4GSRA

Structural basis for the inhibition of mycobacterium tuberculosis l,d-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
263
structure length
263
Chain Sequence
b'SSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable conserved lipoprotein LPPS
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Structural basis for the inhibition of Mycobacterium tuberculosis L,D-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains
pubmed doi rcsb
total genus 70
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4gsrA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gsrA01
3TX4A 5DU7A 3TURA 5LBGA 3ZQDA 4QRBA 4HUCA 2HKLA 5D7HA 4QR7A 4HU2A 2MTZA 4LZHA 3VYOA 4JMNA 5DCCA 5E1GA 4ZFQA 3VAEA 3U1QA 5DC2A 4A1KA 4K73A 4A1IA 3ZGPA 4A52A 1Y7MA 5E5LA 4GSRA 4GSQA 5LB1A 4A1JA 5DZJA 4XVOA 4JMXA 3VYPA 5DUJA 4Z7AA 4QTFA 5K69A 3VYNA 1ZATA 5DVPA 5E1IA 4GSUA 3ZG4A 3U1PA 5DZPA 4QRAA 5E51A 4LPQA
chains in the Genus database with same CATH superfamily
2WKOA 2V8LA 5ECGA 4J27A 2FE0A 2OZNA 4JLRB 3L9RB 1NUGA 2GFBA 1QBLL 3DSFL 4RFNB 4YHPA 2C9RA 1L6XA 4QXTB 3B1UA 2VDOH 4RX4D 5AOKA 1HHHB 1Y18B 3S3JA 1H8NA 4NXSA 3HG1A 3ZQ9A 3NIDF 4KZCA 5F70A 4YZFF 1M6UA 3ILDA 1U95B 1S7QA 4P4KD 4KPHH 1FGNH 5FHBL 1A6VL 3W82A 3ULUE 4U6YA 1J8RA 2I5YH 4U0RC 5HPMA 4WHYH 3U9WA 2YN3A 4LL9A 5DRWB 4AYDC 4U7MA 3PL6C 3UC2A 5HVHC 4YSDA 3OZLA 4FL4C 4K7PL 3BIKA 3D06A 3M1CA 3BT2L 4F92B 1RPKA 4Q9CA 1JNHA 3FUFA 4M1CC 3J2PA 5CP3H 5D7LD 4XHJC 1UA3A 4HPYH 5SWZB 3TZVD 2MKLC 4WV1C 5DLLA 4LRIA 2D4DA 4BFIB 4HWNA 3RL1A 1TTCA 3NABL 2Q6WA 3EJTA 1SJHB 4PJEB 4UI2A 1MFMA 3MYJB 2OXHA 1PLBA 1BEYL 1M1SA 2EDDA 3LQAH 4N4YB 2ZNXA 4Z78A 5DJ0A 3KNBA 3LKOB 1WAAE 4F15B 4YNYB 4TM9A 1JERA 1LGVA 4MJ5B 1KB5H 4A2LA 1Y6NR 5D93C 2W88A 1QBMH 3LOWA 2BW5A 4HWZB 4N2AA 4EKXA 1BFTA 1X5FA 2Y2YA 5DZNA 3L3OB 5EBGA 2Z8RA 2Y06L 5DZLA 1XGQA 2DQGL 5FGBC 2VN4A 4FQXC 2WLMA 2H8PA 2OKMA 3D09A 5F3BA 1D6EA 5AAMA 3ARGB 1A65A 1WFTA 3ZR5A 4I48A 2F9BT 4M62H 1MH5A 4HH9B 1M05B 2AJZB 2VLRE 1U8JB 5CP7A 5BOJA 2VW6A 3GXNA 4NO0B 3GIVB 3AQZA 5DF0A 3MCYA 2F5BL 3SJVE 3KYOA 4NM8H 1LE5A 2BW4A 3F7VB 2EC9T 3LEYH 2MPAH 4NN6B 3MRLA 4E2OA 4Y7OC 4OLXL 1DLFH 3UYPB 3DRTB 1F90H 1S78D 2EH8L 4OFQA 4HG4K 5IQ7L 2GCYB 5FO8A 4KK9D 1JGVH 2FAUA 2JIXA 5EZIH 3E9UA 3MRHB 2MKWA 2UX6A 1MJUH 5D5MA 5KJ4A 4U7SA 4PJIB 5F1NA 3LHPH 3HPJB 4ZTPH 3TEYA 3SSGA 3MLYL 3ZYJA 3MKGA 4LPVA 1XR9A 4OFIA 4A55A 4YC2B 1V7NL 3PU7A 3RWEB 2ZYHA 3LS5H 4EDXA 2N01B 2AMUA 2BERA 3LXAA 2BCKA 4PGDB 3DBSA 3W2DH 2ISDA 4PJFB 3RTQA 4R7NB 4G6FB 4Z0BH 1KCRL 2JKWA 4PJXF 4G42A 5FGSA 1EJ8A 3EHBB 4F2EA 1ZIAA 3CNKA 5LNGA 3KDMA 5ITBL 4MD0A 4HHAB 1SOKA 3MOAL 3KPLA 3O9WA 4JY5L 4LCYB 1S3RA 1TNNA 3PY9A 4KI5D 5IJKC 4EI5A 4ONHA 3CFCH 1NGXA 5IFAL 1FVCA 3MLWH 4OIFA 3PFUA 4ADIA 2EXYC 3HKFA 5E2UH 4R2GC 2HVBA 2XIIA 4HWZA 5DJAB 1P84K 2QHRL 4NAJA 1QUNB 4OLZH 5IT2L 1NFIA 5IMLB 2EE2A 3FFCB 3HI6H 3FTWA 4NI3A 5B38A 3US0A 4B7IA 1S7VB 1KIPA 2YZ8A 2EC9U 3BEWB 1JUFA 4WVRA 2J5LC 4HGMA 4BA0A 5SV4A 3P30H 1HHIB 3ARGA 2WIIB 2GK0A 1AZNA 4P5TB 1Z5LA 3FB8B 1D7DA 4PJAB 4OGAC 4GRLC 4OZ4B 4X7EC 1J8HD 2F8OA 1QWNA 4J28A 4KKRA 5EZLB 5C71A 4PIBA 3BT0A 2R1WB 3GI9L 3WO3B 2IQ9H 1IZJA 3CU1A 3C5ZD 5ESAB 3IDGA 2GBAA 2NX5A 2XNAA 5DHEA 1ZATA 3U25A 4P3DB 1D2OA 1F6AB 3FSAA 3C5SA 4V1DB 5I73C 3B1TA 3FSWA 1ZANH 3K2UL 4PB9L 3T8VA 1BOYA 5BRZE 1PQZB 4J3SA 1WFNA 1PZAA 1RZPA 5J12B 4YLBA 4YDJA 1AHMA 3C6LC 4PJ7E 4BFIA 3ZQDA 1BXVA 3MOBH 1IGTB 2ODHA 1DQLL 1FNAA 4XP4H 1PIGA 3TVMC 4KITB 4IU3A 4TSAL 1XWVA 2WBXA 3LS5L 1H6TA 2YAMA 2E56A 3P4MB 4PCTA 5AQ0A 1ZWIA 3MFFA 1KJ2B 2MMXA 1KC5L 4PR5A 3RWDA 2OP4L 3QFGA 5FLVA 3TA4D 2XIDA 3MMEB 5BPPA 3UTOA 3UXFA 5ITBH 4G5AA 3WYRA 4PVNA 4LLDB 3T4YA 1WTGT 4HS6A 4ZRGA 3TNNB 4PMEA 3TEXA 1XVSA 2P5WD 2ZTBA 3DBXA 4PGCB 2AJUL 3WNMA 5I5JA 3DJTA 3FRPG 3HUJF 1GYCA 1PFOA 4R7XA 2K8QA 1SYVA 3LZQA 3RL2B 4OVVA 1CGSL 3G6JA 2WNWA 2WLYA 3SKNA 3DV4A 2FH8A 1WBXA 4CVZA 5SX5H 1MH5B 3K6IA 3N0PB 3MLZL 1YPZB 1K8DA 1BZDA 3C5ZC 3UBXB 4YPGA 3FFCA 5B38B 5IQOA 3MCKB 5F0LB 2W91A 1ZE3H 3SYOA 2DM3A 3F64A 1E50A 1MEXH 1JRHH 2QDWA 4YE0A 4NQXA 2R23B 2J1WA 3BAKA 1LTXA 3U36A 1NAMH 1BZQK 2VSDA 3QZWA 1O0VA 4X7DC 4IBUA 2ZKYA 2EEAA 3K81A 1FYTB 2OULB 2VM3A 3H7LA 4BHUI 4WWPA 3F12A 4QRQB 5E6RB 2QV2A 2XKUA 3X17A 4OBRA 1I82A 4OLYH 1Y7MA 1U8QA 4TRPH 2FTAA 3LN5B 3D2TA 5DHVH 4FYSA 5BRQA 3OM3B 2CJSA 1JN6B 4XN4A 2YQBA 2DTML 2DKUA 2MPAL 4K23H 4V1DD 2Y5QA 3T77B 1CN4A 2XXGA 1KNOA 1ZV5A 1AXTH 2WCPA 4EVNA 4AGNA 1WDAA 1D5XB 3DK0A 4KY1H 5I30L 1CDBA 4V2BA 4X99B 5HPOA 5FV1L 5IVXF 5L8JB 1ZT7B 5AZEH 3BH9B 3EADA 1I9JH 4LEOA 5DGQA 4BXVA 1TPXB 4WRLA 2EUZA 5DUJA 3IJSA 4HWEL 5JPNC 2IOMA 1MJJB 3LEXB 4XX1E 4JFFA 4ODSL 4BELD 5CEXA 5IB4A 1XZWA 3KYMB 3ZE1E 3W5MA 1Q9LA 2YPVL 1KLUB 2KHAA 3A4AA 3PUUA 5ANHA 4Z5RB 2MRYA 4PJ7B 1A7RH 1ZT1B 1CI5A 4GG6F 5E5RB 1BVNT 1YYLL 1S7VA 4GSDH 3BEWA 1LYQA 5IFJA 2IPTL 4ELME 5DJ8A 2W81C 4MXVF 3PXJA 4DO5A 5CWSB 5TPWL 3KD4A 3ULAB 3VVWA 2FO4A 5EWIL 5F3BB 1M6OB 2WXKA 1XF3A 4QPEA 2BOLA 1VZHA 1U92B 5DMKA 5KSUA 2P7TB 1OPGL 1SJVA 5HHPB 1PJ9A 2Q3XA 3NIFF 3UG3A 2KPWA 2LR4A 4UZUA 4PGEB 3ZDZE 2VE6B 