4GSXA

High resolution structure of dengue virus serotype 1 se containing stem
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
402
structure length
390
Chain Sequence
RCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEVTNPAVLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDTNFVCRRTFVDRGHGNGCGLFGKGSLITCAKFKCVTKLEGKIVQYENLKYSVIVTVHTGGTIATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNEMVLLTMEKKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLVTFKTAHAKKQEVVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKLTLKGMSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGKMFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a dengue virus envelope protein late-stage fusion intermediate.
pubmed doi rcsb
source organism Dengue virus 1
molecule tags Viral protein
molecule keywords Envelope protein E
total genus 67
structure length 390
sequence length 402
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gsxA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4gsxA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4gsxA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4gsxA03
2JV6A 4UTCA 3N44F 3UC0A 2I69A 1URZA 5LBVA 1SVBA 4L5FE 5GZNA 5KVFE 5JHMA 5IREA 2ALAA 3I50E 1Z66A 3N42F 4UT6A 1UZGA 3C5XA 5JHLA 1OANA 4GSXA 5AAMC 4ALAC 3N40F 1RERA 3G7TA 3N43F 3N41F 4AL8C 4X42A 4UTBA 2R69A 3J2PA 1Z3RA 2HG0A 3UAJA 1OK8A 2JQMA 4FG0A 4BZ2A 2JSFA 3P54A 5LCVA 5KVGE 3MUUA 1S6NA 1OKEA 4FFZA 3UZEC 5KVDE 2GG1A 4UTAA 5H37A 3IRCA 3C6EA 2V33A 1PJWA 4GT0A 3UYPB 3VTTA 4UT9A 3J27A 5B1CA 5AAWC 4AM0Q 3WE1A 2P5PA 3UZQB 2R29A 1ZTXE 4FFYA 4BZ1A 5KVEE 1TG8A 3UZVA 5LBSA 2H0PA 5GZOA 5IZ7A
chains in the Genus database with same CATH superfamily
1PU0A 5AOZA 5D8JL 1Z9LA 3QO1A 5L88H 3QXTA 4MSWA 3VE0B 3UOAB 5PCYA 2F5BH 2VDKH 4GRLC 4YZFF 2VLKB 2WVVB 3L4YA 2FX8H 4G3YH 3WUWG 4HSQA 1YYMH 3HZMA 4H0HB 3CZKA 2X28A 3RA7H 3FRPB 3AZUA 3CVDA 2QFPA 5FHBH 4NC2B 1HH9A 1LE9A 2JKJA 4YFEA 3OPUA 2DB8A 4XBPB 3VXPB 1SXAA 1NLDH 3QDMB 5JQ6L 3UTOA 2WB1A 4NJ9L 2ZUTA 4CKVX 1RURH 4NXKA 1GC1H 2AJSH 1A47A 3ZL4H 3ZIYA 3N3EA 4GI6A 4AJVA 3WKNA 4A2EA 1X6LA 4S0TD 4NQDE 4GKZB 1TMCB 4YX2L 4F7MA 1BQHG 4XT1C 2XU9A 4O2FA 1K4CA 5CCJA 1DQJB 2CALA 3FCSA 3HA0A 5BPPA 4JPKH 3TA3C 3DIFA 1IEHA 1I7TA 2UZIL 5D96C 2LTQC 1W72A 1Y6MR 4LGRB 4FZEL 3PXJA 2X6VA 3DX7B 2E47A 2V5YA 2GHZA 3LB6C 2L7EA 2UWEE 4YSAA 4K3DH 3VMOA 1RZJH 4QGYA 1E4KA 3RILA 4POZC 3LQZB 4F9LC 1ITCA 4IRJC 1NQBA 2R9HD 4JG1H 3VFMA 1CYGA 3C5ZB 4FCAA 5A7EA 5T3ZH 3K4AA 3O3UN 3K4DA 3QYCA 3C2AH 3Q5YA 4IK6A 1DN0B 3IDMB 3V0VB 4YHIB 3LMJH 3ZKQD 1JN6A 2O6DA 3KL0A 1EVTC 5I1GL 4YAQA 5DJ8B 4NPYB 4R90H 3IXAB 3B9EA 2ZWZA 3UBFA 1A9EA 4XMLH 3ECBB 5FUZH 2YQ2A 1JI1A 3DVIA 2XTLA 3KYKH 2CJUL 3FN3A 43CAA 5MEND 1EEYB 5BW7A 2WZ5A 1E4JA 2VLLB 4NQSA 5AQ0A 2OCCB 4LMQE 4OZGE 4ZS7H 1BSIA 1THAA 3C2SA 1UXWB 4NO0D 5T1KB 4DW2L 2X4TA 3R0NA 4ZFZA 4EF3A 3GBEA 4FQ1H 1AZVA 1D6EB 4QO1B 3X11B 5EPMB 4DFHA 5C7ZA 3EO9H 5DHYB 3LEXA 4PJCE 2I7OA 2R0LH 4YPJA 5IT2H 4O5LL 1OLZA 2ZAHA 2O5XH 4HIIB 5HJ3A 3MZGB 3X17A 4OY9A 4XZUB 4FCHA 3S3JA 2W9LA 3QORA 1E7UA 1GS8A 2JLPA 1CWVA 1FL3B 3W9DB 3DURB 3HC4H 1ACYL 3OMZA 1CFVL 3EOAB 4UINL 3RHWK 43C9B 1C7TA 4ZDHB 2NZ9D 1D7BA 2H26B 5CILL 3BO8A 1AKJB 4D7BA 3HC0B 2VE6B 3AACA 4JJHA 5TTRA 3RDTD 4K73A 4B6ZA 3T0XA 3CVHA 4R4NC 1R5WB 1T0NB 2HVKB 4U33A 5I74C 3LEVL 1KTLB 3TN0D 3ZKNC 3P02A 2ID5A 3PG2A 3I84A 3F7YA 5LLIC 1A5FL 3BVNA 3QZLA 3SZKC 3P3YA 3OKMA 2F0CA 1OAKL 3H6JA 3WS6C 4AIXA 1AO7B 4XAKD 4F8QA 1ZDQA 2JQZA 2IDTA 3MXWL 3FUMA 3HPLA 2JCCB 3P4MB 1QA9A 4FTDA 3TO4D 1UATA 1DVFC 3NP3A 4BM7A 1BVZA 5D5ME 3BT2L 4LLUB 4JQIA 4MDJA 2ZKWA 1FFPA 3S5YA 1RJYB 4HKZA 2ATKB 1J0IA 1BJ1H 2NNFA 1F2XK 3T65A 3AWGA 2C9UA 1AZZC 4XMZA 4BWWA 5DQDL 3WKPA 4DSYA 4PMEA 5HI5D 5E99H 5DC0A 3OAWA 2ENJA 2IOOA 2PR4H 4L8SA 1OAZL 2XACC 3APDA 2JKRM 4QRRE 1QBML 1OAUL 3ROOA 4PG2C 2G2RA 3TH4T 4AMWA 1BF2A 3LVTA 5B1JA 4RWYL 2CD0A 3BEVA 4H1LH 4NUMA 3LDBC 1XL4A 5CEXA 5T1DL 4HBQA 1F4XH 1MRCH 1LO3L 3OZ9L 1A6WH 1YMHB 4G70B 1LVEA 2BS71 1A7OH 5D1XB 3UTTD 3BJ91 3E9UA 1FO0B 4KKRA 4P3CL 5IBTH 5L2JB 1F6LL 3WTUA 1IQDB 1YLBB 4A2HA 1R17A 3GZOA 4UOW1 2NCMA 5GZNA 4GP4B 3RPIB 4GW4A 3ZHFA 1V3MA 2DJ4A 1RQ5A 4K8RC 1O75A 2YEQA 1RUQL 4FP8L 2VXVH 3TBYA 4ZQKA 2J1XA 2NY6B 1PZ5B 3FULA 2N0KA 4JDZA 3MJGX 1U2YA 1HESA 3B1UA 3B43A 1YEHL 1JE6A 1YN7B 4DK5A 5CBEA 4RIRA 1GH7A 5F9WB 4ZODA 5DHVA 2YAPA 3HC3L 4MAUH 2W5PA 1QQDA 3OF6A 4CW1A 4ZX3A 4YFLF 1YEDB 4KUCF 3ZKND 4XC1L 1EJFA 5JPNC 5DHXB 2PWFA 3E9TA 3GIVA 3V4UH 1TU2A 1KFGA 4PJEB 4KAQH 4AEHL 1T0PB 1LMIA 4HMDA 2LQRA 1M6OA 1MXGA 2AJYL 4JL1A 5AVTB 1OAQH 4LU5L 3B7TA 1FDLL 4S1QH 4AXWB 3EYUL 2RFXA 5DJZA 1IC0A 3F7VA 1DVFD 1L3WA 2PW1A 2PXYB 2BHZA 1GL4B 4W9HC 4AEEA 3E1ZA 3WLBB 4NRZA 3SBRA 4XNMA 2B3RA 3N41F 1Q0YL 4AGPA 1OP5H 1KCSH 1TR7A 2Y7MA 4LFHD 2EDMA 2JJTA 2MQ3A 3WHE0 2XTJC 4OCNC 3U82B 4V1DA 1AS7A 2WN3A 3MV7D 3WD5H 1UCBH 4PRHD 4YDKL 2P80D 2IAMB 4JUTA 4Q9QH 2WO2B 3OKNB 3F8UB 3GZPA 4YFDB 3TBCA 1MI5E 1NAMA 2APVA 4TUOB 3BDXA 4W6XB 4XTRC 3P3TA 4UNUA 3BZ5A 2ZD0A 4MJHA 2A9BA 2BP5M 1WP6A 1IBYA 2QKIB 3DMMA 2OQJB 5EU5B 4KNTA 5HTSA 3AB0B 2PUQT 3D69A 4IS6B 