4GT0A

Structure of dengue virus serotype 1 se containing stem to residue 421
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
402
structure length
390
Chain Sequence
RCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEVTNPAVLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDTNFVCRRTFVDRGHGNGCGLFGKGSLITCAKFKCVTKLEGKIVQYENLKYSVIVTVHTGGTIATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNEMVLLTMKEKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLVTFKTAHAKKQEVVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKLTLKGMSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGKMFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a dengue virus envelope protein late-stage fusion intermediate.
pubmed doi rcsb
source organism Dengue virus 1
molecule tags Viral protein
molecule keywords Envelope protein E
total genus 67
structure length 390
sequence length 402
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gt0A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4gt0A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4gt0A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4gt0A03
2P5PA 1Z66A 1S6NA 1OKEA 3J2PA 3N43F 2H0PA 3UZVA 4GSXA 5LBVA 2ALAA 4BZ2A 2HG0A 3N41F 5LBSA 3UC0A 5KVGE 4BZ1A 4X42A 1ZTXE 4FG0A 3UYPB 3N42F 5IZ7A 2GG1A 5JHLA 2JV6A 5KVFE 5KVDE 1UZGA 2I69A 4UTBA 1URZA 1RERA 3WE1A 1OANA 3N44F 5JHMA 3UAJA 5B1CA 4ALAC 3IRCA 4FFYA 5GZOA 2R29A 5KVEE 4GT0A 1PJWA 1Z3RA 3C5XA 2JSFA 4UTAA 1TG8A 3G7TA 3P54A 4L5FE 4UT6A 2V33A 3J27A 4FFZA 5H37A 5AAWC 3UZEC 4AL8C 3VTTA 5GZNA 3C6EA 4AM0Q 5AAMC 5IREA 3N40F 1SVBA 2R69A 2JQMA 3MUUA 3UZQB 4UT9A 5LCVA 3I50E 4UTCA 1OK8A
chains in the Genus database with same CATH superfamily
1AXSB 2OSWA 5BUAA 1E9QA 4JRFA 2NY0C 2YN5A 1V3KA 3VXUD 1QFHA 5C6TL 5J6HA 3U0PB 2HT2C 3S36X 1FC1A 3O3UN 1AG0A 5IMMB 5EF2A 5ENWA 2NUPB 2CGRL 3KVQA 4LSRL 1KCBA 2WSDA 4HUMB 1MW2A 1S9XB 2K0RA 5I8KH 4ISVA 3GI8H 4UT7L 3MDJA 2DJ4A 2YGOA 1BQKA 1UENA 3DX9B 5C0EB 4L3EB 4PS8A 1ZRUA 1U8NB 4FXLA 4FTVA 4UCFA 2I9TB 2VQ1A 5A2JH 4TQEL 4YPGB 1J18A 1TLMA 1PDKA 1X5XA 4NRYA 4FP8L 1D5MB 3ZN6A 1IGIL 5KSVB 1EXUA 3ZE0E 3I6GB 4L8CA 4W9HC 5B38B 4N20A 2DBJA 1IAKA 5IROC 1J8KA 2RMNA 5EBMA 5H94B 4XWOD 1ZJBA 4PR5B 1ET5A 1NWOA 2X1WL 1HYRC 4OZ4A 4Y5VB 1NGYB 3QCVH 1VAHA 4NRYB 1A4CA 3L7FB 2NXZB 2DRUA 5HD8D 4EUPH 1FFOB 4CVXA 2EC8A 5L88H 4N2OA 3RILA 2AJZA 2E7BA 3ILQD 1KNOA 4ZYKA 4J6RL 4DH2A 3O3EB 1IM3A 2OPCA 3QQ4A 2X2JA 5ISZB 4TQHA 1TLKA 4AEIL 2ATKB 4APQA 1BA9A 5EO1A 2A77L 4N9GA 5JHLA 1QBML 4NQCB 5CJOH 3LNDA 5DUPL 3CFIC 2NZ1A 3D0LB 1VFBB 4PUBL 4WWOA 1RZFL 2ZOOA 4KTEL 5A16A 2GW5A 1AQDB 4UIKH 3OWEA 4LBEB 1F8TH 3JWDH 4PGBA 4HWZA 1EO8H 3B7RL 2CGRH 3M6DA 1HOEA 1U8MA 3FUFA 5TFSL 4GLRI 1T03L 2VDKB 3GXUB 4YEFA 3QIBB 4HWBL 3LOWA 3PIQA 2J6WA 4J7RA 4AJVA 3O3DB 2IOIA 4YC2B 2DYSB 3BE1H 5JHDD 2QPEB 3NCJL 3MYZA 4LOVA 2A6DA 1KOAA 4OFVA 4Y9FA 1AACA 4XVUD 2CAKA 5DUBB 4F37F 1J87A 3O45A 1HCFX 2NY2C 3GRWA 4QOKD 4MBRA 1HEJC 3E8UL 3W2DL 4GAAA 4QXWA 4IDJH 2Y3AA 3ET9F 1BWWA 5GGTL 2DBLL 4H1LG 2GFBA 5D8JL 4PI2A 5D1XB 4AGMA 1T7YA 2D7TH 3WFBH 5HGGS 3RJDA 2ZX9A 4JKPH 3K80A 2P8MB 5IUCA 2FB4H 4I3RH 4XOEA 3W9EB 2NTSP 3EBHA 4GBXB 3L9RA 1NGXA 3AU1A 5DFVD 1F1GA 2DDQH 3JUZA 1B90A 4JL2A 3T0EC 2AKRB 4M8VA 3ZT7A 4FADA 1A64A 2AW2A 3C8DA 4P5MB 5E1IA 3DOHA 2A38A 3CZFB 2I5YH 1SM3H 3FQ2A 3HS0A 3QEGL 1FFRA 1P7QB 3C6SB 5K9JL 1MCKA 2BRRL 2AGJL 4UIKL 3F7YA 3B2VH 1JVLA 3QUMH 2EC9U 2ZSVB 5CSGA 5B7EA 2LOEA 3QXWA 2HG5B 1FV1A 2PYEB 1DN0B 1DFBH 1OKEA 4PCTA 5A2CA 2FX8H 5LVEA 4YWGL 2WGXA 1J5OH 4MX7B 5AL0A 5CCGE 4ZUWA 1JXDA 1WAPA 5E6YA 1NKRA 1M9SA 3FO1A 4XVTH 1N2RA 1W72H 5T33H 4P2RB 3MXWH 2X89D 3CVHA 2ZKYA 4H4NA 4HCIA 4PJAB 4TTDC 1KJ2L 4IQHA 4XMLH 1C16B 4ZNEA 5AW6B 5IHUL 4QLRA 5JPMC 2ATPA 2J1WA 2O4EA 3Q8EA 4G70B 4J1UA 5DSCA 1D5BA 3H2WA 1QKZH 2QBWA 4XOCA 3WNMA 4OV5A 4OCNC 4UV4L 3SCMA 3WMQA 4KKBC 4E9RA 5BRZB 1IM9D 2CUIA 3HNSL 1WZAA 1BQHG 5IJKC 2K1MA 2Y7OA 4XPAH 5HDRA 3WKMH 2IG2L 4GAGL 3AREC 3TBTA 4GQ9H 1AGCA 4YFEA 1BZOA 1F02I 5IQ7H 3WAJA 1NMAH 1D9KA 1HKFA 3IGFA 4H5SB 3U4EA 3VD5A 2ZKWA 1GZQA 1EVTC 2LTQC 3BPOC 3QEQE 4IK7A 5GS2H 4OV6F 2A73A 1IQWL 2CH8A 1OPGL 4D0DA 4PS4L 3MCYA 4KK5D 2ZQKA 5F97E 4KK8C 4GAYA 5FF6B 1BP3B 5EC1A 3KYNA 1W6LA 3ISWA 4FFZL 2BIPA 3DVNA 1MJJA 3UTSD 4PBXA 4XH2A 4CNIB 3FW6A 1MQKL 2UXVA 2H9GB 2WXGA 4BK5C 4F3FB 4TLSA 1KJMA 4PJEF 2YA2A 4KROC 4DTGL 4CKVX 3O11A 2ZYIA 2Y1YA 3KPLA 3BGFC 2WXHA 1FHGA 4HKBA 1TIUA 3VI4E 4OD3L 3FOLA 4Y4KD 3QSKB 5AW8B 2BNRB 4JLRB 2Z0BA 3L48A 3V9CA 1KXTB 3PRZA 3TVMB 1HH9B 5C0DA 3CU7A 2ADYA 5JOEA 3PUUA 5IBLD 5ICZA 1Q9KA 2XN9B 4N3UA 4QHMA 3HHRB 3QPXH 1FGVH 1KV3A 1NCGA 3BUBA 4OGZA 4ZS7L 4E41D 3K6DA 4LF3B 1LNUB 3SD2A 1E50A 1FJ1A 4B96A 43C9B 5I71C 3H0TA 1CXLA 4YHZL 4MJ4A 4BH8B 3Q7JA 4QT5A 2EH8H 5JO5B 3RWGA 5ADOH 2R1YB 1U9KA 1IC1A 1UD8A 2YC1B 5AWNL 3WS6A 3O6KL 3DETD 2AI0L 2LU3A 5D7IE 3P2DA 5IMLA 2DI9A 3JTTB 4EI6A 3ARYA 1HHHB 3IF1A 2XG4B 5GS2D 4MNGA 4WTZA 3KJ6L 1E28A 4PIBA 5GISH 3B8YA 3E2HC 5IBUB 4ELME 1T4KA 1IGFH 1PNCA 1UQSB 4LOFA 3RA7L 3DXAB 1ACZA 2UX7A 4TSAH 5EO0B 3CSYA 1XQ4A 3BEVA 1R3IH 3QORA 1KCUH 4X6EA 4AIZA 5J13C 1WAAE 