1OAYL 2VRAA 2YD1A 4PRNB 4FQJH 2W0FB 4LMQE 5ICZB 4WSGA 3H3KA 4PJ5D 2XFGB 4Q58C 5IWLA 4XP6L 4APXA 3O3AA 3N55A 1L0XA 1NBYB 1MI5A 4HUMB 3SBRA 4CU7A 3ZLQC 5LNEA 4A6YB 4AM0A 1YY8A 3V5HB 3FQNA 2NNXA 3DPDA 1BQUA 2NY5L 2JXMA 2F54D 1E9QA 1XX9C 5LAXA 3Q8CA 3P0YH 3TASA 2WWOA 3I6KA 4QTHA 1F13A 4IK7A 4Y1SA 4YDJB 4U05A 2QPUA 4H5SB 3HEIB 5IK3B 4JRYB 5IHLB 2IQAB 4HV8B 3GJFK 4X5XB 3ZDYF 3DGGB 5DYOA 5IBUG 3NTCH 1H6UA 1E2ZA 3LQAC 1H3UA 2NY3B 4W9CC 1G9MH 1NUFA 1Z66A 2G2PA 3HC4L 1HHGB 4M03A 3OBAA 5DRXA 4EVNB 1IQWL 2WY3B 4C47A 4JO1L 2GW5A 5C2UB 4JPWL 1R0AH 5KUKA 3VXNB 1JGUL 3NIGF 2D7MA 4OVUA 4MAUL 2P24B 4L8SA 2X4QA 3OKOA 4LCCA 4AMKL 4BFEA 3QPXL 2H6PB 2ADGA 1NBZB 3F00A 3OPZL 3QG7L 1YNLL 4K7PH 3ZE2E 5C07A 2RBLA 1YEHH 3T0WA 3W0WE 4NQTA 2R56H 2R69A 4OQTL 1IBFA 2XV6B 3V6BR 1WWCA 3DXAA 4JDTH 4O9HH 1B4TA 1FL5B 1X4ZA 3WUWG 1ZGLB 4KKCD 1S3KH 4PJGE 4EJ1C 2BVOA 3HB3C 1YMMB 3FMGL 3L7EB 4YSEA 4WCYL 1U6AH 3HE7D 2B16A 4I5BA 1MIMH 4UTBA 4HJSA 4GKZA 2DI9A 4M43L 4IJ3B 3V0GA 3H6AA 2JJTA 4P04A 2WGXA 1G6RL 3OMAB 4X6EB 2VMEA 3EGSB 4OT1L 5MEPB 3VFGL 1HQ4A 3WGVB 3V95A 1U8IB 1N0LB 2CUHA 3AU1B 5T1LA 4I3RL 3DO7B 4O00A 2ZP8A 5DJDB 1V54B 1DVSA 4LXFA 4Z7OB 4JGJA 3ZYOA 4Z6AT 1OGPA 1RJZA 4R0LB 2EVHA 4K3JL 3CVDA 4KKQA 1PZ3A 2CPUA 4S10A 5I0VA 2Z31A 3VX1A 5AD0B 3BVNA 2BY2A 1P7BA 2H26B 4CU6A 2QV4A 4XVOA 3X1NA 1E4KA 1F6AA 4KNSA 4FTVE 1VFAB 2OJEB 3BWUF 5I76B 2PTVA 3QZOA 4IBZA 1G7HA 2BJML 4XT1C 2DIEA 2CO7A 3RFRA 1D5XA 2QTEA 2FT6A 4N0FB 2OI9C 4Y4HC 3GUFA 5DS8B 4HC1L 1ZT7A 1EJ6A 1B2WL 3W3BA 4P4KB 3TO4B 3T1WA 3GUTB 1ORSA 5KS9B 1L4IA 3FK3A 5GRVK 2QQQA 1EHKB 3CFJB 4OB5L 1F11A 4YPJA 2BMKB 1I7UA 1U8MA 4RETB 2IV9A 2H3NA 4ANUA 1UD3A 4IBWA 3ESOA 5LJYH 3RG1C 2Q8BL 3IDYB 4OLWL 1RAMA 1S7TA 2DIAA 5GGRA 1L0PA 5GQBA 4JO1H 3LKPB 3KEHA 4JO4L 1AIZA 3KL3A 1WHOA 1GGBL 3N9GL 3N6YA 1WBZA 4HUUA 4PLJC 3JYCA 4KX8A 1IEAA 4YSTA 3GMNB 1BVKB 4FCAA 3I2CL 3TO2A 2JKSA 1EJFA 1NANI 2FJFA 2MHAB 3UPCA 5I1KH 3PAYA 1PPIA 4Z7UE 1DVFC 4YC2C 3ZSTA 3GMQA 4GUOA 2NLJA 3K4AA 2AZAA 3HS0A 5L8LB 3II3A 4OM0H 2EIMB 3HMWH 2GC7C 5BOZG 4WTZA 3ZQXA 4PRNA 3UTQA 4HEMA 2LLLA 1KN2L 4QOKA 3I9IA 1P7QD 2FSEA 4QRPE 5EU3B 5GS0H 2DQDL 5AOZA 4N2KA 3ZZSA 3PG2A 3FCSA 1J11A 4CW1A 1GGIH 4PGJA 5IIEA 4KJYA 4K94L 5H94B 5IFJB 4ABUA 4LSSH 1A6TA 4CMMB 4MFHA 1GS8A 2A74A 4OFVA 2E7LC 4UT9H 3WFHB 2IG2H 2QSTA 4K71C 3US1A 3FOLB 5EO0A 3GGWA 3JWDL 4ECNA 1E8XA 3MOBL 4NIYE 2FJSA 4Y2LA 4KRMB 5BV7C 3CDGB 3QZNA 9PCYA 4HCFA 1I9RH 4X4KA 4W68A 1J5OH 2LGNA 3FO9B 5I66B 3O8XC 4AUUA 1BQHB 4MAYA 3VFVB 5D96B 1DBAL 2X4NA 1UUSA 1OEZW 2JI2A 2VW7A 2XZZA 3VWJC 2IQ9L 2EDXA 2WLJA 1XGUA 4Y8DC 3WDJA 5E7BA 4OGQC 4M00A 3BWUC 3Q3GB 2J6EA 1N59B 1UWGL 1HH6A 1CLOH 2D9QB 5C0GA 5E8EB 4AY0A 4J8RB 1S7XB 4H5SA 5CJQH 3FU8A 4FI6A 3ATAA 1IJ9A 2NSMA 1SN2A 2ILLA 2ZYRA 4KJPD 4PJ9A 4QGTA 4X0KB 2YLHA 5TF0A 1CL7L 1AHWC 2CK0H 3BO8B 4YGAB 4K23L 5LWYH 2OS7A 1XCXA 2MOVA 5DDHB 5F96H 4X8JA 5DC2A 2EUVA 4PJEF 2PPEA 5J57B 4EBQL 2B1OA 3LD8B 1IM3D 4P3CL 1XCQB 1DVZA 4UQIM 4G1EA 4P4RB 3HVNA 3WN6A 1HIML 1ULVA 2XZQH 4DK6A 5LCVH 3PDDA 1REIA 3WNPA 4KMTL 3GJEA 4JQIH 4N85A 5D2NC 5AVTB 3MLRH 3QA3B 2XQYA 3V10A 2Q76A 4P59L 2RACA 2YXFA 3FFCD 3MLTB 5EU3A 4A7SA 1KB5L 1HCZA 2HKLA 2OW7A 1MHEB 4GH7B 2RH0A 5AUMB 5SWQA 1JV2A 4YHYC 3FU5A 5INDB 3P1VA 1U8LB 5E94A 3OLDA 3QZMA 5FOBA 3QQXA 3LZOA 4A7VA 5E4OA 2Z31D 3U48A 4FLSA 2HG5A 2GSIA 2XKSA 4UOW1 4XCEA 3U9UA 3LYRA 5L2KD 2IFGA 2O26U 2AKRA 1IX2A 1EIBA 3NJGA 1E3ZA 1ROWA 1R1CA 1U8KA 2IDUA 1BLNA 5J6GB 3C5ZB 3NZ8B 4M5YH 2AJVL 1HCFX 2CIIB 3D25A 4FZ8L 4GO8A 1YHPA 2B3IA 1OGTB 3L7FB 4I18A 1AZBA 3IMWA 1L9MA 3KGUA 3SE6A 4XMTA 3C6SA 4GAGH 4PCSA 4F57L 1JWUB 1J9TA 3MNMA 4OKVA 3MRRB 2I5YL 5B7FA 1PYWB 3OC8A 1SXAA 1T1XB 3LRSB 2VDKH 4L8SB 1PSKH 4FI7A 4U1LA 3W39A 2VAAB 1BYPA 3VD7A 1TJIL 2X2IA 4UCFA 4I0PA 4PJBB 3UAFA 1XL6A 1WBYB 5D6DA 3QUKB 4S1DC 1WZLA 5BRZA 5BRZD 3NRFA 1AXIB 3NIGB 4PSRA 2NYKA 2JCCB 3NK4A 5I17A 1MFDL 1XR9B 3E80A 1H0DA 1WS7A 1RLWA 2EE3A 3MRQB 4M1GH 2MOGA 4I77L 1RPQA 1GJWA 2XJKA 3T5WA 5CD5C 5F3HB 4YHMH 4UZSA 1N12A 2AV7A 3AB0B 2KL6A 3REVB 3WEMA 3HE6D 3GBLA 3GXIA 3QIUD 4NN7C 2RR3A 2VLJB 2H7WA 4MMXC 2CO4A 3G6AB 4YZWA 1MWAB 3MJ7A 3TVMA 1FDLH 4W4NA 4YK4C 3QJHB 4JL1A 1QW8A 2EKSB 4KMTH 1LEIB 4G1EB 2FUQA 1QSEE 1MN4A 4BKLB 4FQCH 3B9VA 5J06A 1H6EA 1A6UL 2WNKA 5CMAA 5HHOE 2QVKA 4QWWC 2IEPA 4EEEA 4EIGB 3SODB 3GHBL 4I89A 3B2UC 3M8OL 1WICA 3EF7A 4NUJB 4YR6A 1EA9C 4ODXB 1QEWA 3AY4C 3SE8H 3OAUL 5DD5L 1MRDH 5JXEA 3WS3B 4TUJB 3RBSA 3B2DC 1A7QL 4RBPK 3W0WA 4KK8D 4UILH 2NLJB 3RB5A 3CPUA 2HB0A 4YDNA 5IJCC 4A7QA 5HI3D 2X4SB 3LKNA 1IFHH 3QWRD 2BNQD 5JW3L 2AEPL 4FFYA 4WU7B 4PJGF 2VABA 1NDTA 2CRIA 5FFLA 1HILA 2GJ6B 1X5KA 2CGYA 1FCCA 1U6AL 2JK5B 5FUCE 4LCWD 3P3TA 2VSMB 3DOSB 1RXLA 3FU6A 3QYCA 2V17H 2BFVL 2YPLE 1UOLA 2NT1A 3O6FB 1ADQA 1SM3H 4MLIA 5BZWB 1IGIL 2VKWA 1OAXH 4FNLH 4YFLF 1C12A 3LNFA 4JHWH 3IJHA 3ZKMD 1B9KA 2ZAIA 3QS3A 4MA1B 2JELH 5FKPB 3BH4A 4W9EC 1J88A 3JTSB 4JFPA 1DFXA 4FHJA 1P84J 4O2FA 32C2A 3VXUD 1RIUL 1BMZA 4X9BA 3LZFL 1Q90A 4OJFH 5IBTH 5H8DA 5IM7B 4JREC 2N3JA 4GO9A 3ARGC 3WEAA 2D7QA 1M7DA 3D4ZA 1GOGA 5AZ2H 4GSQA 2WXGA 