4GSXA

High resolution structure of dengue virus serotype 1 se containing stem
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
402
structure length
390
Chain Sequence
b'RCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEVTNPAVLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDTNFVCRRTFVDRGHGNGCGLFGKGSLITCAKFKCVTKLEGKIVQYENLKYSVIVTVHTGGTIATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNEMVLLTMEKKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLVTFKTAHAKKQEVVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKLTLKGMSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGKMFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope protein E
publication title Structure of a dengue virus envelope protein late-stage fusion intermediate.
pubmed doi rcsb
source organism Dengue virus 1
molecule tags Viral protein
total genus 67
structure length 390
sequence length 402
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gsxA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4gsxA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4gsxA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4gsxA03
4BZ1A 5KVDE 4L5FE 4UT6A 4UTBA 1UZGA 5GZNA 3UZVA 3N42F 3IRCA 3VTTA 1ZTXE 1S6NA 3UAJA 1URZA 5GZOA 3C5XA 4UTCA 4UT9A 3N43F 1Z66A 2GG1A 3WE1A 1SVBA 2JSFA 4FFZA 4GSXA 2I69A 3P54A 1Z3RA 4UTAA 4AL8C 3N44F 3MUUA 2H0PA 2ALAA 5AAMC 1RERA 3C6EA 3N40F 1OANA 3J2PA 4AM0Q 4BZ2A 3I50E 5H37A 1TG8A 5KVGE 5IREA 5JHMA 5LCVA 2JQMA 5LBVA 1OKEA 5LBSA 3UZEC 4X42A 2HG0A 5B1CA 2V33A 4ALAC 3N41F 5KVFE 5KVEE 2R29A 2R69A 5JHLA 4FG0A 3UC0A 2P5PA 1OK8A 2JV6A 3G7TA 5IZ7A 4FFYA 3UZQB 3UYPB 5AAWC 3J27A 4GT0A 1PJWA
chains in the Genus database with same CATH superfamily
1HVXA 1I31A 4FFZH 4W9ZA 1KLGB 1SM3H 2Y3AA 4BFIB 4XNZB 3JTTB 3CHRA 3DVNA 4IRJC 1EO8H 2NX5E 3JWOL 3B9EA 3OKOB 2UUDK 4J8RB 3ZDZB 5ICYB 1WBZB 2H5UA 5E6RB 1X4ZA 4IGBA 4LCIH 4QRQB 2PXYD 1UZ8A 1OAKH 2XU9A 1WLGA 1JGVH 3DYPA 4M3JA 4WFFD 1NBYB 1J0IA 1HQ4A 5IW6A 4MJ5B 4QIRA 4WF7A 4YHML 5FLVA 2JI1A 3QUZB 4LLAA 9PCYA 1OARL 3EBAA 2IV8A 2NY4D 1T0MB 4Y9FA 3NIGE 1P5UA 2EE2A 2YIHA 3SD2A 3T4AB 2F54D 3ZKMD 4L4TA 4R0LB 2YJQA 1SDDB 3C6LC 2XLLA 2HT4C 1K72A 3TEXA 1G1KA 4BZ2L 2YOAA 3U0WH 1OTSC 1LP9B 1SLVA 3L5JA 3O6LL 1JHKH 1AZZC 4R7DB 4DW2L 4P2QB 4IJ3B 1F41A 1TPXB 3BH8B 3IDGA 4GG8B 1ZPUA 2GYSA 3MLTB 3GPEA 4U6HB 1JNNL 1B90A 3STZB 4DETA 1NCIA 2BVTA 3PDDA 1DO6A 2R1XA 5DRZB 3QIUB 2IVFC 4Y19A 2NXZC 4Z7QE 4UMGA 2DBLL 3MNMA 4P5TA 1VFAB 1U8KA 2JCCF 2Z7YA 3I50L 4MMXB 5BS0D 1F02I 3W5NA 4M6OH 3CFNA 3QI9D 1A4BA 1DQJB 1P5UC 4WW2B 2Q9OA 3ZTNL 5C97A 4K5PA 2DOCA 3RBSA 4DGYL 5IBLD 4PGEB 2C3VB 4MLSA 2VERN 3OLDA 1MW3A 4ZMTA 4S1RH 4PCSA 1JF1B 2P8PA 2CMRH 4JN1L 2R51A 3FU9A 4AEHL 4QHPA 1RVFL 3KEHA 4NQDB 3HC4H 4OZ4B 1E6OH 5DQDH 5HDQL 5B1CA 2R9HC 1PLGH 1T1WA 5I23A 1AQMA 1FDLH 1IILE 1PNCA 1OGSA 5ANMA 5FB8B 1HL9A 1YMMB 4WFFE 3ETSA 2EAEA 1IQDA 4AQEA 2MCG1 2ESVB 4TSBL 3HS9A 2EIZB 3Q1EA 1XXFC 5DZPA 2BIHA 2KLRA 4K7PL 3NRQA 3BEWA 2GTQA 4P5TC 4CA4A 3RY6C 4X9FA 1QI3A 2CIIA 3OV6A 3AXHA 2CCVA 1QW9A 1XT5A 2F54E 3M1BA 1FN4A 1UH4A 2G2PA 1I1CA 3R06B 3KE0A 4DKFL 2CRZA 2WXFA 4XMWA 1OLLA 4LKXB 3W82A 4KNUA 4RISH 3G04B 5J56B 4FQXA 1XZWA 4JREB 1C12A 3OAYK 4PCYA 4F7CA 3O4OB 3ZTJH 1PEZA 1LK3L 3IGUA 1I85A 1TUPA 4DK6A 3BKCH 4KOCA 2FBJL 4XP5H 2H41A 4NUPA 4OIIL 2YN5A 3TP4A 2P43B 1PDKA 1YEFH 3LSOA 4I9WD 4WSJA 4JGJA 5HXMA 2YXWA 7PAZA 2XJKA 1N10A 5F7NC 5EZIL 1AIZA 2Y7SA 5BS0E 1U93B 1UB5B 4EI5B 1JOIA 5F7FA 3EADA 2HT2D 3EUUA 5TE6H 3QC6X 4JDZA 1E43A 1MG2C 5TK2A 3RE0A 1IGJB 4APQA 4ZK8A 5E99H 4UTAH 1UUSA 2FO4A 2CJ3A 4XP6H 3GSWB 3L08A 4DGVH 4M43L 2DS4A 4FQXC 5DJ8A 3ARFA 5DU7A 3T2QA 3C5SA 1NFDB 4DGIL 2JXMB 4W9HC 1HZLA 2H32B 1F58L 3KL3A 5LGHH 1FC1A 5I19H 4I1PA 1BYOA 4WFGD 3QH3A 2GK0A 5I1IL 2XWZA 3IETB 1CFBA 1NC2A 2MOQA 3GXFA 3ZSSA 2ZXQA 3MRDB 2IMMA 3VXOA 5IB1B 1RH8A 3PU7A 4PBVC 4ZX6A 2NSXA 2PYEA 4TS6A 3H9SA 3C9NA 1XDTT 3OKKA 2CRYA 5GJSH 4APQC 3P30L 4NXKA 3FT0A 5KBKA 4JZNA 4R5TA 3RB7A 3FTGB 4Z7UF 3V4UH 1KPVA 2XPGB 2R83A 4J2QA 3UROR 3WS3A 2H9GB 2FR4B 5TQ0H 5HJDA 4HUXB 3RVXC 2H6OA 1WWCA 2IBZX 3D5OF 1TJHL 1ZVYA 3F7YB 4JFPB 3SBQA 4AZ8B 4I9WE 2QGDA 3HUJF 4HPHA 2BFGA 1R1CA 3L3HA 5D7SL 5EA0H 2ZUSA 1ZK5A 3PL6C 3DHPA 2J88H 4UV7H 1JPTH 3ZMRA 5IBTL 3WFBH 1UFGA 4OLZL 4L8BA 1J18A 3IFLL 2I7OA 3ZZSA 4DP1X 4L23A 4UOQA 3TBYB 4GFXA 2CHZA 1QA9A 4K55A 2ZUTA 1XIWB 4KXZH 4MD0A 4YQXL 4W9FC 4MS8D 4WRLA 5EO0B 5GGTH 3VE0B 1F45A 4L8SC 3QUYD 1N6UA 5IB5B 3RWFA 2FHCA 2JCCA 5C09D 1BLNB 4ZG1A 4WV1A 1AIFA 2R0WL 2X87A 1FE8L 1LLAA 5F1SA 1WWBX 1U92B 4DO5A 4U1SA 1JF6A 3HNVL 3S4SG 5M94B 4RFOL 1KY7A 4MAYD 4WFGE 3AAZB 1T3FB 3QUGA 4QYAA 1BIIA 4YSCA 4KUZH 3RDTD 4ZMVA 1QABA 4FTVB 1L9OA 3KL5A 3OJ2C 2J55A 2EDXA 2F8IA 5HGAB 2UZXA 1NCJA 3WIHA 1CXHA 1R46A 4W9IC 1FZKA 2J8UB 1QO3A 4AWJC 1FL3B 3IDYB 4QGTA 3TJEL 5DJYA 1NKRA 1FZJB 1AHWA 1J05B 3BESR 5AUMB 2OLDA 3Q44A 1MRDH 4IM8A 4MNQD 5LWYH 1LNUB 1CD0A 4XZUB 5DHYA 1QLFB 4YVNA 5LVEA 4NZ8A 4WV1C 1FNSL 3ECWA 5CSZA 3RDJA 3ILPA 4IOFD 2V17H 4ODBD 4R8WL 1G7JA 4AX3A 1B0RA 2B1AL 2DQ6A 1A21A 3IJ9A 3LZOA 4Z18A 1KPRB 5EZOH 3VXMD 5D96B 3SY0B 2D03H 