4GT0A

Structure of dengue virus serotype 1 se containing stem to residue 421
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
402
structure length
390
Chain Sequence
RCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEVTNPAVLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDTNFVCRRTFVDRGHGNGCGLFGKGSLITCAKFKCVTKLEGKIVQYENLKYSVIVTVHTGGTIATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNEMVLLTMKEKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLVTFKTAHAKKQEVVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKLTLKGMSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGKMFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope protein E
publication title Structure of a dengue virus envelope protein late-stage fusion intermediate.
pubmed doi rcsb
source organism Dengue virus 1
molecule tags Viral protein
total genus 67
structure length 390
sequence length 402
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gt0A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4gt0A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4gt0A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4gt0A03
5IREA 3UAJA 1SVBA 4L5FE 4UTCA 5IZ7A 3UZVA 1UZGA 1OK8A 3G7TA 4X42A 5KVEE 2JSFA 2V33A 1Z66A 1URZA 1OANA 5LBSA 2R69A 5AAWC 1TG8A 5B1CA 5LBVA 2JV6A 4UTAA 5JHMA 3UYPB 4GSXA 4UTBA 2P5PA 4BZ1A 4ALAC 5GZNA 2ALAA 3N42F 4FFZA 4UT6A 1PJWA 3UC0A 1S6NA 4AM0Q 3I50E 1Z3RA 5AAMC 5GZOA 2H0PA 4GT0A 1RERA 3VTTA 3N41F 5H37A 3N43F 3J27A 3C5XA 3C6EA 2GG1A 3N44F 2I69A 5KVGE 3MUUA 2JQMA 3WE1A 2R29A 3J2PA 3UZEC 5KVDE 4BZ2A 3P54A 1ZTXE 2HG0A 4AL8C 3N40F 5LCVA 5KVFE 1OKEA 4FG0A 4FFYA 5JHLA 3IRCA 3UZQB 4UT9A
chains in the Genus database with same CATH superfamily
3CFNA 3K81A 7TAAA 4XWGL 1MFCH 4DCQA 2R0LH 4XCCH 3VFTA 2WAQA 1F90L 2Z91B 1CDGA 3KYOB 2D0GA 4P2OA 4R3SB 4EI5C 4EZLA 2GJJA 2CM5A 1ZHLB 5L88H 3SE8H 3NH7L 4J39A 4N0CD 1CGXA 2CNYA 3WFDH 3BUYA 3ILPA 1EZSA 4K23H 5JW4M 1HHKB 2PTTB 2X6BA 2V5MA 2E7LC 4YFLF 3ATBA 4CVXB 4YX2L 2V6HA 2NW3B 2EDQA 4R4NC 2J8UA 5AVZB 3WY1A 1QQDA 5MERA 3DHPA 3AUWB 2JJWA 1HEZB 3MC0A 3VSVA 4FHJA 4G3YL 1JYWA 2EC8A 3LZOA 2EADA 3QJZA 4HF5H 4HS6A 3B1TA 3IJ7A 1FO0L 4W70A 2H3NA 2I07B 1D2OA 4Q9QL 3FQRB 4FA6A 1E4WL 1KCLA 4KXZH 5CXPA 5IKCA 1H8LA 3QDGE 4NKDB 3ZUCA 12E8L 2QSCH 3FN0H 2PABA 3KYKL 3VQMA 1FRGH 2EDFA 4M9PA 1MJJB 1YEIH 3D0LA 4MCYB 4ABWA 2OAAA 4XCYB 3E2HB 2K8MA 1AYRA 5D93C 3HUJA 2EEFA 4X5WA 2DEXX 5ITFB 1NLBH 1T6VN 1QAWA 3EO9L 3GPSA 3UAJD 1T5KA 4P5TD 3ZHFA 5MENA 1GTFA 1LDSA 4M56A 1XR8A 1IBZA 3T6WA 3FPXA 3MQIA 2DJMA 3QWQB 1U92B 3OKKA 2F68X 1WFTA 2XI9A 4ESKA 2VM3A 3PAVA 3D34A 1YEDA 4AEFA 1NCWH 2YBRB 43CAA 3W38A 4JO1L 3CHQA 3KPPB 4BCYA 1N5AB 3OR6A 1UM4L 1CD1B 5CN1A 3QNZB 2J56A 3FULA 2OR9L 3CVIL 1ZT7A 2ARJA 4X6BA 4N0CC 5HYJA 3EYQD 4RWHA 3WNIA 2NY1B 1SGKA 1T2XA 5C7XL 1AKJD 1W16A 4FKHA 1PZ5B 3BZ4A 2PYEB 5I18H 5JA8B 2FWLB 3T3PB 5K9JL 1NCJA 5KSUB 4JHWH 3HS8A 4X8CA 3ZIYA 5FLUA 1CD9B 2RIKA 1IX2A 3RHWK 4GW5A 1T0MB 5C0RL 5L7XL 2WNXA 2E7HA 2R27A 3S96B 4HC1L 3GZQA 4KROD 1AAJA 1UB5A 4JRXE 1NIDA 2GTQA 2OFQA 5JLZA 1QBLH 3ELQA 1QSED 1T22B 3AY4C 2VT0A 4ZOAA 3LDBC 4JRYE 1MKFA 1BZ7A 2EIMB 4IU2A 3RPIA 3L3HA 1T21A 1HL8A 1TCRA 2RCSL 1YYML 2YJLA 3G6JF 5I30L 1ACZA 1D5MB 2UXFA 4PJ7B 3ZZQA 4QRTA 3OJDA 4ZD3H 4ZX3A 3MV8B 4PW3A 3P9LB 5DWUH 1TJGL 2E7LA 4Z7VE 3WNLA 2QGCA 4CSTA 5AB2A 2O5ZL 4XBGA 2P5WD 1L7IL 4PGCA 5D6DC 3HCVB 2QDWA 3FCGA 4TSAH 3UAJC 4P5TC 3UJTH 5LXGL 3V6ZB 2OYLA 3QHFH 3A4EA 1KLUA 3OKNA 1R6VA 3TEYA 2EIJB 4JW3A 2YARA 4NM4L 4QXWA 4F8OA 2GJRA 1ZEAL 2BFVH 3Q1SL 3Q8EA 4JG1L 4NUMA 1RK1B 1PG7H 2CRIA 5CP7A 2NYYD 3U83A 1MFAH 3TT1H 1P7BA 3K71A 1IT9H 5IV2A 1W15A 1N0XH 1A9BB 3HG0A 4UTAH 2VISB 4RNRA 1G9HA 4JPIB 4B5EA 2R7EA 2XVGA 4LIQE 4P5RA 3SGEI 5IB1B 1YEHH 4HS3B 3QNYB 1NUGA 1X5YA 2HJFA 3EYQC 1TZOA 2UZPA 4QRRD 4X9YA 4L8CB 3M1BA 5AVVB 3AITA 4JHAL 5CN3A 5M7QA 1ANUA 1P0SE 3UBXG 1AE6H 2V7HB 3QDME 3DRQA 4HMDA 1CGVA 4X9BA 2LU3A 5K93A 4H2CA 1A25A 1DQLL 4JM0A 5LGHL 4G6AD 3S36L 3GS4A 1GTNA 4Z7NB 3IDJB 5BMFH 3KPSD 1ZLSH 1L3WA 4GXVL 3SGDI 1E3XA 3QZBA 2I9LA 5EZPA 4R96B 1CLYL 2GBVA 1DANT 3RGBA 4KROC 1T89A 3ZMRA 4TSBH 3BZ5A 2XN2A 5DK3A 4GIPD 2RALA 1JRHI 3BGAA 3H7LA 32C2A 3UL4A 1RZ7H 1BLIA 1IGTB 2XZAH 5FYJL 2IALA 1RJZB 2OYMA 1N68A 3MXVL 4L29A 5JW3L 3N1GC 3ARYA 1VZHA 1CJYA 1FIEA 3QFDB 5KVFE 2WQVA 2ZE0A 4KKLD 4Z7UB 2Q6WB 1CFBA 3FQXA 2V17L 3HVDA 3MRRB 1UD3A 2EP6A 1IJ9A 1QFHA 3P3YA 3PQYB 3TPUA 1U2HA 1DEDA 3S6CA 5HHOB 2VDOL 3MMEB 3V4UH 2VNCA 2Z31B 5LGKA 4PJ5E 4NERA 1I8UA 1MNNA 2W1NA 3ZDYE 1ZS8B 2NYYC 5ACMA 5CZXD 5FFLA 2DKSA 4G8IB 4PJCB 3AY4A 1KJ2H 4P2RE 3P3RA 3MREB 1MF2H 3RHWF 2E46A 3TVMC 4JZJA 4M61B 5CZVH 3KXFB 4YDZA 2BNQE 3QZWB 4LLQA 3IU3B 1A3LH 1BYOA 4RWYH 3RIAK 2BS71 4K3EH 1OCCB 3SJVD 5D1XA 1GOFA 4UIKH 1QBAA 2WKOF 1G6RL 1RUMH 3ZPDA 2PKDA 4OLYL 1I7ZB 4P3DA 1S9KC 2WW8A 4Q2ZB 1K72A 3PDOA 5FO2A 5D6DA 3T4AC 1AIZA 1MVYA 4WJ5B 2H7WA 2UXVA 1G7IA 4J3XA 1G7QA 3FU7A 1LEIB 3FTXA 1L9MA 4XPAL 1AS6A 4GAFB 1R4XA 3MJGX 4M3HA 3HE7D 4NCC1 4A63A 1XGUA 3AC0A 5DZPA 4Y1AE 2YAFA 2AP2A 5KBKA 3X11A 2PCFB 1IBBA 3D8MA 4IRZA 5D70H 2WINA 1JYXA 1HQ4A 4LRNL 1BOGB 