4GSWA

Crystal structure of ubiquitin from entamoeba histolytica to 2.15 angstrom
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
74
structure length
74
Chain Sequence
NAMQIFVKTLTGKTITLEVEPNDSIDAIKAKIQEKEGIPPDQQRLIFAGKQLEEGKTLSDYNIQKESTLHLVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structural Determinants of Ubiquitin Conjugation in Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Protein binding
total genus 25
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4gswA00
3V60A 5JZEB 2N9PC 2R2QA 1J0GA 1P9DU 3PLVA 1ZGUB 4MEMA 2EMTA 5E6NA 4W9IA 4AUQC 2M4NA 4JGHB 2CHZA 1WIAA 2EKEC 2L3ZA 1G6JA 2MWSB 4IM0A 4ZRKA 4W9JA 3ZDTA 3RYTA 4WJQA 3NZUA 4MSMB 3PGEA 2RPQA 3TCAA 1KLVA 4IWQA 1VD2A 1QZEA 4DHZB 1UGMA 3QAQA 3W1SA 2PJHA 3K9PB 3M62B 2FNJB 4HDQA 1WR6E 5KHOA 2LGYA 4ANXA 2NPTA 1WGYA 3N3KB 1WJ4A 3EECA 1RAXA 4DWFA 4GGQA 2GOWA 2WYQA 1TGZB 3DVGX 2JPHA 3R7RA 4EOYA 5D2MB 3L16A 3W1SC 4W9DA 2KTRA 3D32A 4KZ0A 2Z59B 1T0YA 2MP2A 4TQ1A 2LJ5A 3M3JA 4BOSC 1J19A 4JQWC 4WQOB 1R4MI 3ZKJC 2ZNVC 2XK5B 2A4ZA 4FJZA 4ZYNA 2IBIB 3ZVVA 4MDKE 3ZNHB 1S1QB 4WWOA 4FJYA 1OGWA 3H6NA 4GB9A 4IM3A 1WJ6A 4CHKA 3MJWA 4E71A 4GN1A 4LDTB 2NPTB 2C5LC 3IFWB 4XC2A 3A4SC 3JSVA 1IP9A 2MLBA 2KDFB 2Y5BB 2ZZPB 3L10B 3VXWA 4BFRA 3PS6A 1Y8RC 2RSUA 1P98A 4FHKA 5JHAA 2MA9B 3X23A 5G55A 3DBLI 5CHVC 3L54A 3H7SA 3MHSD 2M1MA 2DYMA 4MGYE 4PYUA 2CHXA 4MGZE 5AZFA 4AJYB 2LRWA 3ZTDA 1OEYA 1ZW7A 4AP4C 3CSFA 2KWVB 2N1VA 3UQBA 2FAZA 1Q0WB 1S3SG 2DHZA 3K9OB 2KX0A 1YX5B 2J7QB 4PS7A 5E6PA 2G4SA 3L08A 3TL5A 3AI5A 3JSVB 2NR2A 4ZRIA 5EDSA 4EZJA 1H4RA 5D6JB 4B9KA 2W9NA 4W9EA 3ZUNA 3HHMA 3BY4B 4OVVA 1R4NI 4MELA 4MJSB 3PRPB 4NJ6A 4BOZB 1OEYJ 2ZJDA 4BBNF 1V86A 1GC7A 1E8WA 1TZ1A 3IBEA 4TKNA 3WAMA 3T9LA 2KDBA 2K1FA 3ZW3A 1V6EA 2K39A 2D10A 4IM2A 2D11A 3IG3A 3KW5B 1YIWA 4JIOU 2XEWA 1A5RA 1WX9A 2JWZA 3JW0X 4LJPB 2PE6B 3SDLC 4ASWC 1C3TA 4CYEA 3DCGA 4W9LA 2KFJA 2M0XA 3B1LX 3R7QA 1TBEA 3KUZA 2UWQA 1EO6A 1E90A 1E8XA 2JF5A 3QA8A 4ZRJA 3NS8A 2MBOA 5DPWA 1WY8A 2JXXA 3UF8A 3VUWA 1KOTA 3N30A 4KSKC 5J17A 2D07B 3L17A 4KZCA 1P3QU 4W9GA 3VHTC 3WAOA 2ZEQA 1IYFA 1FXTB 4GU2A 3RCZA 2V1YA 4DHJD 4AOFA 5C1ZA 1ISNA 3V61A 3VUXA 1GG3A 2IY0B 4NQKE 4HDOA 4ANVA 2MBEA 3R66C 1WI0A 3OLMD 4J6IA 3VVWB 4WAAA 4WJNA 3TIXA 5CTRC 3L13A 3RD2A 3EHVA 4FN2A 3UIOB 4GIVA 2REXA 3APFA 4GDLB 3VTUA 1EF1A 2DZJA 3DBHI 5FR6A 4HPMB 4K1RB 4W9CA 2FCNA 3A9KB 2IZVB 5CHWA 3M63B 2RGFA 2BYVE 3DPDA 2AWTA 1WJNA 4G3XB 4HK2A 4HCPB 4B6WA 1WXMA 3ZLZA 3BINA 2IY1B 3APCA 4EZKA 2AL3A 2A5UA 1JRUA 2D3GA 1GJZA 4HWIB 4NNJB 3ZIMA 2KWCA 2KC2A 3QWZB 3KUDB 1VCBA 2KMAA 3VH3B 3KVFB 2RR9A 1WGDA 2XK5A 3WAPA 3WANA 3RT3B 1V2YA 3ZO5B 4FADA 2BKFA 2N7DA 4MSQB 4DHZE 1YJ1A 2Z0EB 3H9DA 4W9KA 3SU8X 1YD8U 1H8CA 1XT9B 4F1SA 5JHBA 4F8CB 5DPTA 5G2NA 3RULA 2HE7A 3HM6X 2ASQA 1WRDB 4A20A 2MX2A 2KQ7A 3LDZE 4EEWA 4OVUA 2JT4B 2PPHA 2C7HA 4G50A 3CMMB 1YX6B 2O6VD 4BKSA 4DDGD 2KTFA 1BT0A 2KK8A 2IYDB 1PQSA 2LXAA 4BVUC 1Q1OA 1D3ZA 1P1AA 3RZWC 3B0AA 4HJKA 5TR5A 1GNUA 3DVNU 1M94A 4RM8A 2J0KA 4GXBA 2KX3A 2WWZA 3ML8A 1C1YB 2DAFA 4NJ7A 2KXJA 2JVCA 2OOBB 1NDDA 4MJSA 3UGBB 4BBNC 1E7VA 4DK5A 4FBJB 1UBQA 4DXAB 4PYZA 4F7ZA 3EFUA 1MG8A 2K8HA 2L76A 2JY6A 2MCNB 4HXDA 3X0WA 3O65B 2M8SA 3PLUA 3I3TB 2NBWB 2JRHA 2XBBC 5BO4B 1SIFA 3VH4B 4P7IA 2ZVNA 3VUYA 4PS8A 2ZPYA 2KQSA 3WA0A 1SE9A 1CMXB 2JRIB 2K6QA 2OJRA 3VTWA 3ZNZB 2LVOA 2BWFA 1LFDA 2G45B 4FJVB 3ZTCA 4E74A 2LRUA 1LM8B 2V3SA 2YVCA 2JZZA 3Q3JA 2LUEA 3H7PB 1AARA 1XQQA 2KJRA 1WH3A 1WJUA 2BYEA 3ZRFA 3QJZA 4MH0E 1UBIA 2GMIC 2N9XA 1I35A 2KLCA 3UQAA 1I42A 5GMVA 4WJPA 3QCAA 1YQBA 4A3PA 2MBHA 4GDKA 4I6PA 5C23A 4EZLA 1Q5WB 4II3B 4FA6A 2V4LA 4GMVA 3A9JA 2B3AA 4GDLA 2KO3A 3DVNV 2BF8B 3U7DA 2DZMA 1V80A 3U8ZA 3A9KA 1WGRA 3DBSA 3B08A 1WXSA 2KANA 3ZNGC 2WX1A 2N1WA 2IO1B 1OQYA 4NAWB 5KHQA 1WF9A 3HK0A 4N9F4 3OAWA 4ZDVA 2DENB 3NHEB 3GOEA 3OJ4B 1Z5SB 1TTNA 4DHJB 2QHOA 2CS4A 3R3MA 1E5WA 4XZ4A 4GDKB 1UELA 1RLFA 1V9JA 3PREA 2MQJA 3RZFA 1UZXB 1F9JA 5E6OA 2LI5A 4IG7B 2AL6A 2LASA 3A9JB 2JZ3B 2FIFA 2KFKB 3AULA 3KUCB 5LXHA 2KKCA 2KN5A 4PS3A 4RM9A 3CSTA 2K25A 3PVLA 3ALBA 3LJ3A 2G4DB 2K8BA 3TMPB 2MRPA 2KWUB 4KVGB 3VFKA 1WXAA 2ZPNA 2L0FA 1E8YA 2BWES 2KVRA 1EF5A 1HE8A 3ZNID 1WXVA 1GUAB 3AXCA 2ZVOA 2FIDA 3HM3A 1WMHA 3A33B 2GBKA 5LLIA 1GC6A 2KNBA 5L83A 2AEHA 5J18A 4M8NA 4AWJA 3QK0A 4WWPA 2NBVB 2L00B 2L05A 2RD0A 1WM2A 1LXDA 1V49A 4DDID 3ENEA 1RFAA 2LXCA 3A4RA 2DYBA 1V5TA 4I6NB 3VAWA 1XD3B 2AYOB 3KYDD 4XX5A 1WYWB 5AEKB 5D94A 4G0NB 2IO2B 2BGFA 1NI2A 3KYCD 3PPAA 4NPNA 4MGIE 1E8ZA 3NY5A 4X57B 3ZDMC 2WX0A 2KMCA 3ECIA 2O2VA 2MBQA 3DBRI 3DOWA 1WMHB 1WM3A 1WZ0A 4K7SA 2O6VB 3NZSA 4A3OA 2C7MB 3HIZA 2HJ8A 3QARA 4HPLB 4IUMB 3M95A 3QX1A 4KIKB 4WWNA 3L0WB 4I6LB 4TV3A 3ONSA 3U30A 2NVUI 2K8CA 1LQBA 4BKTA 1U4AA 2CU1A 2DX5B 4IC7B 5J2RA 5CHFA 2G3QB 3PT2B 4FULA 4HCNB 2UYZB 3GZNI 4RMAA 5D7GA 2DYOA 2MBBB 3VTVA 1L2NA 4WJOA 3QIJA 3H7PA 2GBMA 2KDEB 4W9FA 2CR5A 2K6DB 2O2VB 4W9HA 3WALA 1RRBA 3SHQA 4MM3A 1KJTA 4EFOA 2KJHB 4LDTD 4K7UA 1E7UA 5IAAC 5IA7A 2KLGA 4KV2A 5DPRA 2LD9A 3VDZA 4EUTA 4GOCA 1IPGA 1WX8A 3DQVA 4II2B 4JLCA 2L7RA 5DPSA 4GSWA 3WIMA 4K7WA 2ZNVB 3PSEB 2KD0A 1WE7A 4DBGA 2I1KA 4FLHA 3QC8B 3KH0A 2KTRB 5L95C 2MP2B 3PHWB 2KC1A 2JUOA 2FCSA 4BKSD 2LVPA 2NBUA 4KDLB 3V6CB 2GBNA 3UINB 4NQLB 4IWPA 4NAWA 1OTRB 2M17A 4AJWA 1V81A 4E3CA 3VQIA 1WR1A 2LGXA 1WZ3A 2HTHA 4ICVA 4TQ0A 3DDCB 2FCQA 2PEAA 2YLMA 3JYUA 3EC8A 5LXIB 2GBJA 2KHWB 2EMSA 3H1UA 1WGHA 3PRZA 4LJOB 2KZRA 2ZCBA 4KDIC 2LVQA 4NY0A 1NBFC 2KDIA 2R2OA 2NCNA 4TUUA 2C60A 4MGKE 2KFKA 2FCMA 1SGHA 3JVZX 3PRMB 2BPSA 3ML9A 2KOXA 3QQ8B 2IO0B 4FHJA 4YL8A 5CX3A 4JL9A 3RUIB 4CO7A 2PE9A 1KM7A 2L0TA 3MTNB 3PV1A 3C0RB 3AU4A 3IVFA 3A1QA 2LZ6A 3UIPB 1EUVB 2L8JA 2C7NB 3QHTA 4EKUA 1V5OA 2LWPA 1X1MA 4M0WB 4HVBA 1K8RB 1WE6A 3TBLD 3ZRCA 1L7YA 1WX7A 4G11A 2KJ6A 2BYFA 5HKHA 4KSLC 2DZIA 5DCNA 1ZKHA 2I1JA 5AZGA 3IHPC 3PTFC 2IO3B 3PZDA 3CF6E 2N9EB 4B95A 1WFYA 1UD7A 1UH6A 2ZCCA 2WDTB 4IWOA 3APDA 4IW0A 4ANUA 3A1QB 4K81A 2Z0DB 3NOBA 2BKRB 3SD5A 3T8MA 2GBRA 4BKGA 4HLEA 1P0RA 4M8MA 2NS5A 2C9WB 2J0JA 5AZHA 4URKA 4LCDE 2J0MA 2DAJA 3DVGY 1WGGA 3Q3FA 3AU5A 4ICUA 2HD5B 4ANWA 2O6VA 3S2AA 2VRRB 3PHXB 3V6EB 2CHWA 1Z2MA 2N7EA 2MW5A 2FUHB 2N4FA 4KIKA 2MSED 3W1YA 1J8CA 2DZKA 2CKHB 3N32A 2D2QA 5JH5C 3V62A 3TJPA 3P2BA 2LGDA 3OJ3A
chains in the Genus database with same CATH superfamily