1XGUB 2H6OA 3SJVB 1VKXA 5AZUA 4M8QA 4PV1C 5FYKU 3S5YA 5F6HJ 2XJKA 4L8SA 3B7TA 3WIIL 4OCLC 5C3TA 4BV1A 5L2KE 1Q1PA 1I1RA 3MLWL 3F12B 1O7DC 3P1VA 1DEDA 4MAYC 5E2WL 1J8HE 5D7IF 3QFJA 1HHJB 1NA8A 5DLML 4CJ0A 1IAIL 3GQFA 2OJZL 5T3XH 4IYKA 4LDCA 1HYSD 3BHBA 3V52H 3EDFA 4JPKH 2VM9A 4G6KH 4XPFH 3B83A 4KKQA 2BSSB 5DRNA 5F6IB 3QK0A 1E4KA 2N4IA 4ELMF 4LBAA 2UWEE 1AD0B 2CKBA 3DX2A 3KWTA 4NS0A 3RKDD 1HAWA 3P3UA 2CHNA 4FNUA 3V6BR 4AJYV 3UTTA 3L9BA 1OE2A 3ZIMA 1H8LA 2V17L 2AABH 2DQGL 5IJBC 4X99B 3KYKL 4A7TA 1WFJA 3QR0A 5GRUH 2OJEB 1JNHB 3ZPDA 1U93A 2HFGH 3HS8A 4N2GA 1AOHA 3GBNL 3MNDA 3L2NA 3S3SA 4AGLA 1X3DA 2Z91A 4XNMB 1XTLA 4HXBL 2DM3A 4EVNB 2F5AH 1D7DA 2EIZB 2WTRA 3O9WB 1KENH 1ASOA 1UD3A 3QJUB 4U6VL 2A0LD 1G0DA 1OSZA 3R1GL 1CVRA 1JOIA 4NQEB 2MHAB 4PJ8C 3BPOB 4PRDB 4UTAH 2R59A 3BZ5A 4WWKD 3GO1H 2BOCB 2WXFA 4X8XA 1MH5A 1EQWA 4UDTA 3DYMA 5INDA 1U21A 1CN4A 1I7UB 1R24A 1XL6A 4YPGA 5HI4C 3NZ8A 3V95A 5JXAH 1WYJA 3KLSA 3GZPA 3KLQA 3S8FB 4NQTA 2YN3A 4OZIA 4M9OA 2H0EA 3QEQB 4E9SA 4RFNC 1OCOB 4KH9A 4MDJA 1EEZA 1GSKA 1VGEH 3S0PA 2FHFA 1NFDF 2V3DA 4DKEL 1RUKL 2CDEB 4ACTA 2VKXA 3O4OB 4AM0Q 1T1ZA 3LV3A 1KB9K 2XWEA 4PU2A 5E8DH 3FB8B 2VMFA 1WD8A 3EGDA 1RVFH 2CM6A 4RMVA 2HRHA 2MIZA 5I17A 1RURL 2DI7A 3NABH 1N12A 3T0XA 1B2WH 5D1QB 1NFKA 5EU3A 4LHQB 2Z4QA 3V0WL 4L23A 3WKPA 3D2UD 4DN4L 3MJWA 1CG9A 3HZYB 3BX7C 5DHXB 1SMOA 5KVDE 5GZNC 3BGFB 2CWRA 1Z7JA 3NSXA 3MYJB 5HHOB 1FYTD 1GC1H 4JFDB 3VXSA 2JI2A 4JFSA 3GIZH 3NPSB 4ODTH 2Y5TA 5E94A 2CKBH 3L8QA 5SWSA 5DURD 1GGYA 3TZVA 1OEZW 5KOMC 4WTWA 3W0WB 2PYFA 2XIDA 3SZKC 4HIIB 1PIGA 3R1GH 1CE6A 3RPBA 3U83A 4Z7IA 4DGWC 5HDQL 4OZFG 2NXYB 5ID1A 3B9VA 5DCCA 1BAFH 1G7JA 1KWKA 2XN1A 3EO9H 4KJQD 4X8JA 3TEZA 2FO1A 8PAZA 2VABB 4IIQC 1M6OA 1HE7A 4JDEB 4YGVA 1N7ML 1FAKT 1SHSA 5EU6D 1GS6X 3U0WH 5L2JA 5ESQB 1EFXD 4OZGA 1IEHA 2XVKA 3G5ZB 2HUHA 3SBQA 2CO3A 2KZKA 3CN1A 2O6DA 5IMKA 4G7SB 1BFTA 4Q4EA 3AC0A 5D1XC 3TP4A 4HAKA 3QEUA 4LRNH 3ARTA 4HJGB 5H8DA 4YGVB 4PJBA 3CX5J 3FU8A 4TXVB 2VKWA 4P2RA 4U7SA 2ADFL 2VQTA 3S5ZA 4IEFA 4X9HA 4NUPA 5GJTH 3T6WA 5A7BA 4ZUWB 5C2BL 3IDXH 2WD0A 3VDAA 5GS1A 3PJNA 4DJMA 1D7BA 1J8HD 4YQXH 1WT5C 3IKCA 2WLMA 1LEGB 1ID5I 3SE3C 2HJLA 2BSBA 2AK4B 3H9YA 2JI1A 4ZAKA 1ORSB 5FYLL 4I0KA 1XVSA 2XQBL 1I8LC 1MG2C 1BVOA 3OLDA 3T65A 2QFPA 1JJUA 3GIZL 3BRGC 2P42B 1MAJA 5CILH 4H7VA 4Z0XB 1FL6B 1A7OH 1U91A 3PABA 4F27A 1GXEA 4M7ZC 3I3DA 4ZMPA 5B8CA 3KLHC 3BP5B 2GUOB 1DQQA 4KNTA 2PPCA 1GRWA 4FG2A 2XOTA 2I27N 2DW5A 1XAKA 4Q9BA 3EJYD 5IM7A 5FGCE 1XBRA 1N7MH 4L3CB 4W9DC 4XP5L 5F7NC 3K6SA 2FR4A 3JV0A 5AOZA 1ZDSA 2KZBA 2VSMB 1CLOL 3MLRH 1P69B 4OIFA 4NKIH 4G6FB 4RLDA 1MCPH 5TGBA 1NMCC 3S5LB 1D5BB 1UURA 3CSFA 4QKTA 1JWMB 2MPVA 1P7KA 4JRYB 4PG2A 2B1OA 4KRPD 4CSTA 4CSSA 1NC4B 4WTZG 1A6AB 4JG0H 4LSPH 3CAFA 1FN4A 5FOBA 4OM1L 2VSDA 1E4XL 1MRFH 2APWA 1DQML 5JIKA 1NBZB 3KL5A 2ADJA 4HX1B 4UZSA 1FH2A 3NT0A 4U7MA 2A3TA 3W38A 2DZEA 3SQBA 3S3CB 1Z1WA 1S4IA 2XZQH 4AMKL 1UOWA 3GMOA 1XF2A 4NDMB 3ZYZA 3EJRA 4KK5C 3L4ZA 1J0HA 3GBEA 2JCWA 2X40A 3J2PA 4LVHB 4P07A 4PGBB 4DFHA 2A4CA 1RIUL 4URTB 1F6LL 3WY4A 1S7SB 3EOAB 1VFUA 5K1NA 3O6LL 4RH4A 3PUCA 1J5HA 1ZV5A 1EEYB 5J56B 3IRCA 1O6SA 1X9UA 3ARDD 3WO4C 2F53B 1XR9B 3OXSB 3OB8A 4HMCA 4HPOL 2W07A 3A67H 3GSWB 3T3PE 3LNGA 1E4HA 1H0DB 4C83B 1TEGA 4HSAC 4U4IA 3ECBA 2X2IA 1GGUA 1QHQA 2HLFD 4RMWA 1L0QA 1ZVHA 3LDBC 4UINH 5D1XD 3BQUB 5DUPH 5E2TH 3D25B 5C0JB 3QUYD 3LKOA 2BP8A 2P8MA 4OZFA 2VN6A 3K3QA 5KYYB 3HBQA 5EPMA 1KPVB 1EBPA 1PX4A 4WW1A 1YNTA 2F1EA 2PCXA 4C4KT 5MENA 4XCYB 3OKYA 3QQXA 1UZ8A 2RJMA 4AT6A 3EUDA 4NHCH 4KXZH 3NH7L 3LXAA 4OVVA 2NNAB 1TPXC 3CGTA 3HI6L 3DC0A 3DTUB 3D4YA 4HFWB 1Y18A 3U30B 2IANB 2CNYA 1H6EA 4HWUA 1DQMH 3BW9B 3PGDA 3KNBA 3H9SB 2VQ1B 3C60C 1D5IL 5CBAB 2ZXCA 5KSBF 3NCCB 1LGVA 2ITDA 4IOSD 4NAJA 1CTMA 4YDMA 3VD9A 2K4AA 3QIUA 4HIXH 5HVHB 3MRFB 3GHEH 4A2GA 5DUML 1SY6A 5HGAB 4EVNA 4G1MA 3D4ZA 1F0LA 1AGEA 3QFDB 3QEHA 2HT3D 2N0KA 3MRMA 4I88A 5CU5A 1OP5K 3ZL2A 2WZPA 3ZXAC 1S9KC 3H2PA 5E6IA 2IVFC 1RKRA 2E7CA 3PHOA 5AVSB 4TQIA 3VDBA 4YEEA 5AALA 4UIMB 4Y2DC 3SYPA 4PB0H 4G7VH 4K3EL 1S5HB 1UD5A 1WSST 4XMKL 3IGUA 4AEHL 4MAZA 2UZPA 4Q4IA 5E2UL 2WLYA 5SWZA 1JYWA 5DZPA 4L9LC 1SVBA 25C8H 4QJ4B 4LNRA 5J06A 2EXWC 4AMXA 1V3JA 2RAMA 2FQDA 5T3XE 5E2TL 4MXVE 4JB9L 1GY1A 3GHPA 5A6LA 2WAQA 5CCHE 2PCYA 3QB7C 3IWUA 1H3VA 5ES4B 2FYYA 5KVFE 2VDQL 4NPYA 2MPAH 4YHIA 3FRUA 4AK2A 3C2AL 2Y7MA 1E4JA 5CCKH 2Y7SA 1I31A 3ZDXE 5HYJD 3S9DB 2J20A 2VR9A 3Q8BA 1L7TL 2VL4A 2G2NA 4PJGE 3SGKC 4DT2A 1DFBL 3U46A 4Z8FL 4PWGA 2DBLH 1YPZE 2R69A 2X4UB 3CFEA 4FNLL 5HHOD 3B1UA 3CE1A 1A0QL 5EEZA 3DXAA 1T5XA 4V1DA 4X6FB 2X4QB 3GSNA 3VUAA 2B4CC 1YLBB 4QF1A 3PDOA 4L3EA 2PPFA 2OYKA 4U1SA 3FT0A 5CLTA 2UY7A 2ZWYA 1GGBL 2E8ZA 3O3AB 5D2NA 5EC1B 3VCLA 1QYGL 3TA3B 3AT0A 3RNQB 2UZYB 1KGIA 3P40A 5F9JA 3DGDA 4HOMA 5BMFL 3GMQB 1GPOL 5MI0B 1MEXH 3T4AA 2X1OA 5IMOB 1IL1B 3I84A 3RIAF 1YDPA 2ZONA 4PWKA 5J3HD 1MY5A 1ZS8B 3QHFL 3RE0A 2GK0B 1GW0A 1FRGL 1J9RA 1PYWB 4NN6B 1NOAA 4UTCA 3NFSH 1AKJB 3TH3T 1XZ0B 3VXMD 3FT2B 4FNRA 1TT6A 1IIKA 2B3IA 3DV4B 4CBPA 1OALA 4DKDC 1UZGA 3ILDA 4JY6A 4P2OD 3W57A 2D4FA 4HEME 4MHHG 1S8DA 1RZQA 1A66A 2CRIA 