1RIVH 2FGZA 2P46B 2XKNA 4NS0A 1SPDA 3NIFB 3MV01 4P9ML 5C0AE 5AG9A 5AL8A 4JPSA 5FYKD 1E42A 2OKMA 5CGYD 4Z76B 4LEXH 1R46A 2GVYA 3NEEA 1PPIA 2WQ8A 2R0KH 2LHAA 1F2XK 5CBAB 2JQAA 4G7YH 2DLFL 2OP4H 2A9DA 1A6AA 3PXJA 1JVOA 5HHVL 4KKLC 2O5XH 1S3RA 3M6DA 1PNDA 1QFUH 5FPIA 1OTSC 3CFEB 5T5FA 4N2EA 4WNQB 4ZAKB 3SB3A 4KFMA 1B9ZA 2XRAL 3GMMB 2D0HA 3KPTA 3V0JA 3L3GB 4UQEA 5DMJB 3ASOB 5SWSA 4DVRH 1G4RA 2W81C 1G1OA 1RI8A 3ES6A 3HS0B 4S2SB 1A1OA 3AXHA 4R0LA 5T1DH 4CC0A 4AYSA 3TIEB 4NWTL 3BGMB 3CJJA 5DSCB 4X6CE 4X99A 1X6LA 2MH4A 3ARSA 3OKOB 2BRRL 1V7ML 1NC4A 1CR9L 5D71L 5CSZB 1SDAB 3TV3L 2NY2B 1TLKA 1W8EA 4KV5F 3FT1A 4XO5A 5BO1L 4NXKA 1WGVA 1XZ0A 1UOVA 4J6IA 1URLA 1FF5A 4E9TA 3LRMA 3SPIA 4XVTH 1I8KB 4POZD 1UWGL 2P5WA 3IJSB 3MV9E 2EH8H 4QMEA 5EULV 3V5KA 4LSQH 3BT0A 1KJ3L 5LGJB 1FAKT 3A4DA 1N4XL 5GGTH 3HE7C 3UDWC 4BSVA 5B22A 1NWOA 5J56B 5DJ8A 5T3XL 4WV1A 5E23A 5HP5A 5L2KE 5EU3A 4ODSH 1HH6A 3ZMNA 1EBPA 1IAIH 1A4JA 3EYFA 3GHBH 4N2FA 3QS2A 2FBRA 4NENB 4QHNB 2XBDA 5FFGA 3VXSB 4L3EA 2VN5A 1I9RL 3TVMA 3K6SB 4HK3N 4PGZA 3KWUA 5CGYC 1U4FA 5J1TC 3BKYH 4FHKA 1W0WA 5AB1A 1X7QA 3QAZB 1CFNB 1TG8A 4Z3IA 2X1WL 4L1BA 4YDNA 2G5BA 3LN4B 4Q8BA 1U3NA 4PJAB 5DI8A 3UBXA 3MRHB 5TDOA 3L4YA 3N55A 5KANG 3FN9A 1OF2B 3C87A 3LKSA 4W68A 2FD6H 4ALAC 1PIFA 5JPNC 5I28A 4Y8AA 5HY9A 3PWUA 3RIAF 1SHXA 4X4YA 3QXWA 1XIWA 2F7PA 3QQ4A 1J8RA 4OM0L 1DFBH 1ZHKB 1ZA6A 3KYMB 25C8H 4ILDA 3CDZB 3S8FB 1EHAA 4H0LC 3B37A 5DRWB 3JV4A 5LG1A 1DBKL 4ODTH 4LL1A 2J6EA 4A2MA 2D3LA 2NY1D 1H3VA 3AJ7A 4ZQTA 4E9QA 3O2DL 4PI0A 5CNHA 3LQAH 2PYED 1EEYB 3ESVF 5DK2B 3GO1L 2C9XA 3EFOA 1E67A 1FNAA 4NKOA 2DLIA 3J27A 4KZEL 4XPGL 1NANH 4QAMB 1XBDA 2AXFA 4NQVA 1HOCB 4N1EA 3IWVA 1NQBA 1GA2A 1O6TA 2DWDB 4POZC 4LLMA 2EKSA 2CLZA 5KVGE 1RP9A 4B9GA 3O4OB 3TNNB 4PRNB 3TO4B 3AMKA 3VM7A 3OAZH 3FB6A 2WJ7A 2WVUA 1JWSA 1NGPH 2X70B 4WAFA 3SPCA 4J5VA 5IJCC 1MDTA 4GRWB 5TJWK 1VDGA 4Y5YB 1OTTD 2CO6A 4KI5F 3UTOA 1X5XA 2OMVB 1WDAA 2L7EA 2MPAH 3Q6GL 3OMAB 3IGLA 4KU1A 1OO2A 4NM8H 4X4XA 1IC7L 3JWOC 3MV8D 1U30A 3E1ZA 4NRZB 3L4XA 2E56A 3B3BA 1PD1A 1DLFH 2B9AA 3D3VA 2APFA 4Y7OC 1G1KA 3WV0A 1TYRA 2Y7QA 5C97A 2OSXA 2ZUQC 3QO1A 1RZIA 1N8ZA 2APBA 3PGCA 3SJVA 1RK0B 1OGPA 3GJFA 1JF1B 1SN0A 1DBJL 1NLDL 1S7UB 3G5WA 4KRMB 4APQC 4QHKJ 4KVNL 4LRIA 4U1HA 1B4RA 2FT8A 1QWHA 4XB8A 1NBVH 4W9GC 1N18A 4KMLB 5TDNB 3JWDC 2COQA 1JP5A 3O8XA 4KVCL 3UZVA 1J1XH 1MHCA 3P4MA 1USQA 2WXPA 4NN7B 3GSQB 4V33A 4ZT1A 5HGDB 2R0LL 4XCCL 2CNZA 2KHAA 3F7QA 3NZSA 4XNXL 4CILA 5BXFA 5D9SB 1XD0A 2B4CH 3POHA 1H3XA 3ZYJA 1UZ6F 2NY1C 1ORSB 3SDDA 3AS0A 3GMOB 3AW5A 3HC4H 2PO6A 4YO0A 4YHOH 2FIKA 3SY0B 3AQYA 5BVPH 1KEGH 1FL3A 2CBQA 4KY2A 3G6JE 3WFDL 5BO0D 1I3VA 5I1HH 4K23L 1M2VA 2UZIH 5F93C 5BQDA 3V55A 3D52A 4UTBL 5DZOA 5EBGA 1TO4A 4Y19B 4MB5A 1NKGA 4M5ZH 2WKLA 4ZTEA 5EZIH 3SBQA 5JPNA 2EIZB 4D8PB 3SODB 4ZX4A 2BY2A 4OI7A 3BAEH 1YPZF 4UT9H 2Y7NA 1U8HB 4IRSC 4N9GA 1JPGA 5KUMA 5TF0A 3D4GA 1DR9A 1TVBB 4JDEA 3GSNA 4JO8A 3SKUD 2KI6A 3MRMA 2EO1A 2GITA 3E6FA 2CR3A 2XZCH 2ISDA 1JVKA 2QSCL 3FN0L 4GOSA 3CFTA 4PCTA 4PY8I 2DD8L 1FRGL 3BKMH 3PQYD 4TL4A 4B95C 3SDCD 1ES0B 3DO7A 5HHOD 2YUWA 1P4LB 4PD4K 1TZ8A 3DK0A 4OM1H 3K6DA 5DEGA 3MTXA 5IB4A 3KCWA 5FW7A 3VA2C 1CYXA 3MJ8B 2EO7A 3PGDB 5GSVA 2JKRM 4X7FC 3G6DH 3H9SA 5I0WA 3UZEC 3KZ8A 2EILB 1P84K 3FUNA 4QTHB 4MZ3A 1ITCA 4QF1B 3QDJA 2VLME 2WGNB 5ESVB 2HPTA 2N4IA 1XCWA 5C0BA 4HEMA 4CAGA 1IM3B 4XMPH 5I8KH 4F9PC 1QZ1A 5DLLA 1ADQH 2O30A 2XETA 2LW3A 2XVBA 3MV7E 3DIFB 4F7TB 2HX7A 4XC1H 3LD8B 3X1BA 1M4KA 2QBWA 3T9WA 4APQA 1HZKA 4KXCA 5C0GB 3WLWC 1DO5A 3L6FB 4JHWL 3D2UB 3OGCB 1KLGB 3DPBA 4WGVB 5I0VA 2G75B 1K8DA 3KPPA 5T3ZE 4DUXA 2Z65C 4ECNA 1JWMB 3ZDWA 3QORD 2C5DC 2W07B 1QBLL 4FKEA 3CVBA 15C8H 4JPQA 3EJRA 2LU5A 5ANHA 5CP3H 4TNVK 3DETD 2P5EB 3U7AA 4BELD 1QMUA 5HPOA 3UO1H 4N8VG 3GHEH 3RURA 2J5WA 4YZFF 4P57B 4QI3A 3P11H 2QQKH 1KF9B 2JKLA 2MPVA 3KWWB 2AK4B 1ECZA 5EFIB 4ZAKD 5FKAB 4ZD3L 3SDCC 4GAAA 5DWUL 3S36X 3EADA 3NCJH 2CSPA 1OPOA 2DQGH 1MH5B 4TSAL 2PP7A 3UJTL 5JXEA 3S34H 5IEKB 3QHFL 2Z7YA 2RGSA 5INDA 2I9TB 2BP5M 4IRSA 2BFVL 1T22A 4XODA 3EH2A 1TITA 1PG7L 2ZG2A 1DL7L 1IT9L 1N0XL 1GZPA 4UTAL 3L4UA 4PJ7A 3CTTA 2NY2D 3T3MF 5CS7A 4OZIB 3MKGA 3MV8A 5E1GA 5FM5M 4WDIB 1JZ2A 2BOBA 4IRZH 1YEHL 4YZWA 3FH5A 4QCIA 1DQTA 4PSRA 3LKQA 3HR5A 2JH2A 1VCBC 1ASOA 2RB8A 4OLUL 7CGTA 1M1SA 1UJ3B 2GUOA 1AE6L 4FFWC 4HUUB 4RVBA 5AW0B 3EG9A 1QR1B 3SQRA 3H3PH 3SQOH 4FJYA 3PHOB 2R29A 4GS7C 4J1UA 3SOBH 4OAWA 1ZLSL 1PFCA 5BMFL 5GRWA 2VC2B 3BFOA 3I84A 5DMKA 4UM8B 1M6UA 2OMBA 2NQDA 2QQLH 2XN1A 5D55A 5T5FH 4GMTH 1A9BA 3VXSD 1JGIA 2F54A 1WBYB 4AQ8C 1S5HA 1O5DT 2VISA 3QORC 4D0DA 4TSBL 4JX0A 5ERWA 3RTQB 3DTXA 1O75A 1NEZG 2NUPA 3H55A 4YSEA 5MEOB 2XIIA 1HEHC 1RZ7L 1WRFA 1OSZB 3DETC 4L8CA 3KLAB 3C09B 3N91A 4U6XB 5BUGA 5E7FA 5E5RB 3LVTA 4F9PA 1EAJA 4AYDC 4F57H 2X2HA 3IJYB 1QI4A 2AEWA 4ZAKC 1F4HA 4KTGA 5CZKA 5EZOL 3WHE1 2OMWB 4UOZA 1U8CB 3GSVB 1JXKA 4UCFA 4G72B 2WIIA 5AVWB 1M7DA 4KMTH 3HBQA 3BZDA 5PCYA 4A2GA 3HS0C 3RU8H 1YVLA 3V4UL 4Z77A 1GCFA 3KCPB 3T6ZA 1SJXA 2A9MH 3QXAB 3BIAX 1DQIA 1T1WA 2NY0B 4E9YA 1T1YB 2WLNA 2NY6C 5D4QA 1NWPA 4RMSA 2CLVA 3D33A 2QPDB 5B38B 3T0VA 1CBVH 1ZSHA 