3D18B 4HKXA 1IM3A 2R1YB 4XH2B 1DSYA 4LT7A 4CVUA 1HJCA 4JO2H 2MQCA 4BJLA 1OANA 4YBLC 5I9QC 2VXQL 5EIIB 3UTSA 2RCSH 1ASQA 3L5WA 3ZO0A 3S4SA 1LQSR 2ZNWA 4IRZL 4MAZA 5C0FB 2J5LB 4NDMA 3GO1H 1KOAA 4HF5L 1AHWC 2AABL 4NO2A 3E7JA 5C09E 5DR5L 1HIMH 1ZHNA 2A4EA 1P2CA 3TBCA 1EXHA 3R4DA 3ZE0B 3CDZB 5C9JB 3ECUA 4WJG3 1A8ZA 3MA7B 4F33A 3DJ9A 1KIRA 1QLEH 3FQRA 3FBKA 4LFHG 2Z8SA 4U4BA 1KC5H 3VWKC 4FQLH 2H3NA 1BXUA 1MJUL 3ES6B 1MRCL 3BXNB 4WI8A 2H0EA 4FQHB 3C5ZB 2IBGA 5D1ZI 3UTOA 1JWUB 2Q7YB 4DQOL 5JQIB 5H8DA 3KBEA 1WUZA 4BK5A 1RY7B 3BDBA 4PFEA 2XNAA 1LO0H 2XG5A 2MNUA 1P5VB 2NLJB 4O58H 4ZMPA 5CBEB 7FABL 5KZCD 3AU0A 5DEGA 5AALA 4PLNC 4MNQE 4PHXA 5BVPL 2EEBA 5DK0B 3WFDH 5L88L 2ZUXA 3CX2A 3NIGF 4XO5A 3NZ8B 4FHBD 2Y0SA 4HEPG 5MP6L 1F0LA 3FRPB 5IMOB 3QO0A 4WQOA 2GEEA 2M26A 4DJMA 4BSWB 3B3BA 3WOVA 4NIKB 1CURA 2AEQL 4KZEH 3QDMA 4UTBL 5B7EA 3VXME 2DEYX 2VR3A 5FDYA 5TD4A 1ORQA 2A6DA 4YHNB 1KULA 4LAJH 5SWZD 5I71C 4HZLB 1VZIA 3ZGHA 3OAZK 1UJTA 4YDVB 5F9OH 4TOYH 5EF3A 5I24A 1S7RA 4G6KH 5ILTL 4O02L 3ZUCA 2VDKB 1WHPA 5DZVA 1OEZW 4U6VL 4KKBD 1NLDH 5GZOA 4IMLA 4JPIA 3KDMA 4BK5C 1MCWW 1NDGA 4QRSB 1GW0A 3IJSB 3HUJA 4Y5YB 3C8KB 4LGSB 1BGXL 4Z7QF 2XRAH 5EC2A 4ELKA 5MENB 2XWTA 5TDNA 1NBVL 4H20H 2BM3A 1DLFH 1U36A 1U58A 4JFQA 4OZHB 2VJ0A 2YEZA 4H25B 1N64L 2X1PA 3EYUL 4PP2B 4ZO6A 4ZDHB 2P26A 5TK4A 2EUZA 2VZVA 4XCCL 3WN5A 2ZCKH 1WSST 5TFSH 3RG1C 2XZCH 1TETL 1IAKA 3FQXA 4I18A 4JFUA 2YO3A 4B9YA 4XP9L 3NYKA 1A1NB 5D72L 2YMTA 1F90L 1JUFB 1KJ3H 1B2WL 2A0LD 4EDWL 4HEPA 1G84A 2A9BA 3NEXA 4KAQH 3OLIA 4JANA 2P8LA 5ABZA 4W4NA 1KCSL 5GZOC 1UACH 2QR0B 3T6ZA 2PCYA 2YBRB 1YN7A 3P11H 4JHBA 5BV7L 3DV6A 5E8PA 3T04D 5GXBB 1CMOA 2OS7A 2C3WA 4WUKL 1BVLB 4WO0A 4UUJA 2ROXA 1DSFL 5KS9A 5B8CA 1I1FB 1HXMB 5F3HA 1VEOA 2UZIH 3MXVH 1JK9B 1NOLA 4JY6A 1WCBB 3WN5C 2C1PB 4RGOL 1U95B 4HH8A 1JWSA 5DMKB 4JFFD 2I07A 3VWJA 5SWZE 1UXLA 3QIBA 2I9TA 4I18C 1G7IA 4V33A 5E5UB 5F2FA 2LFGA 3KPNB 3MJ7A 3QXTA 2ZP9A 2FYYB 1GMEA 3EGSB 3HI5L 4UQDA 1ROWA 4Y2DD 3VRJB 2CR6A 5DUBB 3UG4A 1SHSA 1KJ2L 3MOAH 3BZEA 4AQZA 2NY7L 1N18A 4TRPH 1A4AA 3MREA 2IPUK 4X6CB 4RGNC 1ZTXH 4KRLB 4LPYA 4DCQB 4F8OA 2H1XA 5A16B 5D7JA 3CX5J 3TJHD 4OAWB 4DEUA 2VB5A 4D3CH 2BZ7A 3QZNA 5B8CC 1ZIBA 2H6UA 2FTAA 3ULUD 1A4JB 4UBDC 2UV3A 2PMZA 1WO2A 3GB7B 2WVVB 4LCCB 4O5LH 3T2LA 3L3JA 3QEGL 4DGWC 1VESA 2HA1A 4JN2A 5F3BA 3HG3A 3KYNA 4QHMA 3QIBC 5EZLB 1MLBA 4S11A 3MRGA 3COOA 4G8EB 4Q89A 5GGRY 1GYVA 3WHE1 3NDZE 2P5EA 2I9LB 5IW3A 5I8OL 4YBQD 4GKOA 5CZRA 1OSZB 4OIAA 1USQA 5FUCC 2NX5A 1YEKH 3WNOA 1J8SA 4DWHA 5FO8B 2MKWA 4WI0B 5FOBA 5C0AA 1KJVA 1JXKA 4ISVB 4ENZA 3LKPA 2LTQB 3DBXB 1RMFL 3KWTA 4ODHL 3EJTA 5CLXA 4ANXA 2XYCA 4PY8J 5AKTA 4ZFGL 5B38B 3IGAB 1RIVH 2YZ8A 4UM9A 1DEEA 5H35B 5CEZD 1JMXA 4JFFE 1KGXA 1UUNA 1UURA 2GT9A 1KXQA 1RZIB 2UYLB 5C3LD 3LRKA 1A7NH 2AJUL 3U4BL 4B7IA 4QNPE 1AQKL 1I8KB 1M2VA 5I5MA 3PWUA 3SKOA 4XOCA 1T1YA 4CW1B 3ZDWA 3R4RA 1XMEB 2H47C 5FW6A 1GY2A 5C6WH 1NM4A 3NPSB 1L7IL 2YPKB 2PNDA 3I6KB 5IHZB 3AG2B 1QBLL 5CJ5A 5ITBH 3L45A 4S1SL 1TTCA 4G42A 3OLGA 1NAKH 5KJ4A 2DTML 2XZZA 5DS8B 1K2DB 1HZHL 3PDOB 1T7VA 4H8PA 3L4WA 1J9QA 5F8RC 1AKJD 2V3EA 2DQIH 2FJHB 2PCPB 4N2IA 4M1CC 1X5LA 4FYQA 3UX9B 2CRMA 1MWAB 3DHMA 1ZANL 4E9VA 3EJJX 1F3JA 5MEQA 3ULUE 5EZJA 1HWWA 1NLBH 3DUUA 5DD0L 5TDPB 4AT6A 3QS3A 4D94A 3NH7L 2W9DL 2BC4B 4IW4C 4IOSD 5INCA 3QNXA 2W59A 1T0OA 1EZLA 4GUPB 1A6AA 2J2ZB 3DC0A 1U3NA 4FTDA 2XKUA 4JKKA 1LK2A 4W93A 4TSAH 2FEDD 1R24A 2LGNA 3PGFL 4I3SH 1VFBA 3CVHH 4X7SL 4FMVA 1NCWL 1T0NB 4UNTA 2N7AA 3OMNB 1LILA 1LO4L 3L7EA 4KWUA 1AMXA 4XVJL 3UYRH 4H26B 1U3YA 4M9OA 3NFPA 3KWXA 4OCXH 2MSPA 3W9EB 3CHXA 3M7FB 1EAJA 1FZOA 1T83A 2VKXA 2P24B 3VU1A 3HHSA 5KBLA 4LIQE 3KPPA 1S7WB 5IB2A 3U46A 4UV4L 1Q9KB 3KJ6H 3R18A 1ZT7B 3AQXA 2R2BB 3WUWG 3UZVB 1DANU 3VA2C 1TYJA 3GDCA 2OZNA 5HYQA 3MBEB 1FYHB 1NCBH 5DC4B 5CEZE 5DRXB 3GIZL 1SHWA 4P2CG 3GZQA 3IMSA 3O2WH 1VFMA 4LVNB 1CXIA 1CE1L 4NPJA 1Q0YH 2Z7WA 3AMLA 3HZVA 3QGVA 3SY6A 3KLAB 4ZSOA 3EGXA 1INQB 1CLYH 1Y0LA 4YWGL 2F54A 3WIIH 3QQ4B 2LHAA 4WU5B 5FOJA 1HHKA 1TNNA 4RNRA 2FQEA 5FKAB 2AV1A 3OWEA 3W0WB 5J57B 1URZA 2DZEA 2OR8A 4NKQB 4GP4B 1FJ1B 4FXKB 1FNFA 2J25A 4HJ0D 5DWUH 4HIIB 3IDXH 1TMCB 2W91A 1FFQA 2VC2L 4UILL 5CIPA 1DANT 2D2CC 2J6EH 3RL2B 4X4YA 3GSVA 2CWRA 4X5RA 5ABDE 3VFOA 2HUEA 3QS2A 4B5ZA 1IGMH 3D4CA 5A2LH 5T1LB 3HS0A 2EINB 2K8QA 1MW2A 2PXYC 2LU3A 3FU7A 1I8UA 1ETB1 4Z7VE 4RWYH 3BVNA 4NB7A 4P06A 1UA3A 4YDZA 1BYPA 1MFEL 4J6RL 5SWSD 1HH6B 1LEGB 2VR8A 4AGPA 5AVVB 2X2YA 3OJDA 2NY4C 1G6RB 1XD1A 4R5XA 4LSVH 3ZMEA 1TZHB 2X6UA 4J8QA 2I7SA 3ZKMC 5GS0D 3D4GA 4LARL 3WUWA 3GSQB 5F0JB 2KDGA 5IEHA 5T5NG 1FH5H 1R5IA 1X5YA 3BUQA 5AB1A 5BOPA 1XL6A 1RZJL 2J3SA 4PJDA 4LDEB 5E4EC 2AMGA 2GSGB 3GSUA 4NHCL 1MPAL 3SGJC 3GMNB 4G7SB 2GJZA 3E3QE 1E8ZA 2ZF9A 4AJYV 4DN3H 1T1ZA 4QMEA 1J0ZA 3MOBL 4O9HL 3HS0C 1Z9LA 5ENWB 3B7UX 4X4ZA 1X9RA 3BPOB 3V5DA 2DW5A 4KQ4H 4TNVK 1Y18B 3EXLA 4H1LH 1U2CA 3LNGA 3U2JA 1PZAA 1AS6A 3PIQB 1M42A 4X42A 3WNPA 3ISWA 3RNQB 4U6YB 1BECA 1LEKB 3KPSB 2UXVA 2B2XH 4OGYL 5DD3L 4O51A 3EOBA 2PTTA 3QI9C 1BOGB 4B9ZA 3SQOH 3JSSA 1MFVA 5C7XL 2IC2A 2AK1H 2XTJB 1ZE3C 3II1A 3MI6A 4NP4L 5IBLC 4ABWA 