4GSWA

Crystal structure of ubiquitin from entamoeba histolytica to 2.15 angstrom
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
NAMQIFVKTLTGKTITLEVEPNDSIDAIKAKIQEKEGIPPDQQRLIFAGKQLEEGKTLSDYNIQKESTLHLVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structural Determinants of Ubiquitin Conjugation in Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Protein binding
total genus 25
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gswA00
1WE6A 1WX9A 2GBRA 4KZ0A 1V81A 2RPQA 2LD9A 2N7EA 3M63B 2LGXA 1WI0A 2R2OA 4EZLA 4GIVA 3OJ4B 1Z2MA 1LXDA 2N1WA 4TV3A 2KX3A 4N9F4 1FXTB 4HCNB 4AWJA 3HM3A 5E6OA 1V86A 1UH6A 2EKEC 3A1QA 2KD0A 4MM3A 2KFKB 5DPSA 4BOZB 1S1QB 1MG8A 2KJHB 4FADA 3DVNV 4ANVA 3A4SC 1M94A 4BVUC 2M8SA 3K9OB 2CU1A 1CMXB 2LVPA 4FLHA 3R3MA 4TUUA 3NZUA 3RULA 3ML8A 1P9DU 2KWUB 3KUDB 1WX8A 5G2NA 2FCNA 2KMCA 5CHWA 2KFKA 3V60A 4AP4C 4IWPA 3QHTA 4MGYE 2KVRA 1Y8RC 4KSLC 3A9JB 4A3PA 4GDLB 4HXDA 4GN1A 2FCMA 2IO1B 2KFJA 3IG3A 5HKHA 3OLMD 5CTRC 4NQKE 4GDKA 3ZUNA 2ZPNA 2MCNB 3UIOB 3SDLC 1R4MI 4M8NA 3R7RA 2K8HA 4KZCA 4ZRJA 3AI5A 3PHWB 4WJOA 4GOCA 1WIAA 2FIFA 3DCGA 4MH0E 4I6NB 1E8YA 1EO6A 1H4RA 2O6VA 2MX2A 3EECA 1IPGA 2JUOA 4F8CB 2BGFA 2XBBC 4JLCA 4W9LA 1OGWA 2RGFA 3OJ3A 2MP2A 2IO2B 4DDID 1UELA 5IAAC 4HPLB 3H7SA 3V62A 4LDTD 2LGYA 2KDBA 3CF6E 4OVUA 3H6NA 3VTWA 1ZW7A 4AOFA 2MBEA 5TR5A 2G4SA 1I42A 2CHXA 2WWZA 4BFRA 1E8XA 5AZFA 2KTRB 2JXXA 4KIKB 1WXSA 1XD3B 2MA9B 1WFYA 2REXA 4XX5A 4WAAA 1WGRA 2N9EB 4NJ6A 4WWOA 2YLMA 3W1YA 4EZJA 2XK5B 2L05A 2NBVB 3ECIA 4E3CA 4W9CA 4EOYA 4W9HA 5KHOA 1LM8B 1E8WA 2CHZA 3GOEA 3JYUA 4AJYB 4KVGB 1WH3A 1TBEA 3EFUA 4DBGA 2M17A 3W1SA 3VH4B 4PYZA 2KLCA 4GB9A 4WQOB 3DVGY 3V61A 4IW0A 1HE8A 1OQYA 3QX1A 4MELA 1V49A 2N9XA 4LJOB 3W1SC 2K6DB 3PRZA 4PS3A 3H1UA 1WR1A 3QQ8B 3B1LX 4RM8A 4W9JA 5CX3A 1J8CA 2HE7A 1BT0A 1L2NA 3QWZB 3RZWC 4II3B 2ZNVC 5JH5C 1YQBA 2NVUI 3RYTA 2RD0A 1WGGA 5G55A 1UGMA 3APDA 4LCDE 2DYOA 4MGZE 2KWCA 1F9JA 1WJ4A 1P98A 2WX1A 5DCNA 4NAWB 2J0JA 3NZSA 5D2MB 5DPRA 3WAOA 4HLEA 4ZYNA 4XC2A 2ZVOA 2C9WB 2JRIB 3RZFA 4HCPB 1V6EA 2KOXA 2WDTB 4M8MA 3ZNID 3X23A 1WR6E 3L08A 3UF8A 2Z0EB 1IP9A 2V4LA 3QA8A 3WIMA 1WJUA 1WJNA 1VCBA 5AZGA 2R2QA 1YD8U 1XT9B 2KX0A 3KUZA 4MEMA 3WAPA 1SE9A 3ALBA 3ZRFA 3L0WB 2W9NA 1V5TA 1UZXB 3H7PA 3QCAA 4HDQA 2K6QA 3RUIB 3VDZA 3RD2A 1WY8A 2ZZPB 3DBHI 4KV2A 1WMHA 4IWOA 4NNJB 4ZRKA 2NBWB 2GMIC 4HPMB 1GC7A 2JZ3B 2MBHA 4DWFA 3A1QB 3MTNB 4JIOU 3DVNU 4BOSC 2G3QB 3ZIMA 4E71A 1ISNA 1QZEA 2J0KA 4M0WB 3ZO5B 5C1ZA 1GC6A 2DYBA 2CS4A 1PQSA 1WF9A 2DX5B 2NBUA 3UINB 3VAWA 1I35A 1NI2A 1J19A 2G4DB 4IM3A 2WX0A 3ZVVA 5JHBA 5AEKB 4PS7A 2DZIA 4RM9A 4ANWA 1KM7A 1WXAA 2I1KA 1GNUA 3V6CB 3CMMB 4E74A 4JQWC 2JZZA 4GGQA 1WJ6A 4NQLB 2V1YA 3DDCB 4GDKB 2LWPA 2MW5A 2J7QB 4DHJD 2BWES 4B6WA 3VVWB 5J2RA 3CSTA 4HVBA 1E8ZA 4MSMB 5D7GA 2LASA 3V6EB 3ZTCA 1WGDA 2M0XA 2KLGA 2O6VB 4B95A 1GG3A 1AARA 3JSVA 3M95A 3O65B 4G50A 3TJPA 3VUWA 2IBIB 3VXWA 2KMAA 2MP2B 3A9KA 3EC8A 1R4NI 4ICVA 2ZCBA 4ICUA 2JVCA 3PZDA 5D94A 3U30A 3LDZE 3GZNI 3L10B 1KLVA 2WYQA 1RLFA 1P0RA 3AULA 2LXAA 3PRMB 3M62B 5L83A 2DAJA 2LI5A 3IBEA 2ZVNA 4WJNA 1KOTA 1JRUA 2FIDA 4IM2A 3ZTDA 4DXAB 2JRHA 4TKNA 3PLUA 2JT4B 2D10A 2DHZA 2MWSB 3AU4A 2AL6A 4FJZA 4MSQB 1OEYA 2PE6B 2DYMA 4WJPA 3IVFA 4A3OA 3VTUA 4DHZB 4EEWA 2KKCA 4P7IA 2C7MB 2KDEB 1E7VA 1WRDB 2D07B 2GBNA 3WANA 3PRPB 3WAMA 1G6JA 3VQIA 4IM0A 2AWTA 2LVQA 5L95C 2DZKA 4ANXA 2ZNVB 4BKGA 2KC2A 2XEWA 3QARA 4GMVA 4K1RB 2K1FA 3KW5B 1P3QU 3D32A 4HWIB 2IZVB 2KQ7A 4FJYA 2KANA 2MRPA 2KN5A 3A4RA 2V3SA 2Z0DB 1LFDA 3P2BA 2EMSA 2MSED 5BO4B 1YIWA 2IO0B 3ZKJC 5DPTA 4CHKA 3TMPB 1E90A 2YVCA 2RR9A 3ONSA 2ASQA 5JHAA 4IG7B 3EHVA 4MJSA 5CHVC 2CHWA 2LRUA 2N7DA 3APFA 4EZKA 3KVFB 4F1SA 2Y5BB 3B08A 4FULA 4WWNA 5FR6A 2K8BA 1EF5A 4BKSD 2IY1B 4A20A 1YJ1A 5AZHA 5GMVA 2L7RA 3H7PB 4EUTA 3DPDA 2JWZA 4G11A 2KTFA 4PS8A 2LGDA 3AXCA 4URKA 1WMHB 3X0WA 3S2AA 2D2QA 4KDLB 2N9PC 3PVLA 1SIFA 1V80A 4FA6A 5J18A 4I6PA 4JGHB 3UGBB 2DAFA 1WM2A 4G3XB 1WGHA 1VD2A 2C5LC 1NDDA 3T8MA 2KDIA 1NBFC 2KWVB 4KSKC 4XZ4A 4ZDVA 4K7SA 3DBRI 1XQQA 3C0RB 1Q5WB 3IFWB 4CYEA 4FBJB 3KYCD 3KYDD 4FN2A 4HDOA 3RCZA 3VTVA 4AUQC 4BKTA 3LJ3A 1WM3A 2O2VA 4MGIE 3WA0A 5DPWA 2L0FA 2L8JA 3T9LA 5IA7A 3Q3FA 1TGZB 4WJQA 3ZNGC 2HJ8A 1RRBA 2KZRA 3JVZX 3APCA 1T0YA 2KJ6A 4BBNF 3KH0A 2C7HA 1U4AA 4LDTB 2UYZB 3L17A 3ENEA 2MQJA 1V9JA 3PSEB 4TQ0A 2AEHA 3IHPC 2GBJA 4W9GA 3R7QA 2MLBA 4IC7B 3A33B 4F7ZA 1WX7A 2VRRB 1ZGUB 4ZRIA 1V5OA 3DBLI 3DOWA 4W9EA 1SGHA 2BKFA 3SHQA 3JW0X 4J6IA 2DZMA 2OJRA 1WZ3A 5LLIA 3JSVB 3U7DA 3I3TB 2FNJB 3VH3B 1EF1A 2FAZA 3A9KB 3NY5A 2I1JA 3QK0A 3CSFA 3HM6X 2B3AA 3ZNHB 2A5UA 3MHSD 2ZJDA 1L7YA 3ML9A 1YX6B 1J0GA 4ANUA 2M1MA 3NS8A 1C3TA 3N32A 3TBLD 4DK5A 3R66C 3H9DA 4ASWC 3PHXB 3ZW3A 4W9DA 1Q1OA 4K7WA 3UIPB 1A5RA 4CO7A 4I6LB 2JF5A 1Z5SB 2NCNA 3AU5A 3PLVA 2JY6A 2LZ6A 2UWQA 1TTNA 3RT3B 1E7UA 3OAWA 3HK0A 3U8ZA 1V2YA 2PPHA 2D11A 3SD5A 2ZCCA 2ZEQA 2A4ZA 4HK2A 3QJZA 2CKHB 4JL9A 3QC8B 3N30A 2EMTA 4TQ1A 1OEYJ 1WXVA 1WYWB 3PS6A 1E5WA 1UD7A 2K25A 5KHQA 1KJTA 4MDKE 2FCQA 3TCAA 3A9JA 4GDLA 5D6JB 3NHEB 2HTHA 4BKSA 3TL5A 4NJ7A 3Q3JA 1D3ZA 3PGEA 2GBMA 3HHMA 2HD5B 2KO3A 4PYUA 4WWPA 4EFOA 2RSUA 2L0TA 4W9KA 3ZNZB 1C1YB 2N1VA 4AJWA 1S3SG 4BBNC 4KDIC 4FJVB 3PT2B 1ZKHA 2FCSA 2CR5A 2G45B 3UQAA 2KDFB 3B0AA 4YL8A 4MJSB 2FUHB 2LJ5A 1RAXA 2PEAA 4IUMB 1IYFA 3UQBA 2KXJA 2KQSA 2LUEA 3KUCB 4OVVA 1H8CA 2MBBB 2ZPYA 2BYEA 2LRWA 2L3ZA 4NY0A 5CHFA 4FHJA 4W9IA 3VUXA 1Q0WB 2L00B 3PPAA 5LXIB 2BYFA 4G0NB 2QHOA 2N4FA 4IWQA 1UBQA 4GU2A 3MJWA 2NR2A 2KTRA 4KIKA 2DENB 4X57B 2KHWB 3L13A 4DDGD 2NS5A 2O6VD 2K39A 2PE9A 2XK5A 3PV1A 1P1AA 3VFKA 5E6NA 1UBIA 4DHJB 1K8RB 3M3JA 4K7UA 2IO3B 2GBKA 3ZLZA 4W9FA 2D3GA 2JPHA 3DVGX 4GSWA 4HJKA 5EDSA 2MBQA 5J17A 2O2VB 1WZ0A 3VHTC 3WALA 2OOBB 3DBSA 4DHZE 2KC1A 5JZEB 2K8CA 3ZDTA 2KK8A 3PREA 2C7NB 2LVOA 1RFAA 4II2B 2IYDB 2AL3A 1EUVB 5C23A 5LXHA 3N3KB 1OTRB 1LQBA 2L76A 4FHKA 4K81A 1GJZA 2BPSA 2Z59B 4NPNA 2LXCA 4B9KA 1WXMA 2NPTB 3L54A 1GUAB 2BWFA 3BINA 2BKRB 3VUYA 3L16A 3ZDMC 2GOWA 3NOBA 2C60A 3K9PB 4LJPB 4NAWA 1YX5B 4GXBA 3ZRCA 2PJHA 3TIXA 3HIZA 4RMAA 3SU8X 1TZ1A 3QIJA 3DQVA 1X1MA 2MBOA 4EKUA 2IY0B 2KJRA 4MGKE 2NPTA 5E6PA 1WE7A 2AYOB 2J0MA 3BY4B 3QAQA 2BF8B 1WGYA 2DZJA 3PTFC 2BYVE 2M4NA 2KNBA
chains in the Genus database with same CATH superfamily