3W11D 1I75A 1KTCA 1SOQA 4G7YH 4LSTH 3IMTA 4TVPE 2OL3B 4HJJH 1S7XA 4HFWA 4BFBD 4LDEB 2ATAA 3T0WA 4RX4D 1KB9J 4JCWA 2CIKA 5I6OA 3BKYL 5CN3A 3IGKA 5D1XD 5I6XC 3VWJB 3K72A 3TWYA 3RWDB 4KKZA 4PIRF 1QLRB 2VW4A 1E5ZA 1Q1JL 4L4TD 1C7SA 5EEXA 3QH3B 1SHSA 4CN4A 4YHYC 2FRGP 4S0SD 4WW2B 4PJDB 3U1QA 2BY3A 5IHZB 5CU5A 3ARBA 1YEFL 3ZDXB 3L2MA 1KEGL 3I9GH 1QHOA 4LLMB 1NCAH 4YOKA 1R0AH 3EYVB 1HXYA 4IBYA 1XGQB 1HC1A 1I1CA 4O2FB 1PIGA 4WCYH 3K46A 2V33A 1KY6A 4ZZKA 5EBLB 4Y5VB 4DERA 4UTBL 4QHMB 3BYTA 2JJUA 4IOSD 1ORQA 1JBJA 2VN6A 4JE4B 3U1SH 1HE7A 5E2VL 5TDPB 1OD7A 3GS4A 3LZFH 4PRAA 5EZJB 5HY9A 2W95A 1OZTG 4CBPA 4WGWB 2ZUYA 3VDAA 1WWWX 3D0LB 1UACL 3S37X 4BXVA 2BIQA 2G3XA 1MLBB 2NR6C 1QP1A 4MZ3A 5IJKC 2EIZB 4FG0A 5DR5L 2WUCL 1X4XA 1RVFH 5IEHB 4AYFB 2EXWD 4ABQA 3HKZA 2CGRH 2ARJQ 5TE7L 1SHWA 1HXMA 1F5WA 1PG7L 4Y1AE 3LH2L 4M6OH 4DPCX 1DBBH 3ZDYE 1KTKE 1JGEA 1K8IB 1SRDA 4JN2B 5F9DC 4WHCA 4KK8D 2MPVA 4QRPA 3ML9A 1A4KB 2XTJD 4OGYL 4WHYH 4R4BB 3Q6GL 4NQCA 3CN4A 5DDHB 1CU4L 1BVNT 1HIML 1PNCA 2CM5A 2KLTA 3EFFB 4NGHL 1CFTB 3E8UH 2BIMA 3GI8H 4OF5A 3FPXA 5E5UB 1AZUA 1P4LB 4HAKA 1AXIB 2APXA 3A4FA 7TAAA 1NFDB 4BH7B 5DGQA 2BK8A 2YPVL 1R3KB 1FN4A 4HHAB 3RTQA 4HWEL 4FXGC 5HHOE 5KVGH 2Z91A 4PJHF 5DFVC 4AG4L 4WK2B 1MWAL 1DUYA 4DGWC 1WCBA 3K5SA 4N2BA 1X7SA 4HV8B 4D3CH 1ETZA 1P1ZB 2NTFA 3C60D 4L5FE 5E23A 3HR6A 1X7QA 3DURA 5FF6B 3WEMA 1BIIA 2OW7A 2LABA 2A74B 4QT5B 1FO0L 43C9A 4TM9A 4LCWA 5DK2B 4WHDA 1NAKH 1MIMH 3KL5A 3QWNA 3DV6B 3HG4A 1GVIA 4X5RA 3ZYZA 4EN3C 1E65A 2FBJL 3N55A 5EO9B 5BO1H 3FB8B 3EJCA 4G8FB 4JFXB 1T0NA 2D0HA 2HVKA 2WXLA 2Y72A 4PREA 5D1QA 3TT3L 2A6IA 5MENB 2QQQA 4XPBL 1CGSH 2OL3H 3NESA 4Z7VB 5EEZA 1CZ8H 2YUVA 2B77A 5KVFE 4IM8A 3S35X 2FTAA 3QAZC 5IEKB 5IQ7H 3ZE0F 2R83A 3H9SB 2R29H 3U0TB 2GW5A 3MNZA 2A6DA 5J1SC 1SHXA 2UXTA 4MRBA 3BH4A 4XP5L 3P30L 1IKNC 4KY1L 4I77H 2GBVA 3OLIA 3WJMA 3MRIB 1Z5LB 4NAQA 4AVIA 5DMGC 5KOVC 5IVZB 1ID2A 3TBTA 3SCMA 1MHHA 3QNYA 1T89C 1IGTA 3HI5H 4X4ZA 1Q9WA 1FL5B 5F3HA 1OCWL 5TQ0L 1BZ8A 4NDMA 3UTTB 3KR3L 1CVSC 3GSNA 3TZVC 5CD5C 4RMWA 5B1KA 4HIJA 4RSYA 1RZKC 4Y9BA 2DLIA 3QXUA 1WYJA 2PXYC 3BPNC 4HS3A 4X4KA 3HLAB 3IDJA 3VI4F 3RPKA 1SYSA 1T2XA 4G82A 3FMGH 1U6AL 5C0AD 4NZUH 4P8QA 2P5WE 2IGLA 1DVZA 1IKFL 1ZHKA 2GIYA 3NEEA 2QDVA 3GYRA 4DVBB 3EGDA 3H8NA 4NO3B 4PBWD 3SEPA 1OB1B 1RU9H 2WXKA 3UXFA 3ULUL 4TMPA 3W9EB 1TTRA 3EOBA 4GQPH 4FYQA 4ATWA 4F7PA 1N68A 3X14A 5C0CD 1BFTA 4OQTL 3RHWF 2Y2TA 2ZOKA 3DPBB 2KT6A 2XTSA 4X80H 4GKNA 2HLFD 3S37L 1NSNH 1Q94A 1LK2A 3TZVB 3UBHA 4CC4A 4MJ6A 2DJUA 5ICXB 4UM8A 3QS3A 4DEPB 3AREB 2FJGA 1PY9A 2AF2A 4H8UA 4G7RB 5E9DA 5FK9B 3T6ZA 4N24A 1B2WH 3N1PC 4B9GA 3BWUF 3B3BA 2G75B 2YGOA 4JY6A 2IANE 3FB6A 3VFOB 4B9JA 1KIUB 4HCRH 2ED9A 1CXFA 4D9LH 2Q86A 3CZFB 4HUXB 3A4EA 3FNKA 1RJCA 5HHNA 1U8KA 3DARA 3FTZA 1DVUA 4WKXA 4PJFF 4OQ1A 5BZXA 5C0FA 3AT9A 4JPWH 3ZE0B 2OJZL 2XN9D 4M9OA 4C54A 2PWGA 5K9QI 2J8UA 2NUTA 5C0EB 4KK5C 5I1JL 2OLDA 4YNYA 4MYPA 3IJSA 3O3DB 4WTZG 3VM5A 3VFSA 4DOHB 1WEJL 5BV7B 4YMPA 4JCLA 1A6TB 4HDIB 4RNRB 4DP1X 3VXUD 1RLBA 5BVPL 5E00A 3B4NA 4Z0BL 3DTXA 4WAFA 3LN5B 5CNHA 3BT0A 3A47A 4JKPH 1RIVH 5DFAA 2D7MA 5FFGA 2GJRA 4KZEH 1S5IL 4AQEA 1FE8H 3J07A 5EOTB 4TYUA 4R5XA 1MRDL 1U8MB 1JMZA 2GJ6B 3C5ZC 5DMKA 4NM4H 1E6OH 1PFOA 2BVTA 3VGAB 5DZOA 2WZPD 1TKWA 4OR1A 2GBAA 2VSMB 5E5MA 4ZUTB 2ZUQC 5FYKD 1N64L 4HKBA 4AQ8C 1LE5A 4OCSL 3IXTB 4WFHE 5C08D 5E94A 4NENB 1ZT1B 1XF2B 1KACB 4PHXA 1UA6H 1AZCA 3ZHLA 3FB7A 2DPKA 3JZYA 4JG5A 3RIAF 4JFPB 4LRIC 1IRAY 5C09B 4G1EB 4XXDB 1TSHA 3D69B 4HBCH 4HUWA 4N2IA 5HHMB 2GK0A 2GTWA 3CZJA 2UXVA 1VF5C 4OZGA 5HP5A 2UXGA 4LGPB 1E5AA 1T83A 4N2NA 3N50A 1KEML 4YHML 2Y07H 3VFTB 2Z7YA 1JF1B 1SXSA 2JELH 4H13C 5L0QB 3MLUH 2ESVA 5AW8B 3WIIL 2X87A 4OGAD 3BWZA 1RI8A 4JFDE 5E2WH 3ZE0E 1NBQA 5CCHE 3IU4L 4Z7OB 3CFCL 5A16B 3TH3T 4GI8A 3CFQA 2IAND 2PYFB 3K7UA 2CZNA 5E6YA 1BM7A 2VM3A 2AEQH 3CZEA 1XQ4A 5I1DB 4QTIH 3NTCH 1QEWA 1UOKA 2VL4A 2JSFA 2ZSWB 4UMSA 3VFGL 3VH8B 3FT3A 1OKEA 2E27L 4WI0B 4XPHH 4Y4FD 4ZTEA 4Z7NF 2FR4A 3KW8A 2AJXL 1UM6L 4RDBA 2Q7YA 4OVVA 1G7MA 1J0HA 2D8KA 3GS7A 4PJHA 1XXFC 3U4EA 1T21A 2BRRL 4Y2OB 4W93A 4JM2D 2FGWH 1SGKA 1KPRA 1G6RB 4M1GL 4P46B 5AYQA 4J2XA 2WINA 2Z1PA 1F4WH 2CDFA 3P1VA 2BHYA 3QHZH 5JW3L 2BOBB 4PB0H 5DK3A 1XR8B 3DJRA 5MEQB 3O9WD 4J6IA 3KLQA 1HH9B 5C0CA 2DM7A 1DEEB 1ZHNA 3OBAA 5I6NA 1GGBL 2LU7A 2Y5EA 2ZOUA 5EZIH 4LSQH 2R7EA 4GBXC 5AVVB 2YO3A 3SPCA 4F1ZA 4G80A 5GRXG 5L7XH 1TTCA 1J9SA 1FIGH 4X5WA 4CILA 3BWUC 3RKDC 3UAJC 1J9RA 2ZP9A 3BP6A 4F5CE 4AYBA 3O8XB 1OP3K 2PP8A 5C3LD 2QV4A 1PKQE 1YEEH 3BESR 2XVGA 4MQ7A 2C3VA 2Q76A 3GB7B 2C4FT 2AJVH 5IIEB 1J1OH 4NUPA 4LLQA 2C9PA 5K1JA 5JXAL 3S35L 3T6VA 5BW7C 3DJ9A 2FO4A 4YDLC 5D9SA 5CF3A 2P46B 2Z7WA 4U6HB 3PV6A 3MUGB 3WAKA 2DQUL 3L1OL 2CUHA 3IJ9A 4Z95H 4J3XA 3CXDH 4HCIA 3GBDA 1HAUA 1YY8A 3HBGA 5I18L 1OE1A 5D7SH 1EJ8A 3PQYA 5AVRB 2EICA 2WQXA 3MBXH 4TSCH 2ZWSA 1GTFA 1GYVA 2AC0A 3C5JB 4JFFD 3VFMB 2JFCA 3PWJA 1EK3A 3BQUD 3WFEL 3DVNA 4FQQB 5DK2A 4HH9B 4LVHC 3HW7A 4U1MA 2EEBA 4JAMB 4NNYB 3WN6A 3ZVVA 3DLQR 3P30H 4Z78A 1Y18B 1LDPL 2CGZA 3EGSA 5L4FA 5DMYA 4XMKL 4AGQA 4LHJB 1XD0A 1UXWA 4P05A 5JIPA 4P9ML 4XPTH 5DD0H 