3D8MA 1N3NB 5HD8D 2XY2A 3QO1A 1S5HB 4R4BB 4M3KB 4NWUL 4KKCD 3V0VA 2BLFA 4YDJB 3BQUD 4S1DD 3GRWA 4JFZH 4NQCB 4HCRH 5CINL 4AYBA 3S8WA 3NN8B 3DX9B 5C6TH 3HKZA 1SJVA 3ENEA 3BUTA 1HC1A 3DOSB 5EU3A 1Z9NA 1Z9SA 3IWUA 1QSED 3BKYH 4GQ9L 3BISA 3CMGA 4H88L 3PJSA 4L5FE 1HI6A 1MFMA 1KN4H 4RDQF 2Q6WB 1XGQA 5KYYB 1CFQB 4MX7A 1A3LH 4Q0XH 2EC9U 5F0LB 4RZCA 4JPWH 5SWSE 3BP4A 2B59B 3O4LA 3FHQA 4OGXL 1FVDB 1M6OB 3QJFB 3BZFA 1XEUA 1YYMH 1RZGB 3JZ7A 1KBGH 2PP7A 2EQDA 2X10A 2YAFA 3DJRA 3O6MH 4KHXH 2FSEB 4Z78A 3M88A 4I0PD 3VXSB 3G5XA 3L4ZA 1IE5A 3FMGH 4YAQB 3SCMD 4AMWA 3DRTA 1TT6A 2WXJA 1HU8A 4K9EL 5IWLC 2RALA 2JELL 3PHSA 2WVTA 2XWRA 4PGCB 5AZEH 3MV8B 3QULA 2X4QB 1UD6A 3ZPDA 5KSUA 2CA3A 3ARDB 1RK0B 3LS5H 4DKDC 3P0VH 4QRPD 3Q1SH 1N8OE 4HWBA 2JNZA 2D7TL 3WCYA 3MUGA 3VJ6B 3BUPA 1QEXA 1MCJA 4YMPA 3O2DH 4KKNA 3ZX1A 2HT2C 5F7LB 5FA3B 3VMPA 1BX2A 4OGAD 1KWGA 5BZDA 3MLYH 1DQIA 1GIGH 2K8MA 2WMPA 3W9DB 5HYIA 1OT2A 3FN0L 2BCMA 4PJFB 4Z3IA 1ZY9A 3PGDA 4B41A 3DPBA 4ZFFA 1DJSA 5B22A 2A6JA 2ADYA 4GRWE 2ZX7A 1MVFA 1BQSA 3DGDA 1QSEE 4TVPH 3NJIA 2Y5TB 3TTSA 2PKDA 2ZUQB 3N43B 4YHLL 3UDWA 5C0IA 3LB6D 2G3ZA 3HPLB 3QFDB 4UOW0 1LO2H 2R69H 2CR3A 1PCXA 4JDEA 3DURA 3LKSB 5GSVA 2OMYB 3D39B 3VACA 1LO5A 4PJ5B 2Z7ZA 2GIYA 1N7ML 3UPCA 3QZBA 1SLWA 5AVSB 5HDOA 3STLA 1KGJA 4I1RA 1WA1X 4DN4H 1U8HB 1WITA 3QXUA 4DUWA 4ETYA 4Z8FL 4KNQA 4MRCA 1EJ8A 5C09A 2O6FA 4H2CA 1MCFA 1X6NA 3NQKA 1SFHA 5ADPL 4Q9QH 3VQLA 1FNGB 3FHEA 5GPRA 5JHDB 2WB1A 3B8SA 3G5VA 3D4ZA 4TPRH 4HSQA 4Y1AB 1IC1A 2R56L 3VQ1C 4YSPA 2I25N 3SYCA 3RDTA 4RDQG 3MNZB 3NIDB 1BVKA 4QRPE 3UDWC 3S88H 1IFHH 1XX9C 1XB8A 3V9CA 5F7BA 4E5XG 4ATWA 2ZYSA 5EOQL 1ETA1 4KMTL 2YD4A 2Z92A 5IQ7L 4YSOA 5BOZG 1YAIA 4D8PB 3S34H 4EOWH 5HPMB 1C8PA 1E4HA 4QXTA 4MS8C 2NYYD 3BUYA 2WLKA 3F7VA 5HDLA 3QUYC 4F2ME 4MNQA 5DTFB 4HX1A 4X9HA 2FWLB 2IOMA 4PJCB 2AFNA 5A7BA 2ZXWB 3WKMH 1HKLL 1F4YL 3QDGB 4JLRB 1MZZA 4WWKB 2P80D 3V4VH 3WL9A 4IU2A 4MAYC 2NY5C 1IE4A 4KGJA 1T1XB 2GJ6B 3KLLA 1RURH 5HI5D 2VW6A 3SKNB 2XI9A 4PHZA 1RUMH 4U33A 4HJJH 3RDTC 5TE4H 2JWYA 2J5WA 3FB7A 1Q72L 3PJNA 4U1MA 5DUMH 4CILA 2AS5M 3M8OH 4NN6C 1PG7H 5EBMB 2CLVB 5ESAA 1MUJA 1BM3H 2BS9A 3C8HA 3FUHA 3ULUF 3JXAA 1A9BA 4IEFB 3K7UA 4TUOB 2GI7A 5IVNA 2YEQA 4N8PA 4DEPC 1FL5A 1T7XA 2EILB 1AGBB 1KGCD 4MA8H 5KUKA 3LPPA 3GD1C 2RA1A 4IIZA 1K8DA 2UY6B 4PR5A 1CLZH 4XBGA 2EH7H 1A2YB 1BAWA 4E5XA 4X83A 1KELL 5DEFB 3RJDA 2VH5L 1DO5A 2MWCA 3MBXH 5E9DD 3RWJB 3K72A 4IOFC 1PZ3A 2JKIS 2V7NB 2X12A 1MHPH 4RMBA 4L3CA 3UC2A 3BD3A 3EHBD 4TNWK 1JGUL 5HBBA 3NVQA 4XR8C 4AQOA 4Z1PA 4Y4FB 4F1ZA 4JDTL 3GMPB 4JCLA 2PYFB 1HINL 4QDGA 1GAFL 2IH1A 2GC4C 2D7OA 3EJSA 4MDJB 4PJIB 3WELA 4ZXBA 4OV6F 4JVPA 2O1AA 2DWEA 5LHDA 4HCGA 4IDLA 2KQMA 3LPGA 1JZFA 2WQVA 1U8IA 1HN1A 2IGLA 3AT0A 4XOAA 3GI8L 4ZPVA 3HMWL 1HSBA 1CT8A 3E80A 4NT6A 5E5RB 2QV4A 3L6FA 4HJEA 1DVFD 3P4LA 3VSUA 4ZOCA 1Q38A 4PJ7A 3LEVL 5TGBA 3S7GA 4F7KA 4FP8H 4PUBH 1AP2A 1BAGA 1UOVA 1ZSDB 4NUQA 5EN2A 1X7TA 4XWOD 2DL2A 5FFOA 1RULH 4GKZA 5SWZA 4J3SA 2GY5A 3EDDA 1B4LA 1X5MA 3HZ3A 3FO9A 5BMFH 2VXTL 1F6AB 1J48A 1FFTB 2VAJA 3ZDYB 3HHMA 2GUOB 3O3DB 1I8MB 2WNXA 3UG3A 2A2QT 5E08L 1MDAA 4P2OD 2VDKL 5AAPA 1TVBB 4Z7VF 2XZAH 1H9DA 2C9XA 4GI9A 3RY5A 1NIAA 4FQ2L 1T03L 4UT9H 2BNUB 4PJ9B 5KSBE 1KGCE 3JV4A 4JQVC 4MHHI 5I1AB 3OJMB 4WZ9A 4FG6D 2BNQD 4G5AA 5I82A 1EWHA 3QCUL 1JYNA 4QO1A 1IGTA 2VN5A 4RAVB 1NCHA 3K81A 1WTGT 2YSTA 1FBIH 5FO9A 1J1OH 2R0KL 1D5XA 3WJMB 3KL0A 3O8XB 4OCWL 4G1MB 5DCCA 4QGYA 4ZQKB 4ETQB 4GBXB 3I02B 2PR4H 1AOHA 3FQTB 4DVRL 4OD3H 4PMEA 1E9QB 2YC1A 4NJAH 3IFPA 2EDKA 1S9VB 4CMMA 5B21A 4OD1H 3IJEA 3JWNH 3KPMA 3SBPA 3RNKA 3RIKA 2E9WA 3NZHL 4KKBC 4MCZB 2N0KA 4XC1H 1AO7A 3S36L 3LD8C 4X99B 2MNWA 5DMIL 1OPGH 2FAUA 4C56B 5IK3B 1PS3A 1ZGLA 1XGTB 4QY8B 2VIRB 4IRZA 5C8JB 2NNXA 4UQ3A 1IC4H 2EYSA 4FXGB 4EZKA 1TQBB 3TWCH 2CO2A 4WEUD 1K4DB 4WI4A 4TQ8A 2ZWSA 5LBSH 2IGFH 3CJJA 2R39A 3O9WD 4AVJA 4YEFA 4PJEE 1W9XA 3U4KA 1B4JH 5H94A 4P4KA 3RJQB 4OJCA 4G8IB 3PABB 3MGOB 1F00I 3VFNB 2NY0D 3WNIA 3W3BA 2YKLL 2A0LC 3SGKA 3IMBA 3AREA 1S9WB 1QHQA 3UAFA 4Y2DA 4F3FA 4HISA 1XCTB 3SKMA 3MRFB 2DY2A 2C9UA 1BQRA 5D1ZA 1QR4A 2ZQKA 3DX4A 5TQ2L 1AYOA 4YHYB 3SO3C 1YC7A 2BNQE 4EKJA 2GITB 3OHXB 5ISZD 1R3JA 4UDUB 3BW9A 1SY6A 2DQJH 2WXMA 4OZFG 4PTUB 2VSDA 4AL8L 2R2HB 3MNWB 1JV2A 2UZPA 2NZIA 2BHFA 2V8MA 1KDIA 2F1AA 1CF8H 2MFNA 1P4BH 2F2HA 2WBJD 2WD0A 1CDUA 5F8QC 3QT2A 3V6FA 1JZ5A 1OTUD 3PLYA 1GGCH 2ICEA 5JXAH 4PJXE 2CH8A 5KVDE 1EMTL 3MRIA 3PWPA 4OLWH 4UTBA 4YDNA 1D5RA 1IT9H 5IVXE 2BVPB 2YUZA 3G6AB 3IXAB 4Y2DC 3RAJH 3VFRA 3ZT6A 5DZJA 3QEQA 15C8L 2FX9L 4P2YA 2DIBA 2VRKA 1SHMA 2K6ZA 1TQVA 1Q9LA 3BSZH 5IV2B 4TLUA 2HWZL 3I6GA 1RUKL 5EBLA 1JPST 3TNNB 4HXAL 2ZOUA 4KK9D 4MTMA 4PRDB 3TJHC 2XIIA 4EI0A 1U8NA 4ZRGA 1EJFA 4BSJA 2EE6A 1HNFA 3ULUC 4N2EA 1RP9A 2YGQA 4YHKL 5KBPA 5HGGS 1AD9B 5D71L 4ONHB 4R2GB 3GTVA 1QQDB 2J1YA 1Y07A 3ZHLA 4D0BB 4FQPA 3GDBA 2CHWA 2UWEE 2X9WA 2H8PB 4O2CB 2F74A 4GRWF 4M61B 1WBXA 4F5CE 5D93B 2WCPA 1PIGA 3E6FA 1USZA 4OZFA 2X4SB 4ODXB 2Y6SD 1A1MA 2F0CA 4HMDA 4YBQC 1XF4B 4GJTB 4HZ1A 5ID0A 1A3QA 1EO5A 4U1JB 4KOBA 1OAYL 2B5IC 1ZHBA 3DKHA 3NJMA 4P57B 1MF2H 3D2UB 1CTMA 1JK8B 4TUJA 