4GT0A

Structure of dengue virus serotype 1 se containing stem to residue 421
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
402
structure length
390
Chain Sequence
b'RCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEVTNPAVLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDTNFVCRRTFVDRGHGNGCGLFGKGSLITCAKFKCVTKLEGKIVQYENLKYSVIVTVHTGGTIATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNEMVLLTMKEKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLVTFKTAHAKKQEVVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKLTLKGMSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGKMFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope protein E
molecule tags Viral protein
source organism Dengue virus 1
publication title Structure of a dengue virus envelope protein late-stage fusion intermediate.
pubmed doi rcsb
total genus 67
structure length 390
sequence length 402
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gt0A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4gt0A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4gt0A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4gt0A03
1Z66A 4ALAC 2JV6A 2R29A 4UTCA 1SVBA 1TG8A 2HG0A 3MUUA 3N42F 4GSXA 4L5FE 5AAMC 5IZ7A 3I50E 2GG1A 3N41F 3UZEC 1OANA 2R69A 3G7TA 4X42A 2V33A 5LCVA 3VTTA 2H0PA 3IRCA 5GZNA 3WE1A 4AM0Q 2JSFA 3J2PA 3N40F 3N43F 5H37A 3UC0A 2ALAA 5B1CA 3UYPB 1UZGA 3UAJA 4FFYA 1PJWA 1ZTXE 2I69A 4UTAA 4UT9A 5GZOA 3UZQB 5JHLA 4FFZA 4FG0A 3C5XA 5JHMA 1S6NA 5AAWC 1Z3RA 5KVGE 5KVDE 1OK8A 3P54A 5IREA 1URZA 1OKEA 5LBVA 5KVFE 4UT6A 4BZ1A 4GT0A 3UZVA 4AL8C 5KVEE 3J27A 3C6EA 2P5PA 3N44F 4BZ2A 5LBSA 2JQMA 1RERA 4UTBA
chains in the Genus database with same CATH superfamily
3K1DA 1ONQA 2W0FB 3BP5A 4UUJA 4JHVA 3FCTB 4DP0X 1BP3B 4K94H 4N6RA 4X4YB 3FB8B 5HDRA 8FABA 3QRLA 3QDJA 4G9FA 2DQTH 4LNRB 4JFVA 1T04A 1TOXA 3OZ9L 4ISVA 4L1DA 1TITA 3SGKA 4Z7UA 1BW8A 5FKAA 1M7XA 3MRCA 1C1EH 2G60L 2X2JA 4WFFD 3GJFA 2WK2A 4HF5H 4HUVA 3VW3L 2KC0A 1FZJA 3J8F7 4YEEA 1FNGA 4WI0B 1ZT4A 1EO8H 2JFCA 5T3ZE 1QUNA 1X7TA 2MJWA 5TQ0L 1Q1JH 3WN5B 4EI6A 3BIKA 4JBSA 3B83A 2AJSH 3DLQR 3VFNB 1FVDA 1G5GA 3L95B 4KKLD 4QHLA 1H9VA 2R2EB 2W0KA 3SE3A 2WBJD 2C1OB 2NCMA 4U1IB 1M53A 3IDGA 2VDKB 3T77A 1J1OL 3N40P 2YRPA 1I7UB 3KS0J 1ZE3C 4XB3A 1NDTA 3CUPA 5F1IA 2ESVD 5I75C 5DRXB 3N1PC 1RVFH 4H1LB 4WTXA 4PY8J 4QWWC 2HVBA 3BZEA 4DN4L 3RVXC 2Y5TA 3DYOA 3ARFC 4MXVE 2WTOA 3P4LA 5FDWB 4PJEE 5DK0A 2C26A 1XMEB 4AITA 4JFPB 1GYCA 2FBRA 3BMWA 3LS5H 4HOZA 1RSYA 4G9FB 4G6AC 4PI2A 4YHOL 2GUOA 2FSDA 2V2XA 1NLDL 3MLPA 3TPUB 2ERJB 2HFGH 2ZWSA 4EUPH 5CZKA 5DZJA 4JY5L 1OHZA 4ZS6D 4OGZA 2E27H 3T3MF 2AQNA 4KI5D 4ELKB 3MOBL 3IMSA 3TNNB 1NCJA 4JDEA 1OIOA 3VFTB 1QPXA 1WG3A 3GEFA 3MOAH 1UKTA 1ROWA 3BLKA 1WZMA 1N67A 2C7FA 4OF6A 4DP2X 1WBYA 4P57B 3RGHA 3BQVA 3HMXL 2LLLA 4PVLA 2HTLC 3D85A 1ZLWH 1LEIA 2PN5A 4K8RL 5IK3B 1RLWA 1F02I 1F11A 2FEEI 1TTUA 2E5EA 1ADWA 4Y19B 2HJKA 3U7AA 4JFQB 4JFHD 3WL9A 2FGZA 5I23A 1M6OB 4PTTB 4JG9A 1T1YA 4QO1A 5B22A 1YN6A 2MEJB 5IROA 4JN2A 3T04D 2RQ8A 4AT6A 5KJRL 3HNVL 1IT9L 4XWOD 4RGNC 3W9EB 5I0YA 2XWEA 4LGPB 1WAPA 2RAMA 1WZLA 3FU3A 3QCTH 1V10A 1IBHA 4PB9H 5LB1A 3SDXF 3VO0A 1E8YA 4F57L 4F8TA 1U8NA 2IANB 2V2TA 1YG9A 2GSMB 4FYRA 5LBSH 3Q5YA 3UBHA 3JT2A 4PTUB 3PHQA 2NXYD 3VWKB 3MLWH 5A2FA 3UBGA 2Z7YA 1JS4A 3CFUA 4FTVB 2BY3A 2GT9A 3IMBA 3BISA 4N1CA 2VDQL 1F3DJ 3P0YH 2WY3B 3O3EA 3R19A 1G6RH 2E4FA 3RQ3A 3FUEA 1CB4A 5CGTA 4ZSOE 1KJMB 1LP9B 3MLXH 3VXQA 1IRAY 1AI1H 2WIMA 5KOMC 2G4EA 2B3RA 3I6GB 4KJPC 3ZZSA 5IB1B 2NX5E 2QMJA 2YPLA 1PW3A 1B2WL 2VN6A 3GMOB 2XWTA 4IOIB 3RIAK 3T6QC 2V3EA 2K7PA 3H4FA 3NIFF 3IJEB 2F19H 3RKDC 1OW0A 4AQZA 2EZ0D 4HU8A 5D4HA 3C60C 1GZPB 5HDBF 4L4JA 5F6HI 2GAZA 4F57H 1MWOA 3S8FB 1UZ8B 1C8PA 4H0LC 4ZUUB 1C08B 2DJSA 2HRPL 3DXAA 3NK4A 5CLXA 4D0DA 1UWEL 1AYRA 4BZ2A 4LVOB 1JNLH 1Z9NA 2R2CA 4PGZA 3V10A 5CSBA 2Z8VC 3N1QC 3HS9A 4G6FD 1MCDA 3VXUB 1G4MA 5J9PA 4BHUA 1P4BL 3SDDC 1R3HB 4JFZH 1H3VA 3AREC 3FUHA 2B1HL 1OCOB 3II3A 2ZPKL 3BUIA 2A2QT 5TE7H 1U8JB 3L3OB 1AJ7H 1SXNA 5B39A 3CFTA 2XXMB 3DX6B 1J5CA 1IFHL 4F58H 3NIFB 2NZIA 5FO7B 4HQQL 4MZ2A 1A3RH 5ISZB 5TK2A 3UTSB 4BD4A 4AV4A 2WBXA 3PNWB 4DWHA 3IDIB 4TKWA 1DVUA 1SBSL 4JKLA 1MLBA 4YL4A 2ED9A 3W39A 1D7DA 2GK0B 4X5LA 1VDGA 4PRAA 4AJ0A 1AXSA 3E1ZA 1J8KA 1MXDA 3FT3B 1ZK5A 2RBLA 3CXFA 1FL5A 1RP9A 3DUHA 1A3ZA 3QRGL 4YLBA 3U4BL 3V4UL 2COQA 2XU9A 4LLDA 4MMZA 4QRRD 4P2QB 3T4AA 1C08A 2QPFA 1QWHA 2ED6A 2F58L 4PRIB 2FEDD 1ID5I 2V17H 2XN9D 4NM4L 3CVDA 1RV6X 4PJFF 2Q8BH 2VO5A 2DLHA 3VRJA 1W16A 4KJPD 4JRYE 5FS5A 2BP0B 1P4IH 2MKLC 2NY2C 4G6JL 4LPWA 4R5TA 3SDCD 1OSZA 1WUZA 3SN6N 3KLHC 4DKFH 3L3JA 2BCMA 5ILTL 4O58L 2CUAA 3POCA 4OGAC 1LWRA 3QUYC 2VUYA 4JY4B 1FO0H 1E43A 2ZYSA 3GK8L 3HPJB 2KDYA 4WNSA 2VN5A 4JM4H 5IEHA 4WVRA 3L5XH 1GH7A 4LEEA 1FN4A 4X4XB 4R8WL 5ACZA 4QRSB 5J6GA 1TJGL 12E8H 3NESA 2A83A 4BCYA 4DCQA 4OI7A 4MJ2A 4OV5B 3RUGF 2VDML 3NABL 2AEQL 3NFSL 1OWRM 4N85A 4TUKH 1PGRB 2G9KA 3ZDZF 5TD4A 1PZAA 3TO4A 5C0BB 9PCYA 1A25A 1ZWIA 2IGFL 1CFTA 2XPZA 3FUFA 5E08L 1TFPA 1A21A 4X99B 1SDDB 3P0VL 5KN5A 1KLFB 2BWIA 3CPUA 3SQOL 2QBWA 