4JKMA 1TTRA 2DJ4A 2A4CA 3AREA 1IM9A 4JY6B 4AXWA 1CFMA 1HCVA 1S5HB 4ZYKA 3HN5A 4RFEA 1NKOA 4MS8D 2K3TA 2XACC 1WJ3A 1F1GA 1JWMB 3QUYA 3VTAA 2WJ7A 3IBOA 1PY0A 5E7FA 4AE0A 2WP3T 5D1XB 5JORB 1MQ8A 2CK0L 5F72S 4HP5A 5EV7A 5FUZL 3WAJA 1CR9H 1D9KD 3LXBA 3WMQA 1OALA 4HJUA 2N1TE 2I69A 1WD9A 2P8LB 4HIEB 1V3MA 1F1DA 2RALA 1QPXA 2VLMD 3NSJA 2R4SH 4LHUA 2VTFA 3RY5A 2WZPD 5AB1A 4ONGL 3DX8B 3OKLB 4HUNB 2AEPH 3NVQA 4QYOB 2CPCA 4GUPA 2AJSL 3QHFH 1E9OA 3ME0B 4UINL 3VFPA 4M6NL 4TLUA 3CLFH 3D2UD 3IDNA 2NUPB 1OSEA 4HJ0C 4YDVA 1G84A 1OQOA 1C8QA 1NUNB 2FEJA 3VFVA 3L3OC 1KJMA 4NJAH 4GW1B 4JO3L 4FYRA 4Z77A 5L9DL 3U1QA 2A9DA 3QRBA 5GRYA 1KEGL 2O5NA 4KKBD 3Q6FB 1NA8A 4KOCA 3RIAF 2V5MA 4IM8A 3GSQA 4NFCA 5DEFA 2C9PA 4K94H 3GSNA 4Q0XH 5C09A 4ZW5A 2BY1A 1WAPA 1CXKA 4L4VA 3B7SA 4U2ZA 2G9HB 5AW1B 2QL1A 4W9GC 2ICEC 5AOIA 2XVKA 3QGVA 3HN8A 3UG5A 1TNMA 2C3GA 4OCWH 1PJWA 3L3JB 5E8DL 3UTTB 1TETL 3RVTC 4Q9QL 2AP2A 5KG9B 4PJCB 2VW4A 2OL3L 2ITCB 3D34A 2FYYA 3J7HA 2QKSA 2KUTA 3Q5YA 2P44B 3KM1A 2X4OB 4C59B 1XDTT 3MV8D 3SQOH 3MV8A 2J8OA 1ASPA 3JYBA 1K2DB 2A6IB 3I2CH 4FFZH 5I1KL 4JVUA 1QOKA 3S0PA 4AJVA 2EEFA 4B95C 2VR5A 4KC3B 3WNKA 5I73B 3QG6B 2V9UA 4NNYA 4M7KL 3VRLE 4RA3A 5SX4H 4WHDA 1L7TL 4L8BB 4B60A 4M5ZH 5A7EA 1PY9A 1DO5A 5E1IA 4LNRB 2BNQA 3FPYA 1DVQA 3AW5A 2NQ3A 4BK8A 1S7QB 3DJRA 4ZPVA 4M48H 1BDYA 2MQCA 1BVLB 3EFFB 3WXVH 2J1YA 3HI1B 3KPQB 3TBVA 3VFSB 2VZTA 1HAUA 4UT9A 5F89A 5GS0D 4XBMA 3FUIA 1BAFH 5D7IB 3RZCD 3NZUA 1CGYA 1JNNH 3QC6X 4FXKB 3S36X 3RZCA 1IC0A 5D1QD 7PAZA 5CXPA 3PIQB 1RIUH 1E28B 3O41A 4X9GA 4PREA 3MCLL 1C5BL 3Q6FA 4EUPA 3ZK0A 3LJ3A 3NCFB 5F6HI 4G8FA 3FAWA 2F53B 3NGBB 3O45B 4HFWB 1OT1A 2ZXEB 3CTTA 4MNHA 3CPLA 3W9EA 3S2AA 1SM3L 3OKKB 2P45B 2P80A 2HTLD 2WVUA 3IFLL 3DV6B 1DLFL 1R24A 1PZDA 4MMZB 3NQKA 5EDSA 3DOSA 5E8DH 5KVGL 2WXFA 5A3ID 1ZSDB 5D72H 3RP1A 4EZMA 3PL6A 3ZGPA 2NZIA 3WE6B 1ADQH 2YMXL 4NRYB 1MHCA 3LNEA 2AXWA 5KUMA 4AK2A 4LSPL 2OTWA 3C75A 4ZK8A 2R29A 3KLAA 4MJIA 3VO0A 4UIMB 1UB5B 2CIKA 4IIZA 4LHUB 4PU2A 4EQ3A 3GXFA 1BPLB 2I25N 3QIWB 4PI2A 3SJVD 1YEHL 4O02L 3FQYA 2H1LM 1G7PA 2ZG1A 3JV5A 4I9WD 5E23A 5BNXD 1R17A 3LNGA 4AYFA 3ULSA 5HSFA 4DFHA 4XXCC 1A8JH 1TQCB 3PS6A 5C0FB 4BCYA 2AXFB 2MQ0A 1A8ZA 3ECVA 3QEGH 1KZQA 1FLTX 4JQVA 4QCIA 4ZS6C 3M45A 3OKMB 3O3EB 3GT6A 1BV8A 3Q7JA 5DHDA 4Y16C 5EUOE 3FRUA 1GMEA 2BSEA 3BP5A 3N91A 3IF1B 4ONOA 4U1IA 5JA9A 1EEQA 2EDMA 2G2RB 3B3IA 5FGBA 5T3ZH 4OI8A 5DRZB 4OCRL 4WWNA 2QJDA 5DUBB 5D7HA 1T3FB 1B9ZA 4UIKH 1A1MA 4N0UB 3LKSB 1AD9B 4P5KA 2HH0H 1TR7A 3WFDL 1KPVB 4HIEA 1X4YA 1ECZA 3I6GA 2UXFA 1XF2A 2VR7A 2AEQH 1KGWA 1CFTA 3GSNB 3QP3A 2XN9B 1E3FA 3ZYIA 4JPVL 5E6YA 5C07E 4N8VA 3TN0D 4YHYB 1G7LB 1GY2A 4EI6A 4FQ2L 4J2XA 3V0WL 1HH9A 2CALA 4R7DA 3BJLA 1F18A 4YSUA 3IDIA 4L1HA 2P42B 4KJPC 3O45A 4IU2B 4UT7L 3ARRA 5IQLA 3VXNA 1OGAB 5CINH 4N22A 1N18A 5KBNC 1NCNA 1MW3A 3ZHNA 2KS0A 1BBJA 1IGCH 4ZW7A 5ADOL 4GP8B 1QRNA 3D1MC 3NZHH 5J89A 1GIGL 4ETQB 3V9CA 1YY9C 5B1JA 3RFZC 1FORL 4ZS6D 4PLOB 1NCBH 4L4TD 1DVYA 1Q0XL 5EZOL 4B9YA 3D4CA 1C8PA 1U58B 2C3VA 3MREA 3ZSSA 3KPRB 1D7BA 3U82B 4M3HA 1M53A 3OKEA 5I71C 4LLMB 3EOTL 4Y9FA 3ML8A 3FQ4A 4OLUL 4C56D 2UZXB 4GEJA 3QC5X 3LKQB 4JHWL 2DBLL 4RGMB 2XPZA 2E3VA 3QJXA 1M7XA 1T1YA 4MB4A 4LE8A 4HEPG 1MELA 4LVNB 4K5MA 4O2CB 1DEEB 1E5BA 1SN5A 2AQPA 4L4JA 5CP7B 4ZUVB 3MA9H 5E8OA 1EDYA 1F3DH 1XT5A 1I4FA 3A21A 2WO2B 5EO1B 1KB5B 1XAKA 2P5EB 2GSGB 4F8LA 3SDAC 1N6QH 4AE1A 4IKKA 2XTSA 2WZAA 1LK2A 3ET9F 3OXSA 3QZBA 3TT3L 1XZ0A 2LVEA 1YNTB 2BDNH 1J12A 1HU8A 2WQUA 3O2DL 2YUWA 4PVLA 5GSVA 3IJEA 2P8MA 2BSRB 4R7VA 4UV4L 3X13B 2ICES 3CC5B 2J88H 4G7VH 4HIXH 4TNFA 3IAPA 1G1KA 4ENED 5HGBA 2TSBA 1N19A 2XQYG 4PJ6A 1MEXL 4QHUB 5GZND 1UH3A 3O4OB 4OCYH 2AK4E 1O9VA 4FERA 4S0SD 3QNYB 1RUMH 1YJDL 2OMUA 1X5HA 2TSAA 2JWYA 3ARXA 4NZDA 4S2SB 4RIRA 5C6PB 1K85A 2C1OB 3IS1X 3MR9A 1TJHH 4Y0GA 3T08A 3PQYA 1KGYE 3ILQD 1WWWX 3RDJA 4ELKB 1V5JA 5H35A 2UY7B 4Z95H 2KERA 3GSUA 3UYRL 1JF5A 3BZDA 3LN4A 4L2LA 1LL1A 3VG9B 2WZ0A 5ELIA 5HJ3A 4A2EA 3NFPB 1HOCB 3BKJH 4ZFZA 5GGSY 3SYPA 2DM4A 4IMKA 3WJJA 1ZJAA 2YC1B 3GS7A 3ZTNH 4FQIH 1T20A 1YMHA 2BS8A 4DEPC 5CIPH 1A4CA 1MUJB 4LGPB 1YPZE 3KW8A 3QW9A 1RP9A 5C0DB 2NY3C 4X9YA 4Y1AD 4JG0L 2ITDB 3TWCL 3HG2A 4NQXB 1U3HA 1PDKB 4PPTA 1I1CA 1OL0A 4LHQB 1U93A 3FRUB 5GJSL 5IHUL 1GJUA 1Z5LB 2FSEB 3BPLC 4F8PA 5IJVB 3IK2A 1IQWH 1XSOA 2EE9A 4XRCA 4KRPB 5DTFB 4D7BA 4ZW3A 1XCQA 4F37K 1SJEA 1J0JA 1T4KB 2QFPA 3OZ9H 1KB9J 3BAIA 4TSAH 3RVTD 4L9LA 1CF8H 3HE6B 3FCTB 3WO4B 4PTTB 4DGIL 1EK3A 1S8DB 3CXHJ 5JHBA 4LEXH 4KH2A 4ISVA 1A14H 1R3KB 4HKBB 4L9DA 5D1XC 5DJ2A 2IH8A 2APBA 1DBMH 2VAAA 4UAOB 4DK3A 1DQKA 3UZQA 4WO4C 5GSVB 4LBAA 4OUUA 3QUKA 5BRZB 4ZMTA 4QWWD 1DBJL 3BQUA 4LOUC 4PJGB 2JVUA 5E6IB 5F7MC 1A7OH 1AHWA 3O2WH 4YL4A 2MSPA 3M1OA 3DUUB 5DQDH 5JUEL 3S5YA 3HLAB 5AB9A 1A9EB 5EF0A 4Q9RH 2ZCLH 1T4WA 1UWXK 5LXGH 1AC0A 2DB8A 2VR4A 4XP5H 1MPAL 3C87A 1GIGH 1QD0A 5T1MB 2X4NB 2YEQA 2W07B 3GXTA 5D7JA 3D25B 3BLPX 1FUNA 1KXVC 4PR5B 1I3GH 4YDZA 3ZHLA 1BQHG 1BG1A 4U6TA 2XKNB 4PW9A 1R47A 5HDRA 1ROCA 2PCFA 3QARA 4KRLB 1F8TL 3C8DA 1A6ZB 4MD5A 4YH6A 1FN4A 