1MWAL 4AQ1B 4XE0A 5E1AA 3QRFM 1UOKA 1BXXA 1GL4B 2PWDA 3KPLA 3OR6B 1I3RA 1NBZB 4IOSA 1J1PL 2GSIB 1GGBH 1YJDC 6PAZA 1H15B 3OJVC 3ZKND 5KVGH 3MJ6A 4J4PA 4KDTA 5B7MA 1NOFA 5L4MA 2X0WA 3TBSB 1BZOA 4JJOA 1T0PB 4NUGL 2XPZA 3FYEB 4KZ0A 1T5WB 4KXDA 4BRJA 1WF5A 1I8LA 4GQZA 3FH8A 2QHRH 1MREH 4DP7X 3LKNB 1U4EA 1F13A 1GC1L 4MMZA 1JGDB 4MASA 3U6RB 1ZHKB 3FO1B 2F18A 3WIHH 1KJ2A 4YC2C 3A4AA 4R97B 2R27A 3SDDD 1MVUA 2WUCH 1JFHA 1XSIA 5DQJB 1YY8A 4AIZB 1UB6A 4JPSA 3UP1A 4JFEB 3FUDA 3LXCA 3Q5YA 4YK4C 5IHHA 2ZIDA 3NCYS 1MQKH 4NRZB 4WTQA 5DHDA 1ET8A 2BW4A 4LLYA 4L37B 4X4MA 4GXVH 4DKEH 5DJ0B 4MD4A 1G7PA 1XAUA 2Q86A 2FEDC 4G6MH 4XGZB 3ARRA 1DQMH 1LMKA 2AXHA 2DD8L 3FCBA 1UKTA 1NPNA 4RFEB 4J1UB 1A0QL 3HG2A 1NQBA 1QEWA 4ERSL 3BHBB 4N85A 4QWWD 4MKTA 2B1HL 3ROOA 5HDBB 1AZVA 1I8LC 1SFDA 4QHKJ 5KBMA 2GTZA 3MC0A 3K8LA 5FM5O 3E3QC 1ORSB 3BIBX 2CU9A 1T7WA 3E9TA 4MXQD 3VGGA 1SOSA 5CS7A 2YAPA 2FJFB 3WUZA 1JCKA 4LLQB 3BZ4B 2HVKB 5IQNA 5IF0A 1X5GA 2ZP0T 3EKCA 4YDKL 1CBVL 5SWSA 4QJ3B 1JD9A 3T4YB 5HY9A 3UGXA 5HGBA 3GUTA 3DJTA 3QORB 2GPZA 5IKCA 1XZ0A 1M7IB 1G7MA 2X4NA 5IJBC 3JWDL 3VXRD 2F8XC 2Z1KA 4BSVB 3V0DA 3MYZA 3LQAL 4HUUB 1YEIL 3VSTA 2VLJD 1E4WL 4UQEA 2IIJA 2KC0A 1WP6A 1JXFA 4HJ0C 4ANUA 4LLMB 4N90D 2WTOA 1JPGA 1A5FH 2IOIA 4DP8X 2KT6A 2ZTBA 4MJJA 1E8WA 1QBAA 2BDNH 1DBJL 1FG2A 4PJ8B 2A9NH 5HYJB 4K94C 3KLHD 5EU6D 4NQED 3DX7A 1HEHC 4TQIA 3MCYA 5A7EA 3F05A 1GOHA 1NCAH 1DBAH 3FQWA 1Z5LB 1C8QA 3FTVA 5AL8A 1G9MC 1P4IH 2WQXA 4M7LL 5I1KH 4PEEA 2QBWA 4YSAA 4G6JL 1FZMA 4WDIB 1TU2B 5LBVA 1ONQB 4CAGA 3L2MA 1FYTB 2IDQA 1RPUA 1GZPA 3NABH 5GS0C 1RJZA 3U9PL 1RFDL 3U0TB 2NMSA 3X1NA 1AI1H 5EUKB 4OIBA 1W2KT 1MIEL 3E38A 2YKKA 2ZOTA 4CBZA 5HJ3B 2WN3A 1OGAD 2NW2A 2GTWA 2W0FA 3GSRB 3K2UL 4HFWB 1MLCB 2EYRA 4PGDB 1QSEA 2QHLA 3ZL2A 2MCPH 5FAAA 5KSBF 5LGJB 1DE4A 3QJZA 5HDRA 4WWPA 4TYUA 3DX6B 4OVVA 4QRQA 3RGBA 1FNHA 1HXKA 2APTA 4OJFH 1YEJH 3QDJB 4JG1L 3RL1A 3RU8H 3GHPA 1YY9C 4WEBH 3OB0H 4LRNH 5GQBA 4B9GA 3I74A 4HFUL 1DL7H 4MJ5A 2CNZA 3VXRE 1NIFA 3NZUA 3WKPA 3IGKA 1ZS8B 3B6SA 2Q3XA 2VLJE 3ROLA 1HCFX 3EBHA 3O6FB 4H13C 1T0MA 5HD8C 4S0SD 1AQDB 1S7VB 4KKCC 5GZNA 3X3GH 1QLEB 2X4UB 3WFEH 1HOCA 3BQUC 3LN4B 4N90E 1A7RL 4S1DC 3SPIA 1R17A 3IU4L 3LNIA 5I6XC 2E86A 4JDVB 5ANHA 1YYCA 2VAAB 5GS2H 4FQIH 4LPCA 5ETUA 3IRCA 3DOIA 4ELME 4WK0B 1GZHA 3SE8H 4B3VA 3KPQA 5D1XB 1NANH 5MI0B 5EU6E 4NQEE 2B16A 3WIAA 9CGTA 4DOHB 3ZL4H 4PJBE 4TLKA 1XSOA 2DQEL 4GG8A 4U6HA 1IEAB 4KFMA 4OD2B 3STZA 4G82A 5I8CA 1A1OB 3CX5K 4G80B 2F58H 1PFOA 1G5AA 3APNA 3TO4B 4PRHD 5DRZA 1RJLB 3TA4D 4Y9CA 1RZPA 4UANA 3TT3H 5IESH 4K71C 5MEOB 5FFGA 1ZA6A 3GSXA 4H0LC 4PJEF 4F2MA 1W72B 3SCMC 3FRUA 1Q94B 3AY4C 1KF9B 4GSDL 3EJUA 4RETB 4JBSA 3RGVB 2XQYG 3V5KA 4CNIA 2WLMA 5KJ7E 4PGEA 3L3KB 3GF8A 4RAUA 5DD1H 3X13A 3P9LA 1QBMH 5TE7H 1GZHC 1YO4A 3U82B 3K2IA 2UVEA 4XCYB 4M1GL 3T65B 2AJZA 2VZ1A 4G8FA 4OZ4A 3GBNH 3DX1A 5IVOA 2CGYA 3HN8A 3MRBB 3F8UB 1X5XA 1X4XA 3FS9A 2W07A 4JZOB 2LLNA 4UM8B 3DRQB 5ICZB 3AW5A 3ULVD 5IREA 5ACZB 3L1EA 3GS7A 1NDTA 1E6JH 2K6WA 4OGAC 1RPKA 5CR1A 3T6VA 1D6VL 1PKQE 4E41B 4JPKH 3MRNB 3ZTCC 2OMZB 4PJXF 3DTXB 3DIFB 3R06A 5AOKA 4WNQB 1CDYA 3CIQA 2YRPA 5IVXF 4FS0A 1EERB 4FQQA 4G9FB 2LOEA 5H2BB 4DTGH 3LB6C 5J3HD 4UCFA 5J7CC 2XWEA 5I17B 1UXSB 5C08D 1FNLA 5H4YA 2Z6FA 4L1LA 4K5MA 4AGNA 2XQYA 4E9YA 1ACXA 4PRHE 2H3KA 3DMMD 4G72B 2D31B 3J27A 4F9LA 3QBTB 4X7TB 3QEHB 1I1YB 4B97A 1PCSA 4PW3A 4HKZB 1ETZB 4R96B 1DLHA 2VABA 1HEZB 4N0YL 2J1KA 1FVEB 3RKDD 2Q76A 4QRRD 2UWEF 4N8VB 5BZWA 1BF5A 5K5YA 2FGZA 1NUDA 2YK1H 1JRHH 4M6NH 3GSWA 4HHGA 3SDCB 1ZXQA 3SQRA 1A6PA 4P3DB 1HH9B 2JXMA 2ZUUA 4F8NA 2A9CA 1H3PH 3D12B 4TQEL 3GI9H 4FQJL 5A2IH 1H3WM 3L7FB 1FO0H 1YSOA 3N1MC 4Z23A 2BINA 5CJOH 2A6KA 3ULVE 1IM9B 1JDDA 3ABKB 2DLGA 3CFJA 2EYTB 2CBMA 4WTZG 3MRDA 5KSBA 1TEYA 1XGYL 2NYYC 4MMYB 4F9LC 3QC5X 5DHVH 1BQKA 2FWOA 4GSXA 1QKZL 2QPFA 3ZOAA 3GXPA 3CC1A 2ZSWA 2LFEA 5E9DA 3WGUB 3N1GC 2VDQH 5HI5C 2Y5QA 4PRIA 5IEKB 2C7UB 5FYLL 2XPGA 3TIEB 1YNTA 2H0FA 3NSYA 2H9GA 1RIUH 4PYHA 3O3AB 5C08E 2WPGA 4PV9B 3SYQA 1IVTA 3TU6A 5IQOA 3F7YA 4EQ2A 1UCTA 3OPUA 4A67A 3CSPA 3QRBA 2ZOLB 2DWDB 4QTHB 1AY1H 4E0RB 2EEDA 2WJ7A 2W0PA 4HKJA 2HJFA 4TUKL 4BFFA 3K6SA 1SQ2N 1RIHL 5L0QC 4Z7AA 4F7EB 2NNCA 4ZNCD 3WTTA 2K7PA 2A83B 4L9LB 1A7PH 1X44A 2WXGA 1RKRA 2DYSB 2PABA 4QRRE 2ZAIA 2HH0L 5KG9A 4Y2OA 5IFHH 3QWOA 2WXPA 4U7KA 1ZVSA 1F1GA 4LB8A 2R0LL 3QG6A 5KVEE 1NKGA 2VN7A 4WTZA 5FPIA 4L0PB 1A7OL 3EHBC 4PJEA 1KTDB 4XNXH 1DJHA 5LUMA 3ISYA 3L95B 5J6SA 1YCSA 4BZ1H 4Z7OF 5KANI 4R6UA 1OK8A 2R29L 2EDBA 1PY9A 1P0SE 2Z4QB 3AAZA 3VFGH 2BSSA 1PZ5B 2ADIA 5F88B 5HI3D 4G1EA 3C08H 5IZ7A 4P2OA 1B4TA 1BQLL 3CSGA 3GSNB 1AMYA 4AGLA 5J1SC 5F7EL 5FHAH 2A5UA 1DBML 2Y07L 3CBJB 5ABAA 2BNQA 2FWUA 3R1GH 5D7EA 3UPAA 4GIAA 3U9WA 1FL3A 1CICB 2J8HA 2W81C 1LYQA 2FX8H 5EULV 4PS4H 2P44B 2Z8WC 4W9EC 1DVFC 1J05A 1QFWH 4K3DL 2YD3A 4LO9A 3HB3B 4KO6A 4P9HC 4NUMA 4I2XE 4X5XB 4XZUA 3G6DH 1QLFA 3GRGA 2OJZH 2EXYD 4AITA 4O2FA 3L4XA 3CVHB 5J11C 2COVD 4XWOC 5BCAA 1PEWA 1ZXKA 4FZEL 4FFZL 1OAUH 3RWDB 3TA3B 1B4RA 3FH5A 1JDAA 4ZPTB 3EH4B 4LSRH 5IVXA 4HJ1A 4P2OC 1EO8L 2IF7A 1KDJA 3CD4A 4QKTA 4KRPD 5B3SB 1BBDH 1QSVA 