4GSRA

Structural basis for the inhibition of mycobacterium tuberculosis l,d-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
263
structure length
263
Chain Sequence
SSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable conserved lipoprotein LPPS
publication title Structural basis for the inhibition of Mycobacterium tuberculosis L,D-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 70
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4gsrA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gsrA01
1ZATA 5DUJA 4HU2A 4Z7AA 3U1PA 4A52A 4GSQA 5LBGA 4HUCA 3ZGPA 5DZJA 2MTZA 4QTFA 5LB1A 5E5LA 4GSUA 4QRAA 4ZFQA 3TURA 3ZG4A 3TX4A 5DU7A 4K73A 4LPQA 3VYNA 3VYPA 4QRBA 4A1JA 4QR7A 5D7HA 1Y7MA 5K69A 4LZHA 2HKLA 4GSRA 3U1QA 5DVPA 4XVOA 5E1GA 5DZPA 4A1KA 5DCCA 5DC2A 3VYOA 4JMXA 3VAEA 5E1IA 3ZQDA 5E51A 4A1IA 4JMNA
chains in the Genus database with same CATH superfamily
2A6IB 2EYSA 4KI5F 4JR9H 4QJ3B 2VR8A 3CHOA 2DBJA 3GMNA 4NLAA 4QRPA 2OQJA 2YD7A 1NFDA 3K46A 3OXRB 3R4DA 4XPFH 5E95B 4NSKB 3QRGL 3L3JA 3WKYA 1OWRM 1M1XA 1I1AC 2WKGA 4LLYA 1VGKB 2GCYB 3NZHL 5TJWK 2Y1VA 5DYOA 1SJHB 3QDMB 1BXVA 4WUUA 3KPMB 5HDOA 5KN5A 3FQ1A 2YWZA 5C0CB 4JFPA 3DPBB 4UYQA 1BPLB 3Q1SL 1ZLWH 5E03A 1V05A 4P4RA 4YHLL 4WENB 4HKBB 3BP7A 4IBVA 4FA7B 3RILA 2FD6L 1ZLSH 1A7RH 3E8UH 2ED8A 2E9IA 2VNCA 3C8HA 3CC1A 1AQDA 1HILA 4Y9GA 4ECNA 3IFOB 1JCVA 3WGVB 4YDLC 4U4IA 2B16A 4FQPA 3RFZA 1P9MA 1Q1JL 4WK0B 4D7PA 3EH4B 2VQTA 2YOCA 1HOCB 1NH6A 2F58H 2X1XR 1DBMH 2P5WB 4I4WA 1UD3A 1CGSL 4XAWH 5T3XD 2R56H 3S5LB 2NPLX 4L2YA 4R4ND 3U2IA 5JA9A 2IFFL 4XO5A 1OAJA 2YKLH 4JY6B 4PGCA 2E76C 3KGRA 3TJHC 2KMWA 3KPSB 2VLME 2DM7A 2LU5A 3UTSE 4JPVL 4YXLL 4D3CH 3U6RB 3WNPA 2DM2A 2JELH 5KW9L 2QSQA 3PCYA 1SVBA 3A4FA 2H0JA 3KW8A 4XN7A 5JMOC 1KPRA 4NO0D 1BIIA 3EKCA 2WQSA 1E2VA 3IAQA 2WCPA 1XB3A 1RK1B 4Y2DB 3WMQA 2EDKA 3KJ6H 4QT5A 4LZHA 4HS8H 3QI9C 5L88L 4M29A 3K6FA 3PUUA 3T4AB 3WAJA 1WEJL 2D8KA 2YKKA 3FSAA 1ZD6A 2W0FA 3RKDC 4RRPM 4WW2B 1YMME 5KAQF 4NKDB 4OQ1A 5D1ZB 1WT5C 5F3BB 3CBRA 4W70A 4GNKB 3VXMA 4L3EB 3FQNA 4FKEA 2V2WB 1DVXA 2VR4A 2WLYA 5KSBF 2KKQA 4H44C 4AK2A 4LQFL 1AGFA 2NY7L 2NY3B 2KLRA 4WO0A 3V0VA 1VCAA 2A9BA 3HCVB 3HPJA 3MOQA 3M8OL 3WFHB 4AYSA 1UXSA 3FFDB 3FTZA 1ZANH 1PCSA 3VGHA 1ANUA 3NCCB 1H6EA 5BZWA 2EVHA 4P9MH 4M7KL 1E4JA 4HAGA 3ZKNC 3HC0A 3ARFD 2H26B 1U8MB 1EAPA 1NMCC 4OZ4B 1T21B 4OCMC 2ZOLA 4GG6B 2M8XA 1KIQB 4HYTB 4CVUA 4RX4A 3N1GC 4LCWA 1NM4A 3BP7B 4WGKA 3RU8H 2YAQA 1AMYA 1F4YH 3EGXA 5DGRA 3FF8A 4NQDA 4F7TA 5KYWB 4KK5D 2XC8A 3EGDB 4YHOL 1MJ7H 2IPUK 4PJXF 3K7UA 4KO7A 3MLUL 3GSVA 1EAQA 3AAZA 3LB6D 3IXAB 4UQDA 2MHAA 2R15A 3RWJA 4XZUA 4GBXC 1CDBA 2AEPL 5L2KD 3MGTB 3T6VA 3BC9A 3QPXH 4HK0B 4G5ZL 3HNTL 4GAFB 1CO1A 3U0WL 4P46B 2OYMA 3EFOB 4FYSA 1YLBB 5EBGA 2PR4H 3ULAB 3B5GA 4WTWA 2Q7NA 2JTDA 4YH6A 1AGBB 1YECL 3E38A 4H5SB 1NC2A 2DYRB 1FH5L 1ZS8A 3QJHB 4B0MB 3EBHA 3OZKA 3TA3B 4OD3L 2E5EA 1OXYA 3UEZA 3G08B 1VZIA 3MJ6A 2H1LM 1CXLA 4ACTA 5JOFB 4QF1B 3GUFA 1THCA 1PLGH 4DK5A 3P69A 4WI4A 3FK3A 2WO2B 5DD1H 4KNQA 3O3AB 4EDXA 3BESR 2YMXL 2F1BA 1UA7A 3GRWA 1H8NA 4G83A 2X2IA 1D5BA 1HSBA 3GZPA 4FJZA 4NO5A 4PHXA 3DBXA 2W0FB 4KKAD 4DZBA 2COVD 5JXEC 1K2DA 1Z7JA 1RUML 1OM3H 3VSUA 5KTEL 1YVLA 3MRNA 3UTPD 3U9PH 1U0QA 4GRWF 3L3GB 4ZMQA 4QRQA 4HIXH 1II4E 1T5WA 4JFEE 4NJAH 5GGUB 5B1BB 1JZ6A 1ZXQA 2EDBA 3LSOB 4PV8B 2B15A 3RJQB 3T6QC 3ARDB 4FEMA 4KUZL 3VNYA 3ZDYF 4PRHB 2IF7A 5HYFA 4DGIH 5M94B 1BGXH 1U8LA 1UXSB 2WXFA 1J5OH 4G6FD 3SKUD 4M3JA 4L8DB 4WVRA 3TPKA 4B9IA 2QQLL 3IS0X 4GS7B 2WGNB 1A25A 2V5TA 1M53A 3I85A 4BH8A 4OD2B 3BQUB 4NOBA 4ZFGL 2LU7A 1INEH 3FFCA 2ZOLB 2B2XL 4XN8A 2AQ3A 2C7UB 2BNRE 1IC1A 3LQAC 4YVUA 3UDWA 1QW8A 4AV0A 5LGKA 4PJEB 3KD4A 3VTTA 4FG6C 3C8DA 3CHSA 4I2XE 4M7LL 4Y1AB 2BERA 3IFNH 1HEZA 1WJ3A 2GC4C 2BSRB 4A52A 3DGGA 1YZZA 1L9SA 3P9MB 4OZGF 3STLA 3I02B 1JHLH 3MVSA 4C47A 5JHLA 3NJMA 3INUL 1EDYA 1A0QH 1XEUA 1CL7L 4QXVA 4W4OC 2CJUL 1HINL 3V2AR 4B41A 1SDDA 5D7HA 1OE3A 2VXTL 2ZCZA 3AACA 3QDJA 3BKYH 3QS3A 4UQ3A 4DZ8B 1EAOA 1JV5A 3RWJB 3TZVA 1XGRA 1Q94B 1YAZA 1PDKA 4XNXH 1NL0H 2WHVA 2Z93B 2OLDA 4TNGA 3STBA 1RJLA 1CZ8L 3KH3A 2GBUA 1UH2A 1FG2A 2YD5A 3J07A 2OKMA 1IC7H 1QR1A 2F8OA 5INCB 4F2FA 1KLUB 3VQ1C 4X9YA 2PN5A 2ZCHL 4L0PB 3UAEA 2Z4TA 2AK4A 2NY6C 3PABB 4M1CD 5B1JC 5HYSB 1LEGB 3M1CA 4NM8H 4UV4H 1LNUB 2HUHA 1HHIA 2EADA 1T1ZB 1JGEA 1FZMB 3QO1B 3S0PA 4B96A 5H37H 4GSDH 5DK0B 5TDPB 4ANWA 1BD2A 1RHHB 2DQ6A 4DN3H 3WV0A 4A55A 4ZFOB 3RY6A 4UT9H 1MOEA 3TONA 4POUB 5DWPA 3U6XS 4W68A 5CD3B 1WE5A 4LLMB 4NO2B 2YQGA 4Y9CA 1XD1A 2D7TH 3FZUD 1N59B 1HNFA 1QBLH 2NW3B 2E6JA 3CSYA 4F57L 4JRYE 4Z7NE 1C5DB 2HJKB 3C8KB 4N2KA 4BFIA 2APVA 1C08B 4NS0A 2WINB 4PJ9B 1JN6B 7TAAA 2ICEC 2UY7A 3E1ZA 1I3GH 1AGEA 2EVFA 2GTWA 1F1AA 2R2EB 3ILQD 3HS0B 2XQBH 4EIZC 4ZAKB 4P3WA 2X6VA 2P80D 1PAMA 3DETC 1ZSDB 2OXGB 4HC1L 2ENJA 3J27A 2R1XA 5TH2A 4EQ3A 4MCZB 4WGVB 2VMCA 5EWIL 4Y16D 4G1MB 2WLJA 3K74B 2EYRA 3WN6A 5I19H 2R2BB 4OV5B 4U49A 3B5HA 5GGRB 1TT6A 5DJYA 1GSKA 4OZFB 5KSAD 4C56A 2VWEE 4LEEA 5SWZE 1T6VN 1LE5B 2Z7YA 3UYRH 1DVSA 4GG8B 1RUAH 