4N0CC 4ZO7A 3HI5L 3HVNA 4DQOH 1EHXA 5BMFH 3L9EA 4DUWA 3LXBA 3U0TA 4BWUA 3IGLA 4WI2A 3GJFA 4K94C 2HX9A 3TH2T 4PPTA 3MRIA 3QRLA 5A3IC 1GOFA 1LK3L 2D7OA 1VDGA 3TBTB 1MUJB 5HHOB 3MRPA 2LU3A 5AUMB 3SBPA 5JPNB 4R3SB 4H4NA 1QKZL 3KYMA 3X12B 4AYID 2BNRA 5AVWB 4PY7A 1MFCL 3VXRD 4D0DB 3EJTA 4MA7H 4ZTOL 3GSNB 1OV8A 4LP5A 4ZBJA 3VFUB 4Q9RL 1J0ZA 1FHGA 3ARDD 2MEJB 3PDDA 5KYWB 5JDSA 3HLAA 3IDJB 3ULVC 5E6IA 3RKDD 1DVSA 1XL6A 1E28A 2CWRA 4MA1C 4ONOA 3SOBL 3UYPB 3VSVA 3CV5A 5KG9A 1JDCA 3J7HA 3ZDYB 2IWGA 2MRYA 3HS8A 5E4AA 2GHWB 5CBAA 3F7YB 4PRIA 3IMVA 1PD6A 4EI6A 2CA4A 2QTVA 5GS2D 3ZOAA 3NIGB 2Z34A 4LVOC 3VDCA 2NW3B 4OZ4A 4QYAA 3RIFK 4HJIA 5IK3A 5TPWH 1P4BL 3O6KH 1I1AD 1L4IA 1M7DB 2HH0H 2VH5L 4DN3H 4KQ3L 1PAZA 3CC5B 3BJLA 2J21A 3U79A 3A22A 4R96A 1RJYA 4HKZB 4Y88A 3VTTA 5C7XL 4GRLD 1IARB 2P1YA 4LSPL 2IGFL 5E9DB 2BNUA 4QRBA 1IZKA 4O9HL 2PLTA 1R47A 3VFOA 4KKBD 2WN2A 3WFDL 5G2NA 5DO2C 5IB2B 1MFEL 2VLRD 4F37F 2R23B 4HUXA 2J3SA 1LWRA 5AKRA 3RWCB 2WYZA 3ABZA 3KNBB 4U1GC 4R0LC 1MVFA 2L8AA 4XMWA 1GY2A 1I8IB 1OGAE 3N9GH 1KWGA 3JTSB 3Q2LA 3B83A 3FFOA 4BIKA 4FG6C 4M00A 5B1BB 4Z7IA 2OPCA 3KDMA 5E2UH 3VD2A 3T1WA 3IETB 3QNXB 1DHKA 4YBQD 3WKML 4EI0A 1YEIL 1Z9SB 2J56A 3VRIB 2C4XA 3FH5A 3ZL4L 1S9WA 3SE4A 1KLUA 3PAUA 4EUPH 1SNRA 5TGBA 4PS3A 3IMSA 1ROWA 1J10A 2FIRT 4HYTB 3WENA 2K7QA 3LNFA 2XDHA 1IM3B 2RB8A 1ETB1 1BG9A 1SQMA 4A7GF 4MNGA 3R4RA 5AOLA 1JFQL 5CIPB 4RX4A 1NWOA 4XPFH 3LKRB 5B1CA 3I2CL 3KYOA 3L2LA 4JZJB 1UTDA 4FTVE 4AW7A 1CR9L 1TKWB 4YDMA 3B34A 3V95A 1ZJBA 3AGWA 4ES9A 3RY4A 1OWRM 5FS5A 1FZOB 1T2QH 1PFCA 4S1DD 3HVDA 4LOFA 4XCFH 3H53A 5I8CA 3BQUB 1D6VL 3ILDA 4LE8A 3FTWA 32C2A 1IE4A 2VDML 3IBEA 2X6CA 4HGMA 5CSZA 5FUZL 5D7IA 4F24A 1CXHA 3BZDA 1I8LA 3BP4A 2NUPA 3IKCB 4J4PA 3SQBB 1KPUA 3T04D 3US9A 4RGNE 3GIVB 1X5GA 1YY9C 3HEIB 3ESNA 2APTA 4DP9X 3S9DB 3BAEL 4I3RL 4G7VH 3TBBA 1TETL 2J1WA 2XWBB 2X44D 2A77H 1FNAA 3MOAH 1LMKA 4NQVB 1I1AC 4W4OC 4YSRA 4U3CA 4ZG1A 2APWA 2DQCL 4Z7WE 3CCHA 1JPSL 3GMRA 3HPJA 3KPNA 2HP4A 1UJTA 4HT1H 4P5MA 3C12A 5ERWA 3S8WA 2Z92A 3QRFM 3FQWB 1XVSA 3FT2A 1EX0A 5J12C 1ZE3H 2NY5C 1SLWA 2W1NA 4N0UE 5TDNA 4DKAA 1QEWB 4JN1H 1FRGL 4KVCL 1BREA 3KLAB 1KGCE 3CGTA 4M5YH 3RWHB 1JV2A 4U7KA 1PZAA 2ZZUT 1B9ZA 5IVXA 5I1EL 2XWJA 2HWZH 3GHBH 4F7KA 2ADYA 5FFOA 1MCWM 1OXYA 5JOPD 1LGVA 3WNJA 5KVEE 1TG8A 2CK0H 4F20A 3OKNA 4XVJH 2Y7OA 1Q9LA 1PX8A 5GGQL 3ZLQC 1NA8A 5HSFA 1ZEAH 2BP0A 2EE6A 3KJ4C 5ID1A 4EOWH 5I8OL 1FNSH 1XZ0B 5ICYA 5SWZE 3HB3D 3FN9A 1CD8A 2OQJA 3IN2A 4PQXA 2WINB 3AUWB 2V17H 4WFEE 5EU5A 5AVYB 1OVZA 3PPEA 4X6CF 2P9RA 3MA9H 5KYYA 4LO9A 4PJIE 1I9EA 3K81A 4HC1H 5C3TA 3ZBMA 3N1FC 4BFOA 3LHPH 4IRJB 5I1HL 5J6HA 5D1XE 3VGFA 2PWEA 5IMOA 4Z95L 3VWJA 5DEGB 5HGHA 3TO4C 1BOGA 3FQXB 3S4SA 3VQ2C 3N44F 2ARWA 5BUPA 1OSEA 1URZA 1WS7A 2EDEA 1X5IA 3G5YA 4PRHB 3F7LA 4R26L 1W8NA 3ZN6A 1KB5B 1AQKH 3G9VA 4GG6A 3TCTA 3B7YA 4UT9L 1DFBH 1EAJA 1JUFB 4J8RA 3VXSA 3HFFA 5IUCA 2EH7H 3JUZA 5HHPB 4F2MB 1QABA 3FRPG 2PPCA 3C6LD 2UZYB 1MI5A 4WDIB 3BXNA 4MQSB 1NFKA 3P4OB 1UH2A 1ZA6B 2H6PA 2NYKA 4TLKA 3VI4E 4QHMA 1E8YA 2NDGA 3V4LA 3Q01A 2FCBA 4QDGA 5ACZA 4ELKA 5HD8D 3GXTA 4DAGL 2EEFA 5EZJA 3OWRA 1DUZB 1CE1L 2A83A 2E7BA 3DXAA 1NDGB 2XJLA 3KLLA 1S5HA 5FKPB 5H37G 3SBWA 1NCGA 3TJPA 1J5DA 3UDWC 3ARQA 4ODXA 4DQOL 3HHSA 4E2OA 1CYWA 4NNYA 2QBWA 3L1GA 4JANB 2Y36L 4GSQA 5T3ZD 3FTUA 2GSIA 1BBDH 5DZNA 4IOIA 3LKQA 2ZWLT 5HYJD 3FFCA 3SY0B 2J44A 2AQSA 3RZCC 5KSAB 3N1MC 4CVWA 1EZUA 3BISA 3LD8B 4R4BA 3KGTA 4TXVB 4HOXA 2OMUA 5AAWA 4PUBL 2GJZA 3CSTA 1BBJB 5EZOL 1KTJA 1CFTA 1HOCA 3S96A 5E08L 1O9VA 2XY2A 1AY1H 3ZE1F 4ZNCD 3BMWA 2P44B 2YGQA 4W9JC 1PYWA 3OAUH 2O5ZH 1FC2D 3BKJL 2DI7A 4QJ4B 2NY2D 1XH1A 2O6FA 3IJYA 2YMXL 1QNZH 2GCYA 2IO5A 4MMXA 4UM9A 3NJLA 1ZGLB 2Z91B 4K71C 4JO3H 5CJ8A 4Y19E 4UIKL 4WFGD 3BUDA 5MHSE 1LDSA 4YZFE 4IOSA 5L4MA 4RFOH 3IFLL 4H44C 4J6RL 3H3KA 4PB9H 4RAVB 1WDAA 1FH2A 2HB0A 2A74A 5EA0H 4LLDB 1T20B 2YC1A 2X4QA 2VDQL 1DBMH 5C0RH 5AYUH 1JNJA 4NHCL 3GSUB 5FYJL 2ORBH 35C8H 4KJQC 3BP5A 1AZRA 4P4KC 2VRKA 3ZYOA 1XH0A 2PYEA 1L9SA 2AJZA 5CSBA 3QQ4B 4IBVA 1OWWA 3QDGE 1QRNB 1SUJA 1UB6B 3UJIH 2DWYA 4W68A 2A6IB 4DZ8B 4GOSA 1QFPA 4FMFA 3G04A 1AGEA 4FI6A 4LSPH 2WXOA 3RG1C 1DZBA 1CLCA 2VDLL 1ZE3C 2RACA 1UZ6F 4HCRA 4EI6B 4NPKA 7PAZA 3QPQD 4MAYA 2ICWA 2WGNB 4OZ4B 2NW3A 2IOIA 3O9WB 3P11L 2VLJE 1KXTA 3ZDZB 3H9SA 3ARZA 1GKEA 4HJEA 4ZUVB 3V0HA 1UENA 2OSYA 4NRYA 2YRLA 4LFHG 3CC5A 3MLWL 3P54A 3MMEA 2MCMA 4KO9A 3NCBB 4FNPA 2NY3C 3ERXA 4XPGH 1REIA 2YGVA 4KKCD 4OZFB 5DJCB 4A7SA 1N5AA 1LNUA 1TJIH 1A1OB 4QRPE 3PCYA 2ZOOA 4FZ8H 4OAWB 4E68A 1CXKA 1MHHB 4H8WC 1FYTA 2W07B 2AEOA 1U8JA 1Q9WB 1JXFA 4M7JL 1AD9B 2DJSA 1CGYA 2DQJH 4K9EC 3N42B 1G9EA 4OLWL 4N2OA 4K5PA 3PXHA 5L4IA 3QYNA 5F7EH 1G9MH 5DC4B 5TF0A 4B3EA 4JRYA 5I28A 1KCUL 3EO1B 4X7EC 2D9QB 3DX2A 4AKQA 2IPTH 4G43A 2XQBH 3MFGB 4QRTA 2QLYA 4LT7A 4M6NL 3QIUD 4DKFH 1U4FA 2YPLA 2ZYRA 3I3BA 3R1GL 4TRPL 1ZIBA 3SJVA 3MV8A 3ZX1A 2VIRA 3JTTB 4LKCB 4UIMB 4DVRL 4PN6A 3C6LA 4ZQTA 1BXAA 3D07A 1OB1A 1CI5A 3T0AA 2VXSH 2Q1EA 5IB5A 4J4PC 4OM0H 4WFGE 1XR9B 1RMFL 2HVJB 2WV3A 4ORZC 1YNLL 3OVUB 1E4WH 3VNZA 2VXQL 3D3VB 3C5SA 5ESQA 2W9DH 3AQYA 1G0YR 4HWZA 