3SQBA 4G7VH 4NPYB 4PJAF 4LCIL 5CUSH 1BWWA 1UD4A 4Z76B 1AGDA 1OAKL 4FG6C 1GS6X 1VPOH 1NSNH 3SGEH 3RUGE 1WD8A 5EG6C 3ATDA 1JGVL 1I3GH 2RR3A 3QAZC 3TO2A 4Y4HD 3MV9D 1RHHA 4XX1E 5JXEA 5I73B 2WOBA 2W92A 2J21A 4J3OF 2D7QA 3VI4A 3LH9A 5FUOH 5AG9A 3N44F 3O9WA 2Z35A 3EG9A 2NOYA 1DN2A 4JO8A 4HKBB 3BMWA 1U3JA 3LN5A 4M5SA 2AQSA 5C9JA 2WP3O 3LY6A 3S37H 4L18A 3MRQB 2X3AA 2ZX6A 5AD0A 3IAQA 3WTUA 3WKQA 4YSRA 2QDWA 2AERT 2YQBA 3BXNA 3EYOB 3CFCH 5EWIH 2YXFA 4ONOA 4OUOA 4WUUB 5I0VA 1LDPL 4Y5XB 3IJYB 1RSYA 1UWEL 2NLJA 3GZKA 3O11B 5CBEA 5JXEC 4JFOA 5AW2B 2WQWA 4N0RA 3WI9A 3SOBL 1DQQB 1W0YT 1XGZA 1EAPB 2OR9L 3O9WC 4YR6B 2VW4A 4ZOBA 4QRAA 5IR1B 3IJHA 3IMUA 3P3SA 1QHOA 5GRWA 3S3BB 2HJKB 2NY0C 4NNPH 4ELMF 3NZSA 3WHXB 1G9NC 1EA9C 3UAAA 3HBPA 5K9JL 4N2DA 2H7WA 4S1RL 5JUEH 3QJXA 5ISZE 4QLWA 4U1HB 3E2HB 2IXQB 2FQFA 2ITDA 2LAGB 3BEVB 43C9A 1NBCA 1XBRA 3HC4L 1VZGA 1E6OL 4PJBF 5DQDL 4YDVA 3U1QA 4MCYA 4AMKH 3CPLB 3FT9A 1RUAH 4I4WB 3HMXH 1H9VA 1XEDA 4GLRH 1FDLL 3REVB 4H1LB 4LLVB 4UZSA 2DBJA 1JIBA 1ZA3A 3IJSA 3MV9E 3LKOA 2ZKXA 4W9GC 2QGEA 1HEJC 1XF3A 3TZVD 4U1GB 1ZLEA 4Q9RL 3V9FA 1BFOB 1LXMA 4F9PC 2WBJC 1CGWA 2JB5H 4PP2A 1H6EA 1TO4A 1F1DA 2PPFA 5HVHB 4PRAB 1ADQH 2XV3A 2AEIT 2O5YL 4H8VA 3ELAT 5DXWA 5JW4N 2NY1D 1INDH 4RMWA 4PWIA 2DTSA 4ZS6C 2HCZX 4E36A 3BKCL 4LL4A 4Q6IA 4X0KB 2I24N 4B0MB 1KWKA 1WZKA 2EDTA 4A2LA 1GA2A 3H53A 1J87A 4NP9A 5CWSB 2QT6A 3PQYD 4KHTH 3OSVA 3MV11 4TLSA 1YEFL 3T5WA 1BPLB 1SVBA 2JJSC 5CGTA 2BWDA 4KK9C 3QPQD 2YBRA 4WCYH 2F7PA 3OF6D 4R7XA 1ZT4B 2ZPKH 4YSQA 4LDOB 4S2SB 4KJWD 1BVLA 1NGWB 4FG4A 2KPWA 3H3PH 5E4OA 3UIZA 4F7MB 5T1KD 4G5ZH 5CZVL 1EBAA 3FOLA 1HXMA 1AZUA 3SDAA 2AQ1A 1L0XA 1TIUA 3HOGA 3BH9B 2CR0A 3PWNA 4OCYH 4BWTA 4UTAL 3N06B 2ZXAA 4FQ1H 4XP6L 3EH2A 1VDGA 2NY5H 3SIKA 4DP4X 1X9LA 1WWAX 5C6PB 5DMKA 4GRMA 2HN7A 1U8QB 4DZ8B 2Y6SC 3O2VH 2DRUA 4Q6IC 1X5HA 4XP4H 3RX9A 3KPNA 2WNKA 1VEMA 5BQDA 2A74C 4N24A 5LGHL 2FYYA 3LQZB 3EGSA 5ACLA 3SN6N 3BAJA 2QZQA 2AV7A 5DUBA 2F15A 3SDDA 5B38G 1CFSA 3RTLA 3S37X 3VFPB 3RZCB 2XXGA 3KGTA 1UOLA 5AYUL 2X4OB 3CFBB 3A6BH 4LNVA 1A14H 1SEQH 3RPIB 5HVWA 4B50A 3QIWD 3S96B 5MEPB 2DQGH 1G1CA 3ZKNC 5GJSL 4XMZA 1UZ6E 3WMSA 2CDFA 1I7UB 3V4UL 1TYRA 2LLGA 1CU4H 2FYVA 4ZMNA 2IH9A 3GJFH 3WTWA 3O41B 5TQ0L 4LCWB 3UYPB 1WGOA 3PQYE 5KTEL 3JTSB 1WS8A 4XT1C 2I9LA 3OGCA 5HHMB 1F56A 3FHAA 4BIKA 2MPVA 3C87A 2QZ5A 4H8QA 5E2UL 1O7DE 4IKLA 3ABMB 4LQFH 5EA0L 1M05B 2B14A 3SDDC 2VXSH 3DJSA 1WZMA 3B7RL 4S0TD 4UV7L 1UD3A 4YXLH 3SZKC 3WFBL 1L9QA 2AJXH 4FNLH 3Q5OA 4FMKA 1EHXA 4AXWA 4DH2A 4FADA 3FQYA 2HT3C 3OSKA 5AAMA 2X7LB 5GGTL 1NA8A 1WZAA 4KXZI 3VXRA 3ZY7A 25C8H 5B38A 1OK0A 1UATA 1A9EB 1GKOA 1BMGA 1MSPA 1NCNA 2VLJA 4OJEH 1RZIA 2UYLA 1XH2A 4AYMC 5LQBL 4LMQI 1F4AA 5BXFB 1I8KA 1NGQH 2XWJA 2HFFA 3C60D 3MLPA 5EIQA 3IMTA 2AJSH 1NEZG 2L04A 2Z8VC 4ELMA 5BRPA 5IUCA 2VDRB 4KUZL 3RVUD 3WTSA 3RQ3A 3GXMA 2JKWA 4MXQC 3WSQH 4KTEH 5E23A 3APMA 4NQEA 1HS6A 3T0XA 3MZTA 2CO6B 2RB8A 1HHGB 1PU0A 5GGRB 4BM7A 3RTQD 3MA9L 2QKIB 1MWAA 4HPOH 5LNEA 5AAMC 3VI3B 1T2QH 3K4ZA 2ZG2A 2EO1A 5LWYL 1NCUA 1YPZB 2W60A 4A55A 1G9HA 4UQ2B 5AVRB 5JDSB 4L4VB 4KTGA 1KCRH 1GJIA 1RK1B 3FT2A 2V17L 4IRJB 2BOCA 2CO1A 4HGWB 3P40A 4ES8A 5B7FA 2MRYA 1OGAA 3FYIB 4GAYA 4YDIH 5EZOL 4AGQA 5EOTB 2D03L 3W9EA 1Z9PA 3D05A 4JO2L 3RHWF 2WN2A 4NM4L 2DMGA 3O3BB 4H5SA 1ZRUA 2APBA 2RCSL 4LNRA 3VVWA 1N6VA 3VDAA 3AQDA 1HHHB 1UWXH 1ZT7A 5LGYA 2IPUG 4OZGB 1NEZA 3QQ9D 3WXWH 3MUZ1 2Z64C 3GO1L 3MBEA 4XNYH 1AXTH 2E9IA 3PWLB 4WFED 4IU3B 3CDFA 1HIML 1IJNA 3MV7D 1SJMA 3MZGB 3C6LB 2IDSA 3P4OB 2PWHA 2OV0A 2HJLA 2QQKH 1XVSA 3UOAB 1QLEL 3QFJD 3QQ4A 4WU5A 2BCKB 3MLRL 4FQLL 3L3OC 1QFUH 3CFDA 1SMDA 1FJ1A 1T7YA 3V6OE 2OTWA 4AQAA 2NY2D 3NMEA 5E8DL 3VFTA 3X14B 4NSKA 1KTLA 3DUHA 1UZ8B 3KXFD 2JE8A 4RBPH 1URIA 3AGVA 4JKWA 5EC1B 3RUGF 2ZF8A 4IK7A 4WK2B 2NXZB 1IBHA 2YPVL 1HQ4B 1LO0L 2OL3H 3Q8CA 2KZWA 5IW6B 4PRHA 4F7TA 1ZEAH 4O58L 2XVLA 4QTFA 3WFDL 4E68A 3WFZA 1HH6A 1P5UB 4L48A 4ACTA 2TRYA 3OB8A 1SEBA 1W72L 4L4TB 4ABQA 2PTUA 1CLOH 4OCMC 5BRZB 5E6UB 3DWTA 2ENYA 3ZE2E 5F1IA 4KZEL 3NACH 4ALAH 3FUMA 3IPFA 4BZYA 2ZWNA 3BN3B 4DFHA 2QV2A 3K4DA 5DD6A 3GS0A 3V6ZB 3VNZA 2V2XA 3D3VB 4GXUM 2CXKA 3IDGB 4TOYL 5F9OL 2G3NA 4G6KL 4HC1A 1P7BA 2R1XB 2A1WH 1PL3A 1NLDL 2V5SA 5ENWA 3VH8G 4Y19B 4XCNA 1SY6H 1GGUA 1EEUA 1Y18A 4P5TB 4D0DB 4H20L 4WFEE 3FSAA 3ULUH 4X7DC 4TQPA 3RGHA 3VDCA 3S8FB 5H37A 3MV7E 1GYWA 2VISA 2YARA 4LLUA 4WY7H 3DECA 1TFHA 4N3TA 4OT1H 2DQUH 3QFJE 3VGHA 3LRHA 2N0MA 1HXYA 4GMTH 3FFCB 2GI0A 5JHMA 1QTPA 2XZCL 3WAJA 4OM1H 2P8PB 4KBPA 1FGVH 4WLCA 3QUZD 3MX0A 2DWXA 5CF3A 4NQCA 2YUWA 1KJ3L 3PHQB 2LQRA 3KS0J 1T1WB 2W5PA 3KXFE 5CLYA 1WA0X 4KAQL 4P99A 5ANMB 5AG8A 2GHWB 1IQDB 1OWWA 1UQSA 1KN2H 3DOSA 1NMCC 4TL5A 3DMMA 4J3UA 3I6SA 4HD5A 3ULVC 5JQ6H 4HUWB 3I75A 5EORL 3P11L 4JKPH 1O75A 3BEWB 4OLVL 3E1ZA 5CEZH 2B59A 3M1BB 1YJDH 2XDHA 4YHOH 3G7TA 1MCLA 4BE6A 2A4ZA 3UCRA 2UZIL 2R2CA 3EO9L 4QRRA 4LLWA 5LAXA 3FU3A 3ESOA 4FQXB 5AYQA 3VH8A 5F21B 4YFLI 5GRVK 1C12B 1F1AA 1FWXA 4WI9A 5D2LE 1L9PA 4F7CB 1W6LA 3O6KH 3AS1A 6FABH 4ZUVA 2FEEL 4W9CC 1UWGH 5J3HC 2FEEI 3FL7A 5K1JA 1HX0A 5CBAA 4GG6F 1BXVA 3LSOB 5F7YC 4XX1G 4NLAA 4ZW3A 