1WE6A 1V81A 2SEBD 1LXDA 2KX3A 4N9F4 3NS1A 4HCNB 1TS3A 2PIAA 5E6OA 3C8YA 1UH6A 1MVKA 4RFBA 2EKEC 2BTEA 2KFKB 1E10A 4ANVA 3A4SC 2M8SA 4FLHA 1N61A 2N9KA 4TUUA 1WX8A 5CHWA 3A9JB 2KFJA 4YSYB 1RM6C 5CTRC 4RGOS 1N62A 1TT5B 1L0VB 1Q10A 3RN9C 1HTQA 3R7RA 1FD6A 3B2GA 3I9V1 3MC9A 1WSPA 2BW2A 2FIFA 1C78A 4MH0E 4JE3B 2D3AA 1H4RA 3AEAB 2ICIA 3EECA 3ZGZA 2XBBC 4W9LA 3OJ3A 2IO2B 1VZ7A 3H6NA 2J53A 1I42A 4BFRA 1K50A 4KIKB 3HRDD 1R7SA 1XD3B 1WFYA 2REXA 1WGRA 1CQVA 4EZJA 2XK5B 2NBVB 3W2DA 1DYQA 4EOYA 2AX5A 3EFUA 1T6BX 4WQOB 3DVGY 4A55A 3QX1A 4KGRA 1M4VA 3Q8AA 3PRZA 4PS3A 1WR1A 5CX3A 1L2NA 3DWGC 3UI3A 2RDGA 3RZWC 4M02A 1YQBA 1ZDVA 2NMQA 3ZJTA 3E56A 2D3CA 2DYOA 2WX1A 5DCNA 2J0JA 3WAOA 4ZYNA 4XC2A 1V6EA 2JU6X 3ZNID 3X23A 3VRBB 1RWSA 2V4LA 5FK9C 2VH2A 1VCBA 3L0WB 1V5TA 3H7PA 3R2TA 1QOAA 1WMHA 2KAJA 4HPMB 2JZ3B 2MBHA 2QILA 3MTNB 1L6VA 1BMLC 3DVNU 4MM3B 3ZIMA 1ISNA 2J0KA 2QCZA 2DX5B 1PQSA 2LHEA 1NI2A 3ZVVA 2WX0A 2DZIA 1XLNA 2ONQA 1WXAA 3R8BA 4M0WA 3GS2A 3V6CB 4E74A 2JZZA 4GGQA 4N6EB 3DDCB 2WXOA 4DHJD 1NVID 3FAHA 4NAMA 3CSTA 4HVBA 3FILA 3R2IA 2H88B 1YNTE 5D7GA 2BBCA 2M0XA 4B95A 1AARA 3JSVA 3VXWA 2KMAA 2MP2B 1SIJA 3PZDA 2WXPA 3U30A 3GZNI 3L10B 1OQRA 1RLFA 3GE8C 4OZCA 2CJNA 3PO0A 1D6EC 1KOTA 2FIDA 1N60A 4C4VA 1B1ZA 2PE6B 2DYMA 4WJPA 1TKEA 4DHZB 2KKCA 3AECB 2VZKD 2I38A 2KDEB 2D07B 2TSSA 1TS5A 1C76A 4ANXA 1HZ5A 3ZJVA 1XLQA 4K1RB 3KW5B 4XWWA 4LNNA 1P3QU 3J9CA 4FJYA 3P2BA 1YIWA 3ZKJC 5DPTA 1RYJA 1ROEA 1P7EA 4IG7B 3EHVA 2CHWA 3APFA 4ZHOA 4AS1A 1QQRA 4BAXA 1CK1A 1HQRD 4FULA 1KLUD 4ZYSA 1SEBD 2WXNA 4A20A 3N20C 1TZOA 2L7RA 4EUTA 1YQ4B 2KTFA 1TS4A 3V3XA 3AXCA 2BB5A 2J4XA 2OHFA 2WDRB 2D2QA 1V80A 5J18A 5BMIA 4G3XB 1VD2A 3RNFC 1PGAA 2V3NA 1NDDA 2KDIA 1XF5L 2FUG1 1XQQA 1Q5WB 4BKTA 4MGIE 1WM3A 2O2VA 5IA7A 1YN3A 3BIID 3BK1A 1RRBA 2AQ2B 2QMTA 1I4RA 1N63A 1DOIA 3Q6BA 3R7QA 2KYWA 3U52E 4XGAB 3SFEB 1V5OA 1YOVB 2GRIA 2OJRA 4HROA 3U2SC 5FKAC 1V1PB 3U7DA 3VH3B 3A9KB 3QK0A 2B3AA 3ZNHB 4BZAA 3AM9A 1R4MB 3ML9A 1J7BA 3NS8A 3N32A 2K5PA 4DK5A 2WXIA 2BS4B 3H9DA 2Y5PA 3PHXB 1Q1OA 4K7WA 4CO7A 4IOIE 1ZUD2 3PLVA 1L0XB 5I4DA 3SFDB 2RMMA 3HK0A 3TEZA 3Q3NC 2PPHA 2D11A 2ZEQA 1YJIA 4YWGG 5D3DA 4AQ7A 2ZW0A 2N7JA 4LNKA 1UD7A 2FCQA 1UGJA 3A9JA 4BKSA 1ZDXA 3Q3JA 2HTME 5TSSA 4EFOA 3RFZB 4W9KA 3Q8EA 2N1VA 1S3SG 5BYRA 3PT2B 1L4ZB 4YL8A 1V97A 2V4IB 2B76B 2KQSA 2PW9A 2ZPYA 2BYEA 2W3RA 3AMZA 1T5XD 4W9IA 3VUXA 5C3JB 5LXIB 4G0NB 5EE0A 1F77A 1UBQA 1ZXIA 4KIKA 5HFYA 2BS2B 2KHWB 2NS5A 2O6VD 1K51A 2XK5A 3PV1A 1K8RB 3RI7C 4J3OD 3HVDA 3DVGX 3P4PB 5EDSA 2MBQA 2XN9C 5J17A 2YEPB 2OOBB 3DBSA 2Y5CA 2M0AA 2WXRA 1TKYA 2LVOA 4RF0A 4RNAA 1EUVB 1SXTA 3N3KB 4FHKA 3AE6B 1GJZA 2LXCA 4B9KA 5GXGB 1QILA 1GUAB 2BWFA 3BINA 3VUYA 2WXHA 3L16A 2GOWA 2HJ1A 1TKGA 1VJKA 3TIXA 1I4QA 1KFYB 3QIJA 1EU4A 1KTKA 1P7FA 5HI1A 1TY0A 1WXQA 1FNUA 4YSZB 3ZLZA 3AE4B 3M63B 1NEKB 2R2OA 2IGHA 1I4PA 1PGXA 1V86A 3P4SB 4MM3A 3EFCA 1R4NB 4BOZB 1S1QB 1CMXB 4PK1A 4OW0A 4M00A 2FCNA 1PFDA 3V60A 2N9LA 1QKZA 4P16A 1PUTA 4A3PA 2FCMA 4NQKE 2LFIA 5G5HA 2ZPNA 2MCNB 3SDLC 4M8NA 2K8HA 4KZCA 4LLGM 1HA5A 4WJOA 3PHWB 1WIAA 1F2RI 1EO6A 1FPYA 2BGFA 1OGWA 2MP2A 4DDID 3H7SA 2BYTA 2LGYA 1KLGD 3CF6E 4AOFA 1WWTA 2G4SA 2CHXA 2WWZA 5AZFA 4MT5A 2JXXA 3W9CB 3Q8BA 5E6JA 4WWOA 2YLMA 2MEKA 2PVOD 5AUKA 4E3CA 4W9CA 2RDHA 4W9HA 1AW7A 4B0MA 3GOEA 4DBGA 2M17A 2MJDA 4PYZA 4HKQA 1UWXA 1OFFA 1Y56A 3BVZA 4MELA 4LJOB 2N9XA 2E3TA 3H1UA 3B1LX 4II3B 1DOXA 2RD0A 3DBRB 1F9JA 1C4AA 1P98A 1FNWA 4NAWB 5D2MB 5DPRA 3T3NA 1UWMA 2ZVOA 2C9WB 2JRIB 3FKYA 4M8MA 1WR6E 3L08A 2Z0EB 4US9A 1XT9B 3KUZA 3ALBA 3ZRFA 1UZXB 3DBLB 2ZZPB 3DBHI 4NNJB 4ZRKA 1GC7A 2LEKA 1OQQA 3SR6A 4UDUC 3RPFC 4BOSC 4E71A 5C1ZA 4D2KA 2DWQA 1GC6A 1E6EB 3TEXA 1J19A 1I4GA 5AEKB 1SB3C 4ANWA 1C4CA 2I1KA 1GNUA 3LXFA 4GDKB 5IN7A 1J7CA 2LWPA 2BWES 4B6WA 4L2YA 5J2RA 2I2YA 4RGNA 1GAQB 2LASA 3V6EB 2KT7A 2PKOA 3N1ZC 2KLGA 4C56C 2KACA 1V1PA 3M95A 2IBIB 2QEJC 3A9KA 4ICVA 1HEZE 4RCOA 2QJLA 4QAYA 1KLVA 3NG0A 3OWEB 5BYSA 2LMCA 3V05A 2WXKA 2K9XA 5L83A 3IBEA 1JRUA 1I4XA 4IM2A 3ZTDA 1JW9D 2PTLA 3PLUA 3Q8FA 2MWSB 4FJZA 4MSQB 4A3OA 2GBNA 3PRPB 3WAMA 1G6JA 3VQIA 4N58A 1E0ZA 2DZKA 3ABVB 3D32A 2IZVB 3AV8A 2KANA 4ACFA 2V3SA 2Q5WD 2MSED 1XEEA 2IO0B 2PMVA 3RMKC 5JHAA 5CHVC 2N7DA 1L4DB 2Y5BB 3B08A 3Q3OC 4PT5A 5FR6A 2M56B 2K22A 1EF5A 2AQ1B 4B0EA 1YJ1A 1FM0D 2EELA 2IPKD 4LNFA 3X0WA 3AEDB 3UGBB 2D3BA 2L32A 4YTPB 3AE8B 2C5LC 3EUB2 5IO9A 3T8MA 4L1BA 3C0RB 3MFGA 1FFVA 3Q3MC 4CYEA 2LHDA 3RCZA 4DWFA 4FN2A 3AE2B 5DPWA 3LJ3A 3WA0A 1TGZB 3T3OA 4ZOHC 1K52A 2KZRA 1T0YA 2KJ6A 4BBNF 2UYZB 3L17A 1SBBB 2WU5B 2JSVX 4W9GA 4F7ZA 1ZGUB 2G1EA 3SHQA 1ESFA 4J6IA 2LJIA 3MHZA 5LLIA 2JWUA 2FNJB 3NY5A 2I1JA 1WGKA 3IT6B 3PZ7A 1L7YA 4ANUA 3P63A 2Z8LA 2JF5A 1D5ZC 3AU5A 2LZ6A 1TTNA 3RT3B 1E7UA 3OAWA 1I4HA 3U8ZA 2ZCCA 4JL9A 3RNAC 1VZ8A 2EMTA 1WXVA 1E5WA 1KJTA 4HRSA 3EA6A 1XO3A 2L52A 1D3ZA 1WRIA 1JWUD 3PGEA 2GBMA 2HD5B 4PYUA 2H89B 1RFKA 1C1YB 4KX6B 4KDIC 4FJVB 1ZKHA 2FCSA 2CR5A 3UQAA 3B0AA 1KF6B 4IUMB 1RAXA 4RGMA 2LUEA 3TUOA 3SEBA 1H8CA 4NY0A 5CHFA 1Q0WB 2LUMA 1SF0A 2QHOA 2K0PA 4IWQA 1E7PB 3MJWA 4HKZE 2NR2A 4X57B 3L13A 2K39A 1PGBA 4XYCA 5E6NA 4DHJB 3GP7A 4K7UA 1JCKB 3E9SA 4S0RA 2MH7A 1WYGA 3P4QB 4W9FA 4ZRPA 4GSWA 1K53A 4LNOA 5JZEB 3ZDTA 1FCLA 3PREA 3RNCC 4II2B 2AL3A 1FFUA 1YN4A 3FC4A 2Z59B 4NPNA 4ARIA 2NPTB 3L54A 3ZDMC 3I63C 1V1OA 4KGSA 2WXGA 1F0ZA 2C60A 4NAWA 1YX5B 2PJHA 3SU8X 3DQVA 2MBOA 4EKUA 4MGKE 3DHIC 2AYOB 1YQ3B 2V3PA 3QAQA 3BY4B 1IUEA 3LB8C 2BF8B 1WGYA 3HUIA 2QC8A 2VZKB 3HHMA 2M4NA 1WX9A 2GBRA 4KZ0A 4OZAA 2LD9A 4EZLA 4GIVA 1FXTB 4AWJA 3HM3A 1KH0A 5IOIA 2KD0A 5DPSA 1MG8A 3DVNV 3DHGC 1M94A 4BVUC 1MHXA 1XCQL 3GZNB 3R3MA 3RULA 1P9DU 5G2NA 2KFKA 1CJEA 3QHTA 3HVZA 4MGYE 2KVRA 4KSLC 1TS2A 4GN1A 5HKHA 3OLMD 2BS3B 4OZBA 4GDKA 3DWMA 2WS3B 1TY2A 3KQ4A 4ZRJA 3WCQA 1E8YA 1FCCC 1QT9A 2N0SB 2QSDA 3B9JA 4F8CB 4JLCA 1TYGB 4NZLB 1UELA 5IAAC 1SJHD 4LDTD 4JWUC 2KDBA 2MBEA 5G5GA 2UU7A 1JWBD 2KTRB 1WXSA 1XLPA 2MA9B 4XX5A 2N9EB 4NJ6A 5D3IB 3W1YA 4WAFA 3ECIA 4AJYB 3JYUA 2ZW1A 4WIPA 3W1SA 1MFWA 4RGTA 2KLCA 4GB9A 2BT6A 3V61A 4IW0A 1HE8A 1OQYA 3W1SC 2K6DB 3QQ8B 1J8CA 4W9JA 2HE7A 1BT0A 1CZPA 1D5XC 3QWZB 3RNEC 3W5VB 3RYTA 1WGGA 5G55A 1UGMA 4FXCA 4LCDE 4MGZE 4L23A 4HLEA 3RZFA 4HCPB 3BVMA 3AE3B 2WDTB 2KOXA 2CU3A 3NRZA 3UF8A 1MG4A 3QA8A 3WIMA 4Q2JA 1WJNA 1YD8U 1SE2A 2KX0A 1SE9A 4JX1C 4P1BC 3RNGC 4HDQA 2K6QA 3IAM1 3RUIB 3AE1B 3RD2A 4IWOA 2NBWB 2GMIC 4K3CA 2INNE 3A1QB 2G3QB 4M0WB 1QZEA 2RPVA 2CS4A 3LYYA 2NBUA 3UINB 3VAWA 2KN4A 4IM3A 2G4DB 2WQYB 4PS7A 2JXTA 4RM9A 4XWTA 1JWSD 2LGSA 1VRAB 3CMMB 1WJ6A 1UF0A 2MW5A 2J7QB 4MH8A 3TEWA 2GI9A 3VVWB 3AE7B 4XDDA 2MHJA 2BVCA 1E8ZA 2WU2B 4MSMB 3GE3C 3ZTCA 1WGDA 4WWMA 2O6VB 1GG3A 3O65B 3VUWA 1NYQA 4ICUA 2IDYA 1C77A 2JVCA 1MHHE 1NI3A 4YTMB 2WHIA 4DXGA 3AULA 2LXAA 3PRMB 1IGCA 2DAJA 4NJCA 4OVZA 4WJNA 1JQ4A 3AEFB 4DXAB 2JRHA 2IGDA 4TKNA 4H2AA 2CJOA 2D10A 2DHZA 3TEYA 1N5XA 2AL6A 2FE8A 1EU3A 1OEYA 3H8HA 3VTUA 4REZA 5H92C 3NJTA 2AWTA 1QF6A 2SAKA 2LVQA 2G9HD 5L95C 2ZNVB 4BKGA 2KC2A 1UUPA 3QARA 4GMVA 1HZ6A 2J52A 4HWIB 2W55A 2KN5A 3A4RA 3BYTB 2K3UA 2Z0DB 1LFDA 4YSXB 4CHKA 1E90A 2YVCA 2ASQA 2LRUA 4R3DA 4EZKA 3NVZA 3KVFB 4M01A 1L6UA 1NENB 4BKSD 4YXDB 1JWAD 5GMVA 4DQOC 2LGDA 4URKA 3S2AA 4KDLB 2N9PC 3PVLA 4JPSA 4I6PA 4KGTA 2DAFA 1WM2A 1NBFC 2KWVB 4ZDVA 2AQ3B 1FO4A 3KYCD 3KYDD 3AEBB 4HDOA 3VTVA 2W54A 1D5MC 2L8JA 2HJ8A 3ZXRA 3APCA 2OJWA 1V9JA 3PSEB 2JQRB 2WXLA 2MLBA 3A33B 5C2TB 2VRRB 3I5JC 4CQNA 4W9EA 3DOWA 2E6XA 1SGHA 2BKFA 3JW0X 2DZMA 5JXVA 4K3BA 3ETRA 1BUIC 2QIEB 1EF1A 3CSFA 3HM6X 3BVGA 2KMMA 3MHSD 5HHDG 1SJED 1FNVA 1C3TA 1J0GA 3R66C 3NVYA 4ASWC 3ZW3A 5MPOA 3BK2A 3UIPB 1A5RA 4I6LB 2ON8A 1LGRA 5LNK1 3VR9B 1MJDA 1ZP0B 1C79A 2KDMA 2WP9B 3QC8B 5HG2A 2M19A 2INCC 1OEYJ 1VR9A 1B9RA 3PS6A 5EE1A 2K25A 5KHQA 4MDKE 3TCAA 1L0YB 2DNFA 2X8XX 3NUHB 4WWPA 2IJ0A 1E9MA 2KO3A 2RSUA 2JZPA 4AJWA 4BBNC 3Q2AC 2KDFB 1KRHA 4MJSB 2FUHB 1IYFA 2PLPA 3KUCB 4OVVA 2MBBB 4WH4A 2L3ZA 4FHJA 2WDVB 3PPAA 3NZ3A 2BYFA 1FRRA 2FBWB 1QOBA 3P42A 2KTRA 5BMGA 3CIRB 2DLBA 2PE9A 1EWCA 1JWMD 1AYFA 2RDBC 