5E1GA 1VKXA 1Z7JA 4GKNB 4ZS6D 4BCZA 4H88H 2B4CH 4MJ6B 5DS8A 5EULV 1RUKL 1LO2L 4PLJC 1HHKA 4Q9QL 2GK2A 1DJSA 3PS6A 4V1DE 4NZFA 4P2OA 4P2QE 3BC9A 3GJFK 3B9KA 3ISRA 4L8BB 2YR3A 4X5XB 3VFRA 2R4RL 4KJQD 3MA7A 3U48A 5DR5H 1PBYA 4GQZA 2WUCH 1F2QA 3BH9A 1TJGL 3W5MA 1HQ4B 4K4KA 1MAKA 2IJ0C 4FABL 3HI6H 5D7IB 2E3VA 4QHPA 4WI4A 1TEYA 2ZXEB 3MLXH 1RZKH 2FEJA 3K5RA 2VZUA 3REWB 1FRGH 1KB5L 3QDJE 4JFDA 4KVCH 4LDCA 4Q6KA 4QMEA 1EMTH 3UAFA 1WRFA 2DYPA 2ZG2A 2HWZL 2VDRB 3GHBL 4W70A 4OGQC 4DGYL 4NZDA 2J8UF 4AMKH 1HNFA 4P5MB 5ERWB 3EYQD 1F3RB 1M05A 2FHFA 2XN9B 5HVFB 3VI3B 1UVQA 1KJMA 5F88B 3RFZB 5E8EA 2O4EA 3BWAA 3UP6A 3NSDA 4WV1C 3HG2A 3JT0A 1M1SA 1BMGA 4HPOL 3S36H 3VXRA 2IH8A 1AGDA 3SQOL 3QR0A 4ODTH 2PCPA 2AQRA 4MDIB 4N1EA 5C9JA 1MRFL 2W60B 5D7JC 2FECL 4NNXB 2VXQA 2YK1L 3B7UX 1DSYA 1CGWA 3LEYL 4HISA 4IBSA 3WFBH 1QRNE 4ORGA 4LSUH 5FO8A 2HLAB 4OJFH 4GJTB 3U0PB 4MTMA 1NAKL 3TEXA 4J7RA 5D1QC 3IDNA 1BEYH 5D71L 4LCYB 3MHZA 4QAWA 1EHKB 3LVEA 1C12B 2BRQA 3HZMB 1MCEA 4TVUA 4LVEA 2NNCA 3RZCB 1MJUL 4BH8B 1ACCA 1JFHA 3QIBD 4O58L 4P2RB 1G4MA 4ZXBC 5KYYB 1CLYL 4ACTA 4JFYA 1SDDB 4FLHA 4D94A 2PP9A 1P5UC 1IM9B 3LH2H 4M6OL 2FEEL 1MAML 2FZ3B 4OLUH 1OP4A 2MTPA 1SMAA 3FQYA 4UU9B 4DN4H 3T4AB 2OSLA 3UG3A 3B7RL 4JO8A 4H20H 1V54B 4JFZH 5DRZB 3BZFB 2JK5A 1HEZB 1YYLH 3FOMB 3LKSA 4YSTA 1KB5A 3ELQA 5JA8B 1VFUA 2ADJA 3FAWA 1UKSA 3H3PL 1S7WA 3IU3A 2B59A 3DUSA 1QLEB 3INOA 4M7LH 3G9AB 1YDPB 4LPWA 4Z3EA 4JLRA 1NEZG 4XXCA 3HRPA 1S7QA 1NUDA 3PL6B 4F7MB 3BPLB 4Z76B 3C75A 4ZSOB 4EIGB 4H8WH 5IG7A 4JFEE 4HLZH 4A63A 1IEAA 3BOVA 4LHUG 5CD5D 3D39B 2EC9T 3SZ6A 1SLUA 2NY1C 2XC8A 4Y1SA 2HG5A 4RZCA 3LQZA 5B4MC 4J3SA 4MJ5A 2ENQA 2R8SH 4PWIA 1KYUA 3MJ7A 1CDBA 5EFIA 2HX7A 3SE8H 2ZF9A 1WISA 2EZ0D 3WTXA 4KOCA 1RIUL 2O30A 2F1EA 3U2IA 1ASPA 2VYRE 3QEHA 4N6RA 4EQ2A 1G7HB 3BSZL 3O9WC 1ZHBB 5EORL 3DUHA 5F6IB 4ZO6A 5IB1B 4LIQL 1EO7A 1UOWA 3NIDE 1FFOA 4M03A 1N2RB 3IYLW 1GYWA 3VG9C 2NMSA 1AJ7L 4NZRL 3ZDXF 4G80B 1ZIAA 3E8VA 3AY2A 3GMPA 3JWNC 1ZGLM 2FD6H 4N1CA 4JM4L 3K2IA 1SXZA 4M61B 5DQ9A 3V7MA 1Q9KB 2NY1B 5D7JD 3QSKB 4L8DB 2DD8H 1EPFA 4L29B 1GIGH 3CIQA 4MASA 4QRUB 3X3GL 1WFUA 2R69H 5IVOA 3PHOA 4JB9H 1BMZA 2DDQL 4JFOB 4PSPA 1N6QL 1J05B 2Q87A 3EGXB 5AYUL 2OMNA 1F58L 1QATA 3D87B 2H8PA 4A2LA 4M6AA 4ZK8A 1FLTX 3U2SA 2C9QA 5ITBH 4A7UA 1P9MC 4MHHG 4MWFB 4Y5YA 2ZXAA 4FFZL 4RQQB 4X0KB 3VXMA 3C5JA 4KTGA 4YSOA 3PWUB 1FV1A 3JT2A 1RPKA 2OP4L 3DVNB 4FQQA 4U6TA 5E8OA 5AZ2L 4ZYKA 5IJBC 5KS9B 4NQEE 3FB5A 2BLFA 1QTPA 1NDTA 3N5AA 2WTRA 2VUOA 1Q0EA 2SEBB 1P4IL 1P7BA 2PYEB 4PYHA 1WVZA 3IS1X 1L7IL 2V6HA 5LB1A 1CQYA 3NJXA 3V5DA 4KJYA 4BEIA 2ILLA 5D70H 1AGEB 3RGVD 3NQIA 4R0LA 2Z8WC 5GIRA 1KXVA 4QYOB 1GXEA 3KM2A 3NRQA 2ICWB 4Y16B 3WI9A 3SDXA 5BXFA 3DX1A 3E6FB 3X2QB 3BRDA 4PTTB 1PAMA 1SZNA 1VPOL 4KH2A 4OQTH 3BPOC 1I7UA 3GJFB 1QA9B 3HBZA 1KN4L 3T3PB 4G8GE 3F58L 1E0OB 3LS5L 3RU8L 5B4MD 5E8PA 1NLBL 2OFQA 1INEL 1LNUB 2EC9U 1DQQB 3BE1L 1RPUA 1WHOA 2ADFH 3WIAA 3U7WH 1K85A 4QHNA 2Y5QA 4P5TB 4R3SA 3UEQA 3HNTL 3RL2B 4L8SB 2X4OA 4WGKA 5D7LB 2I07A 4KUCD 5DT1H 4BFKA 2ZCHL 2V2TA 2GT9B 1CN4A 2AXGA 1MFVA 3N1GC 4Q2ZA 2FGZA 3VFUA 4JRYB 5CZRA 3HE6C 3AITA 2YKKA 5CEZE 2YPKB 1LEIA 1TEGA 4TVPD 1A3ZA 2VQTA 4GFTB 4XHQA 5FV2A 4LL9A 4YDIL 4Z7VF 4AM0A 3SO5A 1E28B 3L9RB 5FO2A 5E9DE 2YA0A 3SJVB 5DU7A 1FO0A 1J12A 3FQRA 2OW6A 1KLFB 5IB3B 1S46A 3KCPB 5CBAB 1SVZA 3GSQB 1WZKA 3ZUCA 1T80A 4XC3H 5C0BB 2AKRA 3QC5X 1KT2B 1A8ZA 4QHLA 1XR9A 2ODIA 1QSFD 1TQUA 4PJ7E 1I8AA 2HRGA 3E6HB 4OFDA 3FHEA 3BP7B 2BH0A 4HWZB 4BK4A 1CGTA 2Z35B 3RWFA 3OAYH 5F89B 2J5WA 4R96B 2DLFH 4FKHA 5F7AA 5IGXH 1AIFA 3KG5A 1RIHL 3R18A 3P73A 4PS7A 5L8LB 1GW6A 2ZUWA 5EO0B 1XCXA 1XSOA 1S9YA 3N2JA 3A6CL 4EPSA 4DP0X 1BA9A 4JFEA 4QXGL 2JKWA 2YQBA 3QJHB 1FJ1B 2GTZB 5AG9A 2O61B 3FYIB 4D8PA 4KTDH 2VR3A 5H94B 1DSFL 3TT1H 2FUQA 3NZHL 4I0CC 5D5MA 4RETB 4DGUA 3PLYA 2PMZA 4UZSA 2F54D 3Q8FA 4JHZA 5E6ID 3WDHA 3F6JA 4A2MA 4BZ2A 3LX9A 2UZIH 3EYSH 3OHXA 3QT2A 3RGVC 4CC0A 5JPMA 5BUAA 1D5XA 3BHBA 2YIHA 2GPZA 4LPYA 3NPZB 5DURD 4R4ND 2N7BA 4DKTA 4YBQC 3V5HA 1K4DB 1RULH 3M7FB 5GRVK 1ECZA 3UG4A 2F18A 5C0AA 5D7HA 3G6JA 3PL6C 4Z18A 2PYEE 2DYPB 3BD5A 4BSJA 1S9WB 5BRZD 4IBTA 2RFXB 1WFMA 3STZB 5TGBB 5KS9E 1I8LC 5JORA 4OLXL 1IL1B 2OMZB 5GQBA 2DWDA 2R0KH 4ZXBB 4N0YL 3VI3A 1YECL 3BN9C 5BOPA 3FT4A 2XKSA 3TCLB 1WAAE 3MBEC 5CD3A 3W82A 3T8MA 3WS3A 5D71H 1JZ5A 2WJ7A 5IJCC 3AQDA 3RP1A 3F05A 3GSVA 2BW5A 4LOUC 5KVEH 1A7NH 5F7DA 3NIGE 2NR6A 3V0WH 3GO1H 3HUJA 4N86A 2IAMA 4HS8H 5HGGS 4HCGA 3VAEA 5GRWA 4Z7OF 4G6FD 3D3VD 5JHBA 2VN7A 4XPAH 1XH2A 2HX8A 5JHDD 1CJYA 2QKIA 1NBYB 3F64A 5DVLA 4RFNC 3DYOA 5DF0A 2JCCF 2A7BA 3OR7A 1P7QD 1E5UI 1Z9NA 1PY0A 3CN2A 3L3OB 4F2FA 4X4YA 4DCQB 3HI1A 3B2DC 1T4KB 2FQEA 3MV01 4B5ZA 3EG9A 3CZGA 5D2LF 4JM2F 1BEXA 4FE9A 1UM4H 1WO2A 3D25B 1ECYA 5KANG 1UXSB 4S2SB 3CCHB 1QLRA 5AL8A 4N5EC 1HEZA 3WJJA 5ADPL 3V7AE 3LKSB 5LXVA 5DJDA 1OB0A 4FQIH 2AJUL 4K71B 1DL7L 1LTXA 3FT2B 3TTYA 4XWOD 5TDNB 3QPXL 1YDPA 4UDTB 2F6AA 3U7YH 1VADB 4GBXA 1RUMH 5CCKL 4UOJA 4YWGH 3KPRE 2F54A 4RMUA 2XWJB 1UG9A 2YN5A 4AKPA 3VU2A 1G84A 4OD3H 2CLVA 1JGVL 1L6ZA 3M7OA 4ZW6A 4Z7NE 3X1NA 4QF1A 4XO5A 1IM9D 1X4ZA 4KDWA 