4GSXA

High resolution structure of dengue virus serotype 1 se containing stem
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
402
structure length
390
Chain Sequence
RCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEVTNPAVLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDTNFVCRRTFVDRGHGNGCGLFGKGSLITCAKFKCVTKLEGKIVQYENLKYSVIVTVHTGGTIATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNEMVLLTMEKKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLVTFKTAHAKKQEVVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKLTLKGMSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGKMFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a dengue virus envelope protein late-stage fusion intermediate.
pubmed doi rcsb
source organism Dengue virus 1
molecule tags Viral protein
molecule keywords Envelope protein E
total genus 67
structure length 390
sequence length 402
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gsxA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4gsxA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4gsxA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4gsxA03
1SVBA 2R29A 4L5FE 4UTAA 3MUUA 5AAMC 3UZEC 2JSFA 1OANA 1S6NA 4FFYA 2H0PA 4GT0A 4UTCA 5LBSA 4BZ2A 2I69A 3UYPB 3I50E 3IRCA 1OK8A 5LBVA 4AM0Q 2ALAA 1Z66A 5KVEE 2R69A 5IZ7A 5H37A 5KVGE 3J2PA 3J27A 2GG1A 5JHMA 4AL8C 5GZOA 2JQMA 1PJWA 4UT9A 4X42A 4FG0A 3N41F 3N43F 5AAWC 1OKEA 2P5PA 2V33A 1Z3RA 3C6EA 3N42F 1URZA 4FFZA 4GSXA 1TG8A 4UT6A 2JV6A 3UZQB 5JHLA 3N44F 5KVFE 3VTTA 5KVDE 3G7TA 4BZ1A 3WE1A 3UC0A 1RERA 3N40F 3UAJA 3UZVA 5B1CA 4UTBA 3C5XA 5IREA 2HG0A 1UZGA 4ALAC 3P54A 5LCVA 5GZNA 1ZTXE
chains in the Genus database with same CATH superfamily
1OSPL 1NGPL 2Y0SA 3O0RH 3EDKA 4ZQKB 4NENA 1A7PH 2APFA 2E76C 4I0PA 1BAFH 1GGCH 1EXUA 4B9JA 2YD8A 2EKSB 2IDSA 1L4IA 1XH2A 4RZCA 2W92A 2ZCLH 1V27A 2Z8SA 3VD5A 3ULUE 3FUIA 3HUJF 3D18B 4HAGA 3IPFA 3L2LA 1X3DA 4C4UA 2G0LA 1YMME 4I77H 3X13B 3ZPDA 4ZUVA 3B5GA 4L18A 3DX0A 3VVVA 1HZLA 1W0VB 3W9EA 4HULB 2EAEA 3RVXD 5GGVH 3RWCB 4PB9H 3BH9A 1EDYA 3VWKA 3EYVA 1ZTXE 1H8OA 2HTLC 4Z7OF 2VXQA 4HD5A 4HGKC 4WIQA 1U8PA 3DV4B 2ZXDA 2R69A 3AFLA 3TO2B 2VXQL 4UYQA 1CFSB 5F89B 3ARSA 5CN3A 3PGFH 1TYEB 3VE0B 2QPDB 1TJIH 5JR1L 3VGFA 1RH8A 4PGZA 5CJ8A 5HGHB 2O5XH 5DHVH 4NHCL 4JPVH 4I48B 1WP6A 1M6OB 1MJ8H 4ENZA 1EXGA 5I1LB 3CN2A 4JN2B 1BLNA 1J0HA 3ABZA 1S3KH 3I9GH 4QNPE 1QEWB 3A0OA 2ZOOA 5I6XC 5LCVH 3BHBB 3SKMB 3WJLA 1DQKA 2DQEL 3ZSSA 4YX2H 3FB5A 1AHMA 2MEJB 3MBEB 3OSKA 5EU7E 5TFSH 3A6OA 4KH2A 1UT1A 5LVEA 1B0RA 4ZX4A 5T5FH 4BFFA 1T22A 4OZGF 4NGHH 5CMAA 5A2LH 5KVGH 2ZE0A 1QFPA 2AFNA 4G5AA 5I1KL 1DUYB 1JI1A 4MZ2A 1M05A 4JUSA 5KANG 4NKOB 1HINH 2WHVA 3V4PB 2OULB 4GT7A 2WVTA 2ZWSA 3NACH 4EXKA 5DJXB 2WVUA 2R1XA 1E65A 1BZ9A 1NGWA 2D2OA 5LBSA 1RZQA 3X2QB 1I3VA 2NYKA 1RZKC 2PCXA 2WMPA 5KWYC 3RYMA 1JNLL 4JRWA 2GVYA 4AKOA 3OJDB 2A74A 1GH7A 1XSIA 2PTTB 4X83A 4BZ2L 2GJ6A 1C5CL 2HWZL 4F7TB 4GAYB 1C9SA 4PV9B 3KLSA 4G82A 5DJ8B 5IB4A 1HSAB 1HCFX 1PNDA 4XXDB 4QHUB 1ZK9A 1A6UH 1ZHKA 2B4CL 2F68X 5ITBL 1NKOA 2IANE 2VITA 3IJHA 1TXKA 2BOLA 2BVPB 3L4WA 4OF7A 4NZRH 4HS3B 2CXKA 3DETD 3VQMA 1E7UA 4P5RA 4R26H 3BW9A 1ZHKB 5H37H 3PFQA 4JL1A 1YRKA 5FWQA 3KPSB 4X80L 3REVB 1MH5A 3TV3H 3A4DA 4ZFGL 2H7WA 3ZK0A 4KKLD 1P7HL 3KXFA 3VFGH 4OUUA 2UXVA 3TBCA 3V0VB 1HOEA 3MNZA 2YMXL 4KKPA 4JPQA 4U6HB 3FTWA 1S7UA 4OFDA 3VTTA 2UX6A 3L3KB 4P2QE 5I19L 2J8UA 3MRDB 3CDZB 1SF3A 2FTAA 4TPRH 1RSFA 3DBXA 3W81A 5KZCB 1WYJA 5JPMA 2G5BB 1CLYL 3AS0A 3Q8EA 3RGBA 1BJ8A 3B2PA 4HIIA 1YZZA 4OSUL 1XDTT 4WUKL 2EYRA 4JM4H 2FATL 2Y07L 4MCYB 3GSNA 5D70H 2QFPA 3RVVD 3INOA 4AIXA 5E4AA 3DJRA 5BMFH 1ZKAA 3A23A 2PCPB 1DEEA 2VM4A 4HSQA 2AXGB 4I2XA 3RX8A 1HHJA 3TPKA 3L1OH 3SSGA 3QQDA 3NIDB 3RPIA 1WZ1H 5HDRA 3GHBL 1IFHH 3ZKNC 1UGNA 3DGDA 4I8DA 3AXLB 2SEBB 1B3IA 5F7BA 5JYMA 2ZSVB 5K9QG 1P4BH 1DJIA 3MLTB 1UVQB 2EE0A 1G5AA 1XQ4A 4FLRA 5KAQF 3HHSA 1AGCA 4YVUA 4P5TD 2R2BA 1OCCB 4FQXC 4KDTC 2H3NA 1KT2A 3QIBB 2NXYB 1IL1B 2R1WB 2WCPA 1GPOL 1PVHA 4QLWA 2AI0L 1JVOA 1OGSA 3KD4A 3CNKA 4J3OF 5K9KA 2X2HA 4AQ1B 5DVKA 3SQBA 1R46A 2YFNA 1YUHA 4AYEC 4JMNA 1UTDA 1V7ML 3H42L 1MVUA 4QWWD 5T3ZE 2ITEA 2K9UA 1IT9H 3IBEA 1I1RA 2Q76B 4K3HA 1OF2B 4FERA 3VXOB 5AOZA 5F3HB 5I66A 1KCUL 2J4WH 2BW5A 1UADC 4TUOA 3MJ7A 4TVPE 4G7SB 1F58L 1ET5A 1R5WB 2R56H 4L4TE 4PRPD 2G5RA 4N3TA 1BWMA 1VEPA 4X4MA 2W91A 4EPSA 1FSKB 2DLTA 1VHPA 3C60A 4L3CA 5JNYB 4TV3A 4D2NA 1PFOA 4QTIH 4Q58C 3EJRA 1CYXA 1YJDC 2C9AA 3O3AA 4M43L 1H5BB 3DX7A 4L8CA 4K9JA 5DQ9B 1BD2A 3HZVB 2MNWA 1DYZA 1WEJL 4ZFZA 4QRRA 1HDMB 5C3TA 3BT0A 1OT2A 2PYED 1LWRA 4BIKA 3WIAA 3MN8A 2Q0ZX 2ZJSL 1IO4C 4NN7B 3ZE1B 1OP3K 4AEEA 4B97A 5B38B 3QUMH 2HTKD 4Y2NA 4YAQA 3CFCH 4NO0A 1RZGB 1KJ3H 3QIUB 1YNKH 2E27H 5ECJE 3O6MH 4XCNA 4AUUA 1BAFL 1GGCL 1ZHBB 2FX8H 3SGKC 5FGCB 4IW4C 2Q86B 1R3JA 3ARDC 3PYCA 3VYOA 4DGIH 5DMYA 3UTSA 4Y5XC 4QCIB 1PLAA 2XNAB 1R3HA 2X89A 4XCFH 5DVOA 3HHMA 1S7QB 4P57B 4WW2C 4XP6H 4XNYH 1FE8H 3AWGA 4F2MB 1B88A 3U7WL 3B2MA 3Q6GH 2W60A 1CMOA 4PTTB 4K5LA 4CVZB 2R23B 4Q6IB 1SPDA 3H9HA 3UYRH 3J2PA 4A55A 2WO4A 1PG7H 5I17B 2ARJA 5ACLA 4F37K 2EUWA 