3I9GH 3V0WH 3D52A 3AXLA 5AW8B 3GJFH 3SDDD 3VH8G 3TBYB 5E2JA 5B39G 2OMVB 5D8JH 1WYJA 3I84A 2Y6TE 1L0QA 4GLRH 2H3XC 1AYOA 4IRJD 1ZVNA 3HNVL 1KG0B 1U92A 1X5AA 1UADC 2AEOA 5DMKB 3I9PA 3LDBC 3AROA 3BN3B 4Q89A 3SDDC 4H25A 1SVZA 4S1SH 5GGTL 3S5LA 4GKNB 3PE9A 4XAWH 1CI3M 4JFUA 3VD2A 4NQSB 1KMGA 4JM2D 2AEIT 3KGTA 2IC2A 2Y0SA 3HRZB 3IDXL 3NQIA 3UAAA 1ANUA 4NZUH 4NO5B 4M9PA 35C8H 2AV7B 3O3EA 4QNPE 2F19H 1TTFA 2HFFB 4G2AA 3KM2A 4BH7A 4G5ZH 4KY1L 3V52L 5I30H 2BHFA 3O8XB 3K72A 1RUAL 2Y7OA 4AKPA 1TU2B 2V9RA 2KLTA 2XV2A 3QJSB 3QJTB 4HKJB 4K2UH 3T2LA 4EI0A 3W37A 4JN1H 4HPHA 1DVUA 3QFJA 4FFWD 4XVSL 2H0EA 4JDTL 4O9HL 3D39B 2BVPB 3DX9B 4A2MA 4KXZH 1FWXA 3NCJL 1FL6B 4PJ8D 5I1IL 1GMIA 1YY9D 1SMOA 4X6BA 1F4HA 1MLBB 5FYJE 1OE3A 5F9DC 1FFPA 2R2HB 3MJ9H 4WWKC 5FGCB 2Z6FA 3IDIB 1A6WL 1JPFA 2I9LB 4UDTA 5L0QC 4HALA 2P4AB 3WFCH 4XCYB 1OAUL 3X14B 3D0LA 1U8CB 5F1IB 2XWCA 4TQIA 5DWUL 1E9PB 3VD9A 2B39A 3CE1A 3CX2A 1UOWA 2B59B 4X6DF 1TJGH 1IU1A 1DQJA 1KIQA 3HE7C 4AZ8A 5MEND 4KRNA 5D4JA 1C5CH 3BP6A 3IS0X 5B4MD 3HC0B 3MCLH 2R9HC 1EFXD 5KYWB 3O4LB 3OL2A 2NRDA 4LIQH 1DDTA 4WNJA 2WXRA 1HXYB 5CZXC 2C3HA 2EYRA 1CICD 1NGWA 1YDPB 4UNUA 1PTZA 3IU4H 1Q1JH 2YD2A 3JV4A 1GZPB 3KYNA 4NC2B 4TF4A 2VDPH 3ECBA 1L9OA 1IRAY 4J4PA 1UJ3A 4LCCC 5C0IB 5J1AB 4OB5H 2WUBL 2PKDA 3VFPB 5K9KB 3VTMA 4XMLH 1CE1L 4PGEA 1CLYL 3PWLA 4XH2A 4IGBB 3R06B 2JTYA 2HJLA 3NFPA 4JFEE 3T2QA 2FWUA 1DQTA 5KBDA 3VWJD 3VUAA 3VXMB 3GMPA 4P99A 2DMCA 4XCCL 3HJEA 3VCLB 4EZLA 3JV6A 5L88L 1SYSB 1OD7A 3S98A 3QDGB 3BT2H 1ID2A 1AP2B 1DVXA 1SGKA 3BUQA 3T04D 3HNTL 4LDCA 3E8UH 5CEZE 1GC1H 1P1ZA 2AGJH 5J13B 3QIWC 1LNUB 3FS9A 2C4FU 5TK4A 4F58L 1UFGA 2WO4A 3LIUA 2YO3A 5EOTB 2I60L 4PJFF 5AKSA 5B8CC 4QLRA 1F11B 5F9AC 1VEOA 2A9NL 2A4EA 2AJSH 3VD1A 3QHFL 1ACYH 3TEZA 4F5CE 4QRFA 5FYJH 3WD5H 4S2SA 2NY6D 2ITFA 1JMXA 4QXGH 3V4PA 3IDNB 1EANA 1RKRA 5KSAD 3C60C 3PHSA 3V0IA 3FB5B 3R7RA 4UT6A 4IRSB 2HTLC 4XPBL 4XNDA 4YHOH 3SDXA 5K39A 4PWKA 1E9PA 1X4XA 4WO0A 1NGQH 2AK1H 2CR0A 3LSOA 3WFZA 1DSYA 3LTVA 4KOBA 2E6PA 2NDFA 3TT3H 3C60D 1X5YA 2CDFB 1EVUA 1UWXH 3L3DA 1K2DA 3B8YA 3T1FB 5A2KH 1AQ8A 1MLCA 1B88A 2L04A 4QJ3B 3SKOA 1EO8L 4X4YB 3F7VA 4JAMB 1XD0A 1GYWA 4N2IA 4UNVA 2XU9A 1IMHC 3W57A 3DURA 5KANI 1SLVA 5D7SL 3I9GL 4RFEB 1P69B 3RHWK 1GGYA 3EH1A 3HC3L 3H7BB 3P9MB 1R3LB 1T03L 3BW9B 4XBPA 2ZAHA 5DZJA 3FT4A 4IRJB 3L3OA 5EBLB 3NH7H 3HAEH 4HGWA 1ASQA 5H94A 4EF3A 1CYXA 3AT8A 3D0VB 3MNVA 3VRIA 1FE8H 5E2UL 1G7QA 1KPUB 4A6YH 1MFVA 4Z95L 4B0MB 2P5WE 5EULV 5C0ND 1AY1H 4Z7NF 1W72H 5BVPH 4AYGA 3TA3D 4N90E 3UGUA 4G8EA 1CE6B 2XG5A 4X98A 1ZTXE 1SZNA 4O5LL 1FLRL 1XFPA 3QUML 3TBTB 5JW4M 2OM5A 5E4EC 1LO0H 4EN3C 1UD6A 3MGAA 4NQSA 4RGMC 4ZX5A 4ZI8A 4XMKH 1KCRH 4FQHA 5GHWH 4JO5A 1ZRUA 2OJZL 2CO2A 1FGVL 2OCFD 4Q97A 1NCGA 4MNHB 4RFOL 1EXHA 1CTMA 5KJRL 5C0BE 3U79A 2VLKA 3W38A 2R2EA 1EAPA 4XN2A 4ACTA 3KPRD 3U2JA 4MGXA 1XIWB 3BFWA 3FQXA 1JV5A 3QEHB 2DQGH 1TLMA 1UM4L 3P3SA 3FT0A 3W9DA 4JPVH 2YEZA 4JQVC 4XVTL 2MWCA 3PWUA 4N90D 2QQLH 3CSFA 4DGVL 4M62L 3ULUF 4TUUA 3SPVA 3KMDA 3QFJB 2GT9B 3PGFL 4DPRA 5DSCB 3QCTH 4YZFE 3CVHL 5BJTA 5D7IA 5MERB 3P77B 4EI5D 3N04A 3UJIL 3UC0H 1TCRB 5CD3B 3N1GC 1DBML 4WU5B 1KB3A 1OW0C 2HFTA 3HZ3A 3MRJA 5IQ7H 2O4EA 3L3DB 1E5YA 4ESKA 1H3GA 4HAGA 3RGVA 1AGCA 4MAYC 3RGVD 4F8QA 3QNXB 4LBEA 5C7XH 4XP4L 3V6OE 1N70A 3BEVB 2ZXQA 3BVVA 4N86A 5MEOA 1A4BA 1BZ7B 3MJ9A 3DRQA 1B4JH 4HETA 2H41A 3DJSA 3UTTE 1SBSL 3GF8A 1N10A 1U21A 3NFNA 3QZPA 5EU5A 3QA3A 2W80C 1AR1B 4LSTH 4NQVA 2DWDB 1IQDB 4OLUH 2IBZY 5AAWA 1I75A 2WHVA 5F0MB 2A6JB 2WBJC 1A7BA 5E03A 3JV0A 3B3IB 1H8SA 3O2DA 4PEEA 2R0KL 4FS0A 4NYLB 1MXGA 1EV2E 4MSWB 3SEPA 1TJIH 4Z3HA 3EO9H 5FOBB 3BISA 1A6VH 1PX3A 5GZOC 5H2BA 1CGSH 5E51A 1MCJA 4X4ME 1YA5A 3QHZH 5E1HB 2B1HL 4MJIB 3E3QE 3KCPB 1XTLA 4M5SA 4NHCL 1FJ1A 3FU3A 3N42F 1AR2A 4M7JL 2FGWH 4YL9A 3JV4B 3UTSB 1O6TA 3D48R 1OSZA 3ULUL 2XN0A 3L54A 2ED8A 2Y2TA 1ACYL 4JE0A 3APNA 3L5IA 3C9NA 1ZLVH 4U0QB 2EDNA 3SE4A 5F0JB 5IJKA 4NN5C 3BPCA 4HVBA 1S9VA 4WIQA 3RNQB 3PWVB 2GUOB 3PP4H 2FWLB 5MP6L 3ARDC 4ZT1A 2QHRH 1K5NB 1FFNB 1AQMA 3FO9A 3M6DA 3VMNA 5I66A 3PUCA 1K72A 2XJLA 3QEQB 4CNIA 4CL7A 2XA8H 5D1QC 3INUL 4KRPC 5KAQG 5CGTA 2DY2A 1UEYA 4UB0H 3PNRB 4WI0B 5ICXA 5D2LE 3DKHA 4YSAA 4XHJD 5CM1A 1DBJH 2PLTA 4ZO8A 5DVLA 3DMMA 5BJTB 1CDHA 3UACA 4N2GA 1A3RH 5TF1L 4I18C 5AWNH 5EOTA 4KO5A 2HFEA 2RHEA 5BV7H 5C08D 5KBLA 4UQCA 4LSVH 1ZA3B 1KIUA 4ICWA 4I88A 3IMSA 1ZHKA 4KKNA 3H42H 3MJ7B 1S9WB 1T0MB 2ZWYA 5GGRY 3WUZA 5BCAA 4ZUVA 3FZUD 2OMTA 2HRGA 3GDCA 3MV7A 5FFOA 5DFAA 2PPCA 4YHNB 1BWMA 2I32A 4P4RA 4K94C 5D6DC 5A6MA 2GB2A 2W60B 2ZX6A 4XZ4A 4PV9A 3H9YA 1I8LA 3NZHL 1G7QB 1KPUA 1MJUL 2HRPL 3T6WA 2WLIA 5HP5A 1TETH 3DX7B 3GMMB 2RCSH 3VXSD 4CVZB 4F9PA 3HJ0A 1N4XL 2KYIA 1MHEA 1U9KA 3U30C 1VEPA 1CE6A 2XG5B 4KI5C 1GR7A 5L4FA 4HIHA 1JHTB 2EIKB 2EO7A 3EOTH 1RU9H 3VQLA 4LRNL 2FUTA 1CBVH 1H5BB 3CZGA 1KIRA 3TA3A 2HJKA 2KI6A 1JMZA 2XWTA 4NWUL 4OAWB 5ITFB 3GRBA 4UOZA 1XV8A 4QRTB 3V0DA 3A4FA 1VENA 1CDGA 2NTFA 4P06A 4GMSH 2DLTA 3P9MA 5JHDB 3L7FA 3CCHB 1JZFA 2V7HA 4V1DE 4JQIA 1J8SA 2F1AA 4DZBA 4A7TA 3NEEA 5I1GL 4P0DA 