4GT0A

Structure of dengue virus serotype 1 se containing stem to residue 421
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
402
structure length
390
Chain Sequence
RCVGIGNRDFVEGLSGATWVDVVLEHGSCVTTMAKDKPTLDIELLKTEVTNPAVLRKLCIEAKISNTTTDSRCPTQGEATLVEEQDTNFVCRRTFVDRGHGNGCGLFGKGSLITCAKFKCVTKLEGKIVQYENLKYSVIVTVHTGGTIATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNEMVLLTMKEKSWLVHKQWFLDLPLPWTSGASTSQETWNRQDLLVTFKTAHAKKQEVVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKLTLKGMSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGKMFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a dengue virus envelope protein late-stage fusion intermediate.
pubmed doi rcsb
source organism Dengue virus 1
molecule tags Viral protein
molecule keywords Envelope protein E
total genus 67
structure length 390
sequence length 402
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gt0A04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 4gt0A01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 4gt0A02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 4gt0A03
5GZOA 2JSFA 1PJWA 3UC0A 3G7TA 4UT9A 1URZA 3J27A 5KVFE 4L5FE 4GSXA 3UYPB 4AM0Q 3IRCA 2ALAA 3N42F 3N41F 5AAMC 2I69A 4ALAC 1UZGA 3C5XA 3MUUA 4GT0A 1S6NA 4UTBA 4UT6A 3N43F 2R69A 4UTAA 5H37A 1OANA 3C6EA 5JHLA 5LBVA 3P54A 4BZ1A 3N44F 2JV6A 2P5PA 5IZ7A 5JHMA 3UZQB 2H0PA 4FFZA 1TG8A 5B1CA 3UZVA 5KVDE 2HG0A 1SVBA 5LCVA 4AL8C 5KVEE 3J2PA 4UTCA 1OK8A 1ZTXE 1RERA 2JQMA 2GG1A 3UZEC 4FG0A 5IREA 3N40F 5GZNA 4FFYA 4BZ2A 1Z66A 4X42A 5LBSA 5AAWC 2R29A 3I50E 5KVGE 3VTTA 3WE1A 1OKEA 3UAJA 2V33A 1Z3RA
chains in the Genus database with same CATH superfamily