5AOLA 1QRND 2J8OA 4UIKH 3WY3A 2MPAH 1U3HA 3T4AB 3UBXG 5E5MA 5BOZG 4G7YH 5DA0B 4PJGE 2OSXA 3NJGA 2O5XL 2P44B 1I9IL 4MA7L 1ITBB 5D6DA 5MERB 1B0WA 2NX5B 3H2WA 5KBPA 2R56L 3Q06A 3BO8A 5ELIA 3QWRD 3MOAL 3AXIA 1ECZA 2DYPD 4FLHA 3BGMB 3PIQA 4NPYB 2EE3A 3EYQC 2J8UE 1OT1A 2PCPB 1RUKL 2AJZB 1MFDL 1J0ZA 4OF5A 4PIRF 5HI3C 1C5BL 2RJMA 1N8ZB 2BSTA 2P8PA 3T8XB 2F5BH 3X11A 1I53A 4ETQA 4Z3JA 4KK9C 4FZEH 1PY9A 5INCA 4YGVA 4XOAA 3OX8B 4I3SL 3WEXB 3LSOB 3BP4A 3II1A 3KCPB 2QSCL 3MRLB 2CK0L 5F96L 2NSXA 4RFEA 2NR6C 2X40A 5J9PB 3L8QA 4XBMA 4MZ3A 4AUYA 2AJYL 4UBDC 2KQNA 4MS8D 1G7QB 4HJJL 4RAHA 1OGAB 3BN9D 1UEYA 3D39A 3KPRD 3D3VD 3TWCH 3LEXB 3ZOAA 3UAJD 2P45B 4DN3H 2W65A 3BDYL 3E0GA 3DK2A 1U8KA 1HZLA 1MCOL 3M6DA 5C09A 4PVBA 4AY0A 1JFHA 4XXDB 1L0XA 3BUYB 3HZMB 4WHCA 2R4SL 3EJZD 3PHQB 4FA7B 5L2JA 1WSST 4MDIA 3DJRA 4QXVA 4DQAA 2B14A 5IEHB 1NAKH 1P53A 4NS0A 5KBLA 3IDMB 5E70A 2EACA 4MJ6B 4Y4KA 3VXTA 1U9KA 5DU7A 4YDVB 1GZHA 2R0LH 1JYVA 4Y4HA 4AQEA 5HJGA 1BEYH 1XEDA 1RKRA 2YGPA 4K9EC 3QJZA 1KY6A 1PIGA 4HWBA 2J55A 2Y1AA 3QG7H 5CHNB 5C7XL 4N2CA 1P9MC 2BINA 4ZAKA 2CHXA 4YX2H 5KJ4A 2UUDK 4XE0A 1UFUA 2CO6A 3O3AA 1FZOB 2O6FA 4NQDB 2XUWA 4PJFA 1O0VA 4X5PA 1MIML 5H2BB 3BKML 4CN4A 4DK5A 3U0PA 1IGYB 4S1DC 5EU3A 1XH1A 2LV4A 2Z35B 4UT7L 3W38A 3OKEA 3FRPA 4K7PY 4BH7B 2TRHA 2K8MA 4AYSA 1IGJB 4HYTB 4L3CA 1EQWA 4ZYKA 3OG6B 3PQYA 5C8JB 4I4WB 1J5OH 2IDCA 1KYAA 2WIIB 2JKTM 3U46B 5FKPB 1CR9L 1RURH 4WQOA 3BAJA 4IJ3B 1OE3A 3AMLA 3FT1A 4RFNC 4F8LA 1KLFA 2OX5A 3EJSA 5HHME 1OSEA 2ZX8A 4EZKA 2OL3L 4QYAA 3MRHA 5C07D 3S88H 2EQDA 4ACPA 4F1SA 2WTRA 3E7JA 4HV8A 3R18A 1QR1A 2WB1A 3VFOB 4EMZA 2WXNA 2OMYB 1ZXKA 1NPJA 2YZ8A 3FNKA 3NEXA 3TBBA 1YUHA 2CO4A 5C3LD 4O2FA 1UWYA 2AEOA 4TS6A 1SBSH 3WJMB 1K4CB 2EEDA 1OSPL 2VDOH 3CSTA 5IB5A 4JZNA 1KGXA 1ZA6B 2J1WA 5EBMA 1ANUA 4PJCE 3VCLA 4X6CB 1NPNA 1NGXB 4Y2DB 5ICUA 5J11B 3GBMH 4NZDA 1F58L 5D7SH 4Y1TA 1EZVY 43C9B 4D9RD 3QIWD 4BK8A 4FEIA 3UDWC 3ESPA 1AGDA 1QSFB 1G0YR 4LPYA 2GY5A 1PMYA 2BNRB 2NY7H 5KJ7E 3DV4A 2W5PA 4G8AC 4Z7UE 3LV3B 1EAOA 1G7IA 4Z7IA 5GS3A 2CIKB 3SY0B 1D5RA 5KVEL 5D2LA 4M6AA 2YZ1A 4XX1G 3X1NA 3R0MA 3GXDA 3FOMB 3KPOA 3AG1B 4ISVB 5CJ5A 2F1AA 4E0RA 3QZOA 3B5HA 1NDGA 3O41B 2ICWI 2HLFC 2CCLA 4U1HB 1CZ8L 1GJWA 2BVTA 4FLSA 1OAYL 4JPWH 2B59B 5MHSD 5ABZA 1TJGH 2OAAA 3OJDB 4CILA 5AUMB 4HEME 4YHLH 3UTOA 4YPGA 4A2DA 1YYCA 3QNXB 2Y5QA 1MCPH 4YAQB 3UC2A 1E8ZA 3KYOA 1HSAA 4HJUA 3IPBA 4X80L 4BQCA 2V5MA 3LRSA 2D3VA 3K6NA 1N7MH 1N10A 4PJ5E 4GQZA 3QWQB 3QULB 3M7FB 3ILPB 5CSZB 2IPTL 3N85L 1A6TB 1OGAE 2MOQA 4NIYE 3KMDA 4XPBL 2XTLA 2HUEA 3C9NA 3KYAA 3QQNA 2KT6A 1MRDL 2XBTA 4PPTA 3TM6A 1I8AA 4Z3HA 2W0PA 4ZO6A 5JIDA 1IILE 1RZKH 2B0SL 2QGCA 1S9YA 2EDLA 4L8SA 3QO0A 3W2DH 2RD0A 2VSCA 4NO2B 4XMKL 4G8GE 2PF6A 2VW7A 1RHFA 2WTPA 4KI1A 5DK0B 2VLJE 4OJFH 4NJAL 1K2DB 2QZQA 2Y5TB 1OL0A 1XF5B 5DI8A 3DUUA 2FX8L 4QRRA 3NFPB 5EDXA 1SN2A 3C8DA 5J6HA 2D0GA 4Q52A 1MNUL 1KCVH 4OZIA 3TYGL 2EUWA 4OM0L 1UZ6F 1HL4A 5C0CA 2OSWA 3RKDD 3GI8L 5FEBA 5KYWB 2DQCH 3LZPA 1MFCL 3CN4A 2AJVL 4DGWC 5I73C 5AD0A 1CN4A 3BN3B 4KKZA 2WQVA 3NIGE 1N5AB 5SWZD 1EXHA 1JUFA 5E94B 1NC4D 2R4RH 1E4XL 1LQBC 1JERA 5K93A 3MRJA 3US0A 1DN0A 2XTSA 5JORA 3V8CA 4YSAA 2RR3A 1UADC 2Z31C 4GLRH 4XBPB 5I16A 3WUWB 2CPUA 1D7CA 5BXFB 1E9OB 2PW1B 2X6VA 4RQQA 3RG1C 4UT9A 3TF7C 4OT1H 4W9KC 4J3SA 1WWCA 4GRMB 5J13C 3AQZA 1CBVH 2QQQA 1NGYA 4PJFE 5AYUH 4ELDA 2PNDA 3FT4A 4TN9A 3C60A 2XWJB 1FFTB 3STLB 4PVNA 4EVNA 5I76B 3BSZL 5EC1A 3B3IA 2WLHA 1Q72L 4MD4B 1TF4A 3RDTD 1HFUA 5CEXB 2FO4B 4LIQH 4XVTL 2HX7A 1KZQA 2N59A 4XHQA 2FJFA 2YMXL 1TTBA 4JZOA 1YJDC 3F84A 3MLZH 4W1TA 2ZG1A 4YHZL 1KPUA 3WL9B 3BGAA 1UOVA 3SBWC 3QULA 5CSZA 4X0KB 3SCMD 3QCUH 2ZQKA 3GSXA 1IBZA 5F9JB 3FQYA 1GC1C 1IFHH 4FQQA 1KNOB 1UD2A 3C8KA 4IRJC 2R1YA 3V5DA 4RISH 4OLYL 2X4OB 3HNTH 4JFXB 1ICTA 1GTNA 3Q8CA 5HHQA 2X4UB 1HS6A 1IGCL 3KJ6H 2CHWA 2WWKO 3UEZA 1YC8A 2X6UA 4LASL 4Z3EA 3DETD 4MJJA 3FN0H 3T4YB 4PP1D 4Z3FA 2UVEA 3MLTA 1VF5C 1JNNH 4ORGB 1HSBA 3BWSA 4E9SA 4HJ1A 3S37L 1IGML 3D25A 3RVXD 3UO1L 3EG9B 2QKIA 3BI9X 1J10A 2J1XA 3LD8C 5BZDA 3RFZB 4X5QA 2DQCL 1IKNA 1UB6A 5GGQL 4Q97A 3K72A 1VEOA 2HJLA 3INUL 3EJRA 1J0JA 1OHQA 5GRJL 1CYXA 4AEIH 5EU6B 3UAAA 3FO1A 1L0QA 1ZTXH 4Y5XC 3SPVB 5CP3H 4U31A 2X28A 1EGJH 1F42A 2P80D 4CSPA 8PAZA 4O2FB 1AO7A 4Y4HD 4PG9A 5L2KD 1QHPA 2EADA 1F45A 4PRDB 2YGNA 5KS9E 1MCQA 35C8H 3V4PA 1ETB1 3MCKB 2W94A 1ZHBA 2RCSH 4HXAH 1PFOA 1WBXB 2K4WA 2ZSWA 4LLAA 5DEGA 1JK8B 3AM8A 2X9XA 1YEIL 2MRYA 3VGDA 1P7QB 4KMTL 1IGTB 3HJ0A 5CO1A 1NIBA 1N4XH 2UZIL 4L48A 3GSOA 3Q2LA 1RZ8A 4FMVA 5EULV 1NWPA 3FB7A 1DBKH 1QLEB 1CGXA 3OC8A 3PQYD 1QFPA 3FTZA 4B60A 3EGXB 3L5WB 1MVUB 5E6IB 4TQEL 3BW9A 5B7EA 4ALAL 4NERA 4KVCL 3MR9A 3V4VB 3HC0A 3EFDH 4OQ1A 3O8XC 3F7KA 4OI8A 1XF4A 3EADA 1HSAB 2PXYB 1L9OA 3E38A 1D5BB 2A4CA 2D7MA 4IBUA 4XXWA 2WVSA 4DAGH 3KGRA 3UBXB 1U58B 1Y18B 4P2QE 3TC9A 3UG5A 5I5MA 1YVLA 2E9WA 1H3GA 3TIDA 4NQEE 2H0JA 4APQA 1SN5A 2DV6A 4JK0D 1R5IA 3EDEA 3GSVA 3IF1B 4XMPL 5CP7A 1PZDA 3MRDB 4LLUA 4TPRH 1XH3A 4M43H 5LQBH 1YQVH 4OFVA 5FB8B 1RFDL 1TR7A 2DQ6A 2A7BA 1RZGB 3C2SA 1MHPL 1RSFA 2UY7A 4U3SA 4W9ZA 4WNQB 3PWVB 1MIEL 1JV5A 2DQFB 1LE5B 