3QDJA 4UT9L 2IG2L 5TDNA 3SCMD 3CN3A 1CLYH 5AYTA 2OSWA 3L4VA 3QB7C 4OZGF 2EVGA 1K6QH 4CBZA 3EDFA 1NIBA 2EIDA 1CXEA 2X09A 3W11D 3CK0H 5HDOA 2NY7L 1HWWA 1B0IA 2APXA 2V33A 1J8HA 1U8PA 1WEJH 2ZWLT 1Z7JA 4E42A 1YYMH 4LHJB 3CU7A 4MD4A 1OSPL 5GRUL 3WEXA 4MLSA 2F74A 1M9WA 1HKLL 1MDAA 2LTQB 3FO0L 3EFDH 4UINH 2GTWB 1EZUA 5GZNC 1KGCD 1VFBB 3LPOA 3EDDA 4KQ3L 4M93B 4QRPA 4XVJH 2CLVB 3VH8A 5IV2A 3OWEA 3QRFM 4QEGA 3SBQA 5IHZA 3DDFA 4WWKB 3WKPA 3CWGA 4XNQB 3D9AL 2JLPA 3K0YA 1NBYA 1QEXA 1TJXA 4DAGH 3FW6A 1UWGH 4QI3A 1KGJA 4DKAA 1PBYA 2WUCL 5EZPA 2J57A 4F7KA 1L5GA 4RAHA 2YHGA 1U0QA 2YR3A 3U2IA 1TIUA 4Y1AA 5CGYD 5I1AA 5B3SB 3D0VA 3MNVB 3NRPA 2GBTA 3PXLA 3RY6C 1UA6H 2PPFA 1X5ZA 4CJ1A 2AS5M 3Q8BA 3MLUH 5EEYA 2HKFH 4OSUL 4UU9A 4FJZA 2BWQA 4BWTA 1FFRA 3V6FB 4WK4B 1D5IL 3HZKA 4MB1A 5I0ZA 5EZIL 5GIRA 5C0DA 4P2RE 4U6HA 4Y5VC 2X1WL 3HG1D 2AJYL 5EFIB 4DP6X 4X8CA 3A6OA 3U0TA 4WY7L 3DI2B 3LZLA 1P6FA 3AACA 4M7LH 4X8XA 3STLB 3BWAA 5IEKA 2WJ5A 3BPNB 2OXHB 4WUUE 4ORGB 3SGEI 4HJGA 5JLZB 1W2KT 1F86A 1S7UA 1BAWA 1BFOB 1RIVL 3F6LA 3CG8A 3G5YB 4G8GE 1ADQL 5C9JA 1PSKL 5EEVA 4RZKA 3OTTA 2VMDA 4G82A 3T9WA 4LDEB 4WI2A 1UKTA 4Z7IA 4YWGH 2YJQA 1WFMA 1PCXA 4JANB 2X4RA 4X5XA 5KZCD 3RDTA 3HNSH 5F9WB 3TZVA 3WIIH 3TBYA 1KV7A 2AXGA 1F4YH 5I71B 5DZVA 4WUKH 4LPCA 1SXBA 3DMMD 5C0EB 3A6BL 5L7XL 5HYJA 1U91A 1DN0B 1NCUA 2DM2A 1MIEH 2IFFH 2QPEB 3VXUB 3SGKA 5LKNA 3IAQA 2FR4A 2GQHA 3Q48A 1SOSA 1X3DA 1CC3A 4P2QB 1V8HA 2Q6WB 1FFNA 1S5IH 1FNSL 3H3BC 3D39D 4AM0Q 1ZS2A 3MROB 5KJ7E 2WVTA 2WTRB 4RGOL 2CR3A 4TULL 4J1UA 2HFFA 4Z76B 4ODVL 1H15A 2XPYA 3NN8A 4JFWA 3SKJL 2BC4B 5CLYA 3ROLA 3GO1L 2YAHA 4A52A 3M8OH 4ZFFA 1ES0A 1NFIB 2OJEA 3FCSB 1FRGH 3FFDA 1ZEAH 2FECL 2Q7NA 3QEQE 1GTFA 3OAYK 3CFTA 1U36A 3PNWB 4YEFA 4ALAL 5FYKL 2PWDA 5DK0A 1PDKA 4NDMA 2YUXA 1PNCA 3BQUC 3UTSA 3C8KB 3L6FB 4H4NA 4TUOB 2UYLA 1A7PL 3O3DA 3AS2A 5T33H 4C4KT 1WT5C 1BM7A 5DMJB 3WNIA 3BCFA 1OGAE 2L7EA 3DTUB 4WW2A 5C0CD 5CEYB 3H1ZA 1DUZA 2E8ZA 1OTSD 3GPSA 2NT0A 5FAAA 5IF0B 1E2WA 4J4PC 3O9WB 1DUYA 1QFHA 1XF5A 1EMTL 1MRFH 4RGNC 4ZMZA 5JOPD 1INEH 1FNGB 1EHLL 4HIIA 4XTRD 4Y4FD 1G0XA 4GMTL 1YQ2A 3EO9L 4AZ8B 5A2FA 1TZGH 1M2VB 1ND0B 4GT7A 1EJOH 1OSPH 2CU9A 3BZ5A 1N7ML 1V55B 5GRUH 1NSNH 5JDSA 4P2YA 5E2VL 3RJDA 4EDWL 1O6VA 4GI6A 5AVYB 2PPDA 4IBVA 3DUHA 3KH4A 2IWFA 2YOCA 3QHZL 4A38A 4JGUA 2A5UA 1TITA 2MH4A 2PO6A 5D71L 2YKKA 4G6KL 3ZKXC 4YHIB 4PJFA 3T0EE 4DP4X 4M4RB 4HAFA 5JHDA 1HCYA 1DN0A 1MLBA 3QJUB 2FR4B 1CFNA 2DH2A 4NKQB 1RURH 4G3YL 5DJ6A 5DC9B 1TVHB 3WL9B 1OKEA 2Z31C 5DK2B 1NCCH 4AYEC 4DVBB 1KYOK 5EEWA 3OX8B 4QRRA 5T3ZD 3ARYA 3JVGA 4QRRD 3V79C 4PRHD 5DR5H 3EH3B 3ZVVA 4G80A 1ZCRA 4MDRA 2DM7A 5DMIL 4WNQB 2ADIA 1PS3A 1X5MA 1EO8H 5JPMA 1I53A 4LF3B 4WFED 1K8DB 5GS3A 3VCLA 3KAAA 4JFTA 4K55A 4NFBA 2P47B 2QVFB 3P0YL 4MDJB 5C0FA 2O30A 5CINL 4XCEB 2F5BH 2LU7A 1AQKL 1HXYA 2EJ1A 3FTZA 3PP3H 4QJ4B 2EYRB 2QSVA 2ZUTA 1OAZL 4OZGE 2TAAA 1IC4L 4WWKA 3CXFA 4K3DH 1OP4A 2X6BA 3ZRSA 2EDEA 2HLEB 1OAQH 4OM1H 1M7UA 3FSZA 2D03H 3VG9C 4MA3A 2OR9L 2Z35B 1I7ZB 4PRAA 1T2JA 3A4EA 1EHAA 1I3VA 3QQ3A 1QLFA 4QY8A 5CNHA 3QUZD 5JW4N 1EX0A 5EEXA 4YHLH 1NAMB 5EBMB 1I1AC 1RK0B 1RJLA 4X0KA 3HE7A 4MVBD 3CHOA 1I1YB 4YXHL 4CVXB 1SXCA 1AH1A 4IBYA 4PJBF 4WEBH 3DHJA 3J07A 4MDIA 3V9FA 3NCJH 5DXWA 3HR5B 4TKWA 5F7EL 1ND0A 2CMRH 2XBDA 4AIZA 5I8KL 4UV7L 3P3YA 3HAEA 5C0RL 3FTSA 5LCVA 3ZQWA 3BPLB 3SE8L 3DX6A 2G5BB 4JKWA 5IQMA 2X88A 3Q6GH 4PJHE 4JRXA 5L4JA 1DTUA 2PCXA 1HZKA 1GGIL 2D3LA 4U1JA 1KJ2A 4HXAL 1KSRA 2Z4QA 1MY5A 1I3UA 3BKCH 4J3BA 3GKZA 4NN6C 2Y5TA 5CAYB 4M4PA 3QZWG 3NAAL 3BP7A 4AVJA 2ENSA 5KBMA 5FX3A 1R3LA 4G3YH 1IKFL 4HJIA 4OGZA 3P2DA 1IM3A 3GEFA 3WV0A 1F4YL 2K0RA 3X11A 4WFHE 3RWFB 3ZYZA 3EH4B 5DCCA 1SLUA 2BNRE 3FYIB 5JQHC 3T6QC 4WUUB 4DN4L 5E6IC 4JFDA 1JUFB 2QSCL 2PXYA 2OZ4A 2PXYD 5EEZA 4NDMB 3POCA 2YFOA 1M7IB 1ORQB 3Q2LA 5T1KB 4PM1A 1U3NA 1EDHA 3WDIA 4TVPH 1EZVY 2EP6A 3N06B 3V6FA 1FO0H 1M57B 1ONQA 3GQFA 4FXGA 5I6OA 2QZQA 5AB2A 4AYMC 3A67L 5CJBA 1DQVA 3U36B 3RX9A 4BINA 1NCOA 5IJDC 3DURB 2BRQA 1KXQA 1I3GL 1SUHA 2Q8BH 2D2CC 4ZAKA 3VFUB 2YARA 1YY8B 3EO1B 1WO2A 3V5HA 4FQXB 1A22B 4FP8H 4HWBL 2HLFC 3ERXA 1KGXA 3BN9C 3MO1A 1X9LA 3Q13A 1C1EL 3NCMA 1Q9LB 2HKHL 3PNWA 3EJCA 4N3UA 3THML 4QF1B 1J5CA 3LH2H 2H0FA 1NWPA 3LDBB 3SDDB 1O7SA 1L7TH 5E8PA 3GZPA 4MASA 3QXWA 4MNGB 5DA0B 4CVXA 3VGDA 4ZSOA 1ZLEA 3TCLA 4KQ0A 2NZ9C 2E7MA 2OXGB 4P23A 3VAEA 4GW5A 4KNQA 3QK0A 1C08A 1VIWA 1H5BC 2J5LB 1VRSA 2I7SA 4P46B 3BAYA 4A2HA 5EIVA 1ZHBA 2X89D 2Y23A 2PO6D 4WK2B 4W81A 2EDFA 3V4PB 3EH2A 4U6XB 4FJ6A 3PPEA 1B4LA 1Z2KA 3V0JA 3SE4C 3OZ9L 35C8L 3QJQB 4PUBH 4HJ1A 4LFHG 2B15A 2GHWB 5E4AA 3EJSA 3RWIA 2DJSA 2VDNB 1A6AA 1IC7L 2ZCKH 4U1LB 4CN6A 3SKMB 2EACA 4V11A 1T22A 1RZJL 2C9SA 3LEVL 3SY6A 4YAQA 5JORA 3R1GH 4JHBA 3PWUB 1MZZA 3MVSA 5C8JA 4U1NA 1JNLH 4RMSA 2W94A 5H2BB 5IFAH 4GG6E 4X7SH 2Y3NA 3STBA 4B5ZA 2ESVA 1FFOA 1BX2A 4WU7A 2ESVD 1AGDB 2CQVA 4JE4B 4JPSA 4IKNA 4HV8A 2GJ6A 1P5UC 5KVEE 5J12C 1NWOA 4DESA 3DVGB 5C2BH 3E0GA 1N0LA 4O2EB 3QCUH 3S48A 3LZNA 1QW9A 2YAPA 5JIIA 4DT2A 1IT9H 3KYOB 1VESA 4NKMA 3FCUB 4NC1E 4WWKD 4ABQA 4YE4H 