3RNCC 5E6JA 1J0GA 2EMTA 4W9IA 4AUQC 2M4NA 2V3PA 2EKEC 2QDFA 1XEEA 3RYTA 3NZUA 2BW2A 2WDQB 2JXTA 1QZEA 1UGMA 3W1SA 5C2TB 4HDQA 1XF5L 2LGYA 3EECA 4DWFA 3DVGX 3TUOA 1L0VB 4EOYA 3TEYA 4IDIA 3W1SC 2KTRA 2WQYB 4L23A 4TQ1A 1T0YA 2MP2A 1N63A 4JQWC 4WQOB 4JWUC 3ZXVA 2BB6A 4YTPB 1I4HA 2A4ZA 5G5HA 3O13A 4WWOA 1OGWA 4IM3A 1WJ6A 1KRHA 1ET9A 2LGIA 3IFWB 2BS2B 3A4SC 3L4PA 4XC2A 2MLBA 2ZZPB 3L10B 2WXNA 2INDC 2DLBA 1Y8RC 4FHKA 5JHAA 3H7SA 4PYUA 2CHXA 2DBYA 2BQQA 2W3RA 4LTUA 1Q0WB 4M0WA 2KX0A 2J7QB 2MJEA 2I2YA 4P1CC 2JZPA 4LNIA 4TMAB 3VR9B 3HHMA 4MELA 4MJSB 4BOZB 1GC7A 3IBEA 4TKNA 3T9LA 4QAYA 2J53A 2K1FA 2V4IB 1P7FA 4IM2A 2XEWA 2PE6B 3SDLC 4CYEA 2M0XA 3B1LX 3KWVA 1WY8A 1SJED 2X38A 2ZEQA 1NEKB 1FNVA 3RCZA 1HA5A 3GB1A 5C1ZA 4HRSA 2LFIA 2J4XA 3NVZA 4HDOA 4ANVA 3R66C 3OLMD 1WWTA 4WAAA 1UF0A 2DNFA 3EHVA 3FC4A 1K51A 4GIVA 3APFA 3DBHI 5FR6A 1R4NB 2FCNA 3A9KB 2IZVB 5CHWA 3M63B 2RGFA 1FO4A 1JALA 1JWSD 2K5PA 2L1AA 4HCPB 4YTMB 3BINA 2IY1B 4EZKA 2AL3A 3UI3A 2KWDA 4PT5A 3MC0B 3C8YA 4WURA 1I4XA 1ZP0B 3ZO5B 3NS1A 1PDXA 1C77A 3H9DA 3SU8X 4B0MA 4F1SA 2PLPA 1QF6A 3P4QB 3RULA 4HKZE 4A20A 4EEWA 4OVUA 2JT4B 2PPHA 2C7HA 2HJ1A 1V1PA 3DHGC 1YX6B 2O6VD 1RFKA 4YSZB 1PQSA 4BVUC 4C00A 1P1AA 1T6BX 1M94A 4RM8A 2J0KA 2LMCA 2LJIA 2WXQA 2WWZA 1C1YB 2DAFA 4NJ7A 2J52A 1HXYD 2OOBB 1NDDA 2ACZB 1UBQA 1UUPA 3EFUA 2L76A 2JY6A 4L1BA 1IBXA 1ROEA 1C4PA 3Q8BA 5BO4B 4P7IA 3VUYA 1SE9A 1CMXB 3LB8C 3ZNZB 2X8XX 3BIID 3BVMA 3IAS1 3NRZA 2VH2A 2JX5A 2YVCA 3T3OA 2I38A 2LUEA 3ZYYX 1L4ZB 1AARA 1MPEA 2KJRA 5EE3A 3AEBB 2GMIC 3KQ4A 1DOYA 3UQAA 5GMVA 1L6VA 3QCAA 4A3PA 2MBHA 4I6PA 1Q5WB 1MHHE 3A9JA 1FEHA 2KO3A 3SEBA 3DBSA 2N1WA 2AQ1B 2IO1B 1OQYA 4ZDVA 4P6VF 1TKYA 3GOEA 4US9A 1E5WA 2K22A 1UELA 1RLFA 3AECB 2WXKA 5E6OA 2AL6A 2KKCA 3CSTA 1RWSA 2K25A 3ALBA 2G4DB 1QOBA 1HTOA 3P4RB 3TMPB 2MRPA 4KVGB 3VFKA 1WXAA 2HTME 1Q10A 4BAXA 5BMIA 3MC8A 4OW0A 1WYGA 1OFFA 1WXVA 3AXCA 2ZVOA 2FIDA 3HM3A 3NVYA 5JXVA 1GC6A 2IJ0A 4DXGA 5J18A 3AE5B 4WWPA 2NBVB 2LXCA 3P1MA 1V5TA 4XX5A 5AEKB 3T3NA 4MGIE 4X57B 3ZDMC 2WX0A 2KMCA 1KF6B 2MBQA 3DOWA 1WM3A 1WZ0A 3C19A 2EELA 4A3OA 2C7MB 2HJ8A 4HPLB 5EE9A 3M95A 4WWNA 3U30A 4OVZA 2KVZA 2CU1A 4IC7B 5J2RA 4HCNB 3QIJA 1EU4A 2MH7A 2KACA 3SHQA 4UDUC 2D3CA 4LDTD 5IAAC 1LGRA 5MPOA 3VDZA 4GOCA 1IPGA 1QILA 2ZNVB 2KD0A 2I1KA 1MI0A 1HQRD 3KH0A 2KC1A 2JUOA 4ZRQA 3SR6A 1I4QA 3DHHC 4MM3B 3VQIA 3KLSX 2FCQA 4M00A 2GBJA 3H1UA 2J42A 3PRZA 2ZCBA 4KDIC 4TUUA 1N5WA 3AM9A 4MGKE 5CX3A 3QQ8B 3ML9A 4YL8A 2AQ3B 1C4CA 2SAKA 4C7ZA 3A1QA 1EUVB 1V5OA 2RPVA 1WE6A 3ZRCA 3U52E 2JSVX 4XGAB 2BYFA 4XWTA 2DZIA 3AE3B 5AZGA 3H8HA 2IGHA 2ZCCA 2WDTB 3APDA 4KX6B 2CJOA 3NOBA 3T8MA 2GBRA 4M8MA 2NS5A 2R61A 4URKA 2J0MA 2DAJA 1JQ4A 2AQ2B 2HD5B 3ZJVA 2O6VA 3U7ZA 2VRRB 3GS2A 3V6EB 3W2DA 2MW5A 5HFYA 1J7CA 3AMZA 1T5XD 3TJPA 1QKZA 2R2QA 1BXTA 3P42A 1ZGUB 1E9MA 4MEMA 1DGJA 2CHZA 1G6JA 2WXFA 2MWSB 2INNE 3PGEA 1KLVA 3TCAA 3TSSA 4A90A 4DHZB 2ONQA 1WGYA 3N3KB 1I4PA 1RAXA 4GGQA 4XYCA 2KN4A 2GOWA 2WYQA 4C4VB 1SSNA 3L16A 4W9DA 3D32A 2KQ4X 2LJ5A 1J19A 1R4MI 4ZYNA 4FXCA 4P1BC 4FJYA 5BMGA 2OEDA 4US8A 1ZPSA 1PGBA 2OHFA 2UU7A 5BYRA 2MA9B 3X23A 5G55A 5CHVC 3L54A 3MHSD 4BZAA 2DYMA 4MGYE 1JCKB 4AJYB 2LRWA 5EE0A 3CSFA 1K53A 2FAZA 1WSPA 3K9OB 1UNSA 2H88B 1YX5B 3ZQ4A 2G4SA 3JSVB 2NR2A 1H4RA 4NZLB 4HKQA 2W9NA 3BY4B 2GI9A 1PFDA 3PRPB 4OHJA 4GLSC 3WAMA 3CWIA 2WGSA 2KDBA 2BS4B 3ZW3A 2D10A 3KW5B 1YIWA 3JW0X 2B76B 1MHXA 2N7JA 3I9V1 3DCGA 2QSDA 1RM6C 2QILA 3VRBB 1E90A 1E8XA 2JF5A 3QA8A 4ZRJA 3MHZA 3NS8A 1ZXIA 3UF8A 3VUWA 3N30A 5J17A 2D07B 1P3QU 3VHTC 1FXTB 2D3BA 2V1YA 2WXLA 4DHJD 3R2TA 3V61A 3BK2A 3BVGA 2IY0B 4KGRA 2MBEA 4J6IA 2Z8LA 2IGDA 3BVZA 3L13A 3Q2AC 4MH8A 2GRIA 2REXA 4GDLB 3VTUA 2DZJA 4K1RB 2PVOD 3DPDA 1WJNA 2ZW0A 1N6ZA 4O1NA 2D3GA 2KWCA 1RYJA 1UWMA 1VCBA 2KMAA 3KUDB 4C7YA 3KVFB 1IUEA 2XK5A 4FADA 3WAPA 4REZA 1EM7A 1V2YA 4MSQB 1YJ1A 4W9KA 1H8CA 1XT9B 4RGTA 4HPPA 3KWLA 5DPTA 5G2NA 4YSYB 3HM6X 2ASQA 1WRDB 3RPFC 1TS5A 3OWEB 3CMMB 1I7HA 5FR3A 2KTFA 5TSSA 2LXAA 1D3ZA 1OQRA 1ESFA 3DBHB 4HJKA 1GNUA 3ZJUA 1GPXA 5HHDG 4FBJB 2JVCA 4BBNC 1FNUA 1YN3A 1DOIA 4DXAB 1EU3A 1Y56A 3GP7A 3W9CB 4YT0B 2NBWB 2JRHA 3DWGC 4PS8A 3WA0A 3VTWA 1VLBA 2OJRA 4MACA 4D2KA 1JW9D 2INPE 2LVOA 3RMKC 4A8XC 3OG5A 2G45B 4E74A 2LEKA 3AE9B 1XQQA 1WH3A 2WXHA 2BYEA 4XDCA 1VZ6A 3AE4B 2N9XA 2KLCA 1YQBA 5C23A 4EZLA 1AN8A 3SFDB 3AV8A 2NMQA 2B3AA 2FE8A 4RCOA 2BF8B 2DZMA 1V80A 4AQ7A 4RGMA 3U8ZA 1KLUD 3B08A 2KANA 3ZNGC 2WX1A 3V05A 2VZKB 5HG2A 4NAWB 5KHQA 1WF9A 2XNAC 3HK0A 3E9SA 3NHEB 2WP9B 1TTNA 2QHOA 3R3MA 1ZDVA 4XZ4A 1UZXB 1TS3A 2KFKB 3AULA 3KUCB 2KN5A 2K8BA 2ZPNA 1E8YA 1EF5A 5FKAC 2PVGC 1ZUD2 1GUAB 1FXIA 2JWUA 1FD6A 4AWJA 3QK0A 2YEPB 1JMLA 3TEXA 3ENEA 3A4RA 3VAWA 4PK1A 2AYOB 2E6XA 1D4BA 1PUTA 4HJGE 2YEPF 3KYCD 4ZOHC 1IGDA 1E8ZA 4YWGG 2BB5A 3QARA 4KGSA 2NVUI 2K8CA 1SBBB 2K0PA 2MHJA 4WIPA 4BKTA 1U4AA 4JPSA 2L32A 2G3QB 4FULA 2UYZB 2MBBB 1L2NA 4KGTA 3ZXRA 3H7PA 2K6DB 2IPKD 2RDBC 3WALA 3AE2B 4MM3A 4ZHOA 4EFOA 4USAA 3I63C 1HTQA 4KV2A 1T0SC 5C3JB 1F52A 4JLCA 1WX8A 4GSWA 3QC8B 1KTKA 2KTRB 2MP2B 4BKSD 2LVPA 4KKJA 3V6CB 2GBNA 4LNOA 4NQLB 2M17A 4E3CA 2PMVA 3Q8CA 1WZ3A 3NG0A 4TQ0A 3DDCB 1A70A 3DHIC 5LXIB 2EMSA 3BK1A 4NY0A 2R2OA 3NUHB 4WQMA 1CJEA 1EWCA 3ETRA 4FHJA 4CO7A 1V1OA 3RUIB 1KM7A 3PV1A 2WDRB 1JWMD 2C7NB 4M0WB 4HVBA 2WLBA 1K8RB 4G11A 2KJ6A 2WXPA 1SE4A 4WH4A 3PZDA 1GB1A 2N9EB 2WU5B 1UH6A 2M0AA 4IW0A 1J7AA 3AEFB 3SD5A 4BKGA 3R8BA 1P0RA 2QJLA 1JWAD 4LCDE 4RF1A 3DVGY 1WGGA 1MJDA 3AU5A 4ANWA 3S2AA 1TYGB 4OZCA 2CHWA 3AEAB 4KIKA 4YSXB 2CKHB 2D2QA 1SE2A 2LGDA 2W54A 1FRDA 4C4VA 3PZ8A 3PLVA 5E6NA 1WIAA 2KYWA 4IM0A 4ZRKA 4W9JA 3ZDTA 2FBWB 2RPQA 1VD2A 1M4VA 5AUKA 2ON8A 4N6EB 1WR6E 5KHOA 3Q3OC 2JPHA 1UWXA 2Z59B 1TZOA 3ZKJC 1E6EB 4MDKE 1B9RA 1S1QB 1VZ8A 3AEGB 2NPTB 1IP9A 3ZGZA 3JSVA 2Y5BB 5BYQA 2GB1A 3RNBC 1P98A 3TEZA 1TT5B 1PGXA 1L0YB 1V1PB 2MJDA 3DBLI 2M1MA 4A55A 5T8IA 5AZFA 1FXAA 3ZTDA 1OEYA 1AYFA 2N1VA 2DHZA 3L08A 3TL5A 5EDSA 4ZRIA 1JRPA 4B9KA 1OEYJ 2ZJDA 5FK9C 1V86A 3NVWA 4YTNB 1E8WA 3W5VB 1R4MB 2N9KA 3FAHA 1IBXB 1KLGD 1SE3A 2K39A 2D11A 4NJCA 2D5GA 3Q3MC 3HRDD 4ASWC 2K3UA 2KFJA 3KUZA 2UWQA 1QLBB 3DWMA 2JXXA 4KSKC 3L17A 4KZCA 1IYFA 4GU2A 1N5XA 4LLGM 5BYSA 5HI1A 1WI0A 3I5JC 1VR9A 1ET6A 4WJNA 3TIXA 5CTRC 4FN2A 1EF1A 4HPMB 4W9CA 1SEBD 2BYVE 4HK2A 4IOIE 1WXMA 3ZLZA 3APCA 2A5UA 2KMMA 1JRUA 4DXFA 4NNJB 2KC2A 3QWZB 3FILB 2JQRB 1WGDA 2BBCA 2BKFA 2N7DA 3AE7B 1C4AA 1E0ZA 5JHBA 1FCCC 1NVID 2PW9A 1ZOYB 3VRAB 1B1ZA 3LDZE 2KQ7A 3VR8B 3U4EG 2NTTA 2Y5PA 1T0RC 2M19A 4H2AA 4G50A 1NENB 1K50A 4BKSA 4DDGD 5LNK1 4J3OD 2KK8A 1D5XC 2IYDB 2LHDA 1Q1OA 3RZWC 3B0AA 1QQRA 2IGGA 3DVNU 3SFEB 2KX3A 2LHEA 3EFCA 2NTSA 4MJSA 4DK5A 2RDGA 1CK1A 1I4GA 4PYZA 4F7ZA 1MG8A 3X0WA 2MCNB 4HXDA 4RFBA 4LNKA 4ACFA 2M8SA 5G5GA 1FPYA 1SIFA 3VH4B 2ZVNA 2ZPYA 2JRIB 2K6QA 3EUB2 1LFDA 4ARCA 1LM8B 2V3SA 2JZZA 1WJUA 3ZRFA 3QJZA 4S0RA 4MH0E 1UBIA 1I35A 1I42A 4JX1C 1NI3A 4WJPA 4FA6A 3A9KA 1P7EA 4K3CA 3R2IA 3URYA 1UGJA 3OAWA 1ENFA 2QIEB 4A9AA 1MG4A 2CS4A 4GDKB 2JYEA 1HZ6A 1V9JA 2QCZA 1F9JA 2LI5A 4IG7B 3CIRB 5LXHA 4PS3A 3BWUD 1TKGA 3LJ3A 3FKYA 4RGNA 2L0FA 2JYTA 1FRRA 2BWES 4ZHPA 1HE8A 1WGKA 1C76A 1R7SA 2WXRA 3A33B 2GBKA 3P4SB 5L83A 4M8NA 4WWMA 2XN9C 3AE8B 2L00B 2L05A 2RDHA 1WM2A 4DDID 1FM0D 1HZ5A 1VDVA 1RFAA 2W3SA 2DYBA 4I6NB 3KYDD 1WYWB 5D94A 2V9HA 4G0NB 1JWBD 3PPAA 1T3QA 4KKIA 3DBRI 1WMHB 2O6VB 3NZSA 2WXOA 3HIZA 4IUMB 2WHIA 3L0WB 1SXTA 4WAFA 2DX5B 1YMHE 5CHFA 1ZE3D 3PT2B 4RMAA 3GZNI 2E3TA 3VTVA 4WJOA 2HDEA 2PIAA 3P63A 2CR5A 1BMLC 2O2VB 1E10A 2FUG1 2KJHB 3AH7A 5DPRA 2SEBD 3LYYA 4IKGA 4II2B 4C80A 4OZBA 4K7WA 4DBGA 1L0XB 4L2YA 1EWYC 4ZYSA 5L95C 3PHWB 3UINB 3J9CA 1V8CA 1OTRB 4AJWA 4N58A 2HTHA 1T0QC 2YLMA 4NAMA 3EC8A 2KHWB 1F2RC 1GB4A 2KZRA 3AEEB 1KFYB 4M02A 3N9YC 2FCMA 3JVZX 5I4DA 3PRMB 2KOXA 4JL9A 4MT5A 2PE9A 3MP9A 3MTNB 3C0RB 3AU4A 3IVFA 2AX5A 2LZ6A 3UIPB 2L8JA 5BMHA 1TKEA 2LWPA 1X1MA 4HEA1 3TBLD 1L7YA 4KSLC 4HROA 2CJNA 1I4RA 1K52A 1ZKHA 2I1JA 5IN7A 1F1HA 1YJJA 3CF6E 2V0GA 2IDYA 1WFYA 2WDVB 1UD7A 1PGAA 4IWOA 