1MIMH 3KPMA 3IBEA 2AF2A 4JM2F 4JPIB 3IBOA 4EZJA 1D5ZB 5TK4A 4B0MM 4HIHA 2OLDA 1KLUB 5CJ5A 4ZFFB 5JA8B 1U36A 4M62L 3VFRA 4YHIB 4HSCX 2YQ2A 3GS7A 3IKCB 2JQMA 3WSQH 2KERA 2YFOA 4HS8H 5IK3B 1BLNB 3RDTD 2C9UA 5EN2A 4TUOA 2O6EA 5JOFB 3MACH 2C9RA 1L9PA 4N25A 2J12B 1PIFA 4EBQL 1F00I 1WRFA 2F53E 3MJ7B 3BP6A 1UA6H 4FFVC 1SXBA 2YS4A 3L9EA 2VDNH 3X3GH 3B9KC 3FTVA 3P3YA 1F58L 4IRSA 4YR6B 5GGQH 4M5TA 4AQZA 1GZHA 4N0RA 4PY8I 5IOPB 4NO5A 4TULL 3V4PH 5EBGA 1N59A 2X4PB 3ILPA 4JANA 3B9DA 4OIIL 2NY3B 1MFBL 4G8IA 4WKXA 5GRWA 4G9FD 1FP5A 1RIVL 3E1ZA 5FB8B 4OLZL 2Y1AA 5C0NC 3N1QC 1MUJB 3GDBA 1CGUA 1CF8H 4PGDB 3MNVB 4MD0A 4EKXA 5C71A 5F72S 1CICA 2O5ZH 4X5PA 5F7DA 4RISL 2G30A 1NDMA 4OLUH 3C6LC 4XZ4A 5ID0A 4J3VA 1S3KH 4MDIB 5JHDA 4Z5RB 2F8XC 2ZXWB 3L1FA 3TPUB 3UIZA 3IAGC 3BN9D 3D30A 3MFGB 3QVAA 4A7VA 4P59H 4BFBD 1ADQH 2PYED 4HT1H 4A6YA 3S8GB 3ECWA 3PL6A 3QRFM 1WLGA 1IJNA 3AWGA 3BDYH 2P24A 2CXKA 2HT4C 2XV3A 1S7UA 3FYIB 4PGZA 2ZG3A 5IK3A 5CKAA 3FFCD 4TVPH 4XWGL 4PJ7F 3L08A 3IXTB 3RX8A 4XN2A 4JHWL 2ZOWA 5KBDA 3P0GB 4UOW1 1EK3A 4UM8A 4MJIB 4OD2B 5IJVA 2AMGA 4ERSL 3BN3B 1SNRA 1FV1B 3UG4A 3OSVA 4UT9L 3FTUA 2YGVA 4JPIA 5KBMA 4LMQI 2F74A 2OZNA 2Y69B 3FU5A 1PQZB 3VWJB 3VRLF 3PP3K 4AYEC 3TEYA 5JW4N 1IAIM 4HD9A 2OW6A 4L4VB 4L1TA 4F7KA 1K4CA 4OZGB 1A9EA 3B3IB 1VGKA 4JPVL 5C8JB 3DTDA 4MB1A 5KYNA 1NAMH 2D7QA 3BO8B 1WITA 4JO3H 5AYUH 5JDSA 5CD3B 1UKTA 4A68A 2YRLA 1PX8A 4PRDA 3MBXL 4NBYB 4Z23A 5HY9A 3ZDXB 2AV7B 5FUOL 1YEHL 3JWNH 3QFGA 1KYFA 4GG8B 3ASNB 3FHQA 3N1MC 4TSAL 2CPCA 3V4UH 1FH5L 5BS0A 4JCWA 2AJYH 1R3IL 2VRQA 2IAMC 1Y18B 1NCHA 4LLUA 1JDAA 3D3VB 1GVIA 4PPTA 1QA9B 1TTGA 4HD5A 4ZMLA 4TNEA 4Z3IA 1JPST 1QP1A 3N0AA 1DFXA 4ZW7A 2BRQA 1G84A 4Y1AA 4WV1B 1CDHA 1L6PA 5I2IA 3BMWA 5BS0B 4LLQB 2CJ3A 3HJ0A 3IE4A 3V52L 1QWHA 7PAZA 1CFQA 4RRPM 2G5BB 5D5MF 3EYUL 2ZP8A 3NSCA 1FVCA 2HWZL 2XJLA 1EHXA 3EH3B 1DVQA 4YDZA 4JO2H 3IGKA 1TZGH 2BZ7A 1KSRA 4I0PD 4J8RA 3QZWA 3QPQC 5CD5C 2GUOA 3KR3H 4JFTA 5F93C 2DQJL 3KPSB 3TCLA 4Z78A 2LQRA 2GCYB 4D7BA 1WT5A 3P02A 4HWZB 4M1DH 2QPDB 3VWJD 3OJ2C 5HYQB 3OAUL 3LJ3A 5E4OA 1FL3A 1DDHB 3U7YL 5FA3A 3GEWB 1U8JB 4MKTA 4HKJB 4BWWA 1IGTB 4AGQA 5FO7A 3P4OA 3TJEL 1VACA 3I74A 1IAII 4U4BA 4A7QA 1F4HA 2WXNA 1P5VB 4YZFF 5C0FA 3MX0A 4J2XA 1RURH 5AVTB 4HULB 1U4EA 2MKWA 3IFNH 3L6FA 3RY6A 4Y9EA 2FATH 3QNZB 2F5AL 1Y07A 2VL5B 3M88A 5L4IA 1ZLWK 3PHOB 1EFXA 3MLXH 4OKVA 5FGBC 4KRPC 3T0EB 4AJ0A 5KZCD 5B3SB 1THAA 3PJSB 2BM3A 3QEHB 1G9NL 4NLAA 4PJEE 3U6RA 3TF4A 5KVEL 2NW2A 2UY6A 3LN5B 3F6LA 1JNHA 2I7OA 1ZT7B 5EORH 4HHAB 3RWGB 5JO5A 1G6RA 2X4TB 1TCRB 2Z8SA 2WVUA 1ORQB 1JIBA 4Y2OA 5HHME 5GPRA 3EYQC 2BLFA 4GRWF 3HR6A 1JFQL 1KB3A 4UM9B 1TNMA 1GGCL 2XWRA 4OLYL 2VXUL 5C70A 5LLIC 1WO2A 2M26A 1FNGA 3TIEA 1KWGA 5KVFL 3FB7A 5FLVA 1KJ3L 2Q3ZA 4HHWA 3HE7B 1X6NA 4APXA 2R69L 5T1LA 1HHGB 2Z8VC 1UJ3A 4N8VG 2NY2D 2VLJA 3V6ZB 1I7RA 1LE9A 3VWJC 2H47C 4PVMA 2XZCH 4OIBA 3HG5A 3F6JA 1SDDA 4YL9A 5EZJB 4KNSA 2FRGP 2W81C 4RA0C 3SJVA 1VKXB 4HJSA 4U1JB 4PJ7A 4G1EA 5DA4A 1DVTA 2NCMA 5D2LE 2ZAIA 2QLVB 2WCPA 5H35A 4MMYA 4RMBA 3TX4A 3QXVA 3ZDYB 1EDYA 2Q76A 4GG8A 4TUJB 5I76A 5CHNB 3ARZA 4ZFOL 4G2AA 4N5ED 4M61B 4JEGB 3ARXA 2I07A 2DOCA 3DRQB 2ZOKB 1R3HA 3TBWA 4AQ1B 4F9LA 1OT1A 2CLZA 5GRVL 4WK0B 2ZP0T 3CFKB 2VDKL 4OCRH 3BKCL 2Y7LA 2CO6A 4AV4A 2B77A 4NJAH 4V11A 2FX7H 4YSDA 1EEZB 5DZLA 2PTVA 3IB4A 2BHUA 3EZ8A 1XH2A 1LDPL 5H2BB 2EH7L 2R1XA 4UU9B 3S96A 4KGJA 4A6YL 1AKJD 3VXQA 3QPQD 5CD5D 1R24B 4A2EA 3RI5K 2YD7A 5MERB 3WFHB 1AXIB 4Z7UE 3HZMB 4NAQA 4GY4A 5BRQA 3SE6A 3CDZA 3T77B 5L4MA 5IIEB 2DL9A 5D93C 3ABKB 3BKJL 5A2AA 2XKNB 5F7WC 3WFZA 4NSKB 43CAB 2R1XB 3QXAB 1IBBA 4H26B 4JN2B 3MCLL 4QRRB 1S9WB 1BXXA 2KZWA 2R69H 4BSWA 4NXSA 4FFZA 1KB5H 1WLHA 2FLMA 3Q0HA 3GMQA 5C0AA 2OL3B 2Y25A 4DERA 1MWAL 1N2RB 2YSSA 3RZCB 4EN3D 1ZXKA 2W9EH 4N2IA 4MQTB 2VJXA 4FQ2H 1MFAH 1T04B 3TPUA 1H3UA 4Y4KC 2AANA 3NZSA 5I19L 2KQNA 3C08H 2R56H 2X12A 1UWFA 2Q1EA 1DE4A 4MMXA 4YDLC 2KS0A 2BNUA 3BKMH 5IWLC 4HJ1A 1ROWA 3Q01A 4E9QA 1DO5A 2FX9H 3MOAL 4RAVA 2AHIA 1WS8A 4W9JC 5HHPA 4P23B 1ORSA 1N3NB 5J1AA 4HIQA 1U8CB 1KJVA 1RIUH 4HUVB 2VDLH 5FLUA 4NO5B 1OF2B 2F7OA 2P52A 1HHGA 1CLYH 3F62A 4G8GA 2ALAA 1NBVL 5KVGL 4NKIL 2QHRL 1F8TL 4IS6A 4A6YH 2W9LA 2DQCH 3AY4A 1PLGH 2D3VA 3JV6A 4JZNB 1OCZB 1I7UA 1X4YA 5IFHH 2PTTA 1UFUA 1Z9LA 1HN1A 2X1PA 2VLRA 1UUSA 3GLZA 3MA9H 1IBYA 4A1RA 3FUIA 5HDBE 1PGRB 5JPNB 4P9MH 2A2QT 3BZDA 1NBYB 1ZT4B 2X4NB 3MCG1 1RIHL 4ZW8A 4RMUA 1XMWA 3FUKA 4PJBF 5DTFB 3BVVA 3R8BB 5BRZE 3NQIA 4JRYD 1QFWL 1BPLB 2DQ6A 2Y36H 2Z91B 4XNMA 4PRPD 4L9DA 4R4NC 5CGMA 2PO6B 3VQ1C 4JQIL 3MRCB 1YMHB 4XI5C 1NOLA 4WHYG 3QULB 3FU0A 2FX8L 2R1YA 4BK8A 4PRPA 2R51A 1DSYA 3QUKA 5F6HI 3GUFA 4NP9A 4B27A 4AKOA 1R34A 3MJ9L 1NDMB 2VDLB 5DO2D 5EB9A 3V0EA 4ZNCD 1DUYB 5ID0B 1J05B 2G2RB 3KGUA 2YPLE 5IJDC 3N40P 4YHNA 2AQRA 1PYWA 1BW8A 2AV1A 4FXKA 3SGDI 4ZTOH 2UZXA 3VXNA 4NYLB 3O41B 5F96H 4BCZA 1AZNA 1I1YB 1I85A 5IGXL 5EO1B 1JFHA 4YSOA 1HL8A 2MNJB 2ZE0A 3KBEA 2X4OA 4KVPA 3D85D 4JHAL 1YEKH 3FU7B 4B9CA 1QI4A 3EJUA 4U1SB 3T2NH 4NWTH 4R2GB 2OK0L 2JXMB 4JZJB 2P8LA 5DQ9A 4Y2OB 4D0CB 5EUOA 1W6WA 2FWLB 2XXGA 3V4VA 1GL4B 4WI0A 4IRZL 3SE9H 1P6FA 