1URZA 3MV9A 3QZMA 2E46A 3LS4L 5IQNA 3W9DB 4A2FA 3BFQG 3NCFB 3ARQA 4OJDH 3PABB 4IW4C 2BC4A 2EIDA 2CR3A 1I1YB 5CMAB 2GEQA 1HI6B 3MRQB 4HUXA 4IM8A 4A2EA 3MXWL 1CFTB 3LEYL 1B9ZA 1S9VB 3CXDL 4CJ0A 4OLWH 4PG9B 3WIIL 1F6LL 4P2OC 3OXSA 1PY0A 2VISA 4X7SL 2XZQL 1S5HB 2X89A 1HAUA 1OGTB 2FIKB 3WV0A 3SDDA 5IV2A 3Q3GA 4PLNC 3X11B 4PYGA 2JVUA 3FQWB 4U1SA 5D2NE 4BGDA 3B9DA 1AXTL 4NI6A 5C07E 5KSVA 4B96A 5DT1L 3SB3A 4JDZA 1U42A 2NXYB 5FFOA 4P5TD 5TF1H 2OTUA 1G5AA 2PP7A 3JWNE 3CLFH 3S35H 3CXHJ 3GSWB 4L8SC 4LZKA 5I6OA 5EU6E 2YA2A 4Q7DA 5GSVA 1EDHA 4HJEA 1X4XA 5C3TA 1MWAL 4YHYB 4S1QL 1G9MH 4WKZA 4Y1AA 2BCKB 4BFFA 5T1KB 2P5EA 2XG5B 4O4YL 1G7JB 3W11D 4FQXD 4LAQH 3UPRA 2AEQH 3LSOA 1JXGA 1NCBL 2PYEE 1ZLSL 4YNYB 5ID0A 2VAJA 1BVOA 5DJ0B 3NPZB 4XTRD 2I5YH 3NZSA 1R17A 4N0CC 1KXVA 4DIXA 4IEFA 1BEXA 3NCYS 3PDDA 4L9LB 4Q89A 1G9HA 5E9DD 4CBPA 5IB3B 3UZEC 4M5YL 1RIHL 3VXSE 4EIBA 1DVFB 3ULUE 1WGOA 2WQ8A 3EZ8A 3A67H 5HGDB 2VDNB 1UVQA 5I24A 4JFUA 5KS9B 5IKCB 1DDHB 4K9JA 2AQSA 2A99A 3GSUB 4Z3GA 5HD8D 1F0LA 3IF1A 4XXCA 4JHUA 5CP7B 1C7TA 1BFOA 2VDQB 4PJ9D 5IT2H 1RUAL 2NT0A 5ERWB 2DMKA 1AP2B 1UA6H 1EDYA 2EDMA 2NUTA 3VI4E 1MVYA 2HFTA 4R7XA 3QORD 5HTSA 4CDGC 3TTSA 1BAFL 2NSQA 4N0UE 5HGHA 2EDNA 2ILLA 3QDAA 2P5WA 1BPLB 1NDMB 4BZYA 3BDXA 1T0NA 1BVNP 1WF5A 2GSIB 3UDWA 1Y0LA 1FZOA 1OAJA 4MNQE 4NQDA 2H9GB 2VAAB 3ZTDC 3O0LA 3OKEB 4V11A 5AKTA 4BKTC 5I18H 5JPMA 4I9WE 3NH7L 4UOW0 4HLZH 4ZMTA 1N5YL 4LCIH 4WIQA 1NBVH 1XZWA 4I88A 2Z4QB 2J43A 1A1NA 1AG0A 3FRPB 4RISL 3IFOA 5EORL 5K5YA 1XB8A 1XSIA 4P9HC 1KIPA 1KJVA 1TTCA 4R4BA 2B1AH 1TQTA 1H5BB 1YY8A 1FNFA 1G6RB 5A6LA 3MNZA 3UP1A 3VI4F 2IH9A 4Z1PA 1DBAH 1SMDA 2VXTL 2R69A 1EAPA 1KDJA 3PP3K 3IBOA 2ICWJ 1H0DA 4JN1H 4N28A 3F7VA 4KRNA 3BC9A 3QIBB 4HH8A 3SCMA 1PJWA 1F1DA 3CVIH 3MO1B 4POZD 3S3BB 1EPFA 4WTZG 1YMMA 1JHLH 4OY9A 4PD4K 1E40A 1E3FA 4NKOA 3OXSB 2NY1D 3F8UB 4XNUL 3VFSA 1NIEA 4IIQA 5ALCH 5E7BA 1DVTA 3CBRA 4NM4H 2UZPA 5CGYD 1COBA 2ENSA 5DD6A 3WS6A 2P26A 1VPOL 3VWJB 5IVXF 5B38B 1QEWA 2VZSA 5JQHC 1FYTD 4LVHC 3E9UA 5DQJB 1I8UA 3LTVA 4GSDH 3MLVH 4PV1C 3WXWL 2FX8H 2WLIB 1VGKA 3DDFA 3QJSB 1OD9A 4HS6B 4QNPF 5B1JC 2WPGA 2QHRL 2WXGA 1RD6A 4UT6H 4GSRA 4D3CH 5JHMA 2OR9L 2X4RA 3FH7A 3PYCA 4X9FA 4LFHG 3U25A 3MTXA 1SY6A 4IRSB 3MC0A 4GXUN 3MZGB 4JPQA 1CU4H 3LRGA 1FIGL 3GSUA 5KVEE 4NX0A 4GAYB 4LARL 1LNUA 2V3FA 3JQOB 1O9ZA 5G2NA 3FQRB 1G7JA 4N0FA 4HISA 3V9EA 3FO0H 5CR1A 2SEBA 1HE8A 4PGJA 2WKLA 5HP5A 3U30C 3IDYB 1LP9A 2NX5A 3NDZE 3PF2A 4WJG3 3QR0A 4YHKH 3SD2A 1Y6NR 4EAEA 1GGTA 3QYNA 1TZGL 3MV8D 4ONOA 1CFNB 4CSTA 3CIQA 3NCJH 2VR3A 1KACB 3BRFA 1OPGL 4YHML 4E41D 4L1HA 3KM1A 1AY1H 1XDTT 2PTVA 4P4KA 2FLRT 2I7SA 5CCKL 4HD5A 1VEPA 3L3IA 1B4JL 2VN3A 4HIIB 5FFGA 1YO4A 3Q13A 3RTLA 4N8CH 5F7EL 2EVHA 1JV5B 1AD0A 2DQFA 1LE5A 2B1HH 5FYKU 3D48R 3LPPA 5KN5B 2PO6B 1XTMA 2WNKA 5DR5H 4OFIA 5FYJD 5EC2A 3ARFA 3PGCB 5GGRB 1CGTA 2PCXA 1TTFA 2PUQT 5EN2A 1FWXA 3K8MA 1FVCB 1U93A 2NXZB 3WD5L 2BVPB 1SJHA 2FBOJ 3OKYA 4OSUL 3STLA 3DX2A 5M95B 1ZHNA 1N0XL 3Q1SL 5EUOF 4KQ4L 3Q9QA 1IBGH 3SJVA 4V2CB 4JPSA 3O4OC 1NC4B 1U8JA 4WWKC 1G1CA 1LP9F 3UTTD 2FBJH 2J7LA 5EBGA 4NDMB 4G8GB 3ECUA 1SBBA 4X6BB 1M4KA 2ZX5A 4GQPH 2UZXB 3WFCL 4RGMB 5FYKE 3SZKC 3LKOA 4IRSD 1YMHA 1NCWH 2OTUB 3J07A 3MRJB 1EJFA 1SM3L 1E4WH 1DBMH 5DK2B 3U6XS 2EYTB 5CCKH 1LYQA 1ZV5A 2NOYA 5GZOC 3GSRA 4QCIA 5E6RB 1UH2A 2EEXA 1F8TL 4I89A 2W92A 3FCSB 3EO9H 5MEOB 4NQQA 2AF2A 3CFBB 3L9RA 3QXDB 5KBMA 4D7PA 1MZYA 3VXSD 3ULUD 4O5LL 5DJYA 1CLYH 2VLJD 5K39A 5EEXA 4UDUA 1ITCA 2BNRE 2B8OT 3K6SB 2JB6B 1JVOA 2AAAA 2F74B 2PWFA 4TQPA 1FGNH 3FQRA 2J57A 4N0FB 5D2NC 3VGFA 4ZTPL 4AH2A 1RZFL 3Q6FA 1JGLH 1QFUL 4FZ8L 1FFPA 1EZUA 1JBJA 1BZEA 1JMXA 2KQMA 4U4BA 2ZUUA 3GT6A 3QC6X 1I4FA 5BVPH 2AXHA 2KPNA 4M7JL 4OW6A 2QSTA 5I74C 3ZE2B 4Y8DC 1USQA 4TSAH 1JYXA 1J8HA 1OP5H 2B20A 1D3CA 3BSGA 2J71A 4WI3A 4N22A 3ENEA 4DGYH 3OGCA 2DQGL 1FI8C 4MJ4A 4J5VA 2AJUL 4HFWA 3IAQA 2JK5B 2IANE 3EO9L 3CTTA 1NJ9A 4O9HH 1KBKA 3S7GA 5JDJA 2X1OA 3AY2A 4Y1AE 1ACXA 1HYRC 3CGTA 4H1LA 3LKSA 3HUJF 4HIJB 3E8VA 4D8OA 4NCC2 2X70A 2B2XH 2Y2YA 4X83A 2F53B 4XO5A 3JZYA 3MTRA 3P3RA 1QTPA 3IFNL 4PSPA 1SXZA 5DJYB 1OP3K 1A6WH 2ZUVA 3I6LE 3MCKA 4OU3A 3CZKA 5E95B 4PLOB 1UKSA 1GGCL 1VADB 2CRYA 4U1IA 3RWDA 5I1CL 4CW1A 1U21A 4FNLL 4R84A 4ZFOL 4WV1A 5KYNA 4K94L 5FX3A 5B3SB 3CZJA 3HG1E 1I9RL 4ZX4A 1KPVA 5EOQL 1JVLA 1AGDB 2DH2A 2Q2EB 4I7ZC 3UC0H 4YSSA 4N1HB 1NFDF 1YYMH 4JNXA 3QIUD 2BNRA 4NM8L 3WCYA 1U3ZA 1XH0A 4YHNA 3X2QB 5E7FA 2NDFA 3EJTA 4FTDA 3SKUD 1LEIB 4FTVA 4X6BA 1ZLVK 2W9DH 2YSSB 1RZ7H 1DBJL 3N9GH 2UX6A 4XMXA 4Z7NE 5J1SC 1CPUA 3MRPB 4HD9A 3KPQA 1AKPA 3DTXB 3FCGA 3OVUB 3WBDA 3FUIA 2CXGA 1SQMA 5E6IA 2CLRB 4U49A 5F7DA 4YS4A 4DFHA 1NCWL 3DGGA 4V1DD 1V7NH 2RHEA 5BV7C 5AVQB 1ZHBB 5EIIG 1HL9A 4TVPE 1Q94A 1U6AL 5IBLC 3P11L 5K9QG 3CH8A 2DLFH 4HH9A 4M1DL 4JLRA 3G5YB 3NJXA 3KGSA 4MRCA 4PGBA 3ZR5A 5I2IB 4Z8FL 1XF1A 4PTUA 5DZNA 3TCLB 2CUHA 4LHJB 3K4ZA 5EIQA 5E8NA 2OR9H 2ZSWB 4J3UA 2R2BB 2X4PB 2GHZA 3HVNA 2C4FT 1UJTA 3T71A 3W0WD 5JYMA 1K3IA 2R2HA 4PRHA 4IKIA 4KOCA 2PTTB 2OXGB 1I3VA 4A2HA 4MA8H 1W72B 5AVZB 2WXMA 1JPTL 2CG9X 1MCOH 2P46B 4KTDL 4R0LC 3MLSL 2ALAA 2VRKA 1BFSA 