2D3GA 2JPHA 5FR3A 4HJKA 4C80A 3L4PA 1WZ0A 2L1AA 3VHTC 1ZPSA 3DBHB 2K8CA 1TJEA 1RFAA 4A6QA 2IYDB 2L76A 1A70A 1ET6A 1WXMA 2Y3AA 3U7ZA 3NOBA 3ZRCA 3K9PB 4LJPB 3BYYB 2WXMA 2ACZB 3HIZA 4KKIA 4RMAA 1SE4A 1STEA 1TZ1A 1X1MA 2IY0B 5E6PA 1WE7A 2DZJA 3PTFC 2BYVE 1DOYA 2KNBA 2RPQA 1QLBB 2N7EA 3AN1A 2LGXA 1WI0A 3OJ4B 5T8IA 1Z2MA 2N1WA 4TV3A 1FMAD 4ARCA 3A1QA 1PYWD 3ZJUA 4FADA 1N5WA 2KJHB 1YJJA 2WXFA 2R61A 1QOGA 3K9OB 2CU1A 2LVPA 3B2FA 3KWVA 4RH6A 3NZUA 2DBYA 3KLSX 3ML8A 4N59A 3KUDB 2KWUB 2KMCA 3ZQ4A 4AP4C 4IWPA 1Y8RC 2J42A 4GDLB 4HXDA 2IO1B 2INPE 3IG3A 1QOFA 3ZUNA 3UIOB 1R4MI 2X38A 3BZDB 3AI5A 4GOCA 3DCGA 4I6NB 2O6VA 2MX2A 3N1YC 1IPGA 2JUOA 2WXQA 2RGFA 3O13A 3V62A 4HPLB 4XE0A 1VLBA 3NVWA 4OVUA 4IDIA 3VTWA 1ZW7A 5TR5A 2XNAC 2LGIA 2QDFA 1E8XA 1F1HA 4O1NA 2YEPF 1AWDA 4WAAA 3I57A 2L05A 2NTSA 3MC8A 2WXJA 1F52A 1LM8B 1E8WA 1XCTL 1J7AA 2CHZA 5KHOA 4KVGB 3Q69A 4DXFA 4C7YA 1WH3A 1TBEA 3VH4B 1VDVA 2EKIA 4A8XC 1D4BA 3OG5A 1V49A 4RM8A 3W5UB 1IBXB 3GB1A 4WURA 2ZNVC 5JH5C 2NVUI 3APDA 2KWCA 1WJ4A 2GB1A 3NZSA 1ACCA 1XLOA 1IP9A 1WJUA 5AZGA 2R2QA 2MJEA 4MEMA 1FIQA 3WAPA 1GB4A 2W9NA 3QCAA 3VDZA 1JROA 3N1XC 1WY8A 4KV2A 2D5GA 3AEEB 1IGDA 4JIOU 2JYTA 3ZO5B 1C9FA 2DYBA 1WF9A 5EE9A 4C00A 2BQQA 3MJ5A 1I35A 5JHBA 4IKGA 3IT4B 1KM7A 3AEGB 4YT0B 4JQWC 1N6ZA 4NQLB 2V1YA 1TIFA 2V9HA 3ZXVA 2JX5A 1FXAA 4A90A 3N9YC 1PDXA 3AE9B 3NVVA 1LO5D 4G50A 4WQMA 3TJPA 2KWDA 1R4NI 3EC8A 2ZCBA 3IAS1 2JYEA 4HPPA 5H8YE 5D94A 1ZOYB 3LDZE 2V0GA 2WYQA 3VR8B 1P0RA 4YTNB 3M62B 2LI5A 1FEHA 1T0SC 2ZVNA 1F2RC 4JWSC 2JT4B 3AU4A 4HJGE 3IVFA 2W3SA 4EEWA 4P7IA 2C7MB 1E7VA 1WRDB 3WANA 1ZE3D 3AB5A 4IM0A 2XEWA 4S17A 2K1FA 3KWLA 2KQ7A 3DHHC 4USAA 2MRPA 4LTUA 5EE3A 2EMSA 5BO4B 3TMPB 2RR9A 3ONSA 1BXTA 4MJSA 2INDC 3BWUD 4F1SA 4WWNA 2K8BA 4US8A 2IY1B 3P4RB 5AZHA 3H7PB 3DPDA 4ITKA 1I7HA 2JWZA 4G11A 2WLBA 4PS8A 3P1MA 1WMHB 2MJ3A 1SIFA 4FA6A 1NYRA 4JGHB 2HDEA 1T3QA 4XDCA 1WGHA 1JRPA 3URYA 4KSKC 4XZ4A 3TSSA 1XXGA 1EWYC 4K7SA 3DBRI 3IFWB 2IGGA 4FBJB 1JALA 3IXSA 4HEA1 4AUQC 2KVZA 2L0FA 3T9LA 3Q3FA 4WJQA 4ZHPA 3ZNGC 2BB6A 3JVZX 3AH7A 3KH0A 2C7HA 3AE5B 1FXIA 1U4AA 4LDTB 3ENEA 2MQJA 4TQ0A 2AEHA 4TMAB 1T0RC 3IHPC 2GBJA 4P1CC 4IC7B 1MPEA 1WX7A 4RF1A 4ZRIA 1GB1A 3DBLI 3FILB 1WZ3A 3JSVB 1VZ6A 3C19A 3I3TB 2FAZA 3Q8CA 4P6VF 2PVGC 2A5UA 2ZJDA 4MACA 1YX6B 2M1MA 3TBLD 4W9DA 3MC0B 1FRDA 1Z5SB 2NCNA 5BYQA 2JY6A 4C4VB 2UWQA 2NTTA 3MP9A 5BMHA 5IP4D 1V2YA 3SD5A 4KKJA 1EM7A 2A4ZA 4HK2A 3QJZA 2CKHB 1HXYD 3N30A 4TQ1A 3U4EG 1WYWB 1SSNA 4C7ZA 1V8CA 4GDLA 5D6JB 3NHEB 2HTHA 1YMHE 3TL5A 1T0QC 4NJ7A 4TSSA 4OHJA 2L0TA 1SE3A 3ZNZB 2OEDA 2G45B 2GLSA 3EGRA 2LJ5A 1GOZA 2PEAA 3UQBA 2KXJA 2LRWA 3CWIA 2WDQB 2L00B 2N4FA 4GU2A 4ZRQA 2DENB 4DDGD 2W82A 1YN5A 4LNIA 1ET9A 3VFKA 1P1AA 4LK0M 1UBIA 3M3JA 2IO3B 2GBKA 3PZ8A 2WGSA 2O2VB 3WALA 4DHZE 2KC1A 2KK8A 4EE2A 2C7NB 1AN8A 1IBXA 5C23A 3RNBC 5LXHA 5IKCM 4A9AA 1OTRB 1LQBA 4K81A 3VRAB 2BPSA 2KQ4X 2BKRB 1HTOA 4GXBA 4GLSC 1ENFA 1DGJA 3Q14C 5AUIA 2L83A 1GPXA 2VH1A 1MI0A 2KJRA 2NPTA 3ZYYX 2J0MA 1JMLA 1ZXHA 1L5PA 2WNMA 1UNSA 1C4PA
chains in the Genus database with same CATH topology
1WE6A 1WX9A 2GBRA 4KZ0A 1V81A 2RPQA 2LD9A 2N7EA 3M63B 2LGXA 1WI0A 2R2OA 4EZLA 4GIVA 3OJ4B 1Z2MA 1LXDA 2N1WA 4TV3A 2KX3A 4N9F4 1FXTB 4HCNB 4AWJA 3HM3A 5E6OA 1V86A 1UH6A 2EKEC 3A1QA 2KD0A 4MM3A 2KFKB 5DPSA 4BOZB 1S1QB 1MG8A 2KJHB 4FADA 3DVNV 4ANVA 3A4SC 1M94A 4BVUC 2M8SA 3K9OB 2CU1A 1CMXB 2LVPA 4FLHA 3R3MA 4TUUA 3NZUA 3RULA 3ML8A 1P9DU 2KWUB 3KUDB 1WX8A 5G2NA 2FCNA 2KMCA 5CHWA 2KFKA 3V60A 4AP4C 4IWPA 3QHTA 4MGYE 2KVRA 1Y8RC 4KSLC 3A9JB 4A3PA 4GDLB 4HXDA 4GN1A 2FCMA 2IO1B 2KFJA 3IG3A 5HKHA 3OLMD 5CTRC 4NQKE 4GDKA 3ZUNA 2ZPNA 2MCNB 3UIOB 3SDLC 1R4MI 4M8NA 3R7RA 2K8HA 4KZCA 4ZRJA 3AI5A 3PHWB 4WJOA 4GOCA 1WIAA 2FIFA 3DCGA 4MH0E 4I6NB 1E8YA 1EO6A 1H4RA 2O6VA 2MX2A 3EECA 1IPGA 2JUOA 4F8CB 2BGFA 2XBBC 4JLCA 4W9LA 1OGWA 2RGFA 3OJ3A 2MP2A 2IO2B 4DDID 1UELA 5IAAC 4HPLB 3H7SA 3V62A 4LDTD 2LGYA 2KDBA 3CF6E 4OVUA 3H6NA 3VTWA 1ZW7A 4AOFA 2MBEA 5TR5A 2G4SA 1I42A 2CHXA 2WWZA 4BFRA 1E8XA 5AZFA 2KTRB 2JXXA 4KIKB 1WXSA 1XD3B 2MA9B 1WFYA 2REXA 4XX5A 4WAAA 1WGRA 2N9EB 4NJ6A 4WWOA 2YLMA 3W1YA 4EZJA 2XK5B 2L05A 2NBVB 3ECIA 4E3CA 4W9CA 4EOYA 4W9HA 5KHOA 1LM8B 1E8WA 2CHZA 3GOEA 3JYUA 4AJYB 4KVGB 1WH3A 1TBEA 3EFUA 4DBGA 2M17A 3W1SA 3VH4B 4PYZA 2KLCA 4GB9A 4WQOB 3DVGY 3V61A 4IW0A 1HE8A 1OQYA 3QX1A 4MELA 1V49A 2N9XA 4LJOB 3W1SC 2K6DB 3PRZA 4PS3A 3H1UA 1WR1A 3QQ8B 3B1LX 4RM8A 4W9JA 5CX3A 1J8CA 2HE7A 1BT0A 1L2NA 3QWZB 3RZWC 4II3B 2ZNVC 5JH5C 1YQBA 2NVUI 3RYTA 2RD0A 1WGGA 5G55A 1UGMA 3APDA 4LCDE 2DYOA 4MGZE 2KWCA 1F9JA 1WJ4A 1P98A 2WX1A 5DCNA 4NAWB 2J0JA 3NZSA 5D2MB 5DPRA 3WAOA 4HLEA 4ZYNA 4XC2A 2ZVOA 2C9WB 2JRIB 3RZFA 4HCPB 1V6EA 2KOXA 2WDTB 4M8MA 3ZNID 3X23A 1WR6E 3L08A 3UF8A 2Z0EB 1IP9A 2V4LA 3QA8A 3WIMA 1WJUA 1WJNA 1VCBA 5AZGA 2R2QA 1YD8U 1XT9B 2KX0A 3KUZA 4MEMA 3WAPA 1SE9A 3ALBA 3ZRFA 3L0WB 2W9NA 1V5TA 1UZXB 3H7PA 3QCAA 4HDQA 2K6QA 3RUIB 3VDZA 3RD2A 1WY8A 2ZZPB 3DBHI 4KV2A 1WMHA 4IWOA 4NNJB 4ZRKA 2NBWB 2GMIC 4HPMB 1GC7A 2JZ3B 2MBHA 4DWFA 3A1QB 3MTNB 4JIOU 3DVNU 4BOSC 2G3QB 3ZIMA 4E71A 1ISNA 1QZEA 2J0KA 4M0WB 3ZO5B 5C1ZA 1GC6A 2DYBA 2CS4A 1PQSA 1WF9A 2DX5B 2NBUA 3UINB 3VAWA 1I35A 1NI2A 1J19A 2G4DB 4IM3A 2WX0A 3ZVVA 5JHBA 5AEKB 4PS7A 2DZIA 4RM9A 4ANWA 1KM7A 1WXAA 2I1KA 1GNUA 3V6CB 3CMMB 4E74A 4JQWC 2JZZA 4GGQA 1WJ6A 4NQLB 2V1YA 3DDCB 4GDKB 2LWPA 2MW5A 2J7QB 4DHJD 2BWES 4B6WA 3VVWB 5J2RA 3CSTA 4HVBA 1E8ZA 4MSMB 5D7GA 2LASA 3V6EB 3ZTCA 1WGDA 2M0XA 2KLGA 2O6VB 4B95A 1GG3A 1AARA 3JSVA 3M95A 3O65B 4G50A 3TJPA 3VUWA 2IBIB 3VXWA 2KMAA 2MP2B 3A9KA 3EC8A 1R4NI 4ICVA 2ZCBA 4ICUA 2JVCA 3PZDA 5D94A 3U30A 3LDZE 3GZNI 3L10B 1KLVA 2WYQA 1RLFA 1P0RA 3AULA 2LXAA 3PRMB 3M62B 5L83A 2DAJA 2LI5A 3IBEA 2ZVNA 4WJNA 1KOTA 1JRUA 2FIDA 4IM2A 3ZTDA 4DXAB 2JRHA 4TKNA 3PLUA 2JT4B 2D10A 2DHZA 2MWSB 3AU4A 2AL6A 4FJZA 4MSQB 1OEYA 2PE6B 2DYMA 4WJPA 3IVFA 4A3OA 3VTUA 4DHZB 4EEWA 2KKCA 4P7IA 2C7MB 2KDEB 1E7VA 1WRDB 2D07B 2GBNA 3WANA 3PRPB 3WAMA 1G6JA 3VQIA 4IM0A 2AWTA 2LVQA 5L95C 2DZKA 4ANXA 2ZNVB 4BKGA 2KC2A 2XEWA 3QARA 4GMVA 4K1RB 2K1FA 3KW5B 1P3QU 3D32A 4HWIB 2IZVB 2KQ7A 4FJYA 2KANA 2MRPA 2KN5A 3A4RA 2V3SA 2Z0DB 1LFDA 3P2BA 2EMSA 2MSED 5BO4B 1YIWA 2IO0B 3ZKJC 5DPTA 4CHKA 3TMPB 1E90A 2YVCA 2RR9A 3ONSA 2ASQA 5JHAA 4IG7B 3EHVA 4MJSA 5CHVC 2CHWA 2LRUA 2N7DA 3APFA 4EZKA 3KVFB 4F1SA 2Y5BB 3B08A 4FULA 4WWNA 5FR6A 2K8BA 1EF5A 4BKSD 2IY1B 4A20A 1YJ1A 5AZHA 5GMVA 2L7RA 3H7PB 4EUTA 3DPDA 2JWZA 4G11A 2KTFA 4PS8A 2LGDA 3AXCA 4URKA 1WMHB 3X0WA 3S2AA 2D2QA 4KDLB 2N9PC 3PVLA 1SIFA 1V80A 4FA6A 5J18A 4I6PA 4JGHB 3UGBB 2DAFA 1WM2A 4G3XB 1WGHA 1VD2A 2C5LC 1NDDA 3T8MA 2KDIA 1NBFC 2KWVB 4KSKC 4XZ4A 4ZDVA 4K7SA 3DBRI 1XQQA 3C0RB 1Q5WB 3IFWB 4CYEA 4FBJB 3KYCD 3KYDD 4FN2A 4HDOA 3RCZA 3VTVA 4AUQC 4BKTA 3LJ3A 1WM3A 2O2VA 4MGIE 3WA0A 5DPWA 2L0FA 2L8JA 3T9LA 5IA7A 3Q3FA 1TGZB 4WJQA 3ZNGC 2HJ8A 1RRBA 2KZRA 3JVZX 3APCA 1T0YA 2KJ6A 4BBNF 3KH0A 2C7HA 1U4AA 4LDTB 2UYZB 3L17A 3ENEA 2MQJA 1V9JA 3PSEB 4TQ0A 2AEHA 3IHPC 2GBJA 4W9GA 3R7QA 2MLBA 4IC7B 3A33B 4F7ZA 1WX7A 2VRRB 1ZGUB 4ZRIA 1V5OA 3DBLI 3DOWA 4W9EA 1SGHA 2BKFA 3SHQA 3JW0X 4J6IA 2DZMA 2OJRA 1WZ3A 5LLIA 3JSVB 3U7DA 