4Y1AB 2NR6C 2EDRA 3KYMA 5SX5K 3R7QA 5L7XH 2MOQA 4F58H 1PCSA 2XV0A 1QA9A 2BW5A 2R29L 3LVEA 3P11L 4GW4A 3VXMB 4D2NA 4QXGL 3SOBL 5BQ7A 4CUCA 1I3VA 3GXTA 4XX1G 2VZSA 1H9DA 3ULUE 3ESMA 1DQKA 2MMXA 4GUCA 4YH6A 4BZ2L 3A6BL 4FCHA 2A9MH 4FNSA 4M4RB 1GZQB 1LTXA 4AL8C 2G9HA 4LLVA 2J6EL 4NQVA 3N55A 2H5UA 1E5BA 3CTTA 2X05A 4XVJL 4HVBA 5IEHA 2E7MA 1RZJL 4HCRA 3E1F1 5E9DE 4I4WB 1M1SA 1U8PB 5DK0A 3UJTH 2WUBH 1L5GA 3W0WE 1F86A 4UQCA 5D72H 4MRBA 4AUJA 5EULV 1RJLB 3TFKD 2FDBP 4MWFB 1YN6A 3QJHB 1C16A 3BDBA 4DUVA 4BJLA 2BWIA 4DO5A 1LP9B 4G9DB 4U1LA 5IM7B 3C8HA 1JWSB 5TH2B 1J0ZA 2VDRH 4LHUA 2ICES 3RPIA 3SDAD 1OCWH 1PEZA 4AXWA 4ADJA 2IADB 1ACXA 4XMTA 3VMPA 5FEBA 2D3NA 3ZMRA 1CFTA 1WUZA 4FTVE 4LEOB 1ZTXE 2AI0H 5C0BB 4E9YA 5L4JA 1L9TA 1A0QH 1HXMA 4PY7B 4OI7A 1H3GA 3FQTA 3TO4A 5AW5B 4M03A 4K71B 2VNCA 3LIUA 1AKPA 1MJJB 2DLGA 1TJHL 2IPUK 2WC7A 4XC3L 2E6JA 5JZ7C 4UQEA 4Z3HA 4GAYB 1BEYH 3BUYA 1FZOB 4RVBA 4UQ2B 4NAMA 4QNPE 3SHSA 1I1FA 4ZSOA 3TNNB 1ZVYA 2OM5A 4XODA 4PI0A 3CZJA 1INDL 4I5BA 4XP9L 1I9RL 4XC1L 5LKNA 4X9IA 4UYQA 4NKMA 1LQBC 2CPUA 3HPJA 2D8KA 1U8PA 3O2VL 5E5MA 3U0TA 3O6KH 1CVSC 4JR9L 4AYSA 1ZE3H 3BAXA 1JWUB 5I0WA 4X7TA 2TSBA 1LNUA 3L1OL 3GJFK 2O72A 1HVXA 2OMYA 2PPEA 3KCPA 3QO1A 4LLVB 1IKFL 3IYLW 5HGAA 2XBDA 2HMIC 1LO0H 3ZE0F 1V05A 4O00A 5ICZB 3W0WD 3FT4B 4LGSB 4M9PA 5I1DB 3CU1A 2LU5A 5IFJA 2ADIA 1FVDB 1KIPA 3CC5B 5AW3B 3HC3H 5CS7A 5I2IB 2F54B 3SKOA 4E41E 3D6GA 1LO2L 1B4LA 3PV7A 1WPCA 1IX2A 2BOBB 1M7XA 1WICA 5DS1A 3APFA 2I25N 1M7UA 3C6LB 3OJDA 1IGYB 4H0GA 1N0XH 5FW6A 3O2DH 3FSVA 2YAPA 2XIBA 3HN5A 4LIQH 4ZO8A 1OK8A 4Y7MA 5DQJA 4HF5L 3CZFA 4HBQA 4UTAL 3B5GA 5IQNA 4QOKE 5DJ0B 3KEDA 4CDGC 5JNYB 1JYVA 3REWB 4F2EA 4JKKA 3STZB 2X3AA 1KIUB 2XZZA 4XO8A 4ZTPL 4KVCH 3LY6A 5JHMA 4QWWC 4JAMB 2RIKA 4WWKC 2X88A 4OZHB 3T6QC 3MRPA 3ZYJA 1U91B 3PABB 1UATA 5AOKA 2Q2EB 2X7LB 1ZA3B 1A47A 2WLHA 1P7QD 2BVPB 4BKLB 2EKSB 3GSQB 5JOPD 4WUKL 4ZS6D 2QDWA 3RIFK 4AVJA 4YDKL 4U3SB 4BFIB 2CD0A 4ZAKB 4CU8A 5E4IA 1ONQA 3GSNB 5DXWA 1R0AL 1FFNB 4UDTB 2Q86B 1HWWA 4FKKA 1F6AA 2HTLC 3HHSA 3FQRA 2G60L 1MFDL 3BLBA 4GBXD 4GNKB 2A74B 4C4BA 2IADA 2FBRA 4QEGA 4OV5B 4DOHB 4NM8H 2A4ZA 1IFRA 5I1DA 3WJLA 3CZUB 3G7TA 4U1NA 4YUEL 5T5NF 5KYWA 1CDUA 3E6FB 4ERSH 5H37H 1A6AA 2P7TA 1S46A 4BKSC 1OGTA 4UT9H 1JVOA 3UO8B 1ITCA 1E5ZA 4ZUUB 4GSXA 5DEJA 3HAEG 4JFXB 4GRLA 4G43A 2Q6WB 3V4LA 3O6MH 1QRNE 3U0TB 4NC1C 1RLBA 1T0OA 3N42F 1ZIBA 1VGEL 2CA4A 5E23A 4OCYH 2PTTB 4YHKH 1DJHA 4JO2L 4XB8A 1RZGA 2K70A 2GAZB 1GJWA 2X9ZA 3QAQA 2JB6A 2OMVA 3MBXH 3KPRB 3TBBA 2BDNL 2BVPA 2NZIA 1F11B 2NY1D 4FLOA 2ZNWA 5IMOA 4BKLA 3IDJA 4BYHA 2VR4A 4N6QA 3G3LA 4XPBL 5ECGA 4HUVA 1FH5H 3GXPA 2PXYB 2JJTC 2R0ZL 3NUKA 1WZ1H 4BA0A 1WWAX 2Q3AA 3TJEH 4HAGA 4DP4X 1A5FL 1P4LA 3GMNB 4HCFA 4XP1L 1JN6B 1SLUA 3FB5B 4ODTL 1DBBH 2B9AA 3K6OA 5I8EB 4HP5A 2KQMA 1E42A 1E5AA 3KYMB 4MMZA 4F8PA 5JHLL 2HJLB 2VZ1A 1ED3B 1DSFL 2IH3A 3ARDC 3HUJF 2BWDA 2VXTH 3VI3A 4JX0A 1SDDB 1URLA 4X8GA 3RFZA 2X87A 5F70A 1L0XA 3VFUA 1E65A 1YA5A 3FH8A 4NKDA 4LESA 3KLAA 2W60A 2HPOA 5C07B 2A4EA 4ZO6A 2DB8A 4A7UA 4K5OA 4IHOA 4NZDA 4JFZH 5E24E 2FL5B 2QKSA 1A7OL 1DVXA 3LXBA 4N0FB 5ETUB 2IF7A 3ULVE 2WOYA 4GIOA 4MXQC 5A6MA 1P2CB 4D9QD 1MJ7H 2O5XH 3B8SA 4UWQB 1MCDA 2AQPA 3OKEA 1KFAH 3PWVA 1JGLH 1VZIA 2GY7B 2V6HA 4H20H 4GRLC 4IBYA 3JTSB 3QG7L 4A2HA 1AI1L 4B50A 4X8JB 4OUUB 5AKVA 5LCVH 1N4XH 3EOYG 5KVFH 4I4WA 1J86A 1ECYA 2CNZA 2R4RH 3MGAA 1LWRA 3K6IA 4N26A 4JKWA 1MCQA 1KEML 4M1GL 4O9HL 4PREA 1T03H 2P7TB 2G9HB 2OA9A 1VADA 2GSIA 4X6DA 2FCBA 2A0LC 5T1KD 3DMMA 3RLSA 4TTGA 1BECA 1J1OH 1T5XB 3GK8H 1BZ9A 1VFOA 4JFWA 1S78D 5IHWA 4QHNB 4PJHF 2Z92A 4F93B 1NLDH 2X42A 4LVOC 5HYEA 4J6RH 2AZUA 4ABWA 3ISYA 4AQEA 1PG7X 3BEWB 3DURA 2DV6A 3FCTB 1EHLL 3ROOB 5D7LD 2IIJA 3VG0H 4WWKB 4XPGL 4JG9A 1WS7A 1RZFH 1ROCA 2CSPA 2ZX8A 1CLOH 1ZHNB 3B9KB 3MLRL 3LH2L 2FB4L 2LLLA 2ZXQA 3H8NA 4I3RL 3RY4A 4AXWB 3QZWB 3UADA 1G7LB 1BDYA 1UFGA 4GRWB 1HC1A 1JWSA 4P23A 5JTWA 3FTYA 4QRRD 2IDFA 4GO8A 1HXKA 4P2QB 2WYHA 2GAZA 4YHPA 5IQMA 3BKJH 3CSYB 2FQEA 3CC1A 3IDYB 1QSED 1ZA6A 1A2YA 4P57B 2EO7A 1DBJH 2NY7H 4PRPB 1KTBA 3SCMB 3UTTE 2ADGA 3QUML 2GSIB 4HH8A 3WD5H 4PQXA 1UWEL 3ZKMD 2YAEA 1QSEA 1MPAH 2DJUA 2GHZA 1FAIH 2X0UA 4WSJA 4JVPA 4QDGA 4YK4B 4LCIH 3RWJB 2KH2B 3ABZA 2ICWB 2JKRM 1B4RA 5TK2A 5DJYB 2DI8A 4PRIE 4IKJA 3GBML 5LGKA 3UPRA 4KFZC 3O6LH 3PGCA 3MLSH 1NMBH 3WTUA 1LDPH 2WLKA 1G7MA 1TVDA 5F1KC 3RY6C 4KTDL 5C08E 1XIWD 4U7KA 4X4KA 1ZLVH 5TQ0L 3ZUCA 1HJBC 3FN0L 3GUTA 1PX3A 5JLZA 1WEJL 3LIZL 4AQ8C 5I15H 4JW3A 3B37A 4OFDA 4BRVA 2X38A 4IJ3C 1BJ8A 3TBVA 3F01A 1YZZA 3SBPA 4UINL 4IS6B 4I18B 3FFDA 5MENB 4GW5A 2K7PA 2FL5A 4AL8L 2WO3B 1SUJA 4JFEA 4G8FA 1MHHA 3MNMA 4FC3E 4QRSB 1RPKA 5EDXA 3QUZD 1QBBA 2YZ8A 2BP0A 2VSCA 3QZMA 1XH1A 4NCC1 4I89A 4J8RB 3DJSA 2V4LA 1W0WB 4J3OC 5F9OH 1OAUL 2XWDA 4LASL 5D4QA 3CDGA 1RZKL 3IGLA 1KIUA 3BGMB 2QQQA 3TVMC 1OL0A 1WP6A 2CUMA 1O7DE 4FQLH 3VRJA 5A3ID 2PF6A 1ZHBB 2VDQB 2NYYD 3GJEB 3C08L 3DSNB 1AHWC 3D3VE 2A6KA 5H35B 3OG4B 3T0VA 2R29A 3WV0A 4Y5YC 4KOCA 4EN3B 1YYCA 1HHKB 4HLJA 3BJ91 4HS3A 3NTCL 3Q13A 5CO1A 3E80A 2R1WB 1BF5A 1F3RB 2CCWA 3L95A 4M43H 2X6AA 3MUUA 4RFOH 1M2VA 5LGHH 