5CP3H 3ARDA 5I1GH 3DMMC 1OVZA 3VXUD 4R7LA 5J8OA 3LV3A 1ZTXL 3AVEA 2VYRE 5CN1A 3WGVB 2I60H 4D3CL 3UYOD 4APQB 1S7SB 2FO4B 3RKDC 2V5YA 3A3YB 2BWQA 3FW6A 4EMZA 1G1YA 1YMMD 4ES9A 5DJ8B 4GQQA 4OUUA 1VCAA 2ESVD 1D9KD 3C5SB 4I2XA 4KZDH 3W9DA 5CKGA 2F8OA 2H2SD 2VSCA 3RPKA 4Z7NB 5JA8B 2MOGA 2VDNB 4P23D 1G94A 1H5BA 1PW3A 5EU4B 4ZTEA 2GK0B 1XB6A 3IJ8A 3I2CH 4KUCF 3IM1A 4X5LA 1JYWA 3PL6B 3CSFA 4G9DB 2FJGA 3CGTA 1A6VH 5ERWB 3VXOB 2E6QA 1YEKL 1DJYA 4GO8A 2YA0A 1KYFA 4M7KH 1SZNA 3TBWA 5D55A 2PYEB 4LGPB 3H9SB 3OC5A 3MRKA 2GB2A 3IB4A 3OKKB 2GBVA 2MTAA 3IEAA 2YR3A 4L8SB 3RUGA 2X40A 3TEWA 4PVLA 4XVOA 1U3ZA 5F96H 2YD5A 4JZNB 1RIVL 5C0JA 1O6VA 1KPVB 4NFDA 4X9IA 1JHTA 1NAMH 3MUY1 4TXVB 3WLWD 3WS3B 2ATAA 3AS0A 1KXTA 1DHKA 3G5ZB 2K9FB 4KXAA 2NRDA 1XF1A 4EI5D 4MKMA 1S2EA 5T5FL 1H5BC 1HILA 1ZTMA 5ITBL 1N0XL 4BHUI 3L3HB 4S10A 3RX8A 1I7ZB 3BD5A 1RZKC 3VXUE 1NAKL 1FNAA 1TQUA 3GSNL 4L5FH 5EN3A 4L8BB 4F7PA 1BZ9A 2DQIL 4HA1A 4YXHH 1QA9B 5CJXA 1CFMA 4MD0B 3WDJA 4XX5A 4JPQA 3BP7A 1D5IH 4BRVA 4BXVA 3IBEA 1GH7A 3RWFB 3WU1A 1J8KA 1YMME 2B77A 3L2LA 2P7TA 5GS0H 1T22A 2JCCB 2ESVE 4WV1B 5DTFA 5CN3A 5AL0A 2OW7A 1AGEA 3PS6A 4PJCA 4TSAL 1P7KA 4U1SB 2AEPL 3OKDB 4JLRA 4KNSA 1BM7A 3CVHL 4JZJC 1S7XA 1CI3M 5DJXA 3T3ME 3MLSH 3MCKA 1MCQA 5DZOA 1S4IA 4PB9L 3UYRL 3IS0X 5DURD 1BIIB 2GJ6A 1ED3A 1RUQL 2X6CA 3N42F 4PMFA 3WNKA 5DUJA 2YAHA 1MCEA 3PP3H 5HI3C 2L7UA 4PY8I 4HT1H 3RFRA 5LNDA 2BXZA 1EQWA 3LEXA 4YBLB 5I9QB 2IFGA 3SDXE 4Z0BH 2ZSVA 2P45B 2EVGA 2F1EA 2VE6B 3ZYOA 2DF3A 1FZKB 3U0PA 5IHUH 4CMHC 1OGPA 5EBMA 2CLVA 4PB0H 5CJXC 4XBPB 4JMNA 1ZLSH 4K8RD 5DJYB 4DEWA 3ATFA 3CFIC 3KMDA 4Q7DA 1AHWB 2NYZA 4TUOA 1U21A 2PPDA 5D7KD 1XSJA 5D6CA 1NCBL 3SKUD 4QAWA 3O2WL 1QFPA 1Q0YL 3EOYG 4BEIA 2UY6A 5AOMA 3FN3A 1J9SA 4PU2A 5GJTL 5CSZB 2EXYC 3WIIL 1UC6A 3ILPB 4LOVA 3CCHA 3CHOA 4NOBA 1G7JB 2BOLA 3VWKB 3RWJA 1B0RB 32C2A 3T0WA 4CC4C 2ZCHL 1U30A 4HKXB 1IM3B 4GRWH 4YFEA 2DI9A 1MWOA 1B3IA 5DWUL 3IDXL 1CXEA 2OCCB 2AMUA 1CXLA 4Y4FA 2J6EL 4KRPC 3QHTC 1EEQA 3UTSB 4OV5A 1IGML 4OW6A 3L5WB 1R5VA 4BINA 4LBAA 3B3IA 4NDMB 4B9KC 2PPAA 2X1QA 4RWYL 3Q0HA 4Y4HC 2HFEA 4Y88A 4DHLA 1NEUA 3H9ZA 5DSCA 5KJRL 2OMVB 4OFYD 2RQEA 5A2KH 2MQ0A 1P2CB 4UU9B 1RZFH 1T04B 4Z5RA 4LSVL 2XFGB 5L9DH 4F33B 1TITA 2CK0H 1KIRB 3FQRB 3LRLA 2W9LA 2EDYA 3PAZA 2Q0ZX 2H3NB 4LSDA 4HV8A 5I71B 4CN4A 4A63A 5DRNA 1U42A 4KY1H 2NY3D 1LO3L 2R29A 3IFNL 4DN3L 1F6AA 3SPHA 2GUOA 3O3DA 4PWGA 1EHLH 2XG5B 3DROA 1A6UH 1L3NA 1TVBA 2VLLA 4KQ4L 3BVWA 1ID5I 5D7KE 5DEGB 2FL5A 3CMOH 4OQTL 1LEIA 2F53D 4KX7A 5I1AA 3U7WH 1D7DA 5D5ME 2IDUA 3JYCA 1N67A 1RLWA 2OI9C 4LEBA 1R5WA 3QO0B 1BPVA 2R7EA 3NFNB 4ZW6A 1H6UA 2QSCL 4UT6A 4JKLA 3ZE2F 1CLVA 3KW8A 2AK1L 2ADFH 3QDMB 2L7QA 1K8IA 3ARBD 5DJ6A 2A6DB 1JTPA 1H3GA 4ETQA 4X9YA 3I02A 1DCEA 3FQTA 2EIBA 1TDQA 4JFZL 4LPWA 1B9KA 3QR2A 2WLJA 1E9QA 4HIEA 4YLQT 3KWWA 3TCXA 4IDJL 3UEZA 2QVTA 3V55A 4Q6KA 5L4JA 4IMLB 3PQYA 5E4IA 3MMEA 3HUJB 4GXUN 4PM1A 2KLSA 4L1HA 2XWTB 1DFBL 4RMSA 1Q1PA 3KVPA 5EIVA 3UCQA 3OF6A 4JFQB 1EX0A 3TZVC 1YMHA 4BFOA 2KZKA 4OF7A 1XGTA 2XWXA 5C8JA 4XO3A 1W0WA 5T1KA 3GBLA 1DN0A 4YN3A 1CQKA 2BXYA 1YYML 5EDXA 3WN5B 4HK3J 1KBGL 2A3TA 3FMGL 4NAMA 4WGWB 4ZW5A 1UXWA 4OFKA 5AW5B 1IAKB 3FQXB 4I18B 2NY1C 3IFOA 5D4QA 1GCFA 4B60A 2BS8A 3IDMA 2IAMD 4XO9A 3EO0A 3PABA 2BVYA 3MGOA 3W37A 2Q10A 4DKTA 4JANB 2P8LB 4NN7C 1WCQA 2VLKD 5AZEL 1IKNA 5LCVH 1RERA 4QRFA 4XMKH 2MNJB 4Y89A 5DD5H 5E51A 2OXGA 5LDUA 1IL1A 3LS5L 5I1CH 2VJ8A 1YN7B 3P0VL 1O7DC 3DV6B 2F53E 5E8PB 5AB9A 6PCYA 1EEYA 1KENL 1KIPA 2HKHH 3QPQC 3IXTA 2VJXA 3BLPX 3BT2H 4UUJB 1JZJA 4BCXA 5KS9B 5B8CB 1FA4A 3O2DL 4KJWC 2JQMA 5F3HB 3V0WH 5IIEA 4Q4EA 2XN9D 4JY6B 3ZTJG 2OSYA 4YGVA 1OSPH 2EECA 3HN5A 2ZP8A 3MLYL 1JWSB 5HGHA 5D2LF 2WYTA 2I07B 3VWJB 1I1AD 2VMEA 3W2DL 1PD6A 3QIBB 4QXUH 4K5LA 4LAQH 1E8XA 3WV0A 2X88A 3GLZA 5C3IA 2VRQA 3MJ7B 2QGBA 2O5NA 2LR4A 1ID2A 3APCA 5CCJA 1FUNA 1IBBA 1KFAH 2BOBB 2LU4A 1UKSA 1IKNC 1E9PB 2BVPA 2DKMA 4TVPL 3ZHKA 3VX0A 4OFIA 5F44A 3BZEB 3ATAA 3MJ9H 1DJIA 1A4CA 1LO2L 1TJIL 1NCOA 3QUXD 1F4XL 2DIEA 3Q2VA 3RIFK 1MNUL 4MNGA 5D7JB 5T8IA 4BFKA 4ODSH 2ZG1A 5L4FA 1WZ1H 5BO1L 1KSRA 3WNLA 3ATBA 3QIWC 1FAIH 1TEFA 5ITFA 2SODB 1NGXA 3OLEA 4ZNEE 4DN4L 2RTTA 3GQFA 4XN7A 1ZAGA 3AITA 2EO9A 5GHWH 3KYNB 5F3BB 5ICXB 1OP5K 1MLBB 2OR7A 2VDPH 3MRGB 2YPLD 4ONHA 4PGBA 1X5ZA 3C60A 2VLKE 4TPRL 2EH8L 1QYGH 3L9BA 1QNZH 3U79A 2X4SA 2NYKA 3LEYH 4LVOC 2VDRL 2NX5B 5JA9A 4LZKA 3V6OA 3H8NA 1LP9F 3S88L 1IFHL 3D06A 1F11A 4TV3A 2OK0H 5C0AB 3LKPB 3RTQA 4P57A 1J5HA 2K45A 5GRUH 2ATPB 2BMKB 4R4FH 3F7QA 3VGFA 2XN9E 3D2UA 1X9UA 3S34L 4UM9B 1DEEB 4YE4L 2F19H 3A4DA 4XMLL 4M7ZC 3NIGB 5JNYA 4AE1A 2AAVA 3PWUB 3SKOB 4L2YA 2R2EA 4UTAA 4KNTA 2AKRA 3WKML 3D85D 3W56A 5I1EL 2CQVA 3K46A 2EDQA 2EZ0D 2IPTL 1WUNT 2BVOA 2BP8A 3C60C 3HVNA 3TBSA 1UWFA 1RURL 5E2TL 2VDOB 3MRJA 4G42B 1U0QA 1E9OA 3RVUC 5TE4L 1DEDA 5EU5A 1YEEL 3KG5A 1FO0B 4U49A 3V6OC 5SX5H 4M7LT 5AVQB 1UM6H 2IEPA 5DUML 3U6RA 5KAQF 3FO1A 2F5BH 3M8OL 1ZLUK 3QFGA 2G2RA 3RTQC 3CXDL 2AC0A 1F3JB 2GFBA 5AZ2L 5MEQB 5EZJB 4Z7QB 2E8ZA 3BKMH 3DUUB 3ZDXB 4AIZA 4KK8D 5JIIA 5INCB 3QNXB 2B0SH 4MA8L 3K80A 4Y8DC 1A6AB 2ARJQ 3G6JE 1LK2B 4RQQA 2YPLE 