2H2SD 1YNKL 5FYLD 4PV1C 2IF7A 4HAGA 1I4FA 2YGNA 4GAGL 5D1ZC 5ANME 3ZZLA 1S8DA 5HYSB 5K59E 1EZSA 4F37K 1T0OA 3RJQB 1XO8A 2BFVH 3TF7C 1MNUH 5ISZE 3FHAA 3T0VA 3CFMA 1BAFH 3LNDA 1ZHBA 1YSOA 1UT9A 3LRLA 5J6GB 4NT6B 3P77A 3SSGA 2EDOA 5JOFA 2HZHA 3QZWA 2EECA 3L7FB 5IMOB 2X9XA 3MBED 4I89A 1NCOA 1O0VA 4OGXL 1JIBA 1H6EA 1KIRA 1THCA 1G6RH 3PABA 4GSDL 3OXRB 1Z3GL 5DZAA 5DQ9B 3R19A 1DJYA 1SOXA 3WY2A 3L5WA 4TQEH 2IWEA 2KUTA 2LR4A 3R06B 2AXHA 4IEFA 2YAEA 3SKMB 4HW6A 3WOVA 3PHOB 4XE5B 5JHDE 2OSWA 1KTDA 4NFCA 1INQA 2EDYA 4GEIA 1NBVL 3GUFA 1CFMA 2V3EA 4L05A 4OCWH 5DWUH 1FYTE 3FCSB 5AZ2H 4NKMB 1VEOA 2A6JA 2Y69B 4OM1L 2DEWX 5I2IB 1ZA3B 1MHPL 1A6PA 4I88A 2HFGH 5GZOA 1HKFA 1H3TA 3CBJB 5BRZA 3IFOA 1CFSB 4E5XG 2D03H 1F6FB 4Y2LA 3JYCA 1IAIH 3SE4C 1FV1B 3CDYA 1FSKC 3VI3E 3QJUB 5B3JF 4KVNL 3NQKA 4HMCA 5DUBA 4AEIL 1KPVA 2CU9A 4L9LA 3IDYB 1A9EB 1IQWL 1OGTA 2GJ6E 3MODL 4H5SA 2H0EA 3OAZH 3D34A 5I26A 5IP4A 4MAUL 2DWXA 4KHTL 2J2ZA 3UYRH 2CO7A 1I8KB 1QSVA 3ABMB 5JHLA 3HNTH 2KI6A 4MA1B 4O4YL 4NJAL 3BMVA 1XX9C 4L18A 3IWVA 3OQRA 1G7JA 2KDYA 3AS1A 3P9WB 2CO2A 4R2GB 4YXLL 2YOAA 4DZBB 5MEOB 1J5OH 3W38A 4HZ1A 4P2QB 1U93A 1T2JA 4GW5B 1ZLWH 3KGSA 4YHYB 1ZGLA 2MCPH 1KCSL 5BUGA 5JUEL 3GZKA 3GM0A 3LY6A 5EHFA 4HQQL 3QWRA 2PN5A 3W9DA 2CNYA 3D3VE 1FVCB 1IB5A 3DV4A 5C0IB 4MMYB 4B0MB 4A38A 1DQLH 4HIJB 4J3TA 3MRNA 4JUSA 3KCWA 2A73A 1LEIB 2D3LA 5C09E 4OI7A 4D8OA 4OFYA 2IANB 3IJEB 1VZHA 1N8ZA 1U0QA 1SYSB 2VE6A 1E4XH 2EXWC 4UV7L 5IVXF 3RFZC 4WTQA 1WAAF 5H4YA 4AUUA 1H6UA 2UUDK 2W91A 4ZUUA 4XX5A 4DZ8A 2OMTA 5IGXL 2ITCA 3P2BA 5FGBC 5I1CH 5LDUA 3JWNG 5LNEA 3OKMB 4NO3A 5BZZA 3FQ2A 5C71A 1KV3A 4NQED 1JZFA 1R5VB 3FL7A 4HWBA 1EDQA 4QXGH 4UT6A 5I24A 1OHZA 3KWXA 3QO0B 4J3OG 1ZY9A 4RMRA 3HOGA 4KK6C 2CMRH 5IOKA 3QZPA 2XNAA 3DSFL 4OTXL 2C9RA 1YPZA 3GI8L 1W0YT 4BDVB 3BFQG 5EOQL 1JZGA 4FQXC 2R4SH 4OH2A 3HZKB 4OCYL 1U8PA 2VCOA 3PWPD 3WYRA 1XD1A 2FJGB 4R8WL 1S9YB 1CR9H 4Z3GA 4PJ9A 4ZOEA 2YQ3A 3M6DA 4S0HA 3OWEA 2O61A 1UXLA 2R56L 3TEWA 1CD1A 4TQHA 3T8VA 1HZHL 4CSSA 2OV0A 4F2EA 3DHPA 4Q9BA 2AGJL 2XKUA 3BPCB 4KMTH 2QELA 3UTTE 4DIXA 4OUUB 2XV2A 2R0KL 1LO0H 2Q3ZA 1CTNA 1X6NA 2XXGA 3W1ZA 4LQFH 4XOEA 2C7UA 4G1MB 2OYPA 1A9VA 4BZ2H 5IVXE 4XX1G 3ZY7A 3TNNB 3V0FA 4O5LH 5LGHH 2QDWA 2NY4D 2JLLA 1FF5A 4KTEL 3Q8BA 4RNRA 4QPEA 1ND0A 5L8JB 4ZXBA 5I9QC 5IROA 4ZMWA 4FFTA 1NOLA 1W6LA 2X4RA 1IAMA 3GMMB 2BNQD 4JR9H 4IRZH 4XBEL 1VKXB 1PZ5A 3KPQB 1PQZA 4EZKA 1RZQA 2XPYA 3O3AB 1JGDA 5F7NC 1SY6H 3U2JA 1FIGL 3JWDH 3S88L 3GXUB 3VXOB 3WY1A 3D08A 4LHUB 2Q7AA 4PFEA 4Z7NB 1P7KA 2BW4A 4HKBB 2BWQA 1G7LA 1HIMH 5F9JB 4HEPA 2I32A 3RVUC 1NGQH 1MCBA 3U36B 2E7LC 3K91A 4GIOA 3TZVD 1NCWL 1WWCA 2J6EA 3ETBF 1T03L 3PP4H 3WIHH 5IHBA 4B60A 4N0UA 4AG4H 2WANA 2GABA 1W80A 5JA9A 4DCQA 3ZYJA 3O41B 3FW6A 5SWZA 3WXVL 5I15L 4A6YL 3RVTD 4F57L 1P84K 1C16B 1MWAH 3QUMB 1N6VA 4L3CA 1QASA 3QIUA 3OQ3B 3LN4A 2Q2LA 4JM2B 3NP4A 5FYJU 5G4OA 3KHQA 4BKTC 5J8OA 1CB4A 1G9NH 1Y07A 2CBPA 3VI3F 3ATFA 1QBLL 3GF8A 5A16A 1MG2C 1RK1A 1UQSB 3MRDB 2VR7A 2O93L 1K8DA 2X1OA 1BLIA 1M53A 1CXLA 1HHHA 25C8H 3G6JF 1IBGL 3L5JA 4KY2A 5F9WC 2VMCA 1Z32X 3H9SE 3KBEA 4AV5A 5AKVA 3W56A 3MRCA 3TP4A 4TVSa 3A6OA 4PV9B 4XMKH 1KJ2H 2E6PA 1FSKB 2B4CC 3FTVA 5HHVL 3SDCD 4AJYV 4DUVA 3QWQB 1A6AA 4M48H 3UJJH 1Q0XL 4UAOB 1NAMB 1GMIA 4I77L 1OGAA 5AFAA 3U0PA 2P43B 3N1QC 4CU8A 2Y1YA 1NC4B 5HDBB 5IJDC 4LCYA 2DH3A 3DMMB 1QO3B 3BDYL 3HJ0A 1IC1A 5HHXH 5E5RB 3QIBC 4P59L 4M8QA 2ZIDA 3QEUB 4PRHE 4Y16C 5I1LA 2VDOL 1HL4A 2ED8A 2R2EB 5DEFB 3MLYH 3RNKB 2I5YH 4M1DL 1SDDA 1XF1A 2P7TB 1BZ9B 1WBXA 4E9YA 1ZTXE 3L7FA 5GS1C 2X1PA 3P11H 2VWEE 4P4RA 4OLYL 1JYXA 4PJIB 5F97E 5IW3A 1EQWA 3T4YB 3SD5A 3ZDXE 4PRPA 2NY3D 2VW6A 1ZKAA 4PJDA 3GXPA 1E90A 3HHMA 3NJJA 4G6MH 2XZZA 5BJTB 1S78C 3V79C 1N18A 2Y0SA 5B38B 1H6TA 2IQAB 3MJ8B 3LS4L 4X9YA 2FO4B 4RDQG 4IKJA 4AKOA 4ECNA 5F9AC 5EBWB 3ZT7A 2FBOJ 2RJMA 2OZ4A 1M56B 2AEPH 3GMOA 4UQ2A 5DQJA 5F93C 3A6BH 1H3UA 4QRAA 3AB0C 3PHQB 5J3HD 4FFYA 1ZA3A 5CJOL 5E0QA 1ORQB 3PQYB 4E9QA 2VJ8A 1MCOH 4MD0A 4HETA 4F15B 2X10A 4YX2H 1OCOB 1YEKL 5C0GA 1JGLH 1AZBA 5D72H 3CDGA 1ZPLA 4XVTL 3JV4A 1XGYL 1KCVH 4M4RA 2F58H 1INDL 4PJFE 1MLBA 4JKKA 4MNQD 3L6FA 1P5VB 4KI1A 4PJ7B 1JMXA 2IADB 2OSXA 2ZUQB 3AWFA 3CSYA 3NABH 5EN2A 5I75C 4ZD3H 4NUGH 1VLXA 5DJYB 4OZIF 1T7ZA 1XF5B 1N2RA 5A2IH 5HYEA 2Y7QB 1IO4C 3EGSB 4R7XA 5A2AA 3GT6A 1NCDH 4L1SA 1TTFA 3MLSL 1J8KA 4WEMB 2X4SA 3H9HA 4CC4C 1YYCA 1XFPA 3L81A 3MRQA 1FLRH 1A4KA 2XBTA 3NCEB 1A7PH 2C1OB 2PCFA 3NZUA 3WXWL 1WF5A 1U91A 4G8GA 1H15B 4JRYE 1OPGL 3U9PH 2XWCA 3P9MB 3PIQA 4Y9GA 1NMAL 1TSRA 3UZEC 1UJ3C 1RFDL 3ARXA 3ZTNL 1LO5A 4ETQB 2H0JA 1XAKA 4BRVA 5A7BA 4JG0L 4B50A 3RX9A 3ZHNA 3ZW3A 4OZFG 1D7FA 3NDYE 3OZLA 3X12A 4JO1H 2ROYA 2IPKA 5I5MA 2OZ4L 4Y5YB 4Z9KB 5JXED 3UPCA 2WP3T 1FVCA 5FYLH 3QS2A 4FFYL 1VERA 3FT9A 1A4JA 4NLAA 4NRXB 3VQMA 3WO4B 5KYWA 5C92A 1R3LB 2EKSA 3I02B 4NLHA 5CZVL 2H1PL 3PQYE 1R3JA 4PU2A 4UANA 5EO9A 4F9LA 1TZOA 2K7PA 4L4TA 1QBAA 4CSZA 4QWWD 3FUFA 4QRRD 4MLIA 4P2CG 5DEZA 1JCVA 1R5VA 1KENL 1DVYA 1MWOA 5E95B 4LNRB 3DJTA 4NQEB 1QI5A 1F90L 4E0RA 4H8HA 2X3BA 5IESL 4BSWA 1I7UB 1DBAL 4PS4L 2MCAA 4YHKL 5BVJA 3NJGA 1S7RA 3K2KA 5TQ2H 