3I3TB 2FNJB 3VH3B 1EF1A 2FAZA 3A9KB 3NY5A 2I1JA 3QK0A 3CSFA 3HM6X 2B3AA 3ZNHB 2A5UA 3MHSD 2ZJDA 1L7YA 3ML9A 1YX6B 1J0GA 4ANUA 2M1MA 3NS8A 1C3TA 3N32A 3TBLD 4DK5A 3R66C 3H9DA 4ASWC 3PHXB 3ZW3A 4W9DA 1Q1OA 4K7WA 3UIPB 1A5RA 4CO7A 4I6LB 2JF5A 1Z5SB 2NCNA 3AU5A 3PLVA 2JY6A 2LZ6A 2UWQA 1TTNA 3RT3B 1E7UA 3OAWA 3HK0A 3U8ZA 1V2YA 2PPHA 2D11A 3SD5A 2ZCCA 2ZEQA 2A4ZA 4HK2A 3QJZA 2CKHB 4JL9A 3QC8B 3N30A 2EMTA 4TQ1A 1OEYJ 1WXVA 1WYWB 3PS6A 1E5WA 1UD7A 2K25A 5KHQA 1KJTA 4MDKE 2FCQA 3TCAA 3A9JA 4GDLA 5D6JB 3NHEB 2HTHA 4BKSA 3TL5A 4NJ7A 3Q3JA 1D3ZA 3PGEA 2GBMA 3HHMA 2HD5B 2KO3A 4PYUA 4WWPA 4EFOA 2RSUA 2L0TA 4W9KA 3ZNZB 1C1YB 2N1VA 4AJWA 1S3SG 4BBNC 4KDIC 4FJVB 3PT2B 1ZKHA 2FCSA 2CR5A 2G45B 3UQAA 2KDFB 3B0AA 4YL8A 4MJSB 2FUHB 2LJ5A 1RAXA 2PEAA 4IUMB 1IYFA 3UQBA 2KXJA 2KQSA 2LUEA 3KUCB 4OVVA 1H8CA 2MBBB 2ZPYA 2BYEA 2LRWA 2L3ZA 4NY0A 5CHFA 4FHJA 4W9IA 3VUXA 1Q0WB 2L00B 3PPAA 5LXIB 2BYFA 4G0NB 2QHOA 2N4FA 4IWQA 1UBQA 4GU2A 3MJWA 2NR2A 2KTRA 4KIKA 2DENB 4X57B 2KHWB 3L13A 4DDGD 2NS5A 2O6VD 2K39A 2PE9A 2XK5A 3PV1A 1P1AA 3VFKA 5E6NA 1UBIA 4DHJB 1K8RB 3M3JA 4K7UA 2IO3B 2GBKA 3ZLZA 4W9FA 2D3GA 2JPHA 3DVGX 4GSWA 4HJKA 5EDSA 2MBQA 5J17A 2O2VB 1WZ0A 3VHTC 3WALA 2OOBB 3DBSA 4DHZE 2KC1A 5JZEB 2K8CA 3ZDTA 2KK8A 3PREA 2C7NB 2LVOA 1RFAA 4II2B 2IYDB 2AL3A 1EUVB 5C23A 5LXHA 3N3KB 1OTRB 1LQBA 2L76A 4FHKA 4K81A 1GJZA 2BPSA 2Z59B 4NPNA 2LXCA 4B9KA 1WXMA 2NPTB 3L54A 1GUAB 2BWFA 3BINA 2BKRB 3VUYA 3L16A 3ZDMC 2GOWA 3NOBA 2C60A 3K9PB 4LJPB 4NAWA 1YX5B 4GXBA 3ZRCA 2PJHA 3TIXA 3HIZA 4RMAA 3SU8X 1TZ1A 3QIJA 3DQVA 1X1MA 2MBOA 4EKUA 2IY0B 2KJRA 4MGKE 2NPTA 5E6PA 1WE7A 2AYOB 2J0MA 3BY4B 3QAQA 2BF8B 1WGYA 2DZJA 3PTFC 2BYVE 2M4NA 2KNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE6 A;  1WX9 A;  2GBR A;  4KZ0 A;  1V81 A;  2RPQ A;  2LD9 A;  2N7E A;  3M63 B;  2LGX A;  1WI0 A;  2R2O A;  4EZL A;  4GIV A;  3OJ4 B;  1Z2M A;  1LXD A;  2N1W A;  4TV3 A;  2KX3 A;  4N9F 4;  1FXT B;  4HCN B;  4AWJ A;  3HM3 A;  5E6O A;  1V86 A;  1UH6 A;  2EKE C;  3A1Q A;  2KD0 A;  4MM3 A;  2KFK B;  5DPS A;  4BOZ B;  1S1Q B;  1MG8 A;  2KJH B;  4FAD A;  3DVN V;  4ANV A;  3A4S C;  1M94 A;  4BVU C;  2M8S A;  3K9O B;  2CU1 A;  1CMX B;  2LVP A;  4FLH A;  3R3M A;  4TUU A;  3NZU A;  3RUL A;  3ML8 A;  1P9D U;  2KWU B;  3KUD B;  1WX8 A;  5G2N A;  2FCN A;  2KMC A;  5CHW A;  2KFK A;  3V60 A;  4AP4 C;  4IWP A;  3QHT A;  4MGY E;  2KVR A;  1Y8R C;  4KSL C;  3A9J B;  4A3P A;  4GDL B;  4HXD A;  4GN1 A;  2FCM A;  2IO1 B;  2KFJ A;  3IG3 A;  5HKH A;  3OLM D;  5CTR C;  4NQK E;  4GDK A;  3ZUN A;  2ZPN A;  2MCN B;  3UIO B;  3SDL C;  1R4M I;  4M8N A;  3R7R A;  2K8H A;  4KZC A;  4ZRJ A;  3AI5 A;  3PHW B;  4WJO A;  4GOC A;  1WIA A;  2FIF A;  3DCG A;  4MH0 E;  4I6N B;  1E8Y A;  1EO6 A;  1H4R A;  2O6V A;  2MX2 A;  3EEC A;  1IPG A;  2JUO A;  4F8C B;  2BGF A;  2XBB C;  4JLC A;  4W9L A;  1OGW A;  2RGF A;  3OJ3 A;  2MP2 A;  2IO2 B;  4DDI D;  1UEL A;  5IAA C;  4HPL B;  3H7S A;  3V62 A;  4LDT D;  2LGY A;  2KDB A;  3CF6 E;  4OVU A;  3H6N A;  3VTW A;  1ZW7 A;  4AOF A;  2MBE A;  5TR5 A;  2G4S A;  1I42 A;  2CHX A;  2WWZ A;  4BFR A;  1E8X A;  5AZF A;  2KTR B;  2JXX A;  4KIK B;  1WXS A;  1XD3 B;  2MA9 B;  1WFY A;  2REX A;  4XX5 A;  4WAA A;  1WGR A;  2N9E B;  4NJ6 A;  4WWO A;  2YLM A;  3W1Y A;  4EZJ A;  2XK5 B;  2L05 A;  2NBV B;  3ECI A;  4E3C A;  4W9C A;  4EOY A;  4W9H A;  5KHO A;  1LM8 B;  1E8W A;  2CHZ A;  3GOE A;  3JYU A;  4AJY B;  4KVG B;  1WH3 A;  1TBE A;  3EFU A;  4DBG A;  2M17 A;  3W1S A;  3VH4 B;  4PYZ A;  2KLC A;  4GB9 A;  4WQO B;  3DVG Y;  3V61 A;  4IW0 A;  1HE8 A;  1OQY A;  3QX1 A;  4MEL A;  1V49 A;  2N9X A;  4LJO B;  3W1S C;  2K6D B;  3PRZ A;  4PS3 A;  3H1U A;  1WR1 A;  3QQ8 B;  3B1L X;  4RM8 A;  4W9J A;  5CX3 A;  1J8C A;  2HE7 A;  1BT0 A;  1L2N A;  3QWZ B;  3RZW C;  4II3 B;  2ZNV C;  5JH5 C;  1YQB A;  2NVU I;  3RYT A;  2RD0 A;  1WGG A;  5G55 A;  1UGM A;  3APD A;  4LCD E;  2DYO A;  4MGZ E;  2KWC A;  1F9J A;  1WJ4 A;  1P98 A;  2WX1 A;  5DCN A;  4NAW B;  2J0J A;  3NZS A;  5D2M B;  5DPR A;  3WAO A;  4HLE A;  4ZYN A;  4XC2 A;  2ZVO A;  2C9W B;  2JRI B;  3RZF A;  4HCP B;  1V6E A;  2KOX A;  2WDT B;  4M8M A;  3ZNI D;  3X23 A;  1WR6 E;  3L08 A;  3UF8 A;  2Z0E B;  1IP9 A;  2V4L A;  3QA8 A;  3WIM A;  1WJU A;  1WJN A;  1VCB A;  5AZG A;  2R2Q A;  1YD8 U;  1XT9 B;  2KX0 A;  3KUZ A;  4MEM A;  3WAP A;  1SE9 A;  3ALB A;  3ZRF A;  3L0W B;  2W9N A;  1V5T A;  1UZX B;  3H7P A;  3QCA A;  4HDQ A;  2K6Q A;  3RUI B;  3VDZ A;  3RD2 A;  1WY8 A;  2ZZP B;  3DBH I;  4KV2 A;  1WMH A;  4IWO A;  4NNJ B;  4ZRK A;  2NBW B;  2GMI C;  4HPM B;  1GC7 A;  2JZ3 B;  2MBH A;  4DWF A;  3A1Q B;  3MTN B;  4JIO U;  3DVN U;  4BOS C;  2G3Q B;  3ZIM A;  4E71 A;  1ISN A;  1QZE A;  2J0K A;  4M0W B;  3ZO5 B;  5C1Z A;  1GC6 A;  2DYB A;  2CS4 A;  1PQS A;  1WF9 A;  2DX5 B;  2NBU A;  3UIN B;  3VAW A;  1I35 A;  1NI2 A;  1J19 A;  2G4D B;  4IM3 A;  2WX0 A;  3ZVV A;  5JHB A;  5AEK B;  4PS7 A;  2DZI A;  4RM9 A;  4ANW A;  1KM7 A;  1WXA A;  2I1K A;  1GNU A;  3V6C B;  3CMM B;  4E74 A;  4JQW C;  2JZZ A;  4GGQ A;  1WJ6 A;  4NQL B;  2V1Y A;  3DDC B;  4GDK B;  2LWP A;  2MW5 A;  2J7Q B;  4DHJ D;  2BWE S;  4B6W A;  3VVW B;  5J2R A;  3CST A;  4HVB A;  1E8Z A;  4MSM B;  5D7G A;  2LAS A;  3V6E B;  3ZTC A;  1WGD A;  2M0X A;  2KLG A;  2O6V B;  4B95 A;  1GG3 A;  1AAR A;  3JSV A;  3M95 A;  3O65 B;  4G50 A;  3TJP A;  3VUW A;  2IBI B;  3VXW A;  2KMA A;  2MP2 B;  3A9K A;  3EC8 A;  1R4N I;  4ICV A;  2ZCB A;  4ICU A;  2JVC A;  3PZD A;  5D94 A;  3U30 A;  3LDZ E;  3GZN I;  3L10 B;  1KLV A;  2WYQ A;  1RLF A;  1P0R A;  3AUL A;  2LXA A;  3PRM B;  3M62 B;  5L83 A;  2DAJ A;  2LI5 A;  3IBE A;  2ZVN A;  4WJN A;  1KOT A;  1JRU A;  2FID A;  4IM2 A;  3ZTD A;  4DXA B;  2JRH A;  4TKN A;  3PLU A;  2JT4 B;  2D10 A;  2DHZ A;  2MWS B;  3AU4 A;  2AL6 A;  4FJZ A;  4MSQ B;  1OEY A;  2PE6 B;  2DYM A;  4WJP A;  3IVF A;  4A3O A;  3VTU A;  4DHZ B;  4EEW A;  2KKC A;  4P7I A;  2C7M B;  2KDE B;  1E7V A;  1WRD B;  2D07 B;  2GBN A;  3WAN A;  3PRP B;  3WAM A;  1G6J A;  3VQI A;  4IM0 A;  2AWT A;  2LVQ A;  5L95 C;  2DZK A;  4ANX A;  2ZNV B;  4BKG A;  2KC2 A;  2XEW A;  3QAR A;  4GMV A;  4K1R B;  2K1F A;  3KW5 B;  1P3Q U;  3D32 A;  4HWI B;  2IZV B;  2KQ7 A;  4FJY A;  2KAN A;  2MRP A;  2KN5 A;  3A4R A;  2V3S A;  2Z0D B;  1LFD A;  3P2B A;  2EMS A;  2MSE D;  5BO4 B;  1YIW A;  2IO0 B;  3ZKJ C;  5DPT A;  4CHK A;  3TMP B;  1E90 A;  2YVC A;  2RR9 A;  3ONS A;  2ASQ A;  5JHA A;  4IG7 B;  3EHV A;  4MJS A;  5CHV C;  2CHW A;  2LRU A;  2N7D A;  3APF A;  4EZK A;  3KVF B;  4F1S A;  2Y5B B;  3B08 A;  4FUL A;  4WWN A;  5FR6 A;  2K8B A;  1EF5 A;  4BKS D;  2IY1 B;  4A20 A;  1YJ1 A;  5AZH A;  5GMV A;  2L7R A;  3H7P B;  4EUT A;  3DPD A;  2JWZ A;  4G11 A;  2KTF A;  4PS8 A;  2LGD A;  3AXC A;  4URK A;  1WMH B;  3X0W A;  3S2A A;  2D2Q A;  4KDL B;  2N9P C;  3PVL A;  1SIF A;  1V80 A;  4FA6 A;  5J18 A;  4I6P A;  4JGH B;  3UGB B;  2DAF A;  1WM2 A;  4G3X B;  1WGH A;  1VD2 A;  2C5L C;  1NDD A;  3T8M A;  2KDI A;  1NBF C;  2KWV B;  4KSK C;  4XZ4 A;  4ZDV A;  4K7S A;  3DBR I;  1XQQ A;  3C0R B;  1Q5W B;  3IFW B;  4CYE