3LZNA 1F3JA 3IPBA 3P2TA 3WTYA 4R90L 2EC9T 4P2YA 4OGXH 3PL6C 3QXVA 4ZXBC 3SE4C 3WJJA 4OFQA 2H1PL 1KBGL 1LK2B 3MCYA 4MA8H 4GB9A 4UCFA 1N8ZA 5CN1A 3UTQB 5T1LD 2PR9A 3IU4L 4XXCC 1GGYA 2NOYA 5IVNA 1YN7A 1IJ9A 2DPKA 3NFSL 3CLFL 4UNIA 1S7XA 1HJBC 1XV8A 4ODHL 5C8JA 1A6UH 1E9QA 5KBLA 4GUOA 4XZ4A 4AY0A 3OKOB 3AG4B 4JKKA 2D7PA 4U3XA 4QTIH 5JDSA 2X6BA 1UC6A 5E9AA 3EJYC 5SX5K 1DQTA 1IX2A 2P28B 2XN1A 2D7NA 2MKWA 2Q2EB 1U8JA 4JO2H 2H0EA 2NW2A 2DJMA 5D1QA 3SDDD 1W2KT 1FVEB 2O5XH 3U48A 4ADIA 4WF7A 2XHNA 3HHMA 4MA1C 3JZ7A 3RNQA 1DJGA 3BP5A 3GGWA 2VZUA 5FKAA 3NJNA 3BAYA 2C1PB 5TQ0L 3OC8A 2EEFA 4OZIE 2BSSA 1GGTA 1WS7A 3MLVL 4F91B 3ATDA 4YSTA 3VU2A 1FL5B 3I2CH 3EYUL 4MXWH 2ETWA 3ULUC 3OX8A 5DA0B 1RZKL 2IQAB 1CG9A 4F1ZA 4QLRA 3SYCA 1NC4D 3FMGH 3IM1A 4N2NA 5FYLL 4XWOD 3DK2A 3VSQA 4AQ1C 1KYOJ 2ZT9C 4NC1E 3GKZA 1FE8L 4R83A 4QY8A 3SE9L 1MLCB 5I0YA 2WUBL 2Y07H 3MGOB 1BFVL 1UXMA 2YSTA 2NLJB 2R0LH 2P45B 1PG7X 1AI1H 2RH0A 2V5MA 1I1AD 4ZX6A 2A77L 4NKOB 4R97C 5DJYB 1A14L 3ARBB 1G1YA 4GXVH 4AM0Q 1MFDL 3WCYA 3FU7A 4JN1H 4C56B 5KVMC 3K71A 1DVFB 4OQTH 1ASPA 3L2LA 4MNQA 5A6IA 5MEQB 2HLEB 2XFXA 3FAXA 2P7TA 1S9VA 2HWZH 1OZTG 2V37A 4LE8A 5AVXB 1BM3L 5KVGH 3V4UL 5IJDC 4FFYL 1JSYA 3IMUA 5J3HC 4RGOL 3X3GH 1KTLA 3WDIA 1GZHA 12E8H 1S7RB 4GMTL 4GIAA 1CK0L 2EIKB 5LKNA 1IU1A 2VLRD 4LQ1A 5LCVH 2Z65C 3W2DL 2COQA 2YMTA 5CWSB 5HGDA 5KS9F 4Q9QL 2VRAA 5DHVH 3BZEA 1MWAL 3KAAA 3T65B 2EDXA 5DVKA 1FFOB 4I0KA 3CVIH 1JF5A 4DGVH 3P73A 2P42B 1RZFL 4Y5YC 1S46A 3TIDB 4P2OB 1J8HA 3NSCA 2EXTA 2JJUA 2OSXA 2GJZB 4MZ2A 3WFCL 4HOWA 4TPRL 3UZEC 5E2UL 5FECB 2EEXA 5F1SA 3VFNB 2OA9A 1AO7B 4BFFA 2I9TB 5I82A 3TJHD 4HBCL 1BZ7A 4IRZL 2NSXA 5J56B 4JREB 1KFAL 1DYZA 4FLHA 5A2CA 4IRSA 4FQCH 4U1MB 3IGKA 5I6MA 4JJOA 1P6WA 2G2RA 2XPGA 5FKAB 3TURA 2AVGA 2HN7B 4U1NB 2I25N 1VB9A 3VA2C 1HH9B 2GY5A 4IDJH 1HAUA 3IU3A 5ESQB 1FVDB 1NLDH 3QI9D 3S4SG 3ASNB 2OPCA 1HT6A 4XPBH 4L18A 4FL4C 4I3SL 5M7QA 4PS3A 4QJ4B 4Q2ZA 3E6FA 2Q87A 4ENEC 3W81A 2YR3A 2ORBH 3BQVA 2BSDA 4M8QA 3RKDD 3DTDA 5HPMA 1VKXB 1BVKA 3VXOB 2FHBA 4MB1A 4P9HL 4TTGA 3RWFA 2QLVB 4IJTA 3SEPA 5CGMA 4LVOB 1A1OA 1V7ML 2CO6B 4ZMPA 2YGPA 4QRRA 3DTXB 4IEFA 5ACMA 3DOIA 5GIRA 1OGAD 2WZPA 2OK0L 1CLCA 4JM4H 3EHBC 4GEIA 1H3PL 3CUPB 1QW9A 3UJIH 4ODSH 4G2AA 3UTTB 3H7LA 5B21A 2FYYB 2N1KA 3SE8L 4PJ5D 4KKLC 2CDEB 1TVBA 1GS7A 3LPPA 4OGAC 1CDCA 3ZKND 4LFHD 1E90A 1FJ1B 3MNMA 4WU5A 3E9UA 4AKPA 3WN5A 1O7VA 4MAYC 2MFNA 1Z32X 3GZQA 5T1KB 3BAXA 2VXQL 4XPAH 2DMGA 4XNQA 4U4BA 1WFTA 2VN5A 1A4AA 3K5RA 2OMWA 5I8OL 4OQTA 3KR3H 4BA0A 2EEDA 5T5FA 1OP5K 1OAYL 1X5FA 5FK9A 2H32B 2QADC 4IIQB 4MB4A 3OKLB 3UYPA 4U6XA 4W6XB 1NCDL 3W57A 1OLLA 1PLAA 1UD4A 4DNLA 3DJTA 1GHFH 4JO5A 4F8TA 4N3TA 3P4MA 4WHYH 3RDTB 1AHMA 2ZIDA 5I8CA 1PD6A 2H3KA 2RQ8A 3MV01 4GBXD 4Y2OA 3PNWA 3G7TA 4HPYH 2RCSL 3OM3B 3S37L 1U30A 1P1ZB 4B9CA 1WIPA 5C07D 2ZAHA 1FFNB 3NSYA 4JHAH 2K4WA 4OM0L 1I1YA 2V3FA 1WRFA 2ZG2A 4IGBB 3B34A 4E5XG 1ZVSA 1U36A 5LBVA 3QS2A 4JFFA 1V54B 4FCAA 4XGZB 5I18H 2PW2A 4YEFA 3HG0A 4EN3C 1WFMA 1A7QL 2ZXBA 3DOSB 4JVUA 5D5ME 1NSNL 2VZ3A 3D0VA 4G8AC 2FL5B 1CFNA 3A24A 3H2QA 4HSAC 5C7XL 4GKZB 3QIBB 5HDQL 3QEQD 3TVMB 4YLCA 3SGEI 3QEHB 1W9XA 4LLVB 3B2UD 1MPAH 5F9OH 5DVLA 4V11A 2D03L 1GGIH 4XODA 5JXED 1GY1A 3O6ML 4G42B 1PD1A 5DU7A 2ZTBA 3X14B 1X9LA 5T3XH 5IW6A 3TPUA 3ZZ1A 1M2VB 3SQBA 3RWFB 4NN6B 1R3HB 5IBUG 3N85H 3VFTA 1MFNA 3II3A 4BEIA 4A7GA 2HFGH 4GP4B 4JY5L 1Z66A 4O5LH 3CE1A 2Z7ZA 3KCPA 3UTOA 1AY1L 5I75C 4QJ5B 3ZDWA 5BQ7A 2J21A 3DJRA 3B8SA 3EJUA 4P57B 5CM1A 4F7PA 5EO9A 5BMFL 1IE4A 2WN2A 4JFWA 1REIA 4P59L 2ODIA 2CUHA 1KUMA 2EXSA 4HISA 1AKJB 3VCLA 1DE4B 1UOVA 2VDNH 5D7LA 1T04B 5EF2A 3MRCA 4XP4H 4FFVC 4Z76B 3GMOA 2EABA 3TCLA 5EB9A 1CI3M 4CC0A 5DURB 2Z31A 3FTGB 4FG6D 4ZW7A 1BOYA 3K2KA 4DKFH 4ELMA 1Q72L 3NIDE 5E4AA 4POYA 5FLVA 4G8GA 3IGAB 4N2AA 5C6WH 2XPZA 2NY2C 4HZAA 5DUPH 1F90H 2QTVA 5FYKL 4EBQH 4EAEA 3UBXI 1D2PA 3MPCA 5KVFL 4X8JA 1NDGA 3IDXL 4D0BA 1M42A 2DI8A 1MNUH 1FYTA 3QDGB 4UMGA 5CEYB 3V4VL 1L0QA 3MU3A 3IPFA 3QIUC 5EU3B 4I9WD 4JHWH 3K6SA 2FIKB 3VXSD 3FT3A 2QV2A 1K5NB 1F56A 1TQUA 1J7VR 2DWTA 3O8XC 1GTNA 5BUAA 1JGUL 1ZHNB 3U7WL 2QMKA 1YEKH 2XQYG 1QEWB 3EGSB 3NCJH 5HBBA 1IVLA 5IJVB 1A47A 1JUFA 3OMIB 4MAUL 2DD8H 5IF0A 4N8UA 2QSCL 4MGXA 4K3EH 5T1JA 4QHUB 25C8H 2MQCA 3CZJA 1B2WH 3KGSA 1QNZL 2CH8A 3ZL4H 3L45A 4E41B 5B8CA 4XP9H 3CFTA 3FC8A 4FX5A 3PHQB 4JQIH 3SGJA 4ZRGA 2PTUA 3SJVD 4OV6F 4QOKD 3ULSB 5BXFB 1CFNB 4ATWA 3CZSA 1F2QA 1UWXH 2XOTA 1RZIB 1O75A 3D05A 3GSOA 4PW4A 5GISH 2HKHH 3DKHA 2E7DA 1OPOA 1BM7A 1XEDA 3ROLA 2H6OA 4L23A 3DJSA 3II2A 2W8CA 3AS2A 4OBRA 4KUCF 4YFLF 2WLHA 2OYKA 3C6EA 4E9SA 4S0HA 2DQMA 3P02A 4FP8H 1PZBA 5DJ2B 2EH8H 2QHLA 4NP9A 1AJ7H 2W9EL 3C5SA 1U8PB 4GRLA 4GT0A 1CFTB 2ZOTA 4X5WB 1I3RB 3ARYA 2XLLA 3MLWH 5AOLA 4XNUL 1E65A 1HIML 2HRHA 3H0TB 5I8KH 2TSAA 1ULVA 2FECL 3P2DA 3L8QA 3BRDA 1C5CH 2P52A 3EBAA 4WWKB 1BMZA 4F27A 3R19A 1B4JH 1AAJA 2KC0A 4L4TD 2DWSA 1U8CB 5D7LB 2NZIA 3MRCB 4MMZC 3DETD 4HALA 1AIZA 4KKNA 2I07B 3R06B 4EPSA 5K1JA 1J05A 1G84A 3GQFA 4XNYH 3FU0A 4M7ZB 4G8GB 4QHLB 3IMRA 3MUGA 5AVQB 2F53E 