1UUNA 5F6IB 1THAA 1IGTA 4LAJH 5ANMA 1KEML 2WXNA 1NJ9B 2OXHA 5T5FA 3FO9B 3BKML 4Z7QB 1RFDL 4LCCB 5IKCA 1Q9LB 1J86A 4Q4EA 2OYPA 5TDOA 3GBML 3HRZA 4EKJA 2DLGA 1ET7A 2L7EA 3G7TA 3QCVL 5JHDD 3H55A 5FYKE 3HZKB 2QZ5A 4S10A 2MQ3A 3QHZL 1AZZC 1HN1A 3U4BH 2ZWZA 3DARA 4DCQB 1NGXB 2IBZY 1X5MA 1T5WB 3DMMD 1ID5I 2Y2WA 1NOAA 5HHVL 2HH0L 1JZIA 1IKNA 4G6KL 3UBGA 5JUEL 3TT1L 4NWUL 4OZFG 5DUML 5EC2A 4KK9C 1XGZA 4R2GD 4QAMB 5IJKA 4NM8H 1ITCA 3TURA 1S7TA 3MBED 3LNEA 5DHYB 4KJWC 3PL6B 1D3CA 3LPOA 4WWKA 2DN7A 4FA7B 2VJXA 5DHMC 5EU6D 1JCVA 2DEYX 1KGCE 5LLIC 5T5FL 5DTFB 1U41A 1W9XA 3VVWA 1LL1A 3KPPA 5DHVB 1KV3A 2QGCA 2IH9A 3NZUA 4XCCL 2V3FA 4GMSH 4Z7QF 2NY5H 2YQ2A 4H0HB 5IW1B 2OL3H 5HHXH 2WD0A 3EJUA 2BS8A 2EC9T 4LLUA 4PLOB 3MRIB 4HUWB 4PM1A 4ZTOL 4UT9L 1WT5C 4ZTPL 3LEVL 2E6PA 1JHLH 3RGVD 5ACMA 1OSYA 2W80C 5FOBB 3C08H 3ZMRA 2VDMB 4XAWH 3LKOA 3Q5YA 3KVQA 2YS4A 4Z7IA 1E5UI 4ZOBA 2YQ3A 1Q1JL 2NW2A 1JIBA 4OZ4B 2SODB 4LLMA 3VSTA 4N8PA 1BF5A 5FR3A 1TCRA 1UJ3A 2Y1ZA 1LO0L 2Z8RA 2V2WB 3L3HB 3SOTA 5DLML 1PSKL 1Q9WB 1LP9A 1KZYA 4L3FA 4QXUH 4AMKH 3PP4H 2D03L 2Z7UA 1JNNH 3VH8B 5H2BA 2HMIC 2WM0A 5T3ZD 1E3ZA 3F7YB 1CWVA 4HIHB 4LQFL 2NXZC 3I3EA 5CWSB 2B20A 4OD2B 4MB3A 4O9HL 1MI5A 5I15L 3DMMC 4KJYA 1BMGA 3GTNA 3QIUD 5E4IA 3VG0H 4LT7A 4JRFA 2OI9B 4QRTA 1PZ3A 1UC6A 4YHZH 2KL6A 3V6OE 4G6MH 2QHLA 2Y5QA 4K8RL 3IFOB 3CH1A 3H7BA 5DYOB 1IFGA 2C9PA 2CQVA 4KITB 1FNAA 3CPUA 2FJGA 1PL3A 4NN7C 4PJ7F 4BSVA 3N43F 1KN4L 2W9EL 1TQCC 2HLEB 3HG0A 5HYJA 2YPLD 1IBDA 1NOLA 3QIUC 2ZOLA 1LNUA 2MWCA 5KN5A 5I1AA 1YDPA 1A1OB 2QR0A 3BP4B 1DBKL 2CIIA 4MJ4A 3ARDB 2GJ6D 3WFEH 2RJMA 4OV5B 3T8XA 3BO8B 3OG4B 2PO6C 4PS4L 4APQA 2VR7A 2JIXA 3EYVB 1KPVA 1OE2A 2XI9A 1JGEA 2CHWA 3MX0A 3TZVA 4WK0B 3U0TB 1QR1B 3DYOA 1WAAA 4MQ7A 3QUXD 2F1BA 4H20H 4WK4B 4OLUL 4GQRA 5F7DB 2P8MA 1GGBH 3KXFE 4IRSC 5D71H 4B3EA 1QKZL 4XP5H 4AJVA 5DMGC 1CXKA 3K0YA 4N9GA 4XBEH 1BMWA 1KGXA 2GCYB 3T3MB 2ZYHA 1DUZB 5I1HH 2H6UA 3S37L 5F2FA 1D2PA 2KUTA 3F58L 1UA6H 1KJ2B 1HFUA 3NA9H 4ZPVA 1GJWA 2BNRE 4U49A 4BH7B 4PJEA 2XN9B 1T5KA 2IWFA 5LGKA 1TSRA 3CN0A 4JM0A 5TQ0H 3U9WA 2G60L 4H5SB 3ULUH 1PCXA 1EEYB 3APNA 3AY4A 4N0UB 5CLTA 5ICXA 4GW1B 2VXTH 3DIFA 4QY8A 4I9WD 2VDML 4Y2LA 4DQOH 1XL6A 3BP6B 5EUKA 1G84A 1RK1A 1TUPA 3M86A 4FMKA 5IVXB 2BHUA 3E6HB 3DHMA 4WNQA 3IGLA 3VI4A 4LF3A 3H2QA 1ET8A 2EDWA 4IBSA 4DW2H 3FB6B 3K46A 1MCPH 4DK3A 4PWFA 5FM5M 5D7JB 3M6DA 1WD9A 3MRJB 4QRQA 5L2JA 4NQCB 4HPOL 2KQNA 3MRFA 4PJXE 4F8NA 1MCKA 3HE7B 4WY7H 2DZEA 2XZCL 3D30A 3D5OF 3QHFL 3QNXB 3TO4D 1SXSA 2ED6A 1CDUA 5M7QA 2A74B 4X7DC 5EC1B 3AG4B 1NAML 1CE6B 5CN2A 3O4LA 3PIQA 1IGYA 4LMQE 1F6FB 1BBJA 5C71A 4YXKL 4TQIA 3BIAX 3MROA 4HJGA 35C8L 2OZNA 3FO0H 1OGPA 2G3NA 5E9DE 2EUZA 2X3CA 2E86A 2VW4A 4GSDH 1KJMA 1RULL 2DD8L 2BZ7A 3NESA 4FXGC 4YH6A 3CVHA 4ZAKA 3EUDA 4IRZL 4P9HC 1OOAA 1OCWH 32C2B 4F9PC 3CFIC 5CSZA 4FMFA 2QKSA 5GS2H 3FU7B 5DDHB 4PP1D 3VQLA 2DJUA 1SYVA 1IE5A 3FN3A 3KPTA 2P46B 3SDCA 3DA0A 1JZ4A 4PJ5D 1BJ1H 4B7LA 4PJFB 2FGWL 5B3NA 4ZS6D 2QPEB 3DURA 4YL9A 5CP7B 3O2DH 4HLZH 2OI9C 3L3OA 2IAND 1N5AB 3U1SL 1T66D 2EH8H 1YPZB 4PP1C 5JW4R 4FTVD 1WICA 5FOJA 3R7RA 4JQXA 2NYYD 4JKPH 3ROOB 4KO5A 3KBHE 1BQLH 2PW1A 1JHKL 2H9GB 1CGXA 2A0LC 4NC1C 4EDXA 4UI2A 2NYZA 1CDBA 1DVZA 1T20B 3BDYL 3G08A 3QFJD 4RFEB 4OCXH 3A4AA 2YD1A 3VXRB 4UQ2B 4NCC1 2P5EB 4UOW0 5CCKH 4A7VA 2RFXA 1XH3B 2DH2A 4YAQB 5JHAA 1IM3D 4QRTB 4B3VA 4FQQB 3RZCC 5DR5H 3OC5A 2PO6B 3R06B 4AIZA 1D7DA 1O7DC 1DJZA 5C09D 3VW3H 3VFVB 5AW8B 4LU5H 4EI5A 1IVTA 3MV8D 3IRPX 5ANME 1R3IH 3ZHKA 3P0VH 2XX0A 1EANA 3DROB 5I1GH 3DSFL 2YAQA 3O6LL 4BCYA 2IF7A 4HJIA 5BQ7A 3DXAA 1LQSR 6FABH 1X5ZA 1SXNA 1H8SA 2ZX5A 4G59C 3WLBA 4LEXH 4MWFB 1MFUA 5H94A 1RZJL 3QZWG 4DGYH 4X6DE 3Q8AA 3E2HC 5PCYA 2A6DB 4GAJL 4FFYH 4XPAH 3RQ3A 3LEVH 1KG0A 4XN9A 5D2LA 1Z1WA 1HS6A 4CA4A 4G6FB 5A6LA 3MLZH 1HC1A 1NBVH 4JCWA 4JANA 4WJ5A 3I84A 4OKDA 5AOJA 3F6LA 4GQZA 3MV7E 3U0WH 1VGKA 4HOZA 3JYBA 1GOGA 2VCOA 3GKZA 4WWKD 3IDMB 1NBYB 3B2XA 2Q8BH 1S7XA 1T3FA 5IREA 2FIRT 3PUUA 4HS8H 3RVUC 5FO8B 2QBWA 5ESVA 1I1FB 1KENL 1FL5A 1P1VA 3X12A 2QQLH 4GO9A 4OLZH 4L37B 4XNAA 3ALPA 2IADA 4MMZB 4G8GA 3QUYC 2WLKA 4LB8A 1BHGA 1SLUA 1WCBB 2LABA 3HZ3A 3ELAT 4LP8A 4PB0L 3LXAA 4E41E 3M7FB 1QQDA 2BVTA 4Y1AA 3RDTD 3S5YA 3WFBH 1GC1C 3FUHA 1B4RA 5CEXA 1ZS2A 2M26A 3LCYA 1JF6A 2VC2H 5DU7A 2Z1KA 3HFFA 3ZR5A 4BFGA 5HD8C 2FBJH 4HC1A 3IFLL 2CIKB 2Z7WA 1A4BA 3P11L 3OG6B 4P49A 5D55A 1MREL 3P77A 5LN8A 3CLWA 4LSVH 2JKXA 4WWOA 5AOLA 2A77H 1OGAD 1OPOA 4ZRGA 5F6HI 3U36A 5CFAA 1S7VB 5CP3H 5BNXD 3GZOA 3BRGC 3IGAA 5D6DC 4HIIB 3W5NA 2IOIA 1OHQA 2F53D 4XB8A 4UT9A 4LLYB 3KPRD 1F42A 1MRFH 2DQUL 1WBZB 3MVSA 3O4LB 1UZ6E 1RZPA 3PIQB 1MNNA 3CQQA 1YAZA 4YSSA 4MS6A 4M3KB 4F57L 2DMHA 2J43A 2FSEA 1CFNA 2VDRB 3P4LA 1NCCH 5I19H 3MLYL 3M1OA 3CBRA 3FN0L 4IM8A 3V4VA 1RZIA 4B6ZA 2W9DL 5E2WL 3WKNA 5I1EH 1BG1A 3QPKA 2X4SA 4MBOA 1T21A 2LTQB 5A3ID 5HYJE 1FBIH 2HJLA 2XTJE 4Z7VE 1LWJA 1IGIH 4IKKA 1Y6NR 3D3VE 3NN8A 1TZIA 4YSPA 3ZO9A 3GK8H 4W6YB 1E8XA 3VGAB 3T0EA 4O5LL 3G6JA 2EDYA 4UDUB 5JHDE 2PWDA 3K80A 2FL5A 1NIFA 2I5YL 4X0KB 3OKNB 2IXQA 4UOZA 3KGTA 3I75B 1BZEA 1WZ1L 3ULVC 4GSRA 5DJ2B 4E9SA 5HI4D 4J12A 