4PJBB 4HUVB 1HSAB 1MVUB 2ITEA 3C09B 2BZCA 4QHNB 5E6ZA 4PRDA 4ONHB 3CJJA 3DETC 4L5FL 1E3FA 3IJHA 4DW2H 3IAPA 2G2PA 3TU6A 4LLWB 3VCLB 4HCFA 2NNRA 4EUPB 4NDMB 3UTTA 3ULUD 2R23A 2H1XA 3WLWD 3GGWA 5HGAA 4PJEE 4JN1L 3BPCA 1E40A 5AWNH 3ARPA 1CLZH 3MOBH 3QFDA 3EXJA 1RJLB 3GBNL 1M7XA 5HPMA 4D9QD 1PEWA 4OFVA 2GJPA 3GMQA 4Y4HC 1Z1WA 4PJFB 4DNLA 1NMBH 5GJSH 1F11A 2ED6A 3FQTB 4XB7A 1MREL 1SYVA 1EXGA 2JKLA 4G1MA 2IV9A 5J6SA 5HGDA 5I1IH 3D51A 1G0XA 3KCPA 3QARA 4TQPA 3KEHA 3D7PA 5DUJA 1JP5A 3NIDB 4GT7A 5IMKB 3FDWA 2ZYIA 4PVNA 4KO6A 2AFNA 1O5DT 3GK8L 1S9VA 5LGJB 5AW2B 3GLAA 1J8RA 3VUAA 4UAOC 2NY1D 5BMFL 4CL7A 3F6LA 3BUIA 2YD6A 5JIKA 1ET7A 1T03H 3ZQXA 1QI3A 3ZRSA 2ED7A 3RWFB 5F89A 5JXEC 3M07A 3ZQWA 2I27N 2NXYD 2W65A 1F0LA 5CEZH 1VZGA 3P73B 3VFPA 5SWSA 1MJ8H 4Q6YA 2YK1H 3I6GA 3LEYH 4FG4A 1J88A 4LLVB 1SBSL 2YMTA 3IDGA 4ISVB 2WXJA 4ZSOE 1IV8A 1W91A 3Q3GB 3QAQA 5GS1B 5F1KC 3W39A 5E2TL 1B4JH 5CSZB 2WWKT 4OCXH 5IQ7L 4U1KA 4PD4K 3UC0L 1B6UA 1U92B 3PGDB 1MG3C 2O5NA 4FFVD 2Y22A 3KWWA 3MNVB 1XWVA 1K4DA 4M5ZL 3U0WL 1MCQA 4MDRA 5A6IA 3D6GA 5KW9L 1LQBC 5C07D 4BXSV 2IC2A 4PJXA 4ZMYA 2BOCA 1OAUH 4JKLA 2Z31A 4K3EH 2ZQKA 4PV8A 4UM9D 4L3EA 5DZPA 5LDSA 3MRDA 2XRAH 4P2RE 1YC8A 5ALBL 4Z7AA 1FHNA 3MJ9A 4ZW7A 5GS0C 1MCIA 2DM2A 3U4AA 3TCLA 1SUHA 3HZVA 2MNUA 4PJAF 4PBXA 1U8MA 4K3JH 3TFKD 3ULAB 2A9NL 3KAAA 2VR5A 4WNQB 1IFHL 2CNZA 5DRNB 5H37A 3NRPA 2QSCL 3JV5A 4YBLC 5IVXB 1I9RH 2X3AA 1QWHA 3LKOB 3KYAA 4P2OD 3FU0A 4QOKD 5L6YL 2XPGB 1IX2A 2B2XL 2ZX9A 3S34L 3WEBA 4YH6A 2K3TA 3CVBA 3IDYC 2EDFA 2OR9L 3ES6B 1CBVH 3BZEB 3SYQA 1RUPH 4XXDA 1ZLWK 1QVOB 4QD2E 4PR5A 5SWQA 1MFBL 3SGEI 5HVHC 4IMKC 4XP6H 1T1WA 1WJ3A 4LSDA 5EORH 5T5NG 4MGXA 3L3KB 1ED3B 3MRJA 2IOMA 1F8TL 1WBXB 1JF1A 2DQIL 3VXPA 1FZJA 1XGTA 3P2TA 3Q13A 1D7DA 5DJ0B 3UTQB 4N5ED 1IC4L 3L45A 1AKJD 4M43H 5F1SA 4LBEB 5C0RL 4Q6IC 4TLUA 3ARFA 3IBOA 2GI0A 3KPSD 4EBQH 4J1UA 4FMVA 4ADJA 1E9OA 1FG2B 3GWJA 5A40E 2FYYB 1URIA 2AK1H 3Q05A 4AEHH 4HF5H 3GIZL 1DQJA 1JPFB 4NP9A 3ME0B 2Q6WB 2XIBA 2H6PB 1ODAA 4H1LB 2Y5TA 4HJGB 1J0YA 2V7HA 3QQ3B 5IZ7A 2AJYH 4MD0B 2H47C 3T3PF 5JW4R 1X5LA 2KERA 1T7XA 4GLRH 5D1ZD 1O5PA 2AK4A 2X4PA 3KEDA 1UJ3B 1EZVX 4AL8C 3IS0X 1KELH 5LBSL 3WXWH 2P45B 4J28A 4XPGL 1WT5C 2EKJA 1FVEA 3IT8D 4PBDA 4HK3N 2GSGB 1M1XA 4FXTA 4NWUH 5E2VH 2FJHA 2B7DT 5HYQB 5IM7B 4NXSA 5EOCL 5TDOB 1HTYA 1ADQL 1LL1A 2YSSB 1NCTA 1TQSA 3SKOB 1TJHH 1Y0LA 3OPZH 2Q8BH 2XN1A 2X4TB 5HHME 4WTXA 2WWMD 1QMUA 3ZGIA 3KL3A 3WKMH 2VOTA 4C8XA 4WNSA 5FR3A 5TF1H 3VXNB 4QO1A 3X11A 3BRGC 5E2UL 4BFGA 1RAMA 2NSQA 5D9SB 2F53E 3VFVA 1UWXK 4XMTA 1VFAA 4P46C 1CDYA 4P57A 2PCYA 3ZRCC 1ZWIA 4MX7B 2VR6A 1WFJA 1P53A 3O11B 1S3KL 5IHLB 2ZP8A 5IF0A 3QDME 1JGIA 4HJJL 4X7FC 3BPOB 1GW0A 3V9FA 5DJ6A 3KPRA 5T1LB 4N9OB 1S7SA 5EZLB 1HCVA 4XN7A 1Z6JT 3EYSL 5E2WL 4GQRA 4MJID 1RERA 1QR1A 2BSTB 2YC1B 2CRIA 4HOMA 1NCBL 5DTFB 3ZDZE 4JQXA 3BVVA 4I13B 3N6YA 4JAMA 1T2QL 4KBPA 1NGPH 3T2QA 3NCFB 4Y9EA 5J7CC 4N4YB 1YQVL 2WCPA 1G6VK 2LFGA 4PS4H 3OL2A 4GUOA 4Q9CA 1Y18A 3HN8A 5B3JE 4YDVB 1PX3A 3SCMD 4FGMA 1U42A 5GS0H 3QDGB 4JHUA 3AS3A 4PGEA 1IBFA 3QXDA 3VFNB 5ESVA 4DEWA 3BSZA 5GGRB 4ZFGH 1TPXB 3VX0A 5DVMA 4OZIB 2WWOA 2NZ1A 2BP8A 2ZT9C 3HI6L 4LNRA 1MF2H 4NKDA 5FW7A 4NKOA 4A1RA 3SGEH 1E7VA 1OL0A 2BVOA 5D5MF 1H6FA 1G5GA 4M56A 4R84A 4NRYB 3ZJAA 3MNWA 1BJ1J 2KPNA 2R0ZL 1FGVL 4BFEA 3GO1L 2CBTA 4F33B 5DZJA 1W0WB 5LCVA 4RVBA 1VESA 4B27A 3D85D 2CUMA 2G5BB 3SE9H 1OTUD 4M4PA 3REVA 5CGMA 3KMDA 1H3WM 4PJBA 3RWGA 4BJLA 5EU7E 2ATKA 4WWKA 3N41B 4QTHB 4G5ZL 1U2CA 4R4FH 1HSBB 3Q06A 3CLEH 5HD8C 4NO5A 3N44B 3UO8B 1BGXL 1B9KA 3O6LH 4P06A 2HN7B 3MYZA 5CILH 4NX0A 3U30B 3VJ6B 2Q8AL 1NGXA 2MWCA 5ANMB 1VIWA 3C6SB 1RJLA 5H37H 4U0QB 3VXUA 1PLAA 4LSVH 4CRPA 4PJFA 1BVLB 1Q4NX 5CMAA 1JCKA 1KMGA 4W9DC 5FA4A 2G9HA 4LPVA 4N25A 1SYVB 5KG9B 1K5WA 4WVRA 2VLRA 2WXNA 3L4UA 4KNSA 4X9GA 2VIRB 3JTTA 4LKCA 4UIMA 4YK4C 2EYTA 2IDFA 1DLFH 3ELAT 2W81C 5BZDA 2DL9A 4KFZC 5EF0A 5CEZL 3TEZA 4LCVA 3L16A 2QLVB 1OARL 5IMKA 1LD9B 2ZWNA 1BQLL 5L8KB 2KBGA 2RQ8A 4IIZA 2ZNXA 1V3JA 4EN3A 4HZAA 5JHDB 3RVVC 2W59A 1TTUA 4N2DA 4HC1L 4H2CA 3TBYB 4C56D 1U3NA 2MFNA 4FQXD 2XZAH 3NCYP 3UADA 4CVXA 5DD3L 3MRRA 2MSPA 2WCGA 4U1HB 4U6XB 4M62L 3H4FA 2F8VA 2FWOA 2CR3A 3HE7B 4Z1PA 4IGBD 2GITA 3QVAA 2H6UA 5GRZA 1NCJA 4PJ5D 3O2WL 4TN9A 2FBJH 1P2CB 4JDVB 4LLVA 3B9KB 1CZ8L 1M7UA 1JTOA 1NDMA 4ODVH 4UDUA 4QHKJ 4PYGA 3SDYH 3MCLH 3W39B 4MCZA 4CDHA 4P3WA 5GSVB 1UZ6E 3PNWB 4WFFD 5ISZB 3CH1B 5F0LB 5A6LA 1BZOA 1HI6B 3TPUA 2MHAA 1TDQA 1G43A 3G6AA 2AV1A 3HMWH 4TVPH 4XH2A 4P0DA 2VZSA 35C8L 3M8OL 1MQKH 3QNZB 1SM3L 3FU9A 5FGSA 3PJLA 1ASQA 1CE1H 1T5WA 2WMPA 1ZGLP 3BH8B 1KF9B 1BYPA 2PXYA 4GEJA 5TQ0H 4MS6A 5DWPA 5KVMC 1U58B 3AABA 2O6EA 4PV8B 4JPWL 5FM5O 4WHYG 1IBBA 1M05B 2WBJB 4P4KB 5E24E 3UO1L 4OJDH 3APCA 3MLRH 2X4RB 5F1NB 4AQZA 3PFQA 1IJNA 3ZYIA 4B9FA 2O6PA 3FBQA 4AT6A 2HRPH 2Y24A 1NCCL 5FYKH 3B9DA 5AOKA 4M02A 4TQIA 5JR1L 3KLKA 4NZRH 4OF8A 3WJJC 1JZIA 5GHWL 5EF1A 1AR1B 1Z9PA 4HC1A 2XVLA 4ABUA 2MNJB 2NZIA 1NFDE 2DMBA 3HNVH 2OXGB 5CINH 5EZOH 1D5IL 2OI9C 3CSFA 3RVUD 2OYMA 5HYIA 1A3RH 3PDGA 1OY3B 1YMMD 3QQXA 2DKMA 3UL4A 3IDNB 1I8UA 3PUCA 3QEGH 1A7QL 4OLZH 