4GSRA

Structural basis for the inhibition of mycobacterium tuberculosis l,d-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
263
structure length
263
Chain Sequence
SSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable conserved lipoprotein LPPS
publication title Structural basis for the inhibition of Mycobacterium tuberculosis L,D-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 70
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4gsrA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gsrA01
4LPQA 4LZHA 4QTFA 3VAEA 4A1IA 1ZATA 5DUJA 5E51A 4A52A 5DC2A 4GSRA 4QRBA 3U1QA 4ZFQA 4A1JA 4HUCA 3ZQDA 4A1KA 3ZG4A 5DVPA 4K73A 2HKLA 3VYPA 5E1GA 5DZPA 3ZGPA 5K69A 5E5LA 4GSUA 1Y7MA 3TURA 4QRAA 3VYOA 5D7HA 5LBGA 5DZJA 4JMXA 4JMNA 5DU7A 5E1IA 3U1PA 2MTZA 4HU2A 4QR7A 5LB1A 4Z7AA 4GSQA 3VYNA 4XVOA 5DCCA 3TX4A
chains in the Genus database with same CATH superfamily
2ZF9A 3NIFE 4A1IA 1NGXB 1TPXC 3PWUA 4MQ7B 4XNXH 5CNHA 4EQ3A 1ZHKA 4WUUB 4PJBF 3HI5H 1GIGH 3HC0B 5DRZA 2YFNA 1A7QL 2QVKA 1IBFA 5H35B 1M2VA 1MRFL 1SJHA 2GHZA 3PHQA 1DO5A 3SY0A 5F21B 4P8QA 1TIUA 1A3RL 5JXED 1WTGT 5TE7L 3BH8A 3ALWA 3ZSTA 2OMXB 1WFOA 4O4YL 2Y7QB 4D0BB 2P24B 4K7PX 4NUMA 2VN4A 3CFBB 5C0AB 4M93C 4K8RC 1KIPA 1V05A 3IRZA 1YPZB 4WY7L 1CXHA 3PFQA 4WNQB 3AMLA 4HWEL 4AL8H 1S7QA 1T0PB 4XP5L 4Y5YC 1DHKA 1C12B 5E9DE 4GKZA 1G7IA 2FATL 2W38A 4XOCA 1DVYA 1T5WB 4N6QA 4MD0A 2NQ3A 3DYPA 1L0YA 1N5YL 1J0YA 5IB5B 4ZX3A 5DHYA 3IPEA 3VNZA 1AG6A 3IN0A 2DQEL 1WISA 5CN3A 1HEJC 3FN0H 1WIPA 2CHXA 5FEBA 2O6FA 3S5LG 1MCJA 1FLRH 1UJ3C 4OCXH 4OFYA 4UANA 2Y1YA 3ZY7A 5FYKD 1EZVY 1F11B 1MIML 3OR6B 4A39A 4A7SA 3MRLA 1A3ZA 1ZT1A 2AF2A 2M83A 4QRUB 3TBWB 1FWXA 5DD0H 2BZCA 4OLVH 5ERWA 4BZYA 4CMHB 4B27A 3WJJA 3FKUS 4Q4IA 5D7EA 2CGRL 3SKNB 1JWUA 5E6IB 4RDQF 5EOCH 1MHCA 1PKQB 2BSRB 4AZ8B 1SVZA 1X5KA 5CHNB 1BLNB 2OM5A 2XFXB 4U1JA 5AL0A 3TL5A 3ZKSD 5J1TC 5EO1A 1NCBH 1DDHA 3NJVA 1TQVA 1RK7A 4ANVA 5GGUA 1WAAA 4N0YH 1DQKA 2K8MA 4KMQA 5IJKA 2NW3A 4Y1AD 1JXKA 3MOBL 3RZWA 3ZKXC 4F7MA 5IZ7A 4YGVB 1QFWI 3TA3B 5LGHL 3C8HA 1TMCB 3RVVD 3MKKA 3S0PA 3LQZA 4UT6L 3FSOA 1BIIA 3U2SB 3SO5A 4NCDA 5A6MA 2X89D 2NY7L 4ZAKB 4BK5C 3VXNA 4CJ1A 2VR3A 1I1YA 5LGJB 4HKBB 1U8JB 1S7XB 3EOAA 4DK3A 2BHYA 5T3XH 2V3DA 5SWZE 5C0NC 5JQIB 4AQ8A 1JGEA 2K4WA 2MQCA 2ZNWA 3KYOA 3NIFB 3MLZH 1TCRB 4FCAA 1MCOH 1SF5A 4JY5H 4YXHL 1LNUB 3CXHJ 4P5MA 2LTQB 4NQQA 1T2QL 2EH8L 3RAJH 5CEYB 4L0YA 1YSOA 5SX4I 1JF6A 2P28B 2ZSVB 2BOBA 3GHEL 1D5ZA 2XPYA 5HYJD 1XSOA 4KK9D 4KK5C 1ZKAA 2DN7A 4NN6C 3M86A 3QQDA 4N85A 3CV5A 1BOGA 4XZUB 3FQNA 3QT2A 4P2RD 5JW5A 4C57C 4YJZL 2CDEA 3U7WH 1TZHB 2VUOA 2B1HH 2W92A 5F44A 1PZ5A 1SLUA 1T2JA 3QUZB 1J8SA 2YAPA 4H8HA 3O6MH 1NSNL 1U8IA 1QOKA 4HLZG 1KTJA 1N26A 5SWQB 3ARFC 3BN3B 2B08A 3EUDA 4WGWB 4CGUB 5BW7A 2ZICA 2KH2B 3BAJA 1C7SA 4HJ0C 4YEFA 5ILTL 2K1MA 3DX8A 5E9DB 3FJTA 4A7VA 1U2HA 1WV7T 3B83A 4WENB 5C7XL 1N0XH 1U93A 2B15A 1G94A 2DQFB 3HE7D 2VLKD 2Z4TA 1V7NL 4FZEH 5I1LA 2X4OA 1EDHA 4RAHA 2QLYA 3OKOA 1MCHA 2D2OA 4X7TA 5T1MA 4XB3A 5JDSB 2XA8H 3BIAX 1LP9E 3OKEA 3MRMB 4QTFA 4UDTA 3QQ9C 3HE6D 2V7NB 3LX9A 2ITEA 4HC1A 3T8VA 4PJHE 5D7SL 5DR5H 3MFGB 3W39A 2Z92A 3A6BH 1B4JL 4D9RD 2X0VA 1V3MA 2NQCA 4JRYE 3L16A 3ARUA 1J9QA 2WO3B 3L8QA 3NOIA 2F08A 1LEIA 4GW1B 2MCG1 3ESPA 2KLRA 4Y4FA 2ZWSA 2FO8A 1KB9J 2ICCA 4HG4K 4ZD3H 1JWSA 2F6AA 5GGRA 5JOFA 4ORGA 3W11D 4AG4H 4H0HB 2NUPA 3OKKA 4QRSA 1WLHA 1Z9MA 2BWQA 2PNDA 2R8SH 5K9QI 3JYCA 2C9AA 3KJ6L 2QQLL 1YC7A 3MJ9H 1H9VA 4KXZH 4XVJL 3EYFB 4RMSA 1IM9B 3HR5B 2XKNA 4DW2H 2QV4A 1NDGB 1JK8B 4G42B 2QQNH 3BLPX 1SY6A 4XX1E 2AJVL 2VDQL 3O9WD 4L3FA 4UM8B 4F8LA 5ANME 4YHNA 3BUYB 3EBGA 1NPJA 2Y7SA 4XHQA 5I6MA 1ZVNA 1TJHH 1FVDA 4NWTH 2LLNA 1UM5H 4I3SH 3BVDB 3PWPA 4F7CA 2VDNH 2GJRA 1L0XA 3BIKB 4PLJC 3LRGA 3PHSA 3T65B 3TC9A 4M5ZL 4DERA 4JHBA 3SGKC 1GL4B 1RU9L 4EUPB 3O3DA 3Q01A 5SWZB 5GZOD 1FE8H 3V0IA 2NY3B 3DSFH 4CDGC 1LEGB 2WWMD 1J0ZA 2FD6L 3UTTD 5D93B 4M8RA 4R26L 1OM3H 2OMZB 1CLVA 4OY9A 4BINA 3MRJA 3Q7JA 4LPCA 3FRUB 1TTBA 5FA3A 2V2XA 1OP5H 3KVQA 2VERA 3LNDA 5D1QC 3B37A 3Q1SL 2HX9A 1JNNH 1KCKA 3TYFA 3KBHE 4ZZFA 3CLFH 1ZY9A 2WLIB 3NEXA 2PW2A 3BFWA 3MMEB 1RKRA 2WZPA 1KLFA 2AKRA 3QEHB 4U6VH 1QZ1A 1F97A 4YSEA 3U48A 1MI5A 1I3RB 3LN4A 2FEDD 5FYKH 1JGUL 2AEPL 1IO4C 1FGNL 3FFCA 4NM4H 3PWNA 4HSQA 3RVTD 1MLBA 2NZ9C 3PNWB 4L8SB 1GOGA 4O2FB 3FU8A 1L3NA 5DI8A 3HOGA 3RU8H 1BFOB 2GK2A 2F1BA 1MIEL 1EZVX 3BD3A 1GCYA 1OAZL 5FHAL 2N0MA 3MBEB 1JFQH 2BSSA 1MWAB 1LDPH 4OCYL 4KKBC 1QA9B 1ZATA 5CJ5A 3EO1B 3O2WL 4PJ9B 1LP9B 2F5AL 4NZTL 3Q6FA 5KAQF 4QRQA 1MH5A 3VD3A 5KANI 4J8RA 4PJHB 2WZ5A 1RJLB 2XNAB 5L4JA 1ZT4B 3UJJL 4IKNA 1VFUA 5IQMA 4JRYB 4LDLB 1QTSA 1NBZB 4TLUA 5CP7B 3MR9A 4LIQH 1J05A 1PBYA 5EV7A 4AK1A 2I32A 3OAUL 1OTTC 3UMNA 5K93A 3IDXH 4E5XG 4PJ8A 4QRRA 1E65A 3SE3C 4NZFA 2OCFD 2OL3H 4JG0H 1ZE3C 2IALA 4GSDL 1QI5A 1FFOB 1HSBA 4NQUA 5F96L 5GJSL 1HINH 4CGTA 3LVTA 2VQ4A 4NZJA 5BV7B 2R23B 2RIKA 3WGUB 3VGBA 1I85C 4EPSA 3ZN6A 2XWDA 3WTUA 2NNCA 2PTVA 5CZRA 4XB7A 4PJAA 3HLKA 2WNWA 3SD5A 1OPGH 4UB0L 1B6UA 4PV9B 1GSKA 5F7NC 3KGRA 1E3ZA 