3RWIA 1AFVL 4PV8A 5IVZA 3SBWA 4OZIF 4NDMA 2V3FA 5A1AA 3ZIYA 3KGSA 5CGYD 5C6PB 4RGMB 1DEEB 1FIGH 4LCYA 3MV7D 5DDHA 4Z7WF 1U92A 5F8RC 4E9XA 4ZUTB 2ENJA 3HR5B 1H5BC 2OX5A 1FYTE 4J28A 5SWQA 1CGWA 3H4HA 4G8IB 2IDCA 3PIQB 4DK3A 3UAJA 1FZJB 2JVUA 4QHLA 3QT2A 1VRSA 3SYOA 5CEXA 3LPWA 3S3PA 3NGBC 2ERJB 2JJVA 3PWPA 3H2QA 1A9EB 3PNWA 4R8WH 3ME0B 2P5WB 2QELA 4G8FB 4H88H 4L1SA 4MA7L 4PJCF 3P4NA 4BCXA 3HB3C 3WO3B 1A7PL 4XCEA 3QQ9D 2CR6A 5J8OA 5ANHA 4FFZH 4PRHD 3DVIA 1IEAA 4YNYB 1PD1A 2BHYA 4AYFB 4NWTL 4ODWA 1RCYA 4XHJD 4DGYL 4BQBA 2WAHA 3SY6A 4X4YB 2NDGA 3PGCB 5ERWA 3SDCB 3O9WA 1QBLH 3TO2A 1JGEB 3KBHE 5I6XC 3LPGA 2V3EA 5J1AB 6FABH 3SE8H 1YJDL 4JNXA 3ATBA 2C4FT 4OQTH 5D7JD 3RI5F 1Z66A 2FO8A 4PJAE 4FJYA 4HS3B 3WN6A 4NQDE 3UDWC 1JNLL 3HMXH 1ULVA 2FNWA 2C9QA 4JQVA 2FGWL 2GG1A 3HC4L 2WCGA 3Q5OA 4JDZB 3D3VD 4M7KL 4X5QA 5CLZA 3VA6A 1W2KT 2C1OB 3DX3A 3TPKA 2DN7A 3W82A 3VRJB 1JK8A 1ETB1 1JDCA 2Q8AL 1CTOA 3MRNB 3IGAB 4JHAH 3ESOA 3FT3B 1PY0A 2WB7A 3A4DA 2CO7A 1WWCA 4Z7OE 5JQ6L 1T83C 4LRIC 3L9RB 2K7QA 5CIPA 3ULUL 1IIIA 2YHGA 5BW7C 5DLMH 1KTDB 3SQOH 2K8MA 3QWNA 4LPWA 5D7EA 5HI3C 1M56B 5B4MD 4I18A 4FZ8L 2XDHA 4HU8A 4MSWA 4FABH 3LKRA 4QRTB 3MRGA 1PL3A 1HSBA 4ODVL 3TH4T 3MRQB 1CYXA 3WLWD 2HKAA 3N6YA 3AY4C 1EGJH 3EGXA 4OLUL 4DGYH 3QAZB 3IFPB 2EQDA 1IGMH 2R7EA 4BKTC 3IK2A 2ALWA 4AY0A 3QC5X 1BMWA 3BAEH 5D1QE 5TDPB 1HSAB 1SLXA 1E9OA 3RP1A 1EJ8A 1CQKA 3BT0A 3CFKA 3LQZA 4O58L 4IMLA 2BVQB 4PJ8A 4YC2C 3WXWH 4QHUB 4ZQKA 1C9SA 1NCAL 4EUPG 1JRHI 1CGVA 1E5UI 5DEFA 2VN7A 4TLTA 1AZCA 3C6SA 2BCKA 3QH3A 3QP3A 4M7KH 5GGVH 1FE8L 4FQCL 4L4TE 4OGQC 3ZKSD 2ZOLB 5E8EB 1KLFB 5I26A 4I9XA 5AUMB 2XN9E 4J27A 4JO4H 1CI5A 2CKBB 3I50H 3HBZA 1H3TA 1TEFA 2AKRA 2JXMA 4HKJA 1BYPA 4UNTA 5J6GB 4CILA 1BF8A 3H3KA 3KWWB 4LLDB 1MHEA 4BINA 4FA6A 4JDVB 3KH3A 5FHAH 4G8GB 3VVWA 1XV8A 4W93A 5FYJL 3TT1H 5C3LD 1CXIA 3JQOB 4KXCA 4RMTA 2NYZA 1QSVA 2Y6SD 2W60B 4NUGH 4WI9A 4NNYA 1FNEA 3Q44A 1EX0A 3NCYS 3OD3A 4V1DD 5DEGA 4PJIF 3P9MA 2GUYA 2DTSA 2VITB 3H9SA 5E9AA 3EG9B 3DX4A 5JXEA 4R9HA 3SODB 1SF3A 3NESA 4W6WB 4CW1B 1EGJL 2RQ8A 4N0YL 1EAOA 5HGHB 4Z7QF 4S1RL 3RZCC 4N0CC 4XBEH 5DR5H 3BSHA 4W1TA 5FAAA 1KCWA 3V0DA 4ZD3H 4LT7A 2JWYA 2Y24A 5FX3A 3GSQA 4KDWA 4R0LC 2WY3B 1JCVA 4ICWA 5FYLD 1QNIA 1KGXA 3TBYB 4Y9CA 5BVJB 5TJWK 3ZDYF 3NCYP 1GGIL 2CKNA 4YHYC 1YNTF 1AHKA 1AY1H 3QQDB 3FB6B 5JDSB 4IGBB 1ZEAH 1BXAA 3RWDB 3GBLA 1H6UA 1JNJA 2VLRB 1EAPA 1HAUA 4XVSH 3AADB 4MGXA 2DLFH 5A40E 3PWJB 1IUZA 3DLQR 1NCWL 2DQFA 4DPRA 4XNYH 4NM4L 3AM8A 1BQLL 2VN4A 3FUJA 4GMTH 2F74B 4Z1PA 3SDCC 1CU4H 2E75C 3ZZLA 2G75B 1JRHH 4ZUUA 1QLEB 3BD5A 2FH8A 3SDXF 3VFVA 4ORGA 4Y1TA 2XN9D 3V5KA 4JCMA 2E4TA 4YDKH 2OMXA 2EABA 3ZHNA 1U3HC 2XPYA 2L3BA 4WU7B 5FCUH 4ELKA 3KLLA 4NB7A 2WSKA 3GKWH 3A22A 4KAQH 2X10A 4PJGA 1S7UB 4ETQA 2IANA 1F56A 4HALA 4B3VA 3CH1A 3EYUH 2XWCA 1G9NH 1NEUA 4G9FB 5C0RL 3MUJA 3VM5A 5I0ZA 2Z9TA 4ZPTB 2ZKHH 1AO7E 4V1DE 3U6XA 5DS8B 4PGJA 2W0FA 2WXPA 2CIKA 3BCFA 3P0YL 2WNGA 5HHOE 4UNUA 1I9JL 2IAAC 2APXA 2IC2A 3BQUA 3F84A 3K1KC 4OY9A 4Z7VB 3KPOB 2EZ0D 2QKIB 5K1JA 1KT2A 2B0SH 3CDGB 4QPEA 3QJXA 1YAIA 1YPZF 1NH6A 1PFOA 5B8CB 2FO4A 1C1EH 4F8LA 1RP9A 1A7NH 3FCGA 4YHOH 4MXWL 5KJRL 1T80A 1KIRA 3W9EA 5EOTB 2X1QA 1S7SA 3EOAA 3OKLB 4BSVA 2FWOA 1Y6NR 3Q8CA 5AFAA 5C0GA 3MV8E 2QVTA 4HEMA 5E95B 3L4CA 4D9LH 4P2OA 5EC2A 4Y19A 3VFVB 3HA0A 5ERWB 3SDCA 5I1KL 4MRCA 3JT0A 4KI5C 5T3XD 2BO0A 4OIAA 1ZPUA 1E8YA 3HHSB 3N41B 5CP7B 1VPOL 1EJOH 2PCFB 3KCPB 1P5VA 1OSPH 2BVYA 1EAPB 1JFQH 2WXRA 4WKZB 5BV7B 4XCEB 3GPEA 5A43C 1J8SA 3WDHA 4KHXL 1U6AH 4OSUL 5I1IH 3WNPA 2I26N 1WZKA 4KK6C 1M42A 3P4NB 4JKNA 1AQMA 4K7PX 3MKKA 3I3BA 3IM1A 4BK4A 1A6WH 3V0VB 5IVXF 1G7PA 3N43F 4UUJA 2GY5A 4Q9RH 4GEIA 2QKIA 4HIJA 4KTEH 3TA3D 2APFA 5FGRA 4FA8A 4OZHA 5JUEL 3UPCA 4F20A 4JRXD 4FQ1H 2OMZB 3MNVA 4MD0B 1N3NA 4ONHA 3GJFB 4YDJA 1NFAA 4G80A 4YDVA 2EVIA 4W68A 2I60H 3K71A 3BOVA 5AVRB 1JPTH 2D31B 1LO4H 4BZ1H 4FKEA 3L45A 4B95C 4XN1A 3E2HB 3NCJH 4FXKC 1JZGA 4IRSB 4YR6A 4HFWA 4HZLA 2HMID 4X5WB 3OTTA 1WWBX 1YC7A 1CO1A 3NA4A 5EBMB 2DYPA 4ZNEE 1KEGL 3FQXB 1JUFB 4NLHA 1PTZA 4GKZB 1MCNA 4DK5A 2D7OA 4BHUI 3TOPA 4ELKB 4R97B 3ARVA 3KXFE 1GZPB 3WJMB 4F8TA 2FJHB 5E5RB 3D2UB 1IGJB 2KLRA 4LXFA 2X1XR 4K5PA 4C59B 3CDZB 1M4KA 2FX9L 1EJOL 1JPGA 3MOAH 3O4LE 3FU7A 1UEMA 1KN2L 4QRSA 4C47A 1TNNA 2D0GA 4PJBB 5AUMA 5FDWB 4G6ML 4U3SA 4BFIA 1T83A 3H7LA 3MLZL 3QEQA 4LRIA 5D1ZI 5JR1H 2HRPL 5K9QG 4OF3A 2VAJA 4EI5D 1HX0A 3VFTA 2B9BA 4F7CA 3ARQA 5E0QA 3ME0A 3T0ED 4KRPB 4MBOA 4RDQG 2NW3B 2XX1A 3T2QA 1Q0YL 1DCLA 1KTKE 1M6OB 3G6AA 4K4KA 4YXKH 4PEEA 3TBYA 2V7NB 3SCMD 5FDWA 1KB5A 1FDLH 5J11C 1RMFL 2BVUA 1K2DB 2HX8A 2FK9A 3LQZB 3R06A 4MKMA 3QWOA 3UC0H 2D0HA 3B6SB 3RL1B 5FO8B 1RUPL 4URKA 1T4WA 5DHEA 1JZJA 2YJQA 4OJDH 1I75A 1K6QH 4HETA 3TNMA 4UV7H 1KBKA 3SQRA 4LLQA 1C5CL 2PO6A 3NJLA 1TU2B 2FIRT 5E6UB 2ZUQB 1YCSA 3ISRA 1B0IA 2B3RA 3BVNB 5CEYB 1FNAA 1MPAL 4LKXB 1XSKA 4N2KA 3ULSB 5AOJA 1MFEL 4P05A 2VXVL 2HN7B 5EEUA 2VDLL 4ANUA 2YUZA 4WHYH 3K8MA 4HQQL 3OXRB 4WEMB 1AS8A 4Y1AE 5MP6H 1THCA 5KVGH 1NANH 3JV6B 4JZNA 3UTSE 4FMVA 2YBRA 1FA4A 3GZKA 1JN6A 5CGBA 3MV9D 1ADQA 2N7BA 3AS1A 5DURB 1R17A 1FVEA 4K3GA 