1MH5A 4IOIA 1VFBB 2O6EA 4OLXH 3QFJA 3PJLA 2AK4D 4BGDA 3CDCA 4ONGH 4XGZA 1NPJA 3HA0A 4OFPA 1NGPL 4BELD 4M29A 4ZMAT 4RFEA 4J1UA 2WWNA 2W38A 3W11D 1KZYA 3I3BA 3IN2A 1YQVH 1JGEB 4ZAKD 3PWVA 3SDXF 4ELDA 2IDFA 3OR7A 3HHSB 5HHXH 5IB2B 3U46B 3KXFA 3HC2A 1RZ8A 1WPCA 3TNMA 4EIZC 4JVUA 4MJ6A 1KB9K 5EUOE 1LE9B 2FJFA 5HYQB 4LLQA 1Q4NX 3QQ9C 2J1XA 5I8KL 2HVKA 4KX8A 3K8KA 2NY4B 1BVZA 2DM3A 3HZVB 2ZOWA 3UJIH 1FPTH 5TPWL 5GGTA 1MCOH 1Y0LB 2E8YA 2F54B 2A7BA 4JRLA 1M7IA 1HHKB 4P9MH 3UZEA 1GYUA 1JTTA 3FPYA 4RNRB 4BSVA 2XVGA 4FP8L 2AV1B 4PUBL 1G9NH 5E4EB 4LCVA 1XFPA 1L0YA 1XTLA 3T2NH 3DV4A 2K4WA 3EJYD 5D2LA 1YN6A 2F1BA 3X1EA 4X4YB 3GSVB 4QHNB 3VFOB 3TPUB 1LWJA 4YSUA 4PI2A 5BMFL 3UH8A 5HHPB 3HS0B 3ILQD 4KKZA 3UBHA 3FU7B 3DHJA 2E74C 1MHHA 4UIKL 3BVNB 5HYJA 1SBSH 1DBBH 5C70A 3CWGA 1Z5HA 3LXUX 3TYGH 4QF1A 3NEOA 5BS0B 1YNLL 1JI1A 1NWOA 2H3XC 4OCRL 1INEH 4Q4IA 3OJDB 3DBSA 1JCVA 3UO1H 1Z5LA 3Q7JA 3QI9B 4AC4A 2I69A 3QR1A 5SV3A 2A99A 5B1JA 1N2RB 2AK4E 2X9YA 3KBPA 1J1OL 1FYTA 3A5VA 4PI0A 5IEHB 1R5IB 4AKPA 3GK8H 4PJDB 3Q01A 2PR4L 2VW7A 3WE6B 3N40F 2J6WA 1BEYH 3J2PA 2PETA 2GJZB 4NJAL 5I1HH 2ZE0A 4JB9L 1YVLA 1T1ZB 2X3CA 3BAEH 4P4RB 5D7IE 4M62L 2IAND 2QADD 3C75A 4WU7B 3RVVD 4OZIA 4AK2A 2VNCA 2OMXA 4XC1L 4YLCA 2OSLA 4NX0A 1AE6H 3P3TA 1OPGL 3QXDA 1IEBA 3GJFK 1J7VR 5CSGA 3B43A 1JL8A 4EEEA 1KZQA 4I13B 3DSFL 3G08A 2PTTB 1IC4L 4O51B 1AS8A 1I82A 4HH9A 3FT3A 1RJYA 3WY2A 5B1JC 3TWCL 3A6OA 5T1LD 5LBSL 3VFWA 3D0LB 1IIIA 3QO1B 5HHVH 4FMFA 3V0VB 3KCPA 2WV3A 1ZDSA 2XXCB 2HFGL 3II3A 2J4WH 3QUZC 3FCSA 3LN4A 5E94A 2ICCA 4GW4B 4PN6A 5K9KA 2X6BA 1WAAA 2YXVA 5EU3B 4JM4H 1ADWA 3U7YL 4JG0H 1HI6B 1BAFH 5D1XA 1XGQB 3LNDA 4MX7B 1CBJA 3VD4A 3QJRB 4RZCB 1I9RH 3BP4B 2FQDA 3P02A 4WFHD 2AJYL 4FQCH 4OD2A 4PWJA 1A1OA 3BZFB 1VRSA 4G80A 1OO2A 4K3JL 3TO4A 4EIUA 2E9JA 2DQJL 1E3ZA 1RJLA 2BSRA 5CO1A 4Z78B 3G5XB 5K69A 3APDA 1G87A 2GJRA 1FCGA 1CF8L 3DRTB 3TC9A 1P4BL 1QRKA 1MCNA 1D9KA 1JNLH 2AQQA 2QPUA 5JOEA 4P23A 1R3IH 3UIYA 1L5GA 1QWNA 2VDNL 3QULB 2VITA 1DQTA 2IANE 5D4HA 2OYMA 4FZ8H 3OAUL 4OLUH 5FM8A 5A2FA 5L8KB 3RAJL 3VMNA 1FLTX 4QJ5B 4Q56A 2LABA 5C0CD 4XCYA 1RXLA 5I0WA 3T65A 3IDUA 2VOTA 4G43B 3FO0H 4KRMB 3SDXA 3X12B 2VR4A 1QHPA 2YQGA 1L9NA 4JZOA 1KTJA 2Y7NA 1BX2B 2DB8A 4IRSA 5ACZA 5HYSG 2A6IA 2OMWB 1N6QH 4P2RD 2BSED 1TZIA 2D0FA 1ND0A 5AYTA 3LH2H 3D09A 4XCFH 4J3OH 3N91A 5KVMC 4LVEA 3ABZA 1D9KC 1L7TH 1WAEA 1V7NH 3PGDB 3QHFL 4P46D 3X11A 3DPBB 3DTXA 2H2SC 4JJHA 4ZFFB 3DIFA 2A6JB 3GMQA 4P23C 2XICA 2VZ3A 2WHVA 4JVWA 1MKFA 5C0IB 1D5ZA 4U05A 4YE0A 3V0FA 2JH2A 3LPFA 5IB4A 4JM0A 3BFOA 1HHJB 1YEHL 5FYJH 4C4KO 4XAWH 2D3JA 2Z7UA 4RSVA 1V3LA 2Z4TA 4JDEB 3VXSD 3H7BB 2DL9A 2XV0A 3DURB 5GSVB 4WFHE 1UXSA 1LO5B 3NCCB 4WNJA 2J12B 5G55A 1AGCA 1WH0A 4XMXA 1MF2L 3STLB 2OTUB 1WFUA 1WQVT 1XF2B 3QUYB 1HE7A 4OI9A 3EFOA 5DC0A 5HYEA 2CJUH 4NZTL 3ARWA 5F7HA 5DQ9B 2VXVH 3BDXA 4M8VA 5C09B 1NCGA 5DK3A 1ETZA 1GGBL 1B6UA 1MCKA 3RWHB 4V2BA 3WLWC 4JY4A 3C6SB 4H2AA 1U3HA 3MNDA 4MAYB 4RBPK 3EDKA 1RI8A 3KPSE 5AOIA 1SQMA 5HTSA 4EI5C 3RDTB 2NY6D 1BZ7A 5HYSA 4I0CC 5JW4Q 1BVKB 2W88A 3D07A 2IFFH 2NW3A 4HJGA 1KFGA 1DUYA 5C0CE 4H0HB 3ESPA 3BD4A 2QHRL 3IU3A 4NN6B 1KBWA 1HTYA 4X8CA 3MXWH 3NTCL 3NA9L 2Z92B 3WIHL 2BY2A 3GMLA 4BK4A 4DEPB 3NOIA 2WUCL 2NZ9D 4QXTB 2MHAA 3BUYB 3F7VB 4NZFA 4P2RE 4YUEH 1PSKL 3U36A 1S78D 1UKQA 4MNQB 3R8BB 4HX1B 3OTTA 2ITCA 3KPOA 3FTZA 4NKOB 4NOFA 5IVZA 4WWNA 3DIVA 4JFYA 5D5MA 3P0YL 4Y9BA 4GXVL 4DPAX 4NGHH 2Y24A 4PV1C 4U1NA 1OV8A 2DKSA 4X2UA 3FTWA 2DH2A 2VL4A 2G4EA 3DDGA 3GJFB 3IBOA 3VXMB 2BSDA 4QYOA 5IEKA 4XN2A 2DQFB 1YNKL 3VXSE 1J5OH 3CVCA 3FB7B 4H0GA 3JWNE 4XMPH 3O3AA 4PW4A 4U1MB 1JZ4A 5CLZA 5ESAB 1AXSA 1ZS2A 2IJ0C 5B39G 3X3FL 1WDAA 4HEME 1KNOA 1SJXA 5GRVL 2XWBA 5E8OB 5JYLA 4E0RA 4XTRD 1CG9A 4K8RC 1JVLA 1NMBH 4OFYA 3ARGD 2XUWA 3G6JF 3LZFL 3O3UN 5CEYB 4L9LA 4XBGB 4HCIA 4E5XB 4BE5A 1B0GB 1HAWA 1T20B 2E46A 3U1SH 1WC7A 4M8UA 3BSHA 3K72B 4HGMA 4MZRA 4L3CB 4PJ6A 1CTOA 4BD4A 4A2DA 3PNWA 5DGQA 5L4IA 2Y9RT 4H8HA 2DM4A 3DVGB 1KTDA 3WJLC 3L95A 4BHUA 1CFNA 1QSFD 3PV6A 1A5FL 2D3VA 3CUPA 1PKOA 4AIOA 3H6JA 3FKUS 5JW3L 2Z4QA 2BDNL 2B8OT 3QDGD 5F88A 5EUOF 2V4LA 3E6HA 2E59A 2M1KA 4ORZC 4HG4J 5KZCB 5FKPA 3CIAA 3WEMA 3B37A 3T1FA 1U8IB 3FQNB 1FFOA 5GSRB 1NCAL 4ZPVB 5JMOC 1DBAL 4NQTA 1TJGL 5KVFL 1HSBB 1CT8B 4JL1A 5I1KL 1P4IL 3BAIA 4NT6B 4NN5C 4BA8A 4YNYB 4QHKI 5TGBB 2J20A 4ZYKA 2CD0A 5B39A 5C0EA 5SX4I 1AP2B 1MCPH 3NABL 3ARBA 2ZAGA 5EN2B 1YA5A 5FM5M 1KY6A 2ZX8A 5EOCH 1QFWM 2LVCA 4GKZB 5DLLA 2V9UA 5LN4A 5SWZB 1AI1L 4XPGH 1WD9A 2XTSA 4MXVE 5E1IA 2VLMD 4HHWA 2J44A 2NY3C 3CQQA 4KY2A 1FORH 3HAEH 4HC1H 4ODWA 1DTUA 2E76C 1FGNH 3LD8B 1QX1A 1WRFA 4ZODA 1SOXA 4OU3A 1OM3H 2ZYHA 4Y1TA 2MCPL 3JV4B 4LHUD 4O00A 5D6DA 1JVKA 3L1OL 4GRLD 4MQSB 3JWOH 1YEJL 1RD6A 2HPOA 4U3SA 4QO1B 2VZSA 1S9YA 4LRNL 4M4RB 4PGJA 1DL7L 5FO9B 3IRZA 4OKDA 1D5XB 3FTYA 3VRIA 1A02N 1Z7JA 2YD9A 1Y1DA 5CCKL 4ZNEA 3ARBC 1FSKC 1NCCH 2YC1B 1OARH 3X3GL 3IFPB 4WO4D 3WFEL 2EVFA 1QSFE 1S5IL 2X53A 4H1LG 5D7IF 4M5ZH 5AW9B 3IJEB 3MRQA 3KPMB 4CMMB 4FQIL 3RNKB 3QDGE 2AITA 3F58H 3LKRB 2CUHA 1A6ZB 3SO3B 3L4UA 1E0OB 1XO8A 3NCEB 4LPVA 2BRQA 2HPTA 2OQJA 4YSDA 5DK2B 