2HRPH 3HAEG 4MRCA 5IFJB 1RJZA 1U3JA 3DTUB 1FAIH 1KJ2L 3DV6B 1MF2L 4X6EA 3CH1B 4ZUTA 5CZVL 2NY2C 1C8QA 3UTSA 4AH2A 4UBDC 1NGZB 2VDLB 1ZRUA 3MRRA 3X2QB 3VFWA 1A3LL 1YRKA 4MQ7B 4RWYL 4FI7A 5DA4A 3DX9B 3I50H 3LV3A 3SDCA 4LEOB 1U95B 5FECB 1UGNA 4UIKL 3MMEA 5ISZD 3AVEA 4OCXH 5A16A 1RUML 2EDDA 3TO4D 4TNVF 1JIBA 1ZANL 5E4IA 1WCBB 4XNQB 2XSKA 3C60B 3CBKB 2AABL 3WJMA 4FG2A 4OF8A 2N56A 1J8SA 3P30H 2X4UA 2IGTA 3GTTA 2OXGB 5BRZE 4JJOA 1CZ8L 4TF4A 3N40P 1TZGH 1B0WA 4ODBD 1AP2B 4MYWB 2H6PA 5D70L 4ZYKA 1RIVL 3T6VA 2X28A 3QAZC 3UYRH 5AUMA 4LEXL 3K1KC 1WAPA 3ASNB 2J6EH 4XP1H 3MNWA 2R0KL 1KUMA 1I7ZA 1JZEA 3VFGH 2ESVE 4PRHE 4G7YL 5JW5B 2OP4L 3K1DA 2O5XL 2UY6A 2ZKHL 2C3VB 4G42B 4W9DC 5B8CB 4OUOA 3QJXA 1Q0EA 1QFUL 3B1UA 5IHZB 2XXFA 2C9AA 2HKFH 3L5WB 1N2RB 4I0KA 4Q9RL 5LGYA 3CHXA 3VE0A 2V7NA 5C7ZA 5KVDE 2D2OA 1BCIA 2KZ1B 4ADIA 4D9LH 3B2MA 3P54A 4YPJA 3VXNB 4DVRL 3T77A 1XHHA 5T1DL 3VGDA 4TRPL 1UENA 3EF4A 1AZVA 3FDWA 1DQQB 3QORA 3D4ZA 1RH8A 3VXQB 5B1BB 3QR1A 3FUKA 4E9WA 3BT2H 2CALA 2IDUA 4LAJH 4R9HA 4N8VA 5KAQF 3ISWA 1EO8H 3EJCA 4DESA 3BVNA 4Z7AA 3EHBB 3CFEA 4TULH 4Y19D 4ZAKA 3TO2B 4JL2A 3RWGA 3O4OC 1WFOA 4Y1AD 4ELKA 4XVTL 1I1RA 4XGZB 3VB8A 1J8HE 1K3IA 1KC5H 2XFXA 2WQRA 2UUDK 1YY9D 4S2SA 4HAFA 5B39G 3CLFH 4LSQL 1FZJA 1IAKA 3GJFH 4KJWC 4MSWB 5GGTL 4Y5YC 5EF0A 3TIEA 3VXTB 5DUMH 3BXNB 3HFFA 3QZNA 1GSMA 1P5UB 3SKOB 1MI5B 1KGUA 1KT2B 3UFIA 4ODSL 2EVJA 3TIDA 1ACXA 1IAIL 2NTFB 3GHBL 4M1CD 1W72B 2C26A 5HTSA 5J11C 2EVGA 5DZJA 5JHAA 4ZRGA 3KPMA 4L18A 1IC0A 1UZ6E 2AK1L 2ZUWA 4HBCH 5IBTH 1CICB 2VAJA 1AGEB 5CJ5A 2VR3A 3MACH 1EHNA 4MQTB 5BCAA 4KGLA 4UIMB 2HN7A 3IJSA 5FYKH 1ZTXH 3FO0H 4PJXB 4GMSL 4AE0A 4E41E 1HILA 1QWNA 2PN5A 4G70B 3SDXB 1XF2B 4HUXB 4XMVA 4UAOB 2HB0A 1IAIM 3NBNA 2GTWA 4NN7C 2DTSA 3E8UH 4GI9A 5DFWH 4YIQB 4X6DF 4XP4H 1YPZE 25C8L 4ALAH 3L3JA 5HI3D 1NFIB 3S35H 1DSYA 1KENH 2CBTA 4ODTL 3U7YL 1TPXB 1IM3D 1SOKA 3B4NA 1NEZA 3DVGA 5I8EA 4Z7VA 3GSNH 4I48B 3LN4A 1F13A 4NFCA 2RFXB 3RYMA 4C55A 5CFHA 4JFXA 4KRNA 3QEQB 3MRHA 4X9IA 4P2YA 1RUKL 4Q58C 3RNQB 3WO3B 4DO6A 4PH8A 3D2UD 1OF2A 4Q6KA 1YAZA 1S7WB 2DWSA 3VW3H 3LS4L 2E5EA 1UC6A 2XHNA 5ENWB 2YPLE 2AFNA 3BSGA 3DUSA 3BAKA 3OLIA 5SX4H 1U58A 3D30A 1IE5A 2X1QA 4Z7WB 2YKLH 1ZHKA 4DZ8A 3C5SA 4PGBA 2ATAA 2AI0H 1YY9C 3ASWA 1RUQH 1S2EA 4XPHH 2CO2A 3FT2A 3EJTA 4L9DA 1NGPL 3PABB 1WWAX 3L17A 3W9EA 2P5ED 2V3FA 4KWUA 3TFKD 3U9PH 2FR4A 1XGYH 3QZMA 3BJ91 3HAEA 4UDUA 2MPAL 4UNTA 1KGIA 3PUUA 4ZS7H 1BAFH 4NM8L 4M1CC 2AK4D 3BKJH 1R3HB 2IJ0C 5DK2A 1YLBB 3HLAA 3FCTB 3TCLB 3CGTA 2B2XH 5TGBB 4NO0A 5T1JA 5I24A 1DLFL 1ESOA 2GJ6B 3JWOH 4OFQA 3WN5A 1KXVA 4CJ0A 3MAWA 2YD5A 5ISZA 1J5IA 4BFIA 5FA3B 3SGJA 4NQQA 1MW0A 2EC9U 5IZ7A 4JREB 3NFNA 4PCKA 2Y6TE 4AZ8B 1J0JA 4D94A 3RL1B 4DUVA 2WXGA 1GS8A 3O3DA 4BJLA 2VO5A 2K45A 2HWZH 2OTUA 3NFSH 1D5XB 3F7YA 5IG7B 1J1XL 5HI3C 1JUFA 4NRZA 4DPCX 4XRCA 3S2CA 4HHWA 1BJ8A 2VH5H 4GI6A 3HC4L 2M8XA 4YHOL 1MCIA 2VWEE 3NJKA 3WXVL 4I18B 5BVPL 5I1HL 5CJBA 4B27A 2PR4H 4S1SH 2PPEA 1JF1A 2UZIL 5AW5B 1O7SA 4GW4B 4PJ5A 1O0VA 4FLOA 4J3WA 1IGYA 1F4AA 5JZ7D 3U7WH 4XMWA 4YSAA 1GW0A 2QR0B 2HLAB 4M5ZL 2Q76A 2ZWKA 3K8KA 4YGVA 4ETQB 4ZUVB 1J88A 1OARL 3BAEL 4KFZC 2Y6SD 3BP6B 3HNSH 2ATPB 4N2LA 5HGGS 4YBQD 3ZKXB 2ZSVA 2AXJA 1GYVA 3WIAA 2X0WA 3GMOA 1FNEB 3SY0A 3TFKC 2BNQA 1B0RA 1CTNA 4C8XA 1SYVA 2YWYA 2XZCL 4H8UA 4X7DC 3HZKB 1JV2B 1SJEB 2NY5C 3BKML 4B41A 2VQTA 2OMTB 1TZIB 2YKKA 4ODWB 3CZFB 3MR9A 2FX8H 3U0TA 1Z9NA 2Z8RA 5CCGE 2NRDA 3MZTA 1C1EH 1SFHA 4N0FB 4OM1L 1M7UA 1VEMA 2XV0A 4HS8H 1OGAE 3UTPE 4D8PA 2B16A 4KY1H 3V10A 4Y1AA 3RUGF 3ECBB 1R3JB 2H9GA 1AOHA 3PXLA 4N2BA 5J6SA 5IK3B 1E9PA 4I1NB 3UTQA 2X4NA 3G6DL 5B39A 3LXUX 4F7PA 2WXMA 2AVGA 1AR1D 4LU5H 2GEQA 4ODUA 1G9MC 3GMNB 5EZJB 5C0AA 4MNQD 5EO1A 1K2DB 3BZFB 3C08H 4KNUA 3C9NB 1I3GH 1CB4A 4CVZB 4HUWA 4HYTB 4MJ6B 4XT1C 4PWGA 5DRXB 4AIZA 1ES0A 1VGKA 1ZHBA 5FW8A 3IETB 3UPRB 1P4LA 1UJ3C 4K7FB 1MCSA 3HZVB 3DC0A 4XMPL 5I8KL 5I0ZA 4LB8A 1F8TL 4F7CB 3LIZA 2BDNL 1AS8A 1DDHA 1HDMB 1WLHA 2EABA 3A5VA 1BVZA 3ATDA 3PGDA 2E3VA 4ZW6A 4CU8A 4XC1L 4G8GB 4U6TA 5C3IA 4WUUE 5MEQA 2ZXCA 4R7NB 4FF9A 5JZ7C 4KPHH 3CK0H 4ADGA 1ITBB 1DJZA 2Z34A 2NNCA 1PG7X 1IEBB 2NW2B 3IKCB 3MOAL 4X6CA 1Q9WA 3OKYA 4OZHB 4M62H 3RTQC 4YBQC 3DVNB 4PJIF 1F45A 3M1CA 2FO8A 1KWKA 4FGMA 4HKBA 15C8L 2WZPD 1IM3A 2ZT9C 4XCNA 2VRAA 3GHEL 5KSBF 3P4LA 4G9FB 2TSAA 2QPFA 2QQKL 2XXMB 4OGYL 3MV9A 3AB0B 1CDUA 4PJEE 4TUOB 4KO7A 2X4QB 5IVZA 3D2UA 3UMNA 4ERSL 3FTYA 3NCJL 5FWRA 5IVXE 1I1YB 1BIHA 1CPUA 4OI9A 1XGQA 5ALBH 1NBQA 1HSBB 1FBIL 4PJDF 1I3RA 5L2KA 2VLMD 1XH3B 3QJVB 5IQ7H 2WO2B 2ZX7A 2LR4A 1AR1C 4X8XA 4F37F 2K7PA 1BZQK 2DWEB 4PWJA 5TFSL 4UQ3A 2IQAA 1Q94B 1Q4NX 3GMRB 3LEXA 2Q86A 3EH5B 4JAMA 1A64A 3BWUC 1U93A 4ORZC 3PHSA 3EHBD 1JGVH 3MA9H 3MV7D 1WZAA 2AK4A 2YPVH 4P3CH 4IRZL 1G9NL 2CO4A 5DMYA 2PMZA 5J4MA 1AIFB 3LRKA 1S9YA 1CGYA 4MDIB 5AAPA 5DF0A 3S9DB 1OT1A 4PI2A 4QXGH 3H3PL 1CBJA 3SQOL 2K8QA 5CBEA 3SOBL 1KN4H 1MI5D 1KTLB 2AQNA 2WBWB 3KWVA 3IDIB 2BSSB 2F0CA 2WMPB 3CZSA 3GINA 3WCYA 2GJZA 5T5FL 3DIDA 3F3HA 3FF8A 3GRWH 2OW7A 4ZO7A 4CW1A 1I85C 1BREA 3I6GB 4PB0H 1ID2A 4FFVD 2XG5A 3ARUA 5C9KA 2B08A 3NMEA 2DS4A 4HUUA 