4WI4A 3BGMA 4RFOL 3G5YB 3RZCA 3JWOC 2YMXH 4KVCH 1R46A 4NKIL 3SBRA 4JJ5A 3B9VA 5B7FA 1A4JB 3ZDYF 1U92B 3V0EA 4XCYB 5DVKA 4KTEL 3K72A 4B5EA 3V4VB 4MJ2A 2ZTBA 3EGSB 4F58H 2WN2A 2VITA 1TCRB 1A7OL 3F7YB 1MVYA 5DZVA 3V6BR 2J7LA 1ET5A 2WKGA 3GSOA 4PY7B 3L5XL 1JHTB 3MU3A 1BD2D 2EKSA 1ZT7B 4PJCA 1EZSA 3O8XD 4G6FD 5F0MB 1ZGLP 2IC2A 3P9WB 4HCRL 3UTPE 1XB3A 3W1ZA 4FQIH 3QNXB 5I1IH 4M93B 2CKBL 4HLZH 1QNIA 3HLAB 4I3GA 1A1OB 3PV6A 2Y4SA 2F54A 3N04A 1PL3A 4JPKH 1J8KA 3QDMD 5C9JB 4OLXH 4ODHH 4P23D 2ZXQA 1OPOA 4G6JL 3T2PA 3ME0A 4YSEA 2ICEA 4XWOD 3F7VA 5JOPE 2E7DA 4OQTH 3DGDA 4FL4B 3FQXB 2QVKA 1E4JA 4QHMA 2IDFA 3AAZB 1I1AC 4IOFD 4ZD3H 3FQUA 1TJXA 4WTXA 3UAAA 1G9HA 2NY2B 3DSFH 4GAFB 4BA8A 4Q7DA 4R2GC 2HRLA 3UBXI 1EAQA 3QA3B 2ZX6A 2JIXB 1OIOA 3OJDA 3CLFH 3MVSA 4WIQA 5TDOA 4GW4B 1BBJB 1MHHB 5CSGA 1Q38A 1WBXB 3DVGA 1QSVA 1T0PB 5FW8A 1T6BX 43C9A 3MJWA 4RBPH 3VI4B 5L4IA 3RBSA 3CGTA 2EINB 2MNUA 5EN2B 1OCZB 3ZE1E 4EEEA 3WHE0 4R4BA 2YPKA 5DD3L 5A2JH 1A6UL 3I9GH 5CZVH 1NCDL 3QS2A 3IETA 4OCRL 3CHRA 1F97A 4F7PB 2WYTA 2JI1A 1ITCA 1LQBC 3SKJL 3SJVD 3WD5H 3II1A 2ZWLT 4Y1AE 2BMKB 2WP3O 4M43H 3AQZA 1WS8A 1JVLA 3MRIA 3NCXA 4AY0A 1CDIA 1JYNA 4HJJH 3P4OB 4K3HA 3T3MF 5LXGH 1FL6B 3VYPA 2DW5A 4AZ8A 2R0ZL 4MCYA 4EQ3A 1KIRA 1DL7L 2OTUA 1JZ4A 1VZIA 4PMEA 4FQHB 1EX0A 5DFVC 1MCOL 1ORSA 4KU1A 4DP4X 2E9GA 4XAWL 2RACA 4WK4B 3WIAA 5DSCB 4HJEA 5EB9A 5DLMH 4HIJA 1DLFL 4OLUH 2NY1C 3HZYB 5ADOL 1ZLDA 5D1XC 2NUPA 3C9NA 3RP1A 3MX0B 1C16B 1ZA3A 3PWVA 3Q5TA 5IQ7H 1VGEL 4GUCA 3U2SA 2FJHA 5L88L 2NNFA 4KKLD 4WUKH 5KVMC 1S9XA 3T65A 2EIDA 5DR5H 1MRCL 1I3GL 1FI8C 2UY6A 4QO1A 5SWZA 1FVDA 3S3SA 4KVNH 4CVZA 2WWNA 3QORC 5J6SA 2D0HA 3HNTL 4BH7A 5IMOB 2YEVB 4M1GL 4B7IA 4MMYA 5E00A 1CK0H 3ZY7A 2FL5B 3VXOA 5IFJA 2BP0A 3MLSH 2MHAB 4IGBC 2DD8L 4JQXA 4NQEB 3R8QA 5D1QB 1RK7A 4PP1C 3OAYH 5ITBL 3KPMA 5D7JC 2XC8A 3S35L 1BMZA 2YPVA 4S2SA 2IAMB 3EAKA 2NYYC 4ZBJA 5GSVB 5D5ME 1ACYL 3UZVA 4MQ7B 3ZHFA 5BPPA 4N0UE 2R2BA 3PP4L 4KC3B 3OLIA 4EO5A 4B95C 1Z66A 3M45A 4GT7A 3EUUA 2XN1A 4XC3H 2OW6A 5FM4A 2VZ1A 4WHDA 1NJ9B 3P30L 4O51A 5IHUH 4DPAX 4PVBA 3FPXA 4AGPA 1GJUA 2O6PA 4X6DF 3IS1X 5J1TC 1P9MC 1IGFH 4FQJL 4MS8D 1PMYA 3QCVH 4F2MB 3FCSB 3TBSA 4BV1A 2DKSA 3ZZSA 5CEZD 3L3GB 3HUJE 5D1ZB 3N1FC 4ZQKA 3S34L 4LASL 2X2YA 4GBXA 