A;  4FBJ B;  3KYC D;  3KYD D;  4FN2 A;  4HDO A;  3RCZ A;  3VTV A;  4AUQ C;  4BKT A;  3LJ3 A;  1WM3 A;  2O2V A;  4MGI E;  3WA0 A;  5DPW A;  2L0F A;  2L8J A;  3T9L A;  5IA7 A;  3Q3F A;  1TGZ B;  4WJQ A;  3ZNG C;  2HJ8 A;  1RRB A;  2KZR A;  3JVZ X;  3APC A;  1T0Y A;  2KJ6 A;  4BBN F;  3KH0 A;  2C7H A;  1U4A A;  4LDT B;  2UYZ B;  3L17 A;  3ENE A;  2MQJ A;  1V9J A;  3PSE B;  4TQ0 A;  2AEH A;  3IHP C;  2GBJ A;  4W9G A;  3R7Q A;  2MLB A;  4IC7 B;  3A33 B;  4F7Z A;  1WX7 A;  2VRR B;  1ZGU B;  4ZRI A;  1V5O A;  3DBL I;  3DOW A;  4W9E A;  1SGH A;  2BKF A;  3SHQ A;  3JW0 X;  4J6I A;  2DZM A;  2OJR A;  1WZ3 A;  5LLI A;  3JSV B;  3U7D A;  3I3T B;  2FNJ B;  3VH3 B;  1EF1 A;  2FAZ A;  3A9K B;  3NY5 A;  2I1J A;  3QK0 A;  3CSF A;  3HM6 X;  2B3A A;  3ZNH B;  2A5U A;  3MHS D;  2ZJD A;  1L7Y A;  3ML9 A;  1YX6 B;  1J0G A;  4ANU A;  2M1M A;  3NS8 A;  1C3T A;  3N32 A;  3TBL D;  4DK5 A;  3R66 C;  3H9D A;  4ASW C;  3PHX B;  3ZW3 A;  4W9D A;  1Q1O A;  4K7W A;  3UIP B;  1A5R A;  4CO7 A;  4I6L B;  2JF5 A;  1Z5S B;  2NCN A;  3AU5 A;  3PLV A;  2JY6 A;  2LZ6 A;  2UWQ A;  1TTN A;  3RT3 B;  1E7U A;  3OAW A;  3HK0 A;  3U8Z A;  1V2Y A;  2PPH A;  2D11 A;  3SD5 A;  2ZCC A;  2ZEQ A;  2A4Z A;  4HK2 A;  3QJZ A;  2CKH B;  4JL9 A;  3QC8 B;  3N30 A;  2EMT A;  4TQ1 A;  1OEY J;  1WXV A;  1WYW B;  3PS6 A;  1E5W A;  1UD7 A;  2K25 A;  5KHQ A;  1KJT A;  4MDK E;  2FCQ A;  3TCA A;  3A9J A;  4GDL A;  5D6J B;  3NHE B;  2HTH A;  4BKS A;  3TL5 A;  4NJ7 A;  3Q3J A;  1D3Z A;  3PGE A;  2GBM A;  3HHM A;  2HD5 B;  2KO3 A;  4PYU A;  4WWP A;  4EFO A;  2RSU A;  2L0T A;  4W9K A;  3ZNZ B;  1C1Y B;  2N1V A;  4AJW A;  1S3S G;  4BBN C;  4KDI C;  4FJV B;  3PT2 B;  1ZKH A;  2FCS A;  2CR5 A;  2G45 B;  3UQA A;  2KDF B;  3B0A A;  4YL8 A;  4MJS B;  2FUH B;  2LJ5 A;  1RAX A;  2PEA A;  4IUM B;  1IYF A;  3UQB A;  2KXJ A;  2KQS A;  2LUE A;  3KUC B;  4OVV A;  1H8C A;  2MBB B;  2ZPY A;  2BYE A;  2LRW A;  2L3Z A;  4NY0 A;  5CHF A;  4FHJ A;  4W9I A;  3VUX A;  1Q0W B;  2L00 B;  3PPA A;  5LXI B;  2BYF A;  4G0N B;  2QHO A;  2N4F A;  4IWQ A;  1UBQ A;  4GU2 A;  3MJW A;  2NR2 A;  2KTR A;  4KIK A;  2DEN B;  4X57 B;  2KHW B;  3L13 A;  4DDG D;  2NS5 A;  2O6V D;  2K39 A;  2PE9 A;  2XK5 A;  3PV1 A;  1P1A A;  3VFK A;  5E6N A;  1UBI A;  4DHJ B;  1K8R B;  3M3J A;  4K7U A;  2IO3 B;  2GBK A;  3ZLZ A;  4W9F A;  2D3G A;  2JPH A;  3DVG X;  4GSW A;  4HJK A;  5EDS A;  2MBQ A;  5J17 A;  2O2V B;  1WZ0 A;  3VHT C;  3WAL A;  2OOB B;  3DBS A;  4DHZ E;  2KC1 A;  5JZE B;  2K8C A;  3ZDT A;  2KK8 A;  3PRE A;  2C7N B;  2LVO A;  1RFA A;  4II2 B;  2IYD B;  2AL3 A;  1EUV B;  5C23 A;  5LXH A;  3N3K B;  1OTR B;  1LQB A;  2L76 A;  4FHK A;  4K81 A;  1GJZ A;  2BPS A;  2Z59 B;  4NPN A;  2LXC A;  4B9K A;  1WXM A;  2NPT B;  3L54 A;  1GUA B;  2BWF A;  3BIN A;  2BKR B;  3VUY A;  3L16 A;  3ZDM C;  2GOW A;  3NOB A;  2C60 A;  3K9P B;  4LJP B;  4NAW A;  1YX5 B;  4GXB A;  3ZRC A;  2PJH A;  3TIX A;  3HIZ A;  4RMA A;  3SU8 X;  1TZ1 A;  3QIJ A;  3DQV A;  1X1M A;  2MBO A;  4EKU A;  2IY0 B;  2KJR A;  4MGK E;  2NPT A;  5E6P A;  1WE7 A;  2AYO B;  2J0M A;  3BY4 B;  3QAQ A;  2BF8 B;  1WGY A;  2DZJ A;  3PTF C;  2BYV E;  2M4N A;  2KNB A; 
#chains in the Genus database with same CATH topology
 1WE6 A;  1V81 A;  2SEB D;  1LXD A;  2KX3 A;  4N9F 4;  3NS1 A;  4HCN B;  1TS3 A;  2PIA A;  5E6O A;  3C8Y A;  1UH6 A;  1MVK A;  4RFB A;  2EKE C;  2BTE A;  2KFK B;  1E10 A;  4ANV A;  3A4S C;  2M8S A;  4FLH A;  1N61 A;  2N9K A;  4TUU A;  1WX8 A;  5CHW A;  3A9J B;  2KFJ A;  4YSY B;  1RM6 C;  5CTR C;  4RGO S;  1N62 A;  1TT5 B;  1L0V B;  1Q10 A;  3RN9 C;  1HTQ A;  3R7R A;  1FD6 A;  3B2G A;  3I9V 1;  3MC9 A;  1WSP A;  2BW2 A;  2FIF A;  1C78 A;  4MH0 E;  4JE3 B;  2D3A A;  1H4R A;  3AEA B;  2ICI A;  3EEC A;  3ZGZ A;  2XBB C;  4W9L A;  3OJ3 A;  2IO2 B;  1VZ7 A;  3H6N A;  2J53 A;  1I42 A;  4BFR A;  1K50 A;  4KIK B;  3HRD D;  1R7S A;  1XD3 B;  1WFY A;  2REX A;  1WGR A;  1CQV A;  4EZJ A;  2XK5 B;  2NBV B;  3W2D A;  1DYQ A;  4EOY A;  2AX5 A;  3EFU A;  1T6B X;  4WQO B;  3DVG Y;  4A55 A;  3QX1 A;  4KGR A;  1M4V A;  3Q8A A;  3PRZ A;  4PS3 A;  1WR1 A;  5CX3 A;  1L2N A;  3DWG C;  3UI3 A;  2RDG A;  3RZW C;  4M02 A;  1YQB A;  1ZDV A;  2NMQ A;  3ZJT A;  3E56 A;  2D3C A;  2DYO A;  2WX1 A;  5DCN A;  2J0J A;  3WAO A;  4ZYN A;  4XC2 A;  1V6E A;  2JU6 X;  3ZNI D;  3X23 A;  3VRB B;  1RWS A;  2V4L A;  5FK9 C;  2VH2 A;  1VCB A;  3L0W B;  1V5T A;  3H7P A;  3R2T A;  1QOA A;  1WMH A;  2KAJ A;  4HPM B;  2JZ3 B;  2MBH A;  2QIL A;  3MTN B;  1L6V A;  1BML C;  3DVN U;  4MM3 B;  3ZIM A;  1ISN A;  2J0K A;  2QCZ A;  2DX5 B;  1PQS A;  2LHE A;  1NI2 A;  3ZVV A;  2WX0 A;  2DZI A;  1XLN A;  2ONQ A;  1WXA A;  3R8B A;  4M0W A;  3GS2 A;  3V6C B;  4E74 A;  2JZZ A;  4GGQ A;  4N6E B;  3DDC B;  2WXO A;  4DHJ D;  1NVI D;  3FAH A;  4NAM A;  3CST A;  4HVB A;  3FIL A;  3R2I A;  2H88 B;  1YNT E;  5D7G A;  2BBC A;  2M0X A;  4B95 A;  1AAR A;  3JSV A;  3VXW A;  2KMA A;  2MP2 B;  1SIJ A;  3PZD A;  2WXP A;  3U30 A;  3GZN I;  3L10 B;  1OQR A;  1RLF A;  3GE8 C;  4OZC A;  2CJN A;  3PO0 A;  1D6E C;  1KOT A;  2FID A;  1N60 A;  4C4V A;  1B1Z A;  2PE6 B;  2DYM A;  4WJP A;  1TKE A;  4DHZ B;  2KKC A;  3AEC B;  2VZK D;  2I38 A;  2KDE B;  2D07 B;  2TSS A;  1TS5 A;  1C76 A;  4ANX A;  1HZ5 A;  3ZJV A;  1XLQ A;  4K1R B;  3KW5 B;  4XWW A;  4LNN A;  1P3Q U;  3J9C A;  4FJY A;  3P2B A;  1YIW A;  3ZKJ C;  5DPT A;  1RYJ A;  1ROE A;  1P7E A;  4IG7 B;  3EHV A;  2CHW A;  3APF A;  4ZHO A;  4AS1 A;  1QQR A;  4BAX A;  1CK1 A;  1HQR D;  4FUL A;  1KLU D;  4ZYS A;  1SEB D;  2WXN A;  4A20 A;  3N20 C;  1TZO A;  2L7R A;  4EUT A;  1YQ4 B;  2KTF A;  1TS4 A;  3V3X A;  3AXC A;  2BB5 A;  2J4X A;  2OHF A;  2WDR B;  2D2Q A;  1V80 A;  5J18 A;  5BMI A;  4G3X B;  1VD2 A;  3RNF C;  1PGA A;  2V3N A;  1NDD A;  2KDI A;  1XF5 L;  2FUG 1;  1XQQ A;  1Q5W B;  4BKT A;  4MGI E;  1WM3 A;  2O2V A;  5IA7 A;  1YN3 A;  3BII D;  3BK1 A;  1RRB A;  2AQ2 B;  2QMT A;  1I4R A;  1N63 A;  1DOI A;  3Q6B A;  3R7Q A;  2KYW A;  3U52 E;  4XGA B;  3SFE B;  1V5O A;  1YOV B;  2GRI A;  2OJR A;  4HRO A;  3U2S C;  5FKA C;  1V1P B;  3U7D A;  3VH3 B;  3A9K B;  3QK0 A;  2B3A A;  3ZNH B;  4BZA A;  3AM9 A;  1R4M B;  3ML9 A;  1J7B A;  3NS8 A;  3N32 A;  2K5P A;  4DK5 A;  2WXI A;  2BS4 B;  3H9D A;  2Y5P A;  3PHX B;  1Q1O A;  4K7W A;  4CO7 A;  4IOI E;  1ZUD 2;  3PLV A;  1L0X B;  5I4D A;  3SFD B;  2RMM A;  3HK0 A;  3TEZ A;  3Q3N C;  2PPH A;  2D11 A;  2ZEQ A;  1YJI A;  4YWG G;  5D3D A;  4AQ7 A;  2ZW0 A;  2N7J A;  4LNK A;  1UD7 A;  2FCQ A;  1UGJ A;  3A9J A;  4BKS A;  1ZDX A;  3Q3J A;  2HTM E;  5TSS A;  4EFO A;  3RFZ B;  4W9K A;  3Q8E A;  2N1V A;  1S3S G;  5BYR A;  3PT2 B;  1L4Z B;  4YL8 A;  1V97 A;  2V4I B;  2B76 B;  2KQS A;  2PW9 A;  2ZPY A;  2BYE A;  2W3R A;  3AMZ A;  1T5X D;  4W9I A;  3VUX A;  5C3J B;  5LXI B;  4G0N B;  5EE0 A;  1F77 A;  1UBQ A;  1ZXI A;  4KIK A;  5HFY A;  2BS2 B;  2KHW B;  2NS5 A;  2O6V D;  1K51 A;  2XK5 A;  3PV1 A;  1K8R B;  3RI7 C;  4J3O D;  3HVD A;  3DVG X;  3P4P B;  5EDS A;  2MBQ A;  2XN9 C;  5J17 A;  2YEP B;  2OOB B;  3DBS A;  2Y5C A;  2M0A