1RZKC 4ATTA 2DJUA 4R2GB 4PJ9D 5AZUA 2NUPA 1RK1B 3LN5A 2OSXA 3GZOA 4JCMA 4N0RA 1SLXA 1ZKAA 4LMQI 3KL0A 3D85D 3UTPD 2K6ZA 1ZHLA 4LF3A 4XOEA 1B0RA 3UABA 2BLFA 4JFEA 4ZUSA 1MOEA 2PYED 5JOEA 3T3MF 3TIDB 4F9LA 4UBDC 2UXTA 3Q9PA 2C26A 3L3GA 1MF2H 1FRGL 4L48A 5I23A 2ZOWA 3SBWA 3FO1A 5FA4B 5AW2B 3WTWA 1RZ8B 3RWCA 3P4OB 1WC7A 3DX6B 1WTLA 2F5AL 4JFXA 3KG5A 1ZD6A 2HFEB 4NUPA 5DYFA 2V5SA 3DGGA 3FQ2A 3LEYL 5AL8A 3BC9A 2WVVA 1J8KA 4NQEB 4OZGA 2OMUB 3MUHL 1U95A 1U2CA 1JK8B 3QISA 3FHAA 4G9FB 1RCYA 3ABGA 5CEXB 5A2IH 1RH8A 1SEBA 3V9EA 1JPTL 1LK3L 1T83A 1DE4B 1QNZH 3GBNL 5FLUA 3ROOB 3UAJC 2QQLL 4PJXB 5KS9E 5IEHB 2BIQA 3ZRCC 1QATA 4XC1L 3ARED 4FABH 3DXAD 4RGND 4QHNA 5J13C 3FB6B 2P26A 4Z8FH 5GZOA 5F93C 3QIBC 4ZFQA 3TPUB 1YEJL 3RVXC 5DJAA 5T8IA 5DHXB 5D4QA 5B8CB 3MRNA 3SCMC 1DCEA 3LIZA 3V4UL 1DR9A 2CO6A 1AAJA 1UXMA 4JDVA 1QAWA 3SYQA 2FYVA 2UVFA 2HUEA 1QBAA 2HP4A 1URIA 1MIML 5GS1A 1BSIA 2W0FA 5FO8B 1RUQH 2WIIA 5D7JD 2V5RA 2VNCA 5INCA 4PHZA 2J6WA 3VGAB 3WU1A 1Y1DA 5LXVA 1RURL 4J3WA 3NEXA 4X6EA 4IRSC 4YVUA 2WXPA 2OMTB 1NCWH 3LHPL 4BZYA 1SJEB 5KYNA 5IIEB 3GS0A 1I7ZA 4UM8B 5HYQB 4X6CF 3RU8H 1NM9A 4J6RL 1NGYB 1YLBB 3FBKA 3LIZL 3EYVA 1ZV2A 2P49B 2G9HA 3OMNB 1UGNA 2G3XA 2BP3A 2OLDA 1JNHB 3IU4L 5HHQB 4FA8A 1JHLL 2BVQA 3ZXAC 4WHTA 4AYBA 4FFVC 1LWHA 4P2QE 1LO2L 4XPTH 2LQRA 3AZUA 2FEEL 2GCYA 3VA6A 2FYYB 4LVHC 1TFHA 2BFGA 3X14A 4QAWA 3LN9A 3QEQA 4KKLC 4RRPM 1IB5A 4N0YL 3GMLB 5B21A 5FUOL 1FZOA 1M4KA 4G9FA 2YZ1A 4QXUL 4WI0A 4G9FD 1CL7H 5C0GB 3B9KB 1W0VB 3NYKA 1NC4D 1I9IH 3A23A 1U8NB 4FQIL 2WBJB 4K7FB 3WIFB 1NIFA 2FX7L 3V52H 1TDQA 3P40A 1XGQB 4HXBL 4H8WH 3ARFC 4G9DA 4HBCH 1U8OA 1OAYH 1Q1PA 2VJ0A 4HF5H 3TXAA 3H0TB 1GHFH 4J6IA 4YSCA 3FFOA 4X5WB 3EGSA 2JQZA 4YO0A 1HQ4B 2EECA 3BN9D 1JZ2A 2GYSA 2XG4A 2XLLA 5HHOB 3MV9A 3VI3E 1JPST 3UBXG 3MV9D 4LCUA 4BUHA 4Y5YB 2V9TA 3BDYH 3R19A 2VXQA 1KN2H 3CFEA 2IWEA 3HS9A 4JFEB 5F7BA 1JAEA 3ARDB 3JV6B 5K9JL 4F8TA 3BWZA 3MRHA 1O9ZA 1ZHNB 4KK9C 2YRLA 4CBPA 3PWJA 4RX4A 5AAWC 1E4XI 1OZTG 3ZE0B 3QCVL 5EUKA 1PLGL 4RH4A 3DVNB 4GAYA 4D8PB 2Z8WC 4A7UA 4KNTA 4I85A 2EXSA 5A2JH 1QHQA 2EYTB 4TVUA 3V4PL 3BO8A 5IR1B 4YDLC 3DVGA 2FRGP 3L4UA 4OF6A 3FBQA 2B14A 2AITA 1ED3B 1YJDC 1KLGB 3HC3H 5SWSA 4CC1A 3UZVA 2GTZB 4BHUA 4UTBL 4F7MB 2X0WA 4YBQD 3V5KA 1FIEA 2CKBA 1WV7T 3ZJAA 4OKVB 5B3JF 4BK5C 5DJZB 1EXUA 4TTDD 1CFSA 2F08A 3BPOB 4KGLA 2G30A 4KZDL 3MBEA 1J5IA 4QHNB 3BZ4A 3WJMA 1FYHB 3RVUD 5IUCA 3SKMA 1Z9NA 5E8NA 1NLBH 1O9WA 4H20L 4M5ZL 4L0ZA 5HYJD 4HUCA 1T2XA 2QADC 4OTXH 3TT1H 4FTVD 3D0AA 1I1AB 1IAOA 3O3BA 3MRMB 4Q9RL 4K9EL 2ENJA 3INOA 1KELH 1UB6A 4LCWB 4R90L 1VPOL 5C97A 5D4IA 4ZTOH 5CLTA 5IBUB 1OPOA 3HOGA 4F3FB 3U4BL 2AXGB 3H9ZA 4PFEA 1T7WA 3QR0A 4BZ2A 5F9OL 3CX5J 4PP2A 1FGVH 3CFUA 1FYTA 4UT7H 4IS6A 2G2RA 4IMLB 1MQKL 5HHPA 4XVTH 3BW9A 3KJ4B 4XBPB 1SVBA 4P4KC 1BEXA 2I60H 2PO6C 4LKXA 2Y06H 3WY1A 5J3HC 2GIXA 5AKVA 2H32A 3PGCB 3R0MA 4R5VA 4IGBA 1J48A 5CSZB 1KZYA 1DJIA 2AQQA 2AEQL 1HINH 1S7RA 1T5KA 2HUHA 2L0DA 4G8IA 4CSSA 3HB3B 2Z34A 3LS4L 4LP5A 3WSQH 4LCIH 3L1EA 5INDA 2VC2B 2QR0A 3GC3A 1T0PB 5C0CA 2WXMA 5E1AA 4PV1C 5JPMC 5FHAL 2Y7SA 3UAEA 3JSSA 5DK0B 3RA7L 2VKXA 5D70H 2FQDA 1DJHA 4N68A 4X5RA 5KSAB 1BQ5A 1CK0L 5I0WA 1DJYA 5F7KC 4CDGC 4JBSA 4XPHL 1QHOA 4UM9B 5I19H 5IVXA 5JIPA 3LRLA 4M93C 5FCUH 5LAPA 3KEDA 5IFHH 4MA7H 3TV3H 4FYQA 1BQSA 5DJZA 4PD4J 4OI7A 3U30B 3OJVC 2C9VA 4PJXA 2NUTB 1BECA 1D5MB 1JHLH 1FL3A 1SJMA 3H9SD 5EH1A 1T80A 1JS4A 3WDHA 2B20A 1NLBL 4H20H 5A40E 2DICA 1G7LA 3MJGX 2OQJB 2D4FA 1OHQA 3PABA 1VADA 4Y4FC 3EYFB 2ODIA 2H6UA 4I0PB 4PJBA 2ZT9C 4YDKH 4U49A 3QDGD 3O6LH 5CN3A 3WHE1 5BUGA 3B6SB 4X99A 3MLPA 5E9DD 3L8QA 1USZA 1KTKE 5LGJA 2O6PA 4TSBL 4LLUB 3EZJB 2OTPA 3U7AA 2IDSA 4BXSV 2R23A 1HILB 2FL5A 4G7RB 4Y5VB 4P46C 1WEJL 2D7NA 3AM8C 3OKDB 4FQXD 2NY0B 5HDWA 2X2UA 2UZIH 4HJJL 5AUMA 5SWQB 1HAWA 4NNXA 5D96C 1MPAH 3X3GL 4AVHA 4N2FA 4H40A 1BFSA 2H1XA 3ESMA 2UZXA 3ZE2F 3QS2A 3RGVC 3VJ6A 2GSIB 1PEZA 3K8KA 1Q72L 4GSRA 2ADIB 4DGYL 1IAKA 2P5WB 3QUXC 1TYEB 2IAMB 3DX8A 3N2JA 3JWOC 3NJKA 4JNXA 3QDAA 1EEYB 1C7SA 1NGPL 4R84A 4FEIA 3V6ZA 2BJMH 2ED6A 5B39A 4AEHH 4C58B 2FNBA 2VR9A 3D85A 4OZFG 2NX5D 3TCXA 2XWEA 4FEMA 4JFED 3WUWB 1F2QA 1IIIA 2YBGA 2YGNA 2DQUL 3EJJX 5TFSH 1SJHA 1TJHL 4PJEA 3BDXA 4YQXH 2ZX8A 4X6DA 1FYTE 1NJ9B 1KPRA 3FQRA 2BIMA 1PZSA 3S4SA 4GW4B 3GI9H 4KPHL 3RAJL 3JWOL 3NJHA 1E8WA 4FXGC 4P2RD 5HGGS 4PBXA 5D7KE 1VLXA 1E9QB 1J9CT 5F7HA 1YMHB 2ZP0T 1RHFA 5K59E 1N4XH 2QGCA 4G1MB 3EOAB 3J27A 3TWCH 3AXHA 1LHZA 5BV7B 3H2PA 5DMGD 5EIIA 3OGCA 2BXZA 4Z23A 1NOAA 3RZWA 1DQLH 5SWZD 4IDJL 3K6OA 4PS7A 4YHIA 1CTOA 3OMIB 2F58H 1JPGA 2M8XA 3GXUB 1GL4B 3MNWB 4Q6IC 1OF0A 4U1KB 4UF7C 4Y4HA 2VDOL 3BPNC 4Z3EA 3G5WA 3BUBA 4C55A 3GRWA 2CKBB 1UFUA 2VYRE 1BZ9B 2OMXB 4YGVA 3G5ZB 3FUNA 4LVEA 3CZFB 4WW2F 2EQDA 4NGHH 1MFAH 2X9YA 2ZX5A 4ES8A 2LU4A 5HHVH 1KCBA 2MOQA 3T8MA 2DQ6A 2IAND 2J20A 4R4ND 3X3FL 4AQ1B 1OCZB 3UJJL 4TTGA 1OP3K 3QUYB 4A2GA 2NMSA 5AVWB 5FCSH 2FZ3B 5A2AA 3ZUCA 1YO4A 1CFVL 2WKOF 4MSWA 3U4EA 5JHLH 1XD1A 3INUH 1F56A 2FX9L 1VB9A 2P8LA 4LSQH 4JLRA 4N0CD 4ZMOA 1S9KC 5AOLA 4V2CB 1WS8A 