2WQRA 2OZ4L 4KHTL 4D0CB 1INDL 4PJDA 3SKJH 3QZWA 4TS6A 3GXTA 1KTDA 2Q9OA 4Z7WE 3KPRB 4FDWA 2JJWA 4O58L 5DHDA 4YX2H 4JMXA 2WVSA 4NNYA 4F2EA 3MYJA 3NQIA 1NZRA 4K9EC 1MIEH 5DZLA 3VRIA 1T83A 3II1A 2ZKHL 3HPLA 3SDCB 5L2JA 2GBTA 3O6KL 2KDGA 4TSCH 2DWEB 3LZFL 1UACH 4ZXBD 4PJAE 2UXFA 4TUKH 5E8DL 1E6OH 4KO9A 4U6HB 5D7SH 1A6VH 5D7IE 3U4EA 3WEBA 5CJQH 3IFPB 3O0RL 3RVTC 1RZ7H 2IDTA 3H3PH 3LEXA 5IF0B 1CQKA 5MENB 5D55A 1MHEB 3CVHL 4YL4A 5AVYB 4FC3E 5EBWB 1EEQA 3S4SB 3AT9A 1MXGA 2OR9H 1DBJL 4HCRL 2H0PA 3IB4A 4F92B 1NPNA 4U0RB 3EJYD 3RA7L 1IBHA 4WY7L 5D2NB 3W9DA 3SQRA 4ZUSB 4XT1C 3T0EB 4HCGA 4LIQE 4LSSH 3U1SL 4JQIA 2XVBA 3ESVF 3VW3H 4Z77B 2CO7A 5I28A 1E4KA 4NUQA 1QPPA 4AK1A 3ATFA 5HYQB 3OQ3B 3FOLA 4URTB 2P3YA 3MN8A 2BSCA 4DAGH 1BDYA 3L6FA 1MY5A 1JTTA 4HK3N 5ILTH 4Y9EA 4ZPVB 3BWZA 2IANB 4ATTA 2WO3B 3ETBJ 5L2KA 4NHUA 4KY2A 3VI4A 1D9KC 1X7QB 1ET7A 4GRLB 4Y88A 5HJGA 4ZNEA 1JJUA 5C0BB 3ULUD 4W4NA 1S7WB 3T8XA 5HHNA 4QIRA 2CLRA 1CTNA 3FN0H 1F41A 3QUYB 1G9NC 5E94A 3RDJA 4FMKA 1IBDA 2UWEA 4LSVH 5JHDB 3MV9A 1TYRA 2FBJL 4C83B 4HOXA 2A74A 4Z5RB 1EX0A 3ZOAA 3N55A 4JZOA 2CK0L 5IHLB 4WFHD 2Q8AH 1NINA 2PNDA 2PABA 5CLXA 4GAAA 3OKMB 3EOTL 4EO5A 3S88L 2NUTA 4GXUN 1Z9SA 4ONGH 3ZT7A 4HJEA 2Y7QB 1TF4A 3N1PC 1KEMH 3NK3A 5K9JL 1QLRA 4N6RA 3N3EA 1MCKA 2YPVL 5BS0E 2J8OA 4FJ6A 4KI5C 4AEHL 1CLYL 4ZW6A 1WWCA 3QULA 4JAMA 4EMZA 4HIHB 5FHAL 2PXYC 4R7VA 4ZFZA 1RIUL 1WWWX 5DS8B 4EJ1C 1BQ5A 3VRJA 2E47A 5JPMC 2NXYC 4O2CA 2BP8B 3PWPD 3ZQ9A 5CEZE 1E42A 4RGNB 5HTSA 2OMYB 3AMLA 1G7HA 5J3HD 1Q9WA 2AS5M 1DBBH 4QD2E 4E5XB 3IK2A 4UM9A 2C4XA 2DQCL 3QIWC 2XWBA 1H8SA 3BUYB 3RYMA 1TJXA 3MI6A 3FQWB 5I6PA 1I3UA 2IQ9L 3MLRH 4QRUB 1MI5E 3LEXB 4PRPB 1BLNA 3CWGA 1FAKT 3HE7C 3OHMB 3RUGE 2WANA 1NCNA 2QVTA 4PRDB 5SX4I 4UZUA 1KZQA 2YOAA 2VXVL 1I9IL 1HHGA 1LDPH 2AEIT 4PVLA 4UAOC 2ATPB 1ITCA 1Q0YH 1AR2A 3Q48A 2KDYA 1LD9A 3W9DB 1OE1A 3FO9A 4O02L 3FT1A 5BPPA 3GNML 3KHOA 2AERT 4JRWA 2QVKA 4LEOA 3S98A 3O3EB 4LRNL 5KSUB 1S7UB 4PTUA 4LCIH 4UINL 1PLBA 3D9AH 4H8WC 3RWGB 4KHXH 4F37K 1OB0A 1NTDA 3H53A 3ZLQC 1DUZB 4S11A 3FRPG 3PWVA 4JO1L 5AYTA 3GMQB 4QYOA 1EJ8A 3D48R 5CBAA 1JZHA 1SYSB 5GJTH 4K3DH 3AQYA 2H41A 4Y1TA 5AOKA 4FZEH 4Z3TA 5CMAB 4ENED 1DVYA 5A6MA 4X4ME 4B3VA 2CCLA 2QQNH 5AKSA 3NQKA 3GDBA 1W0VB 2QBWA 5I1LB 1L9TA 3J7HA 3HC2A 3UJTH 2A74B 4RQQB 3EUUA 4AI7A 1IGTB 2PP9A 5AW8B 3PWLB 1KTBA 5E5LA 1AP2A 1FLRL 3QFGA 1OAQH 5GGSY 5IMOA 3QARA 3QCUL 2KPWA 3EHBD 2ZJSH 1NLBH 8PAZA 3L17A 3ZYIA 3IDJA 1OTTC 1G94A 1KB5H 1VEPA 4KKLD 5K39A 3G5ZA 1BREA 3MO1B 2HT2C 2PWDA 4JGJA 5AZEL 2A6KA 4MAYD 2J44A 1X5JA 1MRFL 4CDGC 3NZ8A 4ONHB 1KT2B 1QSEE 3AREC 1UVQB 4KDWA 2WW8A 1FO0H 3NCMA 2G9KA 4D9QD 2FO8A 4K3JH 5E5MB 3S3JA 3NUKA 2VLKD 1Q9WB 1I7RA 3N44F 5SV4A 1QMUA 3LTVA 1ZLWK 1JF1A 4BQBA 1S5IH 1PMYA 3GSWA 3LKPB 2AXFB 4LP5A 4PJIE 4JDVB 4XB8A 1MCBA 5HGAA 4R0LB 4PTTA 4MBRA 4GO9A 3PJSA 4MZ3A 1HH6B 1WSST 4NIYE 3QCTL 1BW8A 1DJXA 2CDGA 2P80A 2JIXB 1AFVL 3HZYB 1ZA3A 3OKNB 4Y16A 1W8EA 4AE1A 1Y0LA 5HHMD 1NCBH 4FG4A 5DMKB 5DZJA 2ZAIA 2B5IB 1OGTB 1IV8A 1LDSA 4X80L 3VFSB 3HHSB 3PQYE 4QMEA 2XWTB 5KSAA 4HH9B 1VFUA 3MCKA 3O2VH 4UILH 1ZT1B 2VDQB 2OMVA 4PWJA 4JKWA 5A2KH 5C0NC 3JUZA 5DD5H 5I1IL 2BH0A 1VZHA 1WWAX 1TG8A 1ND0A 4FQLL 2L7JA 2C9VA 2XVKA 1GPOH 3P3SA 4GAJL 5DTFB 2NNFA 4R5VA 4HPHA 5T3XE 3PHSA 4FXGA 3TWYA 4HAKA 2ZXAA 4DP1X 5T1LA 4P07A 2YRLA 4CW1B 4H88L 3R8QA 2Z8WC 5I1AA 3M46A 3BH8B 2VDPB 2NXZC 4TLTA 3W11C 2PTTB 2IG2H 4UNTA 3L2MA 2XG5B 3MX0A 4FFZL 1OKEA 1DN2A 5IMOB 2BRRL 1QLFA 2W07A 3ATEA 3DRTB 4JPWH 2GYSA 2E4FA 1IGJB 4N0UE 2BXYA 1B3IA 2WC7A 2BC4A 4MA7L 3V5DB 1NANI 4GQ9H 3RRQA 3UTSB 2MMXA 2PWGA 4JRLA 4C57C 3O9WA 3V4PH 1R0AH 1RIHH 4WEBL 4H26B 5FC9A 4F2ME 1ADQH 1MCOL 4FFVD 3CX2A 3SKMB 4JFXA 4LL9A 2ROYA 3VXTB 5KG9A 5E8OB 3RL2A 2N1TE 1D6VL 3EO1B 3U1QA 3X3FL 1VPOH 1JPSH 1A4KB 3LIUA 4RAUB 1OCOB 2NY2D 3CLEH 4WW2F 3T09A 1SOXA 5GS0C 4ZDHA 3EAKA 2GEEA 3P0GB 5CIPB 1YMMB 2D3NA 2WLIB 2ZF8A 5CBEB 4HUCA 1BQLL 1MWOA 1XZWA 5ICXB 1RHFA 5JIIA 1D5ZB 4JFEA 1WZLA 1OARH 4HKZB 1Z3GL 1F4XL 2XQ0A 4B9FA 1HZLA 1ZTMA 2DIBA 3O8XD 3JWNE 1NIAA 4I85A 1PG7L 2IAMC 43CAB 2BJML 1TTUA 3MV8E 3V4LA 2V17H 4P2RE 4WIQA 4MJ5B 1I1AA 2K8QA 4IIZA 5CO1A 3FRPA 3Q2CA 1JGDB 3P77A 4O2FB 1HXYA 4GG6F 4P4KB 2NQ3A 2VJ0A 4JPIB 4BSWB 1IGIH 3M17A 4WO4B 1HEJC 2X09A 2OMVB 3CG8A 3TF4A 1S7QB 2EDQA 3DRQA 1V7NL 3ZE0E 3DGCR 1YNLL 4WNQB 3UFIA 1TVHA 3RGBA 3G6JA 3I75A 5E2TH 3ARZA 4DGUA 3QJTB 1RIVH 4GKSA 3QHZL 2W80C 3UBXG 4ICWA 3CC5A 2ESVD 4LVHB 5FV1L 3RTQA 4CVZA 3CXDL 2XTJE 3Q2VA 2Q6WB 1F4WH 3GO1H 3S2CA 5EA0L 5I6XB 2OAAA 1VIWA 4WHDA 5DHXB 2B9AA 4YFEA 5ADOH 1YYLL 3ARPA 4UWQB 4OLXL 3VXUD 4C8XA 1NAMB 4FNTA 1KOAA 1R1CA 1DO5A 2ENQA 4TNVK 5DT1H 1U3HB 1TCMA 4B95C 1B88A 2V3EA 4ODTL 3PRZA 2VDML 4FYTA 5I71C 3BPLC 4TSBH 1QLFB 2GC7C 1QVOB 3ZXAC 5D96C 1UGKA 4X7CC 4GKNA 1Z3RA 1AE6H 1XXFC 3C9NA 5IQLA 2FBRA 1F1DA 1PG7W 4HXBH 1UEMA 2G3ZA 3HC3L 8FABA 1FORH 2YAMA 3AWGA 1OAKH 5B7EA 4PJHE 4I18B 5L7XH 2WZ5A 3UTPE 4LSTL 4LHUG 3QHFH 5D9SA 3CMGA 4HJGA 2CGRH 2ZONA 4F8LA 3QR1A 3L4TA 3QI9A 1FFQA 1T03L 1ADQA 4L1BA 3FQ4A 1VRSA 1EEZB 3NIFE 1KPUB 4PN6A 