3MJ6A 4QXTB 1G94A 4CSPA 4Z7WB 1P5UA 4ZW3A 2R9HC 1TVHA 1SHMA 4QHKJ 5D71H 2YQ3A 3GSNL 4L8SB 3ARBB 2VC2L 3VD3A 2BY3A 1DBJL 3SKNA 3EJYC 4AW7A 2NY1C 5INDB 5CEZE 5TFSH 4HMEA 5DVMA 3RWDA 1FGNL 1IC7H 2LGNA 3RG1C 5EF3A 3I02B 2XACC 3ZTEA 4DW2H 5CSZB 1EFXB 3T0EA 1C7SA 1LEGA 4HFUH 5I18H 1T5WA 1ICTA 3UROR 1ZHLB 3CHPA 4HDIB 1IGJA 4NO0A 4QRFA 4DKFL 3VRIA 2XCMC 4GI9A 1H8SA 3IFPA 4HX1A 4YFLF 3SE4C 1A3RL 1CT8A 2WYIA 3WELA 1MJ8L 4TMPA 4OGYH 4Z7QB 5D2NC 2Y6SC 3MI6A 1D5ZA 1M53A 3QFJE 4RSYA 5K9KA 1BAWA 5I19H 4BSVB 1HEZA 2B1HH 5DTFA 3QORC 4ALAL 3I6SA 5GZOC 4K7FA 3BVDB 5IGXH 4YZFE 4QO1A 5FYKL 1LJMA 1P7KB 4JRYA 3L4YA 4J6IA 3VXRE 1G1CA 2IH9A 5TQ2L 4A7SA 1KLGB 1YEEL 1FVCB 4Z6AT 3TA4D 2JK5B 2XICA 3MGOB 2CCVA 4HMDA 3BAIA 1KXTA 4NPKA 4F15B 4IRZH 3WTVA 4L18A 5F71A 3FOLB 3GSUA 1SEQH 5D71L 4DEWA 3DURB 3FPXA 2FLBT 1GR7A 2ZTBA 5BRPA 5DJCB 1A6VH 2VLJE 5LGYA 2WXIA 4M62H 4IGBC 1HU8A 1L9SA 3A3YB 4OZGE 4UZGA 1Z5HA 2H32H 4FAAB 3CFBB 3VGAC 5EEXA 4KQ0A 2V9TA 4KDVA 2IH1B 3B2PA 5DC9B 1UM6L 4ZOBA 4MJ5B 4RZCA 3ULVD 2IEPA 3OR7B 3V6FA 5IQOA 3D69B 1J0KA 4CVWA 4ADIA 3S6CA 1XGPA 3IMWA 5CEZD 1BVNT 2GIYA 1JGUL 4KTYA 3WIIH 1I7RB 2BFVL 3ARFC 3CVHL 3JTTA 3N91A 2ITCA 4WWPA 4KZ0A 2ZUQC 2L7JA 4LSSL 1IAIH 1KBWA 1G43A 1KIPB 3CC5A 4JFEB 4R7XA 5EBWA 3VGBA 1KYUA 3JBG7 5C0ND 4Z7OF 1AP2B 2VDOB 1DVFD 3TBVB 3EADA 3AJ7A 4DKTA 1KLGA 3IMUA 3ZDZF 4Y2DA 3RFRA 4PB9L 3MUGA 5CSBA 1W72B 3U48A 4GI6A 2O93L 4MJIA 1INDH 1YEEH 4PJXE 3ILQC 1A4JB 3Q1EA 3GZOA 4MCZA 3RGVD 5HHXH 4MSWB 4JFXA 4Z7UA 2J1ZA 1F4WL 3PNWB 3ZRFC 1GCFA 5CLXA 1N68A 2BSTB 1YEDB 4R4FH 4JRLA 1XAUA 2CGYA 3QQNA 3AB0C 2A7BA 7FABH 4AKQA 5JDJA 5B1KA 3H56A 3H7BA 3SGDH 3BIBX 5E1HB 3QISA 1AR1C 3GBNH 3RWIB 3ZTCC 1EZUA 3UZVB 1UD6A 4NN5B 1OP3K 1DEEA 3DARA 3L5HA 4P2RD 4XC3H 1FZOA 4EN3A 1ZA6B 4JO1H 3CLEH 4OCSL 1JSYA 1TTRA 1HXYB 5KYUA 2PETA 2R2HA 3KPPA 4OKDA 4GKSA 5J4MA 2FNBA 1W16A 3LX9A 1RZ8B 3OV6A 5IR1B 3CH8A 4J3OG 3UBGA 4C57C 3AGWA 3LPOA 5ADPH 5FA3B 4FEIA 5CZVL 1E0OB 3D07A 3QJZA 2Y0SA 3CVHH 3RVUC 1FLRL 5GRZA 1CD9B 1QOKA 3V0FA 3EO1B 2CHDA 1ZK9A 1CFTB 2HTKC 3OF6D 2KI6A 3HS9A 1QFWI 2DKSA 1F11A 1PZCA 2Y5QA 3QO0B 4HWEL 3SB3A 4CAGA 6PAZA 4GKNA 4ODSH 5B22A 4H40A 1WUNT 1B9ZA 3I75A 3V5DA 2BNQB 2JCCE 5J6GA 3N0PB 4QRPB 1CFQB 2IBGA 3GTVA 1TQUA 1UB6A 5FUCE 3UZEC 5LXGH 2BSCA 3VJ6A 4CL7A 1YN6B 4ATTA 2XZAL 1BLNA 1VEPA 2CLVA 4XPHH 4ZODA 2E9JA 3R19A 2PABA 1I3GH 2N1KA 3T8MA 3IJ7A 4MA3A 2H0PA 1T4KB 3HJEA 1EAJA 2XI9A 1COBA 1LO2H 2KDGA 2NX5E 2HSIA 4PJ5B 2YD8A 1CR9H 2RR3A 1DVFB 4RETB 1R3HB 4NUQA 3VXRD 4AQ1A 1K85A 3RZCD 5F89A 1YC8A 3QRBA 5K1VA 4EDXB 3KJ6H 5IBLC 1SUHA 1NL0L 3O2DL 3FO0H 2EE0A 2EYRA 1QI3A 3N5AA 4X5XA 2VW6A 1JNNL 1ZVSA 4S1RH 1OGPA 4DF9A 3BSGA 3QDJD 4PRPE 2OI9B 3UTTB 3K7UA 5E6RB 5E94B 3HG4A 4Q6IC 1TZGL 3CCHA 3WNIA 3MYJA 1Q1JL 4F8NA 3K4ZA 5G2NA 4PCKA 1ZIAA 3VFTB 1TETL 4FQIH 4FD0A 2YPLA 4WVRA 4F7CB 5AENA 3DETC 4MVBD 3L4UA 3M8OH 3SO3C 5D7JA 1YVLA 4MQ7B 1KELH 4UT6L 5I1EH 4NQCA 3V4VB 4L4VE 1WC7B 4FN0A 1FIEA 5D9SB 4BK5A 2YPLD 4JM0A 2EXWD 4DQOL 4ANWA 3EGDB 5I17B 3VFMB 5FGSA 2GTQA 1KNOB 5E99H 4ZYKB 3ZQWA 1TSRA 5CJ8A 1UJ3C 4OAWB 2ADFH 1YYLH 3TTYA 3REWA 5GSRA 3LH9A 4XO3A 4IKIA 1NTDA 1WK0A 2ZJSL 3WJMA 2HVKA 3U1PA 4EO5A 3HB3B 1WC7A 2H4EA 2XG5B 1YEJL 5DWPA 1BQLH 4EAEA 2VXSH 4DETA 4AE1A 4PGCB 4EN2A 1I3GL 5KSAC 5TE6H 3KPSE 5ACLA 3NFPB 2UX6A 4F1SA 5TDOA 3LN5A 3U4KA 2W8CA 1L9NA 1SXCA 3T0WA 3GFUA 5BO1H 3CD4A 1H5BB 3EDEA 2LU7A 3CFDA 2VUOA 4X80L 4TQPA 3IJEB 2FSDA 1HSAA 1TQVA 4O4YL 5GS1B 1ETZB 2J1KA 3BPLC 3FO0L 1UD2A 2A9BA 4P2YA 3VW3L 3CFJB 4M56A 3SPCA 4QT5B 4ZXBD 5HY9B 3R06B 3DBSA 3MRJB 4UQDA 3CJJA 4Y16B 1CGTA 2ZKHL 5IQLA 3SKNB 3EGSB 3GMRA 2CHZA 3QDHA 5IB3A 3WE6B 1AMYA 4PJXB 2ED6A 2QQLH 3L4WA 1TVHB 1NCWH 2DYRB 4YXLL 3E3QE 1GGTA 4AENB 5IBTH 1TG8A 1KG0B 4QWWD 4NUJB 1A22B 2FSEB 3ZKMC 2VJ8A 1RZIA 4X7EC 4JBSA 1GA2A 1P0SE 2WQSA 3MRMB 5KS9F 1QWUA 3EDDA 4IOFC 4PJCB 4DKEH 5PCYA 3FKUS 4QRPA 3VU2A 1HILA 4A63A 1BBJB 3P73A 5E8DL 4N90D 5IEKA 2PWEA 3DYOA 2VDPB 4LSQH 3ZKXB 1BJMA 4GRLD 3VD7A 4WW2F 2I7SA 2R4SH 3WFEH 3TV3L 2FBJH 3SDAA 1UH4A 1FCGA 4NKDB 1RP8A 1FQ9C 2IV9A 2HVJA 2B7DT 3P4MA 2R9HD 3WG7B 1G9EA 3FB5A 3E3QC 4FQ2L 3EW3B 5MEND 4MJ5A 1EHNA 5DHVH 5KSAA 4BD4A 4HK3J 4N2MA 3VTAA 4X80H 2JI3A 5I8EA 3GI9L 1BFVL 2H41A 1I9JH 4KXZI 1L9RA 2CG9X 2ZAHA 3LKPA 2VUYA 2DH2A 3HB3D 1UGNA 3VFMA 3QCTH 4FNPA 1S78C 3G6AB 3B2UD 4OW6A 4IOSA 5JW4R 4RMSA 1CCZA 3OHXA 4ZSOE 2FIKB 5DRXB 1K4CB 2YPLB 4KVNL 1S9WA 3F83A 3VI4F 3Q05A 5DK0B 3PFUA 3OAYH 5E8OB 4C4UA 1AGFB 2ZUYA 3INOA 2FEJA 3H6AA 3MR9A 4GB9A 4XN4A 1Y7VA 1X7SA 1VCAA 4EKJA 2K9UA 4ZZFA 3GRGA 3ZZ1A 5C0IA 1LEIA 4UF7C 3US1A 2DAVA 1PKQB 4IOFD 4J2QA 4GG6B 1MFAL 3MV7B 3TLRA 3S3DB 2C3VB 1H3WM 1OB1B 2G9KA 2R56L 2YWYA 5BV7C 3HPLA 3HNVL 2RALA 3T2OA 2AQNA 3MNZB 1EUUA 4LL4A 4NZJA 5DDHB 4ENEC 1AQHA 2XA8H 3OKDB 5EBLB 2ITCB 3HMWH 3DVGB 4IM8A 4MLSA 5GS0D 3TWYA 1FAIL 5EUKA 2HG5A 4B9KC 1U93B 1KGCD 1NGPL 1U6AL 2EO9A 5E6ID 5J7CC 2Q7AA 1OAJA 1CIDA 1RZPA 3HNTH 4WGKA 1VFMA 3DX6B 1I1AA 2QZQA 2H3NB 2XY2A 3LTVA 1N8ZB 1QTSA 1YECH 4JZOA 4K3JL 5EUOB 4ONFL 3S36H 1DBML 4XBPA 1A7RL 4P5TA 4YSRA 1V7ML 4PG9B 3OX8A 2A5UA 3RB5A 4G1EB 5LB1A 4KUCD 1DQJA 1C8PA 3I75B 2A83A 