5B8CC 3W39B 2VSMB 4N90D 1WSST 1WIOA 3EUUA 1ECYA 1E0OB 4OGXL 3REWA 4ZZKA 5EEZA 2XWZA 4XNMB 1LVEA 2NT0A 2LLGA 5AKVA 1HNYA 3QCUL 3G7TA 3Q8CA 4KMTL 4UM8A 1JK8A 4AENA 3RU8L 5DLMH 2JCCF 5DJ2A 2V0AA 1V7NH 5T1KA 4IBLT 1MCOH 5EOCL 1OOWA 1Y1DA 2VLKD 2A9ML 5DEFB 5GGRA 1F3JB 3RTQA 4JFFE 3GBMH 2F53E 1II4E 3VWKB 1OSZA 3U0WL 4AT6B 1CDBA 3CDYA 4JUTA 1G1CA 3ETTA 1OOAA 4LCCB 3HNTH 1ZPUA 1FAIL 4NQUA 3QEQD 2ICWI 4HIEB 4ZPTB 5DT1L 4UM9B 5I8CB 4HKJB 4F24A 1LK3L 1R3LB 3FB5B 3WFEH 4LSTH 2OMWA 3WJLA 1U8CA 2YA1A 3GLZA 2GK0A 4TN9A 2GJPA 3I50L 3OKDB 3QI9B 2OSLB 3SDAB 2YSTA 2C9UA 4OCXL 1FE8H 4PBWD 1NKRA 3HJ0A 2IFGA 4HIIB 1H9VA 4BRVA 2DQCH 5CLYA 1PEZA 3FFDA 4KJYB 1FN4B 5DD6B 3NZUA 3B83A 3P30L 2J1ZA 2Z7ZA 3QQDA 2Y22A 4NO3B 4NPJA 4XPFH 4QKXB 2MIZA 3MRQB 5CHNA 5H2BA 3GZPA 1T1XA 4MNQA 4BDVA 5CJOH 1S7TB 1TZGL 1MQ8A 3DV6A 2DQHH 4XMZA 1J0YA 2GBAA 4OV5A 4JDVB 4LPCA 3LH9A 3G6JA 3V9CA 1T1ZA 5F6HJ 2GJ6D 3X14A 4GG6F 4XPTH 4MQ7A 3L13A 3UYRL 3F6LA 3BD5A 1YEJH 2XXCB 1FYTB 1QUPA 2J6EL 4XP1L 1GY1A 2A6DB 4QHMA 3VFGL 2IPTH 1UT1A 3CFUA 1EFXA 4P2AA 1MRDL 4A66A 2ZPKH 4UAOC 5F72S 1PZDA 1VESA 4R97B 2HKFL 4K5OA 4A7QA 2B3RA 1AO7E 1KIUB 1Z2KA 3CQPA 3ZO0A 1CL7I 2L7JA 4D9LL 2D7TH 3E0GA 5L2JB 1WS7A 4RFOH 1AP2A 1TPXC 1VFUA 4RFNB 3EGDB 2ADIB 1W9XA 3BT2L 4PLKD 4EQ2A 4DP4X 2E7DA 4L1LA 3PHAA 2WZPA 2B39A 5KN5B 3ZTNH 5JW5A 4OF7A 2GFBB 2OL3A 2LTQC 4LIQH 4X98B 2ZNWA 4W9IC 5F3HB 1XF3A 3HAEH 3CQQA 4PRBA 4S0TD 1J1OL 5EMYA 3MUJA 3BUBA 1WA2X 3L3DB 3IJ8A 4OTXH 4FABH 3IXTA 1MFNA 5CEZD 5JHBA 1M1XA 1WFNA 2VITB 3CFQA 2RQ8A 1KC5L 4MKTA 3TH3T 1QASA 1PZAA 1LO3H 4K94C 1R24B 4HUNB 4FQJH 4XN5A 4QNPF 4A38A 3GBNL 1NFKA 1DQQA 4L8SC 1HHIA 4XE5B 4P4KC 3UAAA 3NIGB 3QIBA 4YPGA 2DBJA 2DLGA 3G5XA 4EE2A 4TOYH 3VMOA 4F9LC 4NZRH 4PRAB 1EHXA 2ALAA 4R90H 3HI1B 2K3HA 4DP5X 4LMQE 3APDA 3GMQB 4BFOA 4HBCL 4JKWA 3MV7A 5IBTL 3SYPA 4XHQA 5C0IA 2F7IA 3QJRB 3TN0A 5SV3A 3MACL 3K91A 2WBKA 2BVOB 5C0FB 4XGZA 3VXRB 4JREC 4MLSA 1BFOA 4LQFH 4H8WH 2BOCB 3VGAB 1ZTXL 1AXSA 3FO0L 4PJBB 4QDGA 4F1SA 1Y6NR 3OSVA 4MSWA 1WVZA 4RBPK 4O51A 1HINH 3MNMA 5GGSA 1P4BH 2LFEA 1KT2A 3HHRB 2P80D 3E8UL 2BWIA 3VTTA 5ADPL 5C8JB 3GSWB 5GXBB 1CXIA 3N43F 1B4JH 4GKSB 4XP4L 1WK0A 1U8QB 4ZO8A 1FL6B 3S35L 1KENL 3AU0A 4XB7A 1XGRA 4KK5D 1UB6B 4W4OA 3T0EB 4KQ3H 4TM9A 3V8CA 1B0GA 4PLKC 4MBRA 3R06B 3X12B 3ECQA 2OX5B 4PRIB 2Z1KA 2UWEB 3GSNL 3JWNC 5F8RC 4A2HA 5HHNA 2WKOA 3CLWA 4G8GD 2VDQB 1I9JH 1INEL 4HJGB 3SDXA 3MLRH 3ETSA 1XF2A 1YMME 3TM6A 1SHSA 3VW3L 3QIWC 5C0JB 3RWCA 2PCYA 1DUZA 3MBWB 4W9ZA 3C6SB 3H2WA 2YKLL 3ZKXC 3RUGE 2FBOJ 4I4WB 3D5OF 4MD4A 3U1SH 2AI0L 1R5IA 1RUQL 1NFIA 2GSGB 3MYJA 4XPHL 3B9AA 1QLEH 2VLKA 5GS2D 1YHPA 3KPRE 1RXLA 3BSZA 4Y88A 1R47A 3S97C 5FGCE 1MJ8L 3U9PL 4M8UA 1XGYL 1CFTB 4LEBA 1KTBA 1T5XB 2PP8A 3AY2A 3IFOB 4ZS7L 4FP8H 4G9FD 5HD8D 1HAWA 3DO4A 5F1KC 1R33A 2B2XL 3BDXA 1XGPA 5IJDC 1S7WA 3QNXB 2Q87A 1A7QH 2G60H 5D6CA 3CFBA 4XNUH 5I1JH 1V54B 4MQSB 3FFCE 3U2HA 4F92B 4GAYA 3W9DA 4A1RA 1MCWM 3FOMB 1KEMH 2EYSB 2R23A 3LIZH 1JNNH 4ES9A 1A8ZA 3QS3A 1TQTA 3RB5A 3MRCB 2HVKA 2PNDA 2K7QA 2X38A 3EBGA 3X1FA 2FLMA 3L1GA 2FK9A 4L8SA 1I1FB 2HWZL 4P4KA 1CG9B 3NFSL 2XX0A 1UKTA 1SBSH 2ADFH 3BQVA 3C8DA 1VERA 4PJIE 1I4FA 4IKIA 3ARWA 3KLKA 4KK5C 4F9LA 5TGBA 3H3KA 3V4VB 2BIQA 2FE0A 4NB7A 4LLUB 2VH5L 5FGSA 2OMNA 4PJHE 2GJ6A 2CJTA 2C7UA 4Y4KA 2YIHA 1SZNA 2B15A 1DZBA 3GMLA 4YUEL 5I66B 5KSBE 4TUUA 2PR4L 4KKCD 4S1SL 1CGUA 2FLRT 1S7QB 2IWEA 4TPRH 5E9NA 3PWVB 3CHSA 3D18A 4HG4J 5F7AA 5HHME 3WS6C 1OCOB 1Z32X 2H8PB 3V6OE 2DICA 1HE7A 1CDHA 3HEIB 3PF2A 1KGXA 2H0PA 1JWUB 4JG9A 4YFDB 1XCXA 4L1DA 1RERA 3U7WL 1DCEA 4ZFOB 4MNHB 5LKNA 5IG7A 2H0EA 2R4RH 5GRUH 1ZLVH 2VLRE 4XXDB 3TBWA 4PJDE 2XQYG 2YXMA 3HRZA 2B5IB 1SYSA 1XB6A 1HK6A 1W6LA 4JK0D 1E4XL 5HGHB 1KNOB 4NXSA 43C9A 3GXUB 3GDCA 2W65B 2WLMA 4PREA 5HD8C 1FZKA 1RZGB 1UURA 5E95B 4H7VA 5C9JB 4WI8A 3ILQC 4BFNA 3FSZA 1L9NA 5EIIB 3MDJA 4WKXA 2G9HB 2Y25A 4XH2A 2ZJSH 5L8JB 3IN0A 1KTDB 4R7VA 1C1EL 1P1VA 1OAUH 4X80L 1TO5A 5IMOB 2W88A 2NY5H 1KV7A 3QIWA 4AG4L 5AENA 4HS8L 2VDNH 4KY1L 3K6OA 5I16A 5BRZA 5G5DA 2O6EA 1ZIAA 5D2NE 2QFPA 3FXIC 3VWKD 4ZMQA 3MRBA 5JHLA 4LU5L 3PU7A 4L05A 5CLZA 4FCHA 2R29L 2R51A 1N12A 4UM9D 1XBRA 2GT9B 2ZKYA 4J4PA 1A9EB 3ROOB 1UA6H 1LE5A 3EZ8A 1G9MH 1RJYB 2Y3AA 2OSWA 3RVUD 3F7VB 2OMTA 2ESVA 4PRHA 1H5BB 4F3FA 3HG3A 2YAQA 3SDAD 3DGGA 1HHJA 1TJXA 1A7RH 3PGFH 2VDKH 3QUYB 4O2FA 3APNA 4KKCC 4ZO9A 3DGDA 1T0OA 4PGDB 4J8RB 4P59H 2JWYA 1VFOA 1HU8A 1J18A 2WQUA 3MBXL 4N0RA 4PJGB 4V1DB 2AV7B 4MA1B 1FVEB 4FLHA 4XZUB 3B9EA 5AVQB 4TNFA 4JM2B 4DH2A 4KPHL 5E94B 3CK0L 5KVGH 3KPLA 3GNMH 5IROA 3U4EA 3NCXA 4GSXA 4A04A 1HHGB 4FXTA 3OVUB 3LZFH 4CVZA 3GXDA 5C0CB 5HYFA 1QUNB 1WUNT 1S9XA 3H4HA 5JIDA 1FYTD 4ICXA 2OW6A 4P2QB 4N0YH 5HDLA 4EN3D 3APMA 4IJ3B 3VSTA 4PRPB 1P5VB 5F7MC 3HZVA 5SWZE 3SO3B 2VERN 4ZUWB 3RZWA 4ZQKB 3L81A 3TZVD 1MDAA 1I82A 5KW9H 1FHNA 1XV8A 4HIJA 1J8HA 2N7SA 3ISYA 2CK2A 5CD3B 2OMZA 2BNUB 2ICCA 3WS6A 2XWJB 4MASA 3U0PA 3FCSB 1UWEL 4ONHB 3TYGH 2VIRB 3WGUB 3WIHA 1YN6A 2OXHB 3Q9QA 3EOAB 3DVNA 4FE9A 4GRLA 3CFJB 4EKJA 4XAKD 4JRYB 1H3WM 1JI1A 4LCCC 1VSCA 3CU7A 3ALPA 4NN6B 3SYOA 4NQDB 4PM1A 4ZUUA 1I7TA 2YEVB 4X9FA 