1X9RA 3K6IA 1IM9D 3A47A 4NI3A 4ZDHB 4CMHC 5CU5A 3HZVB 1FRGL 1SXNA 1Z0NA 3OC5A 1JRHL 2J72A 4MMXB 3CMOL 1WT5A 2ZICA 2H9GA 1RPUA 3V0JA 1YEJL 5T5NG 2BK8A 2HKAA 4JFEB 1G7QA 3ORJA 4UM8A 2JXMB 3LZRA 5D72H 2K45A 3VGFA 5DUJA 1I7UA 4W81A 1OGAA 4AT6B 1M57B 3D2UB 1OD9A 5MHSD 2VLLB 1BOGA 5JXAH 4FHJA 1IQWH 3RVTD 3LQAH 3TN0B 5ITBH 1FQ9C 3P77B 3U7YH 2MOVA 2X1OA 4PJEF 3OKDA 4NNPH 1NKGA 5IY5B 1J1XH 2BNRB 1TQBC 1PPIA 1GH7A 2VN3A 5EZIL 1IT9L 4RFOL 4MA3B 1GYWA 4I2XB 5CGBA 3T77B 3ZDXE 4FFTA 1XTMA 1DN0B 3V0WL 3EG9A 2O5ZL 3CC5B 4OW6A 2QTEA 5CINH 5IMKB 3P11L 4LEXL 1Z9NA 4NHCL 2M1KA 4O9HH 4ZFQA 3FB6A 1Z9OA 5JUEL 5E08L 5DRNB 4P23B 1ODAA 4Y4HA 1IAMA 1S7TA 2APFA 3GBNH 2OL3H 1L0PA 1L7TH 2ICWB 3LKNB 1D9KD 5IBTL 2HFEB 3CPLA 1OGSA 4HPOH 3MMEA 3WE6B 3BRFA 2IH3B 1PKQA 2OBGA 1NGQH 4GRWE 4F58H 4ZOCA 4EKJA 3HE6B 5A2AA 4ES9A 2QKIC 4QRAA 1ZT4A 2D7QA 2WV3A 2G75A 1CD0A 3O41A 5JR1L 3QUKB 4YIQA 3BZ4A 1CR9H 3LPFA 4P9HC 5IVOA 3ZDYE 1F58L 3D85D 4QTHB 3A22A 3QEQA 1EZUA 1EFXA 3GXFA 1TNNA 3FU9A 1WYJA 1ZV2A 3NCFB 3Q3GB 4UU9B 4ZQKB 5EUKB 3GMLB 3D4CA 4NYLA 1N68A 1NCTA 3OAYH 5JXEA 5I0ZA 3CQFA 4ZO9A 1OHZA 1CXIA 1BSIA 5T3ZH 3I9GL 2W0KA 4CVXB 4ZW3A 1BG1A 4JY4A 1UXWA 2PXYD 3OGCA 4JFQB 2GJJA 5LGJB 4NZDA 5GJSL 5JPNA 2NXYD 3FFOA 3CTTA 2CGYA 4ZPTB 2FX8L 4JRYB 4HULB 4Z7NB 4AE0A 2VLJD 3QIWD 1IKFL 5BV7C 5I2IA 2VSCA 4DVRL 1R5WB 3DX6B 3G3LA 4JZJB 1AS6A 3H9SE 3BT0A 5IK3B 1MREH 1R33A 1YEIL 4KPHH 1FPTL 3AQXA 1PNDA 3HE7D 4P5TB 5D7JC 3EYFB 3CFBA 3N2JA 3OV6A 1YEDB 3UBXA 3K2UL 4OJDH 3KYNB 1OVZA 3ZKSD 5AALA 1RLBA 1ZPLA 4NLHA 3QR0A 3V9FA 5I1CH 1H5BB 4JQXC 3T9WA 5GRJL 4BDVB 1O6SA 2W9DH 4Y7OC 3LPWA 1A3RL 1YN6B 5K1NA 2ZXQA 3T0VA 4YE4H 3DURB 5C9JA 4X5XB 1OCWH 3MBEA 1WAAA 2W60B 5SWZB 2XKNB 3EJTA 4K5NA 4O51A 2AQNA 2L3BA 4OCXL 3WIIH 2C3VA 3C60B 2ZUQB 3OR7A 5DC4B 2W91A 2WKOF 1DFBL 2AZUA 3LXCA 5E2JA 1C5BH 4DK6A 2ODHA 4OJFH 4UTAL 4AXWA 2CJTA 1TTCA 3K8MA 4ZX5A 5E2WL 1OP3H 4HETA 4HLJA 1IGML 2DTSA 4HKJB 2DQDH 2W95A 4J6IA 4U6YA 1ZLUH 2LLGA 3CBJB 4HUVA 2G5RA 1M05B 4ZUWA 3LMJL 2J2ZA 4G11A 3LNGA 5GGVL 2EIZA 1NFKA 3Q5OA 4JM2D 5B1JA 1MCLA 5EU7C 1P6AB 3HUJE 1LP9E 1JHKL 4QEGA 2EIBA 3QORA 1KGXA 3NN8B 3PGCA 3N0AA 4IBTA 3HHRB 4KAQH 4KJQD 4M8VA 1HKLH 2LOEA 4GQRA 1OTTD 3B9KC 2BSTA 5FYJD 5J5EA 1MFEH 3KXFA 3QUMA 1AZNA 1E27A 1S7SB 5C70A 1M56B 4JKPL 2HT2D 4XN9A 2I5YH 3J2PA 1RZ8A 4ZFOL 1BF5A 1DSYA 4OFDA 3ULUH 4M5ZL 3ARED 4ZUTA 4OZIB 4APQA 2QZ5A 5ESVB 2CLZB 5J11C 5C3IA 3S8FB 4EUPG 5L8JB 2R1WA 2O6PA 4KKZA 2GIXA 5DUML 1XSIA 4ETYA 1GYUA 4EF3A 4PRID 2ZKXA 1ECZA 1BV8A 2PUQT 2Z0BA 5TFSH 1DUYA 3BKMH 3LEYL 4A67A 3QXAA 1U92A 4KMLB 4Z7UA 2FJUB 4XMZA 4Y4KA 2QLYA 3UBXB 5KYUB 4Q6IC 1ID5I 1CT8B 4ADJA 2VH5L 3KLAA 1ZXKA 1IAKB 2MKLC 3VFOA 3NEOA 3OXSA 2VR9A 3L3DB 1NEZG 3O11A 3OG4B 1Z1WA 1G7MB 5C9JB 2YD4A 2LABA 2X4PB 4H2AA 1F8TL 3H42L 5FDWA 5GGTL 4PLOB 2CKBB 4FCHA 3BSZH 4L8CA 4OZHE 5JQ6L 2VLRE 2JI1A 1PCXA 4NRZA 5SX4H 3MLYL 1N19A 4NUJA 4BZYA 3QG7H 5C0ND 5D2LA 2GW5A 1SJEA 2IGFL 1TZHB 3IDYC 2I7OA 4HIJA 3VG0L 32C2A 4PJFA 4R2GB 4GO6B 4LSDA 3EOBA 3SE4A 1OALA 3PL6A 4LPUA 4A6YH 1W80A 4UQBA 3D7PA 2ZF9A 3V7MA 3U2SB 3FTUA 2EKSA 3VFUA 1NPJA 1CJYA 1BJ1J 4HUVB 4ZUWB 1EAJA 1A6WL 1HHKA 1MRCH 2EVJA 2NXZD 4LHUB 3MREB 3W11D 1T7YA 2WLLB 2HKFH 4QHNB 4MAZA 1J9QA 2BNUA 4AEIL 3SKOA 4QRSB 4ISVA 1UD8A 2YLKA 5DD3L 2YPLE 1L9RA 2EO9A 3MRMB 5CHNB 3OKYA 3QORB 4LASL 3MACL 3OPZL 2SODB 2E9BA 3CZUB 5EF3A 5F9JA 1FNGA 2Y7NA 5IB2B 1FHNA 1DCLA 4JLRB 1MAMH 2V2XB 3S3DB 3CFEB 3VB9A 2IGTA 2FAUA 4NQSA 2BDNL 3HN5A 3JXAA 4NZTH 4XP1L 3F58H 4NCDA 5D5MA 3T2QA 4PVNA 4MHHI 4WI8A 4Z95H 2IXQA 3AM8C 4XCEB 4XBPA 5IQ7H 4LAQH 3F2LA 3FUJA 2ZCLL 4WFGD 4JM0A 4K7PY 4R96A 4GAGH 3P54A 1KLGB 2KZKA 4IBZA 2FGWH 3LXUX 2XZCL 4KTDH 3Q8FA 3DUSA 4N2BA 3O2DL 2F61A 5GS0D 1XX9C 2HVKB 3P9LB 1QWNA 3FQYA 2VL5B 1HHHA 2DTMH 4AQ1A 4PJ5E 2PETA 5LVEA 2X6UA 2AJVH 4PLJC 1TQCC 2H3NA 1X6NA 1RV6X 2C9QA 2WSPA 3KHQA 2GI0A 4ZS7L 4PVBA 4I13B 2DQHH 1FGNL 4R8WH 2IAMD 2Y0SA 3ZPDA 5KS9E 3OXSB 4MX7B 4DUVA 3CFDB 2N7BA 3BT2H 3O11B 1OAUL 2OMUA 2E9JA 3RB7A 1ED3B 3IVKA 4MQ7A 3Q6FA 2Q86A 1YDPB 5ACLA 4W9GC 1MJ8H 1WFIA 4KY1L 2DLFH 4FTVD 3QYMA 3ZQDA 3ARWA 1D5XA 4HWNA 4NRZB 4ORGB 5C0FA 4LOFA 4QRTB 4UQEA 2WB1A 1G1OA 3IE9A 4K8RC 2GIYA 3FUKA 3PWPA 4QXUH 5SWQA 2XG4B 4GP5B 4RZKA 3RGHA 5C08D 1IGFH 3EDDA 3MROA 4M6MH 2RB8A 5HI4C 2H4EA 3Q2LA 5TE4L 5I1EL 5G2NA 4XCNA 1HHKB 5C07E 3QWRD 2NR6C 2R4RH 4A6YA 3MA7A 2QFPA 3QRBA 5I8EB 1S7VA 2ZZUT 2BNUB 3UG3A 4C4BA 2AQ2A 1W6WA 2XTLA 3C08H 2XBDA 1OCRB 3LN5B 3F05A 3UZEA 3F7VA 4LEBA 2GJ6E 3QXUA 4L4VE 1XF4B 5FO8A 5CJOL 2B0SL 3DI3B 5EIIA 2H7WA 2IOIA 4AM0A 3DSFH 3KDMB 1ZIBA 3LPOA 5TDOB 1RFDH 1QKZH 2OSWA 5FUOL 3ETTA 1MHCB 3D3VB 4I3RL 4ZX3A 4OGQC 3JWOL 5D5MB 4U3SB 5IV2A 3FNKA 1U33A 4KJYA 4AIEA 3QT2A 3KJ4B 4J3OC 3LS5H 2ZWNA 5TE7L 5EDXA 1CGTA 1NANH 3BMWA 1IBZA 4GUPB 2ZWSA 3W0WD 3QRFM 4E68A 3BPOB 2JNZA 2CR6A 3ZG4A 3O0LA 4N2DA 2XX1A 3FTSA 1AS7A 5B7FA 3ULVF 5LWYL 3M45A 3CFCH 4WWID 3LS4L 2UUDH 4YL9A 3R8BB 3LRSA 2X53A 4AKOA 3EO9H 2YAEA 1TIUA 3DA0A 3IJYA 5KVFE 1JXKA 4X4XB 4BZ2H 4AC4A 5J4MA 2NQCA 5HI3C 4JDZB 4DIXA 4XMPL 1XH2A 2PMZA 1N0XL 