1KGUA 4HIQA 4BELD 1NWOA 3ZJAA 3IFNH 2EEFA 4NHUA 3DXAB 1Y6NR 3JT2A 4N8VG 2ERJC 1U8NA 5D7SH 3EH3B 4FZ8H 1NEZA 2R1XB 3S36X 5IUSA 2KI6A 3L2NA 3U4BH 3HKZA 4TQHA 3MRPA 5EU6D 3IJHB 4AVHA 5T3XD 1NBQA 4B7LA 3FW6A 2EEXA 3VFGH 2QGDA 3BZ4A 4LPUA 2VN5A 5AWNL 4JK0D 4WSGA 3C6LA 1PPIA 5CEZH 2APFA 3WNLA 5DJYB 5C0CE 2PYEB 2CNYA 5GGRY 1FYTB 1V8HA 5GRJH 5HYSB 1UZ8A 2BVEA 3VRLE 3QDGB 1F1GA 1Y0LA 3LV3B 4KK6C 5HGHB 4AVJA 1PG7W 3ZHLA 5T3ZE 5CGYD 1SHXA 4PJ8C 3BKMH 2VLRB 1AC0A 3D0LB 3BPCA 5KVFL 3GBMH 4XHQA 5CP3H 4F15C 2IALB 4PRPE 5ALCH 5MI0B 1AZCA 3IM1A 1P5UC 2I9TA 1KIQB 4FA8A 1F5WA 1MNUH 4NHUB 4MJ5B 4PP2B 5ENWA 3RGVA 3WY1A 1WEJH 4X7SH 5KVEH 4FF9A 2HVKB 3C5JA 2OJZH 4OZFB 1O7DC 2VTFA 2WBJD 1WF5A 4Z77B 4QT5B 5IVOA 4JFOB 3QI9B 1MCWW 2HX9A 3LVEA 3QWOA 4Y4HB 5D7KD 3GJFK 3CZSA 3MRMA 3TFBA 4RFEB 4Z0BL 1TQSA 5HDQL 1QFOA 1LK3L 2OYMA 1WTGT 2CM5A 3QWRD 1A3RH 3CFKA 4FKHA 4QRRE 3E2HB 3NK3A 3QH3B 4OIIH 2CRYA 3EOBA 5KTEL 3HPLA 3HMXA 4N0UB 4XI5D 3ZRCC 1OTTC 4LPCA 1UD3A 1OW0A 3CV5A 4LBEB 4OFDA 3I9IA 4OFYD 5EBWB 1MRDH 4F7TB 3P73B 3OB8A 3CSTA 1GVIA 4X6DA 3IDGB 5E1AB 4GO6B 4N2BA 2XVLA 2I5YH 4IRJA 3MXVH 3E8UH 4WO4B 5INCB 2X10A 3BPCB 2Z35A 5IB4B 3V0VB 3QDJD 2F19L 1LL1A 1QI3A 1R4XA 2SEBA 3FQWB 1JGDB 2JKNA 3AREC 5GS3A 3VB8A 2ZXAA 2FQGA 5C0BA 1IVLA 3MCLH 5HHOA 5AW6B 4IKNA 1HJBC 1HVXA 2NNXA 1FGNL 4AEEA 2DYPA 1T4KA 2ZSVB 1FNEA 4KI1A 2BHZA 1E4XL 1M6OB 1N0LB 4X9HA 1D2OA 3MREB 3CXDL 4BH8A 1IL1A 1I9RL 3U2SB 5GQBA 3FHEA 4UOW0 2Z91B 4AH2B 4FNRA 1A1MA 3MOAL 1AJ7L 3HG2A 5DUJA 1KELL 1RV6X 2QQNH 5E6YA 4BRJA 5HYSG 2R83A 3OAYK 2W07A 4ZFZA 2OR9L 5CSBA 4ZFOA 5A40E 4P2CG 1NLBL 4HOMA 1A7PL 2NCMA 4ETQA 1MWAL 3K4AA 1YNLH 4PJXB 4C55A 2VR6A 3U9UB 5JPMC 1OK0A 2OM5A 4NCC2 1E9OA 4GQ9H 4N2AA 1UCTA 1XEDA 2BNRD 4YQXL 4AOFA 2D4FA 4P2QA 3E8VA 1JXDA 2DQUH 1NCIA 1JIBA 2XWRA 1G0XA 4P05A 4TOYL 3QWRA 7CGTA 2EQDA 2VQ1B 2VLJD 4OSUH 1F11A 3C60C 3UL4A 4JKPH 1FNFA 4BFIA 3HAEH 1R19A 5IB3A 1L9TA 3HG1B 5EZJB 1Y1DA 1UM5H 5T3XL 1FNSH 5T5FL 3Q8FA 1QRNE 1B0RA 