3IMVA 1MUJA 3FZUC 1VKXA 1BCIA 3MRRB 2B15A 3WL9B 2ETWA 4L4VD 4RMQA 2FIKA 4BUGA 3PV6B 4JZJB 2OMBA 1GRWA 4XX1G 4XZUA 2KLRA 5JOFB 5HD8D 2IOMA 3INUL 3EO0B 2GY7B 1WJ3A 4JRXA 4LVHB 3SZKC 5FW8A 4NO5B 5GHWH 1XH0A 1UFUA 3QXDA 5IFAH 4LRNH 3B9DA 3VYPA 3KPOA 4NQXA 5IHUL 2LE9A 1J05A 3FZUD 1A3QA 4C4BA 1RURH 4J23A 3PJNA 4L5FE 4LHUD 4L8BB 4N5UA 1G7MA 5I66B 3ZE0E 3RWHA 4XP1H 4NPYA 2VYRE 3MRQA 4ZXBC 1XL4A 2WLNA 5EBGA 3G9VA 4NI6A 5DZVA 4J3TA 2CPUA 5EDXA 4L8SA 4W9GC 4DVRH 3E8UH 1FL6A 2CLVB 4P5TA 4RISH 5CINH 2CRZA 3G5VA 1PG7L 2YPVA 4H0IA 3GXTA 4JLRA 3QIWB 4L29B 1VZHA 3POCA 4IRJC 4ERSL 4NT6A 2YC1A 1NCUA 4HJ0C 4KXZH 4X7SL 2Q3ZA 5E0FA 1BQSA 2CDFB 3OLGA 1VERA 1MCOH 4HWZA 2RCSH 2YK1H 4CJ1A 3GS7A 3SDYL 3KW7A 2VQUA 4GLRI 2FJSA 5D1ZC 4EN2A 2ZP0T 4F8TA 5C0EB 1QLRB 5FYKU 2B0SL 1KJVB 1T4KB 3UBHA 1D5IH 4OZGE 4ZFOL 3A67H 1CBVH 1SM3L 4PGJA 1OVZA 3W11D 4IOIA 4G7QB 1HAWA 1Z3RA 4N6RB 3TT1H 2FT8A 2KZKA 2XWTB 5AYUL 3V6FA 1RJLB 1DVFA 4UQIM 4YNYB 1HSBB 2ZOUA 4XVTH 2GTWA 3DPBA 2OJ1A 2XFGB 2A99A 1P69B 4KROD 1LWHA 3ULUC 5GZNA 4U1IB 1U8JA 4JRYD 4J1UA 3GBLA 1MHEA 43C9A 3JV6B 5CBEB 4J5VA 3F7VA 2XT1B 4EQ3A 3V6ZB 4HOMA 1THCA 3IXAB 4ZX6A 1YN7A 3D52A 3NCWA 2NT1A 5FO9A 2DYPA 3EAKA 1EHLL 1HQRA 2P4AB 3HG2A 4UIKH 5GIRA 1UWXH 3BAYA 1EO8L 4YEFA 3S7GA 4HW6A 2KQMA 2V3EA 4PJ8B 5LWYL 3BKJH 3D05A 4FKKA 5I1DA 2XLLA 3MO1A 2PXYD 2KLTA 1QPPA 4L3ED 2XFXA 4M7JH 5IHHA 1RIUH 4WI2A 4H20L 2N3JA 4EN3D 3I74A 3MRPB 1PDKB 1NC4B 2M2DA 2G2RA 3F3HA 1F1AA 4H44C 3S4SG 1UEMA 3HCVB 2H0EA 4K7PX 4YX2L 2IANA 1FNHA 3LN4A 3D39E 1QX1A 2BVPA 4B60A 4DESA 3KWTA 1XF2B 1HXMB 4ELKA 3CIQA 3ULUF 3F7QA 5A6IA 3L3GA 1A7QH 2DLFH 3QXWA 4HIXL 3FYIB 1J48A 1JTOA 3TEUA 5I8CA 4KVCL 5JOPD 1QR4A 3VXPA 3L1GA 4KZDH 2F54E 3RKDC 3WMPA 5HGBA 1IC0A 2FO4B 2FSEB 3QRBA 4JZNA 2YJQA 1E2WA 4P2QD 2DI8A 4Y2OB 4ZOCA 3VGAC 1X5GA 2A73B 1NGZA 2E4FA 5DZJA 1EVTC 1G9NC 5EHFA 3N91A 5DZOA 1TZHA 3AVEA 4PJFE 5J12C 2FO4A 2Q7YA 4MRCA 5EF0A 3RKDD 2FGZA 2NY2C 1QLEB 1HILB 3T77A 4HBQA 5B4MD 3AQZA 3CLEH 3QZWA 1KBGL 4UIMB 2XIDA 3VWJC 2JI3A 3HZMA 1LE5B 2DB8A 2Q7YB 3HLAB 1FO0L 4BZ1H 4M8QA 3RGVC 4HXBH 1A47A 1OP4A 3F6IA 5LAPA 1CD1A 1QSFD 2WQ8A 5EORH 4AG4H 5C6WH 4OB5L 5E6SB 1OP3H 4PJHE 2C9XA 4UINH 3RUGF 1QBAA 4EOWH 2COQA 3C5ZC 4ZXBB 2CO2A 3O6FC 3UACA 1OGAB 4L8DA 4JFED 5GJSH 5CLYA 4MNQB 1MIEH 3ML9A 1E4KC 1M1XB 4HUKB 5D7IE 2LU3A 2Z93B 4GQ9H 1V7NL 4YHMH 1A6AA 4NUJA 1DSFH 4HUXA 3BGMA 3C5ZD 1X5XA 2MH4A 3GSUA 4F7EA 3NSXA 2XV3A 2BIIA 1UB6A 3GC3A 2ZCLL 3NZ8B 1IAKB 3STZB 3GM8A 3IRCA 1A4CA 3OGCB 4EI5C 4XVSL 3EGSB 4PJBB 2CUMA 3RWEB 3ZE0F 1KNOB 2OR7A 3AY2A 4AGQA 5C09A 1EO8H 1BJMA 1WAPA 1PLGL 3RJQB 5GZOD 3SDAC 3QDME 5JW4N 3BZFB 4TVPL 2Z91B 3HZVA 4GG6E 3GTTA 1AJ7H 4XXCC 4N2OA 4G6ML 5HPMA 3HS0C 1MJUH 1HZKA 2PP9A 4PW9A 1LDPL 4WKZA 2CE6A 3BFQG 1NCNA 1JG9A 3CV5A 3O8XB 4IDJL 3QZMA 4G8GB 3B7YA 3QRGH 3CFBA 3N1GC 2FNWA 1CDJA 3IDXH 4Z7NE 5AL0A 4NC0B 4KKQA 5MEPB 4OQTH 3FTGA 3NDYE 1O7VA 1KACB 1BQ5A 4CSZA 3UTQA 4HUUA 3Q6FA 1A6ZB 3Q9QA 1H6EA 5HDOA 2WV3A 3ZKMD 4BSVB 1J1OL 1KJ2L 1SMDA 1MQKL 4MX7A 1YEFH 2PO6A 2NUTB 2Y7NA 5EFIB 4LIQE 2Z0BA 2VUOA 1G5GA 1T7ZA 1CU4L 1CLVA 3KPSD 3KYAA 4PJ8C 1AZBA 2BFVL 3H2PA 1D6EB 5GQBA 2CBPA 1QKZH 3T0BA 4AH2A 3MLUH 4E68A 1JZGA 5IIEA 1L3WA 1OLZA 5FEBA 4BWWA 2P49B 3Q01A 2KDGA 3OX8A 2Y9RT 3FO2B 1CLOH 2X6BA 2PW2A 2MMXA 2X4UA 3DX6A 4J3OH 5E6IC 5GISL 1RZ8B 5D7LA 1MRCL 3UC0L 2QADB 3N6YA 4DH2A 3K4AA 4PBXA 1SDYA 3BYTA 3DYMA 1N2RA 4PVLA 4S1QL 3PNWA 4RSYA 3V0VA 1DCEA 3DSNB 4TF4A 3B2DC 2WNGA 3U2HA 3UC0A 4HS6B 2YOAA 4HLZG 1TQWA 4W9DC 4ZOAA 1OPGH 2NXZD 5I15H 5D1ZI 1ZV2A 5E8OB 4ZS6C 5IQ7H 3CFCL 3AM8C 1AXTH 2A9MH 4R3SA 1I8IA 1U3NA 5EG6C 1FZOA 4CRPA 1ADQA 3QEUA 4ZI8A 1A64A 2ICWA 3QUML 5IVXF 3M07A 3IAQA 1I7ZA 2AK4E 4LBAA 1H15B 1LHZA 3DO3A 4AQOA 3T77B 1O75A 3FRPG 2VW6A 1L9QA 5FYLE 2QGDA 5SWQB 2NY1B 4S1DC 4C8XA 4GKNB 2R29A 4X4XB 1NLBL 3BQVA 3ESMA 1WSST 4YUEH 5LQBH 1Q94A 2EXSA 4DKFL 3TFKD 3POHA 4H8QA 2Z92A 3C09C 2GT9A 1D7CA 3R4RA 4JPSA 5KSUA 4WFHE 5E03A 3RX7A 1S9KC 1MEXL 1J8HD 1TQBB 3ZYJA 3C5ZB 1CF8L 4WUUB 3V0IA 1WFJA 2XA3A 1XR9B 4UT6A 3F2LA 1AE6H 5EA0L 3L5JA 1I31A 1KPUB 2QDVA 5FHAH 1RZIB 2DWDA 2DYPD 3WIIH 1YN6A 1BVLB 4BDVA 4OCYL 43CAB 3MBXL 4P05A 2ARWA 1TETL 1B2YA 4JFTA 3CAFA 2DIBA 5T3XH 2DJMA 1X9UA 3C9NA 1EFXD 5D96C 1JGVH 4G9FA 1XVSA 1INQB 2XZQH 3EJJX 2DRUA 4XNXL 4PGDA 5IK3B 3CZSA 3H9SE 4Y1AE 4M1CD 1BQRA 3BH8A 5T1KB 5BZWB 1D9KA 5CUSL 2WLLA 5FX3A 4A38A 3ZDWA 3GHEH 4ONGH 2JJVA 3NJIA 5E70A 2JVUA 1DQJA 3SPIA 1UACH 4F57H 3CDCA 2VDQH 4L1DA 1T6WA 5GZOC 3RVUD 4ODHH 1EX0A 1GSKA 1MJJA 5INCA 4G1EA 3LH2L 3AQYA 5G4NA 2OL3B 1L6XA 1C1EL 1F00I 4L2LA 1AO7B 4P4RB 5HHXL 1KLUA 1TENA 2DI9A 3W9DA 3V0AC 1MCSA 4Z3TA 1I53A 1MAJA 3NZSA 3DTDA 3OXRA 3NSJA 2GABA 3ABGA 2UZPA 2H6OA 3HMXA 3BAKA 3K72A 5KVEH 1TJHL 3FXIC 3T1FB 1PMYA 4PP2B 1E40A 4WFFE 2XQYK 4QO1A 2GTWB 3DPBB 3MJ9L 4R7LA 1XIWB 2EYTB 3DUUA 5BS0E 1K8DB 3EJSA 2AEWA 5DFVC 4IU3B 1Q9OA 3S8WA 1ZGLM 2EDMA 4DEPB 4B53A 1MHCB 4HK3J 4NNPL 4KDVA 4NFCA 3X1FA 1NPJA 2Z4TA 4KFZC 4RDBA 4IU2B 3LZQA 4UTAA 3IKCA 5E99L 4ZZFA 1S7QA 1ML0A 1LNUB 5KN5B 2XQ0A 4OKVA 3ZZ1A 1QYGH 5JXEC 2GKIA 4LASL 1ZLSH 5C9KA 3T4AB 3ARDA 3HR6A 2CDFA 4KRLB 1RUPH 2F5AL 