1N7MH 4OM1L 1PZ5A 3QNZA 5JW4Q 3B3IB 4K2UL 2CD0A 1JD9A 4G9FE 4MBOA 4UOW1 2OMUB 3QQDB 3WIHH 3AG3B 4NI6A 4YXHL 3TH4T 4HIIA 3NABH 3RPBA 5IZ7A 1B0RB 4XC1H 2CRIA 1BYNA 4G8FA 3PWNB 2V9TA 5JIMA 1S9WB 2FO4A 3N50A 4PIBA 4AGPA 2A6JA 2ZOWA 3QUXB 4B5EA 3BFWA 1VADB 2P24B 1XR9A 3WE1A 3LKSA 3DVNB 4KDTA 4EVNB 3NIDB 5B39G 5EEUA 2VLKA 5DRXB 4LLDA 2EDOA 3ZMNA 2E9WA 4EOWH 3D2TA 3VXSE 4JQVA 3ALXA 4ZZKA 1YC7A 3BP6B 1UWXK 2ISDA 4QXGH 1KZYA 5D71H 3OSVA 1HSAA 2UZYA 4LGRB 3QUZB 4YO0B 5IB1B 4YHMH 3KEHA 2J1XA 1A9BA 1SXAA 3ZZLA 5CXPA 1ZHKA 6FABL 3IDMB 5AL0A 1YC8A 4NUMA 3F7VB 4HWBL 4Y8AA 4QOKE 3SJVE 2Z6FA 4MJ6B 3X13A 2FB4L 1P4IL 1A2YB 1EH9A 4M56A 5E6YA 1KWGA 5FO8B 2CBOA 4U1HA 3WS3A 4AVKA 1MHHA 4WWPA 2VDKH 4WW1B 5J6HB 4LO9A 3KWVA 4OGYH 4MRBA 4CMMB 1TYEB 5DRZB 4I0PC 4U1KB 4EUPB 2J8UF 4ERSL 3F65A 4EN3A 1KG0B 1KTRL 3HZMA 2XNAB 5AZ2H 5CN3A 3T3ME 1I1RA 2EE6A 5FO7B 4JFDD 4MXVE 35C8L 4JFSA 2DKSA 2C8NA 1KB9J 2P8MA 3F04A 5D8JH 3IDNB 4ESKA 1N6QL 1BEYL 3FUDA 3IEAA 2F19H 4XBEH 4PCSA 2VL4A 1N26A 3BJ91 3HZKA 3JT0A 1NEZB 4EZKA 3V0IA 1VJSA 2XN9D 1UM4L 2PP7A 2Z92A 3ULVL 3LZPA 4L4TE 5IHBA 1B9ZA 1OSPH 2R9HC 3MRJA 2BVTA 2R69L 1D5MA 4K71B 4CGUB 5GGSB 4BZ2A 4MS6A 2GHWB 4TMPA 3JTTA 1CF8L 3GMPA 4L1LA 2UYLA 1M1SA 1T22A 1ZSHA 1JPST 1L5GA 3SOBL 5HYJA 5D7JD 1P5VA 1A1NB 2YJQA 1RJZB 2XBZA 3C87A 2XY2A 3RGVC 5E24E 5JORA 1N5YL 5JOPD 3PG2A 4NRYA 3I9PA 5JW5A 5BQDA 3MBWA 5J0BA 1XWVA 3SCMB 3WJMA 5JHAA 2WBJB 4ZUVB 2YAFA 4Z6AT 1X4ZA 3QRGH 5D6CA 3OR6A 3RWDA 4UQ9A 2EP6A 4HQQL 1T5XA 4OSUL 2F53B 1SVCP 2ADGB 3IWVA 3M1BA 2WWKT 4K9EH 3NYKA 4F7CB 4Z7WB 2F54D 3IAGC 1KNOA 1UADC 4N0RA 1J1OL 3LN9A 3V0FA 2CIKA 4KK6C 3TJEH 1CXKA 3NAAH 3ARGC 3JVGC 4JRXD 4OIAA 4WI9A 1ZGLA 3QIUA 1HSAB 1ZCRA 5TF1L 1WCQA 2WZ0A 1KJMA 3O8XA 4PJAB 1QASA 1WTGT 2R0KH 5D7IB 3UG4A 4WTZG 1WFNA 3HG1E 2YA2A 3ABGA 3LEVH 5KZCD 2DW5A 1Q1JH 1OLZA 1BYOA 4P48A 5D1XC 3G5WA 3AGWA 2YRPA 1FH2A 3RUGA 5LN8A 3C5ZA 4PJGA 1MCDA 1T7VA 4NPYA 4XNMB 1CGSH 1I8KB 2AJUL 4GRMA 5J1SC 1B4LA 1SOSA 1U6AH 3SPHA 2AI0H 4JZNA 3HZMB 3IRPX 2OI9C 2JFCA 3QP3A 4M9OA 1YEEL 2BHZA 4TOYL 3KYKH 4R4BA 3ZVVA 3AABA 1RVFL 2ESVA 4YXLH 1DLFH 3JWNG 3B9KD 3DGDA 2XSKA 4ODUB 1MCPH 3H55A 5CZKA 3BUDA 4JDTH 4DF9A 4KVCL 5F8RC 3FT2B 8CGTA 2JVUA 1I8AA 2Y72A 2H6PB 2IPKB 4OF0A 3VXUA 1T20A 3OLEA 1CLOL 1HN1A 2KH2B 3PFQA 1WA2X 4HP5A 3QNXB 4NGHL 1G9NH 2UY6B 2O5YL 3R0NA 4U6TA 5C09D 1IAOA 3UABA 1WIOA 3BKJH 5KYYB 4RAVA 5E8NA 3B5TA 5AW5B 4DKEH 4HWZB 5AWNH 1OSZA 3QFJD 4PJBE 1MJUH 2P44B 1RLWA 1UJ3C 3F85A 3GSNA 3GMPB 3AT8A 1FA4A 1LHZA 3RAJL 4N4YB 1IAIL 3GS4A 5JW5B 3BO8A 5FKPB 1A7PL 3WJMB 4BV1A 5IR1A 4S1QL 4AQZA 3RWDB 3EFFA 4TVPL 2D9CA 3S35H 3N42B 4M7KH 1D7BA 5IP4A 1BFSA 1IM9A 1RP8A 3IXTB 1J1PH 3FUNA 3UACA 5BS0B 5AOZA 1QUNA 5KAQG 5GGQL 2WK2A 3U36A 1SRDA 1GOGA 4WTQA 3BVDB 3JTBA 4ZG1A 5AB0A 4DP7X 3G5YA 1KJMB 4F7EB 1C8PA 4JUSA 3MRRB 2PCPB 5DHVB 1WTLA 2AXGA 1KYOK 5DI8A 5GRXG 4BBWA 1K9TA 1N3NB 1UZGA 2VE6B 3A67L 3LY6A 1R34A 3KPLA 3REVB 2EUVA 3OAZK 1MI5B 3MRKB 3RWHB 5HYIA 1BZDA 3WJLC 1RUPL 4HU2A 2EXWC 1ZOXA 3RUGB 4KH2A 1CE6B 1E5AA 1FV1A 4KKRA 2AEPH 3ERXA 4IRJB 1E2ZA 2OMTA 3ME0B 4DUXA 1ORQA 4H8WH 3BJLA 1N6VA 3NP3A 3C5XA 5DO8A 5ITFA 4HFWB 3MZTA 4FXKA 1NWPA 4GMSH 4L8SA 4GYBA 2VQ1B 3F12A 3RPKA 5HY9B 4X7SL 2DQFB 1K6QL 1RPQA 3SO5A 2FQGA 2BHUA 2EDJA 4MYPA 2MCPL 2VC2L 2ZAGA 3L9EA 3S6CA 1U3NA 2YMXH 4NUPA 3NEXA 1XF2A 3OKKA 1D9KA 1GMEA 1IAOB 4GW5B 4AGQA 5TPWL 4DO5A 1J86A 5E8NB 1MCSA 4A04A 4UNVA 3P3UA 5HVGB 3GSNB 2H2SC 3N43B 4ZMZA 4KKCC 1JK8A 4XOEA 3T4AC 4AGMA 4R84A 5B39B 5H4ZA 3BH9A 4PLJD 4YSUA 3VXRD 4CBZA 3U1PA 3CZLA 4JG0L 1OL0A 3BO8B 5E6RB 1FZKA 4ZO8A 5FYJH 4FABH 1QSFA 5CILH 1QSVA 1YYCA 1G1KA 1KIPA 3OPUA 4AC2A 1WG3A 3NH7L 4BKLA 1T0MB 1SMOA 2FT6A 3ALPA 4ZFFA 5EHFA 5T33H 3DROB 1EO8H 1U8OB 1KENL 4DVBB 5F0JB 4HW6A 4XRCA 2XPYA 1JWSA 2XWXA 3MV7D 4PQXA 4RWYH 4CU6A 1FL6A 2PXYA 4YBHA 1MFBL 4MTMA 2FJFB 4WTZA 1QSEB 3RWCA 4DPCX 2EQDA 4K8RD 5JPMA 5DK3A 3ECQA 1ZA6B 2CLVA 3PGFH 4RMTA 1MG3C 2YPKB 4X6CE 1XSOA 2K70A 4PJIB 3QIWA 4UDUB 5HI4D 2DY2A 5HHME 3IJHB 2YAHA 1BX2B 2J88L 4LBEA 2NR6D 4XMTA 4JG1H 2R8SH 3ZIMA 4JS7A 3D4GA 1TZAA 1M7DB 3BZFA 5CD5C 1P9MC 2XIIA 3RFZC 3BRGC 2PO6A 3ELAT 3QWOA 5I1JH 2HT3C 3T0AA 2XXCB 1I8IA 1JWUA 2DWDA 2E7HA 2MOGA 1N0LB 4WV1A 2W94A 3PQYB 1EMTL 1JOIA 1NCWH 5SWSA 4E9XA 4F5CA 1K8IB 4MWFB 3TNNB 1O5DT 2DLIA 4M6NL 3P30L 4Y19D 4KNTA 1Y18B 2EUWA 1F6LL 3LKRB 2X40A 4LRIC 4AZ8A 2X7LA 2F18A 4RCAA 3BAJA 2CUIA 1JGLH 3M88A 2R39A 1CDJA 2RALA 4YFLI 4N8VG 1XCQA 1MQKH 4L1HA 4RSYA 3RVVD 1VENA 4J3OD 2FX9H 2V2TB 4MCYB 4DQOH 3WO3B 1SN2A 1TZOA 4FQHB 3WO4C 2EXYD 4HH8A 4NQVA 2J4WL 1PZDA 1G7JA 4S2SA 5IJCC 2IIJA 3DXAD 2VXSH 4N24A 1RI8A 4WHCA 3BKCL 2XA8L 4XR8C 5J1AA 2L7QA 1N10A 3U9WA 4Z3GA 3LQZA 4QCIB 5IESH 1B9KA 5B1CA 3K4AA 3FT9A 3GSUB 1AQ8A 2R4SL 4NO0B 5HI3D 2GK2A 1XF3A 4PS8A 1JXDA 3OAUL 4M4RB 3V5HA 2RJMA 2YD3A 1Y1UA 1B90A 1KIPB 3EDJA 4OLYL 4OUOA 4BK8A 5C2BL 5IFHL 4N0UB 4ABVA 3GHBL 3OMAB 3DPDA 4XH2A 4P06A 3EO0B 3GEWB 2J20A 4JDEA 5KSBA 2XIDA 3O3DA 2QPDB 3MLTA 4XRCB 2MQGA 4F2MB 5MERB 5FGCE 4L05A 4WI5A 4HC1H 4YGVA 5DMJB 1Z9LA 4LMQI 3LIZL 3KE0A 