A;  2WXR A;  1TKY A;  2LVO A;  4RF0 A;  4RNA A;  1EUV B;  1SXT A;  3N3K B;  4FHK A;  3AE6 B;  1GJZ A;  2LXC A;  4B9K A;  5GXG B;  1QIL A;  1GUA B;  2BWF A;  3BIN A;  3VUY A;  2WXH A;  3L16 A;  2GOW A;  2HJ1 A;  1TKG A;  1VJK A;  3TIX A;  1I4Q A;  1KFY B;  3QIJ A;  1EU4 A;  1KTK A;  1P7F A;  5HI1 A;  1TY0 A;  1WXQ A;  1FNU A;  4YSZ B;  3ZLZ A;  3AE4 B;  3M63 B;  1NEK B;  2R2O A;  2IGH A;  1I4P A;  1PGX A;  1V86 A;  3P4S B;  4MM3 A;  3EFC A;  1R4N B;  4BOZ B;  1S1Q B;  1CMX B;  4PK1 A;  4OW0 A;  4M00 A;  2FCN A;  1PFD A;  3V60 A;  2N9L A;  1QKZ A;  4P16 A;  1PUT A;  4A3P A;  2FCM A;  4NQK E;  2LFI A;  5G5H A;  2ZPN A;  2MCN B;  3SDL C;  4M8N A;  2K8H A;  4KZC A;  4LLG M;  1HA5 A;  4WJO A;  3PHW B;  1WIA A;  1F2R I;  1EO6 A;  1FPY A;  2BGF A;  1OGW A;  2MP2 A;  4DDI D;  3H7S A;  2BYT A;  2LGY A;  1KLG D;  3CF6 E;  4AOF A;  1WWT A;  2G4S A;  2CHX A;  2WWZ A;  5AZF A;  4MT5 A;  2JXX A;  3W9C B;  3Q8B A;  5E6J A;  4WWO A;  2YLM A;  2MEK A;  2PVO D;  5AUK A;  4E3C A;  4W9C A;  2RDH A;  4W9H A;  1AW7 A;  4B0M A;  3GOE A;  4DBG A;  2M17 A;  2MJD A;  4PYZ A;  4HKQ A;  1UWX A;  1OFF A;  1Y56 A;  3BVZ A;  4MEL A;  4LJO B;  2N9X A;  2E3T A;  3H1U A;  3B1L X;  4II3 B;  1DOX A;  2RD0 A;  3DBR B;  1F9J A;  1C4A A;  1P98 A;  1FNW A;  4NAW B;  5D2M B;  5DPR A;  3T3N A;  1UWM A;  2ZVO A;  2C9W B;  2JRI B;  3FKY A;  4M8M A;  1WR6 E;  3L08 A;  2Z0E B;  4US9 A;  1XT9 B;  3KUZ A;  3ALB A;  3ZRF A;  1UZX B;  3DBL B;  2ZZP B;  3DBH I;  4NNJ B;  4ZRK A;  1GC7 A;  2LEK A;  1OQQ A;  3SR6 A;  4UDU C;  3RPF C;  4BOS C;  4E71 A;  5C1Z A;  4D2K A;  2DWQ A;  1GC6 A;  1E6E B;  3TEX A;  1J19 A;  1I4G A;  5AEK B;  1SB3 C;  4ANW A;  1C4C A;  2I1K A;  1GNU A;  3LXF A;  4GDK B;  5IN7 A;  1J7C A;  2LWP A;  2BWE S;  4B6W A;  4L2Y A;  5J2R A;  2I2Y A;  4RGN A;  1GAQ B;  2LAS A;  3V6E B;  2KT7 A;  2PKO A;  3N1Z C;  2KLG A;  4C56 C;  2KAC A;  1V1P A;  3M95 A;  2IBI B;  2QEJ C;  3A9K A;  4ICV A;  1HEZ E;  4RCO A;  2QJL A;  4QAY A;  1KLV A;  3NG0 A;  3OWE B;  5BYS A;  2LMC A;  3V05 A;  2WXK A;  2K9X A;  5L83 A;  3IBE A;  1JRU A;  1I4X A;  4IM2 A;  3ZTD A;  1JW9 D;  2PTL A;  3PLU A;  3Q8F A;  2MWS B;  4FJZ A;  4MSQ B;  4A3O A;  2GBN A;  3PRP B;  3WAM A;  1G6J A;  3VQI A;  4N58 A;  1E0Z A;  2DZK A;  3ABV B;  3D32 A;  2IZV B;  3AV8 A;  2KAN A;  4ACF A;  2V3S A;  2Q5W D;  2MSE D;  1XEE A;  2IO0 B;  2PMV A;  3RMK C;  5JHA A;  5CHV C;  2N7D A;  1L4D B;  2Y5B B;  3B08 A;  3Q3O C;  4PT5 A;  5FR6 A;  2M56 B;  2K22 A;  1EF5 A;  2AQ1 B;  4B0E A;  1YJ1 A;  1FM0 D;  2EEL A;  2IPK D;  4LNF A;  3X0W A;  3AED B;  3UGB B;  2D3B A;  2L32 A;  4YTP B;  3AE8 B;  2C5L C;  3EUB 2;  5IO9 A;  3T8M A;  4L1B A;  3C0R B;  3MFG A;  1FFV A;  3Q3M C;  4CYE A;  2LHD A;  3RCZ A;  4DWF A;  4FN2 A;  3AE2 B;  5DPW A;  3LJ3 A;  3WA0 A;  1TGZ B;  3T3O A;  4ZOH C;  1K52 A;  2KZR A;  1T0Y A;  2KJ6 A;  4BBN F;  2UYZ B;  3L17 A;  1SBB B;  2WU5 B;  2JSV X;  4W9G A;  4F7Z A;  1ZGU B;  2G1E A;  3SHQ A;  1ESF A;  4J6I A;  2LJI A;  3MHZ A;  5LLI A;  2JWU A;  2FNJ B;  3NY5 A;  2I1J A;  1WGK A;  3IT6 B;  3PZ7 A;  1L7Y A;  4ANU A;  3P63 A;  2Z8L A;  2JF5 A;  1D5Z C;  3AU5 A;  2LZ6 A;  1TTN A;  3RT3 B;  1E7U A;  3OAW A;  1I4H A;  3U8Z A;  2ZCC A;  4JL9 A;  3RNA C;  1VZ8 A;  2EMT A;  1WXV A;  1E5W A;  1KJT A;  4HRS A;  3EA6 A;  1XO3 A;  2L52 A;  1D3Z A;  1WRI A;  1JWU D;  3PGE A;  2GBM A;  2HD5 B;  4PYU A;  2H89 B;  1RFK A;  1C1Y B;  4KX6 B;  4KDI C;  4FJV B;  1ZKH A;  2FCS A;  2CR5 A;  3UQA A;  3B0A A;  1KF6 B;  4IUM B;  1RAX A;  4RGM A;  2LUE A;  3TUO A;  3SEB A;  1H8C A;  4NY0 A;  5CHF A;  1Q0W B;  2LUM A;  1SF0 A;  2QHO A;  2K0P A;  4IWQ A;  1E7P B;  3MJW A;  4HKZ E;  2NR2 A;  4X57 B;  3L13 A;  2K39 A;  1PGB A;  4XYC A;  5E6N A;  4DHJ B;  3GP7 A;  4K7U A;  1JCK B;  3E9S A;  4S0R A;  2MH7 A;  1WYG A;  3P4Q B;  4W9F A;  4ZRP A;  4GSW A;  1K53 A;  4LNO A;  5JZE B;  3ZDT A;  1FCL A;  3PRE A;  3RNC C;  4II2 B;  2AL3 A;  1FFU A;  1YN4 A;  3FC4 A;  2Z59 B;  4NPN A;  4ARI A;  2NPT B;  3L54 A;  3ZDM C;  3I63 C;  1V1O A;  4KGS A;  2WXG A;  1F0Z A;  2C60 A;  4NAW A;  1YX5 B;  2PJH A;  3SU8 X;  3DQV A;  2MBO A;  4EKU A;  4MGK E;  3DHI C;  2AYO B;  1YQ3 B;  2V3P A;  3QAQ A;  3BY4 B;  1IUE A;  3LB8 C;  2BF8 B;  1WGY A;  3HUI A;  2QC8 A;  2VZK B;  3HHM A;  2M4N A;  1WX9 A;  2GBR A;  4KZ0 A;  4OZA A;  2LD9 A;  4EZL A;  4GIV A;  1FXT B;  4AWJ A;  3HM3 A;  1KH0 A;  5IOI A;  2KD0 A;  5DPS A;  1MG8 A;  3DVN V;  3DHG C;  1M94 A;  4BVU C;  1MHX A;  1XCQ L;  3GZN B;  3R3M A;  3RUL A;  1P9D U;  5G2N A;  2KFK A;  1CJE A;  3QHT A;  3HVZ A;  4MGY E;  2KVR A;  4KSL C;  1TS2 A;  4GN1 A;  5HKH A;  3OLM D;  2BS3 B;  4OZB A;  4GDK A;  3DWM A;  2WS3 B;  1TY2 A;  3KQ4 A;  4ZRJ A;  3WCQ A;  1E8Y A;  1FCC C;  1QT9 A;  2N0S B;  2QSD A;  3B9J A;  4F8C B;  4JLC A;  1TYG B;  4NZL B;  1UEL A;  5IAA C;  1SJH D;  4LDT D;  4JWU C;  2KDB A;  2MBE A;  5G5G A;  2UU7 A;  1JWB D;  2KTR B;  1WXS A;  1XLP A;  2MA9 B;  4XX5 A;  2N9E B;  4NJ6 A;  5D3I B;  3W1Y A;  4WAF A;  3ECI A;  4AJY B;  3JYU A;  2ZW1 A;  4WIP A;  3W1S A;  1MFW A;  4RGT A;  2KLC A;  4GB9 A;  2BT6 A;  3V61 A;  4IW0 A;  1HE8 A;  1OQY A;  3W1S C;  2K6D B;  3QQ8 B;  1J8C A;  4W9J A;  2HE7 A;  1BT0 A;  1CZP A;  1D5X C;  3QWZ B;  3RNE C;  3W5V B;  3RYT A;  1WGG A;  5G55 A;  1UGM A;  4FXC A;  4LCD E;  4MGZ E;  4L23 A;  4HLE A;  3RZF A;  4HCP B;  3BVM A;  3AE3 B;  2WDT B;  2KOX A;  2CU3 A;  3NRZ A;  3UF8 A;  1MG4 A;  3QA8 A;  3WIM A;  4Q2J A;  1WJN A;  1YD8 U;  1SE2 A;  2KX0 A;  1SE9 A;  4JX1 C;  4P1B C;  3RNG C;  4HDQ A;  2K6Q A;  3IAM 1;  3RUI B;  3AE1 B;  3RD2 A;  4IWO A;  2NBW B;  2GMI C;  4K3C A;  2INN E;  3A1Q B;  2G3Q B;  4M0W B;  1QZE A;  2RPV A;  2CS4 A;  3LYY A;  2NBU A;  3UIN B;  3VAW A;  2KN4 A;  4IM3 A;  2G4D B;  2WQY B;  4PS7 A;  2JXT A;  4RM9 A;  4XWT A;  1JWS D;  2LGS A;  1VRA B;  3CMM B;  1WJ6 A;  1UF0 A;  2MW5 A;  2J7Q B;  4MH8 A;  3TEW A;  2GI9 A;  3VVW B;  3AE7 B;  4XDD A;  2MHJ A;  2BVC A;  1E8Z A;  2WU2 B;  4MSM B;  3GE3 C;  3ZTC A;  1WGD A;  4WWM A;  2O6V B;  1GG3 A;  3O65 B;  3VUW A;  1NYQ A;  4ICU A;  2IDY A;  1C77 A;  2JVC A;  1MHH E;  1NI3 A;  4YTM B;  2WHI A;  4DXG A;  3AUL A;  2LXA A;  3PRM B;  1IGC A;  2DAJ A;  4NJC A;  4OVZ A;  4WJN A;  1JQ4 A;  3AEF B;  4DXA B;  2JRH A;  2IGD A;  4TKN A;  4H2A A;  2CJO A;  2D10 A;  2DHZ A;  3TEY A;  1N5X A;  2AL6 A;  2FE8 A;  1EU3 A;  1OEY A;  3H8H A;  3VTU A;  4REZ A;  5H92 C;  3NJT A;  2AWT A;  1QF6 A;  2SAK A;  2LVQ A;  2G9H D;  5L95 C;  2ZNV B;  4BKG A;  2KC2 A;  1UUP A;  3QAR A;  4GMV A;  1HZ6 A;  2J52 A;  4HWI B;  2W55 A;  2KN5 A;  3A4R A;  3BYT B;  2K3U A;  2Z0D B;  1LFD A;  4YSX B;  4CHK A;  1E90 A;  2YVC A;  2ASQ A;  2LRU A;  4R3D A;  4EZK A;  3NVZ A;  3KVF B;  4M01 A;  1L6U A;  1NEN B;  4BKS D;  4YXD B;  1JWA D;  5GMV A;  4DQO C;  2LGD A;  4URK A;  3S2A A;  4KDL B;  2N9P C;  3PVL A;  4JPS A;  4I6P A;  4KGT A;  2DAF A;  1WM2 A;  1NBF C;  2KWV B;  4ZDV A;  2AQ3 B;  1FO4 A;  3KYC D;  3KYD D;  3AEB B;  4HDO A;  3VTV A;  2W54 A;  1D5M C;  2L8J A;  2HJ8 A;  3ZXR A;  3APC A;  2OJW A;  