1P9MC 4GKZB 3GI9H 1P2CB 3NN8B 5IR1B 3U4BH 5C3TA 3QFJE 1LWRA 1Q9OB 3I75B 1N64L 3RVUC 1JGVL 3ZYOA 3CIAA 4X9HA 3ARRA 3MA9L 5HI4D 4GUQA 2E0PA 4BFFA 3SDAC 3II1A 4GG6E 4P3CL 1CI3M 5PAZA 4GKOA 2Z0UA 3CBJB 4J3UA 1ILSA 1RQ5A 1I1YA 3CXHJ 3N40F 3ZE0B 4W1TA 1BYNA 5IMKB 3O2VH 3NSDA 5I1LA 4ZFGH 5FC9A 3FHQA 4QXGL 1F11A 1XH3A 4JFEE 1MFDH 3GLAA 3CDCA 1YPZA 3SPHA 2IXQB 1KN4L 2DWEA 1QR4A 3ME0B 3MRKB 5I6NA 1ETA1 3TBVA 1SY6A 4Y4HA 3E7JA 4W81A 4I87A 1T66C 5F1OB 4QT5B 5K1VA 1DHKA 2ZXDA 1A4BA 4L5FE 3ARPA 1TZHA 4EN3C 2C3GA 5LN4A 4GW4A 2CDEA 4FXKA 3VXRD 4WF7A 1NL0H 3QDMB 4YXHL 2ADJA 4MNGE 3ZKQD 2QTEA 3TZVC 2YPLA 5F2FA 4GP5B 4QRUB 3FU5A 4R97C 3APFA 1RJLB 1HESA 2OL3H 5CSBA 2WMPA 3FONA 3IXAB 2H0FA 1EJ8A 3WAKA 5BJTA 1G7LB 2QKSA 3X3FH 5DLML 4RFNC 1V7NL 4GAJH 1MCOL 4U1GB 2XQYA 4M6AA 4HHAA 3UO8B 4QNPE 3VRIB 3GBML 4DW2H 2XPGB 1PW3A 1UEYA 3FQUA 4PRID 4RGNB 5ITBL 2JXMA 3EYVB 5ABDE 5JW4Q 3HNTL 2R1XB 4WK2B 4F80A 1IAOB 2WK2A 4IGBA 2UZYA 5HI4C 3K74B 1P1ZA 2QSQA 4NEHB 4XNMA 5CO1A 4D9RD 4LSTL 2JCWA 1AZNA 4OUUA 1U21A 1C5BL 1FE8L 2N1TE 1CC3A 3W5NA 5IJKC 5FYKU 4M4PA 1AI1H 1CGTA 5DEFA 3SN6N 2DQCL 1FZOA 1Z7JA 1E6OH 4NIYE 4X7TA 3CCHA 4MAYD 3A6CH 4JO4H 3SYAA 4YDIH 3VFPB 5T3ZH 2ODIA 2O6FA 4FMVA 4XPFL 3BJLA 1GY2A 4F2ME 2DQJH 4FTVB 3U79A 1MPAH 4ZPTA 3RILA 2DQHL 1HSAA 4UM9A 1P9MA 5KAQG 2PW1A 4QY8A 4YEEA 3T2QA 3FO2A 5AFAA 4P9HC 4LT7A 4WU5B 2F8XC 1UATA 5I74C 2AJZB 1ZV5A 3SBPA 1YEJL 1ZSDB 5FYLD 1FYHB 4KOBA 3B9KB 1WPCA 1I7UA 2O6DA 2GUYA 2IPTL 2J73A 4TNWK 2Y0SA 4U4BA 4NQEB 2P47B 3AWGA 4WWKB 2ILLA 3VYPA 2ZPKL 3HBGA 3CMOH 2JQZA 2KC0A 3ZYZA 2AQSA 4NO3A 2OI9B 4NP9A 4PG9B 4LP5A 1KCSH 2EDWA 3E6HA 4ZOBA 2W60A 1U3ZA 1MWAB 1PX3A 3BUTA 5A2BA 1MHEA 2D9QB 1EDHA 3DIVA 4CGTA 1T2QH 4J3VA 4KNQA 1QTSA 1X5MA 2AEQL 4BH7A 1Y0LA 2KDGA 4RSYA 3SPGA 2AKRA 3VNZA 2WUCH 1A6WH 1CE6B 3KR3L 4EN3A 5D7SH 4B96A 3IDNA 1AD0A 2DL9A 4F7EB 5GS0H 2VUYA 3ZTNL 1I8MB 4LIQL 5ICYA 1RPUA 4B3VA 2IPKA 2R1YB 1AGCB 1UEMA 7PAZA 1OGAA 3D50A 3KL0A 2ZUTA 3TZVA 1S7XB 5K9QI 3MJ6A 5C2BH 1W80A 2MKWA 4LDLB 4OTXL 4N5ED 1LEGB 4ELMB 2BCKA 4F8QA 4FABL 3AS2A 1JN6B 4PGEB 3V0WH 1MCNA 3ZZLA 3BHBB 1BJ1J 4MA7L 2NY3B 1LO3L 4XC3H 4FQJL 2R39A 3S35X 2UZXB 4MAYC 1IC1A 4AEEA 2WB1A 4DN4L 5ICZA 4LQ1A 3PWJA 4LHJB 2V2TB 1CYWA 4AYGA 4LBEB 2GSIB 4K94H 4ZMWA 3L7FB 4XP6H 2GFBA 3B5HA 4TOYL 2NXYB 3F7PC 1PZBA 4NZRL 5EZLA 2HXAA 3FMGH 5E5MA 2IOMA 2XYBA 3G6AB 5EV7A 5FOBA 2XICA 2C4XA 4ZMNA 2X3AA 5C07E 4G43B 3DSNB 3L3DA 2A5UA 3IDGA 3O9WA 4LNRB 5I5MA 1UXWB 1HCFX 5CCHE 5EUKB 1H0DB 1YQVH 1PYWB 4LQFL 4H8WL 1EJ6A 4K07A 5T5NF 1Q9LA 5IJKA 2OSYA 1JNLH 1HINL 2N7AA 3CWGA 3N44F 1P4BL 3IS1X 5FKPB 2XWTA 5I73B 1TTGA 1X5IA 2EYRB 4MKMA 3DJZA 5IHHA 3RIFK 3D25A 4C4KT 1AZBA 3QEUA 1P7QA 3L4CA 1D5IH 5GRJL 3MXWH 3IPEA 4KQ3L 5ECGA 5KOVC 1MUJA 3QUYD 1SM3H 4HKXA 2J12B 2B59B 2WLHA 1LL1A 1F0LA 4PJEA 1MAKA 2BVOA 2VDPB 4WNJA 3VXRA 1G5GA 2Y36L 3IKKA 1KB9J 4V1DD 4YSTA 2BOCA 3DOSB 3CZKA 5CIPB 5IVXA 1TTUA 1I9JL 4ZG1A 3MLRL 1A7NH 5I1AB 4JM2D 5E8OA 2A6KB 1JZ8A 3JWNH 3C75A 3H53A 1L9SA 5CMAB 4EOWH 5HHXL 3BEVB 2ADGA 2Y7LA 4N5EC 1S9WB 3WIFB 1KJMB 2DQTH 1C12B 5C0CD 2B5IC 2X1OA 3IF1A 4XN2A 5LO7A 5E8NB 1NCTA 3TJEH 4IBZA 1L9PA 3DYMA 1QWUA 4TNWF 5I19H 4P2QD 1QLEL 5CEZH 5KG9B 1UB6A 3BLBA 4Z7OF 4PRPD 2ERJB 3IDMB 2ED6A 1WZMA 3ZE2F 2AV1B 1H19A 3R06A 5JHLH 3BPLB 3I3BA 4X0KA 1SBBA 2FATH 2JKJA 5IQLA 4PJ8B 3CDGA 2IBZY 3DRTB 1CO1A 7PCYA 1E27B 4QO1B 4ZW8A 3WEAA 6FABH 1F3DJ 4JN2A 5C0JA 2BHUA 5K59E 1A7QL 3GB7A 4N6QA 2NX5E 4XO8A 4XNUL 5I1JL 3KH4A 2PETA 5JMOC 3DUHA 4U7MA 4I4WA 1LD9B 4L8DA 4O02A 3TESA 1KEML 2EDLA 3QSKB 3S5LG 4I8DA 3LIZL 2GBUA 1JNNL 5IESH 1NMCC 5I6MA 3SZKC 3K0WA 4YHIB 5KVDH 4NQDD 4JE0A 1JD9A 5GZNA 2P49B 4MAYA 2G5UA 2QKIB 3F12B 5DHVB 5KSAB 3PNWB 4N2OA 1H5BC 2ADFL 2WSKA 3B2UD 4OZGB 1TJIL 2NCEA 3IN2A 2ZG3A 5CCJA 2OMUB 3FUDA 1PKOA 3QUYC 4APXA 4ZX6A 4PJFE 1XB3A 1AHWB 1OAQL 2VXSL 3UBFA 1N5YH 5EO0B 5JQIB 1KDJA 1ZVHA 2V4LA 3WLBA 5A6MA 1M9WA 1UHVA 2PUQT 1KBBA 4LZKA 1RP8A 3FOMA 2V2WB 5CD5D 1MFEH 4MA1C 2NDGA 1T7YA 1Z9SA 5HJ3B 5E9DE 1HXYA 2Y06H 2IOOA 4JM2C 3OAZK 2X1PA 2YLKA 4MGXA 2Z92A 1UCTA 4DHLA 4WI0A 3VFRA 2ZD0A 2I5YH 1MHHB 1I1FA 5C0ND 2F53A 1AGFA 2VE6B 3FQNB 5FHAL 2R4RL 3V9FA 3WHE0 2VLLA 4OZ4B 4MHHI 3NIDF 4H1LB 4C83A 2JF1A 4WO0A 4IJ3C 3V4VA 4X4MA 1DBAH 5KJ7E 4LARL 4PBDA 4LLUA 3ZDZE 3WMPA 3SO3C 4BZ2A 4PWHA 2GPZA 1A6ZB 5I66A 4IKLA 4G80A 1HEJC 3B7SA 5EA0H 1F6AA 4OQ1A 1PKQB 5CEYB 2D2CC 1OKEA 3BUPA 3PV6B 1JZ6A 5HYSG 4N24A 2ID5A 3RIFF 2JELH 3LN5B 3IGAB 2ZJSL 3S3JA 2IDTA 4JZNB 5A6LA 1OAUL 4C4KO 2NY5L 1FFNA 2YMOA 4HA1A 2VDNL 3WY4A 5L4FA 4AUUA 5C0EA 3L2LA 2DQMA 3MCLH 5AZ2H 5C92A 2BWQA 5HGHA 4BRJA 4GKNA 4RGND 1KNOA 2WNKA 1N67A 1N26A 2Z7WA 3GTVA 1JE6A 5A1AA 3OPZH 3VCLB 4BA8A 3JV0A 4GUOA 4YR6B 2YEZA 3DGCR 4N2MA 2EH7H 5GRYA 1KB3A 1RZGA 1K3ZA 4HXAH 2I26N 3RP1A 2HLFD 3IGKA 2HJLB 1GGIH 2CKBB 1UA6L 1M3IA 3B2UC 3CXFA 3FQTA 5KYUB 4BQ9A 1G9ML 3W81A 1CFVL 1NSNL 3OX8B 2G9HA 1Q1JH 5L4IA 3NCMA 1KTDA 3NSYA 3MRLB 4HIQA 4WU7A 2FB4H 4MS8D 1EH9A 2JKNA 4NGHH 1A7RL 1KGCD 2VDKL 4GEJA 2H26B 5D72H 3SDYL 3KWXA 4G7QB 5CD5C 1AO7A 4CRPA 4AZUA 1FCCA 4P59L 2OJEB 3Q1EA 3HKZA 4ATWA 2CBMA 1GC1C 2FIRT 4FL4B 1D5ZA 3SBWA 2H47C 