2NZ9D 2WSDA 3C12A 1QFWM 4WI8A 2APBA 3LN4B 4AQ1A 5C0EB 4M02A 4A38A 2AJYH 5IIEA 1V8HA 3RUGE 4NSKB 3BX7C 3RX9A 4BFIB 1RIUH 4GIPD 4G72B 3WKNA 2V5SA 5J3HC 3FFCD 1OAXH 5F93C 4Z7OF 5IFJB 4D3CL 4NBYB 2CLRA 3T2LA 1TJXA 4Q2ZB 5I8OL 2AJXL 4A63A 2WO2B 4DP1X 1GOGA 1NCNA 3KPNB 3ESOA 2X6AA 2ADGB 5ICXB 5AD0B 4YO0A 4J3BA 4J8QA 4WEBL 5GRJH 1H3TA 4L29A 1YMMD 3SDAA 4X7TB 1MREL 5JXEC 5DJ6A 2NNFA 3CN1A 5JW3H 1KTLA 5DC0A 1XVSA 2HT4D 1CDJA 2IADB 4LL4A 4KAQH 2BY1A 3S88L 4OI9A 2A0LD 4ICXA 5K1JA 1EO5A 1MFBL 5HJBA 3DETC 4NNPL 1NLBH 4N2GA 3ARGC 4M1CC 3NRFA 4QHUA 5A7EA 2YBRA 3QZLA 4HAGA 4MNQD 4QXWA 3FQWA 12E8L 1JPFA 2L8AA 3SE4C 4W9IC 4UYQA 5MP6H 3VD5A 4G6FB 1RIHH 2CA3A 3MMEB 3HE7C 4TUOB 5CJQL 2E4TA 5HPOA 2DMHA 5IEKA 1OZTG 2QFPA 1HI6A 1HIMH 6FABL 3IFLH 3SCMC 2PKDA 5HYIA 6CGTA 5ILTH 1OAXL 3WSQL 4YMPA 2KZWA 2MCAA 3WHE1 4XZUB 3IJHB 4LLMB 3VI3B 4GG6A 1Y1UA 3FL7A 2NX5D 3MKKA 4MKTA 4AYID 1ACYH 3JTTB 2DWEB 1NBQA 5DS2A 4P2QD 1TVHA 1XXFC 3EJQA 3S3PA 2GC7C 1DQDL 1T5XA 1Z9OA 2CO3A 5DD5H 1INDL 3MRNB 3IYLW 5T5FH 4FFVC 4KBPA 4F3FA 5IF0A 1DTUA 5FGCB 2XFXB 4Z7NB 4JZJC 5A6IA 3BZ4A 4NGHL 2ZAGA 5CZXC 2AEPH 4JM2F 2HT4C 4H8HA 5HY9B 1XX9C 3BSZH 3MLYL 2MPVA 1MG2C 2QELA 3KWUA 3TASA 5HPMB 2W9EL 5C0DB 4R2GD 1U0QA 2VZ1A 1DBML 3LMJH 1NDGB 1LDSA 3QI9D 4OJYA 3ARFD 2YA1A 2J2ZA 5AALA 1KBWA 4QI3A 1JTTA 1MFAH 3M1CA 4HWBL 1EUTA 2FH8A 1N59A 1E6OH 3VWKC 2NZ9C 3RL1A 2JKNA 4OD2A 2C7UA 3DVGB 3W82A 2Y3NA 3CQQA 4KDTA 1JGEA 1EEQA 2G3ZA 5DWPA 1CJYA 1NC2B 1VGEH 4HDIB 2VIRB 4UIMB 2A83B 4DCQB 4Z23A 4NQEB 3UXFA 4K94C 3BD4A 5F9WB 3CK0H 4AYMC 1KGCD 5H94B 2BOLA 4A2MA 5IFAL 2VDRH 1OP3H 1BIIB 5LJYH 4I3SH 5T5FL 3O4LB 1FE8L 3CZGA 3JWDH 4MQ7A 4AQ1B 5C0EA 5J11C 5KVEH 2RIKA 1ZS8B 1AACA 4JFZL 3ECBB 1QSEE 4LK4A 1SEBA 1J0YA 4QEGA 1T2QH 3B9KB 5BW7A 2D31B 2EO7A 2ICWB 4HMCA 3SBQA 1NMCC 4KGJA 3KYKL 2EDBA 5D93C 4PG2A 4H20H 4CBZA 2CMRH 4KU1A 4Z0XB 2HJFA 2ZP9A 1TNMA 1NANI 3BWUF 3NSFA 4YDIL 3NT0A 3EYQD 2WYHA 2FNBA 3BWZA 3V4PH 2IALA 2LQRA 5DJDA 2FX9L 1HWGB 4Z7QF 5DHXB 3NRQA 3E80A 2WO3B 3CQFA 2VMDA 3IXAB 1E5ZA 1JN6A 5ANMB 1ZE3H 5IZ7A 1KEGL 5F9OL 3WLWC 4H0HB 4JM2B 2JMRA 4C4BA 3LZFL 4HCIA 5E2VH 2IQ9L 3FTYA 4OCYH 1DQMH 4GKNA 2GSGB 2JB5H 3CN3A 1AZNA 2LTQB 5I8KL 3U2IA 3WTXA 4KNUA 1VB9A 2GIXA 1MCLA 3GB7B 4F7MA 1FJ1A 4HXBL 1UFGA 1W0WB 2VTFA 2WZPD 5CJBA 5B3NA 3VFWA 4J6RH 4AL8C 3UFIA 4PS8A 1T6WA 1YY8B 2H2PC 1FNHA 1MY7A 4YDKL 5D1XE 3W81A 1JWUA 1ND0B 2B7DT 1YJDH 3BHBB 3HS0A 4PYHA 4J8RA 3US1A 3HB3D 3X14B 1QRNE 4D0BA 3DI3B 1UA3A 4BZ2H 5DD6B 5L9DH 4GW4A 2HSIA 4TTDD 4WUKH 4M4RB 1CDHA 3OKKB 3ZDXF 1B4RA 1C12A 5EO9A 1J9CT 5C0BD 1G6VK 1E4XH 1JTPA 3H3PH 4EN3C 1GC1H 3RPKA 4LCUA 3W5MA 1FH5H 3CG8A 3IGLA 1M7DA 1NMBL 3SDCC 3EYUH 4O51B 2WOBA 4MNQB 5CZVL 5AW0B 3HC4H 1M42A 4F37F 1OGSA 3QH3B 4LMQE 3FBQA 4MAYD 3V79C 1VEMA 3PWNA 2OULB 4ALAH 5EBLA 1DQQB 1YEDA 4LCIL 5CR8A 1CC3A 3RGVB 5C0AE 1KPRB 2WXHA 3AFLA 4K5LA 4UQIM 3QWNA 4Z7WA 3MBEA 4FFWD 1FUNA 4OQTH 4L4TE 3IM1A 4ZAKB 4E9YA 1I7RA 4LESA 1D9KC 1KJ2H 2XT1B 3HHRB 1OAQH 4FQLL 5D9SB 4JHAL 3ABGA 5D7IF 3X14A 4ZNCD 4GW5B 4A7GF 4K4KA 5F0LB 3APDA 1IGCH 5EU3B 5E2TL 3VWJC 3QDJD 2QGDA 1CS6A 4PJAE 4ANWA 1FNEA 3KEHA 5T3ZH 4L1BA 4LVNB 4EF3A 2D8KA 1CFNA 4ORZC 1U8IA 2Y7OA 4PRHD 3MACL 3PAZA 4I2XE 4R6UA 4YSEA 1OM9A 1BXUA 3BUQA 2DQIH 2P5WE 4GKNB 2F08A 4PJGA 2HJKB 4DN4H 2QGEA 5LGYA 4R96B 2E75C 4PTTA 4UZGA 2FGWL 1VZIA 1AAJA 1PEWA 3LKRA 3O9WA 3NA9L 4FFWC 5IQ9A 5AAMA 3QQ3B 4DUXA 1YEIH 1ZHNB 1KENL 4N8UA 3VGGA 4ANVA 1HYSD 2OSLA 1F3DH 2Z31B 3C60D 3EW3B 3V0VB 3VAEA 2OI9C 3OZ9H 4K7FB 2PPEA 3IPEA 4ZFZA 5H4YA 5EA0H 1MCWM 4GQ9L 3V6BR 2QQNH 3QI9B 3BSZA 4MXVF 3UX9B 4AIZA 1C5DA 4KZEH 3UAFA 3TT1H 5KYYA 4O9HL 4RRPG 3K2MC 2K0RA 1O7SA 1MDAA 2IAAC 5FGRA 5IMKB 1N9PA 5AZEL 4MZIA 3T0BA 4ODXB 5FECB 2YKKA 1NCOA 2LHAA 3T6VA 4FMKA 2EIZB 1HILA 1I8LA 3CWGA 3IVKA 1DANU 3I75A 4AEIL 3UC0A 3L3DA 3VFWB 3KHOA 4LPCA 2RA1A 2X6BA 1J8HE 1OAUL 4M8UA 2Y06L 3GS4A 1PD6A 5FLUA 2C9XA 2OW6A 3M86A 3NA4A 4XNQA 3U7WH 4ZUTA 4ZS7L 4BBWA 3GMMB 3V0AC 1N4XL 1NINA 2OZ4L 3DJSA 2GITB 4WGVB 3OJVC 5C0IA 2KPWA 2W0LA 4EZJA 3N44F 3NP4A 3OJDA 4P46C 1IM3A 1CXKA 2QKIC 3PGDA 4RNRB 1FO0L 2I26N 1RJLB 4HG4K 2ZF9A 3TBYA 3PL6C 3WUZA 5D72L 5AYTA 1IKFH 2ZOLB 2IMNA 5DHDA 4IS6B 3PS6A 4PV8A 2WW8A 5D9SA 2CLZA 1FFRA 4DF9A 3FAWA 3MROB 4W9GC 4PG2C 1F8TH 2AK4E 2XWBA 1KJ2L 1H8NA 5F21B 1O7DE 4B9GA 2WAQA 5LN8A 2WKOF 5EORH 4BDVA 1E8WA 5J8OA 4LVOC 3RAJH 2FSEB 4OIIH 5CNHA 4A6YA 3QFJB 2VDLL 4Q9BA 3CC5A 3PUUA 3GSVB 1BAGA 5FO8A 3EFDL 4P2RA 2K6ZA 4NKOB 3K6IA 4NWTL 3L3HB 1ONQB 1UZGA 5INDA 4A66A 1XGZA 3D08A 1ZOXA 3U9UA 3PJSA 4Z7QE 5CEZD 3P0VH 2BP0A 2ZXQA 3FB8A 5SV3A 4H5SB 3CN2A 2AXGA 4B53A 4XVTH 4QXTA 2PXYA 4QRFA 4MMXA 5ANME 1S7SA 1KB5H 3T6WA 3MNVA 4NP4H 4NZJA 5FOBA 5GS2D 5HI4C 2FLMA 3CDZA 5GIRA 4E5XB 5L6YL 4PJEF 3DTDA 5AZUA 1T1ZA 3JV0A 3G5YA 4GG8A 2WQRA 5BZZA 1L7TH 1MCWW 5GS0D 2B3IA 5T1DH 5BV7L 5JZ7D 2QJDA 3N42B 2X42A 1G9MC 3VFPB 4JPVL 5BVJB 4PUBH 2R1XA 5A2BA 1LLAA 3Q2WA 3QWOB 2YPLE 3LXUX 4UM8B 2ZOOA 1P4BH 5IESH 5I26A 4Y9BA 5DFWH 1FP5A 2GB2A 5F9OH 3V5HB 1T89C 3V8OA 3WIHL 4DEPC 4ZG1A 1ZVHA 3HG1B 2HB0A 3S9DB 2CE6A 3MNWA 3ZIMA 3A0OA 5LGHL 2IMMA 4X6FB 2DQJL 2AJ3B 2O72A 4PW3A 1GJIA 