1BVNP 1F4AA 4GQ9H 1ORQA 4JUSA 4KO6A 4G70B 1JRHI 1Z9SB 3DUSA 3NDYE 2F18A 1HNYA 2O6DA 3QEUA 1I8LC 2Y2WA 2VDKL 5E9AA 2BFVH 2YFNA 4HIJB 3ZL1A 2AVFA 1NL0L 1ODAA 2R2CA 3OR7A 1J0YA 3LS4H 3B5GA 2X3AA 3BDYL 2E5EA 3VGAC 3VXRE 1A9BA 3WY4A 5FYKD 2OAAA 3QNZB 3G9VA 4FQ1L 4IIQC 2LLNA 3L95A 3MBEB 3TFKC 5ERWA 1YQVH 2Q5BA 2NNFA 4TQHA 1I8KB 2AQNA 3Q5TA 2N7BA 2NY1C 4P2AA 3ZGIA 1DDHA 1RP8A 1JF1B 2B4CH 2UV3A 5E6ID 5E6IA 5J11B 2ROXA 1E43A 3BP6B 1HVXA 4TLSA 2VQTA 3O0LA 3OHXC 2XFXA 4RCAA 3KPMB 4HBCL 5AAMC 2Z92A 3CJJA 2VOTA 1NAKH 2X4TA 3R8QA 2AJYH 3F3HA 4WJKB 4DP9X 4BE6A 2IAAC 1MCWM 1PG7W 2GTQA 4JY4B 4PLJD 3E6FA 1GA2A 4Q2ZB 4PJHB 4FQCL 1JBJA 3CAFA 3DECA 3AQYA 2C7UB 3QIUA 2H3KA 2A6DB 1I3RB 3PDGA 4NNXB 5LGYA 1XMWA 4K2UL 3JXAA 4LSDA 1ZTMA 5D4HA 3DO7A 5EOCL 1NCDL 4CKQA 5J6HA 4FFTA 5FB8A 4RESB 4TS6A 3EOBB 4N8VG 3WFHA 4PP1D 5LG1A 3FH7A 3FQTB 4AGPA 2YWYA 3V0AC 5JUEH 1ECYA 3VXMA 3NABH 1QFOA 4PJ9C 1R33A 5LGHH 3V6ZB 1FVDB 2XICA 1PGRB 4IHOB 1RFDL 1YEKH 1W6LA 2ZUWA 5AL0A 1JHTA 2Y1ZA 4ILDA 1BW8A 4L05A 5HXMA 5IT2H 4Z7QB 4P07A 2XOTA 4XBEH 2HWZH 2H4EA 4W6WB 1PAZA 2WXHA 1G6RA 1TMCB 3HZMA 3L2LA 3K5RA 2WC7A 1YMMD 1XSJA 2LHAA 2CJ3A 1U33A 3KPNA 5C2BL 4D9QE 5EBWA 1KWGA 1R24B 3GSRA 4XI5D 2Q10A 2V2WB 43CAB 3BP4A 3DLQR 1PZBA 3TM6A 3G08B 2AMGA 3PWNB 5F7LB 5GS1C 1QR1B 2EUWA 4LU5L 1PEWA 1TQBC 2R2BA 1WA0X 2P9RA 4FZEH 4HS6B 4Y5YC 5DD0L 3QRLA 2IANE 3ETTA 2QZ5A 2FEDD 2EXYD 4WSKA 1GGTA 1TO5A 5AW6B 4OLZL 4EKJA 5ABDE 3D50A 4HUUB 2IDFA 5H37G 1UWEL 4MNGE 2OXGA 2YRPA 1WBYA 3N43B 4YS4A 3RTQB 4NAQA 3S35X 3VXUA 3CDGA 3TF4A 1J87A 4URKA 3OB8A 4G42B 4OF7A 3L3JA 4P2QA 5DVMA 2APWA 1QSEA 4F1SA 4UDTB 5LVEA 1L3NA 4X0NA 3OKYA 2Z1KA 1UXWB 3VI3B 4UWQB 3E6FB 4Q2ZA 1IEHA 4P57A 1AIFA 4JQIL 4LDOB 5E0FA 4AH2B 1SJXA 4GW4A 3NJNA 4TNEA 1LJMA 3IMVA 1WRFA 1ZK5A 4R3SB 4XO9A 5D2NE 4WJ5B 5IW6A 1XB3A 5JOFA 3U7WH 4GMTH 3ZDXF 3VXRA 4OF5A 5D1ZC 2AK4D 4FTDA 4XC1H 3S3BB 4MQXC 1N5AA 4NAMA 3GK8H 5F7YC 1HK6A 4MYPA 4Z7NB 1HL5A 1GTNA 3ZT7A 1HHIA 2GG1A 2P5WA 2ZPKL 3ELAT 2UYLB 3UG4A 3NSCA 4NQCB 3L17A 5FYJL 2WXIA 3G6DL 1W0WB 5HD8D 1DCLA 2ZCZA 1UOKA 3OV6A 4JDVB 4MXQC 5DWUH 2VIRB 5JW5A 3FUDA 3L48A 1SF5A 3H6JA 4BCXA 4UZGA 3FULA 3KW7A 3AADB 3ESVF 3UJTL 2MQGA 1P1VA 4MMXA 1ETZB 1IBGL 1FC2D 4HIPA 2K7QA 3IGAA 5I1CL 4TVPL 1NMBL 3BHBA 1BEYH 5IMKB 3K71B 3BE1L 4GSXA 1RERA 3JZYA 3UTSE 4WO4D 4H1LG 2WYHA 1J0KA 1PNDA 4QNPF 5I15H 43C9B 2CGZA 5SWZE 1SDDA 2YPVA 2CWRA 2WXQA 1M1XB 1H0DB 4FNRA 4I4WB 3CVHB 1FQ9C 1G9EA 4Y2NA 4DGYH 3AITA 2CM5A 2PN5A 5TDPA 2EDYA 2CKNA 4FP8L 4HWBH 1KEGH 3HR6A 1LO3L 1U8OB 2CBPA 2JB5L 3APCA 1UWEH 4HUWB 5DJXA 3V55A 4RIRB 4PLKC 3V7MA 1JK8A 3RNKB 2ICWI 1TSHA 1ZK9A 4M7JH 4KXAA 3DHMA 5G5DB 3EZ8A 1F45A 5GS2D 3HBQA 4LSRL 4JFZL 5C6WH 5LB1A 3BH9A 5IEHA 1NUDA 4M61B 1NCIA 2P5EA 3IDXH 2XTLA 4L29A 4IRSA 5HDLA 4AV0A 1A1NA 1UVQA 4PJXE 4NNPH 4Z9KB 3B7UX 3CDFA 2IGLA 1RUAH 2V6HA 3GLDA 3MUUA 4MVBC 5ERWB 2RQEA 1GSKA 3DTXA 3K6SA 3IMBA 4ZSOE 2VLRB 3WTUA 2H2PD 5HI3C 1YEIH 4XP9L 5IREA 2I9TA 3RE0A 5HHMD 3IFPB 3VYOA 2LU3A 3FPXA 4FMFA 5AVZB 1RUPH 3LY6A 1IFHL 3IDJB 1KXHA 1IEBB 3IDMB 4KQ3H 4NKOB 2ZOKA 2WQAA 1N8OE 2BP5M 4PG9A 5FF6A 1UCBL 4WY7H 1TT6A 4XVUC 2GJ6E 2ICWA 2WB7A 2L7JA 3U1PA 1EPFA 1R5IB 4PJIE 2EKSA 2LOEA 1LEIA 3FT4B 2C1OA 3GS4A 1Q9OA 2KZBA 3CUPA 1CS6A 1N67A 3G5VA 5IHHA 1ZT4A 3QCTL 1TZHB 1UACH 2HPOA 4HSAC 2K8MA 5HY9B 5IROD 4JJOA 3GSNL 4XR8C 5JQ6L 2R69L 2FLRT 4DQOH 1HL9A 3ILPA 4KHTL 3G3LA 5CZRA 4MNQE 5FHAH 2X2YA 3JTSA 4JFPB 4XNZB 4F33A 1U8HA 1FVDA 1A9VA 1IC5L 3G6JF 3SY0B 4XX5A 5SWSD 4FG4A 5E8NB 4JO8A 3RGVB 1TEGA 4I9WE 5D7IF 1NKRA 1SDDB 4G59C 3BKYL 2AABH 5CGMA 2QMKA 3F85A 3RL1B 1J7VR 2X7LA 2GC4C 4AT6A 4N6QA 1IAIH 2JI1A 4K5OA 4LEOB 2W07A 2VLKB 2G4EA 1QFUH 4LDLB 4U1JB 4MS8C 4PRHB 3CQFA 4MJ2A 1CBVL 4BFFA 3SPIA 4P48A 4PV8B 4FFYL 3UZVB 4JFZH 1ITBB 2YEZB 3JTTB 2BP8B 5K9OB 5BXFA 3SGEH 5F7DB 2ZOLB 4Y4KC 1GVIA 3CFCL 2E7CA 4Z7VB 5J8OA 4KGJA 5DJYB 4NKDA 4DPAX 1OT4A 4PTTA 3J8F7 1WH0A 1HJBC 2WMPA 1WITA 4H1LA 3KLKA 4POUB 3FT2A 3BZ4B 1HZHL 1C5DA 1BREA 4ODXA 1QR4A 3UROR 3KLLA 3HUJE 5KSUB 4LSQL 3AWFA 4TLKA 4OV5B 4PJGA 1S9XB 3C08L 3RPBA 4JG0H 1ET8A 5T3ZL 1HESA 1YEJH 2CDGA 3T65A 1IAIM 5HJBA 1NMBH 3ESPA 1GPOL 5KVDL 4NQEE 3ARBB 2BNQB 3COOA 1GRWA 4Z3JA 1HKLH 2HFGL 5TDOB 3H9HB 5JHLA 2Z8VC 1G7JB 3FB7B 3B43A 1OW0A 4Y19B 1T21A 2WWKO 2PCFB 5DHVA 5FDYA 2DLFL 3T3PF 4AQ1C 3NJJA 3FSVA 1QLEL 2JKRM 3ESUF 4HU8A 4HK3N 3PWPE 3L3HB 4N26A 2HXAA 1BCIA 1EH9A 1MCRA 4RNRA 4P9HH 2VXSH 3CFDA 1CL7I 3SDXF 3TBBA 5ID1B 1G7HB 4KI5F 4AC2A 5JW5B 1KJ3H 3N40F 5I8OH 3ARFB 3D3VB 4LQ1A 2DLIA 3BRDA 3L4WA 3CH8A 1EERB 5HI4D 4ZAKC 2ARJA 5JIQA 4OZIF 4G8GB 3S3PA 2DQFB 4LVNC 4PBVC 1HXKA 4B9PA 3BXNB 4GAGL 4F57H 2FCBA 4A04A 4PV9B 3MYJA 3N43F 4MMZA 4OFYD 1Z9MA 3LN4B 1A2YB 1RZ7H 1UM5H 2N56A 2WOYA 2XCMC 4PJ8C 5DJCB 3ARTA 2KT6A 2VQ1A 2Y5EA 3K6FA 3CXDH 2CM6A 3QWNA 3L45A 3P54A 1C16A 4ORZC 5DD3L 4MCYA 2QEJA 3TX4A 4Z0BL 1E5UI 1MHHB 4WCYH 4R96B 1ZS8B 1KIRB 3MA9L 2NY1B 5LHDA 3UDWC 4EQ2A 5I16B 3FF8A 3BFOA 4P5MB 2VLKD 1HEZA 3ELQA 5ACMA 1R6VA 1AGBA 1O7DC 3LNIA 5BZZA 5CD5D 4OM0L 4NO0D 4OZ4A 3A5VA 3HFMH 4NO0A 4BFGA 2EKJA 5HDQH 2WN3A 