3OHXC 5CJ5A 4YE4L 1FO0A 1U91B 4OZFG 2X2HA 4IBQA 4MXVF 5D1ZD 3D39E 5KS9F 3O2VL 3QUYC 3CSYA 4PJ7F 4RGMB 4HKBB 4APXB 1MG3C 4XMZA 4QRAA 1UB5B 4G3YL 2W91A 1NEZG 1F02I 1SVCP 1IGYB 1B4LA 2CKNA 4OJAA 2CPUA 1FLTX 5JPNC 5ANMA 5HI4D 4EN3D 3QXAB 4U1IB 1S78C 4J1UA 5JQHC 2HUEA 4PP1D 4Y9BA 4J8RB 4HZLB 3FQ2A 3BD3A 4UIMB 4MNQA 3OMIB 1TQBB 2NW3A 3SKMB 4NRXA 4RSVA 5GS0C 5IW1B 1DJSA 4JM2F 1XQ4A 1G94A 3CLEL 1BVLA 2Z3FA 1ZHKA 3P77B 4TL4A 3S96B 4KZDL 4FXGC 2NUPB 3IPEA 4JO1H 3VWJA 1T03H 3QQ4B 3UX9B 4X80H 5HJ3A 3G5WA 3LRKA 3T3PE 4O02L 4YLBA 1AXSB 3PHAA 4NZUL 5I5IA 1J0KA 1WZKA 2N01B 4K5MA 2JLLA 4FNLH 2XV2A 1AQDA 1LO3H 5FGCE 3GNMH 3QJRB 2TSBA 3RWFA 1NGQL 4P57A 2QGCA 4XN9A 5AYQA 1T2JA 5KBLA 1VGEH 3IB4A 1CG9B 3DDFA 4HEMA 3GMNB 4R4FL 4TLKA 4B41A 1QSEA 3G08A 4CA4A 1A6AA 2BSSA 4OJYA 2V6HA 1V7ML 4HEME 5IVXE 2BXZA 1UOKA 3Q8CA 1JGIA 2DPKA 2YWZA 1QBAA 2W0FB 3QC5X 2Z64C 3T4AC 3IFPA 2H32H 4IIQB 3EHBB 2W9EL 1H0DA 3N1MC 5CUSH 2RFXA 3QZLA 5E5UB 3VU2A 1PFCA 2E76C 2N4IA 4QRFA 2EKSB 2MCAA 4MA8L 1CLOH 4HOZA 2BCMA 1BCIA 1TU2B 2ROXA 3MROA 1E0OB 2FEDC 1S7TA 3IDMA 1XXDC 5F9DC 2FGWH 2GY5A 1DLHB 4XPGH 2NT1A 2IAMC 4AQ1A 4PJAF 4KVPA 2VH5H 5DU7A 1AANA 5EEYA 5T1JA 3HBGA 5GGVH 5IVNA 1BZ9A 3OC5A 2DWDA 1F3DJ 1R0AH 1J1PH 4TRPH 2BZ7A 3GIZH 3QDHA 2VL5A 4UQ3B 5AKTA 4L29B 1J86A 3QAZB 4MVBC 2V9UA 2DWYA 2J8UB 2Q86A 4ZI8A 4U1LA 3KGUA 4M7JH 1FBIH 3RILA 4PWGA 5GJSH 5C08A 3RGVC 1AH1A 5EIIA 1ECYA 4XP4L 2VDML 3UJTH 4N8CH 1SOSA 4YSUA 2YSSA 3QIUC 4Y4FD 4BFKA 2O5ZH 2WB1A 4KPHH 1MWAB 1SM3H 3LYRA 3AU0A 4W4OA 3CDCA 5JUEL 1MHHA 4AL8H 3SDCD 1ES0B 3CXHK 3S35H 3HS0A 1I3RA 3CFBA 1K4DA 3ELQA 3IFNL 3HNSL 4HJIA 3U6XS 4C4KT 4XMVA 5EULV 1BG9A 2BHUA 3HC3H 4F7MA 2O61A 2KC0A 4UB0L 4H0LC 2VR4A 2F7PA 2VC2B 5EO9B 3NN8A 4K23L 3RVTD 4YPGB 1CLCA 4PIRF 1JP5A 4ONHA 2JLPA 4L0PB 1E67A 3BUYB 3S2AA 3WELA 3DSNA 5J4MA 4CGUB 1GJWA 3DA0A 1ED3A 4D9LL 2OMXB 3ULVD 3S97C 3HHSB 3FU3A 4M7LH 5JNYB 2UUDK 1HDMA 3C6EA 4JVUA 1HQRB 1IQWL 2WNWA 5CLTA 3U46B 2QR0A 2QPSA 3QNXA 