TU8 A;  3BD2 A;  1K0B A;  1ZCP A;  1GL8 A;  4TR4 A;  3ZLP A;  5L71 A;  2R0C A;  4BPY A;  2DKH A;  2XBQ A;  4WEY A;  8GSS A;  3WGX A;  2C0F A;  1SD8 A;  4L0U A;  4XS4 B;  3SBC A;  3LGC A;  3TOT A;  1USB A;  1AQX A;  2H6Z A;  3FYG A;  2A4H A;  1PGT A;  2NBS A;  4HJM A;  2CVK A;  4IGJ A;  3RBT A;  2VCW A;  3KMN A;  4KB3 A;  1VRS D;  19GS A;  3UVH A;  5JWR B;  3EC3 A;  1PSQ A;  1GSF A;  1V40 A;  2VL2 A;  2HSH A;  1X9W B;  3F9U A;  2X49 A;  5ENU A;  4FYU A;  4OD7 A;  1O73 A;  2YN1 A;  4EO3 A;  4KW6 A;  2LJK A;  4Z2T A;  3MAK A;  2GLR A;  4EUY A;  3L4N A;  4AJ7 A;  2X8G A;  4MPF A;  5D73 A;  5B8B A;  2WJU A;  4N10 A;  5ECQ B;  1YEX A;  3ZIJ A;  2AUV A;  3M9J A;  4J2F A;  1ZYQ B;  3L0H A;  6GSV A;  3FR3 A;  3P2A A;  3E0U A;  1YKA A;  2GQM A;  3HZ8 A;  2ON7 A;  2ZNM A;  2V41 A;  2H73 A;  4POM A;  1G6Y A;  4AKH A;  4JR4 A;  1BX9 A;  2J9H A;  4K8M A;  3UIW A;  1FG4 A;  3TKS A;  2PVQ A;  1Y6E A;  1B9X C;  3GRX A;  2P31 A;  2N5A A;  4QMK A;  2B3S A;  4KA0 A;  1XWB A;  2UZ8 A;  3DML A;  4WR4 A;  4JR6 A;  3P8W A;  2IPA A;  4V1A p;  5D96 A;  1FHE A;  3FR9 A;  1GSS A;  5AN1 A;  1GUL A;  1ERU A;  4MH2 A;  4WF4 A;  3ZRD A;  5IMA A;  1ML6 A;  4HI7 A;  2GZZ A;  3C8E A;  2FD3 A;  5A4V A;  4X43 A;  5CYY A;  5A34 B;  4GSS A;  2N5B A;  1XBS A;  2C1Y A;  4O32 A;  2GQL A;  1JHB A;  4W66 A;  11GS A;  3TOU A;  4DSS B;  3QAV A;  2MBT A;  5COH A;  2FCH A;  4JE1 A;  5GAP D;  3E9J B;  3HHV A;  2HSM A;  17GS A;  4IEL A;  1X5E A;  2HYX A;  2YWN A;  1G6W A;  2H71 A;  2ZUP A;  3IHG A;  1EEM A;  2DC5 A;  4L5L A;  1G7E A;  3C7M A;  4AF2 A;  5HR0 A;  1U87 A;  4XS1 A;  2WCI A;  2R37 A;  4KDU A;  5G1K A;  5EL8 A;  4NPB A;  4ZBA A;  4DSR A;  5JCW A;  1HQO A;  2IWT A;  3QAG A;  2CZ3 A;  2XBI A;  3BOA A;  4K7O A;  5BMU A;  2G0F A;  3ERG A;  4ZB6 A;  1K0M A;  5A1N A;  2WB9 A;  2EC4 A;  4ICY A;  2YWO A;  2HQT A;  5DAL B;  4I8B A;  3GX0 A;  2EIQ A;  4ML1 A;  4ZB8 A;  4X1U A;  3GNJ A;  2XHF A;  1SKS B;  3UMA A;  4NHZ A;  3N9J A;  2E7P A;  3ED3 A;  1GSU A;  4JZQ A;  2MMO A;  5BRT A;  5ABR A;  3ZZX A;  3EE2 A;  2YP6 A;  3LYK A;  3LWA A;  1YZX A;  3BBY A;  3VPT A;  5HR3 A;  5J5N A;  1SL0 B;  2A2S A;  5IQY A;  2CZ2 A;  4O92 A;  2RM6 A;  4BL7 A;  1I5G A;  2OT3 A;  2MMZ A;  1PRX A;  3GUS A;  1M2B A;  14GS A;  4EE0 A;  1M2D A;  5GSS A;  2WDU A;  4OCE A;  2I1U A;  4KSM A;  4K1F A;  4Z7X A;  2C8U A;  4GQC A;  2B1L A;  4TKY A;  4KCE A;  3UOM A;  2QGV A;  2F51 A;  3I43 A;  2QC7 A;  3HKR A;  3TJJ A;  20GS A;  6GSX A;  3KH9 A;  1OC8 A;  1YF0 A;  3KP9 A;  1TXU A;  2F8F A;  4Q5Q A;  2VCV A;  5IMV A;  3W8S A;  1URM A;  3J7Y k;  1LJR A;  1SL2 B;  2RM5 A;  3D5J A;  4XS4 A;  1GNW A;  1TK8 B;  2YOI