3VGHA 3BWAA 1YNLH 4Z7VA 5ICXA 2MWCA 3MLTB 1I9RH 2A1WL 1AZRA 2ZOTA 4PJ7F 3WFEH 1UXSA 2IDTA 1IGFL 4BXVA 5FDWA 1TETL 5DD1L 5IMOA 3HMXA 3FO0L 4LDCA 2R0ZH 1A4CA 4WLCA 5HGGS 3TNMA 4BSWB 1N0LA 1OVZA 4P9HL 4LAJH 4NQVA 2R0LL 2DH3A 3LRLA 3FU0A 1MWAB 2CH8A 2UWEE 3U36B 3BRGC 3CZLA 1JNHA 3BKJL 4FI7A 1H3WM 3SDXA 5EZLB 3QDMB 1OCWH 3QISA 4P3WA 4EKXA 4KK9D 4POUB 4CMHB 4AZUA 5F7NC 3ZE0F 3C6SB 4ZDHB 3VTAA 1BFOB 3HI5L 2YD9A 2FO1A 1WT5A 3RVTD 5CM1A 4QRTA 4MSWA 4BDVB 1EK3A 4FF9A 4JUTA 1MCEA 3MUGA 2WXJA 1D2PA 5DD5L 1DFBH 1V3JA 4HOMA 3OV6A 5A3ID 1EFQA 4BQ6A 4GBXB 4PRNA 1QI3A 3FTGA 3HNVH 2EDWA 5DEJA 3CFJA 4KY1H 2UWEF 1UB6B 2ZOLA 2BLFA 4LSUH 4YSQA 5J57B 4NFCA 4YGVB 3UTTB 1FLRL 3ATEA 2YKLL 1AQKH 2CO1A 3EF4A 4GMSL 3G6JB 3WS6C 4TNVF 3GIZH 5LCVH 3F5WA 2JJTA 4GAAA 3S4SB 4UANA 4C8XA 3P73B 5IVOA 2EDEA 4C57C 2EDXA 1GZQA 3S36L 2J6EL 3TJHD 3MV7D 4PWIA 4D9QE 1NCIA 1Q72H 5DWUL 4KTEL 2ZCLL 3VD1A 3QP3A 3EFFA 1FYTB 3ESVF 1FAIL 3OMAB 1WA1X 2EJ1A 1TYRA 3HI6L 4N2HA 1QPPA 2EDYA 3MLSH 2GSIA 3UO8B 5K9JH 1G6RL 3PHOA 1FFPB 1JF1B 1QO3A 3SJVE 1J18A 2A4EA 4F7PA 4MA8L 4NDMA 5E4IA 5JOPE 1LVEA 4LKXB 3QFJE 4IRJB 2XYBA 4BA8A 2BIOA 5CUSL 2KH2B 1SFDA 4GUOA 3ARDB 4RX4D 1HH9B 5E9DA 4CVWA 3GO1H 3JSSA 3IJ7A 3FU7A 1FV1B 3RPIB 3CE1A 3CUPB 4N2FA 5I0VA 4HPHA 2QV4A 3LQAL 5MEOA 1N6QH 3KXFA 2C7UB 2UY7B 2DQUH 2QADB 4M5ZL 3UPCA 3MDJA 1KGJA 5CBEA 1RVFL 1L7IH 3V5KB 2F7IA 2GTZB 1NCAH 2IO5A 3T0XA 2ZG3A 4ZUWB 5LXGH 1RK1B 1BQRA 2QLYA 3G9AB 4UB0L 4F2MA 4OD2B 1JF5A 3ARBD 2QSCH 4DP6X 2PPDA 3QHZH 2D9QB 4XMLL 4ZRGA 5KYXA 4N5EC 1BJ1H 1AHWA 2XYCA 1WICA 1YEJL 3KR3H 3K8LA 1BM3L 2N1TE 4K5NA 5IHHA 4Y4KB 1XCTA 3DX8A 3VG0H 2I27N 5DF0A 1I1AD 3HPLA 4GEJA 3D39D 5ENWA 4XVJH 1T83A 3QA3A 4NXKA 2CU9A 4Y7OC 2AFNA 1NGZA 1J5IA 4D8PB 1KN2H 4MCZA 1IEHA 4BUHA 2HH0L 3FU7B 3LV3A 5E4EC 4ZXBB 4HUCA 4MNGE 4PHXA 3AREB 2Q8AH 4XN4A 3ZYJA 3DECA 5IB4B 4A7QA 3BVVA 5DSCA 4ANXA 3FT0A 3BOVA 1E6OL 5FYLD 3GB7A 1F4YL 4J2XA 2X9ZA 2E6QA 2K3HA 2WINA 1OAZL 3CMOH 2OW7A 3EJJX 2HVJA 5J7CC 1V7NL 1JRHI 2IPUK 4KKNA 1XGPB 1IM3D 4ZFFB 3DPBB 3MLYH 4YPJA 3VMNA 3LKQB 2D7QA 3HLAB 4M1GH 1A22B 4IRJA 4O2EB 2VLRD 4E0RB 1JXKA 4MA1B 3P73A 4FTVE 4K3DH 1KGCE 5E0FA 4PWJA 4TL4A 3NVQA 2YMOA 3LRKA 4PVMA 4ZW3A 3D2UA 3LH8A 3QC5X 1DJXA 2X4TA 2VM9A 3SQOH 1U3YA 1KN2L 3FCBA 2R29L 2A74A 5BRPA 1HHKA 4H88H 1K8IA 1TVDA 4PJDA 2NR6A 4Y4FA 3UYPB 2FZ3B 2Q7AA 1HXMA 4FQIH 2DQTL 1WA0X 4Q2ZA 4XNAA 2LU5A 1MPAH 1WEJH 3VCLB 2XN2A 3B9KD 2JXMA 2X7LB 4PV9A 4GPVA 3TO4C 4YN3A 4LCWB 1X6LA 1RK7A 4Y4KD 1BD2B 3ILQC 3EXLA 4JRWA 5FCSH 1NBVL 1P1ZA 3NN8B 4OFYD 1FZMB 3QXAB 4J3OC 4PJ9B 5C07A 2B5IB 3MV8A 4HUUB 4OCYL 4WK4B 2BNUB 3GK8H 4HIPA 1U92A 2AJUH 4POZC 2XX0A 4Y5XA 2H1PH 3DGDA 5DJZA 3UAEA 2MNJB 4TPRL 4AIXA 1H15A 2DL9A 3LQZB 1CGWA 4X6CF 4AK1A 4JJHA 4B95C 5KVGE 1N64H 1DQTA 2CK0H 4ERSL 2DICA 3DHJA 1GGUA 4U1JB 3G6DH 2FYYB 5IVXE 3HE6C 2DY2A 4MB1A 1AS6A 2NUTB 3CX2A 4DPRA 1YAZA 2CBMA 4XWGH 4OZ4B 3RJDA 1X4ZA 2AC0A 1A7QH 3TL5A 2HLEB 5ADPH 3L4TA 2CGZA 3MRGB 1RZFH 2XNAA 4B9JA 5D1QE 3ZLQC 2Z92B 4AMKH 4WKXA 1XZ0A 3RWIB 2V5RA 4B5EA 3SODB 1YNKH 4DHLA 4IMLA 1MAML 3O6KL 5FW7A 3ZKQD 5E4OA 1KN4H 4J3VA 5AKRA 4RMTA 4KITB 4XPGL 1TQBC 3QZPA 5CILL 2FL5A 4ODWB 2XRAH 5DRWB 3G5WA 4FL4C 1UM5H 1FL3B 3FO2A 4Q0XH 4WO4A 3F7QA 1MF2H 4IYKA 1R5VB 3UO1H 2B59A 4NRZA 1S3KH 4YXKL 3AREA 4HSQA 2IAMB 2IXQA 1GY2A 4HW6A 3A6CL 4R7LA 3QFDA 4IU3B 4GMSH 1B4JH 1HHHB 2CBPA 2G0KA 2IH3A 3IFOB 5D7EA 2FWUA 1UB5B 1DEEB 4YAQA 2I9TB 3L3DB 5AEAA 3TEYA 3THML 3AU0A 4ADJA 3ZDYE 3BVTA 3CDCA 3UGXA 2DYRB 1E42A 2BH0A 2CKBA 1G0DA 2YR3A 1NQBA 3HG0A 2IIJA 2C34A 2OL3A 1GW0A 5T3ZL 4U6VL 5IQ7L 1U8KB 3LDBC 3IDGB 3VD2A 1H19A 1QBBA 1A7NL 2R2EA 1JZ3A 3IGUA 3QCTL 1WIPA 1UD6A 4C4UA 1LWJA 5L7XL 3FH5A 3NIGF 4LDEB 4M48L 2MCMA 5TE4H 3TBYB 5E4EB 4NBXB 4YK4C 4G70B 2D31A 2ICWA 5LWYH 2FB4L 1FVDB 5IB2A 5MEQB 4JFOA 1DUYB 2PYEA 4BINA 1D5IH 1LO5A 2VN4A 3JWNG 4F8QA 2A77H 4YC2B 5GRYA 3PWPE 1XQ4A 1V5JA 3MRFA 4MD4A 4TSBL 4OZHF 3T8MA 4PBXA 3MV7A 3O3DB 5DO2C 3TPKA 2H26B 4N2NA 3GJFB 4NJ9L 3N55A 3DOHA 3VU2A 5A2JH 3QJQB 4TLUA 3PJLA 2UUDH 3RFRA 1HL5A 4XBEH 2Y36L 1B9KA 1RJLA 3L3IB 4TQ8A 2OL3H 4OD1H 2W07A 3EFOA 5MI0B 4DAGL 2Z93A 3KPMA 4KHXL 3BPCB 3ETBJ 1XD1A 4I87A 2WQXA 4V2BA 4W93A 4OLXL 5HHPA 2JCCF 4OCSL 3JTBA 1Q90A 4QAWA 1VRSA 4QTIL 4IGBB 3OGOE 2CO7B 4PM1A 4PJAB 4D0CA 4JS7A 1KIUA 4YXHH 5T1LA 3ZW3A 4ZOAA 4AM0Q 3VRIA 2PTUA 4Y0GA 5C0CD 4N1EA 3C08L 3C6LB 3MLZL 4Z7WE 1VKXA 1AMYA 5IMLB 4BA0A 5JW4R 4FNQA 4Y5YB 4ZQKA 3D2TA 3P4NB 1DZ0A 1XAUA 4LEXL 4E41B 1E7VA 1N8OE 1F11B 2Y69B 1W2KT 3V52L 2ICES 4NAQA 1ZT1B 5KSBA 3L1OL 2FJGA 4XNXL 3VFVA 4AKQA 2WLNA 3PE9A 4PWFA 2ADYA 2IEPA 4B7LA 1MCIA 4UT6L 3LXBA 3MNVB 4DW2H 3FU5A 1KFAL 2IGTA 3AROA 3NCXA 4XP5H 4F9PC 4NQVB 3WFDL 2O6PA 3VH8G 2YMXH 1PJ9A 1Z9PA 3QS3A 4JMNA 2HYMA 3ISWA 2GBVA 5HYSG 2CQVA 1MFVA 4P4KB 3BVNA 4HP5A 2A74C 3LVTA 4FADA 5FXCH 3JV4B 3Q2VA 4KRPB 3DRTA 3VFMA 1TVBB 3IRPX 3M1BA 3VM7A 2B5IC 4B41A 1QBML 2V17L 3RDTA 4ZMNA 1KIUB 3N85H 1BYPA 3N06B 1PNCA 4FNRA 1ETA1 3U82B 2EDOA 4U6XB 4AC2A 1ZHKB 1QVOB 1RLBA 3V4UH 1AQ8A 2BO0A 3K71A 1Y18A 2PYEB 1FA4A 2Z8WC 3NCYP 2B9AA 1Y7VA 3IJEA 4NQDE 3O3BB 3KWVA 1P1VA 1Q1PA 1HL8A 1J8HB 2VDRL 2BMKA 1HC1A 