1GAFL 3AREA 5CUSH 5GS0H 4N1EA 3L3KA 3VI3E 4AQAB 5DJ0B 5FM5O 2Y5EA 1KXVC 4OB5L 3PAZA 3BQUC 4J7RA 1YUHA 3CVCA 5L8KB 2VQUA 3DBSA 4HUWA 5C0AE 5IFAL 1EZLA 3TLRA 5H94A 3RWEB 3U83A 2CQVA 2DYPD 4OI7A 4M61A 3SE3A 1RULL 1T80A 2DBLL 5DJXA 1Y1DA 3WNLA 3ARFB 4O00A 4OLEA 1HCFX 4BZ1H 2FO1A 1AHWB 2AJ3B 3MAWA 3TCXA 2H1PH 2HH0L 3NIGE 3MV8B 3K1DA 3NFNA 3NACH 4P2RB 4RISL 4DW2L 4ELDA 4ALAL 4XTRC 2ID5A 2BY1A 4LHQB 4PJXA 2VJ8A 3IU4H 5DZNA 3PJLA 5EO0B 3GUTA 5E1GA 1X5KA 5DC2A 5DS1A 5DZOA 5AQ0A 4GINA 5DHYB 3NFSH 2N0KA 5DVOA 4YPJA 1DCEA 1COBA 4ODHH 4P5MA 2BRQA 4I0PD 3UEQA 4RETB 1IL1B 3FH7A 1H3XA 3ZE0B 1OAXL 5LBGA 2VDQL 3GLDA 3PWUA 5G5DB 3GMMB 1GY2A 4IMKC 4N0YH 2ZOOA 4YC2B 2VABB 3DV4A 3K72A 2R29H 5AOJA 4OKDA 3F8UB 4YNYB 3DX1A 1CICA 2XTJB 3BIBX 5E99L 5PCYA 3N1FC 3QZNA 1YQVH 2AEOA 3AW5A 1IC4L 5INDB 3QPKA 1XL6A 2WCGA 4JBSA 4U7KA 2BO0A 1FGVL 2ZYIA 1UWGL 3V6ZA 1AZVA 1U8IA 4ZMNA 5TQ0H 5MEOA 4W9HC 1EVUA 3ZR6A 4J8RA 2B4CC 2W81C 2EIMB 3LQZB 4XP6L 4M03A 3MLVH 4N8CH 2B1AL 2A4EA 2R9HD 5CJ5A 1MSPA 3VGGA 5I1HH 5EU4B 2YC1A 4IKLA 3NBNA 3BDBA 4YQXH 1NDTA 1O7SA 4PGDA 1ZV5A 1UOLA 3ZMRA 3HR6A 4JB9L 2OXHA 4P3DA 3IJEA 3QJSB 1T3FA 4ZQTA 2D0GA 1BVZA 4JKMA 4M43H 1GS6X 4YSPA 1XGQB 1GCFA 1UOKA 4ELKA 3RGVD 5DC9B 1FE8H 3GF8A 3MNWB 4BH7A 3SE9H 2DQJL 3EJPA 5DQJB 4PJHB 1BFVH 4U1JB 3WHXB 1NCUA 2V9QA 4OI8A 1RKRA 4X6DE 3HS0C 3S96A 3ZTNL 5BVJB 4HC1A 1A14H 2F7RA 3NIFB 2MCG1 3MCLH 4XHQA 1X5HA 5AW3B 3UDWC 3FTVA 3PDOB 1SM3L 2WZAA 3IN0A 2JJVA 5MHSE 3BXNA 3GS7A 1ZHBB 4Y2LA 3DUHA 4G6FB 4UTBL 4WFEE 2G9HB 4Z3JA 3C2AH 2ITCA 4I3GA 3ARGD 4JHZA 2XV3A 3BUBA 3V6FA 3V4UH 3G04A 1W72H 2ZP0T 1TQVA 4JHUA 4A7TA 4OZGA 3JV4B 2Q3XA 1YNKL 3S48A 5I5RA 2GUOA 4Q9QH 4P5KA 3TBTA 3TZVC 5D1XD 2WAQA 5E1QA 4BZ1A 4F7MA 2Z91A 1EHLL 4HLEA 4QHMA 1BBDL 5CCJA 4MNGA 2CJSA 2MPAH 4LLAA 1U4FA 1RZFH 1X5IA 3SKNB 1H15B 1KCWA 3VFMA 2CSPA 4H20L 4WJ5A 3DVGA 5ISZA 3TBWA 3H9HA 1EK3A 3RBSA 3ZDXB 1I7TB 1WGOA 1V27A 3DV4B 2OJEA 3LZLA 3MRBB 4NAJA 4U31A 3V5KB 1IEAB 4YUEH 4LFHG 2Q0ZX 2AJXL 1FSKB 5HJDA 1CICB 5I76A 1TJGH 1UQSA 2Y5TA 1Y07A 1DVUA 1UA6H 1DLHA 1WZMA 1X6LA 1A7NH 4R26L 3WAKA 1HVXA 3LRGA 3VH8G 4FQQA 3DIVA 4HJJL 4WRLA 5DSCB 3O4LD 2FWOB 2VDLL 3D69B 5KSVA 4K55A 3OAYK 3GLAA 1NAML 4UB0L 4ZTEA 4AMXA 4POZC 1XH3B 3L81A 3RY6C 5EOTB 3BCFA 1EZSA 1KBWA 1X4XA 1OAZH 2WYTA 2YC1B 1KN2H 2VMEA 1JHTA 5E51A 4YR6B 1F0LA 1R75A 2WSKA 2ZG1A 5EBMB 3RTLA 4GRWB 4P9HH 3LNFA 4MVBC 2F74A 2NTSP 4E9TA 3SGDI 3FT4B 1CD1A 1NMAL 4ELKB 1RXLA 1V7MH 3ZDYB 1RJYB 2OK0H 1P2CB 4Q56A 3ZUCA 3ZSTA 3BW9B 2D31A 3HRZB 1QLEH 4G6JH 3WKMH 2NY5C 3B2PA 3U30B 1O0VA 1INQA 2DMBA 1TYJA 2OTUA 3D3VD 1HHJB 4M8UA 4HGWA 3WI9A 1SEQL 4A7SA 3D09A 4S1SL 2VLJE 4HS6A 2B59A 3RIAF 3ET9F 2GKIA 5EU6D 4DCQA 4YDVA 1Z2KA 1XAKA 5MEPA 4KQ3L 3P1VA 2MQ0A 5KVDL 1EEYB 5I17A 4K9JA 3X12A 3FO0L 3QDMD 4Z7NF 5BV7H 1IE5A 1FIEA 1DVFC 3BUPA 1OAYH 3MRLB 5FCSH 1TJIL 5C0CD 1KXQE 3KPQA 4IKKA 2R0ZL 1N64L 4BFEA 3IRZA 2D3LA 1XGYL 1J12A 3FUFA 1W72A 4NO3A 3IDIB 1ZTXE 1M6OA 1WISA 3ILPA 2XV6B 3H9SB 4PWGA 2EXWD 1CGYA 3AG1B 2R7EB 5DS2A 4A2MA 3WJJC 1K85A 4N8VB 1OP3K 4Z8FH 1AD9B 3QQ4A 5CF3A 2RCSH 4YMPA 4DTGH 1LTXA 5DJDB 3WSQH 4X2UA 4MD4A 3L7FA 3CCHA 2VZ1A 4KXBA 4ZUUB 3KZ8A 3P4NB 2VERN 1XSKA 2PYEA 1I8MA 3K80A 4Z3HA 1I4FB 4HAFA 3MRIA 2DQUH 3AXHA 1R5IA 3HMWL 5HGHA 4HZLB 3D30A 4DPAX 4LGSB 3MJ9L 5IOPB 3VXPA 1JYNA 4I5BA 1L9PA 1DJHA 3FO1B 4FQQB 2MTPA 4AG4L 4HOZA 3UAJA 1HK6A 1ETZB 2L7EA 4JREC 2D9QB 1AXTH 1JVKA 3D12B 1IC5L 2N7SA 5TE6L 3JWOC 4Y5XB 4MDJB 5ADPH 3CHRA 4QLWA 1JHTB 2CRYA 1WS8A 4PS4L 3CU7A 1MIML 1BZQK 3L3OB 3WLBB 2VGLM 2X88A 1EJ6A 1FNLA 2ED6A 3HFFA 2W9LA 3H7BA 1S3KH 7FABL 2H2SD 4JN2A 4A7QA 2QKIA 2EDTA 4G8EB 4KKCD 3SDDB 3RG1C 1FFPA 4Y9BA 2A83A 4FZ8L 4HLZG 2BP0B 3KDPB 2P5EA 3HUJB 1LP9B 5F9DC 3NSFA 5T1MB 1WA0X 2I60L 1VERA 2D31B 5C0RL 4FNLH 1KB5B 4IBSA 2CM5A 4L3ED 1INQB 2DV6A 2FJGB 2Q8BL 4LVOC 1CB4A 4JFDA 3N5AA 2NUPB 1NBYB 1WIUA 1TMCB 3LNEA 5B38G 3DO7B 4MFHA 1SQMA 1JRHI 4LSPL 4AKQA 5CEXB 3NA4A 1ETB1 1NBVH 4OZIF 2X4NA 4PRIE 2HVJA 2Y3AA 4YDVB 5D1ZI 5FUZH 1GZPB 3LXAA 4ZYKA 3QG6B 5K9QG 1NC4B 5IVZB 4KX9A 4WUUD 2ZOUA 5BRZE 4YHZH 1SBSH 2VXQA 1T7ZA 4UYPA 2JK5A 3LXBA 5FYKH 1KJ3H 1XIWB 3K81A 3BAKA 3IDXH 1IGYA 5J6GA 1IEHA 1CTOA 4WDIA 1QHQA 2AXJA 1U8KA 3GBDA 4X99A 1LEKB 4TQEL 5A1AA 5D7JA 4N5EC 1IM3A 5E70A 1DQJA 1P7QB 5FCUL 1MWAB 3BWSA 3T1FA 2X44D 5CD5D 5KYNA 3BDYH 5IB4A 3AXIA 5EO1A 4XCCL 2GG1A 2HT3D 4HFUL 4JQXA 4RMUA 3CN1A 3X1GA 4EDWL 5A7BA 3EIFA 1HC1A 5HHXL 3F01A 2IBZY 3MLZH 3PAVA 3MJ8B 1JZ8A 2DEWX 3K8KA 2QSCH 2ICCA 1KYDA 3EOAA 3I50L 1R3LB 3W5NA 2LU4A 2BCMA 5C0JB 3GBML 4OZHB 3MNZA 3JWDC 5JLZA 4J2QA 2VLRB 3NSJA 3WKPA 1CMOA 4G43B 3WENA 1KBBA 1G7PA 3CXFA 1C1EH 3OHXB 4OCWL 3FL7A 3DX3A 4IGBC 3BN3B 4GW4A 4C4UA 1OT4A 4LVNB 2VCOA 4N90D 1E67A 2BWIA 4UT7H 3RNKA 3QJQB 3FQRB 4PG2A 1WH0A 3LZOA 3QIBC 2FQDA 1OK8A 2OMNA 3A0OA 3L7EB 4PFEA 5IVXE 2JKSA 4MJIE 4CSTA 1QATA 2AV7A 1KDIA 3T6ZA 1XZ0A 5I1DA 2ZXDA 3I6KB 1EXGA 2L0DA 4RSVA 1UB5A 5F93C 2F15A 2YPLB 3NCBB 2BMKA 2AW2A 3QNYB 4NN6C 4UDTA 1HIMH 3THML 4E42A 3PGDB 3WD5H 2VDOH 2CO1A 4IU2B 3ULVC 4PG9A 1YPZE 1RZGA 5T5NF 3ZZQA 