3EA6A 2Z0DB 1LO5D 3Q3NC 2BKRB 3Q14C 3EGRA 2WU2B 1ZDXA 1N60A 3I57A 5H8YE 2LGSA 2N7EA 2N4FA 1OQQA 3W1YA 2DZKA 5JH5C 3N32A 3ABVB 3V62A 3P2BA 3MFGA 4CQNA 3V60A 5JZEB 1E7PB 2N9PC 1P9DU 3MC9A 3IT6B 4JGHB 2L3ZA 4AS1A 4WJQA 4MSMB 1D6EC 3IT4B 3Q8FA 4IWQA 3GE3C 3BYTB 3QAQA 3ZJTA 2PJHA 3K9PB 3M62B 2FNJB 4ANXA 2NPTA 1JROA 1WJ4A 1TY2A 1TGZB 2LUMA 3N20C 3R7RA 3WCQA 3HUIA 5D2MB 4KZ0A 4BOSC 3M3JA 4C56C 5D3IB 2ZNVC 2XK5B 4FJZA 2QEJC 2IBIB 3ZVVA 3ZNHB 3H6NA 4GB9A 4E71A 4CHKA 3MJWA 2RMMA 4GN1A 4LDTB 1GAQB 2C5LC 4LK0M 1TJEA 1VRAB 3VXWA 2KDFB 4BFRA 3PS6A 1SJHD 2RSUA 1TIFA 4TSSA 2BYTA 1MFWA 2K9XA 3HVZA 2KT7A 3RN9C 4MGZE 1ZW7A 4AP4C 1TS4A 2KWVB 3PZ7A 1AWDA 3UQBA 1S3SG 1F77A 4PS7A 5E6PA 1L5PA 3AI5A 2BS3B 4EZJA 5D6JB 4W9EA 3ZUNA 2WS3B 4OVVA 1NYQA 4ZRPA 1R4NI 1BUIC 4NJ6A 4BBNF 5IO9A 3N1XC 1DOXA 1TZ1A 2Y5CA 1V6EA 1SIJA 3IG3A 3IAM1 4JIOU 1A5RA 1WX9A 2JWZA 4LJPB 1C3TA 2MJ3A 1TS2A 4W9LA 3R7QA 3Q69A 1TBEA 1EO6A 5EE1A 3DBLB 2MBOA 5DPWA 2VZKD 1KOTA 1WRIA 1XLPA 3WAOA 4W9GA 3B2FA 4P16A 4RF0A 1L6UA 4AOFA 1ISNA 3GE8C 3VUXA 1GG3A 4NQKE 3RI7C 2WXIA 3FILA 3VVWB 3RD2A 2WNMA 3UIOB 4S17A 1SB3C 5IKCM 2DWQA 2G9HD 1YNTE 2KAJA 4YXDB 2AWTA 2W82A 2W55A 4G3XB 4B6WA 1YJIA 1IGCA 1NYRA 1GJZA 4HWIB 3ZIMA 3VH3B 2L52A 2RR9A 4JE3B 3RT3B 3WANA 4DHZE 2Z0EB 2ICIA 1YD8U 4F8CB 1TY0A 2HE7A 2MX2A 1XXGA 1FCLA 2KDMA 2WXGA 1YOVB 5GXGB 1QOGA 5IP4D 1BT0A 5TR5A 4OZAA 3PO0A 4N59A 4GXBA 1ZXHA 2Q5WD 3ML8A 3RNGC 1XLNA 3LXFA 2JU6X 2KXJA 3UGBB 1C79A 1E7VA 2K8HA 1F2RI 3O65B 5D3DA 3PLUA 5IOIA 3I3TB 4B0EA 2XBBC 3B2GA 2KQSA 1XLOA 4RNAA 3RNEC 4K3BA 2BWFA 4FJVB 2G1EA 3ZTCA 2LRUA 3Q3JA 3H7PB 2M56B 3AE6B 1VZ7A 4RGOS 1D5ZC 2TSSA 2PTLA 4LNNA 3HVDA 4GDKA 1YQ4B 3NZ3A 4II3B 2V4LA 2PKOA 4GMVA 2N9LA 3E56A 4GDLA 1WXQA 2BT6A 3DVNV 3U7DA 1QOAA 1WGRA 3U2SC 4M01A 3NVVA 1WXSA 4XWWA 1CZPA 4N9F4 2DENB 1N62A 2Y3AA 3OJ4B 1Z5SB 4DHJB 3PREA 2MQJA 3RZFA 2LASA 2BVCA 3A9JB 2INCC 2FIFA 2JZ3B 1VJKA 2N0SB 4XE0A 4RM9A 1D5MC 3PVLA 1C9FA 2KWUB 3RNFC 1XCQL 1CQVA 4LNFA 2KVRA 2GLSA 2MEKA 1YQ3B 1L4DB 3ZNID 4Q2JA 3TEWA 3B9JA 3V3XA 3MJ5A 1WMHA 5LLIA 4XDDA 2KNBA 2AEHA 1GOZA 2RD0A 1LXDA 1V49A 1J7BA 1XD3B 1AW7A 2IO2B 2BGFA 1NI2A 4NPNA 3NY5A 3ECIA 2O2VA 1XO3A 4K7SA 2QC8A 1FIQA 3QX1A 4KIKB 4I6LB 4TV3A 2CU3A 3ONSA 4EE2A 5H92C 3P4PB 1LQBA 1KH0A 1YN5A 1FFUA 5D7GA 1FNWA 2L83A 2DYOA 3W5UB 2BTEA 2GBMA 2KDEB 1V97A 4W9FA 4W9HA 1RRBA 1KJTA 2VH1A 4K7UA 1E7UA 2QMTA 5IA7A 2KLGA 2LD9A 4EUTA 3AN1A 1YN4A 3DQVA 4RH6A 2L7RA 5DPSA 3WIMA 3PSEB 1WE7A 4FLHA 4DQOC 4ITKA 1FFVA 1JWUD 1F0ZA 3NJTA 4R3DA 2EKIA 2FCSA 3RFZB 3N1ZC 5AUIA 2NBUA 4KDLB 3DBRB 4IWPA 4NAWA 1V81A 1WR1A 2LGXA 3IXSA 4ICVA 2PEAA 3Q8AA 3JYUA 2OJWA 1WGHA 3Q6BA 4LJOB 2LVQA 1NBFC 2KDIA 3AB5A 2NCNA 4A6QA 2C60A 2KFKA 3Q8EA 1SGHA 2IO0B 3GZNB 2L0TA 1QT9A 1PYWD 1C78A 2V3NA 2WXJA 3QHTA 4EKUA 3N1YC 1STEA 1WX7A 5HKHA 1XLQA 5DCNA 1ACCA 3IHPC 3PTFC 2IO3B 1FMAD 4B95A 2D3AA 1HEZE 4ANUA 3BYYB 1QOFA 3A1QB 4K81A 2WXMA 4HLEA 2C9WB 2J0JA 2H89B 1SF0A 3AEDB 5AZHA 3Q3FA 3RNAC 4ICUA 1MVKA 1DYQA 3PHXB 3AE1B 4JWSC 1XCTL 1Z2MA 1N61A 2ZW1A 2FUHB 3BZDB 2MSED 1J8CA 4ARIA 2BPSA 3OJ3A
chains in the Genus database with same CATH topology
3V60A 5JZEB 2N9PC 2R2QA 1J0GA 1P9DU 3PLVA 1ZGUB 4MEMA 2EMTA 5E6NA 4W9IA 4AUQC 2M4NA 4JGHB 2CHZA 1WIAA 2EKEC 2L3ZA 1G6JA 2MWSB 4IM0A 4ZRKA 4W9JA 3ZDTA 3RYTA 4WJQA 3NZUA 4MSMB 3PGEA 2RPQA 3TCAA 1KLVA 4IWQA 1VD2A 1QZEA 4DHZB 1UGMA 3QAQA 3W1SA 2PJHA 3K9PB 3M62B 2FNJB 4HDQA 1WR6E 5KHOA 2LGYA 4ANXA 2NPTA 1WGYA 3N3KB 1WJ4A 3EECA 1RAXA 4DWFA 4GGQA 2GOWA 2WYQA 1TGZB 3DVGX 2JPHA 3R7RA 4EOYA 5D2MB 3L16A 3W1SC 4W9DA 2KTRA 3D32A 4KZ0A 2Z59B 1T0YA 2MP2A 4TQ1A 2LJ5A 3M3JA 4BOSC 1J19A 4JQWC 4WQOB 1R4MI 3ZKJC 2ZNVC 2XK5B 2A4ZA 4FJZA 4ZYNA 2IBIB 3ZVVA 4MDKE 3ZNHB 1S1QB 4WWOA 4FJYA 1OGWA 3H6NA 4GB9A 4IM3A 1WJ6A 4CHKA 3MJWA 4E71A 4GN1A 4LDTB 2NPTB 2C5LC 3IFWB 4XC2A 3A4SC 3JSVA 1IP9A 2MLBA 2KDFB 2Y5BB 2ZZPB 3L10B 3VXWA 4BFRA 3PS6A 1Y8RC 2RSUA 1P98A 4FHKA 5JHAA 2MA9B 3X23A 5G55A 3DBLI 5CHVC 3L54A 3H7SA 3MHSD 2M1MA 2DYMA 4MGYE 4PYUA 2CHXA 4MGZE 5AZFA 4AJYB 2LRWA 3ZTDA 1OEYA 1ZW7A 4AP4C 3CSFA 2KWVB 2N1VA 3UQBA 2FAZA 1Q0WB 1S3SG 2DHZA 3K9OB 2KX0A 1YX5B 2J7QB 4PS7A 5E6PA 2G4SA 3L08A 3TL5A 3AI5A 3JSVB 2NR2A 4ZRIA 5EDSA 4EZJA 1H4RA 5D6JB 4B9KA 2W9NA 4W9EA 3ZUNA 3HHMA 3BY4B 4OVVA 1R4NI 4MELA 4MJSB 3PRPB 4NJ6A 4BOZB 1OEYJ 2ZJDA 4BBNF 1V86A 1GC7A 1E8WA 1TZ1A 3IBEA 4TKNA 3WAMA 3T9LA 2KDBA 2K1FA 3ZW3A 1V6EA 2K39A 2D10A 4IM2A 2D11A 3IG3A 3KW5B 1YIWA 4JIOU 2XEWA 1A5RA 1WX9A 2JWZA 3JW0X 4LJPB 2PE6B 3SDLC 4ASWC 1C3TA 4CYEA 3DCGA 4W9LA 2KFJA 2M0XA 3B1LX 3R7QA 1TBEA 3KUZA 2UWQA 1EO6A 1E90A 1E8XA 2JF5A 3QA8A 4ZRJA 3NS8A 2MBOA 5DPWA 1WY8A 2JXXA 3UF8A 3VUWA 1KOTA 3N30A 4KSKC 5J17A 2D07B 3L17A 4KZCA 1P3QU 4W9GA 3VHTC 3WAOA 2ZEQA 1IYFA 1FXTB 4GU2A 3RCZA 2V1YA 4DHJD 4AOFA 5C1ZA 1ISNA 3V61A 3VUXA 1GG3A 2IY0B 4NQKE 4HDOA 4ANVA 2MBEA 3R66C 1WI0A 3OLMD 4J6IA 3VVWB 4WAAA 4WJNA 3TIXA 5CTRC 3L13A 3RD2A 3EHVA 4FN2A 3UIOB 4GIVA 2REXA 3APFA 4GDLB 3VTUA 1EF1A 2DZJA 3DBHI 5FR6A 4HPMB 4K1RB 4W9CA 2FCNA 3A9KB 2IZVB 5CHWA 3M63B 2RGFA 2BYVE 3DPDA 2AWTA 1WJNA 4G3XB 4HK2A 4HCPB 4B6WA 1WXMA 3ZLZA 3BINA 2IY1B 3APCA 4EZKA 2AL3A 2A5UA 1JRUA 2D3GA 1GJZA 4HWIB 4NNJB 3ZIMA 2KWCA 2KC2A 3QWZB 3KUDB 1VCBA 2KMAA 3VH3B 3KVFB 2RR9A 1WGDA 2XK5A 3WAPA 3WANA 3RT3B 1V2YA 3ZO5B 4FADA 2BKFA 2N7DA 4MSQB 4DHZE 1YJ1A 2Z0EB 3H9DA 4W9KA 3SU8X 1YD8U 1H8CA 1XT9B 4F1SA 5JHBA 4F8CB 5DPTA 5G2NA 3RULA 2HE7A 3HM6X 2ASQA 1WRDB 4A20A 2MX2A 2KQ7A 3LDZE 4EEWA 4OVUA 2JT4B 2PPHA 2C7HA 4G50A 3CMMB 1YX6B 2O6VD 4BKSA 4DDGD 2KTFA 1BT0A 2KK8A 2IYDB 1PQSA 2LXAA 4BVUC 1Q1OA 1D3ZA 1P1AA 3RZWC 3B0AA 4HJKA 5TR5A 1GNUA 3DVNU 1M94A 4RM8A 2J0KA 4GXBA 2KX3A 2WWZA 3ML8A 1C1YB 2DAFA 4NJ7A 2KXJA 2JVCA 2OOBB 1NDDA 4MJSA 3UGBB 4BBNC 1E7VA 4DK5A 4FBJB 1UBQA 4DXAB 4PYZA 4F7ZA 3EFUA 1MG8A 2K8HA 2L76A 2JY6A 2MCNB 4HXDA 3X0WA 3O65B 2M8SA 3PLUA 3I3TB 2NBWB 2JRHA 2XBBC 5BO4B 1SIFA 3VH4B 4P7IA 2ZVNA 3VUYA 4PS8A 2ZPYA 2KQSA 3WA0A 1SE9A 1CMXB 2JRIB 2K6QA 2OJRA 3VTWA 3ZNZB 2LVOA 2BWFA 1LFDA 2G45B 4FJVB 3ZTCA 4E74A 2LRUA 1LM8B 2V3SA 2YVCA 2JZZA 3Q3JA 2LUEA 3H7PB 1AARA 1XQQA 2KJRA 1WH3A 1WJUA 2BYEA 3ZRFA 3QJZA 4MH0E 1UBIA 2GMIC 2N9XA 1I35A 2KLCA 3UQAA 1I42A 5GMVA 4WJPA 3QCAA 1YQBA 4A3PA 2MBHA 4GDKA 4I6PA 5C23A 4EZLA 1Q5WB 4II3B 4FA6A 2V4LA 4GMVA 3A9JA 2B3AA 4GDLA 2KO3A 3DVNV 2BF8B 3U7DA 2DZMA 1V80A 3U8ZA 3A9KA 1WGRA 3DBSA 3B08A 1WXSA 2KANA 3ZNGC 2WX1A 2N1WA 2IO1B 1OQYA 4NAWB 5KHQA 1WF9A 3HK0A 4N9F4 3OAWA 4ZDVA 2DENB 3NHEB 3GOEA 3OJ4B 1Z5SB 1TTNA 4DHJB 2QHOA 2CS4A 3R3MA 1E5WA 4XZ4A 4GDKB 1UELA 1RLFA 1V9JA 3PREA 2MQJA 3RZFA 1UZXB 1F9JA 5E6OA 2LI5A 4IG7B 2AL6A 2LASA 3A9JB 2JZ3B 2FIFA 2KFKB 3AULA 3KUCB 5LXHA 2KKCA 2KN5A 4PS3A 4RM9A 3CSTA 2K25A 3PVLA 3ALBA 3LJ3A 2G4DB 2K8BA 3TMPB 2MRPA 2KWUB 4KVGB 3VFKA 1WXAA 2ZPNA 2L0FA 1E8YA 2BWES 2KVRA 1EF5A 1HE8A 3ZNID 1WXVA 1GUAB 3AXCA 2ZVOA 2FIDA 3HM3A 1WMHA 3A33B 2GBKA 5LLIA 1GC6A 2KNBA 5L83A 2AEHA 5J18A 4M8NA 4AWJA 3QK0A 4WWPA 2NBVB 2L00B 2L05A 2RD0A 1WM2A 1LXDA 1V49A 4DDID 3ENEA 1RFAA 2LXCA 3A4RA 2DYBA 1V5TA 4I6NB 3VAWA 1XD3B 2AYOB 3KYDD 4XX5A 1WYWB 5AEKB 5D94A 4G0NB 2IO2B 2BGFA 1NI2A 3KYCD 3PPAA 4NPNA 4MGIE 1E8ZA 3NY5A 4X57B 3ZDMC 2WX0A 2KMCA 