4H26A 4OIAA 4OZFB 1REIA 3TO2A 1QSEB 3RLSA 2QADC 3MHZA 5JHDA 3G6JE 1KTJA 4JG1L 5DO8A 4AYID 4P5TB 5AVYB 2F54A 1V3LA 3L7FA 1HL4A 1WAAE 2PPAA 4NKDA 5MENE 4AZUA 5F93C 4TUKL 3GLAA 4HJJL 1QRNE 2F74B 3MNVA 2DMBA 1YEGH 3WDIA 5KJRH 5KSBB 1DFBH 5L7XH 2HLFC 3BE1H 3NK3A 1J9SA 1QVOA 3GKWL 4DWHA 1KIQA 1BZ7B 3PHQB 1XF4B 3VD0A 1RUML 1F3RB 4HWZB 5DWUL 5CGTA 5AW4B 5I0VA 3D39B 3FT9A 1R6VA 4LCYA 2KBGA 3L4TA 4J27A 3RDTC 2X4PA 4XVSH 3MPCA 3ROLA 1KIQB 1IEBA 2X10A 4PS4H 2XDHA 3FS9A 1R34A 1Q0XH 2ESVA 3KHOA 4P2YA 3QUYD 2XN2A 3LDBC 2ZG3A 1JXFA 5CCHE 4CW1A 4YBQC 2X87A 3NIFF 3O9WA 1U95A 4PYHA 5BVJA 4PBWD 2V9TA 3BKMH 9PCYA 2R1YB 3VMPA 1EJ6A 4GKZA 5IW1A 3S37H 5DRXA 3UZQA 3SBQA 2Q3XA 2NX5E 4TRPH 4YFLF 2XWDA 5GSRA 1YPZF 3D25B 2ZXWB 5I0YA 1YQ2A 3MNMA 1XXFC 3I6SA 4IBZA 1NGQL 3REWB 4BQ6A 1Q4NX 2BP8A 4KKLC 1J10A 2P5WB 3INUH 2WAHA 3FOLA 5EF1A 1NCWH 3GSQA 5TGBB 1VACB 3TF4A 1QLEH 3KXFB 5DJZB 3TA3A 4DKDC 4BCZA 4O02H 1OGAA 5FV1L 3HTLX 3DX8A 4UDUA 1CE6A 1YEIH 1PW3A 4HT1H 3D0AA 2XXCB 3O4LE 4X6BB 4YDJB 3BVUA 3EZ8A 2OMWA 1GCFA 1JV5B 1VFMA 2FWOA 4IOFD 3SPVB 2VXTL 2JKWA 3ZT5A 1GS7A 3TLRA 4YQXL 3N3EA 4G43B 4XGZB 3M1CA 4GSUA 5DHYA 4FZ8L 5FKAA 1LEKB 1YY9C 1H19A 1AYOA 1WG3A 1S5HB 1ES0B 1TFPA 3KBFA 2I60H 3VXUB 3LZFL 3UX9B 1QTSA 1Z66A 1Y7VA 2Y23A 5AKTA 5HJBA 2PYFB 2VZTA 2X1WL 5F6HJ 8PAZA 4P4RA 4AEIH 1LEKA 3KYNB 4E41D 4KTDH 2HLAB 3ZY7A 4UT9H 2UVFA 2JQMA 5AVZB 3I6GA 1OKEA 2Z7ZA 5EN2A 2NR6D 4LDEB 1YO4A 1Z0NA 3Q0HA 1I1AA 3GHPA 1NDMB 5DD5L 3TV3L 4CBPA 3IFLH 4P2CG 1T03L 1S9VB 3PQYA 1KTLB 1IKNC 2VH5L 4KXCA 1E67A 4YHPB 1OD9A 3VMOA 2EEBA 3T0WA 1RULH 3WLWC 2NX5B 1L9TA 5CCGE 5BXFA 1CGWA 2VXUL 5FKPB 1XCQB 5KVEE 4EKXA 2Y5TB 3KVPA 4RGNC 5AG8A 1VEMA 4M61B 4IKNA 3T4AC 4NQCE 1PX3A 5FECA 1X7QA 4GAAA 5I9QB 4ZZKA 5JHLA 3TNMA 3JTTB 5HHME 4IOIB 5CKAA 1KXTA 4KOCA 4GKOA 4J6RL 3QDJA 3GT6A 1HL8A 4RGND 1BOYA 4ONFL 4AYFB 1PNCA 4YHIA 1T1XA 2H26B 2OJEB 3Q1SH 1ZJBA 3TM6A 4KKZA 3QWQB 5B22A 3L1OL 3Q48A 3VAEA 4L3CB 1TVHB 5JNYA 2VL4A 1WFIA 4KXDA 2OJZH 4HJUA 1MCCA 2ZKWA 2ZWLT 3VI3F 1BF8A 3NIDF 4DNLA 5K93A 3BH4A 3QIWA 2BSBA 1SYSA 3CU7A 3U6RB 4YNYA 5F3HA 5D2LB 1YPZE 5D93B 3P9MB 3IU4H 4O5LH 4PJHA 4PV8B 2NW3A 5ID1B 4KJQD 4HVBA 1IAIM 1RSYA 3FCTA 1A1MA 3HNSH 5ESAB 3OF6A 1NFDA 1PLGH 4PU2A 4G80B 4D7BA 4MAUL 5IJBC 1KJVA 3F65A 3W11C 4Z8FL 5DR5L 1IAOA 2VMCA 3BPLC 3JWOL 4XMKL 1AO7D 4B9GA 1S9WB 2X4TB 5KSVB 4DPBX 4FG0A 5B39B 4WV1B 3QUZA 4LXFA 4EIBA 1M71A 2OA9A 5FYJL 3UTQB 1CICC 3V0WL 2BK8A 4JPIA 1OP5H 4A2MA 5A16B 5BUAA 4MJJA 3NH7H 5J1AA 2EIMB 3G5YB 4A6YA 2CNYA 4KQ4L 4KK8C 4WCYL 4I1RA 3L4UA 5GGVY 1RUAH 3TVMC 3FQNB 5LWYH 2Y7QA 2DY2A 4G9FE 3QG6A 4QUOA 3QDMA 3UPAA 4Q0XL 3U0WL 2X9XA 2A6KB 1B4LA 1WRFA 2P47B 4QF1A 5DRWB 2ZUUA 4NQDB 4BZ2H 1LO4H 4NCDA 5I6XB 3HIZA 4PWIA 5I6MA 3C60D 3IFPB 4ERSH 5F3BB 3ARFB 1TEFA 5DHVA 4HF5H 4PJIA 2VXVL 3NJNA 2WSPA 1KJ3L 4FZEL 2ICEB 4I89A 5J3HD 4WI0A 2ZF8A 3ZDXB 1EWHA 2Y5EA 3PL6A 4WSKA 4H13C 4I9XA 5LGJB 4G8FA 2WXHA 5KOMC 1MKFA 3H9SB 5IUSA 4HEPA 3QWOB 3Q2VA 5AAMA 1M6UA 3MUY1 2HX8A 4R7VA 4KQ0A 2PYEA 2BZDA 4ZO7A 1JUFB 3QUHA 4HZLB 2ZAHA 1DQTA 3D3VB 4TULL 2V0AA 5ENWA 3MFFA 3TA4D 5D7EA 1A3RL 1LXMA 2E9JA 5KUKA 1MCBA 1MRFL 1U4EA 2DQUH 1ND0B 3D3VA 2YAOA 1I3GH 1CTNA 4L3EA 5FW6A 5CHNA 1E6OL 4FFVC 4AL8C 5AB0A 1ZY9A 2GT9B 1M4KA 4KJPD 5EBMB 4EOWL 5J89A 2VIRB 1WBXA 5KBKA 2ADJA 2X9YA 3AADB 2FJUB 4NM4L 3K1DA 2X4NA 4WHTA 4AW7A 2NSQA 2XIIA 1I9RH 2ZXCA 3KS0J 1RJYA 4NM8L 1IFHL 3HN8A 4PJCF 2CMRH 2QMKA 2EH8L 1Z9NA 1GOHA 2EADA 4F92B 3DUHA 4QRSB 3M46A 4BFRA 2P5WD 1TDQA 3QYCA 2QV4A 1Z32X 1ODUA 4UYPA 3VI3A 5L2KE 1P4BL 2COVD 1WAEA 4QGYA 3RWIA 4G7VH 4XPHH 4YS4A 1SJVA 5EIIB 4NX0A 2RR3A 3MUGB 4LAQL 4UM8A 5C0DB 3UPRA 3FU8A 3ESNA 3KM2A 3S3SA 3TN0A 3C6EA 2N59A 1CE1L 5D1ZD 1YECL 4UU9B 2J25A 4WJ5B 4RMBA 1BBDL 2ZXAA 1G4RA 4WCYH 4P5KB 4DP0X 5IF0B 2R4RL 4GRWE 5BVPH 1H3XA 2W07A 4LSQL 1HVXA 1JHLL 5E1IA 4FG6D 2AXHA 3IVKB 1ZPUA 4UAOC 5AL8A 1KN2H 5I30L 5C6TL 2C3GA 3HMXH 4MAYC 4PS3A 1BPLB 2VISA 1K6QL 1NIAA 1UWXK 3QIUA 4GSXA 3PWNB 4HA1A 1HWGB 1T1YB 5G55A 2XRAL 5EUOB 2C9UA 3ZYOA 3K7UA 4R0LC 4R8WL 1QR1A 2FEJA 4UQ3B 1YC7A 3O6FD 1J9CT 3QIBC 1DL7L 5T3XE 4WSJA 4MNGE 1JHTB 2P8MB 3LZPA 4NQDD 4L3AA 3E8UL 3TVMA 3WJJC 4AQ1C 2AQPA 3VU2A 3MLZL 3FK3A 3RIFF 3KHQA 5JHDB 4ODUA 4L8SC 2V8LA 4ODXB 1T7YA 2BOBA 3VB8A 1PZUB 5LKNA 1BEYL 4WGKA 3HNTL 1OSEA 4H1LB 4Y4KC 2G3ZA 4NNPH 4X5XB 1S2EA 1MPAH 1W2KT 3OJVC 2NY6B 5T3ZL 4V1DE 1OQOA 4PJ9A 4H8HA 1J5OL 3N9GL 4OCSH 4YDNA 1FZJA 3FT2B 2EXWD 1CD0A 3U46A 4XCFL 1CFMA 4XOAA 1JV2A 2WGNB 3ARBA 1AH1A 3NP3A 4AITA 3S36H 2A4EA 3M1BA 4LSSL 4N1HB 5DS2A 5IW6A 3SGEI 3W0WA 3DJ9A 1A6WH 1BQUA 2M83A 3L16A 5D5MB 4TUUA 4JMXA 2NR6A 1YMHB 4GS7C 1P7KA 1HEJC 4Z95L 1T80A 3HG3A 3V5DB 1II4E 2GC7C 1UACL 3PQYE 1JWUA 5FK9B 4V2BA 4PJBF 1NUDA 4LKCB 4ZJ9A 3WBDA 5DF0A 5GS0D 1KEGL 3SKNA 1OE1A 1WE5A 3DGGB 5DEGA 3DWTA 2HZHA 4AT6B 3QH3B 2AJUH 2C1OA 3EGDB 4Y5XB 2MHAA 2ED9A 1VRSA 3WO3B 4GIPD 4EZLA 5C0RL 3ZIMA 3WL9A 1D9KB 3LXCA 4D9LH 3L95B 4M7JL 4AY0A 1DVTA 2FATH 5GS0C 3MTXA 3TNNB 4LGRB 4GG8A 2YD9A 3QDJE 4JHWH 4TUJA 3BIKB 2AJXL 4DO4A 5I6PA 5J6GA 3CSPA 3TEYA 4JKLA 2IG2H 3WIIL 2YIHA 3N42B 5HHQB 2B2XH 2LW5A 3CZEA 3KL0A 3W1ZA 1RZKL 1BSIA 