3S34L 4KBPA 3B9KA 4CRPA 5HDLA 4WFGE 4KO6A 3TNMA 1C12B 3BUQA 2EJ1A 4PRHD 1L9OA 5HHVL 1YMHB 2VQ4A 4IU3A 4QXWA 1UZ6E 5LG6A 2PPFA 2ATKB 1JCKA 4F20A 4YSAA 3ES6B 3LH9A 3WXWL 3BQUD 5C09A 2Z7WA 3HN3A 4K7FB 1CDIA 3WTTA 3M07A 4TQPA 1BAFL 5EOCL 1ACZA 4UQ2B 4RX4D 3GZKA 1K8DA 3QQ3B 4LCWD 4XBGB 4NENB 1FNSH 1IFHH 3UZVA 1BVLA 1RZJL 1JK9A 4X99B 1YEHL 4NQDD 3N9GL 4PJ5B 1J8SA 1RUQL 1IM3B 4TUJB 3ZRCC 3DHUA 1P5UA 4JR9L 4JHVA 4EXKA 3IGLA 5TGBA 4FTVE 5KOVC 4LLWA 5IB4B 5EO1B 5HGBB 1F4AA 4G9DA 2GAZB 4OU3A 3TT1H 4HS3B 3V4VA 5AFAA 5KS9B 5CR1A 3QDAA 3O0RH 5FW6A 4XTRD 1KYFA 1HDMB 4MSWB 3VH8B 4ANVA 4OFVA 3ZTJG 1L6ZA 5IB5A 5C08E 4K8RH 4PGEB 4NN7B 3HC4H 1WC7A 2HG5B 3D0LA 3G6DH 4GFTB 1KJ2B 3CK0H 5HDRA 3VB8A 4CAGA 1NC2D 2G4GA 4F93B 4N0FB 1ZLSL 1A7RL 3BVXA 4GAYB 3MRGA 4JGUA 3D1MC 1TETH 3AB0B 5E1AA 2HTKC 2BVPA 2BIPA 4JFZH 3O6LH 4GBXB 1WICA 4G80A 5J9PB 4QPEA 3ZGHA 3BMVA 1P7KA 1UYWH 1U8QA 3GJFB 5AEAA 2IV9A 1O6VA 4P05A 1ONQB 5C07B 2F58L 5FF6A 3CLWA 3MLXH 4ANUA 3IBOA 4PB0H 3TS8A 1U8NA 3FB7B 2AV7B 4XAWL 5E1IA 2R56L 5E6IB 2FLRT 3TGXA 5HJ3B 5BJTA 4MMYB 2YKLL 3DIFB 5F9WC 2GJ6B 2CO4A 4I48B 1T2XA 3BVNA 5DXWA 5FA4B 4L4VB 4D3CL 2JELL 5BVPH 3U0TA 3SPVB 3NZSA 2FBJH 2XY1A 4PGZA 3Q8BA 2EDFA 2F68X 1IUZA 3TU6A 1MCQA 4J3OH 2LU3A 3W0WE 2A7BA 2CK0H 4R3SA 3KJ6L 3LN4B 3B6SA 4UUJB 3AM8A 4HS8L 4RNRB 3VG9B 2BVQB 3ABLB 5F1IA 5IHWA 4J4PA 3VFWB 2R0WH 4LCUB 2NY4C 1W91A 4LKCA 5CLTA 2YPVH 3CZEA 4NFDA 4PR5B 3SDYL 3R1GH 5CP7B 4AEHH 2Z31C 2CIIA 2XRAH 4G59C 4RFEB 5J89A 2OZ4A 4Z1PA 1DQLH 4N5UA 1TZGH 4AMKL 5A43C 1PQZB 3VXRA 1GC1L 2A9CA 1CGWA 1GYVA 3BFQG 4P3CL 3D18A 3RBGA 1AH1A 3WIFA 2VW7A 1ZANL 2EE0A 3TWCH 4NWTH 3MUY1 3UC2A 2BNQA 4G9FB 1ZEAH 3SDCC 5AD0B 3TZVD 4G7YL 4WI7A 4OVUA 2AKRA 4E0RB 1UT1A 1XH0A 2K9FB 4PB9L 4UIMB 2L04A 5IM7A 3MV7A 1ES0A 1OCCB 2YJLA 3DX8B 3KNBB 1J18A 4AYEC 1G6RB 2WVVA 3NIDF 1X5AA 3CVHA 1DEEA 3IDGB 1F4YL 1KB3A 2J3SA 4KRPC 4PY7B 5KBMA 3L4ZA 2NYKA 1XF5B 5HHOA 1OTUC 3KLSA 3SDAA 4LRNH 5B8CC 5DMGC 3VXSB 3KYOB 2VDRH 4ODWA 3IN2A 4B6ZA 4I1PA 5DHMC 1P7KB 2FZ3A 1MJ7L 4U0RC 3RPIB 5D2NC 4JO1H 1UCTA 5AYUH 1XCTA 2OL3B 3T0EC 2NX5A 1AD0B 5GRWA 3PYCA 2V6HA 4POZD 1E28A 3QPXL 1RSFA 3MOBH 5BJTB 1DBAL 1JAEA 5B38B 2PR4L 1KC5H 3MZGB 1JPTH 2HKLA 5IHUH 4FNQA 5DJ6A 3SJVB 2KUTA 3I6GB 1U93B 2AK1H 2BIIA 3ZU8A 4WNJA 3EYSH 3FN3A 4MVBD 4XX5A 5K33A 4GRLC 1A6ZA 4KXCA 3VFRA 5IUSA 3QXDB 5DEGB 3VRLE 1K4DA 2DQEL 5IHHA 2EIJB 2IBGA 4Y19A 2OP4L 3QUYC 2X0WA 1XGTA 4WSKA 5AAWA 1FLRH 3B6SB 5GRVL 3QCUH 4B97A 1QRNA 3T3MB 5A16A 3AU1B 4QRBA 4N2GA 5E8EB 4A1JA 2XN9E 4LKCB 4L48A 2FSEB 4N9GB 1OM3L 2H5UA 2OSYA 3L3HA 2FJHB 5AZEH 5F88A 2AF2A 2X6AA 1F6AB 3DXAA 4D9LH 2CDFA 1MRFH 4YAQA 1JWMA 4HIXL 4HUXA 4DESA 2YPVA 2ICEB 3F5WB 4CU8A 4AENB 2XCMC 4K7PX 5JW4M 3CVBA 4CSSA 2HP4A 3U9UA 4C56D 1RK0B 4L4TB 1DVFD 1KLFA 1BF8A 4DGIL 1BGXL 4X4KA 4BHUI 4YHIB 4CNIB 1ERNA 2VR7A 1UH3A 1T83C 3UTZA 2IH1B 1D6EA 4FF9A 5F70A 1UOWA 3QUGA 3V8CA 4RGNC 1SEBB 1MJJA 3AUVA 4JE4B 4PV1C 5JMRA 3QCTH 4MDIA 1INEL 1WUNT 3PREA 4N3UA 3S9DB 4QAMB 2AANA 2F54E 3UO1L 1ZT7A 4X4YA 3QC5X 5ID0B 1J5IA 4DFHA 1XGPB 3GWJA 4HX1B 3CVHB 3QE5A 3IFNL 3T8MA 2LAAA 5L8LB 3LJ3A 4X6FA 5DK2B 4X80H 5HHOB 3TTYA 4OLZH 4Z7WF 2DDQL 2GSIA 4G3YH 4X9BA 1JHLL 4PJ7E 3KLQA 1TU2A 3EUDA 4ZXBB 5CFHA 2A2QT 3T0XA 1A0QL 3WOVA 2DQTH 2J8UE 2M83A 2CR0A 5DJCA 2JCCE 4OIFA 5I1IH 3L95B 4L3CA 2VR6A 5ESAA 5D1QD 1S9YA 4CUCA 4PJAF 2BWQA 2DWYA 1CD8A 5I30H 1XTLA 1E4KC 4LF3B 1NL0L 5D7IF 4HJ0C 4NQCA 2P26A 2P8PB 2GJRA 1CUOA 3HR5B 4N2FA 3HG1B 4LL4A 4CSZA 4D8PA 5EZLA 1Q1PA 5EU7E 3CFJB 1IC7L 4H88H 3RL1A 1KCLA 1HOEA 1MUJA 3VFGL 5TK4A 1FNHA 1FAIH 1A6ZB 2HA1A 3GIVB 4J23A 4NX0A 4LCCA 4B53A 1Z6JT 5AVUB 4Y9FA 4NM8L 4UV4L 2BINA 1OV8A 4FFZH 4MA1B 5I26A 1TJHL 3TO4B 2BRRH 5F96H 3BEVB 4UOJA 3IFLH 3ZHKA 4GSDL 4ODXB 2A74C 3TFKC 3V6OE 2QQQA 2QGCA 1I9JH 4MB3A 4DN3L 2HRPH 4UT9L 2K3HA 1FN4A 2ROXA 3SGDH 4PCKA 2DM4A 4TVPE 2LVCA 3VFVA 1MCOH 4J2XA 2X4UB 3TP4A 2ZP8A 3UTTD 2D7TL 4AYID 2FVNA 4I88A 4NKIH 1QBLL 5C0EA 4W9ZA 4PY8I 1D6VH 1T6WA 5T1DH 4HKXA 4ZTPH 2AAAA 4LB8A 3ZYOA 1NBZB 2E7MA 2GSGA 4PJBB 3IF1B 2AJZA 4Z0XB 3ROOA 1I3GL 1OO2A 4PREB 3RHWF 3FSWA 4AIZB 3TBSA 3HOGA 1QI4A 4U1SA 2XQBL 4R97B 1AGCA 2WJ7A 4N5ED 3WTXA 1TITA 3RGVA 5I74C 4H1LG 4AW4A 1PG7H 4BRVA 1SDYA 5E5RB 1MFVA 2QL1A 4OCRH 4YHNA 3W39A 5I19L 5DEZA 4N86A 3N42F 2WVUA 3X2QB 3TIEB 4M5SA 3WELA 4X8GA 4L8BA 3LDBB 5ERWB 5GS1A 2Y25A 4AYBA 1J8HD 3HB3B 2NYZA 3OKEB 1HESA 1GA2A 1FZOA 3AXLB 4O02B 3UYRL 4PY8J 2KI6A 4XNBA 4PPTA 1H3TA 1FFRA 1YNLH 4TRPH 1ZVNA 3JVGA 4X6EA 3FCGA 1BAWA 4IGBD 5E9DA 3GSRB 3GJEA 4OGXL 5CSZB 4WHTB 2RFXA 4H0LC 2GFBA 2B77A 2JB6A 5DMIH 1I7ZB 3F00A 3KPNA 2N7AA 4MA8L 4Y5YB 3MXVH 2R23A 1JZ3A 5DFAA 2RTTA 1FL3B 4KZEH 5D1XA 5ACZA 3QIBD 3UG5A 4PGBB 1YYLH 4TLKA 2GI7A 4NXSA 4ETQA 3V8OA 1LWHA 1A6UL 2AXHA 5I0DA 1GGCL 2VISA 3BEWB 2VT0A 3IJSA 1BQHA 4LKXA 4QTIL 5K1VA 2YGNA 2K7QA 4Z7VE 2OW7A 1U95A 1GW6A 5F7DB 1MH5A 2JQZA 2WTRB 3LNHA 1M2OA 2Z8SA 2XWJB 5C0DB 1Y7MA 4FFZA 2O5XL 4KVPA 3GHEH 3HS8A 1T1XB 1A6AB 1W16A 2XYCA 4R7XA 3E80A 2XICA 1FUNA 1R3IH 5F6IC 2PCFB 4MQTB 1JPGB 3EYOB 6CGTA 2OR8A 1IBYA 2VM9A 5DJZB 