A;  4POB A;  5D9W A;  3GL3 A;  3APO A;  4NMU A;  1Y1U A;  3A2W A;  2H1B A;  4HZ4 A;  3ZIT A;  4BVX B;  1IYH A;  1TOF A;  3GKM A;  4Q5F A;  4FYB A;  4Z2U A;  3EU3 A;  5IOX A;  1JFU A;  5B8A A;  3Q6O A;  1PX6 A;  1FVK A;  2WRT A;  2MYG A;  4ZL8 A;  2H70 A;  1T00 A;  3L9U A;  3NIV A;  3IV4 A;  4LL1 B;  3QFB C;  1EV4 A;  4MNN A;  5ECH B;  3IRA A;  2LRT A;  1XFL A;  2CVB A;  4NV5 A;  2IMF A;  1GLP A;  6GSY A;  5HQP A;  1SK1 A;  2REM A;  2OAC A;  2K9F A;  1PQN A;  5F0G A;  3QD9 A;  1F9M A;  2ZCT A;  1J08 A;  1X5C A;  1HNA A;  4IQA A;  4E8H A;  1TRV A;  4GF0 A;  2LEG A;  3ZVJ A;  2B7K A;  3F3Q A;  2AAW A;  4MZC A;  2HFD A;  5E4W A;  4LLR A;  4IS0 A;  4ECB A;  4XTS A;  3LJR A;  2VKZ G;  3Q74 A;  4ECI A;  2GS3 A;  2C80 A;  1WMJ A;  3H79 A;  4GTU A;  1MDI A;  2F8A A;  1EWX A;  3F3R A;  5KEJ A;  4RUV A;  4JED A;  4MJC A;  5DCH A;  1F2E A;  5G2Z A;  1DBY A;  5B6N A;  4YQU A;  4K7N A;  4MP4 A;  2B1K A;  1TJD A;  3CBU A;  4HQZ A;  5CRW A;  4LL4 B;  2WUL A;  3EUR A;  2WFC A;  2V6O A;  5IO0 A;  5ECI B;  4IP6 A;  2OKA A;  2KOK A;  2H0H A;  4ECJ A;  4BWQ A;  2YZU A;  1N2A A;  5FWG A;  3O3T A;  4EL1 A;  5GAN D;  1TKD B;  4G0L A;  5CO3 A;  3LQ7 A;  1VF2 A;  3LEF A;  1R4W A;  2J23 A;  1VF1 A;  3LFL A;  3KP8 A;  3HDC A;  1QUW A;  5DCG A;  4QQ7 A;  3F0I A;  1GNE A;  5A34 A;  2LUS A;  3EWL A;  3VLN A;  1GSY A;  2R4V A;  3F63 A;  1EP8 A;  1O8W A;  2GT5 A;  2VCZ A;  3WD6 A;  3GYK A;  2VL3 A;  2HZE B;  2LV3 A;  2OA7 A;  1XZO A;  2HSM B;  3OR5 A;  2VCX A;  1TI1 A;  2GSQ A;  4IN0 A;  2EIO A;  4IKH A;  3DIE A;  4POL A;  2B7J A;  2GTU A;  3J7Y b;  1EV9 A;  1K0O A;  1ZYN A;  1Z7P A;  1ON4 A;  1O85 A;  4NXI A;  2YZH A;  5ECN B;  4ZB9 A;  1A0F A;  3F8U A;  1X9S B;  2FWF A;  3UEM A;  3WT2 A;  4Q5R A;  2O7K A;  3M9K A;  4GLT A;  1ZOF A;  1N25 A;  1RQM A;  2EIR A;  2X4A A;  3CMI A;  1ZMA A;  1R5P A;  2VO4 A;  1R7H A;  5C00 A;  2K8S A;  2HSY A;  1XWK A;  3KH7 A;  5IMC A;  5LD0 A;  1SL1 B;  2P5Q A;  1OE7 A;  4G19 A;  3TKP A;  1W4V A;  3ME8 A;  3IBH A;  2WGR A;  2HLS A;  3HJM A;  3W8J A;  4AJ6 A;  4QL7 A;  2B5X A;  2TIR A;  5DAL A;  4TR0 A;  1JLV A;  4OMV A;  4MH3 A;  1RW1 A;  2I9H A;  3GST A;  2LRC A;  4G01 A;  2KP2 A;  3VWU A;  4AKG A;  1Z6N A;  2CT6 A;  2H1L A;  3ZVJ D;  4G10 A;  2M72 A;  4K6X A;  4FQU A;  3IK9 A;  1PX7 A;  5KN3 A;  3ISO A;  3NOF A;  4O5U A;  1K3Y A;  4BL7 B;  1RK4 A;  1O6J A;  3M0F A;  2H0G A;  3IC8 A;  5J3R A;  4ULX A;  1FVJ A;  3FEU A;  4OO5 A;  4PUF C;  2HZF A;  3HJO A;  2M80 A;  4PQ1 A;  2VLU A;  1S3D A;  4EC0 A;  4PQI A;  2CA8 A;  4H86 A;  3R2Q A;  5J9C A;  6GSW A;  3FRC A;  1MTC A;  3FZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...