3V5DB 3ARBA 1TMQA 4E5XB 1IM3B 4XCNA 2X4OB 4ZDHB 5JIIA 1SFDA 3NK4A 1Q8MA 3EYVB 4ODXA 1ZHNA 4YFDB 5E6IB 1U30A 3RPKA 3OKNB 4Q9CA 4HIEA 3ERXA 3AUVA 2VDQH 2A83B 2JJSA 5GGSB 5H94A 1MHPL 2NY4B 3C2AH 3MV01 1AGCB 3NBNA 3GSVB 4JY5L 2VRKA 4G9FA 4NN7B 1CDBA 2J3SA 4HWBH 1D5MA 1KN4L 4U1GC 4ZMXA 1MAKA 2WIIA 3VFPB 3NJFA 3CZKA 3RGVC 1O5DT 3C87A 3CSGA 4WTXA 3DMMB 4LKXA 3T3PF 3D09A 1PEWA 1C5CH 5F9DC 3UBXA 1O75A 3IJHB 2EDWA 5TH2A 1ZT7A 4FQJL 1TO5A 4OU3A 2F54A 3SKOB 1PD0A 1KGJA 4FJ6A 2NYKA 2WVSA 2YAHA 3L17A 4NFCA 1QSEB 4PJHA 1R5IB 2ZX5A 3H42H 2A77H 3ZTDC 3D25A 5C0JA 1HH6A 3ETBJ 4F15C 5HPMA 4NO0B 3UTTD 3FTGB 2XPGB 2Z34A 5F7YC 1F6AB 3DROB 3OJVC 1YECL 4BH8A 2OS7A 5KVEE 1G1YA 2E6PA 1FRGH 3HE6A 1O9VA 2BY0A 5C0IB 2YXWA 4WENB 3JWDL 3TEUA 4TVSa 2VDMH 3S96B 4F1ZA 2Y2YA 3MXVH 4CKQA 5F9OL 1PBYA 3BT2H 4BELD 1CBVH 4GSDL 1FWXA 4MNHA 3F64A 3BDXA 5JHDE 4HIEB 1S7XB 3OHXB 3Q2LA 3HAEB 3F2LA 1X5IA 1KPUA 1F3DH 5M7QA 1FFOA 1OQOA 3TBWB 2PXYD 2F53D 2AEIT 3ARFA 3MV11 1OW0A 4OBRA 4X7DC 3JYBA 4Y4FA 4Y4HB 3VXMA 3HI5L 3CQFA 4Y19D 1IVTA 1NANI 4RAVB 1OVZA 3E9UA 3NCEB 4JKMA 1BF2A 4IBSA 3ILEA 1OTTC 3OX8B 4XNUL 3QZOA 4YVNA 5L8JB 1JS4A 2JJUA 2GHWB 1W91A 1N8ZA 3D1MC 3I9AA 4HFUL 4L8SC 2DQIH 3FN3A 5T1KB 4DO6A 2GJ6B 2E7LA 1P9MA 3L3OC 2XWZA 3U46B 3F7KA 3MJ9A 1JV5A 3W39B 3IETA 2LR4A 5HVGB 5F7UA 4CC4C 4OF0A 4FMFA 1IAKB 2WWKO 5IB1B 4P4KD 4AOFA 5JW3H 2Q10A 3ZO0A 2JB5H 5TGBB 3A5VA 1KJ2H 2UV3A 4XMLL 4JJHA 4ZFFA 1TJHH 2FQGA 1X9LA 3VFSA 1YJDC 4JFOB 1F58H 5GGQL 4EI6B 2VO8A 5KW9H 1FVDA 3U4BH 4QRRA 4FFYA 5DD0H 1WJ3A 1QKZL 1MCRA 2CQVA 5IMMA 3SDDC 3R0NA 3J27A 3ZQ9A 1YY8B 1AC6A 2GTWB 3INUL 3TURA 4UI2A 4TQ8A 4CMHC 1X5FA 5DJ8A 4ZXBB 3WY1A 4IRJD 2WBWB 5KWYC 4PM1A 2OV0A 3DIFB 4R7DA 2VDML 5BXFA 2GVYA 1KG0A 2X4TA 4KKAC 3MV7E 1WFUA 2EVHA 1X5JA 5KVDL 1G7QB 4WW2B 1IE4A 3GRBA 1KBVA 2GBTA 1ET8A 4OJYA 1X44A 3X3FH 3DPDA 1H3PH 2DM2A 2XKSA 1X5MA 1JF1B 1JPGB 1DLHB 1F42A 3DX7A 3Q5YA 4FYQA 1I53A 1NUGA 3HMXL 2AJVL 1OTTD 5EFIA 3IETB 2C5DC 1KYAA 1QG3A 5PAZA 4ELDA 3T2PA 2VERA 4P9HH 5CJXA 3CZNA 5T1KA 4GQRA 3SBRA 1ONQB 4JZJA 4D0CA 4GINA 1UC6A 2IWFA 4JY4B 2BFVH 3DSFL 3PHQB 3PL6B 1AYOA 2YQGA 2WO4A 3ULVF 2EXYD 2YMXH 1SDYA 4P4KC 4OBSA 4Z7WA 4AV0A 3HS0C 1J8HB 4F5CA 4Z76B 3IXAB 1IKNC 4Q56A 3AXLA 3BWAB 3L3DA 3UBXG 3PNRB 5T8IA 4PP1C 2FAUA 3OZ9L 1OPGH 2QV4A 3RVWD 2WLLB 1KCVL 2PYEE 4PGDA 3VXNB 4UQBA 4ZTPH 1S2EA 4TYUA 3ZBMA 1O6SB 4JKLA 3LS4L 1K3IA 4XBPB 1JZ2A 2C1OA 3FOMB 4KY1H 1ID2A 4WJ5B 3RTQC 2YLHA 4IRSC 4UBDD 3ZO9A 1MCCA 3LAFA 3MCKB 5IHZB 2WQAA 1JTOA 1Z3RA 2VDRB 4K9EL 4LARL 2VRAA 4AK1A 5L8KB 4QXVA 4TM9A 4PW9A 1QLFA 3PREA 1MNUH 2E76C 3V2AR 2CO1A 3K6NA 4R7NA 2GJPA 3ECQA 3WJJC 2CXGA 1QSEE 5KYWB 2YGQA 1A6TB 3RU8L 4OJFL 3WSQL 4DP1X 2B1AL 2QMKA 4P99A 4TNFA 2YBGA 4L9LA 5C0AE 4PJEB 2LW5A 4TUKL 1UM5H 3KNBB 3G6DL 4WFHE 1A4BA 3F8UB 3VX1A 2ZIDA 3OAZK 1TFPA 2BNQD 5E1GA 1H19A 2GI7A 3VFGH 4KVCL 1ZLEA 2R27A 5GRJL 1XIWA 2IFFH 3TC9A 3ZRSA 5MEQA 3T9WA 4AITA 5T3ZD 1FO0L 5AZ2L 1U8IA 3K6SB 4R4FL 2NT1A 4OCYL 2B2XH 4PJFA 5KAQG 2FH6A 1G1OA 2VLMD 3HVDA 4PP1D 1QQDB 4P4RA 1H6FA 1ETA1 1UB5A 4H2CA 1U8CA 3BYTA 2R2EA 1NGWA 1S9VB 4HKBB 3JZ7A 1G7JB 1H9VA 4CMHB 3L2MA 4FERA 1QW8A 5I9QC 2VN3A 4RZCB 3KPOA 1NGZB 1YUHB 1ZLUH 4JREB 4BDVB 2A9DA 4TTDD 1S7TA 3MJ8A 5DEZA 5LG1A 2YUWA 4EI5A 1HHIB 4PTUA 5AVQB 4F7TA 2H3NA 4XBEL 4MMZC 4K9EH 4LARH 5EIQA 3V0AC 1M2VB 2GQHA 4M1CD 4F7MB 3D3VA 3FFOA 5C0CD 3U7AA 3UZQA 3RTQA 1N18A 4LDLB 3P4MB 1N19A 1JPFA 2WYTA 1ZVSB 5JHLH 2X9XA 3O45B 3Q9QA 4CW1A 5E2WH 5JYLA 4G7YL 3U36B 4LIQE 5A2FA 2WQRA 5D55A 1I8AA 4FZEH 4EPSA 4HWNA 4LCWE 4E9VA 5IESL 2YGNA 3R4RA 4RWYL 2EXYC 4P5TC 2OMZA 1L3WA 5CD3A 5ECJE 3NSYA 1RK0B 1TITA 3S5LG 3X11A 4X0KA 3HKFA 3LIZA 3PAZA 4XMZA 4KXBA 4DO4A 1U8IB 4XNYL 4C56D 5AKRA 4PRID 2OSXA 3IXAA 3UO1H 2VW7A 4MCZB 4WK2B 4P3WA 1G6RB 5C0AD 3RL2B 4BGLA 5MEQB 2R23B 3OAZH 3BEWA 2MOGA 1A3LH 3M1BB 4K94L 3CXFA 4FQXB 3WEAA 4O02A 5DGRA 1OAXL 2ZF9A 3CFNA 1WDAA 1MXDA 1A5FH 4JO3L 4XP1H 1AI1H 2I9LB 3G5XB 5AYUL 1U3NA 5F9AC 1N4XL 1DQQB 1SYSA 5FXCH 4AZUA 2WQVA 1DQLL 2HLEB 3PQYE 1YEJH 2XN0A 2UZIL 3JYCA 4UQ2A 1E8WA 1B4TA 1U3YA 4WI7A 5I6NA 3FUMA 4Y19B 4DOHE 1S6NA 3HOGA 3JV5A 3OGCB 1ZT1A 3X14B 2OR7A 3MREA 3D4CA 4HLZH 1GAFH 1U8QA 1TQBB 3VNYA 5E7FA 5DJ6B 4R3SA 2MSPA 1XXDC 2CM5A 1U8JA 3QIUB 4NJAL 5HYFA 3GMMA 4JFZL 1E5YA 1OV8A 2YIHA 1LE9B 2KLSA 2WVVA 4HKZA 1E4KC 3SDAB 4OLEA 1T0NB 2IALB 3SCMC 1SHXA 5AOIA 1QO3A 1VPOH 5HDQH 2JKTM 1WIPA 5HI4D 3T1FA 2XKUA 4F7PA 1UZ6F 3MRGB 3QUXA 5EF0A 2E9GA 5DJDB 1BFSA 3QG7H 3B3BA 3H7BB 1CTNA 4ISVB 3IFLH 1WE5A 1KXQA 3NJIA 4MXWH 3KR3L 4ZBJA 5C08B 5LCVL 4APXB 2QQLL 4N4YB 3ZDZE 1F4YL 3OXRA 3MCLH 3TWCH 3NDZE 2APBA 4D3CL 4JLRA 4G6FD 3V0WH 4WWKA 5C2UB 5MEOB 5IMKB 3H6JA 4TOYH 2XRAL 2J1XA 3AXIA 3QUXB 4BFFA 1PLBA 2AV1B 4FXKB 5AW7B 4DP7X 1W72A 4LCUB 4XNDA 2HFEB 3O4LB 3F3HA 4LSUH 1BOGA 2HUEA 4UT9A 4L3AA 5EO0A 3OG6B 2FATL 2F2HA 3F7VB 1ITBB 5DEFB 4J8QA 4PJAF 3DX7B 4Z3TA 5F89B 3ZTNH 3OC5A 4PRHE 2QMJA 3RHWK 2H0FA 1TDQA 3OGCA 4QIRA 5I1IL 1MW3A 3H9ZA 3WYRA 3QYMA 3BZ4A 3U4AA 4LZKA 1X5AA 1DQTA 5EORL 1EPFA 4ZMNA 4TPRL 5A16B 4FFYL 2L7EA 2AK4D 2IMMA 4LNRB 3CFMA 2BVOB 4E9LA 4HUUA 2DF3A 3EGXB 4NN5C 4X7CC 4O02B 1NAMA 