3ZL4L 1ZGLB 3BVVA 3O6LH 1BEXA 4G2AA 4ANVA 4DW2H 1UOWA 3ZR6A 2EYSB 1A6WL 3AM8A 4I1NB 3LRGA 5C2BL 2XN9A 3LHPH 3FB8A 3SPJA 4JFSA 4JFFB 1DQQA 5KVGE 1I1AA 1T7ZA 4NCC2 4P4KB 2DBLH 3HRZC 4OBSA 1EAPA 4GEJA 3X1FA 1BREA 3I50H 5KBDA 2VLME 2DMHA 4HQQL 4ONFH 5IR1A 3T1WA 2IAMC 2Y5EA 4MAUH 3CZLA 2HJKA 3AREB 4Y2DB 3ZTNH 4F3FB 1S7QA 1ETJA 4G6AD 1QBML 5TE7L 3D69A 3KYKH 1PX8A 4Q97A 4U1HA 4FKHA 1N70A 2VO8A 3NGBC 1W91A 4OB5H 4MZIA 1GZQA 1R3JB 4JN1H 3TGXA 3I9PA 1AZNA 3BAXA 4QHLA 1IBYA 4H1LA 4KI5F 3V6BR 3AM8C 4QI3A 2COQA 4XRCA 1U33A 3FUJA 2VDMH 4PJIE 5AB0A 1J1XH 1SLUA 4BBWA 3UO8B 1ET7A 2GJPA 4TSBH 4XN4A 3V6FB 5IHBA 4JPKL 4HLJA 2CBPA 1I1AC 4HJTA 3G6JA 4K7PH 1AQ8A 3LPOA 4NYLA 1JP5A 4HMEA 3MRIB 2YPLA 4A2MA 5JPNA 4JHAH 1HWHB 1IC0A 4HSCX 4LGRB 3VO0A 5CM1A 3UZQA 5FHBH 3VB8A 1EHAA 4N2LA 3VFRB 4DTGL 4HCRA 2B5IB 5EH1A 5I74C 4X6DE 4X0KA 3IDNA 3QUXC 5A40E 1OP3K 1Q9LB 1XH3A 5ADOH 5DT1H 1W8NA 2V9RA 1RU9H 5CWSA 1THAA 2FQGA 3I6GB 4QEGA 4HU8A 2FBJH 5E24E 1IZJA 1U8NB 4OIIH 4Z95L 5LAPA 5EUOA 5L7XL 1ZD6A 2UX7A 1HNGA 2NTFA 2EXSA 1YQ2A 3L4TA 5EEWA 2ZX5A 4F7MA 5EZIH 1MOEA 1EEZB 2RBLA 2Y1AA 3D85A 1UCBL 3T3PB 5I6KA 1KMGA 5JPNC 3BH9A 1WBXB 4M8QB 1D5BA 2DJSA 1WLHA 2X09A 2YK1L 4DF9A 1JRHL 4M6NL 4OZFB 4NO5B 5E6YA 3APFA 1JRHI 5ID0B 3F6LA 2FLMA 2WKOF 4IIQA 1RHFA 5GS2D 4M43H 3T6QC 3TH3T 2BIOA 1H3PL 3KCWA 3KVDD 4YC2B 5IY5B 1FO0L 1HSAA 2W94A 3LQZA 3B9KD 4XHJD 3LNEA 1AFVH 1F58H 1NWPA 2HAZA 5K9OA 1KBVA 1J10A 4TUJB 4Z7VB 2MQGA 5E1AB 3RZCA 2H45A 4YK4B 3KPLB 5E8NA 2CO7A 5E9NA 5ALCH 1F4WL 3O2DA 3DNKA 4OF5A 5I6MA 1TG8A 4GSUA 3SYPA 5JHAA 2W0KA 3H9HA 1QR1A 3TCTA 4N25A 5CAYB 3H42H 4EN2A 4XXWA 3UGUA 1DJWA 1XB3A 1CWVA 3CAFA 5MEPA 4YXKH 1FIGL 3VCLB 1K4CA 4NO0D 2EZ0C 4ZUUA 1MHCB 3GFUA 1EAQA 2VDQL 4Z7UE 4M93C 4KROD 1S7UA 4TSCH 2GIXA 4ZAKA 5KBNC 4M1DH 3O41A 1RIUL 2BVUA 3Q8AA 4IIQC 2X42A 1SJEB 3UYPA 3TM6A 3SYOA 5TF1L 1ICTA 2XFXA 5D7IA 1SMOA 4XVTL 2CZNA 1TJXA 1MVUB 2DYPD 3HJ0A 1MVYA 3NP4A 3OG4B 4FLSA 4YZFE 3SKJH 4HAGA 1YY8B 2R69A 1TJHH 1UB6B 1M05A 1OAJA 1UT9A 5FUZH 2Y3NA 4KK8C 1LDSA 3ALWA 4P5SA 2F7QA 2Q3ZA 3ARPA 5T3ZD 1A7PL 1CUOA 2GCYA 1G7PB 2WTPA 3K2KA 5IBTH 4OLZH 1KYUA 2WWKO 2Q86B 3IFLH 4XXWC 3IKCB 4XPFH 1JN6B 4G8GD 5IFHL 3CDGA 4BDVA 4HLZH 4A2EA 1CGSL 1WS7A 3F04A 5J12C 1XQ4A 5AVXB 1B3JA 3ROOB 2G9KA 1NC4A 3W11C 2VTFA 4ZAKC 4PRNA 4BZ1L 2JF1A 3EBGA 4MA3A 4A6YH 1E4KA 1WEJH 1R6VA 3VFGL 1M3IA 1PBYA 4XC3L 3C08L 3LQMA 4RFOH 3BIKA 4U1IA 3VTTA 4LL9A 1CGVA 3FFOA 2O93L 2BSTB 2CO6A 1T4KA 3FT4A 5SWSB 1Q9WA 5HY9B 2VZOA 4NHUA 5HGBB 2FZ3A 3R1GL 3GUTB 5IKCB 1XZ0B 5F7WC 1G7MB 2QKIA 2X4NB 4ZZFA 1T21A 3VI3A 3V8OA 4R90L 2XQYK 1MAJA 4KQ3H 5GISL 2OJZL 5I66A 3BUIA 4A37A 3EJYC 5EU7E 2GIMA 3V4VA 3MFGB 1OAUL 4PJFF 1FNSH 3HLAA 2PO6D 1FG2B 3ILQC 2IANA 4QRTB 4PBDA 2J72A 3V2AR 1KEMH 1ZLVK 4W1TA 3DX7B 3VYNA 1MAML 1BBDL 1CIUA 1XBDA 2DYRB 2ID5A 4JRYD 4IKJA 4EKXA 3FQWB 1F5WA 5T3ZE 3OAWA 1VPOL 1NSNL 1ZLWH 2HXAA 2QLVB 1HHHA 2WNWA 2AXFA 3VD1A 1FZMB 4OZGA 2VXQH 4G8GE 3HC0B 4LDCA 4UT6H 1U6AL 3BFWA 1RJZB 3I3EA 5FUOL 3PWLA 4EVNA 3ELQA 5FFLA 1MN4A 5EZPA 3BQUB 4HF5H 5C0GA 3QARA 5I6XB 1FH2A 2XQ0A 3D87B 3L81A 4MXVF 3C6LA 1KGYE 2XCMC 2G5UA 2AJ3A 3S37L 3EYVB 1XL4A 3MROA 1MFAH 2NW2B 2GTWB 2BCKA 2W0FB 4GRWB 2EYRB 2VL5A 1QSEB 3DETD 2QADC 4G3YH 3RVVC 1DE4B 3IPBA 5HHOA 2ED8A 1J12A 2R59A 4WTXA 2E7HA 1VACA 2WKOA 3L1GA 3NIDF 3IPEA 3WIFB 3RL1B 3X14A 1KT2A 3G9AB 1L9SA 5EC1A 3PGCB 2HKAA 2WAHA 2AXJA 4CC0A 5BQ7A 1ZGLM 4FFWD 5I1LB 4K71B 1XR8A 3B6SB 3G5YA 4P3WA 3D9AH 4GKLA 3KNBA 1G7LA 3ROLB 2Q3AA 3ZK0A 4PSPA 1AG6A 3JWNG 1TQCB 5CGBA 1HOCB 3DSNB 3MFFA 3VM5A 3AXLA 5FYKD 5L88H 5BRZA 1VZHA 5FGCE 5ETUB 1PGRB 5KYUA 1MEXL 4TNVF 3WHE0 3KPQB 2VC2B 3V6ZA 5JUEL 1SF5A 3MNVA 4DSYA 2VQ1A 3D3VA 5C0CA 4AMKL 4JRYE 3KHQA 3F00A 4HWBL 1RUAL 4KKPA 5I8CB 3HS8A 4YH6A 4NKDA 2WWMD 2VO5A 4EI6A 3VG9C 3ECVA 2GK2A 2EJ1A 1YZZA 3K6FA 4N0UE 4J6IA 1IGIL 4UT9A 2JKRM 4O02H 1I4FA 2MEJB 3DLQR 4D0DA 3RY6A 1ZA6B 3GSXB 4F2MB 1BGXH 5J4MA 3V0IA 4O2EA 1JZIA 3DXAD 3FRUB 5L2KD 1NBVH 2B3RA 2JB5L 4P46A 5SX5K 5DZNA 3V5KB 3WEXA 1ADQL 4CNIB 2IOOA 1XMWA 4OTXL 3EYUH 3FFCA 3U4EA 1E4XL 4RAUB 3X13B 3NJHA 3P9LB 4D7BA 3O3EA 1INDL 4XPHL 1E4XI 1VAHA 2D0GA 3MHZA 4N6QA 1TTAA 3KYMB 3EO1A 4WW1A 1HYRC 2AJZB 3B1TA 4YHPB 4G8FB 3PHQA 5F1OB 1EFXD 3CXHK 4HALA 2DDQH 3HC3H 1CDBA 1O5PA 1MELA 1F90H 2W07B 1MY7A 3LIZH 5D72H 1ZSHA 5EB9A 3BWUC 3V0GA 1UM4H 4XN1A 4AUYA 4EDWH 4ZTOH 2ZXCA 1B0IA 3FCGA 4HEMA 3THML 5AENA 3R7RA 4HUWA 4PJIF 4WCYL 3CVIL 2EDNA 1GYCA 3MLZL 3BGAA 3EXJA 2ZUVA 2F8VA 2JKNA 4K7FA 3E0GA 3QJUB 4UDTB 1DQDL 5BRQA 5BV7H 3H3PL 3LOWA 3L4VA 5FYKE 2F7RA 4P46C 2DJ4A 5LBSA 1QPPA 2Y1ZA 2X28A 3F7LA 1EGJH 4OCYL 4GAGL 2ZG3A 1WZLA 2FB4H 4FQ1L 4U4IA 1W15A 2NY5L 1XAKA 4FQQB 5BW7C 5LLIC 2N7SA 4X6DF 1HCYA 1RSFA 2NUTA 3O2VL 5IBUG 5EF0A 4XP4L 5LDSA 4UMSA 3QRGH 2X2HA 2ENQA 3JWNC 3ZTEA 4QUOA 4Q6YA 4DGUA 4LDLB 4UZUA 4N2FA 2PPCA 3CC5B 4HULB 3QNZB 4U2YA 5KWYC 2ZONA 3B2XA 5DVMA 3TVMD 3UEQA 4F57H 5EPMA 3A6BL 3V7MA 3MRRA 5L2KE 3DXAE 1DLHB 2VABB 3C8DA 4DP9X 5D9SB 2WLIB 2H0JA 4NNXA 2SEBA 2Q76B 2DQTL 1GW6A 5GIRA 3ZZQA 5BZWB 4A7UA 2DQGL 1S7SA 4CGTA 2ERJC 1NPUA 3F7KA 2NY6C 2C9VA 4BH8A 3FAXA 2XN1A 4C8XA 5EU4A 5IQMA