3ECIA 2O2VA 2MBQA 3DBRI 3DOWA 1WMHB 1WM3A 1WZ0A 4K7SA 2O6VB 3NZSA 4A3OA 2C7MB 3HIZA 2HJ8A 3QARA 4HPLB 4IUMB 3M95A 3QX1A 4KIKB 4WWNA 3L0WB 4I6LB 4TV3A 3ONSA 3U30A 2NVUI 2K8CA 1LQBA 4BKTA 1U4AA 2CU1A 2DX5B 4IC7B 5J2RA 5CHFA 2G3QB 3PT2B 4FULA 4HCNB 2UYZB 3GZNI 4RMAA 5D7GA 2DYOA 2MBBB 3VTVA 1L2NA 4WJOA 3QIJA 3H7PA 2GBMA 2KDEB 4W9FA 2CR5A 2K6DB 2O2VB 4W9HA 3WALA 1RRBA 3SHQA 4MM3A 1KJTA 4EFOA 2KJHB 4LDTD 4K7UA 1E7UA 5IAAC 5IA7A 2KLGA 4KV2A 5DPRA 2LD9A 3VDZA 4EUTA 4GOCA 1IPGA 1WX8A 3DQVA 4II2B 4JLCA 2L7RA 5DPSA 4GSWA 3WIMA 4K7WA 2ZNVB 3PSEB 2KD0A 1WE7A 4DBGA 2I1KA 4FLHA 3QC8B 3KH0A 2KTRB 5L95C 2MP2B 3PHWB 2KC1A 2JUOA 2FCSA 4BKSD 2LVPA 2NBUA 4KDLB 3V6CB 2GBNA 3UINB 4NQLB 4IWPA 4NAWA 1OTRB 2M17A 4AJWA 1V81A 4E3CA 3VQIA 1WR1A 2LGXA 1WZ3A 2HTHA 4ICVA 4TQ0A 3DDCB 2FCQA 2PEAA 2YLMA 3JYUA 3EC8A 5LXIB 2GBJA 2KHWB 2EMSA 3H1UA 1WGHA 3PRZA 4LJOB 2KZRA 2ZCBA 4KDIC 2LVQA 4NY0A 1NBFC 2KDIA 2R2OA 2NCNA 4TUUA 2C60A 4MGKE 2KFKA 2FCMA 1SGHA 3JVZX 3PRMB 2BPSA 3ML9A 2KOXA 3QQ8B 2IO0B 4FHJA 4YL8A 5CX3A 4JL9A 3RUIB 4CO7A 2PE9A 1KM7A 2L0TA 3MTNB 3PV1A 3C0RB 3AU4A 3IVFA 3A1QA 2LZ6A 3UIPB 1EUVB 2L8JA 2C7NB 3QHTA 4EKUA 1V5OA 2LWPA 1X1MA 4M0WB 4HVBA 1K8RB 1WE6A 3TBLD 3ZRCA 1L7YA 1WX7A 4G11A 2KJ6A 2BYFA 5HKHA 4KSLC 2DZIA 5DCNA 1ZKHA 2I1JA 5AZGA 3IHPC 3PTFC 2IO3B 3PZDA 3CF6E 2N9EB 4B95A 1WFYA 1UD7A 1UH6A 2ZCCA 2WDTB 4IWOA 3APDA 4IW0A 4ANUA 3A1QB 4K81A 2Z0DB 3NOBA 2BKRB 3SD5A 3T8MA 2GBRA 4BKGA 4HLEA 1P0RA 4M8MA 2NS5A 2C9WB 2J0JA 5AZHA 4URKA 4LCDE 2J0MA 2DAJA 3DVGY 1WGGA 3Q3FA 3AU5A 4ICUA 2HD5B 4ANWA 2O6VA 3S2AA 2VRRB 3PHXB 3V6EB 2CHWA 1Z2MA 2N7EA 2MW5A 2FUHB 2N4FA 4KIKA 2MSED 3W1YA 1J8CA 2DZKA 2CKHB 3N32A 2D2QA 5JH5C 3V62A 3TJPA 3P2BA 2LGDA 3OJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V60 A;  5JZE B;  2N9P C;  2R2Q A;  1J0G A;  1P9D U;  3PLV A;  1ZGU B;  4MEM A;  2EMT A;  5E6N A;  4W9I A;  4AUQ C;  2M4N A;  4JGH B;  2CHZ A;  1WIA A;  2EKE C;  2L3Z A;  1G6J A;  2MWS B;  4IM0 A;  4ZRK A;  4W9J A;  3ZDT A;  3RYT A;  4WJQ A;  3NZU A;  4MSM B;  3PGE A;  2RPQ A;  3TCA A;  1KLV A;  4IWQ A;  1VD2 A;  1QZE A;  4DHZ B;  1UGM A;  3QAQ A;  3W1S A;  2PJH A;  3K9P B;  3M62 B;  2FNJ B;  4HDQ A;  1WR6 E;  5KHO A;  2LGY A;  4ANX A;  2NPT A;  1WGY A;  3N3K B;  1WJ4 A;  3EEC A;  1RAX A;  4DWF A;  4GGQ A;  2GOW A;  2WYQ A;  1TGZ B;  3DVG X;  2JPH A;  3R7R A;  4EOY A;  5D2M B;  3L16 A;  3W1S C;  4W9D A;  2KTR A;  3D32 A;  4KZ0 A;  2Z59 B;  1T0Y A;  2MP2 A;  4TQ1 A;  2LJ5 A;  3M3J A;  4BOS C;  1J19 A;  4JQW C;  4WQO B;  1R4M I;  3ZKJ C;  2ZNV C;  2XK5 B;  2A4Z A;  4FJZ A;  4ZYN A;  2IBI B;  3ZVV A;  4MDK E;  3ZNH B;  1S1Q B;  4WWO A;  4FJY A;  1OGW A;  3H6N A;  4GB9 A;  4IM3 A;  1WJ6 A;  4CHK A;  3MJW A;  4E71 A;  4GN1 A;  4LDT B;  2NPT B;  2C5L C;  3IFW B;  4XC2 A;  3A4S C;  3JSV A;  1IP9 A;  2MLB A;  2KDF B;  2Y5B B;  2ZZP B;  3L10 B;  3VXW A;  4BFR A;  3PS6 A;  1Y8R C;  2RSU A;  1P98 A;  4FHK A;  5JHA A;  2MA9 B;  3X23 A;  5G55 A;  3DBL I;  5CHV C;  3L54 A;  3H7S A;  3MHS D;  2M1M A;  2DYM A;  4MGY E;  4PYU A;  2CHX A;  4MGZ E;  5AZF A;  4AJY B;  2LRW A;  3ZTD A;  1OEY A;  1ZW7 A;  4AP4 C;  3CSF A;  2KWV B;  2N1V A;  3UQB A;  2FAZ A;  1Q0W B;  1S3S G;  2DHZ A;  3K9O B;  2KX0 A;  1YX5 B;  2J7Q B;  4PS7 A;  5E6P A;  2G4S A;  3L08 A;  3TL5 A;  3AI5 A;  3JSV B;  2NR2 A;  4ZRI A;  5EDS A;  4EZJ A;  1H4R A;  5D6J B;  4B9K A;  2W9N A;  4W9E A;  3ZUN A;  3HHM A;  3BY4 B;  4OVV A;  1R4N I;  4MEL A;  4MJS B;  3PRP B;  4NJ6 A;  4BOZ B;  1OEY J;  2ZJD A;  4BBN F;  1V86 A;  1GC7 A;  1E8W A;  1TZ1 A;  3IBE A;  4TKN A;  3WAM A;  3T9L A;  2KDB A;  2K1F A;  3ZW3 A;  1V6E A;  2K39 A;  2D10 A;  4IM2 A;  2D11 A;  3IG3 A;  3KW5 B;  1YIW A;  4JIO U;  2XEW A;  1A5R A;  1WX9 A;  2JWZ A;  3JW0 X;  4LJP B;  2PE6 B;  3SDL C;  4ASW C;  1C3T A;  4CYE A;  3DCG A;  4W9L A;  2KFJ A;  2M0X A;  3B1L X;  3R7Q A;  1TBE A;  3KUZ A;  2UWQ A;  1EO6 A;  1E90 A;  1E8X A;  2JF5 A;  3QA8 A;  4ZRJ A;  3NS8 A;  2MBO A;  5DPW A;  1WY8 A;  2JXX A;  3UF8 A;  3VUW A;  1KOT A;  3N30 A;  4KSK C;  5J17 A;  2D07 B;  3L17 A;  4KZC A;  1P3Q U;  4W9G A;  3VHT C;  3WAO A;  2ZEQ A;  1IYF A;  1FXT B;  4GU2 A;  3RCZ A;  2V1Y A;  4DHJ D;  4AOF A;  5C1Z A;  1ISN A;  3V61 A;  3VUX A;  1GG3 A;  2IY0 B;  4NQK E;  4HDO A;  4ANV A;  2MBE A;  3R66 C;  1WI0 A;  3OLM D;  4J6I A;  3VVW B;  4WAA A;  4WJN A;  3TIX A;  5CTR C;  3L13 A;  3RD2 A;  3EHV A;  4FN2 A;  3UIO B;  4GIV A;  2REX A;  3APF A;  4GDL B;  3VTU A;  1EF1 A;  2DZJ A;  3DBH I;  5FR6 A;  4HPM B;  4K1R B;  4W9C A;  2FCN A;  3A9K B;  2IZV B;  5CHW A;  3M63 B;  2RGF A;  2BYV E;  3DPD A;  2AWT A;  1WJN A;  4G3X B;  4HK2 A;  4HCP B;  4B6W A;  1WXM A;  3ZLZ A;  3BIN A;  2IY1 B;  3APC A;  4EZK A;  2AL3 A;  2A5U A;  1JRU A;  2D3G A;  1GJZ A;  4HWI B;  4NNJ B;  3ZIM A;  2KWC A;  2KC2 A;  3QWZ B;  3KUD B;  1VCB A;  2KMA A;  3VH3 B;  3KVF B;  2RR9 A;  1WGD A;  2XK5 A;  3WAP A;  3WAN A;  3RT3 B;  1V2Y A;  3ZO5 B;  4FAD A;  2BKF A;  2N7D A;  4MSQ B;  4DHZ E;  1YJ1 A;  2Z0E B;  3H9D A;  4W9K A;  3SU8 X;  1YD8 U;  1H8C A;  1XT9 B;  4F1S A;  5JHB A;  4F8C B;  5DPT A;  5G2N A;  3RUL A;  2HE7 A;  3HM6 X;  2ASQ A;  1WRD B;  4A20 A;  2MX2 A;  2KQ7 A;  3LDZ E;  4EEW A;  4OVU A;  2JT4 B;  2PPH A;  2C7H A;  4G50 A;  3CMM B;  1YX6 B;  2O6V D;  4BKS A;  4DDG D;  2KTF A;  1BT0 A;  2KK8 A;  2IYD B;  1PQS A;  2LXA A;  4BVU C;  1Q1O A;  1D3Z A;  1P1A A;  3RZW C;  3B0A A;  4HJK A;  5TR5 A;  1GNU A;  3DVN U;  1M94 A;  4RM8 A;  2J0K A;  4GXB A;  2KX3 A;  2WWZ A;  3ML8 A;  1C1Y B;  2DAF A;  4NJ7 A;  2KXJ A;  2JVC A;  2OOB B;  1NDD A;  4MJS A;  3UGB B;  4BBN C;  1E7V A;  4DK5 A;  4FBJ B;  1UBQ A;  4DXA B;  4PYZ A;  4F7Z A;  3EFU A;  1MG8 A;  2K8H A;  2L76 A;  2JY6 A;  2MCN B;  4HXD A;  3X0W A;  3O65 B;  2M8S A;  3PLU A;  3I3T B;  2NBW B;  2JRH A;  2XBB C;  5BO4 B;  1SIF A;  3VH4 B;  4P7I A;  2ZVN A;  3VUY A;  4PS8 A;  2ZPY A;  2KQS A;  3WA0 A;  1SE9 A;  1CMX B;  2JRI B;  2K6Q A;  2OJR A;  3VTW A;  3ZNZ B;  2LVO A;  2BWF A;  1LFD A;  2G45 B;  4FJV B;  3ZTC A;  4E74 A;  2LRU A;  1LM8 B;  2V3S A;  2YVC A;  2JZZ A;  3Q3J A;  2LUE A;  3H7P B;  1AAR A;  1XQQ A;  2KJR A;  1WH3 A;  1WJU A;  2BYE A;  3ZRF A;  3QJZ A;  4MH0 E;  1UBI A;  2GMI C;  2N9X A;  1I35 A;  2KLC A;  3UQA A;  1I42 A;  5GMV A;  4WJP A;  3QCA A;  1YQB A;  4A3P A;  2MBH A;  4GDK A;  4I6P A;  5C23 A;  4EZL A;  1Q5W B;  4II3 B;  4FA6 A;  2V4L A;  4GMV A;  3A9J A;  2B3A A;  4GDL A;  2KO3 A;  3DVN V;  2BF8 B;  3U7D A;  2DZM A;  1V80 A;  3U8Z A;  3A9K A;  1WGR A;  3DBS A;  3B08 A;  1WXS A;  2KAN A;  3ZNG C;  2WX1 A;  2N1W A;  2IO1 B;  1OQY A;  4NAW B;  5KHQ A;  1WF9 A;  3HK0 A;  4N9F 4;  3OAW A;  4ZDV A;  2DEN B;  3NHE B;  3GOE A;  3OJ4 B;  1Z5S B;  1TTN A;  4DHJ B;  2QHO A;  2CS4 A;  3R3M A;  1E5W A;  4XZ4 A;  4GDK B;  1UEL A;  1RLF A;  1V9J A;  3PRE A;  2MQJ A;  3RZF A;  1UZX B;  1F9J A;  5E6O A;  2LI5 A;  4IG7 B;  2AL6 A;  2LAS A;  3A9J B;  2JZ3 B;  2FIF A;  2KFK B;  3AUL A;  3KUC B;  5LXH A;  2KKC A;  2KN5 A;  4PS3 A;  4RM9 A;  3CST A;  2K25 A;  3PVL A;  3ALB A;  3LJ3 A;  2G4D B;  2K8B A;  3TMP B;  