4FTVD 4IK6A 4PN6A 4XN7A 1YDPA 1Z5HA 3PL6B 5C0NC 5KVGL 1CLOL 4WK0B 1KYUA 3LZFL 1OSYA 4KRPD 2HFTA 3CMGA 3REVB 3ATAA 1IB5A 4EUPB 2J8UF 1S6NA 1A1NA 4L8BA 5F7KC 5FDYA 5I0YA 4CC1A 2NSMA 2RA1A 3L4WA 4N0YL 5IJVB 3B9KD 3EYOA 3BLPX 2J1WA 3G5ZB 3HI6H 3QUYA 5K1JA 3WY2A 3D09A 4NQED 1N3NA 3LYRA 3EOBA 4J8RA 2W92A 4M6OL 3OF6D 4FQQB 4WWKD 5KW9L 4HPYH 5DJCA 1PCSA 1TQVA 3HI5H 1FVEA 2GIYA 2KT6A 2X09A 3KVDD 5DXWA 2FCBA 4H0HB 4H25B 5F9JB 4MLIA 2NUTB 4Y0GA 1XMWA 1N59B 2WNGA 3R19A 5KVMC 4U1GC 1OP9A 1OWRM 2Y5EA 3B8YA 3VFUA 5INCB 2WANA 4JZOA 4RISH 1UQSB 3M17B 4FNTA 4RGNC 3F62A 4PY8J 2FWOA 4TQEH 1N6QH 4P2QA 5B7EA 3ABLB 1EDYA 1OSPH 4IQHA 4JG0H 4NX0A 3KS0J 2ZWNA 3LNFA 3VG0L 1Y1UA 5C09B 2HLFC 4Z7IA 1LTXA 3GI9L 3ZL4H 3HW7A 2HG5B 2ITFA 4H8VA 2K0RA 1NEUA 4UYQA 1MZZA 5D5ME 2BERA 3T71A 1T0PB 3V6OC 4MS8C 4AVHA 4RFEB 2WQAA 4XHJD 3AREB 1KXTB 1E2VA 2IGLA 4Y9EA 4W93A 5AEAA 4A7GA 2NY3D 3O2VL 1NGXA 3UZQB 3ATEA 1ADWA 3BEWA 4ZFGL 3Q5YA 4U7SA 3G5VA 1ZVNA 3CFJA 5IM7B 4OKVB 3S5LA 3WTUA 3TYFB 1KDIA 1RUPL 4HWZA 3C6LB 5EDSA 3E38A 4NQDA 4D8OA 3V0VA 2NXYD 4GKZA 4KRPC 5JQHC 1FLTX 1XL4A 1L5GB 3MUHL 1BEYH 3DROB 4MXWL 3I75A 1JGLH 4UNUA 2V33A 1BD2B 4JFQB 4R4BA 3FW6A 1DSFL 1J12A 1IQDA 3B9KC 1NL0L 1YMMA 5IMKA 3TT3H 2JI3A 2ITCB 4RAVA 4WWKC 3HIZA 3HG1E 4NO2A 1YEKH 1B0IA 2QVFB 4EEEA 2AERT 1A0QH 3RUGA 2OL3L 2OI9C 5IB3A 1XF4B 3PNRB 2IXQA 2GBTA 3EJJX 4NQCE 3L5IA 2ED8A 3KPRA 5D7IF 1XQ4A 4MJ2A 3X3FL 4GKLA 1N0LA 4JFSA 5E8DH 2P4AB 5EB9A 2VDRH 4GIOA 1K6QH 1RIUH 4JJ5A 1XDTT 3WKPA 4DW2L 2B77A 3A23A 1PQZB 2FL5A 1NBYA 2B9BA 4HDIA 2NNXA 5FO9B 3FQ1A 4Q0XL 5IMLB 2RACA 2CA4A 3KL3A 1FZMA 3POCA 5D7JB 4E9XA 1DVXA 2F8OA 4QRUA 2KQNA 3FFCA 5FM8A 4XP9L 4IEFA 2LVEA 3O0RH 3IJEB 2JLPA 5HYSA 3QUMB 5BV7B 2ZOLB 4LLYB 5TE4H 3NQKA 3OJMB 4XHJC 2XN9E 2GG1A 3QDHA 3EJZC 2NY3C 3WHXB 4OJYA 1MIEH 2YD7A 3LH2H 1AI1L 2A6JB 5F1SA 5B21A 1E6OL 3QUZB 3A6CL 4JO4L 2XPGA 4YDIL 5T3ZL 1Z9PA 5F7DB 4RX4D 2YAPA 2UX6A 4GQQA 2DQJL 4PJ8D 4AJVA 1MPAL 1WISA 4PJHA 4FNPA 3C12A 4XP5H 2F74A 1S7RA 3RNKA 3IS0X 1ZVSA 2FQDA 2P8MB 1PVHA 4HGWB 1AZZC 1DDTA 3SPVB 2IANE 3AGWA 1ML0A 3V6OA 4DKTA 1KGJA 4P9HH 1MFUA 2EE0A 1DZ0A 3QARA 4JQIA 5GPRA 1TMCB 2VLRA 1EAQA 4PJDA 4FMKA 2KBGA 1X5ZA 2EQDA 3CMOL 4N20A 2CGZA 3JZ7A 3QXDB 1CFQB 5K9KA 5KSAD 3I9IA 3RX5A 2MCPH 4HX1B 1KCSL 4KO9A 4KXZI 2VLJB 3PWNA 4XMXA 2H2SD 1OK8A 2QZQA 1A6UH 1FC1A 1KB5B 9PCYA 4YE0A 1T2QL 2AZAA 1RJCA 1GGCH 3VFMA 5EPMB 4WU5A 2WUCL 3ZE2E 2R4SL 3ZE1B 4NUJA 5LN8A 2CG9X 2QHLA 4HQQH 2AS5M 4OGQC 3WKQA 3BSZL 5D7SL 4DGVH 5CLWA 4J2XA 1AQDA 5GS0L 1BW8A 2XTSA 5BW7C 5C0DB 1KY6A 1MREL 3DXAB 4HOMA 1C5DA 4JFDE 5C2BL 1BFVH 1JYNA 4NOFA 3QG6B 5D2NA 5DZVA 4DERA 1IE4A 1BLNB 3CZUB 3VYNA 4N2IA 3V0WL 3FUHA 1RY7B 1Z0MA 3VMNA 3KPOA 2WUBH 4H5SA 4WI3A 3OTTA 4XC3L 1CLCA 3NCCB 5E8EA 1U8IA 2ZCZA 3DBXA 1KCKA 3IJ9A 2E8YA 3BPLC 2ZX9A 3Q3GB 4LKCA 4AM0Q 4GBXA 4NQXB 3N9GH 4UILH 1FORH 2VW6A 3MBEB 1LWJA 1UVQA 3I3DA 4K94L 4PJ8C 4F2EA 4F7EA 3T08A 4QHUB 5KBDA 1AGCA 3M88A 4CADA 2XTLA 3F01A 3FMGL 3TV8A 3ARFD 4QOKE 4YL9A 2CR6A 4ZOCA 3VXPB 4LL4A 5AKTA 4TLUA 2Y5TB 1OE3A 1HKLL 3CNKA 2C3XA 1CS6A 3BP4B 3NFPA 3WE6A 1WT5C 3CN1A 1A1MB 3DV4B 3KPQB 4Z3FA 5FDWB 5GGSY 3PPEA 2WAHA 1J05A 5FO8B 3CG8A 3NJFA 2OA9A 1JI2A 5FUOH 5FYLH 3ARDB 2GQHA 4I2XE 4ANVA 3NABH 1S8DB 1KXQE 1WAAA 2QKIC 4I9XA 1UWYA 1JNLL 1O9ZA 4LCVA 1JZFA 5F3FA 3V4PB 4NZJA 4ZTPL 4WWOA 4BKLA 4C59B 3MLYL 2H2SC 3NIDE 4MXQD 1CDIA 4Q14A 1J9TA 4NWUH 1Q9KB 4WRLA 5JDSA 1D5IL 3MXWL 5D1QE 4HALA 3DSNA 4WTZG 1KACB 1SM3L 3KW8A 4GSQA 2X2YA 3V4VH 3ZL1A 4AVJA 2BMKA 1DJYA 2YC1A 4L48A 1UXWA 4R8WL 4OCSH 3I3EA 4ODXB 2C8NA 4J3OD 4J3OG 3DX6A 4UU9B 3VFOB 4GP4B 5HDQH 4Q97A 1QSFE 1T20B 3RPBA 3PL6D 3Q8BA 2W59A 3BH9A 1D5BB 3U82B 1E9QB 4AQOA 4CDHA 4FQXD 1BEXA 1JYVA 2R56H 2DQTL 3TA4D 3MGTB 3KHQA 3WNPA 1LMIA 4G8FB 5DJYA 3NCBB 5E6UB 4ZSOB 1URIA 4TQ8A 4KH2A 3FU9A 3TJEL 5CEXB 3MUGB 4L3AA 3BVWA 2J4WH 5I19L 1NH6A 2BSEA 5CEZL 3MRNB 3QFJA 3MLSH 2DY2A 5FGBC 1X5HA 1V55B 3VYOA 2R0WH 5HHPB 5H8DA 1DQVA 3SGDH 1AGDA 2W38A 3FT3A 5ABZA 5JHLL 1JK9A 1PMYA 3DTDA 4OCWH 2XTJB 1K4DB 1OGSA 3DOSA 3IMSA 5J1SC 3ESMA 3QXUA 4IMLB 3ARFC 4JDZB 4OZFB 1YMHB 2P5PA 5BW7A 5AB0A 2HX8A 4Z8FH 6FABL 4DKDC 1JRHH 2WSDA 4JFEA 3MROB 3D4CA 1S9WA 3FRPB 3WIFA 5JOEA 2X3BA 2VDMB 1C12A 2X6CA 3GBEA 3GT6A 4LCWB 1UKQA 4LASH 2XV2A 4M6NH 2DYPA 3JTTB 5E8NA 4NC1C 1CI5A 2J21A 4D0BA 3OMZA 5JIMA 2GCYB 5AKRA 3H7BA 1T04A 5IESL 5I6LA 4BUHA 5KG9A 5KVDL 4DP7X 4B9JA 5H4YA 1LM8V 3P0YH 2Z8WC 1QBML 3CFIC 5C09D 3P1VA 3G04B 4EXKA 4K15A 2WYZA 4WWNA 2G4EA 3VU2A 4RX4A 5FF6B 3G9VA 4PJ8A 4MXQC 1XSJA 3HPLA 2J8UE 1SJMA 4MNGA 1B6UA 2MCMA 3S2AA 4JFUA 2BVEA 2QQNH 3BVVA 1I8LC 4TL5A 5DGRA 3S5YA 2R2BB 3ARED 3LIUA 3K8MA 1N5YL 4AUYA 1DUYB 2M1KA 1FH5L 2CIIB 2MNWA 3OKLA 3EGXB 3V5HA 5J12B 4M7LH 4J3OC 3T8VA 4FL4C 1CDCA 4NPYA 1I1CA 3VRLE 1CXHA 4S1DD 3C6LD 3NJNA 1UGKA 4M43H 2OTWB 3GZOA 3PL6C 4GQ9H 4PP2B 3QW9A 3VGGA 4ZTOL 4BFRA 5FS5A 3O4LE 4W6XB 5AVYB 4NQSB 4FQXC 5JO5B 1M53A 1UXSA 3ARBD 5DD5H 1U8PB 3HTLX 4DNLA 3EDKA 2KUTA 3DVIA 3PNWA 4BZYA 2YD6A 3FK3A 3MNVB 4UT6H 2HT4D 2CRZA 2W9EH 1BD2D 1QLFA 4OZGA 3VDCA 3II2A 3WIHL 3PIQB 1XT5A 1DBAL 3O41A 2P8PB 4W6YB 1LO5B 4OFYD 1NCOA 1YECH 