2V9UA 3SBPA 3W9EA 2Q76A 2JTYA 4QRFA 1DQML 2B39A 4KMTH 4PJCE 2C9UA 3FHQA 1IZKA 4WFFE 3I2CL 4EIUA 1F00I 1SF3A 1FNFA 1WBXA 4XCYB 1O5PA 1MCHA 2Q7YA 4JE0A 3RX7A 2E6QA 1ZIAA 2UX7A 2VAAA 3HLAA 3FJTA 5EC1B 5IHZA 1MLBA 2LFEA 3N43F 4PS7A 1JRHH 4NQEE 2ZSVB 3FMGL 1QQDA 2C1OA 3FF7A 3PXLA 1UJ3A 4U1LA 1EHNA 2ZNXA 5IIEA 1QYGH 3Q01A 5ANMA 5JHMA 4D9RD 2W65A 3B43A 4V1DA 1K4CB 5LNDA 3P3YA 1CDYA 1Q9OB 3AROA 2Y07L 3EDEA 1WA1X 3CPUA 4MAYB 3OJ2C 2R0LL 1EDQA 1AI1L 2GBAA 2WIIA 5C0GA 3D3VA 3HAEG 4GXVL 4L8BB 4QO1B 3UIYA 5HHQA 1H9DA 3KL3A 4JN1L 1B6UA 3TEWA 2PWFA 3QJUB 2YQBA 4Q9RH 3OXRA 3AITA 4NSKA 4ILDA 4OCYL 3H56A 3LD8B 2HWZL 1IT9H 3H6AA 3AT0A 1VGKA 3GBEA 2GCYA 2V9RA 4FS0A 4LSUH 1G0YR 4NZUH 3SQOH 5KVGL 4C4KO 1SJHA 3X3GL 3QDMA 3ZJAA 3KPMA 2W92A 3KVQA 4PJIF 3VE0B 4X6CB 5C0CA 1AMXA 3DPBA 2HTKD 4UAHA 2YZ8A 5DFTA 1RU9H 5LCVL 2NTFB 4GSUA 2ERJB 2IALB 4HKBA 5HHMB 5JUEH 1UASA 4I7ZC 4E9WA 4D0DB 5F7YC 2WYIA 4LVHC 4DGVL 2VW6A 4FXGC 3IFOA 3NRPA 1WZ1H 2OMXB 4GQZA 3L4VA 4QGTA 1S9XB 3D39E 5FA3B 2PKDA 2AV1A 1HOCA 1U95B 4AL8L 3J8F7 3HNSH 3C75A 3QZLA 3ZW3A 1YCSA 2P46B 1YEFH 2P5WA 3ZHLA 4OCNC 1U3HC 2BY3A 3S5LA 3GMRB 3RE0A 4GKLA 5DJAB 5L4FA 4JY6A 5JW3H 2R1YB 3GD1C 3KPSA 4WUKL 3VFPB 1F13A 2Q76B 3O9WC 4IDJL 3U6RA 1NLDL 4IDLA 3G5XB 5GHWH 3BLPX 3ZTCC 4XPBL 4AYFB 1TSRA 1WAEA 3FDWA 1A7OH 5D7LD 4DWHA 3ELQA 2JH2A 2NY4D 4WJKB 3B2VL 5AOIA 7CGTA 2ORBL 2VAAB 4Z9KB 3RIFF 4MNHB 1RK1A 4Y2DA 5EEYA 2K0RA 4JX0A 3UAFA 2Z31D 1P84J 4H1LA 4XAKD 3UP6A 4G8GD 4HIQA 5JOEA 3T4AA 3N44B 3O45B 4X5LA 2OMZB 4WW2A 4JM4L 4MMXC 4NKDA 4XOCA 4YHKL 5D1ZA 2QEJA 4M7JH 4DKTA 5F3BA 1HNYA 1JNHB 3TT3L 2O61B 1IKFH 1FYTD 2QR0B 4L3EA 4ODSL 3IDUA 5IB3B 2V2WA 1PZUB 3SDCD 2M2DA 3I6SA 4MCNA 2Y2YA 4AWJC 3FQTB 3EFDL 4KI1A 2N4IA 3WLWC 1YEIH 4B0MM 1LILA 4PYGA 3HCVA 3A6BH 3WFHA 1X7TA 2Q5BA 2NY2B 4KXZH 4YK4B 5FGCB 4FLQA 3FFDA 3LVTA 4XPAL 1NFIB 4Y8DC 1E9PA 4W9JC 2VAJA 2LQRA 3JSSA 3WFEH 4LGPB 3VI3B 15C8H 3KR3L 2XVLA 3GLZA 1QHOA 1U8MA 2AEQH 2H26A 4KRPD 5EUOF 1OTUD 1H8LA 4OZ4A 1T21A 5DMGD 4GG6A 3QH3B 3US9A 1KIQA 3B7SA 5C0AB 1R3JB 4LLUB 3OVUB 3F7KA 2MTAA 2G0LA 4MASA 1LK3H 3KGUA 4NT6B 3EJSA 4OCXH 3NFPA 1MHPH 1T1WB 3RTQC 2MCMA 3T0ED 5IG7B 1DFBH 4HHGA 5AB9A 5LG1A 4OJAA 5KYWA 4BKSC 3DMMB 4H25B 4HPYL 3EGDA 2V8MA 3KLKA 1DVTA 4QHKI 3NIGB 3TH2T 3L9RB 2AV1B 3FN9A 2CA3A 3A6CH 3B7TA 5ALBH 3IXAA 4JHAL 5F71A 1G9MC 5DWUL 4OZFG 3WEAA 4L5FH 2QHRH 2VDMB 2IAND 1HQ4B 3MGTA 2Z1PA 1FVCB 4GRLD 4HK0A 3K2MC 3ZE0F 3FU5A 2FATH 2A5UA 3M86A 4P46A 5GGVH 1NPUA 3EFOA 4IOSA 4CC4C 4LRIA 4EI5B 3QUYD 2NSMA 3V9EA 1AGBA 3BN9D 4H5SA 1Y7VA 3KL0A 3QJHA 5JHDD 2C4FU 4L1SA 3TA3A 1MPAL 3S3CB 4NPJA 1ZHLB 2H1XA 2J56A 3G08A 3ILDA 1GGIL 5JOFA 3MBXH 2HCZX 4QF1A 3GRWH 3VD3A 2B4CH 4PSRA 5T3XL 1UKQA 4XWGH 1PZAA 4H1LB 5EC2B 3N85L 3O3AA 1XHHA 5EOQH 5EIQA 1PEWA 2RACA 1MELA 2ZX7A 4M5ZH 4X6BB 2YEZB 3G5VB 2WLZA 4QHKJ 2HFGL 4O5LL 5IJKA 1FBIH 2CXKA 4MMZB 5TF0A 2X2HA 3TO2B 4X5QA 1F2XK 3L3GA 4FLOA 5JZ7D 5GGUA 3CD4A 2F7OA 5F7MC 3D25B 4RGND 1GZQA 2F5AH 3LSOA 2X6MA 4PV8A 3WEOA 3ARDA 3CZNA 2VDNL 4JJ5B 4PRHA 4XP4L 2YXMA 1VACB 5FM8A 4PJHF 4GI6A 4LDLB 4TQHA 2R2HB 4L8DA 2X28A 3QB7C 4B9JA 5GZOA 1E9PB 3FH5A 4PRPD 4DKFL 1KFGA 1KB9K 2HXAA 4X6DB 3CH1A 3NIFF 4P5TC 4BUGA 1KXVA 4HHAB 4KK8C 1QTYT 3BQUA 4OD2A 4KXAA 5DUPL 4M6OL 1F90L 4E9VA 3ECVA 2C7UA 2HX7A 5FFGA 3FCSB 1LYQA 5GGTH 4G7RB 4G6MH 4PJEA 1H5BC 1FFTB 2ENPA 2CRMA 2OX5A 4Y1AA 5JHLH 3D06A 1MNUL 2BSRA 2YGOA 3HI5H 3Q9PA 3NFPB 4GH7B 3IETB 1R47A 3P9MA 1CFSB 5E5UB 1KEGH 3I02A 1TR7A 4ZMVA 1YEKL 4HJ0D 1WO2A 1JS4A 4YDIH 4KOCA 1NAKH 4Y4HC 1VEOA 4KTEH 4DZ8A 2ZUQC 4UTAA 2DD8L 2G60H 1A6WH 3A5VA 1Q94A 3SY0B 3ECBA 1B2WL 3L5WB 1E9OB 4HGKC 2Z93A 3ZL4L 4HBQA 2PWHA 4M4PA 1QBAA 1EJOH 4JQIL 2FWLB 3ZDXF 1OWWA 2FEEL 4JVPA 3U0PB 5KVEH 5GISL 4IMKA 5INCA 1KLUA 3MV9D 2HKHL 1EJFA 1JI2A 3D07A 2X4RA 3O4LE 3KBEA 3TFKD 1A64A 4RGMC 3PABA 2W59A 3FONB 1GVIA 5HYSA 3KMDA 4P2QA 1LEGA 3CDYA 3DARA 1LNUA 1T1ZA 1FZMA 2B08A 3QO1A 1P4BH 4LP4A 5DK0A 5TDPA 1XFPA 4FP8L 4YHPB 2X1QA 5HDBE 2EH8L 1RHHA 1OSYA 1HL9A 1TTGA 2ZCLH 3HAEB 5AL8A 4ZFOA 3HA0A 1N2RB 4Q0XL 3MLWL 3Q1EA 2XZCH 5CD3A 5I8KL 4DERA 4LLMA 4WNSA 3D85B 5KVDE 4NO2A 1LEIA 3SDXF 5CLWA 1T4KB 2DEXX 3AWFA 4XOBA 2YD2A 2EH7H 4OIIH 5JPNC 1N59A 1P7BA 2F2HA 4YE0A 2NW3A 5KJRH 1GZQB 4RIRB 1MCRA 1BIHA 1C5DA 2HJKA 1LO0H 3C8KA 3HN8A 2YUVA 2NY5H 3L48A 4UM9D 3KWXA 2BVOA 1C08A 3LHPH 4PWIA 3H1ZA 1LO5B 2WINA 5FO9B 4PJ9A 1JN6A 3AS1A 2CHWA 4QXTB 2DAVA 1LQSR 4XNYL 5EU6E 2R2EA 4YOKA 3CH1B 3HS0A 3KPPB 4NC1C 2DF3A 4ZAKA 2NXYB 5DZAA 3SKJL 4AV5A 2JIXD 2FH8A 1ZSDA 2OXGA 4MZIA 3WHE0 1ACYH 4MCZA 4YX2L 5J6SA 2VLJB 4WK2B 4Z18A 4G1MA 4W9LC 2XI9A 2OX5B 3TH3T 1MIEL 2R2BA 4C59B 1X5LA 4OV5A 5GGRA 1O9ZA 3QEGH 5GGTA 4TSCL 1E8YA 1QFWL 4OZFA 4K5MA 3MBEC 1UACL 3HE7B 5F1KC 3CFUA 4TUKL 3FQXB 3AVEA 2NT0A 1LE5A 5D7SL 1A6VL 2FX7H 3BGMB 3BI9X 5C2UB 3CDZB 3PWJB 4GG8A 4WU7B 5E2VH 1U21A 5JNYB 1CVSC 1RZ7L 4XHJC 4AIXA 5MP6H 4R2GC 4MKMA 4N2IA 3ECBB 2X70B 4AJWA 3W38A 4H8QA 2WKOA 4P5RA 3CIAA 5EZJB 2MEJB 4TNFA 1LK2A 1N18A 2OR9L 3CX5J 1A9EB 2HRGA 3OAWA 3UTQA 1D2OA 5LO7A 3ZZSA 1MCEA 3HG5A 3HLKA 2NNRA