4Z7QE 1QBBA 1AVAA 5DUJA 2RIKA 1CI5A 4XP4L 2YA1A 4FG2A 5F9DC 2IEPA 2X3BA 2OR8A 3NRFA 4YIQB 3TH2T 1MJJB 2IGFL 4U1SA 1S7SB 3WN5A 3L81A 5TF0A 2CJTA 1G7IA 1Z3GL 3LQAH 4NLHA 4JO2L 5FC9A 2IXQB 3DHJA 3PL6C 1W0WB 1NICA 3RFZA 4IMLA 1FLRH 4AVIA 3VFPB 1N4XL 3VGHA 1YA5A 1C16B 3PG2A 1ZA6A 3NAAL 4WZ9A 2X0UA 3A4EA 2NY7L 3OKMA 4QKTA 4KI5F 4JVUA 5B8CB 3BWAB 3S96B 2NY0D 5EWIH 3CN4A 4YBHA 9CGTA 1M9WA 2M8XA 3ZKMC 4XHJC 4JREB 1GSMA 4ZNEE 1J0IA 1WHOA 1R24B 2V9UA 4W9IC 5C09E 2OTWA 4DN3H 1M9SA 2W5PA 3BKYL 3EUUA 5E1AB 3LN5B 4GG6A 3LKQB 1U92A 4AEHL 2LU7A 5E2TH 4JFEB 4XI5C 1M57B 2D7TH 4APXB 4YHZL 1XD0A 2Q86A 2LR4A 2X6AA 2FQEA 3MC0A 1N5YL 1J5HA 5DS8B 1ZSDB 3ZUNC 2C34A 2BSCA 3UBXI 5AW5B 5ESVB 4N2GA 3S3DB 1T22B 3PJLA 1NH6A 2NY6C 1VFAB 4ICXA 1ZIBA 4E36A 1WFOA 1XFPA 4MNQE 2WQSA 2R59A 2XVLA 5HTSA 4X9YA 5ALCL 1CJYA 1ERNA 4AIOA 4JPVL 1FYTD 5DC0A 1MY5A 3D87B 1U8MA 1IB5A 4A2FA 1CFQB 3OD3A 4G3YH 4PJHB 2GJ6E 4YOKA 5GS3A 5H94B 5J11C 4ZFZB 4M62L 3K6DA 3JV4B 4NDMA 1OARL 4LFHG 3UYOD 4U1JB 1KG0B 3JTBA 5A3IC 5AW9B 2BJML 3L1FA 4AM0B 1YEDA 5GRJL 3VFSA 2A6IB 4HFWA 4NQCD 1NIDA 1BG9A 4XP5L 2MQCA 1BZ8A 4MLSA 1TIUA 1FORL 3SDXA 2OQJA 5CD5D 1FZJB 3FT2A 4HCGA 3BN9C 1NDGB 5CBEA 5E9DD 4AC4A 1OZUA 5D1ZA 2XHNA 1IEAA 1FFPB 1QVOB 4KAQH 1NFDB 1Z9SA 5D7SH 5AZ2L 1KJ2H 4OBSA 3BRDA 4J6IA 1PD6A 5KYYB 2Y1VA 3NRPA 1U8HB 3TO4C 3EF4A 5F7WC 5J9PA 4R96B 3EBHA 4W9LC 4F7CB 5KS9F 1Z6JT 1PG7X 4DKEL 3LIZA 4B9IA 1C7SA 5IHWA 4PJDA 2DWXA 1OAQL 5D7KE 5I2IA 2Q9OA 2JB5L 2BIOA 5IG7B 4IRSD 5E8NB 2WLHA 3IMUA 1ETA1 4FLOA 4MDRA 2H47C 4OJFL 3TWYA 1A0QH 5MEOA 5DFAA 1QHPA 3EBIA 3US9A 4M56A 2F54D 2F5AH 1N0LB 2GEEA 5T1MA 4MA7L 3PGDB 1YPZA 5E95B 4Q74A 3TVMD 2HVKB 2HRLA 1S7UB 2NY5L 3OAUH 3UGUA 3VXMB 3U9UA 3LQZB 4JKKA 1TMCB 1RIVL 5FCUH 1T5XA 5LCVL 5B21A 1TPXB 4UB0H 1WZAA 2IH1B 4FTVB 4QT5A 4WDIB 4ZTPH 4UM9B 5IQ9B 3DX3A 5KS9B 5FIEA 3SDCB 1SLWA 1A9EA 1PKQB 3EJYD 5FA3B 1FFNB 3MRBB 1BWWA 2VDPH 5I75B 1NFDF 4HK0B 2PXYB 4N0UE 4UT7H 4EZKA 1WFNA 3OGCA 1Q90A 4ZAKB 4ZOEA 4WEMB 2APTA 1K5NB 1MFNA 4KUZL 5D7JC 3T09A 4N8VG 2R0ZH 3DRTA 1HCZA 4Z7AA 4OGQC 3HE7C 5F7EL 1MUJB 3P2TA 1COBA 2FB4H 1INEL 2W65A 4KI1A 3EADA 1G7IB 3PWJA 3V4VB 1EGJA 2A74C 3LVTA 3QDHA 5AAMC 5F9JA 5DXWA 4XMPL 4XO9A 4KZ0A 2VIRA 1IIIA 3OLIA 3RGVA 3GO1L 5C08D 4XB7A 1FNLA 1A02N 1KC5H 5HY9A 5M95B 1HZHH 4M7LH 2B1HL 2X1PA 3MFFB 4MA1B 3DO7B 4Z3GA 1QFWI 1IQWL 3K4ZA 4AVKA 4PJCE 2D0GA 3VXSD 2C7FA 1T83C 4KTEL 1VFUA 3BPCB 4GAFB 4AQAB 4Y19A 1UM6H 3FULA 1QLEL 3TEXA 4JO4H 4YDZA 2BC4B 3MBXH 4UTBL 5TE6L 5DD0L 1SUHA 5IW3A 4BWUA 4JFPA 4M1DH 3TONA 4ONOA 1HDMA 2DMKA 3KPMB 3WXVL 1EEZA 1IILE 3QDGD 1JDDA 3UADA 3B9VA 3DOIA 3EG9B 1FL3B 3UTZB 4JJ5A 4Z1PA 5I74B 1RPUA 3CVHH 1UWGH 3FHEA 1C5BH 3MRKB 3GDCA 4LLQB 5A2CA 5KSAB 3IFNL 4FXLA 2XN9A 4IBWA 1URLA 5JO5B 5I1KH 4E5XG 2C5DC 3IXTB 4K5NA 5I6LA 1PQZA 3LNFA 4L9DA 4H1LH 3MJ6A 5FO8A 1SVZA 1G7LA 1F97A 3MKGA 3AM8A 4TQEL 3EH4B 4G5ZL 5CJQH 3JWNG 4QTIL 5E9NA 4A7QA 4HHAA 2Z31B 1CE1H 1F5WA 1YMHA 2XG5A 2BSDA 3PU7A 1FZOB 4L0PB 2VDMH 3QG7H 1AYRA 2C9VA 5DVLA 5IVXA 3HNSL 1L0QA 4D3CH 4H40A 3T8XB 1GYVA 1GL4B 2XQYG 1WEJH 1AD9A 4WWNA 3WLWD 2J55A 1NWPA 3HI5L 3MX0B 1MFAH 3TZVB 1AGFA 3OAZK 5EOTB 1GGTA 4K5OA 1I9IH 1PY4A 4AYBA 1DZ0A 5LBGA 4EDWL 4PJ9D 4AT6A 3T6QC 3MMEB 5H4YA 3FDWA 3V4VL 4ETQB 1SUJA 3DNKA 4KDTA 4NUMA 2Z35B 4TSBL 1U8NA 1DUZA 4OD1H 1BIIB 1YUKB 2OR9L 4JY6B 1BM7A 3WV0A 4JDEB 2ESVE 2JE8A 5EPMA 1ZXKA 3U2SB 1RVFH 4APQC 4HIEB 1DL7H 1BECA 1IGFH 2UZYB 2VLRB 4BSJA 4YHLL 4OI9A 3VXQB 1KCUH 3GB7B 3N85H 5HVGB 3EH3B 4U3CA 1NGYB 3F5WB 3NFSL 1WS8A 4DVBB 4FOMA 3FT3A 4ZX5A 4ZFOB 4YDLC 5JQIB 2ZPKH 1LTXA 5CS7A 4AENB 2QKIC 4CC4A 1A6TA 3WUZA 2FYYA 3HB3D 4HKBB 2AEQH 4EIUA 4AGMA 2YPKB 3O0RL 2PXYC 3GXNA 1OCWL 1X5YA 2E0PA 3ISRA 3PWPA 3MRHA 4QJ3B 1T04B 4G7VL 5D70L 4Y16C 1OGAE 3BMWA 3OKOA 3GMQA 3QUYB 5HYEA 3RX5A 4F9LA 5IUCA 1AHWA 4P4KA 2CKNA 4X98B 4ZNEA 3PABB 4DPRA 4HC1H 1RK0B 4ZXBA 1EMTH 5AKSA 3REVA 4MS8C 2PNDA 3HE7D 3JT0A 4Z3EA 1NEZB 4XX5A 2Y6TE 3U1SH 4YJZL 2PCFB 4PRIB 3P3RA 4KY1H 4C55A 3NEEA 2XJKA 1FWXA 3D0VB 1JF1B 2H45A 3IJ7A 2X4SB 3VFMB 2F53E 3CVHL 3U30B 2YEQA 3I3DA 3T1FA 1E8WA 4JHAL 4BA0A 5E9DA 2VNCA 5JOFA 3HMXL 1UOVA 1LK3H 4G9FD 1CN4A 4EE2A 1KLGA 5BXFB 4G6AC 4UBDC 4NO5A 1AG6A 4AYSA 1BFVL 2X89D 4F1ZA 1AZRA 1TLMA 4U1KB 3FRPA 4EN3A 4FN0A 4LLWB 3RU8H 4Z0XB 2K8QA 5E6ZA 4YIQA 3HC0A 1BV8A 3QA3A 3RX9A 1USZA 3CLFH 1SYVB 1F6AA 2R7EB 1NAKL 5IM7B 5DHXB 1S7SA 1X9RA 5CHNB 1AR1B 1SQMA 1QD0A 2YD7A 2RB8A 4WI3A 1EA9C 3QI9D 1UM4L 1SEQL 1JTPA 1AY1H 5FYLL 1YNLL 3QS3A 2HH0H 4GSQA 2EXWC 4EZMA 1IE4A 2YRLA 1SHMA 4DGVH 3RWJB 4JKNA 1BDYA 1N6UA 3OKMB 4QRSA 1NUNB 2B59B 1RZKH 4KJWD 4RGOL 3AG1B 3BAJA 3WN5B 4HMCA 4KKNA 4Q2ZB 1DP0A 4C56E 4GRWB 2X7LB 3B83A 2FJFA 2OTUB 2Y06L 4G71B 4QTHB 1U58A 1I1AC 3IDYB 2AQTA 4P2QA 2J8UE 3PREA 3MOQA 3SCMA 3T2QA 4AGPA 1GZQB 3ZHFA 5CEZL 1XX9C 3FTUA 2F15A 1W6WA 2DQMA 3BMVA 2VXUH 2E27L 3HG4A 3LYRA 4LZKA 1ADWA 1KYUA 2K45A 1P4IL 5E7BA 2PW2B 3FF8A 3LEYH 4FG6C 4C83B 1CXFA 2DW5A 1JZDC 5D4HA 3WCYA 2BNRA 2WQWA 3X17A 3HR5A 1FH5L 2VL5B 3DC0A 4NBZB 2FRGP 1ZHBA 4PJXF 1SY6L 3UH8A 3GIVA 3AS3A 3FCSB 3WFBL 1NC4A 4U6XB 1D6EA 4MASA 1JFQL 5K39B 1MXDA 4JO1L 3R7QA 4TMPA 