2MRP A;  2KWU B;  4KVG B;  3VFK A;  1WXA A;  2ZPN A;  2L0F A;  1E8Y A;  2BWE S;  2KVR A;  1EF5 A;  1HE8 A;  3ZNI D;  1WXV A;  1GUA B;  3AXC A;  2ZVO A;  2FID A;  3HM3 A;  1WMH A;  3A33 B;  2GBK A;  5LLI A;  1GC6 A;  2KNB A;  5L83 A;  2AEH A;  5J18 A;  4M8N A;  4AWJ A;  3QK0 A;  4WWP A;  2NBV B;  2L00 B;  2L05 A;  2RD0 A;  1WM2 A;  1LXD A;  1V49 A;  4DDI D;  3ENE A;  1RFA A;  2LXC A;  3A4R A;  2DYB A;  1V5T A;  4I6N B;  3VAW A;  1XD3 B;  2AYO B;  3KYD D;  4XX5 A;  1WYW B;  5AEK B;  5D94 A;  4G0N B;  2IO2 B;  2BGF A;  1NI2 A;  3KYC D;  3PPA A;  4NPN A;  4MGI E;  1E8Z A;  3NY5 A;  4X57 B;  3ZDM C;  2WX0 A;  2KMC A;  3ECI A;  2O2V A;  2MBQ A;  3DBR I;  3DOW A;  1WMH B;  1WM3 A;  1WZ0 A;  4K7S A;  2O6V B;  3NZS A;  4A3O A;  2C7M B;  3HIZ A;  2HJ8 A;  3QAR A;  4HPL B;  4IUM B;  3M95 A;  3QX1 A;  4KIK B;  4WWN A;  3L0W B;  4I6L B;  4TV3 A;  3ONS A;  3U30 A;  2NVU I;  2K8C A;  1LQB A;  4BKT A;  1U4A A;  2CU1 A;  2DX5 B;  4IC7 B;  5J2R A;  5CHF A;  2G3Q B;  3PT2 B;  4FUL A;  4HCN B;  2UYZ B;  3GZN I;  4RMA A;  5D7G A;  2DYO A;  2MBB B;  3VTV A;  1L2N A;  4WJO A;  3QIJ A;  3H7P A;  2GBM A;  2KDE B;  4W9F A;  2CR5 A;  2K6D B;  2O2V B;  4W9H A;  3WAL A;  1RRB A;  3SHQ A;  4MM3 A;  1KJT A;  4EFO A;  2KJH B;  4LDT D;  4K7U A;  1E7U A;  5IAA C;  5IA7 A;  2KLG A;  4KV2 A;  5DPR A;  2LD9 A;  3VDZ A;  4EUT A;  4GOC A;  1IPG A;  1WX8 A;  3DQV A;  4II2 B;  4JLC A;  2L7R A;  5DPS A;  4GSW A;  3WIM A;  4K7W A;  2ZNV B;  3PSE B;  2KD0 A;  1WE7 A;  4DBG A;  2I1K A;  4FLH A;  3QC8 B;  3KH0 A;  2KTR B;  5L95 C;  2MP2 B;  3PHW B;  2KC1 A;  2JUO A;  2FCS A;  4BKS D;  2LVP A;  2NBU A;  4KDL B;  3V6C B;  2GBN A;  3UIN B;  4NQL B;  4IWP A;  4NAW A;  1OTR B;  2M17 A;  4AJW A;  1V81 A;  4E3C A;  3VQI A;  1WR1 A;  2LGX A;  1WZ3 A;  2HTH A;  4ICV A;  4TQ0 A;  3DDC B;  2FCQ A;  2PEA A;  2YLM A;  3JYU A;  3EC8 A;  5LXI B;  2GBJ A;  2KHW B;  2EMS A;  3H1U A;  1WGH A;  3PRZ A;  4LJO B;  2KZR A;  2ZCB A;  4KDI C;  2LVQ A;  4NY0 A;  1NBF C;  2KDI A;  2R2O A;  2NCN A;  4TUU A;  2C60 A;  4MGK E;  2KFK A;  2FCM A;  1SGH A;  3JVZ X;  3PRM B;  2BPS A;  3ML9 A;  2KOX A;  3QQ8 B;  2IO0 B;  4FHJ A;  4YL8 A;  5CX3 A;  4JL9 A;  3RUI B;  4CO7 A;  2PE9 A;  1KM7 A;  2L0T A;  3MTN B;  3PV1 A;  3C0R B;  3AU4 A;  3IVF A;  3A1Q A;  2LZ6 A;  3UIP B;  1EUV B;  2L8J A;  2C7N B;  3QHT A;  4EKU A;  1V5O A;  2LWP A;  1X1M A;  4M0W B;  4HVB A;  1K8R B;  1WE6 A;  3TBL D;  3ZRC A;  1L7Y A;  1WX7 A;  4G11 A;  2KJ6 A;  2BYF A;  5HKH A;  4KSL C;  2DZI A;  5DCN A;  1ZKH A;  2I1J A;  5AZG A;  3IHP C;  3PTF C;  2IO3 B;  3PZD A;  3CF6 E;  2N9E B;  4B95 A;  1WFY A;  1UD7 A;  1UH6 A;  2ZCC A;  2WDT B;  4IWO A;  3APD A;  4IW0 A;  4ANU A;  3A1Q B;  4K81 A;  2Z0D B;  3NOB A;  2BKR B;  3SD5 A;  3T8M A;  2GBR A;  4BKG A;  4HLE A;  1P0R A;  4M8M A;  2NS5 A;  2C9W B;  2J0J A;  5AZH A;  4URK A;  4LCD E;  2J0M A;  2DAJ A;  3DVG Y;  1WGG A;  3Q3F A;  3AU5 A;  4ICU A;  2HD5 B;  4ANW A;  2O6V A;  3S2A A;  2VRR B;  3PHX B;  3V6E B;  2CHW A;  1Z2M A;  2N7E A;  2MW5 A;  2FUH B;  2N4F A;  4KIK A;  2MSE D;  3W1Y A;  1J8C A;  2DZK A;  2CKH B;  3N32 A;  2D2Q A;  5JH5 C;  3V62 A;  3TJP A;  3P2B A;  2LGD A;  3OJ3 A; 
#chains in the Genus database with same CATH topology
 3RNC C;  5E6J A;  1J0G A;  2EMT A;  4W9I A;  4AUQ C;  2M4N A;  2V3P A;  2EKE C;  2QDF A;  1XEE A;  3RYT A;  3NZU A;  2BW2 A;  2WDQ B;  2JXT A;  1QZE A;  1UGM A;  3W1S A;  5C2T B;  4HDQ A;  1XF5 L;  2LGY A;  3EEC A;  4DWF A;  3DVG X;  3TUO A;  1L0V B;  4EOY A;  3TEY A;  4IDI A;  3W1S C;  2KTR A;  2WQY B;  4L23 A;  4TQ1 A;  1T0Y A;  2MP2 A;  1N63 A;  4JQW C;  4WQO B;  4JWU C;  3ZXV A;  2BB6 A;  4YTP B;  1I4H A;  2A4Z A;  5G5H A;  3O13 A;  4WWO A;  1OGW A;  4IM3 A;  1WJ6 A;  1KRH A;  1ET9 A;  2LGI A;  3IFW B;  2BS2 B;  3A4S C;  3L4P A;  4XC2 A;  2MLB A;  2ZZP B;  3L10 B;  2WXN A;  2IND C;  2DLB A;  1Y8R C;  4FHK A;  5JHA A;  3H7S A;  4PYU A;  2CHX A;  2DBY A;  2BQQ A;  2W3R A;  4LTU A;  1Q0W B;  4M0W A;  2KX0 A;  2J7Q B;  2MJE A;  2I2Y A;  4P1C C;  2JZP A;  4LNI A;  4TMA B;  3VR9 B;  3HHM A;  4MEL A;  4MJS B;  4BOZ B;  1GC7 A;  3IBE A;  4TKN A;  3T9L A;  4QAY A;  2J53 A;  2K1F A;  2V4I B;  1P7F A;  4IM2 A;  2XEW A;  2PE6 B;  3SDL C;  4CYE A;  2M0X A;  3B1L X;  3KWV A;  1WY8 A;  1SJE D;  2X38 A;  2ZEQ A;  1NEK B;  1FNV A;  3RCZ A;  1HA5 A;  3GB1 A;  5C1Z A;  4HRS A;  2LFI A;  2J4X A;  3NVZ A;  4HDO A;  4ANV A;  3R66 C;  3OLM D;  1WWT A;  4WAA A;  1UF0 A;  2DNF A;  3EHV A;  3FC4 A;  1K51 A;  4GIV A;  3APF A;  3DBH I;  5FR6 A;  1R4N B;  2FCN A;  3A9K B;  2IZV B;  5CHW A;  3M63 B;  2RGF A;  1FO4 A;  1JAL A;  1JWS D;  2K5P A;  2L1A A;  4HCP B;  4YTM B;  3BIN A;  2IY1 B;  4EZK A;  2AL3 A;  3UI3 A;  2KWD A;  4PT5 A;  3MC0 B;  3C8Y A;  4WUR A;  1I4X A;  1ZP0 B;  3ZO5 B;  3NS1 A;  1PDX A;  1C77 A;  3H9D A;  3SU8 X;  4B0M A;  4F1S A;  2PLP A;  1QF6 A;  3P4Q B;  3RUL A;  4HKZ E;  4A20 A;  4EEW A;  4OVU A;  2JT4 B;  2PPH A;  2C7H A;  2HJ1 A;  1V1P A;  3DHG C;  1YX6 B;  2O6V D;  1RFK A;  4YSZ B;  1PQS A;  4BVU C;  4C00 A;  1P1A A;  1T6B X;  1M94 A;  4RM8 A;  2J0K A;  2LMC A;  2LJI A;  2WXQ A;  2WWZ A;  1C1Y B;  2DAF A;  4NJ7 A;  2J52 A;  1HXY D;  2OOB B;  1NDD A;  2ACZ B;  1UBQ A;  1UUP A;  3EFU A;  2L76 A;  2JY6 A;  4L1B A;  1IBX A;  1ROE A;  1C4P A;  3Q8B A;  5BO4 B;  4P7I A;  3VUY A;  1SE9 A;  1CMX B;  3LB8 C;  3ZNZ B;  2X8X X;  3BII D;  3BVM A;  3IAS 1;  3NRZ A;  2VH2 A;  2JX5 A;  2YVC A;  3T3O A;  2I38 A;  2LUE A;  3ZYY X;  1L4Z B;  1AAR A;  1MPE A;  2KJR A;  5EE3 A;  3AEB B;  2GMI C;  3KQ4 A;  1DOY A;  3UQA A;  5GMV A;  1L6V A;  3QCA A;  4A3P A;  2MBH A;  4I6P A;  1Q5W B;  1MHH E;  3A9J A;  1FEH A;  2KO3 A;  3SEB A;  3DBS A;  2N1W A;  2AQ1 B;  2IO1 B;  1OQY A;  4ZDV A;  4P6V F;  1TKY A;  3GOE A;  4US9 A;  1E5W A;  2K22 A;  1UEL A;  1RLF A;  3AEC B;  2WXK A;  5E6O A;  2AL6 A;  2KKC A;  3CST A;  1RWS A;  2K25 A;  3ALB A;  2G4D B;  1QOB A;  1HTO A;  3P4R B;  3TMP B;  2MRP A;  4KVG B;  3VFK A;  1WXA A;  2HTM E;  1Q10 A;  4BAX A;  5BMI A;  3MC8 A;  4OW0 A;  1WYG A;  1OFF A;  1WXV A;  3AXC A;  2ZVO A;  2FID A;  3HM3 A;  3NVY A;  5JXV A;  1GC6 A;  2IJ0 A;  4DXG A;  5J18 A;  3AE5 B;  4WWP A;  2NBV B;  2LXC A;  3P1M A;  1V5T A;  4XX5 A;  5AEK B;  3T3N A;  4MGI E;  4X57 B;  3ZDM C;  2WX0 A;  2KMC A;  1KF6 B;  2MBQ A;  3DOW A;  1WM3 A;  1WZ0 A;  3C19 A;  2EEL A;  4A3O A;  2C7M B;  2HJ8 A;  4HPL B;  5EE9 A;  3M95 A;  4WWN A;  3U30 A;  4OVZ A;  2KVZ A;  2CU1 A;  4IC7 B;  5J2R A;  4HCN B;  3QIJ A;  1EU4 A;  2MH7 A;  2KAC A;  3SHQ A;  4UDU C;  2D3C A;  4LDT D;  5IAA C;  1LGR A;  5MPO A;  3VDZ A;  4GOC A;  1IPG A;  1QIL A;  2ZNV B;  2KD0 A;  2I1K A;  1MI0 A;  1HQR D;  3KH0 A;  2KC1 A;  2JUO A;  4ZRQ A;  3SR6 A;  1I4Q A;  3DHH C;  4MM3 B;  3VQI A;  3KLS X;  2FCQ A;  4M00 A;  2GBJ A;  3H1U A;  2J42 A;  3PRZ A;  2ZCB A;  4KDI C;  4TUU A;  1N5W A;  3AM9 A;  4MGK E;  5CX3 A;  3QQ8 B;  3ML9 A;  4YL8 A;  2AQ3 B;  1C4C A;  2SAK A;  4C7Z A;  3A1Q A;  1EUV B;  1V5O A;  2RPV A;  1WE6 A;  3ZRC A;  3U52 E;  2JSV X;  4XGA B;  2BYF A;  4XWT A;  