3AREB 1E6OH 2OTWA 4Y2OA 4U49A 3H3PH 3QA3A 4X5XA 3U82B 4FA8A 5ANMB 1CGWA 3RWCB 2DQGH 4JFOA 2BP0A 3VI4A 1MW2A 1ERNA 4LAQH 4W9EC 3MUJA 1NCCL 2OXGA 2AK4D 2DBLH 3TV8A 1A4JA 2IAMA 2R0KL 3KYNB 5A6IA 5KSAC 1I8LA 3OL2A 1CXIA 4OZ4A 4JM2B 5IMMA 3EYSL 4E68A 4H26A 2E9JA 4PJHF 1TUPA 1VGEH 4ZDHB 4IRJC 2DAVA 2FB4L 5D71H 2W81C 3VFVB 4A66A 1CF1A 3WDHA 5IHUL 1AQMA 4XCFH 4ONGH 4BFRA 1MHHB 2XETA 5MI0C 1ILSA 2PF6A 2E46A 3WFBH 5FKAB 5IV2B 3IPBA 5DVOA 4JJOA 4ODVL 5EF0A 5CD5C 5KVEE 4OQTH 4V11A 4HIXH 4TQHA 4ZPVA 3D69B 1GC1H 2BNRA 3ARBC 3QC6X 1U8NA 2QT6A 3HS0C 5FYLE 4DUXA 5I74B 3TJHD 3D0LA 3LTVA 2FSEB 5CSZA 4I89A 3LQAH 4GIOA 3EADA 2NDGA 3SDXE 3HBQA 5J6GB 2J88H 2DWEB 2AITA 1T83A 3BQVA 1EEUA 5GJTL 3QPQD 3U2JA 3SE8L 1MRDL 3UEQA 3VJ6B 4MJIE 1J86A 1DBKL 1DN2A 2J8UE 4BXSV 4LKXB 4P5KA 4LSRH 1GJWA 4WJ5B 4DF9A 4TVPL 1FO0H 2FQFA 4B9JA 2WNKA 3QUKA 4ZOAA 1QSFA 4F8PA 3ZJAA 4FNTA 2HLAA 2X40A 2G9KA 2DLIA 4O51B 3N06B 4YL4A 5AWNL 5KS9E 3ESUF 3CFUA 5FDWA 4WW2B 5EU6D 3GO1H 3BRFA 5FLUA 3TT1L 1KB9K 3LN5B 4JY6A 1XT5A 1SLXA 4LCWE 3GJFK 1M7IB 1RZ8B 4APQD 4QNPE 2YRPA 4G3YH 3RZCD 3NK4A 4HIPA 3C5ZD 3WLBA 1CICC 1IGJA 4TNVF 2I5YL 3QO1A 1T1ZA 2WVSA 4HIIA 2BNQD 3LV3A 2VXVH 3K6IA 3R0MA 3IJYA 2VSCA 1IL1B 1FFRA 2A0LD 5IT2H 1X5IA 2N4IA 5CD3A 1JUFB 1ZA3B 1JSYA 2FQGA 1H15B 3S36L 2HB0A 5GS3A 3V4PL 2KUTA 2F5BH 4IU3B 3D05A 4XBEH 4L4VD 3EDJA 2BC4B 3WEXA 1XGPB 3LJ3A 4A63A 1MDAA 3C09C 1YC8A 2WLHA 3TO4C 2V2TA 1I9JL 2QR0A 2IAND 3QDGE 5TE4H 5MEQB 3GMPB 4MAYD 4NRXA 2CMRL 1HSAB 2ICEB 2GCYA 4G9FD 3VRIA 4F2EA 2LQRA 2EIZB 4L9DA 1BVNT 1WE5A 4GEJA 3VFGH 2VQ1B 3BKJL 3DTXA 2OMUB 4MMYA 2X9YA 1A3QA 1KELL 4UM9D 4GAGL 3V52H 1CCZA 2VL5B 5CCKL 3EJYD 4NNPH 3VRJB 2DLFH 3D7PA 2B1AL 4HUKB 1SXNA 3QZOA 1HE7A 3GSRA 1G7PA 1T7VA 2TRYA 4MCYB 3SPVB 1UYWH 2WSKA 3T6XA 5FO9B 5FFOA 4CN6A 3RJOA 4FTVD 1NQBA 2XQBL 4AEEA 5IUSA 3EFDH 4LOVA 4G7RB 3GQFA 2O5YL 1AKJA 3QP3A 5D7JC 2VCOA 2KC0A 4TTDD 1DBBH 2B9BA 4B9CA 5C2BL 2OJZL 1OSYA 4OZFB 1DSFH 1AOHA 5I1CH 5GRZA 1FBIH 1KBGH 3H9SD 3OG6B 3RI5F 3VWJC 4RNRB 5D72H 4EI5C 1CFSB 4ZMZA 5K9KA 3FOMB 1F4HA 4R4ND 1W6LA 1NKRA 5CJOL 3C6LB 1C08A 4FQ1L 4A2MA 3UO1L 3SDXB 1N64H 5EBWB 3ULSB 3LKRA 4RGND 2X1QA 4M7LT 2BM3A 3T2NL 4QGYA 1A7NH 3DA0A 4MJIB 5CKGA 2J8UB 4G1MA 3TXAA 1XL4A 4PGCB 5JOEA 1A6UL 4D3CL 3VTTA 5HGAB 5IOPA 2DDQL 3UBXG 1XZ0A 4LCVA 3CFTA 4MQSB 1T89A 4PYHA 5GS1A 1BQ5A 4JO4H 4TSAL 2WMPA 5ADPL 5KS9B 4ZUSB 1RIUL 2HXAA 3IFLH 3LS5H 1NLDH 2GKIA 3LKOA 5AW4B 1EUUA 3MUUA 4UAOC 3ZL4L 1P1VA 4OM1L 1ZV5A 3L48A 4LCWB 4IMKA 3QIBA 4AM0Q 1UASA 3QJTB 4PSRA 4Q9QL 4NP4H 3Q13A 5D9SB 1F58H 1S9VB 1HIMH 2RA1A 3BN9D 3FU3A 4PJGF 3UFIA 2PMZA 5A3IC 5C0JB 2A6DA 1N10A 3OWEA 4PJXA 5JTWA 1PS3A 1UADC 3OC5A 4HOWA 4PRID 4XE0A 4PCKA 2F7RA 1UXLA 5K1JA 3GXPA 4IRSD 2H1PH 3MJ8B 4B5ZA 3QZBA 2ZD0A 1QAWA 4OZFH 1J9RA 4ZXBD 5CLTA 4S1RL 4MWFA 1J8HE 4GYBA 4XP1L 1D5MA 5C1MB 4FLOA 5F6IC 1V55B 3DGGA 4JJHA 1U8MB 2G5BA 5FYLH 3ZZ1A 1N3NA 5DD3L 1R6VA 1Z32X 5ISZD 1TYJA 3BH4A 2NNAB 1AZNA 4AQEB 1ZMYA 5INCB 4NO5B 2GJPA 1YDPA 2F8VA 2WANA 2JQMA 3DX7B 1IKOP 5EPMB 4G6FD 3KPNB 4Y16B 2KQMA 3V5KA 3AUVA 4OLEA 4Z3FA 3QZWG 3X13A 5E2TL 3I9AA 5DVPA 1TOXA 4RMWA 5D7LA 1A7QH 3HFMH 4LFHG 5EIIA 4R0LC 1A25A 3B9DA 1MRFH 3UAJA 3U1SL 3BHBA 1JYWA 3VWKC 3C2AL 1A3RH 4P2OB 5TE7H 1FA4A 2BVPB 3GFUA 4IEFA 4O4YH 1QP1A 4KTDL 2Z31D 5FB8B 1F1GA 4LPYA 1Q94B 2WWKO 3CFJA 5DJ6A 3P30H 4KQ3L 1JHTB 3LRSB 3MRQA 3B43A 4OZIE 4IBSA 3QHZL 4B95C 1F6AA 4YLCA 4N2FA 3VFRB 4HKZB 1KYDA 4WEEA 4WY7H 1P4UA 4HWEH 2HJFA 4XOAA 3BVNB 4XP5H 1QRKA 3GS0A 1LO4H 1BVKA 2AERT 1D5RA 4FZ8H 2NR6C 2FATH 3OGCB 4AWJC 4JAMB 5A16B 1D7BA 2VNCA 2IH1A 4O02B 2FX7L 3ZE0E 2BSTA 4R97B 4XXDB 4FTDA 4AYMC 5JQHC 4A04A 5L8LB 4S2SB 1XR8B 3TVMC 1N5YH 3SKOA 4LSSH 4F91B 4KNUA 5JORA 1GHFL 2GJZA 4N8UA 4ZQKA 2DQEH 2PETA 2WKOF 1AXSA 4OJFL 1F13A 4TLSA 3GXNA 1K4CB 2Y24A 2MPAL 1BBDL 2DI9A 2BIPA 4GXUM 3NCYP 2NPLX 1AGEA 3C8KB 2X2JA 1WTLA 5D1ZA 1HVXA 3L3GB 3CUPB 1MIMH 5BZDA 3MLUL 1EBAA 3GIVA 4PBXA 1E3XA 2B4CL 4BRVA 5DRXB 5JHLL 5MEND 5FO8B 2EACA 3D2TA 4FG0A 2VN7A 1Y6KR 1G9NC 3M17B 1F90L 3TYGL 3MC0A 3CDZB 5KOVC 4FMVA 2CGRH 2J43A 3ZVVA 2AP2A 4PYGA 5KG9B 3JTSA 3V4UH 4F15C 1O6VA 2K6WA 4HWUA 4BDVB 4JL1A 1QWHA 4AVJA 3GK8H 2DEXX 3CSBA 5IMOB 4DTGL 4W4NA 1YQVL 1HS6A 2Y3AA 4LPUA 1IAIL 3MXVL 3ZQ9A 3HAEH 4LPTA 1JK9B 4S1DC 1QI4A 3MOBH 5EO9B 1J8HB 5LGHH 3HG0A 4PY8J 4IHBA 3D18B 2YKLL 4UT6H 3QZMA 2YIHA 4Y9BA 3QWRD 2DYSB 4IRSB 3IETB 5F7KC 4NEHB 1QI3A 4MD4A 2FIKA 5ICZA 4ZXBB 1MF2H 4Q2ZB 4IDLA 4Z7QF 4M1GH 5BS0A 3JWNG 1NMCB 3PP3K 1FC1A 4YDIL 3B1TA 4LFHD 2AS5M 4PMEA 5EN3A 1CL7I 4L3EA 4YXHH 1RZKC 2C7UA 1K2DA 1AS8A 1EHLH 2AEQL 4MD5A 3RIFK 1T2QH 2EH8H 3VVVA 3IMTA 5HHOE 1E43A 2F8XC 1FNGA 1XB6A 2EINB 3CFDA 2NSMA 5H94B 5HYSG 4KXAA 3GHEH 4J1UB 4U4IA 3ZZLA 4XBGA 4CMMA 1G1OA 3DETC 3R06B 3UYPA 1C8QA 1OQXA 2PCPA 4JHVA 1NJ9A 4RQQA 4OZIB 2BX5A 1NSNH 3Q5YA 3GUTB 4CNIB 4YFEA 4BH7B 4LCUB 3WE1A 5GS2D 3MRIB 5ILTH 3W57A 5E94B 5C7XH 3DJ9A 3QAQA 1YVLA 3HPLB 5LG6A 4QHMB 3ZE0B 3F3HA 4AQ1A 4RSVA 1PNCA 4ZO8A 3QFDA 3CHSA 3K6NA 5EEVA 4WLCA 4PRAA 5DCCA 5IMKA 3CN1A 1Q9OA 1FYTD 1AGFB 1X5LA 3KJ4B 