1V9J A;  3PSE B;  2JQR B;  2WXL A;  2MLB A;  3A33 B;  5C2T B;  2VRR B;  3I5J C;  4CQN A;  4W9E A;  3DOW A;  2E6X A;  1SGH A;  2BKF A;  3JW0 X;  2DZM A;  5JXV A;  4K3B A;  3ETR A;  1BUI C;  2QIE B;  1EF1 A;  3CSF A;  3HM6 X;  3BVG A;  2KMM A;  3MHS D;  5HHD G;  1SJE D;  1FNV A;  1C3T A;  1J0G A;  3R66 C;  3NVY A;  4ASW C;  3ZW3 A;  5MPO A;  3BK2 A;  3UIP B;  1A5R A;  4I6L B;  2ON8 A;  1LGR A;  5LNK 1;  3VR9 B;  1MJD A;  1ZP0 B;  1C79 A;  2KDM A;  2WP9 B;  3QC8 B;  5HG2 A;  2M19 A;  2INC C;  1OEY J;  1VR9 A;  1B9R A;  3PS6 A;  5EE1 A;  2K25 A;  5KHQ A;  4MDK E;  3TCA A;  1L0Y B;  2DNF A;  2X8X X;  3NUH B;  4WWP A;  2IJ0 A;  1E9M A;  2KO3 A;  2RSU A;  2JZP A;  4AJW A;  4BBN C;  3Q2A C;  2KDF B;  1KRH A;  4MJS B;  2FUH B;  1IYF A;  2PLP A;  3KUC B;  4OVV A;  2MBB B;  4WH4 A;  2L3Z A;  4FHJ A;  2WDV B;  3PPA A;  3NZ3 A;  2BYF A;  1FRR A;  2FBW B;  1QOB A;  3P42 A;  2KTR A;  5BMG A;  3CIR B;  2DLB A;  2PE9 A;  1EWC A;  1JWM D;  1AYF A;  2RDB C;  2D3G A;  2JPH A;  5FR3 A;  4HJK A;  4C80 A;  3L4P A;  1WZ0 A;  2L1A A;  3VHT C;  1ZPS A;  3DBH B;  2K8C A;  1TJE A;  1RFA A;  4A6Q A;  2IYD B;  2L76 A;  1A70 A;  1ET6 A;  1WXM A;  2Y3A A;  3U7Z A;  3NOB A;  3ZRC A;  3K9P B;  4LJP B;  3BYY B;  2WXM A;  2ACZ B;  3HIZ A;  4KKI A;  4RMA A;  1SE4 A;  1STE A;  1TZ1 A;  1X1M A;  2IY0 B;  5E6P A;  1WE7 A;  2DZJ A;  3PTF C;  2BYV E;  1DOY A;  2KNB A;  2RPQ A;  1QLB B;  2N7E A;  3AN1 A;  2LGX A;  1WI0 A;  3OJ4 B;  5T8I A;  1Z2M A;  2N1W A;  4TV3 A;  1FMA D;  4ARC A;  3A1Q A;  1PYW D;  3ZJU A;  4FAD A;  1N5W A;  2KJH B;  1YJJ A;  2WXF A;  2R61 A;  1QOG A;  3K9O B;  2CU1 A;  2LVP A;  3B2F A;  3KWV A;  4RH6 A;  3NZU A;  2DBY A;  3KLS X;  3ML8 A;  4N59 A;  3KUD B;  2KWU B;  2KMC A;  3ZQ4 A;  4AP4 C;  4IWP A;  1Y8R C;  2J42 A;  4GDL B;  4HXD A;  2IO1 B;  2INP E;  3IG3 A;  1QOF A;  3ZUN A;  3UIO B;  1R4M I;  2X38 A;  3BZD B;  3AI5 A;  4GOC A;  3DCG A;  4I6N B;  2O6V A;  2MX2 A;  3N1Y C;  1IPG A;  2JUO A;  2WXQ A;  2RGF A;  3O13 A;  3V62 A;  4HPL B;  4XE0 A;  1VLB A;  3NVW A;  4OVU A;  4IDI A;  3VTW A;  1ZW7 A;  5TR5 A;  2XNA C;  2LGI A;  2QDF A;  1E8X A;  1F1H A;  4O1N A;  2YEP F;  1AWD A;  4WAA A;  3I57 A;  2L05 A;  2NTS A;  3MC8 A;  2WXJ A;  1F52 A;  1LM8 B;  1E8W A;  1XCT L;  1J7A A;  2CHZ A;  5KHO A;  4KVG B;  3Q69 A;  4DXF A;  4C7Y A;  1WH3 A;  1TBE A;  3VH4 B;  1VDV A;  2EKI A;  4A8X C;  1D4B A;  3OG5 A;  1V49 A;  4RM8 A;  3W5U B;  1IBX B;  3GB1 A;  4WUR A;  2ZNV C;  5JH5 C;  2NVU I;  3APD A;  2KWC A;  1WJ4 A;  2GB1 A;  3NZS A;  1ACC A;  1XLO A;  1IP9 A;  1WJU A;  5AZG A;  2R2Q A;  2MJE A;  4MEM A;  1FIQ A;  3WAP A;  1GB4 A;  2W9N A;  3QCA A;  3VDZ A;  1JRO A;  3N1X C;  1WY8 A;  4KV2 A;  2D5G A;  3AEE B;  1IGD A;  4JIO U;  2JYT A;  3ZO5 B;  1C9F A;  2DYB A;  1WF9 A;  5EE9 A;  4C00 A;  2BQQ A;  3MJ5 A;  1I35 A;  5JHB A;  4IKG A;  3IT4 B;  1KM7 A;  3AEG B;  4YT0 B;  4JQW C;  1N6Z A;  4NQL B;  2V1Y A;  1TIF A;  2V9H A;  3ZXV A;  2JX5 A;  1FXA A;  4A90 A;  3N9Y C;  1PDX A;  3AE9 B;  3NVV A;  1LO5 D;  4G50 A;  4WQM A;  3TJP A;  2KWD A;  1R4N I;  3EC8 A;  2ZCB A;  3IAS 1;  2JYE A;  4HPP A;  5H8Y E;  5D94 A;  1ZOY B;  3LDZ E;  2V0G A;  2WYQ A;  3VR8 B;  1P0R A;  4YTN B;  3M62 B;  2LI5 A;  1FEH A;  1T0S C;  2ZVN A;  1F2R C;  4JWS C;  2JT4 B;  3AU4 A;  4HJG E;  3IVF A;  2W3S A;  4EEW A;  4P7I A;  2C7M B;  1E7V A;  1WRD B;  3WAN A;  1ZE3 D;  3AB5 A;  4IM0 A;  2XEW A;  4S17 A;  2K1F A;  3KWL A;  2KQ7 A;  3DHH C;  4USA A;  2MRP A;  4LTU A;  5EE3 A;  2EMS A;  5BO4 B;  3TMP B;  2RR9 A;  3ONS A;  1BXT A;  4MJS A;  2IND C;  3BWU D;  4F1S A;  4WWN A;  2K8B A;  4US8 A;  2IY1 B;  3P4R B;  5AZH A;  3H7P B;  3DPD A;  4ITK A;  1I7H A;  2JWZ A;  4G11 A;  2WLB A;  4PS8 A;  3P1M A;  1WMH B;  2MJ3 A;  1SIF A;  4FA6 A;  1NYR A;  4JGH B;  2HDE A;  1T3Q A;  4XDC A;  1WGH A;  1JRP A;  3URY A;  4KSK C;  4XZ4 A;  3TSS A;  1XXG A;  1EWY C;  4K7S A;  3DBR I;  3IFW B;  2IGG A;  4FBJ B;  1JAL A;  3IXS A;  4HEA 1;  4AUQ C;  2KVZ A;  2L0F A;  3T9L A;  3Q3F A;  4WJQ A;  4ZHP A;  3ZNG C;  2BB6 A;  3JVZ X;  3AH7 A;  3KH0 A;  2C7H A;  3AE5 B;  1FXI A;  1U4A A;  4LDT B;  3ENE A;  2MQJ A;  4TQ0 A;  2AEH A;  4TMA B;  1T0R C;  3IHP C;  2GBJ A;  4P1C C;  4IC7 B;  1MPE A;  1WX7 A;  4RF1 A;  4ZRI A;  1GB1 A;  3DBL I;  3FIL B;  1WZ3 A;  3JSV B;  1VZ6 A;  3C19 A;  3I3T B;  2FAZ A;  3Q8C A;  4P6V F;  2PVG C;  2A5U A;  2ZJD A;  4MAC A;  1YX6 B;  2M1M A;  3TBL D;  4W9D A;  3MC0 B;  1FRD A;  1Z5S B;  2NCN A;  5BYQ A;  2JY6 A;  4C4V B;  2UWQ A;  2NTT A;  3MP9 A;  5BMH A;  5IP4 D;  1V2Y A;  3SD5 A;  4KKJ A;  1EM7 A;  2A4Z A;  4HK2 A;  3QJZ A;  2CKH B;  1HXY D;  3N30 A;  4TQ1 A;  3U4E G;  1WYW B;  1SSN A;  4C7Z A;  1V8C A;  4GDL A;  5D6J B;  3NHE B;  2HTH A;  1YMH E;  3TL5 A;  1T0Q C;  4NJ7 A;  4TSS A;  4OHJ A;  2L0T A;  1SE3 A;  3ZNZ B;  2OED A;  2G45 B;  2GLS A;  3EGR A;  2LJ5 A;  1GOZ A;  2PEA A;  3UQB A;  2KXJ A;  2LRW A;  3CWI A;  2WDQ B;  2L00 B;  2N4F A;  4GU2 A;  4ZRQ A;  2DEN B;  4DDG D;  2W82 A;  1YN5 A;  4LNI A;  1ET9 A;  3VFK A;  1P1A A;  4LK0 M;  1UBI A;  3M3J A;  2IO3 B;  2GBK A;  3PZ8 A;  2WGS A;  2O2V B;  3WAL A;  4DHZ E;  2KC1 A;  2KK8 A;  4EE2 A;  2C7N B;  1AN8 A;  1IBX A;  5C23 A;  3RNB C;  5LXH A;  5IKC M;  4A9A A;  1OTR B;  1LQB A;  4K81 A;  3VRA B;  2BPS A;  2KQ4 X;  2BKR B;  1HTO A;  4GXB A;  4GLS C;  1ENF A;  1DGJ A;  3Q14 C;  5AUI A;  2L83 A;  1GPX A;  2VH1 A;  1MI0 A;  2KJR A;  2NPT A;  3ZYY X;  2J0M A;  1JML A;  1ZXH A;  1L5P A;  2WNM A;  1UNS A;  1C4P A; 
#chains in the Genus database with same CATH homology
 1WE6 A;  1WX9 A;  2GBR A;  4KZ0 A;  1V81 A;  2RPQ A;  2LD9 A;  2N7E A;  3M63 B;  2LGX A;  1WI0 A;  2R2O A;  4EZL A;  4GIV A;  3OJ4 B;  1Z2M A;  1LXD A;  2N1W A;  4TV3 A;  2KX3 A;  4N9F 4;  1FXT B;  4HCN B;  4AWJ A;  3HM3 A;  5E6O A;  1V86 A;  1UH6 A;  2EKE C;  3A1Q A;  2KD0 A;  4MM3 A;  2KFK B;  5DPS A;  4BOZ B;  1S1Q B;  1MG8 A;  2KJH B;  4FAD A;  3DVN V;  4ANV A;  3A4S C;  1M94 A;  4BVU C;  2M8S A;  3K9O B;  2CU1 A;  1CMX B;  2LVP A;  4FLH A;  3R3M A;  4TUU A;  3NZU A;  3RUL A;  3ML8 A;  1P9D U;  2KWU B;  3KUD B;  1WX8 A;  5G2N A;  2FCN A;  2KMC A;  5CHW A;  2KFK A;  3V60 A;  4AP4 C;  4IWP A;  3QHT A;  4MGY E;  2KVR A;  1Y8R C;  4KSL C;  3A9J B;  4A3P A;  4GDL B;  4HXD A;  4GN1 A;  2FCM A;  2IO1 B;  2KFJ A;  3IG3 A;  5HKH A;  3OLM D;  5CTR C;  4NQK E;  4GDK A;  3ZUN A;  2ZPN A;  2MCN B;  3UIO B;  3SDL C;  1R4M I;  4M8N A;  3R7R A;  2K8H A;  4KZC A;  4ZRJ A;  3AI5 A;  3PHW B;  4WJO A;  4GOC A;  1WIA A;  2FIF A;  3DCG A;  4MH0 E;  4I6N B;  1E8Y A;  1EO6 A;  1H4R A;  2O6V A;  2MX2 A;  3EEC A;  1IPG A;  2JUO A;  4F8C B;  2BGF A;  2XBB C;  4JLC A;  4W9L A;  1OGW A;  2RGF A;  3OJ3 A;  2MP2 A;  2IO2 B;  4DDI D;  1UEL A;  5IAA C;  4HPL B;  3H7S A;  3V62 A;  4LDT D;  2LGY A;  2KDB A;  3CF6 E;  4OVU A;  3H6N A;  3VTW A;  1ZW7 A;  4AOF A;  2MBE A;  5TR5 A;  2G4S A;  1I42 A;  2CHX A;  2WWZ A;  4BFR A;  1E8X A;  5AZF A;  2KTR B;  2JXX A;  4KIK B;  1WXS A;  1XD3 B;  2MA9 B;  1WFY A;  2REX A;  4XX5 A;  4WAA A;  1WGR A;  2N9E B;  