2DZI A;  3AE3 B;  5AZG A;  3H8H A;  2IGH A;  2ZCC A;  2WDT B;  3APD A;  4KX6 B;  2CJO A;  3NOB A;  3T8M A;  2GBR A;  4M8M A;  2NS5 A;  2R61 A;  4URK A;  2J0M A;  2DAJ A;  1JQ4 A;  2AQ2 B;  2HD5 B;  3ZJV A;  2O6V A;  3U7Z A;  2VRR B;  3GS2 A;  3V6E B;  3W2D A;  2MW5 A;  5HFY A;  1J7C A;  3AMZ A;  1T5X D;  3TJP A;  1QKZ A;  2R2Q A;  1BXT A;  3P42 A;  1ZGU B;  1E9M A;  4MEM A;  1DGJ A;  2CHZ A;  1G6J A;  2WXF A;  2MWS B;  2INN E;  3PGE A;  1KLV A;  3TCA A;  3TSS A;  4A90 A;  4DHZ B;  2ONQ A;  1WGY A;  3N3K B;  1I4P A;  1RAX A;  4GGQ A;  4XYC A;  2KN4 A;  2GOW A;  2WYQ A;  4C4V B;  1SSN A;  3L16 A;  4W9D A;  3D32 A;  2KQ4 X;  2LJ5 A;  1J19 A;  1R4M I;  4ZYN A;  4FXC A;  4P1B C;  4FJY A;  5BMG A;  2OED A;  4US8 A;  1ZPS A;  1PGB A;  2OHF A;  2UU7 A;  5BYR A;  2MA9 B;  3X23 A;  5G55 A;  5CHV C;  3L54 A;  3MHS D;  4BZA A;  2DYM A;  4MGY E;  1JCK B;  4AJY B;  2LRW A;  5EE0 A;  3CSF A;  1K53 A;  2FAZ A;  1WSP A;  3K9O B;  1UNS A;  2H88 B;  1YX5 B;  3ZQ4 A;  2G4S A;  3JSV B;  2NR2 A;  1H4R A;  4NZL B;  4HKQ A;  2W9N A;  3BY4 B;  2GI9 A;  1PFD A;  3PRP B;  4OHJ A;  4GLS C;  3WAM A;  3CWI A;  2WGS A;  2KDB A;  2BS4 B;  3ZW3 A;  2D10 A;  3KW5 B;  1YIW A;  3JW0 X;  2B76 B;  1MHX A;  2N7J A;  3I9V 1;  3DCG A;  2QSD A;  1RM6 C;  2QIL A;  3VRB B;  1E90 A;  1E8X A;  2JF5 A;  3QA8 A;  4ZRJ A;  3MHZ A;  3NS8 A;  1ZXI A;  3UF8 A;  3VUW A;  3N30 A;  5J17 A;  2D07 B;  1P3Q U;  3VHT C;  1FXT B;  2D3B A;  2V1Y A;  2WXL A;  4DHJ D;  3R2T A;  3V61 A;  3BK2 A;  3BVG A;  2IY0 B;  4KGR A;  2MBE A;  4J6I A;  2Z8L A;  2IGD A;  3BVZ A;  3L13 A;  3Q2A C;  4MH8 A;  2GRI A;  2REX A;  4GDL B;  3VTU A;  2DZJ A;  4K1R B;  2PVO D;  3DPD A;  1WJN A;  2ZW0 A;  1N6Z A;  4O1N A;  2D3G A;  2KWC A;  1RYJ A;  1UWM A;  1VCB A;  2KMA A;  3KUD B;  4C7Y A;  3KVF B;  1IUE A;  2XK5 A;  4FAD A;  3WAP A;  4REZ A;  1EM7 A;  1V2Y A;  4MSQ B;  1YJ1 A;  4W9K A;  1H8C A;  1XT9 B;  4RGT A;  4HPP A;  3KWL A;  5DPT A;  5G2N A;  4YSY B;  3HM6 X;  2ASQ A;  1WRD B;  3RPF C;  1TS5 A;  3OWE B;  3CMM B;  1I7H A;  5FR3 A;  2KTF A;  5TSS A;  2LXA A;  1D3Z A;  1OQR A;  1ESF A;  3DBH B;  4HJK A;  1GNU A;  3ZJU A;  1GPX A;  5HHD G;  4FBJ B;  2JVC A;  4BBN C;  1FNU A;  1YN3 A;  1DOI A;  4DXA B;  1EU3 A;  1Y56 A;  3GP7 A;  3W9C B;  4YT0 B;  2NBW B;  2JRH A;  3DWG C;  4PS8 A;  3WA0 A;  3VTW A;  1VLB A;  2OJR A;  4MAC A;  4D2K A;  1JW9 D;  2INP E;  2LVO A;  3RMK C;  4A8X C;  3OG5 A;  2G45 B;  4E74 A;  2LEK A;  3AE9 B;  1XQQ A;  1WH3 A;  2WXH A;  2BYE A;  4XDC A;  1VZ6 A;  3AE4 B;  2N9X A;  2KLC A;  1YQB A;  5C23 A;  4EZL A;  1AN8 A;  3SFD B;  3AV8 A;  2NMQ A;  2B3A A;  2FE8 A;  4RCO A;  2BF8 B;  2DZM A;  1V80 A;  4AQ7 A;  4RGM A;  3U8Z A;  1KLU D;  3B08 A;  2KAN A;  3ZNG C;  2WX1 A;  3V05 A;  2VZK B;  5HG2 A;  4NAW B;  5KHQ A;  1WF9 A;  2XNA C;  3HK0 A;  3E9S A;  3NHE B;  2WP9 B;  1TTN A;  2QHO A;  3R3M A;  1ZDV A;  4XZ4 A;  1UZX B;  1TS3 A;  2KFK B;  3AUL A;  3KUC B;  2KN5 A;  2K8B A;  2ZPN A;  1E8Y A;  1EF5 A;  5FKA C;  2PVG C;  1ZUD 2;  1GUA B;  1FXI A;  2JWU A;  1FD6 A;  4AWJ A;  3QK0 A;  2YEP B;  1JML A;  3TEX A;  3ENE A;  3A4R A;  3VAW A;  4PK1 A;  2AYO B;  2E6X A;  1D4B A;  1PUT A;  4HJG E;  2YEP F;  3KYC D;  4ZOH C;  1IGD A;  1E8Z A;  4YWG G;  2BB5 A;  3QAR A;  4KGS A;  2NVU I;  2K8C A;  1SBB B;  2K0P A;  2MHJ A;  4WIP A;  4BKT A;  1U4A A;  4JPS A;  2L32 A;  2G3Q B;  4FUL A;  2UYZ B;  2MBB B;  1L2N A;  4KGT A;  3ZXR A;  3H7P A;  2K6D B;  2IPK D;  2RDB C;  3WAL A;  3AE2 B;  4MM3 A;  4ZHO A;  4EFO A;  4USA A;  3I63 C;  1HTQ A;  4KV2 A;  1T0S C;  5C3J B;  1F52 A;  4JLC A;  1WX8 A;  4GSW A;  3QC8 B;  1KTK A;  2KTR B;  2MP2 B;  4BKS D;  2LVP A;  4KKJ A;  3V6C B;  2GBN A;  4LNO A;  4NQL B;  2M17 A;  4E3C A;  2PMV A;  3Q8C A;  1WZ3 A;  3NG0 A;  4TQ0 A;  3DDC B;  1A70 A;  3DHI C;  5LXI B;  2EMS A;  3BK1 A;  4NY0 A;  2R2O A;  3NUH B;  4WQM A;  1CJE A;  1EWC A;  3ETR A;  4FHJ A;  4CO7 A;  1V1O A;  3RUI B;  1KM7 A;  3PV1 A;  2WDR B;  1JWM D;  2C7N B;  4M0W B;  4HVB A;  2WLB A;  1K8R B;  4G11 A;  2KJ6 A;  2WXP A;  1SE4 A;  4WH4 A;  3PZD A;  1GB1 A;  2N9E B;  2WU5 B;  1UH6 A;  2M0A A;  4IW0 A;  1J7A A;  3AEF B;  3SD5 A;  4BKG A;  3R8B A;  1P0R A;  2QJL A;  1JWA D;  4LCD E;  4RF1 A;  3DVG Y;  1WGG A;  1MJD A;  3AU5 A;  4ANW A;  3S2A A;  1TYG B;  4OZC A;  2CHW A;  3AEA B;  4KIK A;  4YSX B;  2CKH B;  2D2Q A;  1SE2 A;  2LGD A;  2W54 A;  1FRD A;  4C4V A;  3PZ8 A;  3PLV A;  5E6N A;  1WIA A;  2KYW A;  4IM0 A;  4ZRK A;  4W9J A;  3ZDT A;  2FBW B;  2RPQ A;  1VD2 A;  1M4V A;  5AUK A;  2ON8 A;  4N6E B;  1WR6 E;  5KHO A;  3Q3O C;  2JPH A;  1UWX A;  2Z59 B;  1TZO A;  3ZKJ C;  1E6E B;  4MDK E;  1B9R A;  1S1Q B;  1VZ8 A;  3AEG B;  2NPT B;  1IP9 A;  3ZGZ A;  3JSV A;  2Y5B B;  5BYQ A;  2GB1 A;  3RNB C;  1P98 A;  3TEZ A;  1TT5 B;  1PGX A;  1L0Y B;  1V1P B;  2MJD A;  3DBL I;  2M1M A;  4A55 A;  5T8I A;  5AZF A;  1FXA A;  3ZTD A;  1OEY A;  1AYF A;  2N1V A;  2DHZ A;  3L08 A;  3TL5 A;  5EDS A;  4ZRI A;  1JRP A;  4B9K A;  1OEY J;  2ZJD A;  5FK9 C;  1V86 A;  3NVW A;  4YTN B;  1E8W A;  3W5V B;  1R4M B;  2N9K A;  3FAH A;  1IBX B;  1KLG D;  1SE3 A;  2K39 A;  2D11 A;  4NJC A;  2D5G A;  3Q3M C;  3HRD D;  4ASW C;  2K3U A;  2KFJ A;  3KUZ A;  2UWQ A;  1QLB B;  3DWM A;  2JXX A;  4KSK C;  3L17 A;  4KZC A;  1IYF A;  4GU2 A;  1N5X A;  4LLG M;  5BYS A;  5HI1 A;  1WI0 A;  3I5J C;  1VR9 A;  1ET6 A;  4WJN A;  3TIX A;  5CTR C;  4FN2 A;  1EF1 A;  4HPM B;  4W9C A;  1SEB D;  2BYV E;  4HK2 A;  4IOI E;  1WXM A;  3ZLZ A;  3APC A;  2A5U A;  2KMM A;  1JRU A;  4DXF A;  4NNJ B;  2KC2 A;  3QWZ B;  3FIL B;  2JQR B;  1WGD A;  2BBC A;  2BKF A;  2N7D A;  3AE7 B;  1C4A A;  1E0Z A;  5JHB A;  1FCC C;  1NVI D;  2PW9 A;  1ZOY B;  3VRA B;  1B1Z A;  3LDZ E;  2KQ7 A;  3VR8 B;  3U4E G;  2NTT A;  2Y5P A;  1T0R C;  2M19 A;  4H2A A;  4G50 A;  1NEN B;  1K50 A;  4BKS A;  4DDG D;  5LNK 1;  4J3O D;  2KK8 A;  1D5X C;  2IYD B;  2LHD A;  1Q1O A;  3RZW C;  3B0A A;  1QQR A;  2IGG A;  3DVN U;  3SFE B;  2KX3 A;  2LHE A;  3EFC A;  2NTS A;  4MJS A;  4DK5 A;  2RDG A;  1CK1 A;  1I4G A;  4PYZ A;  4F7Z A;  1MG8 A;  3X0W A;  2MCN B;  4HXD A;  4RFB A;  4LNK A;  4ACF A;  2M8S A;  5G5G A;  1FPY A;  1SIF A;  3VH4 B;  2ZVN A;  2ZPY A;  2JRI B;  2K6Q A;  3EUB 2;  1LFD A;  4ARC A;  1LM8 B;  2V3S A;  2JZZ A;  1WJU A;  3ZRF A;  3QJZ A;  4S0R A;  4MH0 E;  1UBI A;  1I35 A;  1I42 A;  4JX1 C;  1NI3 A;  4WJP A;  4FA6 A;  3A9K A;  1P7E A;  4K3C A;  3R2I A;  3URY A;  1UGJ A;  3OAW A;  1ENF A;  2QIE B;  4A9A A;  1MG4 A;  2CS4 A;  4GDK B;  2JYE A;  1HZ6 A;  1V9J A;  2QCZ A;  1F9J A;  2LI5 A;  4IG7 B;  3CIR B;  5LXH A;  4PS3 A;  3BWU D;  1TKG A;  3LJ3 A;  3FKY A;  4RGN A;  2L0F A;  2JYT A;  1FRR A;  2BWE S;  4ZHP A;  1HE8 A;  1WGK A;  1C76 A;  1R7S A;  2WXR A;  3A33 B;  2GBK A;  3P4S B;  5L83 A;  4M8N A;  4WWM A;  2XN9 C;  3AE8 B;  2L00 B;  2L05 A;  2RDH A;  1WM2 A;  4DDI D;  1FM0 D;  1HZ5 A;  1VDV A;  1RFA A;  2W3S A;  2DYB A;  4I6N B;  3KYD D;  1WYW B;  5D94 A;  2V9H A;  4G0N B;  1JWB D;  3PPA A;  1T3Q A;  4KKI A;  3DBR I;  1WMH B;  2O6V B;  3NZS A;  2WXO A;  