1AGBB 4R4FH 1RPUA 1NA8A 2P80A 4QY8B 1FNEB 1SVZA 4TOYH 2YD0A 4FNSA 1RZJL 3VXTB 4B3EA 3AUVA 4HSCX 5DR5L 1F41A 2WBJC 1MFCH 2DS4A 2D7NA 2WQSA 5C2BL 4DK6A 4ZTEA 2XETA 4QRTB 3RWCB 1HX0A 3ZDZE 3MV01 2JB6A 3QQ4A 2OZ4A 3G5ZA 4OGXH 4PJIE 1CE6A 1DR9A 1T89A 3RZCD 1PX4A 5D6CA 1FH2A 3ZKND 4ZUUA 4OQTL 5I1DA 1A6AB 2W9EH 5BUGA 4JL2A 1BAFH 3H0TA 3PFUA 3QDMA 2HKFH 2ADIB 2W80C 3B6SA 1K4CA 1KGYE 1NCUA 2WMPA 4OCNC 3FO9B 4XCYA 2LVEA 1AHKA 3KS0H 4OM1H 4QR7A 2EP6A 3MV11 4Z8FH 2D3JA 3DXAE 1E6JL 4YHYC 2PPCA 4QF1A 3ECQA 1A7RL 2R2BA 4NFBA 4XC1L 3N40F 5AOKA 5FGCE 4BKSC 2YA0A 3U7YH 2HVKB 4BQ8A 4IU2B 3AMKA 3B9KA 3C5SA 3F62A 3RVUC 5DRWA 1VFBB 4KXZH 3PWJB 3CD4A 3U4AA 4IEFB 4L9LA 3C5XA 4Q6IC 1AGBA 2CGRL 4PY8I 2TAAA 5LBSL 3HZVB 1ZV2A 4YHPA 2PABA 4E68A 1T1WA 5A1AA 1MNNA 4HHAB 3TIEA 1OCZB 4JR9H 5D8JL 3A6BL 3VGBA 1KN4L 2O30A 4I8DA 3U1PA 1EZLA 1RAMA 1QI5A 1E9OA 2PW1A 3F04A 4RFOH 1X9QA 5C92A 1TIUA 2PWHA 3QARA 5J12C 4BE6A 2J5LC 1MCFA 1JZGA 1SQ2N 1JF6A 1ZHKA 4LLDB 4MMZB 3HKFA 4WTWA 3TA4D 3ARTA 1Z3RA 1YRKA 7TAAA 3B9KC 1XGTB 2XZCL 1A14L 1CL7I 3LCYA 2NW2B 4G43A 3IPFA 1XR9B 1ZLEA 4TVSa 4FGMA 1OGPA 3OPZL 2XA8L 1HZHH 2V7HA 1DQML 2FDBP 3GNML 1A8JH 4F7TB 3ZZLA 5JLZA 4U1KB 4FCAA 4WHTB 2YAPA 4Z7OB 4FJ6A 1RULL 1FL5B 1Z9MA 3KLLA 3L5IA 5F1IB 3KPQB 1Y6MR 3QDME 2Q0ZX 1FN4B 1NAKL 2JJTC 3PABA 2X89D 4FQJH 5AQ0A 3RGVD 5DHYA 4E9QA 4KVNH 2V9UA 5IHUL 5D8JH 3KHQA 5JW4M 5A16A 1S46A 4QRBA 3L16A 2IF7A 3Q6GL 4HJSA 2KDGA 3P4MB 1WIOA 2B15A 5IQOA 2WKOA 5T1JA 1OSZB 4D8PA 1PTZA 1MHHB 3D25B 1XSOA 4L8DB 5C9JA 5HHXL 4OBSA 4FDWA 1H8LA 1JHTB 4KFMA 1A4BA 2DQEL 4FERA 4WI0A 5JQIB 3QUML 4AZ8A 4TVPD 1F97A 4PW4A 3HPJA 4P06A 3HPLB 1M1XA 1RUMH 3RIAF 2H0FA 1BMWA 4WFGE 1KMGA 4D0CB 2YBRB 3FB6B 2DEWX 3ZE0E 2W81C 1T5XB 5ISZE 5I1LB 4H8PA 1A1MB 3QA3B 5C08A 3V2AR 5JW5A 2BSTB 5C6TH 3HUJE 1NKRA 2EXTA 3NAAL 5K59E 3CLEL 5C86A 3NBNA 1R9FA 3GLZA 4P0DA 3V52H 3WD5H 1I9JH 1M9SA 4U6YA 4X2UA 3A67L 1LK2A 2BERA 3LYRA 4DTGL 1L7TL 3ROOA 2FWSA 2OMZB 3SBWA 1G9NL 3B2UD 3SCMB 4TNGA 4AVIA 1KZYA 4XTRC 2DIAA 3D18A 5IOPB 1DJIA 4K8RD 1TEGA 2DZEA 4FCHA 4L2YA 3MGOB 4JFSA 1IAKA 4KQ4H 4UOJA 1IX2A 3MR9B 4K07A 1IM9A 3HLKA 4GXVL 4GB9A 2DYPB 4B7IA 2X53A 1AGCB 3QORA 4H8UA 4LSQH 4HJTA 5KBKA 4ZI8A 1E8XA 1FFOA 2G2PA 2ADJB 1TQCC 5C0JA 1BWWA 3G7TA 4JREB 1JPFB 3DX1A 2WZAA 1N6UA 1XBDA 4PJ7A 1J9RA 3ZRCC 3QQ3A 2FT7A 3MMEA 1FFQA 3WKYA 2BW5A 4NQDD 5DEGB 5I6LA 5MENB 4EI5B 2GT9B 3H4HA 4J4PC 5FM5M 4APQB 1QZ1A 1FNAA 2D4DA 3IJ8A 2WVVA 5DFVC 4B3VA 1NDMA 1Q4NX 3FMGL 1D5BA 5D71L 1JHLL 2PO6A 1B0IA 1OCRB 1TSHA 2J56A 2BVQB 2A73A 4TUOA 4RDQG 2BDNL 2XCMC 1E0OB 3BYTA 1CICB 3Q8AA 1P6AB 4Z78A 1X5YA 3B8SA 3NN8A 2BIIA 1U8PA 4PFEA 1INEL 1ASPA 4JN1L 3RILA 2HT2D 3SE8H 4NQEA 1EANA 4XOCA 3UGUA 1BOYA 4KKAD 4BH7A 2AGJL 3ES6A 4PJ9A 3MLVL 1CK0L 2VRAA 1XL4A 2RGSA 5F1NA 4PRBA 2KYIA 2HT2C 3EH2A 3RAJL 4AKPA 5K9QI 4M7ZB 5BVPL 1KB3A 4FP8H 2JXMB 1KTDB 4U3XA 4BEIA 1CDUA 3B3BA 3ARFB 3PGCA 4BK5A 1NWOA 1XZ0B 3RWIA 4B50A 3BT0A 4NQCB 2HLAA 3FF8A 3ZDZB 4Z7OE 3NJKA 5FM8A 2EC9T 4TF4A 1E67A 2NY0D 3O0RL 5JW4Q 3IXTA 2C5DC 1BD2E 2X4UA 4TM9A 1XF2B 1J48A 2X44D 2R0KH 4WW2C 1MFNA 3FO9A 4HS8L 4ABUA 3PQYB 5BPPA 1DQDH 3DSFL 1K4DB 2VKXA 5AAWC 5DD3H 1X5GA 1CDYA 3WIFB 5G5DB 5CSGA 2Z35A 1YEFH 4D9QD 2FHCA 2ZPKH 5A2IH 4A04A 2FEEL 3KLAB 5DWUH 3DBXA 5H94A 2ICEC 4YSTA 2H41A 3S5ZA 1MWAH 4EDXA 2N7BA 1VESA 2EDFA 4H88L 4PJHA 3TCTA 1ZPLA 2JNZA 4WTZA 2EIKB 5SX4I 3ZE1B 1ZLVH 4E9LA 4L3ED 4UV4H 2D4FA 5LNGA 1TJIH 1ZTXE 4GAYA 3NZ8B 4LHUG 5MP6L 2ZP0T 2QMKA 5ETUA 5ADOH 3TZVB 5D2LB 2UXFA 1HHGA 4G3YH 2MNUA 1FJ1B 2IPUG 4GI9A 2BRQA 3LKNA 2ENYA 2YWZA 3QE5A 4I18A 1QD0A 3ESMA 1Q0YL 4JAMA 4M93B 4ZUVB 2X1PA 2WJ5A 3IGFA 3P3UA 1XGYH 3IXTB 3QGVA 4P4KD 3DV6B 3FHEA 5SX5K 3V4LA 1CXLA 4WJ5B 4I3RL 5I6NA 3IJYA 1A3LL 3C09C 2FHFA 2E7DA 2YMTA 5EV7A 3MNWB 3HB3B 4PJXF 3P9MA 5F88B 4YDLB 1CXEA 3QDMD 2ZXDA 3VFUB 3KJ4B 2I69A 4Z78B 3B5GA 4WCYL 1AANA 4G6MH 3GSNH 1U33A 3K0WA 3F65A 3K5SA 1JXJA 3AWEA 3AT8A 1PQZA 4K55A 2XV3A 4FEMA 4G6KL 4K3JL 1I9IH 1FO0A 3Q8FA 5F0JB 1IMHC 3L3GA 4U4IA 3P9WB 2X3AA 4FQPA 5B39G 1PZCA 1NIFA 2DQHH 4X42A 4XAWH 2WQUA 5A16B 1MKFA 1I1FB 1NCAL 3I02B 1MCRA 4NYLA 3NCWA 1SFHA 1SOKA 3NFPA 5ADPL 2GTQA 3MNZB 3QDHA 2XA8H 5GGVL 2O6DA 4KV5E 4ZFOB 3DVFA 3O2DH 1NJ9B 2XSKA 4GAGH 3BP6B 4PJDF 3DKHA 4D7BA 2WV3A 4PGEB 3ML8A 5B1KA 3GSQB 1NEZG 1IE5A 4Y5YA 4M6ML 4ZQKB 5JXAL 4PS7A 2APWA 2XZQH 3BWAB 2DBLL 5IVXB 3P2BA 1CZ8H 4JPWL 4QRSA 3NJFA 2IC2A 5LLIC 3CPLA 2AK1H 1SXSA 5I1LA 1A7NH 5T1LB 1XIWC 2EYTA 1DVFC 5ENWB 2VMCA 1S3RA 3MJ8B 2YAEA 3SKJL 2N4IA 2GUYA 1S9YB 3B2VH 3FCSA 5DJ2B 2NY5L 4ZMXA 3QUYB 1BBJB 3KYMB 4NC2B 4XNMB 3L9RB 4Y4FC 1NUNB 1D6VL 2QVTA 5JO5B 5CXPA 4BZ1A 5CLYA 2Q8AL 3SKOB 2ED7A 3MREA 3OSVA 3PG2A 5AB1A 3S4SG 2GQHA 3BIAX 4ZUTB 3UERA 4DOHB 4S0HA 2AVGA 4HWUA 3AQDA 3H3BC 3ZXAC 4KO9A 3UTTA 2P8MB 3L13A 4P5KB 3P4OA 3TWYA 2GK0A 3WNMA 4K5OA 3S4SA 3BEVB 4LQ1A 1WUNT 3CHRA 3IJYB 3SYPA 1KOAA 4FOMA 5D7JB 5JHDA 3CSFA 1F2XK 1U8MB 3VSUA 4F7EA 3LHAA 2H6UA 3CFJB 5TF1L 3CAFA 5ABAA 1CD9B 2ROXA 5DJAA 3VXSA 5I30L 2H3XC 2CHNA 4P48A 3OJMB 3GIZL 5FUZL 3BESR 2X2UA 3HCVA 5EOTA 3A22A 3TWCL 4P46A 4RFEB 4HIJA 4PSRA 5HYFA 5HDBE 5CBAB 2JI3A 1ORSA 3VUAA 