3OKDA 1S8DA 2OSXA 3GINA 4H1LB 4XNMA 1F5WA 1T1WA 1YUKB 2FBRA 3NCFB 3ARGC 5D7SH 2HMID 2DMKA 4ZQTA 1B4JH 4DEPB 1TXKA 4A7QA 5H37G 4XBPB 5HDBE 1SBSL 4ATTA 3DVFA 5DZJA 4M9OA 3ZT5A 3ET9F 1EQWA 1OB0A 3G5ZB 2VW7A 4MJ6A 1HOCB 4K0OA 4EN2A 3RDTD 1PG7L 1J5OL 5B3JE 5E2VL 4X8JA 1E8WA 2CALA 2DQIH 3SDDA 1RJYB 5I1GH 3BDYH 2AJZA 1AFVL 1FORL 3DO4A 4QO1A 4QTHA 3ZTJH 3KJ6H 1S78C 4L2YA 2QQLH 4XMWA 3EJZC 1BCIA 1KFAH 1DQJA 2C1PA 4TVPE 1MZZA 2JLLA 1MG3C 1NFIA 3FB6A 5MHSD 5K1NA 5FUCE 4AI7A 5J13C 4QIRA 2AJVH 2VDQH 3ROOA 5I6OA 1EXHA 4KHTL 3IM1A 2LVCA 3MFFB 4OCMC 4P2AA 4R3SB 3GIZL 4EZKA 1JWMB 3DO7B 3WO4C 4Y7MA 2V7HA 1WEJL 4PP1D 1EH9A 3T3PE 2EUWA 3IKCB 3L3KB 3NFPA 2ITCB 3AMKA 4M5ZH 1P69B 4W68A 2EYSA 1H3PH 2JB5H 3MNWA 4BZ1A 4EI6B 3PWVA 2G3NA 1RU9H 5ITFB 3VDCA 2WLYA 1GZHA 4H1LH 3S2AA 2FD6H 4GB9A 3G7TA 1DQQB 3CSYA 5C0DB 3UP6A 1S7RA 4R26H 1HL8A 2YOAA 1T0MB 1EJOL 3RTQB 4PJFA 1UA3A 3GEWB 5TH2B 4U1NB 1JTPA 3RUGE 3P4OA 1W0WA 4TLKA 4PIBA 5BQDA 3Q1SH 4N1CA 4BKLB 6PAZA 3MTRA 4Z7VA 4NRYB 3BGFC 5JPMB 3IDMB 2HT4D 3QQXA 3KWWA 2DYPB 4LOUC 3FYEB 1DR9A 4FKHA 4CVWA 4RGOL 1ZA6B 1JGUH 4JJ5B 1AQHA 1FGNH 4MNGA 1DCLA 5BMFL 3PABA 5LJYH 3KLDA 2RH0A 1QLFA 3V7MA 4QRTA 4LU5H 1XF5A 1GKOA 4NIKB 4JO5A 3ARQA 4L18A 3H85A 1UKTA 4PWFA 4KKCC 25C8L 4XNQA 5TDOA 4ANWA 5GS0L 1MIEH 4PLNC 5MP6H 1HOEA 3I74A 1OAZH 4HAKA 2RCSL 4NOBA 4ODXB 4PJ7F 5FHAH 1XCQA 4XVUD 2W5PA 3AQZA 3VRLF 2AC0A 1HHGA 3EFFB 3O2WH 3WFHB 2F5AH 4NZTH 5KSBE 1EDYA 4NXSA 1NCTA 5C9KA 2FDBP 2O4EA 4KH2A 1VDGA 2BIOA 3B7UX 3OKYA 4I13B 1P4BL 4PVMA 3HBPA 3VD2A 4K8RL 3UJJH 1C9SA 3BWAB 1AHMA 1BX2B 4HUVB 3GXIA 1Z66A 2PXYB 3UZEC 4L4JA 5HDBB 4D8OA 1OSZA 3OHXA 5IQ9A 4PR5A 4ES9A 1C5DB 1OSPL 2ZKXA 1OKEA 3BQUA 3FT4A 2Q6WB 4N87A 4HXBL 3MBWB 3LYRA 3BSGA 2E9IA 3RPIA 4GSDH 4V2BA 5KBPA 4TUOA 4Y4HC 2IH8A 5F96H 5GJSH 4HUWA 4X6BA 1L9NA 3HBZA 3PE9A 3H42L 3UTQB 4RISL 4F80A 1Z9LA 1GMIA 1FG2B 3PREA 1UZ8A 4UB0H 1KIQA 5FS5A 2X6VA 3V6OC 3EOBB 5JXAL 3RDTB 3FUJA 3ZMEA 1RZJC 3IFOA 3P4MA 5LAPA 2GBTA 1UATA 3ARDB 2EO1A 1F3DJ 4NAMA 2F2HA 1AIZA 1F8TH 2B16A 5HGGS 1AGCA 1KCLA 5DJDA 4AJWA 1A6TA 1NCCH 4F7PA 5I8EA 2HAZA 5GRVK 2R0KH 2OW7A 4IS6A 3QCVL 5K5YA 3K2IA 3T3PB 2YA2A 2XHNA 3QULB 4F24A 5E1GA 4FQHA 3EYSH 3CC5A 3L5XL 5C2UB 3PV7A 2AV7B 2Z8SA 3VXRE 5C09A 2EYRB 3CXDL 5IHUH 1EK3A 3FUMA 2GQHA 2QADC 4M5YL 5HDBF 4ATWA 1BXVA 3T4AA 3O6FA 1NCDL 3AROA 3CCHB 5T5FA 4LHUG 2DYRB 1SZNA 2GAZA 4Q52A 5FLVA 2ICES 4I77L 4PRPA 3RUGB 3K74B 4HHGA 5CZVH 5GSVA 5B3JF 1PLGL 5GRWA 3W81A 1NM9A 1V3KA 4UIKL 4OAWB 6TAAA 3QUGA 3O4OB 1NMAL 4Z7IA 4Q0XL 3E2HB 4JKMA 4N86A 3VXQA 3QEQE 5GJTH 2O5NA 1WGVA 3SE8H 4IGBC 3TN0C 1MRDH 1U3HD 2B3RA 2E7CA 4MZIA 4PHZA 5EH1A 1DBKH 1PQZB 2OYLA 1X5HA 1OF0A 4HBCH 2BPBA 2PPCA 2EABA 4AEHL 5ESVA 3TZVD 1DQLL 4FXKB 5HJ3A 4FNRA 5AWNH 1VJSA 3JVGA 1N67A 4DCQA 5LLIC 3C12A 4D8PA 3CHXA 1A6PA 2XWBB 5ID1B 5KSBB 1HEZB 4B50A 2B7DT 4K55A 3MRCB 2WXOA 4PCSA 2I5YH 2EIDA 4D7PA 3OHMB 3PAVA 1XX9C 4DGVL 4HMCA 4Y4KD 1RK1A 1N2RA 5EF1A 4AUJA 3QORD 1I1RA 3FC8A 1SYSB 5EU7E 2CIIA 1RZIA 3NCCB 1JN6A 5F7AA 4BQCA 4UILL 3V4PH 5A2AA 5E1HB 3T0EA 1RZFL 5EU4B 4DKDC 3ECWA 1U4EA 3AY2A 2GSIB 5TQ2H 4QKTA 1LE9B 2IFGA 4F7TB 1I9JH 2BZDA 2D7NA 3QBTB 2XN9A 2CMRH 4LB8A 5AW5B 4I9XA 2C4FU 5E8OB 2EC8A 2X38A 3IMVA 4GI8A 1CD8A 3QE5A 4R84A 4ZG1A 1KELH 4LXFA 4GAGH 4MA7L 3KYMB 3R0NA 5CCKH 1RL1A 1W80A 4EIZC 2B1AH 5JIQA 5HHQA 4KRLB 4DZ8B 4P0DA 3GXTA 2MOVA 3GC3A 4AYDC 3OB8A 4NFCA 1WIUA 1HHKA 4NKOB 3V55A 3S8FB 4PWJA 3UP1A 1NC4D 1NAKL 1EFXA 2E3VA 1FVCA 1KACB 2O5YH 1NGWA 3VXRB 3WKYA 1QSED 4LGSB 1IVLA 1B0GA 3ZRCC 3NJFA 1E27B 1P9MC 2KZ1B 1VEMA 2J12B 3L6FB 3M6DA 5C2BH 2XN0A 2OJZH 1BG9A 4X7EC 2GYSA 5T1DL 2XTSA 1RJZB 3E6HB 2FWLB 7FABL 5INDA 3QJHB 5AVXB 3WE6A 5DSCA 4WV1C 4ADGA 5CJOH 2FBOJ 4FQ1H 4A7GF 1JD9A 4HS6A 2APTA 3UJTL 5AYTA 3U7YL 2BHUA 2HTLC 2E9BA 3QEQB 5T3ZL 3T2NH 3MXWL 3G08A 2ARJA 2Z0BA 3BW9B 4WU5B 1D9KC 3OJDA 3SJVE 2AQ2A 4D3CH 5FUZH 1CD1A 2DDQH 1G6VK 3L3OC 1B0RB 1FC2D 4NQEA 5B38A 3IDUA 3CFIC 4TSAH 2MOGA 1RIUH 4ZSOE 1A6AB 1CE6A 2F68X 3A6CL 3I6GA 5HGHA 1IEAA 4PU2A 3IAPA 2KS0A 3ZL4H 2VLRD 4OM1H 4HLJA 4HWBA 4OLXL 5E8NA 2VDPL 1HH9B 4ISVA 2L7UA 1MXDA 3VTAA 4WHDA 4HEME 4RFOL 1TCMA 2V17L 1WICA 4X7SH 1TZAA 2XIBA 2LGNA 3IDJA 4MQTB 2Z6FA 1YHPA 2JIXD 4LL1A 5E5MB 2L04A 3CFMA 2VW4A 3EGXB 4PWHA 32C2A 3UZQA 3CN2A 1YEKH 4B9GA 2GIYA 3KPSA 4N68A 2HUEA 3NFNB 5EUOE 4LLQA 2NSQA 1A1OB 4Y1SA 5DS8A 4PRHD 4XP1H 3D2UD 5L4FA 3MTXA 2G9HA 1T5XB 2Y07L 3BIBX 4G8IB 1D6EB 1JI1A 4M8VA 3RNQB 2C3GA 2VSMB 2SODB 1MUJA 5DD3H 2IMMA 2D7PA 1YUHB 3UG5A 5IHHA 1E40A 3QFGA 2Y7MA 3VSVA 1MVFA 1SRDA 1C16B 2NY1C 4RAVA 1NLBH 1F4AA 1GGIL 1NFDA 1Q90A 2X7LA 4GKNB 4Z0XA 5GISL 3DARA 4Q6IC 5DWPA 5GSRB 4PJDA 4O2CA 5E2TH 1YEWA 1SEBB 3IFNH 2F18A 1KB5A 1UOLA 5L2JA 4QRPE 1LD9A 5LAXA 1SBBA 1W0VA 1M2OA 2QSQA 3KZ8A 4UMSA 2MFNA 4WTQA 3U1SH 4DP8X 5I28A 1T0NA 5F88B 3GLZA 3C2AH 5AAWC 4PJIF 4QXUH 1BG1A 4JGNA 3JBG7 2DKMA 5BQ7A 5J1SC 2GSGA 1H5BB 5DEJA 5C08E 5CO1A 4ZMWA 4JRXD 5HHXL 2F74A 4KTDH 3EYOA 5D1XE 3OG4B 3U4EB 3GBLA 2I9TB 4KQ3H 3CX5J 5ES4B 1BJMA 4AKPA 1XGQA 3QHZH 1VCBC 3U79A 3C08L 3A24A 4X6CE 1GGCL 1CLCA 