2VZ3A 5BXFB 5TQ0H 4YX2L 1J48A 3ZVVA 4DPBX 2XHNA 4L4TA 4YLQT 2XN9A 4QHMB 2H6PA 4XZUA 4NWUL 3L13A 1CDIA 2QPUA 5JMRA 3QO0A 4M5ZH 5T5FL 4QRQB 1BFOA 4LSQL 1KJ3H 3EJCA 3CMGA 4JVWA 2X41A 4G6AD 3VWKA 1BPVA 4FKHA 1FZJA 4WV1A 1BXVA 1JUFA 2K3TA 2R39A 2NCEA 2Y36L 3HZVB 2EE3A 4KBPA 4PRNA 4YZWA 1IM9B 1NIFA 2Z1PA 1BGXL 1UWXK 4M6MH 5ELIA 3ZL4H 5T1MB 2Y2WA 2BNUB 3LYRA 4PMFA 3WGUB 3H9SE 2XC8A 3AQXA 3MTXA 2AVFA 1K4DA 3J8F7 4AH2B 4KI5D 5LWYH 4ZFOA 4QHKI 3APDA 4IIQA 4KTDH 3W9DA 2H26A 2WOBA 3N44F 4A55A 1AMXA 1R33A 3PAUA 4AQ1C 1BQSA 4I77H 1GH7A 4IDJL 1F90L 4P3CL 1DQIA 4PJ9C 2VXVH 4YBLB 3KHOA 2JCCB 1YAZA 2HP4A 4JFDD 1AAJA 1DQDL 3WIAA 3UJIL 2BVTA 3QNFA 4KK6D 4E9WA 3IS0X 4KVNH 5CZRA 3EOBB 43CAA 4X4YA 5LO7A 2DQUH 4E5XA 4QRUA 5ISZD 4G42A 1A7RH 3WDJA 4DP9X 1ACYH 1F6FB 5A3IC 4GUQA 1Q0YH 2YA1A 3CXDH 2YJLA 3CHXA 3H3PL 5F1IB 1NBQA 3OKEB 4Z7QE 5JQIB 5I1GL 2EDKA 3KXFD 3SDDD 4H88L 1HIML 2X6VA 3IPFA 4AZ8A 4WQOA 1ZLDA 5GGSY 2AK4E 4J3UA 4CVZA 2FT8A 4P49A 5ALBL 3UG3A 2D2OA 5AVYB 2IWEA 3P0VL 3DYPA 2BOBA 3VFRB 3ZDYE 4KKAD 4KX7A 4HJ0D 4NERA 1OD7A 3P2TA 2CLRB 2A6DB 1UYWL 3FHEA 1MNNA 4ABUA 4Z3JA 4Z0BL 3CHSA 3OB0H 2XTJB 1KN4H 3G9AB 5FYJE 4JY6B 5I0VA 1AGBB 5C7ZA 3QZLA 2C9SA 1MW1A 2QSVA 3TFBA 5CM1A 4NQED 3DMMC 4Z5RA 1HSBB 1IBHA 3RDTA 1JXJA 3WHXA 2VJ0A 4Z3FA 2NX5B 1QTYT 3S5LA 4LBEA 4XVJH 2Z4TA 5JORB 5LQBL 5FB8A 1NZRA 1F90H 4P3CH 4BFEA 1DBKH 1AO7A 1ZA3A 3FO9A 3EHBC 1ZS2A 1CICB 4OT1H 5F7DB 5I1CL 3D7PA 5ICYB 1AS7A 4GQQA 1XF3B 9PCYA 5HHVL 1NCDH 1NPNA 4YXHH 3H0TB 2AXWA 2IG2H 2KT6A 4GAGH 3CXDL 2R8SL 1DQJB 2GTZA 2ZF8A 3CH1B 3C6LD 4P2CG 3BT2L 2NW3A 1CBVL 1G9HA 1QRNA 1AG6A 3TIDA 3W3BA 3MC0A 4CBZA 4DW2L 5C7XL 2BY1A 4I2XA 5KSAB 1QZNA 3US0A 3LZFL 3ZT6A 4NQCD 4ZFOB 1J5OL 2GFBB 4G71B 4O2CB 5LHDA 2HA1A 5CUSH 3AGVA 2XPZA 3UCRA 3MXWL 4M8UA 4WFFE 1WVZA 2H3KA 2DY2A 5EBLA 5IJVB 3X13B 3PAVA 3MRHA 4Q6IB 2JKXA 3UGUA 2AQ3A 2O26U 3QDMD 1SN5A 3STLB 4WRLA 5IROD 4K23H 3DV6B 4XHQA 1TJIH 3LXUX 4QOKA 1MLBA 4NI3A 3HNSH 4O58H 5K69A 1MI5D 1PKQA 2P24B 1L4IA 3LVTA 4L1LA 3RVTD 2I85A 1CGXA 4N2CA 4UANA 4KKCC 5I1JL 4DGIL 3VI3E 1OE1A 4NCDA 2Q7YB 3GSUB 1LO5B 1TQCC 1CZ8H 2GCYA 3BP7B 4JB9H 2Z7WA 3EHBD 3OVUB 4M5YH 3V6OE 4Q6KA 1NINA 1AGEB 3QFDA 1USZA 4P5KA 2EKJA 4OZHE 2HPTA 4NXKA 5BOZG 1QNZL 2QJDA 3B4NA 3G08B 4WI4A 5CZKA 3L81A 3OHXC 3Q8AA 1NJ9A 5GXBB 2WANA 4NC0B 4QO1B 1BHGA 1F2QA 2BCMA 3GXDA 4IK6A 5AWNH 1YMMD 3LZFH 4H44C 3EG9A 3FK3A 4FNLH 4RRPA 4J3OD 1N6VA 2QZ5A 3F7VA 4JQXC 4NUGL 4ORZC 3LSOB 1X6LA 4U1MB 5SX4H 2MWCA 3WHXB 2DEWX 5KBNC 4X6DF 2EE6A 2F58H 1A8JH 3ZKND 3ZT5A 5AYQA 3U6RB 4WO4D 4NQDB 1GGBH 2XG5A 2UVFA 2GBAA 4JG5A 4HKXB 2VDNB 3VA2C 3I3EA 4E36A 2OMYB 2W07B 1OP4A 4OH2A 1G87A 4MNGB 5ADPL 1KGYE 3D0VA 5HJGA 1EERB 3RWHB 2FYYB 2AAAA 2V7NA 3AZUA 2Z35B 1ZJAA 4R2GD 4Z9KB 9CGTA 2WQWA 4MAYA 4BH7B 1NM4A 3GLEA 2DIJA 1RZIB 2IXQA 5E5MB 3FC8A 4B9FA 1PAZA 1TF4A 3RX7A 4GKLA 4EIBA 1S5HA 2FTAA 2JJWA 4PWIA 2OSYA 1HQ4B 4YDNA 4AIEA 5HYSB 5I5IA 2ZUVA 1ZEAL 3D87B 1M05A 2NSQA 4P5MA 4S0HA 2NTFB 3DPBA 3VI4B 1MFMA 3SGEI 2HJKA 4LAJH 1INQB 1BZ8A 4JM2A 3K72B 3ZZSA 4I1RA 1CFNA 1RHHB 3FTGA 3VH8B 3MNWA 1PCXA 3NIGB 4U3HA 5AAPA 4J12A 1T2QH 3ZDWA 4DAGL 1R5IA 2SEBB 5AD0B 1SJXA 5KUKA 4TSCH 1CQYA 1IBDA 3DX0A 2OULB 1I9IH 5SWSB 4WCYH 2HN7A 4Y2DD 4L2LA 1TSHA 2VN5A 2X2HA 5DA0B 4EBQH 3MUHL 1VB9A 2OAAA 4B60A 5GZNA 2A74A 4Q9QL 1B88A 1JV5B 2WIIB 4K07A 4PGCA 4LHUG 1L0PA 1UT1A 2MTAA 4KAQL 2VAAB 2Q86A 1LL1A 1YNTB 3O11B 3PXLA 4OJFH 5DVOA 1MDAA 3VM7A 5HGBA 4TUKH 4N68A 2P8LB 5DQ9B 5F1NA 4XT1C 5E9DB 3ETSA 5IOKA 4FHBD 3FB8A 4XMPH 1MUJA 4RGMC 3ZSSA 3VWKB 5AL8A 2B08A 3O81A 3KS0J 2BS8A 3ARFB 3QG6A 5G4MA 3V8CA 2DMKA 1I4FB 2VXQH 1BFOB 4QRQA 4QXUL 4BUHA 3P3RA 2BDNH 3PE9A 5D9SA 2FZ3A 2WZ6A 1TXKA 4B9ZA 2ZG1A 3QHTC 1PG7W 4KKRA 1GYWA 1IZKA 1RZ7H 2YD4A 4IBVA 2V9QA 3VGAB 4MA8H 4N9GB 3CVIL 4P23D 3Q2NA 2PXYC 2DQDL 4LAQL 5F3FA 4X5XB 4L05A 1ZV2A 4F7MA 4AQOA 4HK0A 4BHUA 5DHYB 3DUSB 3JWOC 4L1BA 3T0EE 4DN4H 4IRJB 4PAZA 3V4UL 2ILLA 4IIZA 3L7FA 3ROLB 3B2MA 3GO1L 3ZKNC 3T3MB 1DVFA 2WKOA 4S1SL 2BIOA 4BQ6A 2CRZA 3WEBA 5C0GB 2RD0A 3HG1E 1B4JH 5E4EB 5HP5A 1JZ3A 3B2DC 5I0XA 3L3OB 4WUUA 5DZ9A 4NHUA 1MVFA 2XXMB 4KTGA 3F58L 4YPJA 3A0OA 4MJ2A 1T1WB 3U1QA 5JHDB 3GBDA 4LLWB 1BZDA 3FUDA 3QUGA 3PPSA 5JPNC 5D7IA 1DCEA 3LEXB 4KROB 4Q0XL 3LS5L 4PLOB 3F7RA 1JPSL 1A6WL 4RQQA 1XF3A 3MODH 4YDJB 15C8L 3EJZC 1DDTA 3C5SA 1FBIL 2GB2A 1UG9A 5F7HA 4HEPG 1CD1A 1AO7B 3DA0A 4XNBA 2VLLA 1G9ML 3KLAB 2E5EA 3AW5A 3U7YH 3L95B 5FM5M 4F2FA 5CMAA 3FT1A 1INEH 5DD3H 2PP9A 3RDTB 5KN5A 4P2QD 4GSUA 5IFAH 1ED3A 4AUUA 1T6WA 4YE4L 1RUQH 4R96A 2P28B 4N2LA 4KWUA 4V2BA 4TUOB 4PJDE 1J11A 1YEGL 2D0FA 4X50A 1VZGA 5FIEA 5HVWA 2EIMB 5DD5L 1MJUL 2F0CA 5IESH 4JUTA 4ZAKC 1KEGH 3LRHA 5F88B 3VD4A 1DVYA 4X7SH 2C3WA 3O6FB 3JWNC 3JVGA 4WFEE 1OM9A 2GBVA 4ZFQA 2DLIA 4FFTA 1U8KA 4C55A 4ZMWA 1JG9A 1SLVA 4ZS6C 3RIKA 2JB6B 2OZ4H 3II3A 5IEKB 4RSVA 3EXJA 5DFTA 3FMGH 4OF5A 1N26A 5D7IB 1Q9WB 3DX1A 3G5ZA 2J4WL 3ZMNA 4J3OH 3U9UA 1BZQK 5HI3D 2EYTA 2IH8A 5IVOA 1YEIL 3BWUC 3FJTA 4PH8A 3TT3H 5IW3A 1JPSH 4BA8A 4QTIL 5EU6A 3VVVA 5C2BH 3L3HA 2ZWKA 4PJXA 1MCBA 4PVLA 2IAMA 5EZIL 2FR4B 2UZIH 1KJVB 4RRPG 4B5EA 1E4WL 2DEYX 3WD5L 2EDTA