2CXGA 4HJJH 1ZLWK 1ZV2A 4XVUD 1X7SA 1DN0A 1MAMH 1W0YT 2XJKA 2CR0A 2DTML 2IAAC 4BE6A 1I1AB 2OJ1A 3SGKC 2G9KA 1DE4B 1ZE3H 2JELL 2XYCA 1XSIA 3AAZB 3HC3H 4AMXA 1MFVA 3STLB 1ETZB 1PU0A 3Q44A 2X05A 3FZUC 4HWUA 1NM9A 4XMKH 4DFIA 3ZT7A 1BX2B 2XWDA 4F2MA 2ZAGA 3MCLL 1BZ9A 1BMWA 4JQXC 1F86A 4OD2B 3RVXD 1VFAA 3P73B 1A9VA 3OPZL 2Q8BH 3NACH 1W8NA 5D7JD 2X4OB 1R1CA 4ZPVB 3T3MB 2DLTA 4HXAL 1GGIL 3CFDB 4O2EB 2FZ3B 2ZWSA 4RGMB 1SY6L 2B1HH 1NBZA 3OMIB 1Q1JL 1YJDC 3LNDA 2R1WA 3AREC 4JANB 4YE4H 3ARFA 5C08B 4GSDH 3GUTB 5E1HB 2FB4L 1XGTA 4R7DA 1U8NA 4M8VA 2WWKT 2ICWB 4NGHL 5FM5O 5D72L 2KS0A 2KZWA 1KLFB 3V4LA 2X5PA 4XBEH 2PWDA 4F20A 4UUJB 5I1IH 5EC1A 3QUZD 4S1DC 3C6LC 1PDKB 3O3AA 4IIQB 4RCAA 5IHBA 1CTOA 3U4AA 5DUPH 3ZKMD 5GGVH 4YR6A 3ARBC 5D7IE 3VXMB 1GAFH 3ZGHA 4M4RB 1P6AB 2V9UA 2VQ1B 8CGTA 1GC1H 2HT4C 1NJ9B 3FUIA 4MMXB 3SY6A 4GUPB 2EZ0D 2OR8A 3V7AE 2YLHA 1CGWA 1HI6B 3VRJB 4N2KA 1I8LA 4I85A 4XVUC 3HI6L 2H26A 3MV11 2WM0A 5DHMC 5IIEB 3KBPA 4DP0X 1X5FA 5FOJA 35C8H 1M57B 4HPYL 4MDJA 2DQUH 3JV6A 1N8OE 1OTUD 2P48B 3HI5L 2H6OA 1DLHB 4A7UA 4ZDHA 1CWVA 3P9WB 3UJJH 3GSUB 5H35B 1GYCA 2VLJD 3GSRB 4WFED 5F9AC 1VZGA 5KS9B 1EHLH 4X4ZA 2VRQA 3HC0B 3HC2A 4FQXA 5G4OA 1ASPA 4HLZG 2YWZA 3REVA 2OM5A 4K2UH 1ZD6A 1AFVH 2G2PA 4DOHE 4RISL 3RVXC 5LAPA 3WU1A 1IAII 3OXRB 4UV4H 4NC0B 1RZFH 1SXNA 1BQ5A 4TQEL 1N6QL 2CXKA 3O6KH 1VEOA 4NRXB 1DJGA 1OSPL 4GT7A 4JG0L 1R19A 4YQXL 4CN1A 1AZRA 5D7JC 3SD5A 5C07A 3UCQA 3MO1B 3ZL4L 1UXMA 2ZCKH 3DXAD 3QR0A 3T65B 3X1EA 5BV7C 3QPXH 2BVQB 1FVCB 4XNDA 4HFUH 5DRNB 3F5WB 3SGKA 4H25A 3AMLA 5D7LB 2AW2A 3AG2B 1WC7A 3LMJL 4F2FA 7FABH 3KNBB 1CXEA 3AQZA 2VL5A 2E4TA 2HVJA 4KI5D 4S1RH 3AG3B 3QUZC 4N0UB 1UQSA 3M17A 4KK9D 2X4SB 3VD3A 2VSKB 5IHLB 4JQXA 1XCTB 3MBED 2PR9A 2JKSA 3ZKMC 4EI6A 1KBWA 1HL9A 2MWCA 1ZGLB 3RZCD 4AITA 5ACZA 1INQB 2DN7A 5LBSA 4UZGA 1BEYL 3SYQA 4EVNB 1WFIA 1JGLL 2A6IB 1IU1A 2A83A 2IWGA 3LQZA 2Y1ZA 3GXPA 5IB2A 3NVQA 2CIKB 3UTZB 4X83A 4YDMA 3HN5A 3WUZA 5E2JA 3TT3L 3UZQA 5I76B 4F33B 3VG9B 1MCCA 1ZA3B 5GJSL 1YEKL 1U8MA 4Y9FA 1OTUC 2CO1A 1INDH 4OKVA 3F8UB 2A7BA 3NT0A 5K39B 1ONQA 2WP3T 4NUGH 3C6LA 4X8JA 1HIML 3M1OA 2PXYB 3FB7B 4W9JC 4CMHC 3IDUA 1IEHA 2OQJB 3DA0A 2CHZA 3ARBA 3B34A 3BWSA 1OE2A 3AZUA 4QTFA 4QHPA 2VDRL 3I02A 3CD4A 4HFWB 1K6QL 1J48A 2ARJQ 5DD1H 3GTNA 5E6IA 4ZFFA 3U2SB 5IBUB 2GHZA 3D85B 3OXSA 1HS6A 4U31A 3KGTA 4OFYA 4AGQA 4XBPB 2OULB 2EVFA 5DK0A 2AEPH 4PHZA 1FUNA 2NX5A 4LGSB 5IEHB 2ZCLL 3UAFA 2WXIA 3NRQA 3WENA 3TBYA 4HJIA 4EBQL 5A2FA 1SXBA 5TE4L 3M86A 2J8HA 2WQSA 4AQEB 4IOSD 4XX5A 2XIBA 1EJFA 3EO1A 2Z64C 4PJ7F 3P77B 4HBQA 1JL8A 1RZJL 2HTLC 5EU6B 5E2UL 4MJHA 5DJ6A 3NAAH 1MIEL 1EXGA 5F89B 4KK9C 4LPVA 1O6SA 2O5NA 4YBHA 2ENQA 4CN4A 2GAZA 3MBEC 3MFFA 3MA7B 4X5RA 4RRPG 3STZA 1AJ7H 1PQZA 4C4UA 2MNJB 2JB6B 4CVUA 2XTJD 3LRLA 3RZCC 1ROCA 4PJFA 5IMLA 1D6EA 3NJVA 4LOEA 4OLZH 1YYLH 4I88A 5IW6B 4WWID 4EZKA 4DP9X 1KCUH 2C1OB 3MJ7B 4PY7A 4ABQA 4YSPA 2WLZA 1VKXA 3FB8A 4JFOA 3ULUD 3WS3B 4CKVX 2BZCA 3RBSA 4LCWD 4FAAB 1CTMA 2EDXA 3UH8A 3ZXAC 1AHKA 1Z1WA 3HR6A 1L6ZA 4P9HL 1G94A 1CCZA 3IMTA 3T8XB 3BWZA 4FQHB 1JOIA 4RQQA 5DJZA 1NCGA 1UYWH 1QSEE 3B7RL 1TTCA 2AJ3B 1X4XA 4YMPA 3KS0H 5E08H 2BZDA 5DR5H 2WHVA 3EFFB 1QPPA 1QZNA 3ECVA 4X6DB 2X40A 1Z66A 4DUWA 3H0TA 4JN1L 5I17B 2YOCA 2WLLB 4W9HC 5KEZA 2BSTA 4Z7NF 3K2KA 1NCBH 3T4YB 2ORBH 1GGCL 2P8MA 3QQ9D 4FCAA 4HGWA 4AQAB 4K3DL 1DBBH 1MCJA 4HHGA 3U46B 2ZNXA 3ABMB 3UTTB 3B3IA 3ML9A 3FQ2A 4HQQL 1FJ1A 5ETUB 3Q8AA 1U8JB 2K6YA 4DGVL 3AUVA 3B2XA 4HUVB 5I1KH 5E8PA 4IIZA 1G7PB 3VJ6A 3BESR 4HIHB 1A7OH 4L3CB 5CIPH 3RWHA 4BWTA 5HYQA 4PAZA 2YHGA 1J10A 1BFVL 1L0QA 2FT6A 1DVTA 1S7SB 3EBHA 3MPCA 4I3GA 4WUKH 2NNRA 3TA3B 5IOPA 1F4XH 5AZUA 3I50E 1SDDB 3VM5A 1O7DC 1UD8A 2VJ0A 5CUSH 3CLEL 5HHQA 4HWEH 5H94A 2ICWJ 4JY4B 3MOBH 5EPMA 4ODHL 4O02L 2IF7A 2XPYA 1WE5A 4IU3A 1YUHA 4CDGC 4QRRE 4V11A 5JIKA 4XN4A 2XTJC 2AQ2A 3BAWA 2YD1A 3ARGB 1I1AD 3LX9A 3N9GL 5DUBB 1ZJAA 3DX8A 1X5LA 5C0DA 4L5FH 4ENED 2RTTA 4HLEA 4XXCC 3KPSE 3EOTH 5JOFB 1RZQA 3EBAA 3ULUC 3CSYA 3AXIA 4BM7A 1SEBA 4L4TB 4AI7A 3ZRCC 1QRNB 1MOEA 1BVOA 3WUWB 2VMFA 1G7JB 3HMXA 1K85A 4ORGA 4Y16B 4WTWA 5EO9B 1T4KB 5JIHA 4YJZL 5FUOL 3RFZC 1A6TB 3OJ2C 3UABA 1H15B 1U6AL 4NYLB 3NABL 2P24A 3PFQA 4WKZB 5M94B 4TVPD 4AVKA 2H45A 3Q3GA 1FNFA 1ERNA 4UQ2B 4QEGA 3ABKB 3MBEA 2H32B 4FZEH 1KPRA 4C58B 1UUNA 3F7KA 1L6XA 3BCFA 1IGIH 2Q3AA 3RZCA 1EUTA 2JJSC 5DHVH 3AXLB 2DI8A 3QQ9C 5C08D 4NWUL 5D96B 1ZY9A 4KKAD 4A6YA 3KGSA 4PUBH 4RETB 4U6HA 5SWQB 2VUOA 3LKPB 3V4VL 5J12C 3OHXA 5DJ0A 2HJKB 4BZ2L 3BAJA 4OCSL 3BPCA 4OCMC 3PREA 1H6TA 4G8EB 1VF5C 1S8DA 1UZGA 5HDQL 1DFXA 2WZ5A 4L2LA 4LVNB 4QJ3B 3VXMD 4J3TA 5DO8A 4OF6A 2R56L 1KTRL 4MD5A 2APXA 3BO8B 3GIZL 5F6HI 4NHUA 3U6XA 3WTTA 2PCPB 1YSOA 3ZTJH 1BBJB 1UH2A 3GQFA 3T6XA 2J4WL 1Q9KA 2MTAA 3TBBA 4YAQB 3MLSL 1HJBC 3SJVE 2HT2D 1YC8A 4H1LH 2R0WL 5CILH 4AV0A 3RWJA 5DRZB 1MNUH 4LPTA 1I1AC 5D5MA 1JPFA 2D7PA 3ERXA 3D0VA 4U1NB 2FUTA 3SE9H 3WJJA 1EEZA 1IBDA 3VFOA 5B1KA 2P9RA 2SEBB 3QA3A 5JORB 2Y7MA 4PV8A 1JRHL 1D5BA 1E9QA 1HH9B 4Q74A 5TH2B 1A7PH 5BZDA 1PD6A 3K6NA 4P23B 1MN4A 4N28A 1VAHA 4M6NL 3IDXL 5BNXD 4XAWH 4QR7A 1KFAH 2D3VA 1BM7A 3PP3K 