1D5IL 2FX7H 3CHRA 1QBLL 2B5IB 4PWKA 5DQ9A 1A66A 1IV8A 3ECQA 4LCIH 2X2IA 2EH7H 4NQUA 3ULVF 5E6ID 5B1AB 3U6XA 2WZ6A 1SF5A 2XPYA 1NCDL 1WFUA 1A25A 1BLNB 1OAXL 2MQGA 2NZ9C 3CC1A 4OFYA 4TVPH 2CMRL 4XXWA 3GXIA 4ICWA 4UQDA 1TTGA 4EJ1C 4WJG3 4GRWF 4JHWL 4GT0A 4F33B 3ARBB 3GBNH 3PNWB 3BO8A 4M48H 2OZ4A 5KYWB 1A7OL 4WI9A 5J5EA 2N4IA 4G6JL 4OTXH 5EZLA 4MZRA 2QVKA 1G7HA 3QUGA 4RRPM 4LSUH 4PJIB 1X5HA 4JHAH 3KGRA 4H1LA 4TQHA 4WW2F 3VG9C 3V0JA 4IRZH 4JHVA 1L0YA 5EU3A 4FLQA 5I73C 4AV5A 1A14H 1UZ6F 1XGUA 1WS7A 4HWBH 2WZPD 3V5DA 1SXZA 3RURA 1MWAB 3BI9X 3MGTB 2AJ3B 4U4BA 3FT3B 4ALAC 1K85A 2BSTB 1T4WA 5IVNA 2OCFD 5GGUB 2AJSL 2NYYC 1R33A 4HLJA 5AKVA 5LBVA 4N24A 5DK2B 4NIYE 4BFBD 4Y2DD 3KDMA 1BQLL 2FX9H 3TFKC 5BPPA 3CGTA 2WJ7A 1CVSC 2LFEA 4KQ4H 2OL3L 4MSWA 4P59L 1P7QA 4PVNA 2NX5D 4O02B 4OU3A 4O2EA 2APXA 3P73B 2NOYA 2NY4D 3NFPA 4LOFA 4MNQA 1BD2E 4OZ4A 6TAAA 5GZNC 4O02L 1XAUA 5EO9B 4F2EA 1JZHA 2GHZA 3LZNA 3QK0A 4Y19E 4D9LL 3MNWB 3PXHA 1VKXB 3RZCD 1HEHC 1A2YA 1AR1D 4TL5A 3C08L 1LD9A 5L4FA 5G5DA 2VAAA 4ZPTB 2VWEC 4U31A 5F44A 5K59E 3AUWB 2QVIA 1V05A 5KVDL 3AGVA 4OF8A 3KDPB 4MA3A 1EGJH 3LKOB 3F7YA 3UBFA 3VDCA 4ELME 1AGBB 3ES6B 4JQIH 5FS5A 4AQAA 3T6WA 2VLLA 5D72H 4UIMA 5F0JB 3MRMA 1BX2B 4GRLD 3V9EA 4ZODA 5B8CA 1FFQA 3DRQB 2C4XA 4ZW3A 3KPPB 3KG5A 2L7UA 3BDXA 4QRUA 1ZANL 3CFEA 3HAEH 3HC2A 4A63A 2NCEA 5CAYB 2IV8A 5IHUH 2ADJB 3V0EA 2O6CA 3LD8B 1SMAA 4PY8J 2Q1EA 4JEGB 4K3DH 2BMKB 1KCLA 3EKCA 2XBTA 5C86A 5DEFB 2PCPA 4I2XB 4WWKC 3RFZC 3LEXB 4GPVA 1I1AB 1W15A 3EJCA 3IDYC 3CHQA 4URTB 3TA3C 3WEXB 5I8EA 1N59B 5ITBH 4UT6H 1LDSA 1OAKH 1G9MH 1I4FA 3AU0A 3UZVA 4Y5YC 4OLZL 1T7VA 2D7QA 3TN0B 4B9CA 3DO7A 4TTDC 1FORH 1FGVH 1PD0A 1M53A 4K5PA 4H0LC 2EE2A 4IGBB 4AMXA 3ZDZE 5IMMB 4FNQA 4LPUA 4S1SH 1PGRB 3NOIA 2FLMA 2GSGB 2NUPB 1ECYA 3QEQB 2F1AA 2YD4A 1I9RL 1QTYT 3G5XB 3AW5A 2VDNB 5I71B 2ZUSA 2XG4B 3ECUA 3MV7A 2Q8AL 5IV2B 2UX7A 2XWJB 1FNFA 4GNKB 3F85A 1NJ9A 1BQHA 3FTYA 1ID2A 4DP9X 2RALA 2J1WA 1EEYA 4N0UA 4QCIA 5AOMA 2X70B 1FNGA 1QW9A 2WP3T 3TCLB 2VE6A 3AAZB 3KR3L 1FO0B 4WEBL 3VX1A 1NINA 3BD3A 2B2XL 1MLBB 3ARFD 5FGCE 2L04A 4RNRA 2YD2A 1SHSA 3GSVA 3D69B 3PHAA 2XFXB 4WLCA 2OXHB 1VGKB 4Y1AB 3PWUB 3HFML 2I32A 4OZGA 3ETBJ 2EICA 5B38G 3OAUL 2VLKB 1XMEB 1UEYA 3LPPA 3W0WB 1LEIB 2J6EL 3H9SD 3O45A 2ZNXA 2E6JA 1DVQA 4F3FA 3LNIA 5KAQG 3L5HA 3PDDA 1QABA 3B2VH 4GKNA 4MWFA 4ZS7L 3V4PA 2GJPA 1Z0MA 1N0XH 1PZ2A 1WFTA 5BOPA 3REWA 2A38A 4BH7A 4QRPE 5DO2D 1AG0A 2YD6A 4S1RL 2A6IA 2NR6C 4HFWB 4HAFA 3LAFA 4Z3IA 4PCKA 5IMKA 1X6LA 2YRZA 3BGFB 3MNVB 3MV9B 2AP2A 1AANA 1J8HB 3CZFB 1VFBB 3GFUA 2BSTA 3QUXB 5EPMB 2XICA 5LB1A 3ZR6A 2G2NA 4F1SA 3PUCA 4UF7C 5DLLA 3ILPA 5DRZB 2QVFB 5DC2A 4AI7A 4G83A 1E4WL 3SGDI 4Z77B 3QJXA 2DIEA 2ESVB 4NRXA 1C5DB 3FO0L 2YD0A 1SXCA 3F7KA 1IBZA 1M7IA 5GS1B 3GXDA 4PJ8D 4BUQA 2X4PB 1IARB 4OCWL 4GAGH 2WCSA 1D5BA 3GJFH 3HNTH 1NMCB 1K2DB 4GSDL 4U1LB 4OCLC 1EAPA 4LOVA 2HJFA 5D4IA 4HCFA 4QJ4B 2PTVA 1MFBL 4IOFC 4BQCA 5CF3A 1M7IB 4OZHF 5AB2A 1TFHA 4K55A 3VCLA 5I16A 3NIDE 3VWKC 1K2DA 3OZLA 2CO7A 4I87A 5C92A 5GGSA 1EUUA 4M4RB 4FJZA 3ZL4L 1FQ9C 2AXGA 4KUCD 4YDMA 2EH7L 2I9TA 3QEGL 4NZUH 4Z7OB 3MJ8B 5L4JA 1G7PB 3K71A 3L5XL 3TN0D 2JJTA 1JNHB 1QNZH 3X11B 4JJOA 5HYSB 4RRPA 3APCA 3QNZB 3BESR 1N5AA 2O26U 4DKAA 1C16A 1MCOL 5CO1A 4OZHB 4ZQKA 2JJUA 3TN0C 5E8DH 2XV0A 2VDNH 1IM3A 3LKPB 2UZIH 4OF3A 1ZLVH 1RPQA 5K1VA 3UMTA 3UYRL 5IROC 3TX4A 1FNSH 2P28B 3KPLB 3PV6A 4PUBH 1E28A 1F2QA 1OCOB 4AKPA 4JY4B 3LQAC 2Z64C 4AYFA 2EYTA 3DUUB 4MKMA 1CICD 2AGJL 1ZT1B 4QHMA 1DBML 3QCVH 3O9WD 4A67A 5HHOB 1RJZB 4Y2DB 3PS6A 4M4PA 1TQBC 3DI3B 5E5MA 2EDDA 3KWWA 5D1QC 1ESOA 1JWSA 1FPTL 1X7QB 3HPJB 3W9DB 3B9EA 3BCDA 2F2HA 3ARQA 3O4OC 4EDWH 4IDJH 4L23A 1FNGB 4JFXB 3S3BB 3P0YH 1W6LA 4ABUA 3D09A 3KLLA 3QISA 1UH2A 4O00A 3O41A 5EIQA 3MYZA 1PLBA 3IDNA 2FCBA 1JGIA 4UOQA 3BAIA 1JPSL 2DQDH 2IMMA 5D96B 1UD4A 4YHPA 1CU4H 1WFMA 4GXVH 1E4XH 2WLIB 5D1XD 2R0LH 1HHHA 4G42B 4GW5B 3WNNA 5BJTB 1PIGA 4I3RL 3DX2A 1IC4H 1X5KA 3T0DA 1Z3GH 2OKMA 3LQAL 5IHZA 2VW7A 1MZZA 2FHCA 3T71A 3FRUB 3OHXB 5B7EA 1EEQA 4F7PA 4LCUB 2NY3B 4Y5YA 1PZSA 5E00B 3WKPA 3LZRA 3G6JF 2EYSB 1ZWIB 1RUKH 2BVQA 3QFJB 2XY1A 3LSOB 4LLAA 4K7FA 3PF2A 5AB1A 2XWZA 4HDIB 2AERT 3QJFB 1HX0A 4GAYA 3MCYA 2L4OA 5F7EH 3C8KA 4H7VA 4R26L 5SWZE 3AY4C 4K94H 3MRLB 1I8UA 3BWSA 1E3XA 1URIA 5E5LA 5EO0B 1QQDB 3IJ8A 3IJSA 5CD3A 3EOBA 1OLLA 4PGBA 4D0BA 2V7NA 3UTSB 4HWEH 4IJ3C 1N12A 5AVRB 2BLFA 3DX7B 4GBXA 5GS1C 4LMQI 3VRIA 2H3KA 1XB6A 4BK4A 2DWYA 3DDGA 5ITFB 1GMIA 3NJHA 1R5IB 1T04A 2OFQA 3E9TA 2DKMA 3S34L 4YPGA 3D0LB 3OWEA 1W72A 1RVFL 4YDKH 2O5YH 4FADA 1IAOB 4V11A 4C56A 1J1XL 2Y3NA 5DD1H 3QVAA 1JFQH 2J5LC 5DSCA 2AABH 4S0TD 3DETC 3BUYB 2B1AH 4M7ZC 4F7CA 3HS9A 4P5TC 2D2CC 4FAAB 3AB0C 4M1GH 2XXMB 4YUEL 1P4LA 1N68A 2AJ3A 3V5KA 5CBAB 1EJOH 2ZCHL 3S4SA 3CJJA 3NIGE 3NJKA 3SY6A 2WXLA 4DN4L 1F3DH 3C5JB 3SY0B 2W9LA 3GHBH 4RBPK 3QJTB 3SPCA 4KX7A 2VLMD 2GTZA 2A83B 2YD5A 2PW1B 4CBZA 4HJ0D 5DK2A 1IC7L 3MREB 5T3XL 1BVNP 4YK4C 2QMJA 3V52L 4PRHA 3FB8A 4YE4H 4X6DA 3RHWK 3WFEL 4AENA 2H32B 3H9ZA 4TNEA 1HH9B 3BDYH 1YC8A 3RDTB 4H25B 5K69A 1ROCA 4P9ML 2E5EA 5DWPA 1YEIL 3H3KA 3IDUA 4ZQTA 2J1KA 