3HIZ A;  4IUM B;  2WHI A;  3L0W B;  1SXT A;  4WAF A;  2DX5 B;  1YMH E;  5CHF A;  1ZE3 D;  3PT2 B;  4RMA A;  3GZN I;  2E3T A;  3VTV A;  4WJO A;  2HDE A;  2PIA A;  3P63 A;  2CR5 A;  1BML C;  2O2V B;  1E10 A;  2FUG 1;  2KJH B;  3AH7 A;  5DPR A;  2SEB D;  3LYY A;  4IKG A;  4II2 B;  4C80 A;  4OZB A;  4K7W A;  4DBG A;  1L0X B;  4L2Y A;  1EWY C;  4ZYS A;  5L95 C;  3PHW B;  3UIN B;  3J9C A;  1V8C A;  1OTR B;  4AJW A;  4N58 A;  2HTH A;  1T0Q C;  2YLM A;  4NAM A;  3EC8 A;  2KHW B;  1F2R C;  1GB4 A;  2KZR A;  3AEE B;  1KFY B;  4M02 A;  3N9Y C;  2FCM A;  3JVZ X;  5I4D A;  3PRM B;  2KOX A;  4JL9 A;  4MT5 A;  2PE9 A;  3MP9 A;  3MTN B;  3C0R B;  3AU4 A;  3IVF A;  2AX5 A;  2LZ6 A;  3UIP B;  2L8J A;  5BMH A;  1TKE A;  2LWP A;  1X1M A;  4HEA 1;  3TBL D;  1L7Y A;  4KSL C;  4HRO A;  2CJN A;  1I4R A;  1K52 A;  1ZKH A;  2I1J A;  5IN7 A;  1F1H A;  1YJJ A;  3CF6 E;  2V0G A;  2IDY A;  1WFY A;  2WDV B;  1UD7 A;  1PGA A;  4IWO A;  3EA6 A;  2Z0D B;  1LO5 D;  3Q3N C;  2BKR B;  3Q14 C;  3EGR A;  2WU2 B;  1ZDX A;  1N60 A;  3I57 A;  5H8Y E;  2LGS A;  2N7E A;  2N4F A;  1OQQ A;  3W1Y A;  2DZK A;  5JH5 C;  3N32 A;  3ABV B;  3V62 A;  3P2B A;  3MFG A;  4CQN A;  3V60 A;  5JZE B;  1E7P B;  2N9P C;  1P9D U;  3MC9 A;  3IT6 B;  4JGH B;  2L3Z A;  4AS1 A;  4WJQ A;  4MSM B;  1D6E C;  3IT4 B;  3Q8F A;  4IWQ A;  3GE3 C;  3BYT B;  3QAQ A;  3ZJT A;  2PJH A;  3K9P B;  3M62 B;  2FNJ B;  4ANX A;  2NPT A;  1JRO A;  1WJ4 A;  1TY2 A;  1TGZ B;  2LUM A;  3N20 C;  3R7R A;  3WCQ A;  3HUI A;  5D2M B;  4KZ0 A;  4BOS C;  3M3J A;  4C56 C;  5D3I B;  2ZNV C;  2XK5 B;  4FJZ A;  2QEJ C;  2IBI B;  3ZVV A;  3ZNH B;  3H6N A;  4GB9 A;  4E71 A;  4CHK A;  3MJW A;  2RMM A;  4GN1 A;  4LDT B;  1GAQ B;  2C5L C;  4LK0 M;  1TJE A;  1VRA B;  3VXW A;  2KDF B;  4BFR A;  3PS6 A;  1SJH D;  2RSU A;  1TIF A;  4TSS A;  2BYT A;  1MFW A;  2K9X A;  3HVZ A;  2KT7 A;  3RN9 C;  4MGZ E;  1ZW7 A;  4AP4 C;  1TS4 A;  2KWV B;  3PZ7 A;  1AWD A;  3UQB A;  1S3S G;  1F77 A;  4PS7 A;  5E6P A;  1L5P A;  3AI5 A;  2BS3 B;  4EZJ A;  5D6J B;  4W9E A;  3ZUN A;  2WS3 B;  4OVV A;  1NYQ A;  4ZRP A;  1R4N I;  1BUI C;  4NJ6 A;  4BBN F;  5IO9 A;  3N1X C;  1DOX A;  1TZ1 A;  2Y5C A;  1V6E A;  1SIJ A;  3IG3 A;  3IAM 1;  4JIO U;  1A5R A;  1WX9 A;  2JWZ A;  4LJP B;  1C3T A;  2MJ3 A;  1TS2 A;  4W9L A;  3R7Q A;  3Q69 A;  1TBE A;  1EO6 A;  5EE1 A;  3DBL B;  2MBO A;  5DPW A;  2VZK D;  1KOT A;  1WRI A;  1XLP A;  3WAO A;  4W9G A;  3B2F A;  4P16 A;  4RF0 A;  1L6U A;  4AOF A;  1ISN A;  3GE8 C;  3VUX A;  1GG3 A;  4NQK E;  3RI7 C;  2WXI A;  3FIL A;  3VVW B;  3RD2 A;  2WNM A;  3UIO B;  4S17 A;  1SB3 C;  5IKC M;  2DWQ A;  2G9H D;  1YNT E;  2KAJ A;  4YXD B;  2AWT A;  2W82 A;  2W55 A;  4G3X B;  4B6W A;  1YJI A;  1IGC A;  1NYR A;  1GJZ A;  4HWI B;  3ZIM A;  3VH3 B;  2L52 A;  2RR9 A;  4JE3 B;  3RT3 B;  3WAN A;  4DHZ E;  2Z0E B;  2ICI A;  1YD8 U;  4F8C B;  1TY0 A;  2HE7 A;  2MX2 A;  1XXG A;  1FCL A;  2KDM A;  2WXG A;  1YOV B;  5GXG B;  1QOG A;  5IP4 D;  1BT0 A;  5TR5 A;  4OZA A;  3PO0 A;  4N59 A;  4GXB A;  1ZXH A;  2Q5W D;  3ML8 A;  3RNG C;  1XLN A;  3LXF A;  2JU6 X;  2KXJ A;  3UGB B;  1C79 A;  1E7V A;  2K8H A;  1F2R I;  3O65 B;  5D3D A;  3PLU A;  5IOI A;  3I3T B;  4B0E A;  2XBB C;  3B2G A;  2KQS A;  1XLO A;  4RNA A;  3RNE C;  4K3B A;  2BWF A;  4FJV B;  2G1E A;  3ZTC A;  2LRU A;  3Q3J A;  3H7P B;  2M56 B;  3AE6 B;  1VZ7 A;  4RGO S;  1D5Z C;  2TSS A;  2PTL A;  4LNN A;  3HVD A;  4GDK A;  1YQ4 B;  3NZ3 A;  4II3 B;  2V4L A;  2PKO A;  4GMV A;  2N9L A;  3E56 A;  4GDL A;  1WXQ A;  2BT6 A;  3DVN V;  3U7D A;  1QOA A;  1WGR A;  3U2S C;  4M01 A;  3NVV A;  1WXS A;  4XWW A;  1CZP A;  4N9F 4;  2DEN B;  1N62 A;  2Y3A A;  3OJ4 B;  1Z5S B;  4DHJ B;  3PRE A;  2MQJ A;  3RZF A;  2LAS A;  2BVC A;  3A9J B;  2INC C;  2FIF A;  2JZ3 B;  1VJK A;  2N0S B;  4XE0 A;  4RM9 A;  1D5M C;  3PVL A;  1C9F A;  2KWU B;  3RNF C;  1XCQ L;  1CQV A;  4LNF A;  2KVR A;  2GLS A;  2MEK A;  1YQ3 B;  1L4D B;  3ZNI D;  4Q2J A;  3TEW A;  3B9J A;  3V3X A;  3MJ5 A;  1WMH A;  5LLI A;  4XDD A;  2KNB A;  2AEH A;  1GOZ A;  2RD0 A;  1LXD A;  1V49 A;  1J7B A;  1XD3 B;  1AW7 A;  2IO2 B;  2BGF A;  1NI2 A;  4NPN A;  3NY5 A;  3ECI A;  2O2V A;  1XO3 A;  4K7S A;  2QC8 A;  1FIQ A;  3QX1 A;  4KIK B;  4I6L B;  4TV3 A;  2CU3 A;  3ONS A;  4EE2 A;  5H92 C;  3P4P B;  1LQB A;  1KH0 A;  1YN5 A;  1FFU A;  5D7G A;  1FNW A;  2L83 A;  2DYO A;  3W5U B;  2BTE A;  2GBM A;  2KDE B;  1V97 A;  4W9F A;  4W9H A;  1RRB A;  1KJT A;  2VH1 A;  4K7U A;  1E7U A;  2QMT A;  5IA7 A;  2KLG A;  2LD9 A;  4EUT A;  3AN1 A;  1YN4 A;  3DQV A;  4RH6 A;  2L7R A;  5DPS A;  3WIM A;  3PSE B;  1WE7 A;  4FLH A;  4DQO C;  4ITK A;  1FFV A;  1JWU D;  1F0Z A;  3NJT A;  4R3D A;  2EKI A;  2FCS A;  3RFZ B;  3N1Z C;  5AUI A;  2NBU A;  4KDL B;  3DBR B;  4IWP A;  4NAW A;  1V81 A;  1WR1 A;  2LGX A;  3IXS A;  4ICV A;  2PEA A;  3Q8A A;  3JYU A;  2OJW A;  1WGH A;  3Q6B A;  4LJO B;  2LVQ A;  1NBF C;  2KDI A;  3AB5 A;  2NCN A;  4A6Q A;  2C60 A;  2KFK A;  3Q8E A;  1SGH A;  2IO0 B;  3GZN B;  2L0T A;  1QT9 A;  1PYW D;  1C78 A;  2V3N A;  2WXJ A;  3QHT A;  4EKU A;  3N1Y C;  1STE A;  1WX7 A;  5HKH A;  1XLQ A;  5DCN A;  1ACC A;  3IHP C;  3PTF C;  2IO3 B;  1FMA D;  4B95 A;  2D3A A;  1HEZ E;  4ANU A;  3BYY B;  1QOF A;  3A1Q B;  4K81 A;  2WXM A;  4HLE A;  2C9W B;  2J0J A;  2H89 B;  1SF0 A;  3AED B;  5AZH A;  3Q3F A;  3RNA C;  4ICU A;  1MVK A;  1DYQ A;  3PHX B;  3AE1 B;  4JWS C;  1XCT L;  1Z2M A;  1N61 A;  2ZW1 A;  2FUH B;  3BZD B;  2MSE D;  1J8C A;  4ARI A;  2BPS A;  3OJ3 A; 
#chains in the Genus database with same CATH homology
 3V60 A;  5JZE B;  2N9P C;  2R2Q A;  1J0G A;  1P9D U;  3PLV A;  1ZGU B;  4MEM A;  2EMT A;  5E6N A;  4W9I A;  4AUQ C;  2M4N A;  4JGH B;  2CHZ A;  1WIA A;  2EKE C;  2L3Z A;  1G6J A;  2MWS B;  4IM0 A;  4ZRK A;  4W9J A;  3ZDT A;  3RYT A;  4WJQ A;  3NZU A;  4MSM B;  3PGE A;  2RPQ A;  3TCA A;  1KLV A;  4IWQ A;  1VD2 A;  1QZE A;  4DHZ B;  1UGM A;  3QAQ A;  3W1S A;  2PJH A;  3K9P B;  3M62 B;  2FNJ B;  4HDQ A;  1WR6 E;  5KHO A;  2LGY A;  4ANX A;  2NPT A;  1WGY A;  3N3K B;  1WJ4 A;  3EEC A;  1RAX A;  4DWF A;  4GGQ A;  2GOW A;  2WYQ A;  1TGZ B;  3DVG X;  2JPH A;  3R7R A;  4EOY A;  5D2M B;  3L16 A;  3W1S C;  4W9D A;  2KTR A;  3D32 A;  4KZ0 A;  2Z59 B;  1T0Y A;  2MP2 A;  4TQ1 A;  2LJ5 A;  3M3J A;  4BOS C;  1J19 A;  4JQW C;  4WQO B;  1R4M I;  3ZKJ C;  2ZNV C;  2XK5 B;  2A4Z A;  4FJZ A;  4ZYN A;  2IBI B;  3ZVV A;  4MDK E;  3ZNH B;  1S1Q B;  4WWO A;  4FJY A;  1OGW A;  3H6N A;  4GB9 A;  4IM3 A;  1WJ6 A;  4CHK A;  3MJW A;  4E71 A;  4GN1 A;  4LDT B;  2NPT B;  2C5L C;  3IFW B;  4XC2 A;  3A4S C;  3JSV A;  1IP9 A;  2MLB A;  2KDF B;  2Y5B B;  2ZZP B;  3L10 B;  3VXW A;  4BFR A;  3PS6 A;  1Y8R C;  2RSU A;  1P98 A;  4FHK A;  5JHA A;  2MA9 B;  3X23 A;  5G55 A;  3DBL I;  5CHV C;  3L54 A;  3H7S A;  3MHS D;  2M1M A;  2DYM A;  4MGY E;  4PYU A;  2CHX A;  4MGZ E;  5AZF A;  4AJY B;  2LRW A;  3ZTD A;  1OEY A;  1ZW7 A;  4AP4 C;  3CSF A;  2KWV B;  2N1V A;  3UQB A;  2FAZ A;  1Q0W B;  1S3S G;  2DHZ A;  3K9O B;  2KX0 A;  1YX5 B;  2J7Q B;  4PS7 A;  5E6P