3MGAA 1NCAH 5FYKE 4IKKA 1QATA 1LP9B 1QW9A 2IADB 3P0YL 3SIKA 4TVUA 1JHTB 1A8JH 4RRPA 3NESA 4RGMC 3WXWL 2ZOKA 3NYKA 4JMNA 2VCOA 2KLRA 1MJUH 3WI9A 1JHKH 2CKBH 2QQNL 2UVEA 1OM3H 2A9NH 5E1IA 3HZ3A 4KKAC 2R83A 5J13B 2HFFB 3HG1A 4NNXB 5GSRB 3Q43A 1HTYA 1QNZH 4Y9GA 5HPMA 5HVFB 4PYHA 4ACPA 3IE4A 4NQCA 2YJQA 2JIXB 5I75C 2JK5B 1HZHH 2A9CA 4MAUH 4F7MA 4IIQC 2HT3D 4K9JA 3OKMA 4I3RL 4M43L 4GQ9L 3RFZA 3O3EB 2GABA 1GSKA 4Z7VF 5LCVA 1M05A 5FW6A 4IW4C 4J3OH 4PJAF 4X8GA 2PTUA 5DD5L 1E90A 2F8IA 2E27L 3BPOC 4MMXC 3ESPA 2W9EL 1LLAA 2AJYH 2UYLA 3SKNB 2TAAA 4F58H 1TKWA 1AXIB 2EE3A 3PWPB 4MJIB 5EBLA 1Q0XH 3E9UA 3NEOA 4ZNEA 1YECL 4HJJL 4Z0XB 3RWDA 2BC4B 4BK5C 1DUYA 2BXYA 1MAML 1KG0B 2E74C 2XN9A 4N3TA 3KLHD 2YPKA 1K5NA 5HDBB 1J9SA 3QO0A 4PEEA 3U2GA 5DCCA 3SKMB 2F08A 4JFZH 1U8KA 3VXUB 5DHEA 3TBTB 3GF8A 2FYYB 2VM9A 3HC3L 4QRPB 3L3IB 1MLCB 1XEUA 3JTSA 4JY5L 3UBXI 1FNGB 1T3FB 4G7SB 4JY6B 1UFGA 1N6UA 3HZMA 2ARWA 3QC5X 1NAKL 1A2YB 4XMKL 3UXFA 4Y4FA 5ESQB 3ZQXA 5EEVA 1QSVA 2Q7NA 4G1MB 4HH8A 5A2JH 1RCYA 3OG6B 3D85D 1RHHB 1UCBH 4HKZA 4JO3H 3VMPA 1S9VB 2HUHA 3X13B 1M7IB 2X0UA 4UDTB 2IV8A 5F6IB 3HOGA 3D08A 4HD9A 5AAMA 2Q8BL 3TCTA 3NACL 4JB9H 3MRJA 3O6FB 3IEAA 1PZUB 4LCUA 2B1HL 4E0RA 4IDLA 4FFZA 4YHLH 5LBSH 1NFDB 4NZUH 4JLRA 4YE4L 2WOBA 4GSDL 5E00B 1UD2A 5EU6D 2DQDH 3O4LD 4N9OB 2CRYA 4O2CB 3KDMB 4OSUH 4AQ1A 5F9OH 4LLWB 4HSQA 1YJDH 3VSQA 3N1QC 2D7QA 2DQ6A 1WWCA 1V27A 4XBEL 2BFGA 3NP3A 4KQ4H 5I1IL 3NUKA 3ULSB 4I0CC 4R26H 1JZ3A 3NZ8A 1WEJH 4MMYB 3W56A 3BQUB 2F6AA 1EV2E 4GT0A 1OAXH 5DUPL 5GGVL 2J5LC 1GAFL 1HYRC 2VUKA 2PYEE 2ZP0T 5J8OA 1JXDA 3T3PE 3RE0A 5ILTH 3CN4A 3MX0A 4JFPB 2D3NA 3P4NA 3WFHB 5KYXB 3TJHC 5EUOB 3DHMA 3ZDYF 3L9RB 3BDBA 1B3IA 4JFDA 1LK2B 3VG9C 1GS6X 5FIEA 5T1MA 2XLLA 3KLHC 3V95A 2WBJA 4Z3EA 3FOLB 2LE9A 5DQJA 3WTSA 2DQUL 1VFBB 4RDQG 1FFPB 4J2QA 4AL8C 4IIQA 3UJJL 4G5AA 4U49A 4WHTA 2JCCB 2GYSA 5D1ZI 4PJ7E 4XTRD 3VXMA 4XE0A 4X5QA 1EHLL 1JPSH 4M4RA 5H37G 3MV8E 2I7SA 5T1LB 1NJ9A 4K2UL 4TTDD 2VERA 1AFVL 4HIXL 4WW2B 3ELAT 1TTFA 3LXCA 4YSCA 1EANA 4UV4L 1E8WA 1FO0B 1RZFL 1XSOA 1BQUA 3KVPA 4Y2DD 4LOVA 2VKWA 1CYGA 4QOKA 2F18A 5K1NA 2F5AL 1NOFA 1W0VB 2GY5A 3NTCH 1QOKA 4D9QD 4NIKB 3GGWA 4BK5A 1IKFH 2ZCKL 4P5SA 1SVCP 3QPXL 3WOVA 1RURH 4BSWB 1EO7A 1RZ8A 3CUPB 3KJ6H 1Z6JT 3MRGA 3VA6A 2BP8A 3H85A 5EN3A 3TA3D 4AXWB 3GSUA 3GMPB 4I2XA 4NN5B 4HZ1A 5BV7H 5TDPB 5E5LA 7FABL 4U3SB 2J43A 1IZKA 3HG5A 3DMMA 3BDYH 5AVUB 4HVBA 5J6HA 4OGAC 4FHBD 1F4WH 2RBLA 3OXRA 2VZOA 5AAWC 3F85A 3UG4A 2BW4A 4JQIL 2JV6A 4XR8C 8FABA 3ARGD 5DJAA 4NRXA 5JQ6L 3TTSA 3S4SG 4HWNA 3N3EA 5D1QA 4IRJB 1A6VH 4BWUA 4FQ1H 5BOJA 1B4TA 1J9RA 3L7EB 4JFHD 4YHYB 3KEDA 4MYPA 4Z7NE 3W5MA 2A0LD 2PWGA 5ESAA 4GG6B 4KVPA 4NDMA 2HRGA 5D4IA 5IVOA 4KDWA 1U3YA 3DX3A 3QHTC 3T0XA 5B7MA 4Q7DA 5DRNA 3DX7B 4H40A 2QGBA 1NC2B 1FFOB 4L4TD 2ED7A 2N0MA 1QRND 5GGVY 4LDCA 4BFBD 4TSCL 1QSFA 4A7VA 4Y16D 3S48A 3O11A 3CZLA 4EMZA 2VN7A 3JZYA 4ZUSB 3BWAB 2UY7B 3CSBA 1INDL 3NPZB 5FK9B 1WICA 4G9DA 4NUGL 4BKTC 4XTRC 3C8KA 4Z5RB 2JJUA 2DBLH 1ZGLA 1J5HA 3MUZ1 3RL2A 1Z0NA 1ZT4B 4PJ9A 3PQYE 4R83A 2E9BA 4YC2C 4TTDC 3R4DA 5DFTA 1QFWI 1A14H 2OLDA 4Y2DC 5F71A 2EDEA 5HHOE 5MEPB 1OP3K 3RWFB 3U6RA 2AJUH 4HLZH 1SOQA 4YDVB 5D4HA 5GGUB 5F0PB 3U9UA 4JUSA 1B2YA 1EWHA 2CZNA 5CGTA 1EVUA 4XO9A 2AEPL 3W11D 2NR6D 1NMAL 5GRZA 3V5DB 3IVKB 2EYTA 5KYNA 2VKXA 4YSRA 1C5CH 4PJCE 1Z3GH 3GIVB 3NJIA 4CNIA 4UI2A 2W0FA 1NDMA 1BQKA 3KXFE 4U6VL 1OAKH 2OYPA 2OQJA 3D39B 1VPOH 3N6YA 3R7QA 1TVHB 1OCWH 3NAAL 5KANI 1G7MA 5E4AA 1QVOB 3RWEB 3HMXH 1NOLA 2AQPA 3U30B 4M02A 3MOQA 3D85A 4L4VB 1KYOJ 5HDRA 3L3OC 2DRUA 2EAEA 4JS7A 4PV9A 3V0EA 1NDGB 4Y7MA 1YY8A 4K5MA 4PS4H 1EZUA 4B9IA 4OLZL 3RY6C 4DAGL 2A0LC 1GVIA 1YYLL 3BFWA 3FQ4A 4RZCB 5ECJE 4XO3A 1KCUL 2FSEA 5I1CH 1NGYB 1BPVA 2BVUA 2VR8A 3T6QC 4P23D 1U91B 4CU7A 4M1DH 1CT8B 9CGTA 3BVXA 1E5CA 1WZ1H 3QWRD 4UANA 4LSRH 4Y16C 5EU6A 4A6YH 3NIFE 4CSPA 3KL5A 3O4LA 4OZIF 3DI3B 2C4FT 5DS1A 4XPBH 4KUCF 1PD0A 1V3JA 1HT6A 3MLUL 5E2VH 1UYWL 5L8KB 3N06B 1TTBA 3O45B 3CX2A 5AAWA 3QQ3A 1E4XI 1X5AA 3N43B 1DANU 2MFNA 5MHSD 3TNMB 1QPXA 1SJHB 5F88B 4BH8B 3LKOB 1T5WB 4MMZB 1I8IA 3KM1A 5D96C 3CIQA 5DHXB 3WFBL 5IFAH 5CZRA 1T0NB 3QXTA 2ORBL 3QH3A 3QULB 3N42F 3F65A 2NY7H 3UJIH 1VLXA 3WS3A 5LVEA 3VWJB 2IAMC 1GS7A 1MXDA 2JIXD 2YD3A 3W11C 1U2YA 2NR6C 5EORH 5JNYB 1OWWA 5I1KL 3MRIA 3DHJA 1JGDB 2DLHA 4FJZA 4LVNC 1U42A 1D2PA 1A7OL 1S46A 1Z3RA 2AJ3A 3PHQA 5DS8B 4WUKL 1F4XL 1RUAH 2VDOB 2A74A 4DGUA 2FHBA 3MHZA 4NFDA 4BQ6A 1NIBA 5CLXA 5CUSL 2R59A 3PWPD 5H37A 4HWEL 4P5MB 2Y5QA 2EACA 3MOBL 4Y1SA 4MZIA 4PWKA 4WHYH 3U46A 5F3BB 3QE5A 4YN3A 2KERA 4J8QA 3EF7A 4Y2DA 4GO6B 3FUEA 3WSQH 3GSXA 2PWHA 1DTUA 4HUVA 1J8KA 3VXUD 3CFCH 4L5FL 1IVTA 4I5BA 2DJUA 4HIHA 1IGCH 4L3CA 3RWIB 2WZ0A 4NRYA 4QRPD 4EI5A 3CFKA 3DO3A 2PPDA 3IFPA 4P23C 4ZS6D 1XH2A 2OPCA 5KSVA 3VXSE 3GSOA 1IFHH 4N6RB 1G6RB 3FH8A 1XEDA 5J9PB 5HI5D 2P7TA 1QP1A 3BWUF 4U1SA 3ULUH 5TQ0H 5D7IA 4YHZH 5DHYA 1SQ2N 1WITA 2NNAB 1CN4A 3O6FD 4PJAE 2OCJA 4NT6A 4C56B 1B2WH 4FZEL 3L4ZA 4UT9A 1KMGA 5DUBA 5LCVH 1PLGH 3L3OA 1I9EA 5EOTA 3LZRA 3S4SA 1IGIL 5K9OB 2E7BA 3F84A 2V2XA 5I5JA 3B5GA 3R8QA 4UINL 2PW2B 1BVNT 3SQBA 4PUB