4N0UB 2C9AA 5D55A 1OIOA 3H4HA 4BH8A 3RZCA 1Q1PA 3SQBA 4D9RD 1FBIH 4UQIM 1SJMA 1A4BA 2AABL 1T6VN 1AD0B 1EO5A 3NFSL 2QQKL 4N0FA 2XYCA 4L8CA 2FX7L 5F72S 2K6WA 1ZT4A 3BAYA 3QWOB 4KK9D 1KJVA 4OGZA 2JK5B 3DVFA 1CS6A 1JNLL 1AR1C 1MFUA 2OP4H 1YEGH 2QVFB 5DJAA 4NHCH 4ZW8A 3EH1A 4WHTB 4JG1L 2BS9A 1KEMH 1OLLA 2ZYHA 4J1UB 4UQBA 5F8RC 4LLMA 6FABL 4J5VA 2FYYA 2I7SA 5IHHA 3KLAA 3UP1A 3JTBA 3IWUA 1JGUH 1ORSB 3QORD 3O3BA 4HUMB 4XVOA 2DICA 3GSNH 3QXAB 4Z3JA 3F2LA 5TDPA 1UYWH 1AG6A 1E27B 2BZ7A 2F5AH 3DDFA 1CK0H 3CZNA 4EI5A 4LZKA 2GY7B 1PTZA 4ZPTA 4OD1L 1WAEA 2Q8BL 3MRFA 3OPZL 5G5DA 5ICYB 5LCVH 5EFIB 2VZTA 3D05A 1EJOL 4WY7H 4GLRI 3SPJA 5D7LE 3PFUA 4Y16D 1GC1L 4DHLA 1BJMA 3DXAE 3QEHB 3UTPD 1T0MB 1S5IH 2P80A 5GRJH 3ULUF 1HXMB 1NAMH 3AQXA 3LNIA 3RDTB 1BZ9A 2Z65C 5JW5A 2XN0A 4KK6D 1OAXH 3LKNB 2FWLB 4FQXA 2H0PA 3EDKA 2G4EA 2ZSVB 4PJIA 4UILL 4AWJC 3ASWA 3I2CH 4Y1AA 5EWIH 4XCNA 1G9NC 3B7SA 5KYNA 4M6NH 1ILUA 1UCTA 4JQXC 4MJIA 4CSPA 1AGCB 4OCSH 3ARSA 1S78D 1TZGL 4LSRL 2X0WA 4QRUA 1AQHA 4KHXL 2WIIB 4MXWL 2XT1B 5FV1L 1RHHB 3L3GA 4NN6B 3B8SA 3VXSE 3BIKB 5F9OH 5CFHA 1MI5B 4PG9B 3CBKB 4LPUA 4N8CH 4NM8H 3SE6A 3DJZA 4BHUA 3BN3B 5LUMA 2DRUA 1EFXD 1PSKH 3CMOL 4K9EH 1GAFH 3U2SB 3ULVF 2VDNB 2AGJH 3DDGA 4MWFA 3SJVE 5EZLA 1BIIB 3ARBD 4LQFL 4Q0XL 1JPSH 5T1MA 2MPAH 3UZEA 1RL1A 3G7TA 4AQAB 2B1AH 1KN2H 4PJDF 5D7JB 1K6QH 1P5VA 4PJEF 3D85A 3P0YL 3E0GA 4ZYKB 1LP9A 4YHIA 1PDKB 3DV6A 2D9CA 1TMQA 4ABWA 4B9KC 4ZS7L 2GTQA 3IKKA 1FZMA 1XF5A 3AS0A 4IOIB 4XN8A 3X1EA 1UFUA 1JI2A 1EEYA 3GZQA 5D1QB 2QEJA 2ZXDA 2PPAA 4MCMA 5E70A 3MLTA 1NL0L 1C5DA 3NZHH 5ESVB 3VXRE 4JFED 4QYOA 1XCQB 4YJZL 1PLGL 2ALAA 3LIZH 3CLEL 5T3XL 1OANA 5BXFB 1JXJA 1EERB 4C58B 1CI3M 4G8GB 2B1HH 3KLDA 3V6OE 4XN2A 2CMRL 3M17A 3CLFL 3JWDL 1NH6A 1H8LA 2FWUA 3D18A 3Q8EA 2YD1A 1D9KC 2VDPH 5FYJD 3REVB 4ELMA 4K94L 3CD4A 5DI8B 3TVMD 1A1NA 2OCJA 3C8KA 4UM9B 4HIIA 5HJ3B 1DR9A 5LQBL 4XVSL 1KCRH 2C1PA 2ZUVA 4WJ5B 5DJXB 4HUCA 5FOBB 5IFJA 4KJWC 1N7MH 3QUHA 5MERB 5LWYL 2D7PA 4K23H 3QPKA 3QJZA 3ZE2F 4ODTL 3SGDI 4CMHB 2IH1B 2I07B 3TWCL 3N42F 3CK0H 4KVPA 3GXFA 2I60H 2Q2EB 2X4QB 2EKSB 1YEEL 2J72A 12E8H 1CD9B 1R19A 1U95B 3MRBB 3Q2VA 3AG2B 4MFHA 4TUJB 4D9RE 3AY4A 2VDRH 5F7HA 2VGLM 2AANA 4ZMXA 3KH3A 1ZHKB 5T5FH 5EBGA 1EXUA 4M62H 4AZ8B 3DVGA 2EIJB 4DVBA 2FHCA 2J1KA 3C87A 3SDXF 2LU5A 4MAYB 3K80A 4KGJA 4F7EA 5J89A 2OR8A 4GSXA 4NZTH 3QUZB 4FJYA 3QRBA 3K3QA 1PJ9A 2WLHA 3EJPA 3SDCC 2LV4A 4JRXE 4MBOA 4DTGL 5GGTH 4BFIA 3E6HA 1GC1C 1RY7B 4G9DB 4QI3A 1UM5L 1WG3A 3MSPA 4D0CA 3MMEB 3V6ZA 3IB4A 1R24B 2Z4TA 3O4OB 4OZFA 3SKNB 4UM8B 1NANH 4HJUA 5IOPA 3BFOA 3DYPA 4JL2A 1HSAA 1JTTA 4V1DD 1KXQA 4YGVB 1FPTH 2PTUA 1NIEA 1KBBA 1P4BH 4XRCA 3QJHA 4K7PH 3OKYA 4PI2A 4YXKH 1IT9H 3I50E 1R34A 5BRPA 3ROOB 2JCCE 4P9HL 3KGRA 2H0FA 2JNZA 4W4OA 5T5NF 3L9YA 1AO7E 4I0PD 5HPMB 5GZND 3CUPA 2MHAB 1PKQB 2D4DA 4CMMB 4D2NA 3Q9PA 4XP1L 4Q6IB 5KVDE 3EYOB 1ILSA 1L0QA 1OE2A 1QUNA 3HHRB 3RL1B 5CN1A 2E7LA 3EZ8A 4UAHA 2BDNL 5SX4H 4CU6A 3Q0HA 1HCYA 1C5CL 3MRHB 4G6ML 4PIBA 3A3YB 3D39E 3IFPA 4LCUB 3FUKA 4GRWE 4IBQA 1CGXA 3LN5A 4ALAC 1AYOA 1TQBC 3VD0A 4XHJD 3FT4B 2WWNA 5J3HC 1G7QB 1R4XA 5EOTA 1GRWA 1TQWA 4NUJA 4R97C 4GQQA 1WK0A 1KN4H 2EDKA 4JQVA 3GD1C 1KNOA 1N9PA 4NO0B 5T1KD 1AXTL 2CLZA 2QSVA 3FQ4A 1AQMA 2V5TA 5D2NE 4PJ9D 5I16A 3CFEA 9PCYA 4S1SH 4X6EB 4XVTH 2X9WA 3ARUA 4PJCB 4X5XA 5F7MC 1Q1JH 1RSYA 1ZT1A 2X70B 4CSTA 1SJHA 5IB4B 1JRHH 5FOJA 1PD1A 4R5VA 3U9UA 3WNMA 1NBYA 3ARGC 4KQ4L 5ITBL 2M8XA 3C08H 1H9DA 4UOZA 4ZFFA 4HIHA 2EDRA 2VNCA 3S4SG 2FEDD 2MQGA 2FNBA 3U25A 4OZGB 3KWWB 1RV6X 4JFDB 1MPAH 5D93B 2AK4D 3SODB 4PG2A 3SOTA 1EHNA 3KE0A 1JGUL 2CIIB 2QADB 3FUHA 2BSBA 2EIMB 3H85A 3U4BH 2VO5A 3ATBA 1JWUA 2X9YA 5KSUA 5AD0A 1EAPB 3KPSB 2XN9A 4RISL 1OOWA 5L9DH 3KJ6L 1QRKA 2ZWYA 5B8CB 3I85A 2YD8A 1UB5A 5DZLA 1FGNH 5EF3A 1VADA 5KBNC 3SN6N 5F96H 2DQHH 3FT3B 4FULA 5J4MA 1VZIA 1ZDSA 2PCPB 2XN9E 4JO1L 5C9JB 1NJ9B 3IRZA 4AGNA 2P5WA 3F83A 2QHRL 3SDDC 3GUTB 3EYFA 3GI9L 5KBDA 1G7MB 1YEIH 3LHAA 1VPOH 5AW3B 2W0PA 1B2WL 3D50A 4W4NA 4YHZL 3GMNB 4PP1D 2EYRA 1E27A 3WSQH 3FT0A 4D9LL 5FO8B 3QDJB 2AQTA 4NQDB 2I9LB 3ES6A 5DMIL 4PW4A 3TIEB 4N3TA 1NIFA 1NKOA 2F53B 1G6RA 1C1EL 4E9SA 3DOSA 2H3NB 4KJPC 2EH8H 1I7ZA 4Y2DD 5GS3A 1ZK9A 3IDXL 4F7CB 1DANT 4TUUA 2C3GA 4UV4H 4IS6A 4AIZA 3IEAA 5TE6H 1GHFL 2A4CA 2EDXA 4EN3D 3Q1SL 1DLHB 2J6EL 2V9QA 4NT6A 1IM3D 1EJ6A 4ZTPL 4NC1C 1IM9A 3RDTA 4N90D 3TYGH 2VZ1A 3MV11 2B20A 1CT8B 4JFHE 2P3YA 2ZSVA 3T77B 4KRPB 3T4AA 1RUKH 3CFNA 4ODSH 3OXRA 4PAZA 1NCAL 3QHFH 4LBEA 1CF8H 4UB0L 2X7LA 1A4CA 3PGCB 4XX1E 4N0YH 1CDJA 1RIVL 4M3KB 5DGRA 1HWWA 5JMOC 1DVXA 1D7CA 4PY8I 3RJOA 4HXBH 1GSKA 2XA3A 3WN5A 3PV6B 2Z0BA 4JHAH 1EH9A 4RGNC 1EGJL 1B0GB 2ZPKL 3WLWC 5EBLA 2FWSA 3RI5K 3MGAA 5BCAA 4BRJA 5FB8B 1H5BC 1KCKA 5SV4A 2NY4B 3F85A 5I6PA 3V2AR 1SN2A 4FKEA 3V4VL 1U8NA 4G7VL 3QQ3A 1HWHB 2B5IC 2DW5A 2QSQA 1JYNA 4N0RA 1SOSA 3IFOB 3AJ7A 3L4CA 4HA1A 2GFBA 3ROLB 3GSOB 1AZNA 1D9KB 3PWLA 5T1MB 4X9HA 4AJWA 4DGYH 2K1MA 3RIFF 4TULH 4IYKA 5DYFA 2CBOA 2FNWA 3UGEA 3RJDA 5T3XH 5D2NC 1PG7H 3V6BR 5IB1A 4W1TA 4Y19B 4K5OA 2AI0L 2YWYA 3NJHA 2H32A 4ONGH 5GSRB 4Y1TA 3T9WA 4H5SB 1CICB 5HBBA 1TEFA 