1LEGB 3IXAB 3O4OC 3C08H 1FNFA 4H8PA 4Z7VE 3QJFB 4JM2C 3VE0B 4P49A 2XZCL 1W8NA 3WUWA 4TN9A 1S8DA 4GQQA 2W0LA 5KOVC 3B7YA 1TYJA 2J88L 2ZX7A 5CSZA 3RWHB 2FDBP 4B53A 4K8RC 1NMCC 3P9LB 3NK3A 1NEPA 4DGVH 1N5YH 3C5XA 4QHPA 4RQQB 3HUJA 4L1BA 2VAJA 4PREB 1S7SA 4AV4A 5TE4H 3REWA 3EYOA 1IKNA 1S7XA 3NP4A 3AG2B 3NOIA 4I3GA 1SXSA 5KBKA 1IE4A 4E42B 4LVOC 3X12A 3QDJD 1DQDH 3GSQB 4JG1L 5FK9B 3NA9L 1OF2A 3P4MA 4POZD 3TL5A 3GTVA 1A02N 5T1JA 1EFXB 1K4DA 4IRZA 1WIUA 1QQDA 5IGXH 1FH5L 4M8QB 4P9HL 1HH9B 2R27A 1VACB 4X5PA 2D03L 2OTUB 4K5LA 4M8UA 5KVEH 5D7LB 4RZCA 4N0CC 3JUZA 3MDJA 2VWEC 4KZ0A 1G9HA 1OPGH 1A6WH 3UTTA 1R3IH 2ZOLA 4MA7L 3RLSA 1A4JB 3G5XA 2A73B 2NR6D 3Q43A 4LL1A 5F88A 4JHVA 1OCCB 2OTWB 4FQJL 1S5IL 3E38A 3T0XA 3NCYS 1D6VH 1E5ZA 2DKMA 5IB2A 3PIQA 4JPIB 4R83A 1E28A 1JL8A 1NCAH 3O41B 4ZMAT 5L4MA 1M56B 2VT0A 4R97B 2R0WL 4AVKA 1R75A 4DPBX 4AENA 2HT2D 1CFQA 5D7SH 3IVKA 2XY1A 3U9PH 4QTIL 5CFAA 4UAOC 3X1BA 1I1RA 3PRZA 1P0SE 4DW2H 2WWNA 5IEKB 3UAJA 2O5ZL 4XN7A 2QGBA 4QOKB 4JM4L 3DUSB 4PJAA 3BPOC 4BFKA 5ADPL 4O2EA 1FG2B 3C8HA 1YC7A 5DUPL 3O8XA 4D0BB 4Q56A 3H9SB 3KR3H 3O8XD 3CK0L 3D18A 4RRPA 3EIFA 3VWJA 5D71H 3HB3D 4DIXA 5B1JC 3RFZA 1A6TB 4CMMA 1MAKA 2V0AA 2VSKB 2YA1A 5MHSD 3F04A 4B50A 4ZW8A 3EJRA 1GAFL 1L7IL 3OLEA 1F4WL 2HWZL 1N64H 2J56A 2QT6A 3K7UA 3I9AA 2FX8H 3ZZLA 4JB9H 1ET7A 1N3NB 3FRPA 4RFNC 5JHLL 1H8OA 1KNOB 1NTDA 3FQWB 4IQHA 4NPKA 2WOBA 1AOHA 2XQYK 1LO5A 2ZE0A 4LAQL 1H3WM 4BZ2L 1Q9WA 2QADD 1A4AA 2V37A 2BH0A 4R90H 4H0GA 3T65B 2F53A 2PTUA 1RUKH 4K5NA 4WHYG 2PO6B 3PFQA 5G4NA 2VLLA 3FYEB 3HE6C 1A2YA 1TSRA 1JWSA 1RZKH 2E6QA 2O6FA 1KXTB 1F6LL 3M88A 3RY6A 2ZCLL 3KYAA 3H7BA 3VM5A 2BP8A 4FL4B 3T4YB 5K9OA 3KJ6L 1HYSD 3L1OH 4DVBA 3I6GB 4JGNA 2HRPH 5EA0L 2VO8A 1UQSB 4LPXA 5TTRA 3BMVA 2HCZX 4OM1L 4ICXA 4OI9A 3FQ1A 4GS7B 5ICYA 5D5MF 5JXAH 1FIGL 2JB6A 3IMUA 4BQ6A 2YMXH 1AKJB 2WLLA 3D07A 3B4NA 4MXWH 3V4PH 1OAXL 2JCWA 1E67A 4FNLL 4PJAE 1IC5H 4G8EB 1T6WA 3MYZA 4YDIL 4CMHC 5J1AA 3PHQA 2WCGA 3KPMA 5I5IA 2C4XA 4ETYA 1T0NB 2P1YA 3L9RA 3RTQD 3GD1C 5CJOH 4JM4H 4QXTA 3QEQD 5IHUH 1U93B 5I5MA 4ZO7A 3Q01A 2WBWB 2A6JA 1FNGA 3ARBA 3BZFB 5HGDA 1QA9B 5I9QC 2X6VA 1NDGA 1OHZA 4I87A 2FZ3A 1OB1A 1W8OA 4C57C 1A6UH 5DRZA 1LDPL 4X4XB 5B38G 1F0LA 1UEMA 2NXZB 2SEBB 1CFVH 3T2PA 1EDQA 1PU0A 5J6HB 2XI9A 3IFOB 1FI8C 5A2BA 1RUPL 4U6VH 5FKPA 3SDCD 3GHBH 1QTSA 3K8MA 2YK1L 3MXVH 3DC0A 2CAKA 4MWFB 5A16B 1BGXL 3OC5A 1W80A 4M1CD 3MRCB 3A4DA 4FNPA 1QBBA 3L4TA 3IKCA 4N1CA 4KX7A 1DFBL 5FGRA 5C70A 2BZDA 3QWQB 1BM3L 1CFBA 1IBBA 3MRRA 4OFKA 5I15L 2IBGA 1BZEA 4GAFB 3WFEH 4RWYL 3NCWA 3K2KA 1BBJB 1QSFD 1I8MB 3SDXB 1YEEH 4JPIA 1JV5B 3FUEA 2E4TA 4L3ED 4RMQA 2C8NA 1MWAL 3CZSA 4ZTEA 3WMSA 2OMZA 2X4PA 2BVTA 2Y1AA 3X13A 3K5SA 5DC0A 2K7PA 5I17B 3ECUA 4IYKA 3B2UD 3AGVA 5FA3B 4AW4A 4EZKA 3C09B 3IVKB 3OSVA 5B3JE 2C5DC 4K7FA 1MZYA 3GSXB 3WIFA 5ACLA 4XNZC 1AC6A 2E59A 1AO7A 5I2IA 2GFBB 4JM0A 2UXGA 5KYUA 1VFMA 2NDGA 1KV3A 3RUGA 3PHOA 1XB8A 4E41B 5AOMA 1A1OA 4HH9A 4MXWL 1T89C 5L6YH 5ESQA 3AS1A 4K3DL 3QPXH 1MCNA 1BIIA 1NMAH 3ME0A 4U4BA 2J1KA 2LW3A 4YXKL 2NW3A 3TS8A 5GSRB 4KVNL 5I1EL 5EBLA 4NX0A 1KXVA 4NS0A 2V2TB 3MV9E 3VI3A 3S37X 3LVEA 1BD2B 2K6YA 1AGFB 1RJZB 2YD3A 3MBED 4GQRA 5A7BA 1CU4L 3DX7A 2NZ9D 3SZKC 2NNCA 2EYSA 2D7OA 1TMQA 1R3KA 4YBHA 1QEWB 2BOCB 2AERT 1OCWL 3I85A 4H88H 5FYJD 2R7EB 5IVZA 4A6YA 4R8WL 3FQNB 3MO1B 4X98B 2FATH 2Y07L 3S5ZA 3CFKA 3O4LE 4QHKI 3VFTA 3BFQG 1XBDA 1D5ZA 3DI3B 1JTOA 4GMSL 3TA3B 3JWDH 4I4WA 1YYLH 2ZWKA 3VGHA 4H8UA 4NHCH 4C83B 2CD0A 2B77A 3D39A 5IQ9A 3ZIYA 4XWGL 1NIDA 4FLHA 5L2JB 1A7NL 2QQNL 3CH1A 2BIHA 3C5JA 3JVGC 5I0XA 1RZIA 3F65A 4Z0XA 3SYAA 2NY4B 3SDYH 3ZHKA 1S9WA 3ILEA 3VXQB 4PRIB 4CSTA 4F7CB 4WSJA 4EBQH 4LEEA 3N41F 1IGMH 1QVOA 2C3XA 3BUYB 3P2TA 1A6ZA 5CKAA 3NIGE 3IJHB 1WBZB 1FL3B 4PJ5E 1HSBA 5H35B 2XTJB 2BNRD 3FAXA 4JFDB 4F2FA 2P24A 2IANB 2YKLL 1A6AB 1CURA 4E9XA 5HJ3B 5E9DE 4ZZFA 1WA1X 2MHAA 3L4XA 1AKJA 3D2UA 4D0CB 2ZD0A 4D9RD 1YC8A 1UT2A 3F83A 5H37H 3MAWA 4OQTA 1OANA 1G5GA 1GS7A 2XVGA 1DQMH 2XV3A 5A3IC 1RZKL 2F7RA 4ZX3A 5AVSB 5AZ2L 1B4JL 4HJEA 5CN2A 1MF2L 1TVBB 4WI7A 4OF8A 1JWSB 4D7PA 2YQ2A 4JO4H 4ONFH 1KTDB 3W11C 1NFDB 3DX0A 3FUHA 5E5UB 3WTTA 5C86A 3DPBB 4KROB 4AQZA 4A1KA 4L5FL 3NZSA 1PZUB 2IGTA 2DWSA 3MRGB 4YXKH 5ID0B 4L8CB 2FQFA 3ARBD 1PLAA 2ADFH 3FCTA 4JZJA 4F93B 3BKML 3R4DA 5EC1B 5LDUA 1QZ1A 2DW5A 3OHXB 4W70A 2OMBA 5HJGA 3FOLA 3VFNA 1FH2A 3HS0C 3TLRA 1K3IA 4R2GD 4UU9B 3IMTA 5EG6C 4B96A 5LQBH 5CCJA 1K8IA 3EXJA 3HG3A 1AP2A 4IDJH 1C08B 4H8HA 4LT7A 3MNZA 4XNYL 3RBGA 3CSGA 4HOZA 4OUUB 1JZGA 1KTBA 1MAJA 5CZXD 2XQBH 3QXDB 2BSCA 1ONQB 4PI0A 1D7CA 3P4OA 5H4ZA 1AOZA 4XVUD 1JZ7A 4NP4H 4NKOA 2FT8A 3KDMB 4XNUH 1QI5A 3I74A 5FGCE 2ATKA 5I1LA 1UJ3C 4XMWA 1X5IA 5T5FH 4PRHE 4M43H 5MP6H 4BA8A 3EOYG 5GRVL 2H47C 1HEHC 2PPAA 4YLCA 5JNYB 1B4RA 4H13C 4NZTL 1XB6A 3ZL4L 4F37F 1N9PA 3OJMB 4XNQA 1JZJA 2E9WA 4GXUM 5LXGL 4F7TA 2CUMA 3FZUC 2ZOTA 4DZBB 1RUQL 3Q5OA 1DE4A 3ROOA 2FHCA 3HMXL 5DMIH 2AI0L 2H5UA 4PJ9B 3IFOA 4E41D 1UT1A 3JWNC 3KHQA 3U4KA 1OM3L 4XPFH 2CJTA 5CSBA 3MGTA 2FX9H 5LNDA 2DQJH 4P2CG 4XAKE 4N5ED 1HYRC