1Q94B 3SDXE 4ES8A 1YEGL 2I85A 4P5SA 2YEQA 3ARGB 3QUHA 4ZFZB 4P23C 3FYEB 3UAJC 4JFXA 3UZQA 2FUTA 5IJVA 4U2ZA 1FNGB 2NNXA 3RURA 3B6SB 2C9AA 4HHGA 4NO0D 5GISL 3I2CH 3MZTA 4YE0A 3MRBA 4BJLA 2JJSC 5KBNC 2NQDA 4K2UL 1ZKAA 4YX2L 2VT0A 1WLHA 5HGBB 1HILB 3K5RA 4HGWA 3ULUC 1LEGA 1MAJA 3NCBB 4JCMA 4PCYA 1OCCB 3HAEH 1WFJA 4UU9B 5C0GA 4KI5E 4OIAA 4N2KA 5DUJA 2YFOA 4JHZA 3X1FA 4EEEA 4KK6C 3RWEA 1JZFA 2DIJA 5GHWL 4Y16C 1OPGH 4YHMH 4G11A 4XMLH 1PD0A 5JXAH 4YHPB 3U1QA 3QWOA 4F8NA 4KXBA 4NWUL 5ITBH 2FHBA 2K4AA 4KZEL 4P9HH 1JFQH 4HU2A 3O6ML 2H47C 3HG1A 4WWKD 2FAUA 5T3XH 1F6AA 1JSYA 3BVXA 4FFTA 5D7IE 5IMMA 4RMQA 1XWVA 3I3DA 3IJSA 1PFCA 3UJIH 3NJJA 2J1KA 1X7QA 3GBLA 2AABH 3IU3B 2A9NH 1YMME 2BNRD 3B8YA 2NCEA 5DC2A 1N2RB 1OTUC 2I7OA 2QPEB 3K74B 3II2A 3D4CA 3S5LA 2X2YA 3GMOA 3VMPA 4K3DL 1QNZH 3KR3L 2GTWA 2C3XA 2MHAA 1WBXA 1OAYH 3O6LL 4X9IA 2BVUA 3X13B 5I6XC 15C8H 1J1PL 4FNUA 4XVSL 2C3GA 4R3SB 1SRDA 1G6RA 2XPGA 4GNKB 1MLCA 4YDJA 4RSVA 5T3XE 4GQRA 1OLZA 4IMKA 3IGKA 2OMXB 1FCCA 2ZKMX 1MF2L 2H2SC 1WHPA 4RX4A 4NHCL 4P2RB 4DNLA 1QBLH 2DEXX 3B2PA 2G4GA 5JHLA 4ZT1A 2ZCHH 1A4KB 3BYYA 1TO4A 3DTUB 3NIFE 4JZJB 1LDPL 1WFIA 4WY7L 2FSEA 4G9FD 3H42L 3KXFD 5JR1H 4WI4A 1T4KA 3ASNB 2L3BA 2IQAB 1NFAA 2K70A 2IAND 3GMPB 3QR2A 4LSSH 4OZFH 1YEEL 1AOHA 32C2B 5SWZA 2W9LA 1H5BC 1DZBA 3CFBA 1C5CL 1RERA 1X5XA 5KBDA 2J20A 2MQ3A 1EHAA 3GRWL 4CC4A 2P8PB 3T8XA 2E7MA 2WCGA 3GXPA 4F9LC 3A4DA 3CFMA 3D2UB 5F7LB 2CPCA 1H6FA 2BS8A 3LB6C 1F4XL 2A74B 1ZANH 4HKXB 5FC9A 4IIZA 1P7QD 4W9CC 5KSAC 2QHLA 2WN2A 2DW5A 3V6OC 5EFIB 1HNFA 3EDFA 4PJAA 4F58L 4XWGL 2R83A 1T1ZB 4B9CA 2AXFA 1BFVL 1IC5H 1NOLA 3LKSB 4JQVC 4AE1A 2ESVA 1HEZA 1KLUB 1LO0H 1T21B 1XAKA 5IT2L 5CBAA 5MEQA 4HC1L 1BGXL 3IDXL 3KPRE 3ZX1A 4WI2A 5E8PA 1CVRA 3ARGA 5I28A 2BC4B 5IJVB 4KV5F 1SMOA 3GBEA 5AOJA 4XCNB 3SDAD 3U1SH 1JG9A 4YXHL 3TEXA 4OZFG 2H26A 4F8OA 3H9SA 1WITA 5CJQH 3MGAA 1DJYA 4L8DA 3QPQD 1SJXA 2HJFB 1DVXA 4P49A 3SPCA 3OKNA 4EUPB 1KT2A 4GS7C 1R24A 2QL1A 3K4AA 4U6TA 3KWTA 4OCMC 4IRZH 4LAQL 1AJ7L 4CUCA 3ESUF 3G5VA 5LG6A 4PJ5A 1QKZL 1OANA 2OTWB 1AQDB 2VR6A 5MEND 4H1LH 4BSVB 3POHA 4NRYA 5ITFB 4JDZB 2NY4D 3MRIA 1TT6A 1O9WA 1M9WA 3DO7B 4RESB 3QXDA 2A5UA 4JKKA 4B27A 5C0DA 3BXNA 3LH2L 2XBZA 4HK3N 1M57B 4U1SB 1BXXA 4WO4B 3DK0A 4PWGA 3TOPA 3X1GA 1Q38A 4BE5A 2EYSA 5HHVH 4WKZB 4KUCF 4JE4B 5L8LB 3BKJH 1WPCA 1DSWA 3O81A 3SDDB 1RUML 3GSWA 4NSKA 2IDFA 5T8IA 1BIHA 2ARJQ 3CX5K 1JYNA 2VISB 1Q9OB 2Y7QA 1U8OB 4GRWH 1AR1C 2OMWB 3FZUD 3JVGA 4WJKB 5DJAB 3FT3A 2JI1A 5EBMB 3QUKB 1RZQA 5HVGB 2YN3A 4DVBB 1DJHA 5LGKA 3ARDA 3KBPA 2X9YA 1URIA 2FL5B 3RA7L 1BECA 1SEBB 1YUHB 2V37A 1FV1A 3QAQA 4QGYA 3VXOA 4ATWA 5AW8B 1AXSB 2DQGH 1YUKB 1P84K 1FFOB 1ET7A 3HR6A 2CKNA 2CBQA 3ARBC 1XGUA 4LQFH 4ODVH 1PIFA 1MJ8L 5DUBB 2L7JA 2Y06H 2FD6H 3HJEA 4F7PB 1KYFA 2PWDA 2XBDA 4PD4J 3RGBA 2IAMA 2IXQB 4RRPM 2VDPB 1M71B 1YEWA 1L4IA 2FH6A 3PNRB 3ZDXB 1IGFH 4GEIA 4KMQA 4X4XA 2ZAIA 4ZMVA 2ZD0A 2D03L 3HN3A 4APXA 3NAAH 2CDEB 4LSQL 2ZICA 3OLIA 3H3PL 2BX5A 5SX4H 3UROR 1BX2B 4R4BB 2QQLL 3TBTA 4TTGA 3S5YA 5DHVA 3QXWA 5D70L 1XIWD 1KIPB 1D5XB 1W91A 3DXAD 4L29B 1K2DA 2AK4B 1DE4B 2BHYA 1U8CB 3HHSB 5D1XA 2HPTA 2F19L 1KEML 1KV7A 4JQVA 5D2NB 2XXGA 4W6YB 4M61A 1R3LB 3RU8L 5H37G 5LAPA 4WSJA 1KWGA 1WZ1L 3HS0B 1T0NB 4G8IA 5C0ND 5HGAB 4CKVX 4P8QA 4N0RA 2CGRH 1W8OA 2Q86A 5F6IC 1BREA 1DQLH 1W8EA 3BCDA 3N5AA 3ILPA 2X6MA 3TN0A 2DWEA 3STBA 5FOJA 4Z7QB 1EAPB 4Z3IA 1ASQA 4PJHB 4IJTA 3ZQXA 1JZHA 2BS9A 1S8DA 3GRBA 3KPRB 4JFTA 2P48B 1S5IL 1R3KA 4YSDA 5AW7B 3O6FC 4HEPG 2H6PB 4O51A 1F00I 5SWSA 2OXGA 5T1DL 1T7VA 5BV7H 2UY6B 3UTSD 3K3QA 1A47A 1A7QL 3P9LA 3PREA 3MV9D 4OLXH 1DDTA 5G5DA 3EXJA 3BGMA 3RVVD 2XXFA 4H8QA 1R47A 4MASA 1DLFH 2CKBL 4RIRA 3HLAA 3GXUB 3OQRA 4P2OA 2J6EH 4WW1A 3ZN6A 5TK4A 1DJZA 3SYAA 1RZJC 1XCQB 4GAJL 4K5PA 4WUUD 3VH8B 3ZQ9A 4X4YA 3C8HA 5FECA 3SPVA 2ICCA 4XX1E 3TX4A 5EO1A 3S36X 3NPSC 5GRXG 3DV6A 3GI8H 3D85D 3D4ZA 1MQKH 4RAVB 2EIMB 2WINB 1BXVA 3KCPA 3DX0A 1YQVL 3ILEA 1BZ9A 1RY7B 1WO2A 1YNLL 1T7WA 2KLTA 5H37H 3GDBA 1QW9A 2FZ3A 3WTSA 1PPIA 3DVGA 4JLRB 3FQNA 3MCLH 3W5NA 4NQCE 4KNTA 3E3QE 2AJXH 4JKPH 1M05B 3GHPA 1OTTD 1IAII 4QYOA 3BD3A 4WWKA 4PP1C 1QLEL 1IAIM 3U2HA 3WIHH 1BOGB 4U1LB 4AXWA 1JGUL 3TT1L 2MTAA 4PMFA 1WBZA 4NENA 1X5AA 3EOBA 2H3KA 4DGVL 3EOTH 2CDEA 4K73A 4UTBA 3AVEA 2XKSA 2R1YB 3ZMRA 4ODWA 5HVFB 3AS3A 3ALXA 1VENA 1U41A 3IJ9A 3CDZB 5GIRB 4E5XA 4FQXA 4PR5B 4J3TA 1BHGA 4L4TA 2FBJL 4GG8B 5BUAA 4PWKA 1I1FA 5SX5H 3VFTA 1FFNB 4HPOH 4IJ3C 1L0YA 3T4YA 2YD6A 4KZDL 1OSYA 5T1LD 4L2LA 4I0PA 1SDYA 1Z5YD 2GJJA 1K8IB 1X5FA 1ZDSA 4W4OC 5TQ0H 1RP8A 1QP1A 1FDLL 1SJHB 2Y23A 3R8QA 3ATDA 4ODBD 5D5MB 4G83A 2X10A 3GSQA 4MKMA 1OB1B 1RU9L 2X87A 1ETJA 4OFDA 3BEVA 1L6PA 5IVNA 5I1IL 2DYPA 2VITA 3AS1A 3MNDA 5AW9B 3MUZ1 3QCUL 3B4NA 2A6JA 2CIIA 1WAAE 4MA7H 2DL2A 3WELA 1JOIA 4QD2E 1CGSH 1FPTH 4S1RL 1R34A 3GXFA 4IDJL 4ELMF 4AENB 5J0BA 4PJ7B 1ULVA 1G7LA 4KK8D 1XB6A 4RLDA 2RH0A 3LZOA 2GBUA 4UT6A 4KNQA 2R23A 1RCYA 1GZHC 4QHUB 5IR1B 5JO5A 4CADA 3SBPA 4CVXA 1FIEA 4OGXL 2J6WA 3ROOB 5E5UB 3T0ED 5JW4N 2J8HA 5KSUA 4HMDA 5HPMA 4HCFA 3O41A 4XWOC 3FO1B 3ZE1E 3D18B 3EHBD 4L1LA 5IOPA 3QZWB 1LHZA 1X7SA 