4ALAH 2A99A 2VDKB 3WO4C 2JKXA 3VXTA 4LRIA 4HJ0C 5E03A 4QRPB 1DCLA 4QRQA 5D7IF 1I8KA 4IBZA 4M61A 1SQ2N 3JWNE 4ILDA 4ZPVB 4APQC 1JHTA 1CFBA 4L29A 3K6SB 1T1YB 1IGFH 4GIAA 1KYOK 3CDCA 2AJUH 3DJSA 5CJQL 3TS8A 3VXQB 1L6XA 2ADIA 2XPZA 3K6NA 3VFVB 3VWJC 3NZ8A 3D18B 4YHKH 4P2QA 2H9GA 2VLJB 3G6JE 4P46D 2FDBP 1ZWIB 4MX7A 2VB5A 3IF1A 3MRPB 2J88L 5AUMA 5IF0B 3MNMA 5D4IA 1DUYB 3KYMB 3HC2A 3NAAH 5JNYB 4A04A 1CLOL 1P1ZA 5HPOA 3ZU8A 3QFJD 4CNIB 4A67A 2Z1KA 4MA8L 3ZK0A 3DTUB 4BSVB 4KROD 4TKWA 4X4XA 4YLQT 1A0QL 1AMXA 5IWLC 5KSAC 3V5KA 3CIAA 1F42A 5KS9A 4A7VA 4NO2B 2HCZX 3MRBA 2WTRB 1MRCL 2FEEI 4KRLB 4LARL 1UM5H 4Z7VE 5J11C 4GRLA 2ZCKL 1PS3A 2V4LA 1GGCL 2PWDA 1ZV2A 2P48B 4C83A 1Y7VA 1Z9OA 3X13A 1ZLEA 1FYTD 1CMOA 3I9IA 2XXMB 1O7VA 4CJ0A 4G8GD 4RGND 5EUKB 3SDXB 4M7KL 2KPWA 1L5GB 5DUMH 1ZLSL 1U8IA 4HKJB 5C07E 8FABB 2TAAA 1T1XB 1YN6A 1M7DA 2OI9B 4PGJA 1MNNA 4G2AA 4C47A 5DS1A 5I8KH 3V6ZB 3EJRA 5E8PB 1DDTA 1EAQA 3ARGB 1N0LB 4IDJL 5AAWC 2VR9A 5TJWK 1X9UA 2VDMB 1DQVA 4I5BB 2QPFA 2WBKA 2AXWA 2D2CC 2XZQL 3AXLB 3OKLB 2HN7A 5JXEA 5FHAL 2AJ3A 3FQUB 2ZKMX 1L7TH 1OT4A 4OUUA 1DQML 1U8HB 3HBQA 5LXGH 1E8ZA 3Q48A 3CUPB 3ULUH 3GXIA 3BKJH 1OAZH 2BP3A 3FCTA 2G9HB 4ICXA 3DO7B 3DX3A 5DQDH 3JUYA 4X7CC 4YSCA 2CGYA 4RRPM 4WI8A 15C8L 2IFFL 5FCSH 3TEYA 3FQRB 5IB3A 4F1SA 3U2GA 5DURB 5F7EL 4JVWA 1IGMH 3FS9A 4U1SA 4JM0A 4OGAC 1L9RA 3VI4B 2DQDL 4NP4L 3QG7L 4HK0A 3OMIB 4XPTL 5DD0L 1FFRA 5CAYB 1VCBC 4CN6A 4KHTH 4IBLT 4MS8D 1EUTA 1E2VA 1OSPL 4EN3B 2QMKA 1OW0A 2NY5H 2WPGA 3BD3A 4FNRA 3IVKA 2VITA 4F2ME 2WBWB 1JPST 3TTSA 2PNDA 2FK9A 2IGFH 2XN2A 4LDOB 1HX0A 1ODUA 3BAWA 4L37B 4U1JB 3MGTA 4Z7WB 1PQZB 1BPVA 2H6OA 3QUGA 1W9XA 4OSUH 4YXLH 1NGWA 2Z31C 3DX6A 3UJIL 3T6XA 3M46A 1BQHA 2F54E 4X5PA 3B2VH 4AYGA 3EFDL 1J8SA 3S3CB 1CE6B 2F5BL 3M1OA 2VC2L 5EG6C 4PJBE 4Z77B 2X70A 1MXDA 1NDMB 3M88A 3RPBA 1E6JH 1IAIM 1RUQH 4FXKC 4LVNB 2WB7A 4JO2H 4HUUB 3U9UB 2YAOA 1F3JA 5GGTA 4JPSA 4PJAB 5C3IA 2VERN 3J2PA 3CH1A 2P4AB 2QTEA 2WQUA 4IKIA 4J3VA 2YBGA 4G9FA 4N68A 3CN0A 5SWZB 3VFGH 2UY6B 3SGJC 3ZMRA 1TVDA 4F58L 2VTFA 4MJ2A 3RGHA 4TNEA 3WMQA 1JYWA 2GUYA 2D03L 3OGCB 2QHRH 3BH8A 3STZA 1A6TA 2A1WL 1M57B 3EO9L 2WQ8A 4YUEL 2E86A 2YBRB 3E2HB 1I3GH 3BVWA 2HJFB 3WUWA 5JQ6H 2OMZA 2GKIA 4XAWH 1MRDH 3QFJA 1KJ3H 5DS2A 3O8XD 4LU5H 1DJZA 2J5LC 3CAFA 1B3IA 3QEQB 4EBQL 5KJRH 4K8RL 5CR1A 3DRQA 2A6KB 2XWTA 2Z93A 4L0ZA 4D0BB 2ADGB 1ES0A 4FXKB 4LVNC 3OF6D 5E7FA 3IDXH 4OB5H 3MLSH 4PJ5A 2KLSA 1XSIA 3EO0B 3HZYB 4LCCA 2XV6B 4JKWA 1Q9LB 3HBPA 3OC5A 2OAAA 3PAVA 4AQ1A 1OGAB 2WWKO 2IBBA 1NCBH 5CP3H 2I9LA 3S2AA 1EXHA 1XZ0A 4UQCA 4RGNB 2VXTH 4WI7A 1OTTD 1QO3A 2VXQH 3K1KC 1YCSA 2LTQB 1EA9C 4Y9FA 5AKTA 3KXFD 4AVJA 1KGWA 4MNHA 4LL4A 3DBXA 3Q6FB 4ZW5A 2F7RA 3HNSH 5ID0A 1CYXA 1KB9K 3NJNA 3WFBL 4NWUL 1AMYA 4U6VL 3EW3B 1LE9B 3BZ4B 5JLZB 3LRKA 3IAQA 3ZSTA 2CKBL 4FX5A 3ZT5A 5KYXA 3AADB 3V52H 4L8CB 2ZPKH 4P4RB 2ESVB 3QDMA 1F4YH 1DVQA 5FYLL 3MRMA 5E4IA 5I66A 4FTVB 2X4UA 1MFDL 5LAXA 3G5YB 3MV7A 3MKKA 4IRSD 3ZKMC 3PPSA 5BJTA 4Y7OC 3LZRA 2YPVA 3U1PA 1NFIA 5FUOL 4BK5C 4NGHH 2AJXH 4NKIL 3QJVB 4CMHC 5JIIA 3F84A 2AP2A 3FTYA 3RIKA 3VXMD 2UZYA 5CXPA 4LRNH 1K4CB 4XBEH 5IHUH 3GMOB 4UQ2B 5E4OA 1KBWA 3LQAL 1JG9A 2X2YA 3MJ9L 1EMTL 3B3IB 4QLWA 2CXGA 4OKVA 5BOJA 2J25A 3DX7A 2JTYA 2OTPA 3QQDA 3IE4A 4GH7B 1AC6A 1DQDL 5ACZB 3MBEB 5CZXC 4Q97A 4WLCA 1DEDA 1QG3A 3UMNA 4UTAL 1NGZA 1ZS8B 4S10A 3GHEH 3TBVA 3GSOA 5KVFL 1S8DB 5HYSA 1DBAH 3C5ZA 1ZHLB 2TSAA 5MI0B 3CWGA 4ODXB 2CDFB 3HTLX 4LPCA 5ANHA 2ETWA 3IMWA 3R8BB 2IADA 3ULVD 5MEQA 2VDLB 4TUKL 3IRCA 4G83A 2JB6A 4A68A 5C0CB 1DE4A 2GSIB 3TBWA 5JW5B 2H32B 2EDHA 2HRLA 3IFNL 3LQMA 5J13B 5C6WH 4XWGL 5F6HI 4PGBB 3RVVD 4FQXB 3ALXA 4XBMA 3V0WL 5F6HJ 5FO7B 5KSAA 5IWLA 3BX7C 1JS4A 2GC7C 1F1DA 4NFDA 2WYTA 1G1OA 3ZE1E 2YXMA 4GXUN 5F7UA 2EC8A 3Q1EA 3HS9A 5B3SB 1A6VH 4PWEA 5HDBE 5L0QC 3BIKA 4L9DA 1CFNB 1INQB 4U6HA 3L17A 5IQMA 5DLMH 3OTTA 3SOBH 2GVYA 4NKMA 3QQNA 1N0XH 1U9KA 4KKLD 1WFNA 3LOWA 3DGDA 1WD9A 2AERT 3SIKA 3DO4A 2ZX6A 3SJVD 1DANU 2O72A 2YEVB 1XTLA 2DOCA 3O2DA 1IAII 3BGMA 1OCCB 2F74A 2O5XL 4NCC2 3PWJB 4PWJA 1T20A 3CTTA 1MH5A 4X4MA 1QFWL 3H3PH 4HK3J 4LKXB 4NQCD 1OM3H 2D7TL 2MOGA 3LPFA 1TQBB 1PNDA 3IGFA 1KG0B 1GMEA 4ELDA 4MZRA 4QUOA 2DQ6A 1UZ8B 3UZQB 4DP2X 4L4TB 4OQTA 4G6FB 3VD1A 2DTML 4C83B 3MLTB 4JNXA 3QIBB 4UOQA 2I25N 4OCXL 1AO7A 4HKJA 3MROB 3AAZA 2LU4A 4Q52A 4JHBA 4HG4K 2VM4A 3GBML 5D1XC 1AO7D 4LL1A 1JZDC 5I5RA 1YC7A 4YC2B 2R8SL 2ZOLA 4UQAA 5AW9B 5CZXD 4PRBA 2DIAA 1S7RB 2VC2B 1BW8A 2X53A 3DROB 1MHEA 4YHPB 4FQ2H 2WZPA 4BQCA 1CDHA 2C1PB 3D12B 3L7EB 1VFMA 4KJWD 3WJLC 4ELMF 4K7FA 5ACMA 4TS6A 1AD9A 2RH0A 5FAAA 3U2HA 3GGWB 2ORBL 1MI5D 3S8FB 2E7CA 4PP2B 3EO1A 3U7WL 1X5JA 1UD2A 4IRSA 4G43B 5EU7C 4MXVE 2WXRA 4L3ED 4TVPL 3UYPA 3O2DL 4BFNA 5B8CC 1IMHC 4IOFD 4JDTH 4OZHA 5FYKE 3LNGA 3MV8B 2VH5H 2ZJSL 3QA3B 5I1JH 2GUOA 1JNLH 2KYIA 5CP3A 2XTJB 2ITCB 1OAQL 2R51A 5DD6A 3W2DL 4YHOL 4E42B 3OZ9H 3VI4A 4WSJA 1BFOB 4ZOBA 5IB5B 4GW4B 4G6JL 4NN7B 1WLHA 4H0LC 5BQDA 3LZQA 4LASH 5C09D 1S7UB 1A7BA 2VITB 2EJ1A 3IAGC 3Q2CA 4DO4A 5C7XH 4L8SC 5KVDL 3MLYL 4L37A 2BCKA 4BDVA 5K59F 1P1VA 3MRGA 3QUYA 2A5UA 2ITDA 4N20A 3DO3A 1LQSR