2ZOTA 3EFOA 5JHLL 4JO3H 1D5MA 3AC0A 1DVFC 3N1PC 4PVMA 2GSIB 4MYPA 4ZSOE 1EHXA 3BUBA 3PXJA 4LARL 3QUMA 3ESUF 3MLRH 4I18B 5GGRA 4BFEA 1XBRA 3HS0A 4YHKL 4FQXA 4F7MA 3KPNA 3AITA 4L0ZA 4XC1L 3EYOA 4PV1C 1N19A 3QIBD 3K72B 3FQRA 3VXRA 2BNQB 4HP5A 3BGMB 4KMQA 2JWYA 4TNVF 3KWVA 5FYJU 2O93L 3O11A 4DUWA 3QQ9D 5IQOA 2G5BA 4LDLB 4I3SL 4JRYE 5AUMA 4Y4KA 4I5BB 3VXMD 4YSRA 3D34A 2Y7SA 3S3PA 1FH5H 1S78C 1Q9OB 2E7DA 3OKNA 1P6FA 3P9LA 2VDRL 3BJ91 3MR9A 1GHFH 1EZVY 2Z91A 4ZMOA 3ISYA 5JPNB 1QG3A 1NFIB 1NZRA 3WEBA 2F58L 1KXTB 4QDGA 1E42A 3S5ZA 2EUXA 1IAII 2JKSA 1D9KD 1OZTG 3ESOA 5E56A 4QHNA 2BS71 4M8QB 4RESB 4ZAKD 3TIDA 4CMHC 3NTCL 4JQIL 1HXKA 1YNLH 1G7QB 4GRLC 5T1DL 4ZBJA 1JS4A 5C0CD 2R4SH 4HIXH 5B1JC 1P6AB 2EACA 2IGTA 2PWHA 2ZQKA 3KYKL 4LK4A 4OAWA 4UT7L 3G6DL 5EWIL 1IAMA 5K9OB 4IRZA 4NQEB 5BZDB 3HMWH 4NNYB 4B7IA 1P53A 1NMBH 2NQ3A 3ZQ9A 4GXUN 3TTYA 2O6FA 2P42B 5AZEH 4HWBA 4RZKA 5I6OA 4Q9CA 2D3JA 1MVFA 2I7SA 4XNYL 3U6XS 1Z2KA 5AYUH 1YYLH 1S9XA 4JKWA 1AS7A 2AABL 4AIEA 4QXTA 3QR1A 2J1ZA 3LKQA 5TE7L 1DLFL 2CDGB 2UWEB 5CN1A 4WFFD 3IMRA 1CFTB 2O1AA 1CTMA 3ZKND 4NWTL 3NQKA 2QSCL 2B1HH 2ADGB 3HAEB 4F7KA 1I1YB 3GKWH 1OM9A 3VD3A 3WTUA 1E9PA 1S7WA 4LKXB 3NYKA 2YZ1A 1NCHA 1L9SA 3T0EE 1GC1H 1QEWA 4XOEA 1ZE3C 4MAYD 4GRMA 5IVXE 3T8MA 5C8JB 5BMFL 3LN4B 2V17H 4HJSA 2QTEA 1EZLA 5E94A 2GBUA 2FJHB 3ZTNL 1Y0LA 3QQ9C 5EBWA 5C6PB 3S8FB 4XAKD 1I8IB 1BYPA 5E2JA 3H85A 2Z9TA 5TH2A 1NLDL 5L9DH 4GH7B 1M7XA 2DWEA 2BP8B 4LARH 4NQVB 3WGUB 4YSOA 3UG3A 1NBZB 5CCJA 4N8CH 4W68A 3FBKA 4RMWA 4I0PD 2HVKA 2ENPA 25C8H 2GPZA 3QZNA 3TBSA 3RL2A 4WO4A 1NDTA 2Z31D 4QHKI 1JZJA 2P5WE 3HBZA 1FVDB 3RHWF 1G4MA 1YN7B 5KBLA 3L9EA 1TTBA 4K7PY 4Z78B 4GUCA 3OBAA 5JDJA 1LE9A 3PRZA 5GGUA 1A7BA 2ZXGA 5FYJE 1UQSA 4XBGA 3EYQC 4OGXH 1H6UA 4XB3A 4PJ8A 1GHFL 2OMVB 4P04A 1O7DE 1B3JA 3KCWA 4LOUC 5DUPL 3EYSL 5AYQA 2HFTA 1HT6A 4MSWB 4Y16A 1IM9D 5J9PB 4UUJB 3I2CL 3QWRD 2AKRA 1F13A 4XBMA 5HHNA 4I9WE 3WE1A 5C2BH 1GGUA 4JPKL 1XO8A 4R5TA 3Q2LA 4LHQB 4OGYH 1PBYA 1DBAL 4DP2X 4U2YA 3L6FB 5LAXA 1RL1A 4LRNL 4UTCA 3WFHA 1DJWA 2DIAA 1H3UA 2LLNA 4RIRA 4MBRA 4TSBH 5IFJB 4Y5VC 4QOKD 5KYXA 2HB0A 3P3UA 3SQBB 4WTXA 3ILQC 3V5HB 1YQVL 4IRJA 5BQDA 2AQ2A 3NP4A 4PGCA 4I18A 1MVUB 2L8AA 3FFCD 4HEMA 1A4AA 5GGRB 1C5DA 4YDIL 3VTMA 4N8VA 4BSWA 4L5FH 4U7KA 4FJYA 4YHYC 2BH0A 4J4PA 1NWOA 2V2XA 3GGWB 3GZQA 4LSRH 2F53A 5E99H 1BYOA 1VA9A 5CWSA 1HXYA 1KT2B 5H37G 2X0VA 1ZRUA 4OCWH 2QQKL 4KXZI 4X7SH 4BQ8A 1MDAA 4Y9BA 3H9YA 5D1XA 4W4OC 2ORBH 1YJDL 2OSLB 2WCGA 3K6FA 3RNKA 1V3JA 4G9DA 1IC5L 2O5NA 1JGDB 1Q9WA 2AXFA 5T5NF 4EBQL 1I7TB 1KYOJ 1JAEA 1WGOA 4QHPA 5I8OL 5CR8A 4QJ5B 1KEGH 4YHIB 3CFBB 1INEH 4HWNA 4TYUA 2H5UA 1U4FA 2ALWA 1KNOA 4YPJA 4TM9A 1F4AA 5DGRA 3O6FA 4PH8A 2QV2A 4W6XB 3T0ED 4ENED 5GS0L 1WIUA 2YPLB 4S2SA 3FL7A 3HEIB 3G3LA 1B0GB 3PCYA 3C9NB 5E4EC 3RWIB 1G7JB 4I88A 5E4OA 3FBQA 2BIHA 4KY1L 1IQWH 4NSKA 3TJEL 4NQTA 4X4ZA 5AW1B 1IAKA 4POZC 2BVOB 1N67A 1PJWA 1HQ4A 1UOWA 3EOAB 3EO0A 4MJHA 5EEZA 1BFVH 2OMNA 4RNRB 4YLBA 3TBTB 4C83A 5I8EB 4RRPG 3NUKA 1F4XH 1XCQA 25C8L 3U4KA 4W1TA 4WW2B 4F15C 2MOQA 3V4LA 2HKHH 1TZ8A 1KTBA 2X42A 1PFCA 5CLWA 4EVNA 3L3OB 1I1CA 1JK9A 4O51B 1MAKA 3MJ9H 4JY5H 4Y9EA 3CH8A 1BVKB 3T0VA 4E9RA 4MJID 5D6CA 4H8PA 4LVNB 2XV6B 3WHE0 1MRDH 2CRMA 3ETSA 1WIPA 3LIUA 4DK5A 1HYSC 1X5JA 1R24A 2NNRA 4PYGA 3HZYA 1WA1X 5EA0H 1G0DA 1UWGL 2IAMC 4MMXB 15C8H 4XT1C 1NEPA 2R2EB 3G5XA 3NPSC 3KR3H 3MAWA 3OR7A 1AGDA 2B14A 3GSRA 4PJDF 3GSNL 3QPQC 1U8OB 5DUBB 4CNIB 5IB2A 4JPKH 2WUCL 4PRDB 1KWGA 4DQAA 1JRHH 3PJSA 3DK2A 2IDCA 5IVZA 3TWCL 3CX5K 5IESH 1JZ7A 2V4LA 3LB6C 3QEUB 4OFIA 3EOTH 1AGDB 2C9SA 3GQFA 5ANMB 1UOLA 4NUQA 2A9AA 2BCMA 5DHDA 4YO0B 4H5SA 1ZLWH 5FA4B 2JCCB 3M17B 1UM5L 3BZ4A 3HI5H 4GLRH 5DQDL 4CC0A 2E9WA 3RVWC 3B2UC 1CDCA 3LKRA 4R97B 3D85B 2ICEA 1IC4L 4F93B 3OF6D 1NAMA 4Z7UB 5HJGA 3TS8A 5DO2C 5EV7A 4TL4A 4LOUD 3OGOE 4NQED 2FR4B 1TJXA 1JDCA 4F2MA 3WXWH 1A7PL 4Q4IA 4C54A 1VF5C 3OM3B 1TTFA 5KANI 3O3UN 5F88B 1T0MB 4RMUA 1CK0H 2XX1A 2X0WA 5JQ6H 5AAPA 2WO2B 1NKGA 1UURA 4DKFH 4I77L 1UXMA 4HJTA 4POZD 5EORL 4PJDB 1V3MA 3WTYA 1UWEL 4WFGD 4KVNH 4EUPG 1KYDA 4DJMA 1A2YB 2BP0B 5GGVL 3L95A 3KBPA 4FQJH 4NC2B 5I1DB 4N2AA 1IL1A 2VAAB 3ET9F 1E0OB 2EIBA 1FDLH 3GBNL 4U05A 4ELDA 2JTDA 2GUYA 4CSSA 4Y4KB 3PAZA 2A9CA 2WAQA 4IDLA 3BSHA 4HSCX 4A7SA 3PAYA 3PGDA 1QUNB 3Q5TA 4QEGA 4P8QA 1RUPL 3FB7A 2EDJA 4OIIH 5DMGD 3WFHB 1N26A 4KXAA 4NRYB 3AWFA 3LRLA 1R17A 2DV6A 2JXMA 4ODSL 4XXWC 3RWDB 4DFIA 5HHPA 4PJ5B 4JFFA 2X4QA 5FDWA 4XP6L 2BOCB 2AJYL 1UWFA 4OD2A 4P2RB 4PJGF 3OSVA 4QRRE 3MCLL 3QEGH 4IBYA 4MNHA 1FNEA 2GB2A 2DQJL 3CDGA 2AQQA 1CLZL 2APWA 3EJTA 4GRWH 2E9GA 1RMFH 1MLCA 2WP3O 2XWBA 4X4YB 3EDDA 3X1GA 1ZHLA 2BOCA 1LP9B 2PYEE 2FX9L 1AHWC 1C1EH 4JG9A 4P4KC 3WKQA 3ULAB 2EXYC 2ZOKA 4E9LA 1CDYA 3UIZA 2OMYB 1U3JA 4PRHB 5D7LE 2X6CA 1CT8A 5KVGE 2KC0A 4XCYA 4MJ6A 2CD0A 1N3NA 3FTGB 5KVGL 2QZQA 1J05B 3ROOA 4A37A 1GJIA 4FNPA 4JPWH 1UJTA 1JNJA 2CXGA 5BRQA 2B3IA 1FNSL 3SE3A 3W2DH 4WUUE 1SRDA 5I1IH 3RP1A 1PYWA 4L3EE 3L9BA 3D7PA 2AV7A 2FIKB 4FI7A 1SJHA 4FQLL 3ZUCA 4R84A 1EEZB 5EEVA 1ZMYA 2NY5C 3BH8B 5T1KA 3MV8A 1XIWA 5DMKB 3H4HA 1PTZA 5AKRA 5T1LB 1BM3L 3RAJH 