1ZEAH 3PY9A 1LWHA 3K6SA 3AWFA 3GSRB 4QCIB 5A3IC 5D7JD 2OZ4H 5L4FA 2OJZL 2R7EA 3TPUA 2EDQA 5KTEL 3ARZA 3PAYA 3QNZA 3ARYA 3EOYG 4KUCD 4H8WH 3BHBA 3FQUB 3ZKXC 1KC5H 5IV2B 3U4BH 5IBTH 4MAZA 1CGVA 4OM0H 4KTYA 3SGDI 4G8GA 3D30A 5I0WA 3MCG1 5J1AA 4LF3B 4N0UB 3RIKA 4G7VH 1X44A 1UZ6E 2LE9A 4G5ZL 4HWZB 4RWHA 3QPXH 5F7MC 1OP9A 4KMLB 3SYCA 4JFWA 3EJYC 5EO1B 1FL3A 1DANT 4ZFGL 4F20A 3V4PB 3QO0B 3MYJA 5CZVH 3QEQB 4J3OD 3U2GA 1M1SA 4PGDB 4AYFB 2ARWA 4QHKJ 4DVRL 4B0MM 1EJ6A 4PRNB 3S35X 4QRRB 3LZRA 2C3VA 1QI4A 3EGXA 3L5WA 4GOSA 4R8WH 3KYOB 2VR8A 4KZCA 5EWIH 3SE8L 4F7TA 3BH4A 4FC3E 3SBRA 4M5YH 1ASOA 3MRDA 4U6HB 4WHTA 4YBHA 3P0GB 1BOGA 3ES6B 3Q1EA 4ZW5A 5F71A 5TGBA 4ODHL 4DZ8B 1OE2A 1UT9A 2GAZB 1N0LB 1PZUB 3EJPA 3LKRB 5KYUB 5I8CB 1I3RA 3WJJA 2VC2H 2WYTA 3QNXA 3G6JA 2A6IA 2FQDA 1DVZA 1G7IB 1W80A 3EYSH 5E8DH 5F0MB 5L4IA 2WXOA 3C6LA 4G43B 4WWOA 1IB5A 4QRPA 4WFED 2AJVH 5EZLA 1EAJA 4YFDB 1MJUL 2EXWC 2VXVH 1GZQB 3E6HB 4L4TB 4I0CC 1OO2A 4KJWC 5ETUB 4H20L 4CN6A 2JTDA 4G5ZH 4KVCH 2Y6TE 3VYPA 1YC7A 1YECH 4E2OA 3L4UA 4OJEH 5DCCA 1XFPA 3THMH 4ZZFA 2A6KB 5HHQB 3KNBA 1OQXA 5DD0H 4HIHB 4F2ME 2Z9TA 3MV7B 2VXSH 4MQXC 4WUUE 5CEZL 5D1QC 3DBXB 1MW0A 3IDIA 4DUVA 2CHDA 3I6KA 4FZEL 2LLNA 4RFNB 3PPSA 1TZIA 2J1YA 4L5FH 5FIEA 1T5KA 4AEHH 3U36A 3B7YA 2A1WH 4NO5A 4XO4A 5L4JA 3NZHH 4GY4A 4HZLB 4B9IA 2R2HB 3FUMA 1KPUB 2GBAA 5LCVL 1NGWA 2HFFA 4GXUM 3AS0A 4M7KH 4YC2C 2OMZA 2P4AB 2H7WA 2J5LB 2Z0UA 5DC4B 4EKJA 4PJ7E 3CLEH 3EJYD 5ITBL 2JF1A 4KUZH 2VDMB 4YUEL 2WLLB 4RAVA 2YQ3A 4NKIH 5E8NB 1AOZA 4B0MB 4FQ1L 5LWYL 3MUGB 4MNGA 3EDDA 1D2OA 2BOBB 3T09A 3P40A 5BRZE 3QJFA 3BLPX 5E8OB 2A9AA 1QLRB 2ICEA 2EAEA 3FTVA 1CUOA 4FLQA 5IGXL 1QLFB 4X5WB 4X4MA 3NACL 2CDGB 3AG2B 4JFEA 5JHAA 2WXIA 2JKXA 4Y1AB 2AQRA 1UWXH 3BPLB 3IFNH 3FFDA 4U6VH 5DZVA 4Z76B 2EE2A 3ZHLA 5GGTA 2E9GA 1JWMB 3F6JA 5GQBA 1Z0NA 2ADFL 5J1AB 4JO8A 5DS8B 4JZOB 3WN5C 1T22B 3QNYA 4N2EA 1XSJA 4ODSL 2ZXEB 3BQUB 3UG3A 1SN0A 4KKCD 1FSKB 5JIPA 4GH7B 1RUQH 3AT0A 1KELH 3VXME 3ZHDA 4JG0L 5E00A 4NIKB 2PWGA 1GPOH 4JR9L 2E7BA 4UTAA 3U9UB 4O58H 1MIMH 3ARBB 1I1CA 1KTLB 3OPZH 2DPKA 3O3BA 4G1EB 1KNOA 1TPXC 3H9YA 4PJEA 3LEXA 4GRWE 1OF2B 2BNQD 4PRBB 1NAMA 2EH7L 1ED3A 3KXFE 4Q8BA 4R97B 1S7SB 2EDHA 5FUOL 5FYJL 2DQJH 3JV5A 3OC5A 4XN7A 4YDIH 3V6OE 1HQ4B 1V27A 3MOBH 3QORC 5GGTH 4Z77B 5J56B 4QOKE 1HYSC 3SPHA 1WTGT 1Z9LA 3D39B 1C5DB 3HG2A 3L3HA 1GS7A 3A4AA 2ISDA 1E2VA 2BP8B 2R0KL 2LFEA 2VSMB 2W65B 4XRCA 5DRZA 3ZDWA 3QPKA 5LAXA 4MGXA 1TZOA 5TFSL 1V54B 4HFUL 5C6PB 4QY8A 5CCJA 4IHBA 1NL0L 3U30B 4O02B 3GIVB 3BKMH 4NPJA 2QDWA 3MO1A 4ENZA 3MRLA 4LLUB 1WAEA 4N4YB 5E03A 2JE8A 1W6WA 3T8VA 5HXMA 1E4WL 1XTLA 2YXWA 4XCFH 2D2OA 3OB0H 1N8ZA 4WEUD 3TTYA 1X3DA 3FCTA 4QT5A 1RUPH 3AC0A 2ZUYA 2ATKA 4ZS7H 1FVCA 4Y19D 5GGSY 3GI9L 4MJ5A 2IBZY 2G0LA 2ZONA 4MWFA 4FYTA 3HC0B 4L8CB 3BUPA 3GRGA 4GINA 4MJIB 3T3PF 4FHKA 3V5HA 2J12B 4LLQB 5DMYA 4XT1C 3TESA 3BZ4B 3W37A 2GIMA 5TDPB 2WZ6A 5HY9A 4BUQA 1KXQA 2EECA 1E9PB 4NQED 1B2YA 1L9SA 1KYOK 1Z66A 2KLSA 4R26L 3JTSB 4LBEB 2IV8A 1EO8L 4MAYC 2EYRB 5AG8A 1PAMA 1QUPA 4TLSA 4U1MA 5D2LF 5EZIL 4V33A 3AABA 5EF1A 4S0SD 1CMOA 5DFTA 1FORL 4XCCH 2BSCA 4OTXL 3WTWA 2C9SA 3WENA 3BPOB 4DGIH 1MCJA 1UH3A 3M88A 3VRLF 1BF2A 4Y7MA 1Q0YH 1W0VB 1A7OH 3QUXA 4S10A 1PZBA 3W9DA 1DVSA 3HZ3A 2VN7A 2BFVH 2PPFA 3P1VA 5JDSA 5GZND 5DQJA 2WYZA 3B9EA 3N9GL 4MNHA 4WNJA 4D9RE 1NFKA 2AW2A 4LLWB 4E41E 3T0EA 4JKMA 3WNJA 1HIML 1VFUA 3ZKMC 3WNIA 4KQ0A 3QUZD 3QUYD 3GSNL 4IBQA 5C9JB 1UG9A 2WXLA 1XGTA 2CDFA 4EI6B 4BRVA 4JHAH 5J6SA 1QBAA 4UNTA 1FCGA 3BE1H 3OQ3B 1OAZH 2NUPA 1UOLA 1J1OH 2IPKB 3WTVA 1EEZB 1TEYA 3HI6H 4AG4H 1ZD6A 4OGYL 3KM2A 2WLYA 4JFFD 5F1OB 3P3TA 3HB3C 3L3KB 4HC1A 4YDLC 4FQLH 3R06B 4NQSA 3FFCA 1S8DB 3AM8C 4K7PX 1V7MH 2AI0L 4B9FA 4GT0A 5GS0C 2EUVA 4NLAA 4HEPA 3S96A 1D5MB 2G5UA 3MUHL 3MXVH 1HHHA 3DX3A 3FSZA 1Q0EA 2F15A 1I85A 4D9LH 4N2DA 1R5VA 5TF0A 4HKJB 4ZPTA 3MV8E 1MHEA 2AV1B 5KVGH 5IB2B 1PG7X 3VD9A 3ZBMA 5HYJD 2F54B 3KW8A 4ZX6A 3ZJAA 3GPEA 4FXTA 3AU1A 3S5LB 3MQIA 2VDKH 4PY7B 4LOUC 2MCG1 2B1OA 1YEJH 3ZL4H 3TH2T 1RZ7L 2CMRL 2VR5A 3OHMB 4L3CB 3RJQB 1PVHA 1XXDC 4R7NB 4MNQA 1ZA6A 2HMIC 4A37A 4H26A 4PJDE 3W1ZA 3NH7H 4LSPH 5AW2B 2NYZA 1A6PA 4OKVB 3T0EE 4LPUA 1B6UA 4FYSA 4S1DD 2GJRA 3QDGD 4NNYB 4JFYB 3T1FA 4KWUA 3MRHB 2OMTB 1E27B 3PDGA 5KS9F 4LSSL 2G5RA 4IK7A 1U3HC 4PJ6A 1GHFL 2X41A 4TSCL 1NFIA 4QOKA 3FJTA 3VSVA 1N6QL 4MJ5B 2WSPA 2CJTA 2OTPA 5FW8A 1FSKC 5DUPH 5FYKL 1TTRA 4XO8A 3RVUD 2QGBA 1Y07A 4A7SA 4QNPE 5IB3A 5K1VA 3G04B 2Z93B 2NTFA 3KPMB 3QH3A 4UZUA 1JIBA 1CBVL 4IHOA 1IKOP 5FYLE 1GOHA 4LCYB 1F6FB 1QEXA 4L4VE 4PMEA 4S2SA 3VWKD 5IJDC 2WBWB 3A4EA 3BZFA 4R97C 1UXWA 4KH9A 4NZUH 4HVBA 5FHAH 4N90E 2XV0A 2QKSA 2P5EE 3JYBA 5DHEA 2NUPB 2YC1B 3EO0B 3AAZA 4KKLC 4KKRA 1R4XA 4M29A 3ETBF 4G8FB 1L9TA 3O8XB 2A73B 4X4KA 2YD1A 3I84A 2CO7A 2KHAA 3K2UH 4IIQC 2Q9OA 1GC1L 4JDVB 1G7QA 3I6LD 3S36H 2QADC 3DI2B 1DFBL 3BN9C 3MBWB 4GRWF 2EYSB 4LSVL 1SGKA 2VM3A 3V7MA 1NANH 1L9PA 1AZZC 4K9EL 4A7VA 4R90L 3CHXA 3NP3A 5AW3B 2ATPA 4GXVH 4RA3A 3LKPA 3U6RA 1FIGH 3BP4B 4PLJC 3RWEB 3MFFB 4BZ1L 1KWKA 4NQCD 2CKBB 2ZG2A 4X9HA 4GSUA 4W9EC 4Y4FB 2R39A 4OUUB 2X70B 1IBBA 1PL3A