1ES0A 3HHMA 1ED3B 2CWRA 3TO2B 1Y7VA 4U1SA 2ZSWB 4YHZH 5B4MC 3ARZA 2WBKA 4OSUH 4HSCX 1CD0A 2F54E 2HKAA 1HYSC 4JPIB 5C0BE 4YE0A 2FX7H 5D2NE 5KW9H 4OZHA 1RHHB 2EDKA 4G7VL 4ZOBA 1IAMA 5IVXE 1QMUA 4NN7C 1N59B 4IRZA 4GRMB 2IMNA 1GHFH 3K4DA 4V33A 2JKIS 3QUYA 3H53A 1M71A 1ORSB 3ZZQA 3OR7B 4KROC 4MLIA 3RX9A 3TJPA 3V6ZA 3QXVA 4HH9A 2K7PA 2QTEA 4OV6F 4UNUA 4GRLC 2MPAH 1BBDH 4LEOB 4N9GA 3WN5C 1H3GA 2H32A 3SJVB 1JZIA 4K73A 4JFQB 5GGSB 4Y5XA 5F9AC 1PY4A 1PTZA 1E5ZA 3G5YA 3F6JA 1ZXQA 3MLUH 3FQRB 3QYCA 1XAKA 1ACXA 3WENA 1JVOA 5JHLH 2FWUA 4ZSOB 5C0EA 2O26U 3IN2A 2KPNA 2WXHA 1CJYA 4YK4B 2E56A 2IFFL 4P06A 3H3BC 1F90H 3TYGH 3F01A 5FWQA 4B9PA 1GMEA 4UQIM 1IVTA 3QHTC 3SPJA 1U8QB 2H6UA 2WQAA 4JGMA 4JFUA 4WWKA 5B7EA 4OTXH 3UAFA 1SLVA 1A9VA 3C2SA 1SJEB 1WCQA 2DM4A 2ADYA 2Q76B 2HPTA 1OANA 5KSUB 4PJEE 4O5LH 2CPUA 5JIHA 1YQVH 4DTGH 2IIJA 3BLKA 3IB4A 1IAIH 3MXVH 3UTSD 4LMQE 5EUOB 1ZHBA 4XCYB 4ZX6A 3N91A 4YAQB 1D6VL 4FFTA 4MLSA 2NNXA 1R9FA 1R5IA 4KKRA 2YKLH 5DZVA 3QUXB 1GS7A 1BQSA 4KTEL 3DV6B 4U6HA 1KJMB 1LXMA 1IAOB 3OGOE 5AYUH 3UH8A 1TTUA 4NENB 3EH1A 1BVLB 4PRHB 1CFQA 2RMNA 1LLAA 3D2UB 4KO6A 4DKTA 4YDIH 3DJTA 2EKSA 2R29A 3BH9A 3JWDC 3RWHB 1WWWX 4DPCX 4PVBA 5C8JB 1ZRUA 1S3RA 3BZFB 5CEZL 1J8KA 4C4KO 2F8OA 5EN2A 2AEQH 4QRPB 3DMMB 5T8IA 4MX7A 4ZUUA 3COOA 3MRNB 4PHXA 3T0XA 3OD3A 1WA0X 2PW1A 2QDWA 3GMQB 3STZB 4M62L 4QKXB 2A3TA 3CSPA 5C08B 1G6RL 1NWOA 4GAJL 4LP4A 5D1XB 5T1KB 2J8HA 1BOYA 4OH2A 4LKCA 4UTAL 3MSPA 3F7KA 4NQSB 2AQ3A 4POYA 2LE9A 4X6CB 1DLHB 3VXUE 5F0MB 4AVKA 3MROB 1E9QA 4W9CC 5ALCH 5L2KA 3UZVA 2JQZA 5IM7A 3QNXA 4YHLL 2QZQA 3EXLA 2F54B 2YJLA 4AV5A 5C0BB 2GJ6A 5D2NB 1T22A 1OGAA 5IVXB 1TF4A 3AY4A 5D4IA 1GGYA 2E6PA 2HJLA 3QRGL 4JB9L 4QWWD 3VB8A 1OP4A 1VFBA 3APNA 3FCTB 1W8OA 1KXQE 4FKKA 2CUAA 4G8GE 5G4NA 2Z91A 3SCMA 1EZUA 1DJIA 5B39B 1MRCL 2W0FB 3WTXA 3MV7D 3L5WA 1I1FB 1Z3RA 1MCFA 3BSZH 2NW2A 3MLVL 4P23A 1SXCA 5C0ND 3WO3B 1YYCA 2JLPA 3THMH 1WFIA 1BVOA 4TNWK 4W1TA 1T3FB 2EDRA 2OPCA 4JREB 3J27A 1J5OH 4JPVL 1KTLA 4F9PC 5E2VH 3EGSA 4HDIB 4KDWA 3BAYA 2BLFA 1LWJA 1AFVH 1FORH 5I16A 2WUCH 1DVQA 1BZOA 3MV7E 4KVCH 1T7ZA 3LEVL 3H9HB 3HZVB 1DJGA 4JFPB 2PWFA 3MO1B 2HFTA 1T7XA 4PJEB 5E4AA 1JG9A 4JMXA 2UXTA 2P7TA 4TULL 3TBVA 5HYQB 3I6LD 3OWRA 1UQSA 3GIZH 3VFOB 3KNBA 4ZOCA 5DMGC 5C3TA 4FQXC 3IAQA 1PYWB 2RACA 3ARFD 4PJBA 1ID5I 3VAEA 3I9IA 3GJEA 1WEJH 1XGTA 5IVXF 4G6KL 4QF1A 1O7DC 4GAFB 4X6DE 3ZR6A 3CMGA 1BFTA 3F04A 1AHKA 1Z7JA 5GRJL 3UTSB 3DYMA 1GCFA 5LN4A 4W9IC 1KPRA 3WUZA 1HCZA 4KXZI 5CJBA 2H47C 2J6EA 1NGYB 2VWEC 4KTGA 2NT0A 2Y5TA 4L2LA 2VQTA 5I2IB 1HJCA 4HFWB 1FZMA 4NP9A 3CX5K 3IRPX 4ZUTA 4Y2DC 4XVTL 2PWGA 1TQCC 3L5IA 4AOFA 1CGUA 5I1AA 1EJOH 3I50L 2OULB 2P5WD 3NA4A 2ATPA 5JA8B 1HHJA 1FFPA 5IY5B 3DXAA 5HPMB 2VZOA 3HRZC 2K78A 5BRZE 3VQLA 5CM1A 4S1QH 3KPRE 2VZSA 1FZOB 1RZQA 5E6RB 4LLUA 5ID0B 4ZMAT 1ONQB 5C6TL 1EA9C 1I9RL 1J1OL 2WXIA 3LKQB 3OAYK 4RGOH 2BHFA 2XYCA 4ZFOB 4AIZA 2P5WE 5IROC 5J89A 4PJEF 3CZFA 5BMFH 3MV9E 4WSKA 1UJ3B 1KXHA 5DQJA 3VXUB 3FFDA 1JYVA 3FTWA 3QQ3B 3PRZA 4GBXD 3Q48A 4J6RL 3QG6A 1BF2A 4MDRA 3QSKB 3L17A 3CPUA 4UOW1 2DRUA 25C8H 3IDIB 1O6SA 1TVHA 4WUUA 1KYFA 4K3HA 3DO3A 2RCSH 5I15H 4TV3A 3Q8EA 5I6XC 3FQUA 4LRIC 3T08A 3VM5A 4JGJA 2PPEA 1OHQA 4QXTB 1XGUB 4LSDA 2BMKB 3REVB 1BQKA 4CBPA 2Z1KA 1P4BH 2JCCF 1CFBA 4XH2A 4K8RH 4PLJD 1OCCB 5C0AA 3PP3H 4XNAA 2HJKB 3QZNA 3N42B 4G8GB 3MV11 3RIFF 4WZ9A 1TQBB 1JXJA 2VXTL 2X6AA 3K0WA 4AENB 5T3ZD 5D2LE 2NXZC 3RB7A 2OW6A 1MHEB 1OSPH 1SDYA 2G3MA 4LSQL 4MA3B 2BIHA 1B9KA 4IQHA 1C12A 3ORJA 4LNRB 4HXBH 1T5WA 3ESMA 3R7RA 5J6SA 2RBLA 4JNXA 3LIZA 3V5HA 3NSYA 3AFLA 3H0TA 4P2QE 3FFOA 4WO4D 4ZMYA 2X2HA 2VLLA 3MV7B 5IB5A 4IMLA 3CSFA 2VMFA 4RISH 3SQBA 3FO9A 3KLHD 1G7MB 2B3IA 1L7IL 3GSWB 5JXAH 1JGLL 5CILL 1A7PH 3U4BL 1P7QA 4U1MB 2ILLA 3L7EB 4G9DB 5D1QE 5F9WC 4BRJA 1JNHB 3CAFA 2NZ9D 3MV8D 4F5CA 5B3NA 5EU3A 1E4XL 1VA9A 9CGTA 1SHSA 4Y8AA 1G9NL 3P4LA 3SBRA 4QRUA 3MRHB 4NN6B 4LCCC 3OSKA 3QCVH 4NYLB 4X6DB 1YMMA 5E2WH 5J11C 3L5XH 3PJNA 3EDDA 3RJDA 2XZCL 3I84A 4AZ8A 5KSVB 1PKQA 1MAKA 2BSRA 4KKBD 4YBLC 3N42F 2HT2C 8FABB 2HFFA 2EE0A 1MCWW 1N8ZA 1QBBA 1BLNA 1EWHA 4M5YH 3RWFB 3S5LB 3LHPL 2EDWA 4ZMLA 2ZG1A 4NKDB 1J0JA 5E9AA 4I77H 2ZX9A 4KI5E 1BMGA 2PUQT 2Q10A 1ZLUK 3EBHA 1PD6A 4M56A 4FNLL 5BRZB 5C97A 3S37L 3UO8B 1R47A 3ZKNC 2EDDA 1NMAH 3KPRB 1FAKT 2CO3A 2ARWA 3U2SA 1NICA 5D5ME 3KHOA 2P5WB 3F7VA 3CFEB 1M05A 3PQYA 1BBJA 4G59C 1P5UA 7CGTA 3O6KL 3CVIL 3KD4A 3AQYA 1RZKL 1DQLH 1FNSL 4QOKE 1BLIA 3A4FA 1UXMA 4YE4L 1DCEA 3QI9A 4F2FA 1EANA 4YN3A 4K7PH 2PTTB 4L4TD 1JRHL 2JF1A 3WJJC 1UTDA 5IB2B 4XN2A 4PMFA 1WUZA 3EYUL 1BJ1J 2ZSVA 3G3LA 1KPVB 2O5ZL 1KJ3L 3FBQA 5J4MA 4FNSA 2VLJD 2ICWJ 4ZO6A 1L5GB 2P9RA 2OZ4H 4ABUA 5KSAD 3T71A 1OF2B 4FXLA 1S7TA 2IOMA 3QUZA 4QLWA 2QVFB 5IIEB 3I75A 5EDXA 2QFRA 4IRJD 4W9KC 1W72B 5D2LB 5JXEA 1X7QA 2IGFL 3VXSD 4G1EA 3HZKB 3MJ7B 2H26A 2X4SA 4GXUN 4X0KA 4UILH 5IEHB 5CD5D 3SGEH 3O6LL 4CADA 1XF1A 4XVSL 5HYFA 2BJML 3B56A 4P2QB 1ETJA 1OQOA 1KWKA 4MKMA 1AZUA 8PAZA 4X5LA 4YLQT 1XIWB 3ARBD 1KENL 4H40A 4QEGA 1FAIH 1DJSA 1DL7L 3D12B 3KW8A 4KJWC 