4NJ6 A;  4WWO A;  2YLM A;  3W1Y A;  4EZJ A;  2XK5 B;  2L05 A;  2NBV B;  3ECI A;  4E3C A;  4W9C A;  4EOY A;  4W9H A;  5KHO A;  1LM8 B;  1E8W A;  2CHZ A;  3GOE A;  3JYU A;  4AJY B;  4KVG B;  1WH3 A;  1TBE A;  3EFU A;  4DBG A;  2M17 A;  3W1S A;  3VH4 B;  4PYZ A;  2KLC A;  4GB9 A;  4WQO B;  3DVG Y;  3V61 A;  4IW0 A;  1HE8 A;  1OQY A;  3QX1 A;  4MEL A;  1V49 A;  2N9X A;  4LJO B;  3W1S C;  2K6D B;  3PRZ A;  4PS3 A;  3H1U A;  1WR1 A;  3QQ8 B;  3B1L X;  4RM8 A;  4W9J A;  5CX3 A;  1J8C A;  2HE7 A;  1BT0 A;  1L2N A;  3QWZ B;  3RZW C;  4II3 B;  2ZNV C;  5JH5 C;  1YQB A;  2NVU I;  3RYT A;  2RD0 A;  1WGG A;  5G55 A;  1UGM A;  3APD A;  4LCD E;  2DYO A;  4MGZ E;  2KWC A;  1F9J A;  1WJ4 A;  1P98 A;  2WX1 A;  5DCN A;  4NAW B;  2J0J A;  3NZS A;  5D2M B;  5DPR A;  3WAO A;  4HLE A;  4ZYN A;  4XC2 A;  2ZVO A;  2C9W B;  2JRI B;  3RZF A;  4HCP B;  1V6E A;  2KOX A;  2WDT B;  4M8M A;  3ZNI D;  3X23 A;  1WR6 E;  3L08 A;  3UF8 A;  2Z0E B;  1IP9 A;  2V4L A;  3QA8 A;  3WIM A;  1WJU A;  1WJN A;  1VCB A;  5AZG A;  2R2Q A;  1YD8 U;  1XT9 B;  2KX0 A;  3KUZ A;  4MEM A;  3WAP A;  1SE9 A;  3ALB A;  3ZRF A;  3L0W B;  2W9N A;  1V5T A;  1UZX B;  3H7P A;  3QCA A;  4HDQ A;  2K6Q A;  3RUI B;  3VDZ A;  3RD2 A;  1WY8 A;  2ZZP B;  3DBH I;  4KV2 A;  1WMH A;  4IWO A;  4NNJ B;  4ZRK A;  2NBW B;  2GMI C;  4HPM B;  1GC7 A;  2JZ3 B;  2MBH A;  4DWF A;  3A1Q B;  3MTN B;  4JIO U;  3DVN U;  4BOS C;  2G3Q B;  3ZIM A;  4E71 A;  1ISN A;  1QZE A;  2J0K A;  4M0W B;  3ZO5 B;  5C1Z A;  1GC6 A;  2DYB A;  2CS4 A;  1PQS A;  1WF9 A;  2DX5 B;  2NBU A;  3UIN B;  3VAW A;  1I35 A;  1NI2 A;  1J19 A;  2G4D B;  4IM3 A;  2WX0 A;  3ZVV A;  5JHB A;  5AEK B;  4PS7 A;  2DZI A;  4RM9 A;  4ANW A;  1KM7 A;  1WXA A;  2I1K A;  1GNU A;  3V6C B;  3CMM B;  4E74 A;  4JQW C;  2JZZ A;  4GGQ A;  1WJ6 A;  4NQL B;  2V1Y A;  3DDC B;  4GDK B;  2LWP A;  2MW5 A;  2J7Q B;  4DHJ D;  2BWE S;  4B6W A;  3VVW B;  5J2R A;  3CST A;  4HVB A;  1E8Z A;  4MSM B;  5D7G A;  2LAS A;  3V6E B;  3ZTC A;  1WGD A;  2M0X A;  2KLG A;  2O6V B;  4B95 A;  1GG3 A;  1AAR A;  3JSV A;  3M95 A;  3O65 B;  4G50 A;  3TJP A;  3VUW A;  2IBI B;  3VXW A;  2KMA A;  2MP2 B;  3A9K A;  3EC8 A;  1R4N I;  4ICV A;  2ZCB A;  4ICU A;  2JVC A;  3PZD A;  5D94 A;  3U30 A;  3LDZ E;  3GZN I;  3L10 B;  1KLV A;  2WYQ A;  1RLF A;  1P0R A;  3AUL A;  2LXA A;  3PRM B;  3M62 B;  5L83 A;  2DAJ A;  2LI5 A;  3IBE A;  2ZVN A;  4WJN A;  1KOT A;  1JRU A;  2FID A;  4IM2 A;  3ZTD A;  4DXA B;  2JRH A;  4TKN A;  3PLU A;  2JT4 B;  2D10 A;  2DHZ A;  2MWS B;  3AU4 A;  2AL6 A;  4FJZ A;  4MSQ B;  1OEY A;  2PE6 B;  2DYM A;  4WJP A;  3IVF A;  4A3O A;  3VTU A;  4DHZ B;  4EEW A;  2KKC A;  4P7I A;  2C7M B;  2KDE B;  1E7V A;  1WRD B;  2D07 B;  2GBN A;  3WAN A;  3PRP B;  3WAM A;  1G6J A;  3VQI A;  4IM0 A;  2AWT A;  2LVQ A;  5L95 C;  2DZK A;  4ANX A;  2ZNV B;  4BKG A;  2KC2 A;  2XEW A;  3QAR A;  4GMV A;  4K1R B;  2K1F A;  3KW5 B;  1P3Q U;  3D32 A;  4HWI B;  2IZV B;  2KQ7 A;  4FJY A;  2KAN A;  2MRP A;  2KN5 A;  3A4R A;  2V3S A;  2Z0D B;  1LFD A;  3P2B A;  2EMS A;  2MSE D;  5BO4 B;  1YIW A;  2IO0 B;  3ZKJ C;  5DPT A;  4CHK A;  3TMP B;  1E90 A;  2YVC A;  2RR9 A;  3ONS A;  2ASQ A;  5JHA A;  4IG7 B;  3EHV A;  4MJS A;  5CHV C;  2CHW A;  2LRU A;  2N7D A;  3APF A;  4EZK A;  3KVF B;  4F1S A;  2Y5B B;  3B08 A;  4FUL A;  4WWN A;  5FR6 A;  2K8B A;  1EF5 A;  4BKS D;  2IY1 B;  4A20 A;  1YJ1 A;  5AZH A;  5GMV A;  2L7R A;  3H7P B;  4EUT A;  3DPD A;  2JWZ A;  4G11 A;  2KTF A;  4PS8 A;  2LGD A;  3AXC A;  4URK A;  1WMH B;  3X0W A;  3S2A A;  2D2Q A;  4KDL B;  2N9P C;  3PVL A;  1SIF A;  1V80 A;  4FA6 A;  5J18 A;  4I6P A;  4JGH B;  3UGB B;  2DAF A;  1WM2 A;  4G3X B;  1WGH A;  1VD2 A;  2C5L C;  1NDD A;  3T8M A;  2KDI A;  1NBF C;  2KWV B;  4KSK C;  4XZ4 A;  4ZDV A;  4K7S A;  3DBR I;  1XQQ A;  3C0R B;  1Q5W B;  3IFW B;  4CYE A;  4FBJ B;  3KYC D;  3KYD D;  4FN2 A;  4HDO A;  3RCZ A;  3VTV A;  4AUQ C;  4BKT A;  3LJ3 A;  1WM3 A;  2O2V A;  4MGI E;  3WA0 A;  5DPW A;  2L0F A;  2L8J A;  3T9L A;  5IA7 A;  3Q3F A;  1TGZ B;  4WJQ A;  3ZNG C;  2HJ8 A;  1RRB A;  2KZR A;  3JVZ X;  3APC A;  1T0Y A;  2KJ6 A;  4BBN F;  3KH0 A;  2C7H A;  1U4A A;  4LDT B;  2UYZ B;  3L17 A;  3ENE A;  2MQJ A;  1V9J A;  3PSE B;  4TQ0 A;  2AEH A;  3IHP C;  2GBJ A;  4W9G A;  3R7Q A;  2MLB A;  4IC7 B;  3A33 B;  4F7Z A;  1WX7 A;  2VRR B;  1ZGU B;  4ZRI A;  1V5O A;  3DBL I;  3DOW A;  4W9E A;  1SGH A;  2BKF A;  3SHQ A;  3JW0 X;  4J6I A;  2DZM A;  2OJR A;  1WZ3 A;  5LLI A;  3JSV B;  3U7D A;  3I3T B;  2FNJ B;  3VH3 B;  1EF1 A;  2FAZ A;  3A9K B;  3NY5 A;  2I1J A;  3QK0 A;  3CSF A;  3HM6 X;  2B3A A;  3ZNH B;  2A5U A;  3MHS D;  2ZJD A;  1L7Y A;  3ML9 A;  1YX6 B;  1J0G A;  4ANU A;  2M1M A;  3NS8 A;  1C3T A;  3N32 A;  3TBL D;  4DK5 A;  3R66 C;  3H9D A;  4ASW C;  3PHX B;  3ZW3 A;  4W9D A;  1Q1O A;  4K7W A;  3UIP B;  1A5R A;  4CO7 A;  4I6L B;  2JF5 A;  1Z5S B;  2NCN A;  3AU5 A;  3PLV A;  2JY6 A;  2LZ6 A;  2UWQ A;  1TTN A;  3RT3 B;  1E7U A;  3OAW A;  3HK0 A;  3U8Z A;  1V2Y A;  2PPH A;  2D11 A;  3SD5 A;  2ZCC A;  2ZEQ A;  2A4Z A;  4HK2 A;  3QJZ A;  2CKH B;  4JL9 A;  3QC8 B;  3N30 A;  2EMT A;  4TQ1 A;  1OEY J;  1WXV A;  1WYW B;  3PS6 A;  1E5W A;  1UD7 A;  2K25 A;  5KHQ A;  1KJT A;  4MDK E;  2FCQ A;  3TCA A;  3A9J A;  4GDL A;  5D6J B;  3NHE B;  2HTH A;  4BKS A;  3TL5 A;  4NJ7 A;  3Q3J A;  1D3Z A;  3PGE A;  2GBM A;  3HHM A;  2HD5 B;  2KO3 A;  4PYU A;  4WWP A;  4EFO A;  2RSU A;  2L0T A;  4W9K A;  3ZNZ B;  1C1Y B;  2N1V A;  4AJW A;  1S3S G;  4BBN C;  4KDI C;  4FJV B;  3PT2 B;  1ZKH A;  2FCS A;  2CR5 A;  2G45 B;  3UQA A;  2KDF B;  3B0A A;  4YL8 A;  4MJS B;  2FUH B;  2LJ5 A;  1RAX A;  2PEA A;  4IUM B;  1IYF A;  3UQB A;  2KXJ A;  2KQS A;  2LUE A;  3KUC B;  4OVV A;  1H8C A;  2MBB B;  2ZPY A;  2BYE A;  2LRW A;  2L3Z A;  4NY0 A;  5CHF A;  4FHJ A;  4W9I A;  3VUX A;  1Q0W B;  2L00 B;  3PPA A;  5LXI B;  2BYF A;  4G0N B;  2QHO A;  2N4F A;  4IWQ A;  1UBQ A;  4GU2 A;  3MJW A;  2NR2 A;  2KTR A;  4KIK A;  2DEN B;  4X57 B;  2KHW B;  3L13 A;  4DDG D;  2NS5 A;  2O6V D;  2K39 A;  2PE9 A;  2XK5 A;  3PV1 A;  1P1A A;  3VFK A;  5E6N A;  1UBI A;  4DHJ B;  1K8R B;  3M3J A;  4K7U A;  2IO3 B;  2GBK A;  3ZLZ A;  4W9F A;  2D3G A;  2JPH A;  3DVG X;  4GSW A;  4HJK A;  5EDS A;  2MBQ A;  5J17 A;  2O2V B;  1WZ0 A;  3VHT C;  3WAL A;  2OOB B;  3DBS A;  4DHZ E;  2KC1 A;  5JZE B;  2K8C A;  3ZDT A;  2KK8 A;  3PRE A;  2C7N B;  2LVO A;  1RFA A;  4II2 B;  2IYD B;  2AL3 A;  1EUV B;  5C23 A;  5LXH A;  3N3K B;  1OTR B;  1LQB A;  2L76 A;  4FHK A;  4K81 A;  1GJZ A;  2BPS A;  2Z59 B;  4NPN A;  2LXC A;  4B9K A;  1WXM A;  2NPT B;  3L54 A;  1GUA B;  2BWF A;  3BIN A;  2BKR B;  3VUY A;  3L16 A;  3ZDM C;  2GOW A;  3NOB A;  2C60 A;  3K9P B;  4LJP B;  4NAW A;  1YX5 B;  4GXB A;  3ZRC A;  2PJH A;  3TIX A;  3HIZ A;  4RMA A;  3SU8 X;  1TZ1 A;  3QIJ A;  3DQV A;  1X1M A;  2MBO A;  4EKU A;  2IY0 B;  2KJR A;  4MGK E;  2NPT A;  5E6P A;  1WE7 A;  2AYO B;  2J0M A;  3BY4 B;  3QAQ A;  2BF8 B;  1WGY A;  2DZJ A;  3PTF C;  2BYV E;  2M4N A;  2KNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...