A;  2G4S A;  3L08 A;  3TL5 A;  3AI5 A;  3JSV B;  2NR2 A;  4ZRI A;  5EDS A;  4EZJ A;  1H4R A;  5D6J B;  4B9K A;  2W9N A;  4W9E A;  3ZUN A;  3HHM A;  3BY4 B;  4OVV A;  1R4N I;  4MEL A;  4MJS B;  3PRP B;  4NJ6 A;  4BOZ B;  1OEY J;  2ZJD A;  4BBN F;  1V86 A;  1GC7 A;  1E8W A;  1TZ1 A;  3IBE A;  4TKN A;  3WAM A;  3T9L A;  2KDB A;  2K1F A;  3ZW3 A;  1V6E A;  2K39 A;  2D10 A;  4IM2 A;  2D11 A;  3IG3 A;  3KW5 B;  1YIW A;  4JIO U;  2XEW A;  1A5R A;  1WX9 A;  2JWZ A;  3JW0 X;  4LJP B;  2PE6 B;  3SDL C;  4ASW C;  1C3T A;  4CYE A;  3DCG A;  4W9L A;  2KFJ A;  2M0X A;  3B1L X;  3R7Q A;  1TBE A;  3KUZ A;  2UWQ A;  1EO6 A;  1E90 A;  1E8X A;  2JF5 A;  3QA8 A;  4ZRJ A;  3NS8 A;  2MBO A;  5DPW A;  1WY8 A;  2JXX A;  3UF8 A;  3VUW A;  1KOT A;  3N30 A;  4KSK C;  5J17 A;  2D07 B;  3L17 A;  4KZC A;  1P3Q U;  4W9G A;  3VHT C;  3WAO A;  2ZEQ A;  1IYF A;  1FXT B;  4GU2 A;  3RCZ A;  2V1Y A;  4DHJ D;  4AOF A;  5C1Z A;  1ISN A;  3V61 A;  3VUX A;  1GG3 A;  2IY0 B;  4NQK E;  4HDO A;  4ANV A;  2MBE A;  3R66 C;  1WI0 A;  3OLM D;  4J6I A;  3VVW B;  4WAA A;  4WJN A;  3TIX A;  5CTR C;  3L13 A;  3RD2 A;  3EHV A;  4FN2 A;  3UIO B;  4GIV A;  2REX A;  3APF A;  4GDL B;  3VTU A;  1EF1 A;  2DZJ A;  3DBH I;  5FR6 A;  4HPM B;  4K1R B;  4W9C A;  2FCN A;  3A9K B;  2IZV B;  5CHW A;  3M63 B;  2RGF A;  2BYV E;  3DPD A;  2AWT A;  1WJN A;  4G3X B;  4HK2 A;  4HCP B;  4B6W A;  1WXM A;  3ZLZ A;  3BIN A;  2IY1 B;  3APC A;  4EZK A;  2AL3 A;  2A5U A;  1JRU A;  2D3G A;  1GJZ A;  4HWI B;  4NNJ B;  3ZIM A;  2KWC A;  2KC2 A;  3QWZ B;  3KUD B;  1VCB A;  2KMA A;  3VH3 B;  3KVF B;  2RR9 A;  1WGD A;  2XK5 A;  3WAP A;  3WAN A;  3RT3 B;  1V2Y A;  3ZO5 B;  4FAD A;  2BKF A;  2N7D A;  4MSQ B;  4DHZ E;  1YJ1 A;  2Z0E B;  3H9D A;  4W9K A;  3SU8 X;  1YD8 U;  1H8C A;  1XT9 B;  4F1S A;  5JHB A;  4F8C B;  5DPT A;  5G2N A;  3RUL A;  2HE7 A;  3HM6 X;  2ASQ A;  1WRD B;  4A20 A;  2MX2 A;  2KQ7 A;  3LDZ E;  4EEW A;  4OVU A;  2JT4 B;  2PPH A;  2C7H A;  4G50 A;  3CMM B;  1YX6 B;  2O6V D;  4BKS A;  4DDG D;  2KTF A;  1BT0 A;  2KK8 A;  2IYD B;  1PQS A;  2LXA A;  4BVU C;  1Q1O A;  1D3Z A;  1P1A A;  3RZW C;  3B0A A;  4HJK A;  5TR5 A;  1GNU A;  3DVN U;  1M94 A;  4RM8 A;  2J0K A;  4GXB A;  2KX3 A;  2WWZ A;  3ML8 A;  1C1Y B;  2DAF A;  4NJ7 A;  2KXJ A;  2JVC A;  2OOB B;  1NDD A;  4MJS A;  3UGB B;  4BBN C;  1E7V A;  4DK5 A;  4FBJ B;  1UBQ A;  4DXA B;  4PYZ A;  4F7Z A;  3EFU A;  1MG8 A;  2K8H A;  2L76 A;  2JY6 A;  2MCN B;  4HXD A;  3X0W A;  3O65 B;  2M8S A;  3PLU A;  3I3T B;  2NBW B;  2JRH A;  2XBB C;  5BO4 B;  1SIF A;  3VH4 B;  4P7I A;  2ZVN A;  3VUY A;  4PS8 A;  2ZPY A;  2KQS A;  3WA0 A;  1SE9 A;  1CMX B;  2JRI B;  2K6Q A;  2OJR A;  3VTW A;  3ZNZ B;  2LVO A;  2BWF A;  1LFD A;  2G45 B;  4FJV B;  3ZTC A;  4E74 A;  2LRU A;  1LM8 B;  2V3S A;  2YVC A;  2JZZ A;  3Q3J A;  2LUE A;  3H7P B;  1AAR A;  1XQQ A;  2KJR A;  1WH3 A;  1WJU A;  2BYE A;  3ZRF A;  3QJZ A;  4MH0 E;  1UBI A;  2GMI C;  2N9X A;  1I35 A;  2KLC A;  3UQA A;  1I42 A;  5GMV A;  4WJP A;  3QCA A;  1YQB A;  4A3P A;  2MBH A;  4GDK A;  4I6P A;  5C23 A;  4EZL A;  1Q5W B;  4II3 B;  4FA6 A;  2V4L A;  4GMV A;  3A9J A;  2B3A A;  4GDL A;  2KO3 A;  3DVN V;  2BF8 B;  3U7D A;  2DZM A;  1V80 A;  3U8Z A;  3A9K A;  1WGR A;  3DBS A;  3B08 A;  1WXS A;  2KAN A;  3ZNG C;  2WX1 A;  2N1W A;  2IO1 B;  1OQY A;  4NAW B;  5KHQ A;  1WF9 A;  3HK0 A;  4N9F 4;  3OAW A;  4ZDV A;  2DEN B;  3NHE B;  3GOE A;  3OJ4 B;  1Z5S B;  1TTN A;  4DHJ B;  2QHO A;  2CS4 A;  3R3M A;  1E5W A;  4XZ4 A;  4GDK B;  1UEL A;  1RLF A;  1V9J A;  3PRE A;  2MQJ A;  3RZF A;  1UZX B;  1F9J A;  5E6O A;  2LI5 A;  4IG7 B;  2AL6 A;  2LAS A;  3A9J B;  2JZ3 B;  2FIF A;  2KFK B;  3AUL A;  3KUC B;  5LXH A;  2KKC A;  2KN5 A;  4PS3 A;  4RM9 A;  3CST A;  2K25 A;  3PVL A;  3ALB A;  3LJ3 A;  2G4D B;  2K8B A;  3TMP B;  2MRP A;  2KWU B;  4KVG B;  3VFK A;  1WXA A;  2ZPN A;  2L0F A;  1E8Y A;  2BWE S;  2KVR A;  1EF5 A;  1HE8 A;  3ZNI D;  1WXV A;  1GUA B;  3AXC A;  2ZVO A;  2FID A;  3HM3 A;  1WMH A;  3A33 B;  2GBK A;  5LLI A;  1GC6 A;  2KNB A;  5L83 A;  2AEH A;  5J18 A;  4M8N A;  4AWJ A;  3QK0 A;  4WWP A;  2NBV B;  2L00 B;  2L05 A;  2RD0 A;  1WM2 A;  1LXD A;  1V49 A;  4DDI D;  3ENE A;  1RFA A;  2LXC A;  3A4R A;  2DYB A;  1V5T A;  4I6N B;  3VAW A;  1XD3 B;  2AYO B;  3KYD D;  4XX5 A;  1WYW B;  5AEK B;  5D94 A;  4G0N B;  2IO2 B;  2BGF A;  1NI2 A;  3KYC D;  3PPA A;  4NPN A;  4MGI E;  1E8Z A;  3NY5 A;  4X57 B;  3ZDM C;  2WX0 A;  2KMC A;  3ECI A;  2O2V A;  2MBQ A;  3DBR I;  3DOW A;  1WMH B;  1WM3 A;  1WZ0 A;  4K7S A;  2O6V B;  3NZS A;  4A3O A;  2C7M B;  3HIZ A;  2HJ8 A;  3QAR A;  4HPL B;  4IUM B;  3M95 A;  3QX1 A;  4KIK B;  4WWN A;  3L0W B;  4I6L B;  4TV3 A;  3ONS A;  3U30 A;  2NVU I;  2K8C A;  1LQB A;  4BKT A;  1U4A A;  2CU1 A;  2DX5 B;  4IC7 B;  5J2R A;  5CHF A;  2G3Q B;  3PT2 B;  4FUL A;  4HCN B;  2UYZ B;  3GZN I;  4RMA A;  5D7G A;  2DYO A;  2MBB B;  3VTV A;  1L2N A;  4WJO A;  3QIJ A;  3H7P A;  2GBM A;  2KDE B;  4W9F A;  2CR5 A;  2K6D B;  2O2V B;  4W9H A;  3WAL A;  1RRB A;  3SHQ A;  4MM3 A;  1KJT A;  4EFO A;  2KJH B;  4LDT D;  4K7U A;  1E7U A;  5IAA C;  5IA7 A;  2KLG A;  4KV2 A;  5DPR A;  2LD9 A;  3VDZ A;  4EUT A;  4GOC A;  1IPG A;  1WX8 A;  3DQV A;  4II2 B;  4JLC A;  2L7R A;  5DPS A;  4GSW A;  3WIM A;  4K7W A;  2ZNV B;  3PSE B;  2KD0 A;  1WE7 A;  4DBG A;  2I1K A;  4FLH A;  3QC8 B;  3KH0 A;  2KTR B;  5L95 C;  2MP2 B;  3PHW B;  2KC1 A;  2JUO A;  2FCS A;  4BKS D;  2LVP A;  2NBU A;  4KDL B;  3V6C B;  2GBN A;  3UIN B;  4NQL B;  4IWP A;  4NAW A;  1OTR B;  2M17 A;  4AJW A;  1V81 A;  4E3C A;  3VQI A;  1WR1 A;  2LGX A;  1WZ3 A;  2HTH A;  4ICV A;  4TQ0 A;  3DDC B;  2FCQ A;  2PEA A;  2YLM A;  3JYU A;  3EC8 A;  5LXI B;  2GBJ A;  2KHW B;  2EMS A;  3H1U A;  1WGH A;  3PRZ A;  4LJO B;  2KZR A;  2ZCB A;  4KDI C;  2LVQ A;  4NY0 A;  1NBF C;  2KDI A;  2R2O A;  2NCN A;  4TUU A;  2C60 A;  4MGK E;  2KFK A;  2FCM A;  1SGH A;  3JVZ X;  3PRM B;  2BPS A;  3ML9 A;  2KOX A;  3QQ8 B;  2IO0 B;  4FHJ A;  4YL8 A;  5CX3 A;  4JL9 A;  3RUI B;  4CO7 A;  2PE9 A;  1KM7 A;  2L0T A;  3MTN B;  3PV1 A;  3C0R B;  3AU4 A;  3IVF A;  3A1Q A;  2LZ6 A;  3UIP B;  1EUV B;  2L8J A;  2C7N B;  3QHT A;  4EKU A;  1V5O A;  2LWP A;  1X1M A;  4M0W B;  4HVB A;  1K8R B;  1WE6 A;  3TBL D;  3ZRC A;  1L7Y A;  1WX7 A;  4G11 A;  2KJ6 A;  2BYF A;  5HKH A;  4KSL C;  2DZI A;  5DCN A;  1ZKH A;  2I1J A;  5AZG A;  3IHP C;  3PTF C;  2IO3 B;  3PZD A;  3CF6 E;  2N9E B;  4B95 A;  1WFY A;  1UD7 A;  1UH6 A;  2ZCC A;  2WDT B;  4IWO A;  3APD A;  4IW0 A;  4ANU A;  3A1Q B;  4K81 A;  2Z0D B;  3NOB A;  2BKR B;  3SD5 A;  3T8M A;  2GBR A;  4BKG A;  4HLE A;  1P0R A;  4M8M A;  2NS5 A;  2C9W B;  2J0J A;  5AZH A;  4URK A;  4LCD E;  2J0M A;  2DAJ A;  3DVG Y;  1WGG A;  3Q3F A;  3AU5 A;  4ICU A;  2HD5 B;  4ANW A;  2O6V A;  3S2A A;  2VRR B;  3PHX B;  3V6E B;  2CHW A;  1Z2M A;  2N7E A;  2MW5 A;  2FUH B;  2N4F A;  4KIK A;  2MSE D;  3W1Y A;  1J8C A;  2DZK A;  2CKH B;  3N32 A;  2D2Q A;  5JH5 C;  3V62 A;  3TJP A;  3P2B A;  2LGD A;  3OJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...