5JHDE 5F3BB 5LWYL 2OTUA 3L4UA 2ZOKB 1YECH 1YYML 5FYJD 1CLOH 3IJHB 5AW0B 3UAAA 1T7YA 4IOIB 4EKXA 5HVHC 4RA0C 4MA7H 4MXVF 2YUWA 5D1QB 3VDBA 3CIQA 4GP8B 4PJ5D 2AMGA 3NBNA 3Q6GL 2VDPB 4TNEA 5ELIA 3EDFA 4NQCD 4FAAB 2JJUA 3CVHB 5AW1B 4EDWL 1RLWA 1NAKH 3LD8C 5IQ7L 4YO0B 2X44D 4QY8B 5LVEA 4AK2A 2D73A 1ZWIA 3AQXA 4PJ5E 4X2UA 3PP4L 3EYFA 1H3UA 3OZLA 5D2LF 2H5UA 2ENSA 1N6UA 4D7BA 1F3RB 2I07A 1CICD 1HCYA 1S7WB 3VW3L 5T1DH 1U8PA 4XN7A 7FABH 4I18A 3QGVA 2YO3A 1BXXA 5CEZD 1BAFL 5MERA 1R3IL 1CTOA 1VGKA 2XJKA 5IKCB 1FNLA 2H3NB 5CLXA 3UJTH 3WY1A 3B1UA 3U7YH 3BIKA 5JNYB 1UT1A 4CILA 5D5MB 2XWRA 5T3ZH 1JAEA 3MXWH 4MMZA 3BPLB 4PV1C 2FHBA 4WSJA 4Y1AA 4UIMB 1AJ7L 5IQOA 1V54B 1LEGA 3TO4D 4Q8BA 4UWQB 4QOKB 3MZGB 2QLVB 5T1LD 1X7TA 5AOIA 3QWQB 3LH2L 3STLA 2X89A 3FU7B 3QZLA 1QPXA 2VXSL 3A6CH 3T8MA 1F4XL 2OL3A 3AG1B 2ITDB 2BP5M 2P8PA 1A1NB 3VFTA 4OLXH 2H9GB 2VDPH 3EFOA 1MXGA 4JVWA 1HN1A 3MCKB 4N5EC 5EC2A 3MMEA 2CA3A 2PPFA 3DUUB 4PREA 2V17H 4RFOH 1FNEA 4WDIA 3MKGA 4AT6B 2BZ7A 1I3RA 4N5UA 3TPUB 3C75A 3FPYA 4M1DL 1IEHA 4LLDA 4ZS6C 3RVXC 4K9EC 2P5ED 3NSFA 4XAKD 2WZ0A 5J7CC 5HYJA 3TESA 2DF3A 4LSTH 3P3YA 3DPDA 1QLEB 1BFOA 3EHBB 5C07E 1QEWB 2P1YA 4P2RA 1PCXA 5KSAB 1FH5L 2X4RA 3DVGB 4QMEA 1DQML 2Y07H 1TEGA 3IU4L 4GPVA 3NJGA 3FO1A 2E5EA 1QA9A 4NGHL 3SE4A 3VWJD 1ZLEA 3BZ4B 3V9EA 5L9DL 2Z65C 1K8DB 1D2PA 3HS9A 4HKXA 4LLYA 4P5TB 3WS3B 1GGIH 5IVZA 5JHDB 5G2NA 1RQ5A 1UB6A 2EDJA 5TE6L 3LXUX 4UOQA 2UY6A 1VACB 3HE7A 1OZUA 2VLKA 4JANA 4RIRB 1NZRA 3A3YB 4K7FB 5JPNB 4OQTA 2C4XA 4WF7A 1BVZA 1FL6B 3ARBB 3FUFA 1N68A 3HS0B 3S8GB 2FECI 4ZFFB 1U95B 3HE6A 2OFQA 1OW0A 4PG9B 4OFVA 1J0IA 1ZE3H 1Q72L 3DUHA 4JN1L 1KTKE 4NQXB 3HI6L 3POCA 3WMQA 2IBZY 3SZ6A 1Q0XL 3ROLB 3O45A 3D06A 5HHXH 1LO5A 5TQ0L 3BUDA 1ITCA 2DMBA 5ACZB 1MFUA 1ZHNA 2WQ8A 4PJ5B 4AQAB 1G0YR 2JH2A 4HWNA 1QASA 4GQQA 2YZ1A 4N24A 1RZJL 1GGCH 4EN3B 2OA9A 5TPWL 1FO0A 3X12A 5A3ID 4M48H 3NABL 1MW3A 4UQEA 2O72A 4N90D 2O6EA 5K9QG 1P5VA 1A4KB 5ANMA 5DT1L 2LHAA 2NXYB 1SYVB 4OGAC 3BUIA 2CK0L 3L1EA 4G7VH 5I19L 1R34A 2B0SL 1BZQK 5G5DB 3FPXA 5I75B 2I7OA 5E6IC 3O9WA 4ZDHA 1E5BA 1M42A 2PO6B 1RSFA 4HP5A 4PP2B 4D0DA 3O41A 4X8GA 2IADB 3C5JA 1WA2X 3OX8B 4GLRH 4M8QB 5CCJA 1INEL 1CLZL 5DK0B 3LKSA 3VFNB 5IV2A 2E47A 2Y7NA 3GMMA 4PJ8C 3CVCA 4RGMB 4TPRL 3ZMNA 2D0FA 4KUCD 3PGFL 5IHZA 5DVKA 2IFFH 3A4AA 3AWGA 4HU2A 5JZ7D 5IBLD 3BZEB 3P3TA 3TA3C 2BSED 4OZGE 5TDNB 1G6RB 1ROCA 2J71A 3H2QA 2YD3A 5FCUH 4NPKA 2ATKB 4LHQB 1BZEA 1BYOA 5FM5M 2JJSC 4BELD 3I85A 3ULVD 1QEXA 4ZAKC 4Z76B 4Z5RA 1MW1A 3ES6A 2ORBL 5DGRA 1RUML 2WSDA 2RALA 2G0KA 3W38A 2LU4A 5I76B 3U0TB 5C07B 3ZW3A 4BBWA 1FDLL 1J5CA 2IAMC 3KVPA 3KXFE 4RBPK 4WRLA 4MJ4A 3WKML 1WT5A 1D6VH 3BT2H 1R3HA 2DI8A 2LTQC 4O51A 1UH3A 3ZX1A 2P44B 4I0CC 2JTYA 2ZXWB 1HAUA 1VFAA 4KTEH 1IEBB 2YC1A 3F6LA 5LNDA 2NR6D 1TLKA 3O4LE 3CH1A 5DHVA 5HI4D 4XNBA 1JZ3A 3Q05A 5IB1A 2P42B 2WVVB 5D7JB 3CSGA 2JNZA 3D25A 5GGTL 1WHOA 3FZUD 1NAMH 3TVMD 3NSJA 4N2MA 4UTBH 5CEZH 4U6XB 3LQMA 5AB2A 3WKNA 1JV5B 2JV6A 4RWHA 1X5MA 4EI5B 5HHPB 1YMHB 2HRGA 3NTCL 1TMQA 2PCFB 5AVVB 3F7YA 3BVXA 2YSSB 2XXMB 1JUFA 1NOAA 1ZA3A 5AW8B 5KANG 3LN9A 3A5VA 4JHUA 3P3SA 2EE6A 4GQZA 2BC4A 1OCZB 1EJFA 4WWPA 3WJLA 1W9XA 4XODA 2QZ5A 3N44F 3N9GL 4UTAH 4IIQA 1E2VA 5IUCA 3Q9PA 1MCPL 1VRSA 2IPKB 4GI9A 3GMPA 5MEQA 4NWUL 1TTFA 4WGKA 4NNXB 2FE0A 4CKVX 4HZAA 1XH3A 3HG1E 3PGDB 4J7RA 5E4IA 1PSKL 3EF4A 1F4YL 4YHLH 5I17B 4JO3L 1F3DH 5AAPA 1DUZA 3MLTB 4XVOA 5BXFA 1CQYA 1HHHB 5H2BB 1AR1D 4QHKJ 2JXMA 3BE1L 2Y06L 1JPTL 3L9RB 4L48A 4MCYA 1G7JA 3NSDA 3QRGH 4JB9H 4WTZA 1K4DB 4ZNEA 5F89A 2FYYA 4OUOA 2PPAA 4OUUA 4UQ2B 1WAPA 3C60C 2W0LA 1MCQA 3L45A 3W0WD 1DDTA 4WCYL 1ORQA 4PJGA 4JG5A 4DGIL 2AK4A 1IGCL 2VAAA 4KV5E 4ONHB 1MRCH 2J20A 3MLWL 2VABA 5A1AA 4ELMA 3MVSA 1QQDA 5PCYA 3K6SB 4BD4A 3HBGA 3JWOC 2VTFA 1ETZA 3MLVH 4DZBB 2UUDK 2VL4A 4O9HH 4OF3A 4BQBA 4CC1A 4RNRA 1I4FB 4F1SA 3OMIB 2EO9A 5FOBB 5C0FB 3BP6B 4JPVH 4OZGB 4XPAL 1T6BX 2AJXL 4HQQL 2ZUUA 3FTSA 2EDOA 2F19L 3TCXA 4HFUL 2VH5H 5AZ2L 5DTFA 3D4ZA 4G8EA 3LEVH 5I9QB 4NO0B 1QBAA 3HI1B 3IE9A 4KAQH 5I0DA 2XG5B 2A4EA 1PNDA 4WQOA 3DETD 4GXVL 1U2CA 4ZUVA 5CLZA 2NY3C 4HCFA 1E8YA 4I2XA 4TULH 1AZRA 5D93C 2QQKH 1Y18B 3FQXA 4R0LB 1MWOA 3EBIA 1TNNA 4WKZB 3TX4A 3X14B 1WCBA 3KXFB 1AD0A 4DK5A 1D5IL 3VWKB 4W70A 1EBPA 1NBCA 3SYAA 1ND0A 3KPLB 4G6KH 4AMKL 5CIPH 1BIHA 2X1WL 3O4LB 3V5DB 1T6WA 2VAJA 3B3BA 4OB5L 5GRJH 4AVIA 2FX8L 2MQ3A 2IBZX 2QVMA 4MDIB 2QHRL 2DWYA 4L37B 4FADA 1NC2D 5EIIG 5EBLA 2EYTB 5CBAB 3QS2A 3VXPB 2W65A 4OF0A 4PJCE 3OSVA 3V10A 3ZTDC 5LB1A 1K5WA 2C3XA 5EU6A 3KS0J 4XVTH 3UBXB 1QSVA 5BVJB 4NQVB 5FCSH 3MJ8A 3I50H 3ARGD 5AOKA 4X83A 2XV0A 1QYGL 4APQA 4MQXC 3RZCA 1XDTT 3U9PH 3C5ZA 3X1NA 4OZGF 2XVGA 1SFHA 3RWEA 3MBEC 3RX5A 2CBTA 4IW4C 5SWSE 3US0A 2BNQA 3DJSA 5C6TH 3U0PB 1I9RH 1J1OH 5HJGA 4KUCF 2KT6A 4PJ9C 4BSWB 2OCCB 5T5NF 1OAQL 4AQEA 1R24A 3QQNA 2ADIB 3MYJA 4OLWL 2ZJSL 2WKOA 3BPCB 3FU5A 1EAQA 3DX7A 4S10A 1S78D 2EZ0C 3KPNA 4J6RH 4Y16A 4Y8DC 5GS1C 1IQDB 4OJYA 3BOVA 3E8UH 3HG1B 1ZD6A 4KRNA 2DTSA 4L4VA 3DK2A 2C9PA 4WHYG 4WFGD 1TFHA 5I1DB 4WFEE 4IMKC 3VU1A 