1BZDA 3ARXA 4Y9FA 4FCHA 4UB0L 2Y5TA 3WOVA 1E9PB 1S7WB 4HEPG 5KVDH 2XVBA 3V8OA 4MQSB 3DXAD 3FF7A 5JO5A 4XI5D 4JB9L 3ZE2B 3UCQA 4KNQA 5GRVK 1J1PL 3D8MA 4FFZA 2J12B 2CKBA 1ZT4A 5IWLC 3NJVA 1S78D 3MUGA 4PJ7A 3LNDA 3KYMA 1K4CB 2LW3A 4ZYKB 3TH4T 3RRQA 2QADD 2X44D 1MCRA 4KTYA 1UYWH 4X7TA 5C0AE 4YDKL 3OHXA 2I7OA 4WI7A 1INDH 3SHSA 1KB5B 3OAWA 1XZWA 4UQEA 5IQMA 3D48R 3R1GH 1NCTA 3TP4A 3L5XH 5C0NC 2Y72A 2BWQA 5DUBA 5LCVA 2R0KH 3ZE2F 4BKTC 4ZW8A 5AFAA 4R97C 2WTRB 3EO1A 4AEIL 1E2VA 2XOTA 4F8OA 4NNYA 4CC1A 4KO7A 2E7LA 2GITA 2EQDA 4MDIB 4KHXL 1G6RH 3O6KH 3QJVB 4JFOB 5IP4A 4IRSA 1IM9A 2Y07H 5FM8A 2WLZA 4QHUA 3T2LA 4AGOA 5MERA 2APBA 2WVVA 2KLSA 1JF5A 1F18A 5ETUB 5HVWA 2QGBA 2L0DA 5E1HB 3GJFK 2FH6A 1VACA 1DJXA 2WW8A 1CVRA 2W95A 4B9KC 1LO2L 3VFRA 2EDQA 3DGGA 4GKSB 5DEGB 5I18H 3GDBA 2KMWA 3L2NA 4PHXA 5LGYA 4P57A 1NM9A 3IMSA 2YPKA 4M8VA 4V1DA 4IMKC 1NCWL 2ZKHH 4QOKE 4X6CF 5HGDB 1D5XB 2WBXA 4OZFH 4K71C 5KW9H 3U7YH 2KDYA 3KVDD 2WZPA 3QJUB 2HKHL 3BJLA 3LKSA 1GPOH 1KTDA 1L0XA 2BNUA 1P2CA 1JDAA 2IDFA 3Q6GL 1TNNA 3F5WA 4DVBA 3V0DA 3NGBB 1QEXA 1WPCA 5CJOL 3SE9H 5BV7L 5TDOB 1R3LA 1D5MB 1DN2A 2ADIA 3EZJB 3GK8L 5D7SL 4M5YH 1AQKL 2HKFL 2MNUA 2P45B 4K2UH 4M1GL 3B6SB 1QW8A 4P2RA 3TH3T 2XN9D 4KNUA 1KCBA 3B2VL 4M4RA 3A24A 4LPCA 4X4KA 3ZQXA 1I8MA 1GVIA 1JZ8A 2K7QA 3UBXB 5IEKA 4LE8A 2A6JB 2ATPA 4LDOB 1UT9A 3ARVA 4Y89A 3CFJA 2DM7A 4AQEA 5HYJD 4C57C 3PFUA 1FG2A 4BZ2A 3BUTA 5DJCB 1AHWB 4P4KB 5I0DA 5FCSH 3BP5A 4GQQA 4HUMB 4P46A 2HRPH 5I1JH 5E0QA 3V4VH 5A2KH 1ZEAH 4XMLH 3WNOA 2V33A 1HAUA 1HINL 1NCBL 4RCAA 4F7MB 2Y22A 2X9WA 1J8RA 1JZ3A 4XWGH 4J4PD 3C6SB 1DDHA 3IJYB 1CI3M 1ZHLB 4MD4A 2WKGA 2ZWNA 1CGSL 4H25A 5G5DB 3FQ2A 3TO4B 4U6YA 5DUPH 2IGFH 3D50A 1BEXA 3L5IA 2P48B 4UV4H 5K9KB 3FTZA 5J1SC 1OM3L 4GIAA 2NZIA 4OKVB 1YNKL 2Q6WB 4HUXB 2Q2EB 3BAEH 5A7BA 4DZ8A 3R0MA 3KXFD 1CGUA 1TQUA 3VH8A 3LH8A 1UXSA 3T3PE 2JFCA 4L8DB 4HCRA 4NZRL 3P3TA 3MCKB 3WFCH 5ERWB 5F1NB 4ZMVA 3NBNA 4M29A 2PR4H 3TTSA 4L8BA 4IKJA 3HPLA 5BS0B 4X80H 4ZFGH 4BKLB 1DEEB 1DN0A 4Y4KD 4YDIH 4FQCH 4O2CB 1ZDQA 3F12A 4RLDA 1VFAA 1P0SE 3HLAA 4HUNB 5TK4A 5JA9A 1UWYA 5HBBA 1HZHL 1JYNA 4OLUH 3GMOA 4DGUA 1FVEA 3TIEA 1G9ML 1ZCRA 5I75C 3HVDA 1DLHB 4M93B 1I1YA 4TOYH 1DTUA 3X14B 4XOBA 4ZAKC 4MA8H 4JRXB 3GSOA 2DQIL 2LU5A 3LZLA 4MMZC 5CZRA 1MJ7L 1ZWIA 2BVQB 2E7HA 3VFTA 5AENA 3LKNA 1ITBB 2VMJA 3MV7D 1ORQA 5E8PB 1ED3B 1YNTA 4WI6A 2I69A 3T2NH 3QPXL 4PJGE 3B7SA 1RZFH 3T1WA 3W57A 4BXSV 1NAMB 4Z7UA 4JVPA 1FAIL 1JK9B 5FAAA 2WANA 4Y1TA 1WITA 3QC5X 5E1AA 5ES4B 3LV3B 4FA6A 2ZUVA 5FUZL 2TAAA 2GY5A 2A7BA 1N7ML 2QQNH 3P1VA 2C9QA 3ALXA 3HI1B 4LVOB 4X5WB 2R15A 4BZYA 3QFJA 2MJWA 1HQ4B 1NCAH 3NG5A 4TRPL 2H2PC 4C47A 3BZDA 4OBRA 4W9CC 1K6QH 4XPGH 2IO5A 2FHBA 3OL2A 4P9HH 4ZUUB 2AJUL 3NFNB 2O5XL 2VWEE 4K71B 1F90H 4OFVA 3ETBF 3VFWB 2WWOA 5IBLD 2BCKA 3UGXA 2WLMA 3RBSA 1DZBA 3HFMH 2J5WA 3D07A 3CZNA 5DFWH 4F7TA 1QLFB 5B7MA 2J6EA 1KSRA 3VWJD 2E9BA 2CUAA 2IPTL 2OMWB 1H0DB 5HVFB 2CCVA 2XWXA 4OUUB 5EUKB 1D7BA 4PSRA 2D3LA 4XWGL 1NAMH 3GTVA 4B5EA 2JJSA 1W8NA 5LGJA 5TGBA 2J56A 2WPGA 1BGXH 1GS6X 5KSAC 4OGZA 1P5UA 2PPCA 5ALBH 3DX8B 2UYLB 43C9B 4KI5D 4XCNB 2PPFA 1R47A 4NQCA 4IS6A 3VXUD 4AMKL 3G5ZB 5KYNA 2AQ1A 5KG9B 1IBBA 2CA4A 4R3SB 3NIFE 1E90A 2FWSA 2MTPA 1SLXA 4G43A 3FQ4A 1FFTB 1BOGA 4U33A 3P0GB 3OV6A 2AQ3A 4ESKA 4G8FB 5AVSB 2YGNA 2PR4L 4N0CD 3L1EA 1A6VH 2MPAH 1H6FA 1B2WH 1OK0A 1MCIA 3FT0A 3NFSH 5C0IB 3E1F1 4AL8L 2BSSB 4WFEE 3P2BA 4LEOA 4JZJC 2CGYA 2EDXA 3PGCA 4PJDE 3NFPB 1KB9K 1EK3A 1DHKA 2MHAB 4KH9A 5BRZE 4LASH 1KIUA 2XU9A 5AVVB 4L9LA 3LZOA 3BZ5A 3HN5A 2ZAGA 3KPNB 5F9WC 4PR5B 3L3DB 2CU9A 4Q9QL 2QQLL 4RBPH 4OLYH 4OUOA 1TG8A 5B4MC 2VZUA 2EDKA 4MA3B 1SY6A 5C07E 2E9IA 4PJ7E 5D2LE 3RTQA 4MD4B 2F53B 3PY9A 3QUMB 4E42A 1DJHA 4ORGA 4ES9A 4ZO6A 2XV2A 1FAIH 2WB1A 5H2BB 1Y18A 3MNWA 4WGWB 1UH4A 3BP7B 2ICCA 3DVFA 3KJ4B 4IRJB 4K23L 3IETB 2AJVH 4KRPC 4YE4L 1EV2E 1KB9J 3BOVA 1N6QL 1DDTA 4BELD 2HT2C 2VDPB 1GIGH 2WINB 1BXUA 1NUFA 2OZ4L 2Q87A 4NENB 4P9MH 1YECH 4YE0A 1N3NB 3O2DA 4X8XA 3IFOA 1HEZA 2VDNL 2XTJB 4Z7VB 4HKXB 3QCUL 5B1KA 2FJGB 4NKMB 1NC2B 2BNRD 3TWCH 5IESL 4XN2A 2I24N 5IBUG 3R06A 1I7RB 3HUJE 4YWGL 3RWCA 3Q1EA 3QARA 1VEOA 3FU9A 5KBPA 4DGWC 2OK0L 1IX2A 3IDGA 1SOKA 2VZSA 2YAEA 3CFTA 4UQ9A 3KLAB 4U6XA 5E51A 1YEEL 2H3NB 4PRPE 2XPGA 3T0EC 1O6VA 4W9HC 5I26A 1SEQH 5E2UL 4W9FC 1MCPL 2OAAA 2NNAB 3JVGA 5AD0B 4UTBA 1BFOB 3AREB 3L08A 2OMZA 3GJFA 1KXQA 2FK9A 2EP6A 2DEWX 1KELH 2IQ9L 3ECBA 4FNRA 4O4YL 1HYRC 5FO7A 4WK2B 3RA7L 3K8MA 4GMSL 1JGLH 4OR1A 2N1KA 2OW6A 5IF0A 4BK8A 4L1HA 3GI9L 1NL0L 3DUSB 2AQRA 1I7UB 4U0RC 5F72S 2WLIA 3BZFA 1PZAA 1Q9KA 3AU1B 4FL4C 5D5MF 2GK0A 4P0DA 4RX4A 4ZUSA 1AR1C 3SDXE 5C0CB 5T3ZH 1Q1JH 3LZFH 1AR2A 3D69A 2VL5A 2ARJQ 3KL3A 5TE4L 5C0FB 2TSBA 1RUKL 1FP5A 3WS6C 2PCYA 4LPYA 3OAYH 1TYRA 1T5WA 2GIMA 1IGCL 4MMXA 1CQKA 5IQNA 1J12A 1EXHA 1XGPA 4WU5A 4M3JA 2GK2A 3JV0A 1RPKA 1Y07A 2WXGA 2PKDA 4NO2A 3EXLA 2LV4A 1CB4A 1A6WL 4JZNB 4EQ2A 3HRZB 5TTRA 4RA0C 5FPIA 3LXBA 3MV8E 3GBDA 1MHHB 1SOXA 1AC0A 2PR9A 4G7YH 3BISA 3MCLH 2LT9A 4JHBA 5HXMA 3C8DA 4JX0A 5DURB 1QO3A 2AZUA 2PETA 1OARH 2VSCA 2JLLA 3CBJB 3QNXA 3SJVE 3WKYA 2JB6A 1TQSA 3ZHLA