3GGWB 3NZHL 2OYKA 3V0HA 5C71A 1YN6A 3FQ4A 4NKMA 1XCTA 4G9FA 1OB1B 3HKFA 4K5OA 2CLZA 4UNVA 2BVPA 1UVQA 3WL9B 43CAA 1H8OA 1C8PA 4UM9A 4L8CB 5BV7C 2DMCA 5DHMC 1Q0YL 2I9LB 2BVOB 3JWNE 1HXMB 3SDAD 4B60A 1TITA 3QAZC 4JN2A 3DIVA 2ZX5A 5F3HA 2VXTH 4XCNB 3G6JE 3LKPA 4A2GA 3QZWB 3HAEA 3AREC 4FTVA 4LSQH 1JHKL 2YAMA 3OGCA 4MB4A 4JAMA 4UT6A 1ZJBA 2F53E 4AE1A 4XXDA 1M1XB 5IR1A 3FB8A 4UOZA 1BREA 2BH0A 4PH8A 1UA6L 4X6EA 4XPGL 3C6SB 4JM2C 2B14A 3SYPA 3X1BA 2DICA 1AD9B 3H9SA 2I85A 1TLMA 1L7IH 4ZW7A 2EDEA 1X5JA 1JGLH 4W4OC 5CILH 4P4RB 3T8XB 3U9WA 5IB3A 3C8KA 1EEZB 2XWEA 5DK2A 1U8CA 4TM9A 4ZODA 3U1QA 3L3GA 3ME0B 3CUPA 3ZL2A 5ADOL 4MRCA 3CDGA 4GG6E 1JS4A 4B41A 1E4XH 3GM8A 1G9NH 1XD0A 2CO4A 3BYTA 2Y72A 3C5XA 2GUOA 2V3FA 5JLZB 2AXJA 1FL5B 5DEFB 4KKCD 5I74C 1UOKA 3AB0B 1WZLA 5HYIA 4J3OC 2R0WL 2Y7LA 3UAJD 2XZCH 4PD4K 4L3CB 5BOJA 2OX5B 4OFDA 1FGVH 5DMKB 1KTRL 1EVTC 4KXCA 4Q89A 4PJCB 3ZQWA 2APXA 3K2KA 1XBRA 4WWOA 4JFXB 4H13C 1A9EA 1WBYB 1OLZA 1IGTB 2OMTB 5D7IA 2O5XL 1QW9A 3AZUA 3ZDZE 4FNLH 3S37H 3D18A 3GMRB 1D3CA 5SWSB 3VUAA 4WW2C 4PRIA 1WFNA 4M61B 1PZAA 3QJSB 5FGRA 4YHYC 4WI8A 4IRSA 3NAAH 4M4RA 5EULV 5EWIL 3ZHDA 3IETA 3O3AB 1W15A 1BECA 3MAWA 4UQCA 4KO5A 3QCTL 3IRCA 3ZHFA 4Q56A 4ZXBA 2EVHA 5D1ZC 4NN5B 4Q2ZA 4Y4HD 3O6KH 1CGTA 3CVIH 3D08A 3JWDL 4P48A 1NGZA 3T6VA 1RZKH 1OV8A 1W0YT 3IJ8A 2YWZA 2BS8A 3DX9B 1CT8A 1GJIA 2APFA 4PAZA 1JMZA 5ISZA 4RESB 4BYHA 3VO0A 1JRHH 2JJWA 4IKKA 3W3BA 1KN4L 1L9SA 2W94A 2FR4A 3DVIA 3QFJE 4YS4A 3EYUH 3QPXL 5DQDL 4ZMPA 3GZQA 3MOQA 2O5ZH 3QXUA 2HG5B 4J1UA 3MRKB 5D6CA 1FH2A 4R4BA 1YEDA 4YUEL 2MTAA 5IG7B 2VN6A 3LDBC 3D34A 1JDCA 4PJCF 5AAMC 1CB4A 5J13B 3AS1A 3E0GA 3NJHA 5I1JL 4CW1B 3QJOA 5EZJA 3G6JB 2QL1A 2Z93B 4XNZB 2A74B 2ZCZA 2YEZB 3F12B 2IGFH 3MRIA 2YRLA 5E94A 1O7VA 3GS4A 2Z31A 4K94C 1PPIA 1QZNA 2OYPA 4QHMA 5C0RL 2F53B 1A9BB 3KPMB 2E4TA 3O6LH 1RHFA 4QLRA 3SDCB 5HYSB 1T1XA 4XVSH 2BJMH 1V10A 2UZPA 3FDWA 5B8CB 2Q2EB 4KJYA 4XMZA 4MSWA 3OAYH 3PCYA 4LP8A 1XVSA 4G8FA 1KENH 4YH6A 1YEGL 3N0PB 1N18A 3MCLL 1RIVL 4H1LA 5LWYH 2P48B 2VXQH 5DRNA 3LZLA 1YYMH 2MCAA 2C3HA 1MSPA 4BA0A 2YLKA 2B8OT 2FJUB 3RFZB 4IGBD 3PHOB 4GG6B 2ESVD 4HETA 3AAZB 4AMWA 1T20A 3BGFB 2DIEA 3W9DB 2Z35A 4MCMA 5E95B 5FV1L 3G5ZA 1HOCA 2P3YA 3Q6GH 4QJ4B 1LE5B 3SOTA 2D9QB 3C6LC 1IAKB 3OZ9L 3GBEA 4MGXA 2EVFA 1JZFA 1N4XL 4J3XA 5GGVL 3ILPA 4EDWH 3ILDA 1MFNA 1WHPA 3P1VA 2BNUA 2QPEB 3N2JA 4H44C 1J11A 3MLRL 5IJBC 2FQEA 3PP4H 5JO5B 1M6OB 2WZAA 3N04A 1A8ZA 1AH1A 3VW3H 5L8KB 5EIVA 2O93L 1IT9L 4YXLL 1XF2A 3MFFA 2MTPA 3ZDZB 3B2UC 1BAFH 4X4ME 4L5FE 1OE3A 1R3IH 4JFTA 4X98B 1ZLWH 3ZZSA 4JQXA 1XD1A 5ICYA 4PJ7A 1GPOL 1Q1JL 3N43B 4U1HB 1G4MA 1CC3A 3IKCA 1Q9WB 2ZG3A 4YR6A 1S5IH 4DAGH 4DP6X 2IDSA 1CI3M 4NO3B 2CLVB 1AJ7H 2YPKB 5ITFA 3DROB 3WTTA 4MJ5B 5IREA 2OSLA 1DQQA 1QATA 2OP4L 4NO2B 2FJHB 5E8DL 5C0DA 3K80A 2WQRA 2ZCLL 3QWRA 3LH2H 4ZUWB 1JPFB 4KDTA 3RTQA 2Q1EA 1U92A 2VXSH 1F4XH 3VFSB 3QFJB 3WNOA 1KEGL 1E50A 4U3SA 4CSZA 3GSNB 3VSUA 5JPMA 3IDMA 2WTOA 3GBNL 1SVCP 4DKEL 3KDPB 4M1DH 4MNQD 1PZBA 4DUVA 5ECJE 3S3CB 3Q5TA 3QWOA 1HNYA 3D6GA 2NYYC 4OVVA 3R19A 4NOFA 1AGDB 4XRCB 4ZS7H 3C9NA 2M26A 2BWDA 3DDFA 4ONOA 4YNYB 5H8DA 1T04A 4HGMA 1ADQL 3L95A 2UZYB 1WYJA 1TJGL 2GBAA 3BAWA 4ZFZA 3CG8A 3TBYB 1DQMH 4NPYA 1I7ZA 3IU4H 2YPLE 3KLAB 3LRMA 4WU7B 1MAML 3EJQA 4HOZA 1HXKA 4NGHH 2NNFA 1CGSH 4NRZB 5C0CD 3ATFA 2NCMA 2WO4A 4P2OC 3RGVB 2QADB 3F58L 5IHBA 2FO4B 1JD7A 5TE6H 4DOHE 4EDXB 1LQSR 2DB8A 4AGOA 4I0PC 2EDNA 2MNJB 4HUVA 2PXYA 3F00A 2YQBA 4Q9CA 5C0CE 1OCWH 2V3EA 2W07B 3K3QA 1FYTA 1D9KD 2A9BA 3GJFB 4KKLD 3DI3B 4DO5A 4BSVB 5JIMA 1U8OB 2CJ3A 4GUOA 4LCIL 1SJVA 1IGMH 2HVJA 3CU1A 4KUZL 1Q72H 4JN1H 1H0DA 5HGBB 3HI6H 1I7UB 3HG4A 2BCMA 4F92B 1Q0XH 3KLKA 1U8LA 5DUBB 4TRPH 5TQ0H 3TN0B 2Z4QB 1RY7B 3DWTA 1NGQL 2R2EA 3O8XB 2J6WA 4E41E 2YRZA 2UXVA 3GRWL 2FWOA 1RZJH 3G5VB 5J06A 4LARL 4XCCL 1B2YA 4F33B 3FCSB 3ALPA 5TPWH 3RDTA 4P9ML 3NABH 2EDMA 1JPST 4BZ2L 4YDLC 5DD1H 4Y9GA 5EUKB 5AKRA 5DT1H 5BO1L 3TV3H 5TFSL 1RURL 3X2QB 3FUNA 1CFMA 3MU3A 1VKXA 4NT6B 4KZDL 2B0SH 2X6MA 4OLZL 1H3VA 4Z78B 3LH8A 4OIBA 4KBPA 1QUNB 4PI0A 1SM3L 3D8MA 3UYRL 3GRGA 5K59E 3LPOA 3PL6B 1A6ZB 4ZO9A 1KYUA 4KU1A 4OV5B 3FQ2A 1PJWA 2IVFC 1KCBA 5EFIB 5C86A 1YNKL 5E8PA 1INEH 1PDKB 2NY1D 2H3KA 1R5VB 3QJFB 1II4E 4GKOA 4TXVB 5CU5A 2P8MA 4TPRH 4KZEH 3DVNB 4JDEA 2JB6B 4XN1A 2JK5B 4Y19E 2L7QA 5FM5O 3BZDA 2GITB 1KGWA 1M3IA 3GB7A 4RSYA 5CJ8A 3V4PA 5HXMA 2BXYA 1QO3B 4QRBA 3MLSL 3ZO0A 2Q3XA 2L0DA 5GPRA 3NMEA 4A6YB 4LVOB 2X9ZA 3V2AR 3FT2B 1JZHA 1A1MB 1KJ2L 3PFUA 4YPGB 1L6PA 1ZT7B 2ORBH 4H7VA 1OGPA 4HIEB 1RUMH 3FO2A 3K6OA 3VMPA 4R7NA 1JZEA 4CVZB 2YSTA 1R5WB 4LHUB 2NLJB 2Y22A 2JJVA 3QJQB 1ZANH 4GI6A 1NDMA 1FDLH 1CK0L 1BYNA 3L3JA 4HIHB 2R69L 3WKMH 4BK8A 4OKVB 2RGSA 2IBGA 1SGKA 2YPLB 2FT7A 1U8KB 3TF4A 2YD1A 5IEKA 5CGYC 4UUJB 4H20L 1HYSD 3K71B 1HEZA 1CFVL 1OT2A 3MREB 3T4AC 1GYVA 4M9PA 2XQYA 4KVNL 4M1CC 2ERJB 4DOHB 2WLKA 3MRFB 3VD7A 4X8XA 3NRFA 1OO2A 2V9TA 1KEML 2OTPA 3QO0B 2CDFA 1IAII 4KROD 5DQ9B 4XPBH 3W5MA 3F65A 5C0CB 3QEUB 4XO4A 3RNKA 2R7EA 3HG5A 2KHAA 3NTCH 1Q9LA 1VHPA 4H25A 4XMKL 3DPBA 3HZMB 3X3FL 3TTYA 3FB7A 2OJEB 2X4UA 2ZOUA 3GSXB 1B6DA 4V1DE 4A7GA 3JSSA 5FF6B 3E3QE 2EEDA 3N9GH 2GFBA 4B7LA 3HPJB 3T6QC 4E41B 1MCPH 1LE9A 3NZ8A 3AS0A 4JFFD 4NWUH 4PGEB 5KVFL 3C5SA 3R8BB 4DEPC 3JVGC 1PSKH 1BWWA 1XF4B 1TT6A 1F4YH 1HZHL 2FL5A 4ZRGA 3UMTA 1PX4A 4QCIB 4RAUB 4JO3H 3OXRA 2KZKA 3MGOA 3DX4A 5I6KA 3BE1H 2Y06H 1JPTH 3LEYL 1UWFA 4JQVC 5EO0A 3MA7B 5DZNA 1E9PB 2WTRA 3T09A 3PWJB 5CGTA 3FH8A 2VDLL 1KBBA 3PXLA 3DV4B 4WHTB 4BK4A 5B38G 4WCYH 3VXRA 3W1ZA 2QKIA 4ZO7A 2CKNA 3QDJD 4FFVC 4MB1A 3WGVB 4DGIH 1S7UB 1IGCH 2XU9A 2D3NA 3MLWH 4XMTA 1SUJA 1XF3B 3SBWA 5CZXD 1RJZA 3E6HA 4Y19B 3QJHA 3MRPA 1Q9KA 2FZ3B 5ENWB 1HZLA 1IGFL 1INQB 2AJXH 2Q5BA 4HQQH 5DURB 3MOAL 2NY1B 1Y7MA 2E27H 4KMTL 4HFUH 3ZTNL 2DLEA 5AZ2H 4RWYL 2AXGB 4H0LC 3H3KA 4QXGL 4Q6IB 1GZPB 4WVRA 4HK0A 4PEEA 2AQNA 4GXVH 3KPQB 4WU5A 1K5NA 4OGQC 1YNTF 1A2YA 1WFTA 4LDEB 1L9MA 4TS6A 1SLWA 1D5IH 5F1IA 4F2MA 2YEQA 1VPOH 4M7LL 3O2VL 3VYPA 3DHPA 1U3HA 1JI2A 3R4DA 2DIJA 3GSVA 3M88A 1S9YA 3NCWA 2NZIA 1KG0B 1TTGA 3BESR 2CG9X 1BAWA 3MODH 4M6NL 3BAIA 4OB5H 3VXOA 1H8LA 2VUKA 1AANA 3GKZA 4PJIA 3TZVA 1BJ1H 2FX8H 3OBAA 4OCSL 5K59F 3EGDA 4FI8A 3U46A 2QHRH 4YBQD 2YWYA 4HHAA 1UEYA 3S36X 4IJTA 1GZQA 3WSQL 3ZYIA 4K9EL 4P4KB 3IAGC 4YSOA 5E5MA 4G80B 1DVXA 5DVLA 4FI7A 2FT8A 1NOLA 3GZPA 4AKOA 3ZDWA 1QYGH 3DX6A 3ZL1A 3WHE1 3QNYA 2YMOA 3HR6A 2A77L 2H8PB 2NT1A 3FH5A 3VD0A 3PUCA 1T5XA 1F3JA 5T33H 5AD0B 4PJ6A 3IJSA 3RNQA 1S7SA 3LY6A 1PY0A 4V1DB 1FL3A 2NY0C 3PDDA 4D9QD 4GRLB 2ZONA 3WEOA 1OAQH 4U2YA 2LW3A 2UZXB 3QORA 1RUPL 4KKAC 4HH8A 4YHOL 4OLWH 2ZJSH 4FNQA 4AXWB 4FMKA 1MFVA 1KY7A 1X6LA 3MRGA 1UACL 2IPTH 2R1YA 2CZNA 3HZ3A 1JYXA 4F8QA 1T4KB 4F8NA 2VSDA 4JR9L 5E08L 5JHLA 1SEBA 3D39E 1CWVA 4N0FB 3KPPB 5DO2D 4R2GC 4UZUA 4N2AA 5GGSY 3ARWA 3NZHH 3WMPA 5F88A 2A6KA 3KH3A 5CUSL 2Y5QA 4R5XA 1LMKA 3EIFA 4NQDE 5DMGD 4FQXD 4HJGB 3UOAB 3V0EA 3WIAA 1RUQL 3QIWC 4N2HA 4QT5B 3SYCA 1Q0YH 1H3XA 2X4NB 3MGTA 4YDNA 5AKTA 2M1KA 1VADA 3EYQC 4ERSL 2JMRA 1YJDL 3D3VD 4LMQI 1ZGLA 2Z8WC 5LXGL 5FUCC 3CFCL 3GMOB 4JDTL 1JHKH 1OP9A 1TU2A 1KLGB 3T1WA 2EKJA 2X2IA 3RURA 4Y2DD 2Y1AA 4MZRA 5DUPL 2WO2B 2B39A 2NSXA 2NY2C 2BSBA 4OJDH 1UA6H 2QFPA 3MUY1 2E59A 3B7YA 4MZ3A 4GRMA 4GW4B 4UBDC 1ZTXL 1HNGA 2VWEE 1IBBA 1UXSA 4KJPC 5DD6B 4JZJA 2PYFB 2ZUVA 3PXJA 1WDAA 2DQMA 4GH7B 4HD5A 3VX1A 1F4WL 5B1AB 5DJ8B 3WNKA 1B88A 2NTFB 2H2PC 2VM9A 3II2A 4JKKA 5F1NB 3SJVA 2BVQB 2H1XA 4JFQA 2BVTA 5GGSA 1SJXA 5IROD 3NRQA 3HLAA 3PIQB 5E00B 1Z3GL 3W9EB 5ADOH 4XXCA 3ZGPA 4GIPD 5K1VA 5G55A 2QMJA 3APMA 5J3HC 2LU3A 4JZNB 1R0AL 4C4UA 1LHZA 4JRFA 4LVNB 3L2MA 2ZUSA 2A83A 3HG3A 5KVGH 2B77A 2R0WH 3UX9B 1DVUA 1BM7A 1YYLL 2LV4A 2O61B 1ZXKA 2WP3T 1OIOA 2D2CC 1SN0A 4DIXA 5IB4B 3NN8B 3E9TA 1E28A 3U7AA 3GRBA 5DJZB 2VLRA 1PU0A 4UDUA 1A3LL 3I6SA 4LF3A 2UUDH 4FXKC 3OKNB 4UZSA 2VM3A 1RUKL 4LBEB 3ML9A 2O5XH 4XCYA 1RIHH 2ADGB 4AYID 1MY7A 2IBBA 3DBSA 1JF1A 4B0MM 4IBWA 3IU3B 2BO0A 1JMXA 4HZLA 2JIXA 5DJYA 3WFEH 2NXZD 2YPVL 2PYEE 1D7FA 4O2EA 4HXAL 1YNLL 1SOXA 3SQOL 3ESNA 5I8CA 4K3GA 1K85A 5EWIH 5EZOL 1ZEAL 4B9IA 1KJMA 3FQTB 4RRPM 3N41F 5FGBC 1IAOA 3VG9B 3QCTH 4K5MA 4X99B 4X4XB 3ML8A 3P77B 3JWDH 4PRHA 4A1JA 4XAWL 4Y5VA 3D2UA 4BM7A 4PBVC 2VDKL 2XVBA 3QUYD 2YHGA 3BZFA 3DHUA 3KLSA 3UTZA 2VISB 4ZW6A 1B9ZA 3BSZA 3D39B 3ZYJA 2Q7AA 4YDJA 1CYGA 1KN4H 3WNIA 1DQIA 4FFWD 3DOSB 3QPXH 5DQDH 5HGDB 2YQGA 5TJWK 4C47A 3GMQA 4NQDB 5BZZA 3JV0A 4YUEH 2K9UA 5T1KA 4C56D 1ZK9A 1J8RA 4NDMB 3DSNB 1EEYB 1RD6A 1RULL 4N2LA 4PV8A 2W91A 5I1JH 4PVNA 4LLVB 4R96B 4FF9A 4FQXB 3MI6A 3P9LB 1HILA 2HT2D 5F72S 1JZ7A 3GWJA 2IWFA 1FNFA 4JRXA 3MUHL 3DUSA 4KQ0A 2F54A 5LKNA 5C0RH 1P6AB 4GQ9L 3D0AA 4HJ1A 3INOA 3QARA 4BCYA 3AT9A 1U91B 1J18A 2CO7A 2QHLA 4HEPA 4YHIB 3H8NA 5IVXA 3FHAA 3E80A 4KQ4H 3QIUD 1AP2B 4ZNCD 1QKZL 3VXTB 4P07A 1KXTB 1YEGH 4P46B 4WEMB 3ZKND 3MCLH 1RIVH 5IWLC 1I8IB 2AK1L 1TQCB 2IOOA 4MDJB 3GLDA 3SDYL 3HVDA 5MEOB 5B39A 4HWZB 2W0FA 5HHNA 3SPGA 3JWOL 4GG8A 5E5RB 3HRZB 1MCWM 2KBGA 4JFDE 1RERA 3I02B 5DS1A 2ZOLB 1HL9A 3SGEI 3ZK0A 3SKUD 3T77B 2J1YA 3KL3A 3RWIA 3OZ9H 1VERA 4HDIA 5GGVH 2WQXA 4GSXA 5K39A 2WAQA 4UQBA 1E90A 3WIHA 4ODUB 4PVLA 1NEUA 3NJLA 4BUHA 2DQCL 2X53A 3MLRH 4RH4A 3REWA 3H9HA 3IDYC 4F9LA 3IS0X 4JFPA 4P99A 1U21A 1TSHA 1CVSC 3BEVB 3MO1A 2HFGL 3P9MB 5EBMB 3BP4B 3U0WL 3L9BA 4JUTA 3KG5A 3LXAA 5EOTB 5F0PB 3MJGX 3O3EA 3QDMD 5HYQA 3SB3A 4LDCA 1IT9H 4YXLH 1G7QA 4U6YA 5I6XB 4R6UA 4NM8L 1AQDA 3WFZA 1PYWA 4PW4A 3RI5K 2PYEB 4RFEA 1GPOH 1Q1JH 3M45A 2H0FA 5E1AA 1WC7B 5KJRH 3UTSA 5C0GA 1OGAD 1HXYB 2IDCA 1ANUA 1NGYA 4B9FA 1XSJA 2JCCA 1ZLVK 4HFWA 2OP4H 1J0HA 4P23C 5E8DH 1EV2E 2ZCLH 3OMAB 4Y5YA 1PFCA 4KJWD 2YR3A 1YY8A 4H88L 3F5WB 1ZVYA 3DURA 5IJVA 1KEGH 3FOLB 1FV1A 3RP1A 1MWAL 1Y6NR 4RDQG 4PS4L 2B59B 3WJMA 2WLLB 1CZ8L 4H8QA 1IFRA 4YZWA 3SBQA 4YQXH 5ID0A 2YBRA 3PWUB 1P4IL 3QDAA 1ONQA 4U7MA 2V4LA 2ALAA 1ZHKB 2LT9A 3T3ME 3TA4D 1JDDA 3U9UA 5E8EA 4Z77B 3HC4L 1UJ3A 1M2VB 1SJHB 3QQ3A 1UD8A 4JL2A 2BW5A 2IWEA 3P2DA 3WLWD 1LGVA 3G6DL 1KDIA 2WB7A 2X4PA 5CR8A 2A6IA 4Z3GA 2B4CC 3OMNB 4R9HA 1ADQH 3IDIA 3PGCB 1TJGH 1M7DA 5LUMA 1ITBB 1MAMH 5LNEA 3ETTA 3RGBA 4NNYA 4YBLB 3NSCA 3A47A 1KTDB 4QXTA 2W0KA 2WN3A 1H5BC 2F15A 5BV7L 5F0JB 1S7QB 3O3BA 3O3UN 3P69A 4J6IA 1PG7X 1MQ8A 2NZ1A 4GKZB 1G7IB 5ETUB 5B22A 1UURA 2HKHL 3ECBB 1CDUA 2CO6B 4XCEA 4MD0B 5DEZA 4JFDB 1H8NA 1MHEA 3BJLA 5CCGE 3CBJB 4LCIH 5E7FA 3HMWL 4KUZH 4CN1A 3MNZB 1HKLL 1KGCE 1L4IA 1UH2A 3ISYA 5FFGA 2R1WA 4NC0B 4BK5A 2QPUA 4PG2C 1XXFC 5TF0A 1T03L 3MV7A 3S9DB 1VESA 1NGQH 2IPUK 3UROR 3GRWH 4OCNC 2ZX6A 3MRLB 4LARH 4XCCH 4QXWA 4ODTH 1OTUC 4UT9L 4P9MH 3EO9L 3ARTA 3NESA 5ERWB 4BZ2H 4U1MA 2AABH 3QUML 4ZS6D 5AVYB 4PW9A 5CFHA 2UWEA 5BO1H 5TFSH 2YJQA 4MAZA 2AJSL 3ARSA 2F7PA 1CDJA 5ICXA 4U1JB 4WUUD 4KY1H 1DBAL 2ZYHA 5EO1B 1DDHB 2OZ4A 1SM3H 3UYRH 3QDMB 1KLUB 1K6QL 5GGUB 4DFIA 3RIKA 4GJTB 2NW3B 2P49B 1G43A 4F7MB 4NKIL 3ARFA 1YNKH 5JHAA 2PKDA 1GW0A 4MA8L 3LQZB 3PWPE 5I82A 4DP5X 1DLFL 4NKDA 3KS0H 4S1SL 2Q86A 3UDWC 2B2XH 3D50A 4KZCA 3WEBA 2GEEA 3VXNB 1I1YB 3M1BB 5B1KA 4AM0A 1FP5A 1PGRB 3EOAB 1Q8MA 3HB3B 5F9OL 3MLSH 4RMUA 1JGEB 3QUXC 3KPRA 3KYOB 4JY4A 1DVFC 4N8PA 5AW9B 4ANKA 4KITB 4P2CG 3T3MB 1KJ2H 2P5WA 4FHKA 3GSUA 3ASOB 2OLDA 3IMUA 1NIEA 1P7BA 4P5MB 3UG3A 1E2WA 1NH6A 3VA2C 4GLRI 4WI6A 2R2HA 1Z5LA 5CEXA 1M9WA 2WHVA 2BOBB 4NHCL 1D5ZB 5F7DA 1Y1DA 3H2WA 5T3XD 3MRBB 1MY5A 3GXUB 2ZCKL 2R69H 4K3JL 1BOGB 2ZF8A 3FQNB 5IFHH 3ZDYF 1YY9C 5JW5B 3DMMC 1MI5E 2PTTA 3DKHA 3ZE1F 2ETWA 2IDUA 1WZKA 1ZHLA 3FFCE 4OCWL 1PIGA 2B5IC 4NHUB 4GBXA 4L1BA 1AS7A 4H20H 5IW3A 1BEXA 2BFVL 3F2LA 1CFVH 4OGAD 1UXWB 2YAQA 5F8QC 3A22A 5D1XC 3BD5A 1N0LA 2WINB 4KVNH 3DX8B 4NUGL 1IIIA 4GFXA 1U93B 4WI4A 1TZOA 3GI9H 2FX9L 3GSOA 1KEMH 4OGXL 2X4OB 5I1LB 5E6ID 5CN1A 3OKOB 4X7TB 5T1MB 1AGBA 3IXTA 2YD9A 3OKEB 4K94L 3MJ7A 3PJSA 4UDTB 4WI0A 4XMKH 4TN9A 5D2NC 1JV2A 4N6RA 5TDPA 3X3FH 3II3A 5M7QA 4TUKL 1K3IA 1Z9PA 2J21A 3W39B 2Z92B 4JLRA 5GIRB 1P5UC 4W9FC 3T3MF 3SGKA 3QYNA 3TA3D 4DVRH 1XH1A 1QUPA 5EZLA 5AW7B 1LEIB 3V4VL 2WB1A 2KQNA 4Y4FB 2OBGA 5KVFH 4QRRE 4UQDA 5GGRB 3QCUL 4ORGB 4ZAKD 1MFMA 5TGBA 2BS9A 3HHRB 5IW6A 1AZBA 3OKKB 4QRSB 4E36A 5DC2A 4AVHA 5D1QA 3BUBA 1FFNA 1XSIA 5KVEL 3KW7A 4HJUA 3QK0A 2XZQL 1U3ZA 3LEYH 5KAQG 4K15A 3IF1A 2JKXA 3FRPB 4JREC 4PJAE 4DKFL 1WFUA 1I9IL 2H4EA 2PCXA 4QHLA 2VDLH 5HHVL 3TWCL 5JOPE 1V3JA 1QNIA 1AVAA 4YDMA 5CBEA 2FJFA 3L08A 3VI4E 2ZKHL 4YHNB 4ILDA 5MEPA 1FVDB 4Z7OF 4I4WA 2IF7A 4ACTA 3D85B 3NDYE 5BPPA 3PWPB 1S7WA 2JE8A 2XV6B 4AJYV 2XXCB 5GS0C 1V7ML 1P7KB 3FTUA 3QUZD 3VI3F 2DQUL 2HKLA 3FU9A 3O3DB 3VXME 1IGFH 3MOAH 3ZTNH 4KMTH 2I24N 4RWYH 5E9DD 4JRLA 4QXGH 5GGQL 1GW6A 4F7EA 2CXKA 4I3RL 4JDZB 2WUBL 1NFKA 4UIMA 2V2XB 2VDMH 4XTRD 5FA3B 2VC2H 5IF0A 3LKNA 4N8VB 2MNWA 3L2NA 4X7DC 3Q1EA 5I8OL 4A2EA 2BNRE 3TYFB 4QOKA 2E75C 5L8JB 1PCSA 4ACPA 4G7QB 1TKWA 5AVUB 1HCVA 1KLFB 2AKRB 5A2LH 3SE3A 5GZNC 1MI5B 3FU7A 4M7LH 3T0BA 3O2VH 3GXMA 5KYUA 3N40F 2BP8A 4Y9CA 1L9OA 3FFCB 4M6NH 3PWNB 1CDCA 3LZRA 4LQ1A 1MLBB 2KKQA 4OCSH 3U2IA 1I85A 1NINA 3DUUA 4AT6A 3WSQH 1QSFE 4K9EH 5DZOA 4L4TA 1EHNA 3C87A 3IXAA 3RWDA 1C5CL 3BVVA 1DO6A 4MBRA 2BSSB 3ZGHA 2ZUTA 2X0WA 3NJMA 3C60D 4QJ3B 4N3UA 2CR0A 2VLJA 3Q6FB 4H8UA 5I71B 4QRQB 1IM9D 5KSAA 2NTSP 1JPGA 4J8RB 2FQDA 3MV01 3HHSA 2YUXA 5DJXB 1GXEA 4MMZC 2E74C 4B6ZA 3BZ4A 4F57L 5D55A 1IARB 1NCOA 2R15A 4IRJA 4W9HC 4AYFB 5BJTA 5L6YL 4FYSA 2H1LM 3MR9B 3F05A 1RUPH 3VXSA 4C59B 1J05B 1RZGA 4NZRL 1OAUL 1YPZF 3DRQA 3TPKA 3BWUC 2ALWA 3BGMB 1TTCA 4QRRB 2Y23A 4PJ8B 1UACH 3P0VL 1O9ZA 2AXFA 2DQJH 1TQBC 2IALB 4JR9H 4K7FA 4P9HC 1HSBB 1X5AA 2H45A 5SWZD 3ARBA 2NY3D 3HS0A 3N3EA 3DDGA 4O02L 5CUSH 1AMYA 3MRRB 2D3JA 4PJAB 4Y0GA 9PCYA 4NQXA 1TZGH 1BFSA 1R3LA 3QWNA 1EXUA 4DVBA 1RUQH 4Y2OB 1BHGA 1WG3A 3QA3B 4X5XB 1URLA 3FSAA 4OF6A 3TIEA 3T2PA 3VI4B 1JYNA 3PPEA 2WKGA 4PJ5A 1E67A 4DETA 4L1DA 2FYVA 2G4EA 1A4JB 2IAMB 4NC2B 3AG2B 4E9YA 4NQCA 1GKEA 3CFCH 5LXGH 4OZ4B 1F86A 3BP7A 4JDTH 4WIQA 5IMMB 4EOWL 1BZ7B 4H26B 3BX7C 2BERA 2UVEA 3C6EA 5DUPH 3VXMB 5A2KH 3FAWA 2D4FA 4XC1H 3PUUA 4KDVA 4MQXD 4C83A 1VFMA 3IWUA 1CICA 1ZTXH 3HE7C 1FSKC 3MX0B 3MBED 5HI5C 1NAMA 3B5HA 2VDKB 3IGKA 1NEZB 4UTBA 2QPSA 3IDNA 4EO5A 2BNRB 4PJ9D 6CGTA 3K8LA 2RR3A 1UD4A 1U8NB 4GKSB 5DK0A 3O11A 1Z3GH 5DGQA 3VFNA 3OQRA 1NBYB 5CSZB 4U1GB 1HI6A 4JO2L 2EZ0D 2EXTA 2ODHA 4M6OL 4WSGA 1R0AH 4JRYD 3H7LA 2YN5A 1WSST 2HKFL 3TO4A 3FH7A 4P5KB 2ATKA 3KL0A 4KVPA 4MXWL 3KCPA 4X8CA 5T1LA 4FRWA 4UTAA 1YYLH 2HZHA 3EUUA 3IMRA 4XO5A 5AZEL 3RKPA 1QSFB 1N6QH 4JQIH 4B9YA 5DC4B 3NIFF 2R1XA 3DJRA 4X5WA 1NA8A 5FDWB 5A7BA 3P40A 2V5MA 4EXPX 1EHXA 3MGAA 1A3LH 3CE1A 5AW2B 2R9HC 4JY6B 4YE4H 1RUKH 1E4XI 4M6AA 3AW5A 5C70A 5AW3B 4BHUI 2DOCA 4GY4A 4JFYA 5DJAA 1H3TA 3WLBB 2AQPA 1DUYA 2COVD 3QO1B 2YPVH 3ARED 1T1ZB 4HXAH 4PJXE 2ZKMX 3Q8FA 1YNLH 2P5EA 3QHFL 1IEBA 5KYXA 3C60B 3LV3B 5EZOH 1ZEAH 5M95B 4W6YB 4JVUA 1AY1L 2WKLA 4KKPA 4Y88A 4TUJA 5F93C 3IJYB 4ZFGL 3M1OA 5T5FL 2WTPA 5D7JA 1SQ2N 5FM4A 4FL4C 4CU8A 4XAWH 2VDOL 5J8OA 5CD3B 3K2UH 1HEHC 4A2FA 2VDKH 3NACL 4JM2D 4QHNA 5FDYA 3W2DL 3VWJA 4LVHB 2Z7YA 2O6PA 3ERXA 4WTWA 3WEXB 4WTZG 1R3JA 1YMHA 5GZOC 5A2CA 4L3AA 5HHPA 4Z3TA 2X6CA 5E1IA 2V2TB 3AXHA 2QR0B 3U6RA 3UADA 4NRXB 1OT4A 2WYTA 2ZOTA 1SFDA 1YEEL