3T3PF 1LWHA 1ZY9A 1KN4L 3HI1A 3ZR6A 2ERJB 5HHQB 2YKLL 3WIFB 5CCKL 6FABH 2DZEA 3UAJC 1BOGA 4RESB 4PD4K 3F12B 3N91A 4Y2OA 5CZXC 1KJ2L 5I0DA 3X2QB 5IFAL 4L0ZA 2CR3A 3Q1SH 4K3JH 3BKJH 3AREB 5HDBB 4D8PA 3V5DB 4HW6A 5DQ9A 1IGMH 1EZUA 5IJDC 1FIEA 2Z7ZA 3GT6A 1MHEB 2OMZA 1PLAA 2XWDA 3C09B 4Y4FC 4CMMA 3O0LA 1P84K 3K4ZA 3F85A 4QHUA 3ROOB 3IU3B 5A2FA 1DBMH 5EC1B 4K3DL 4X8GA 2K0RA 4NYLA 4IU3A 1AMXA 4YPGA 3RL2A 3SCMB 1SYSA 4X4YB 1EFXD 4JN1L 2AK1L 5EEVA 1G7PA 3NJHA 2G3XA 3W0WB 3SDAD 4M1CD 5E4AA 1A14H 4JDVB 4M48H 2O6EA 3MJ9A 2A9DA 3SGDI 3B2UC 3WFEH 4BD4A 3TONA 5I5RA 3T0ED 2VLJA 5IVZB 4GNKB 3MGOB 3VFUA 1JTOA 3LKPB 2WQXA 1F4YH 5IQLA 3ZZQA 1AQ8A 3DYPA 3MUGB 4M1DH 3PE9A 4LEBA 3DOIA 2YA2A 1SLXA 3MRFB 2P8MA 5TE6L 5M95B 4U1KA 1F3JA 4H8UA 3PY9A 4NUJB 1GYCA 4QRPE 4F8NA 1WZLA 5I9QB 4XCNA 1MFDH 3D30A 4NPJA 3EDJA 1OAZL 2QBWA 4AJWA 1S5IL 4QTIH 4BXVA 4JY4B 4LARH 4PG9A 3V7MA 1RPUA 3G5ZB 4FQCL 2CRIA 2BY0A 2YOAA 3UC2A 1AFVH 5DGRA 1MCCA 4GB9A 4I9XA 2EXSA 3LPOA 1S7VB 2OCCB 3RU8H 4W9IC 3FTGB 5LN8A 4OW6A 3CXDH 1XGPA 4N25A 4WWOA 3DUUB 2HJKB 5I6XB 2EDQA 3GSUA 5IIEB 4FMVA 3UJJH 2VXTH 5DD5L 3NAAH 1RHHB 2PXYC 4GP5B 5IQOA 3RWIA 2BVUA 1HEZB 4RFEA 2HFEB 4P49A 3D33A 4O00A 4I18B 1M05A 1NGYB 3GO1H 5H4YA 3QDMB 5MEQA 4LLDB 4WI6A 1LO0H 2XTJB 3NIGE 3IJ8A 4Y5XA 4ICWA 5CLXA 1QA9B 3WDJA 2G2RA 1MY5A 3N40F 3R1GL 4DPRA 1Q1JL 3KM1A 5HVHC 2VLKB 5I30H 2IQ9H 2FRGP 2E3VA 1NMCB 3NSCA 2QR0B 3BAEH 4DEPC 2IAMA 4CJ0A 1IM3D 5F3BA 2PETA 1F13A 3MOAH 1F58L 5C6PB 1KELH 2H1PH 2QQNL 4JO5A 2Q86B 1SJHB 3D0LA 1T21B 2HWZL 2OR8A 4JZJC 2EADA 1S7VA 3M46A 3ULAB 3WHE1 1ZHBB 5KYXB 2X4OB 4RETB 2OMYA 4NNPH 3RUGF 2VMEA 2GJ6B 5KVGL 1WICA 4HUNB 1OAUH 1U58A 4Z78A 4FNPA 3RWJA 5IREA 1C5BH 4ZD3L 5IBLD 3QXTA 2BIHA 5FFGA 3P4MA 4KXCA 4XCCL 2PWEA 2E27L 2VMJA 2OPCA 4XPFH 3CLEH 3WEBA 2ZT9C 5CCGE 4QPEA 2ZX7A 3GKZA 1O7VA 4B0MB 1U6AL 4OD2A 5DJXA 4CVXB 1D5MB 5CEZE 4OAWB 3JTTA 1IBFA 2FJUB 4XX1G 5JIKA 2UUDH 3FCGA 4MAYC 5TH2A 4JZJB 2ARJA 2IDCA 4FC3E 2X0VA 3CXFA 4G3YH 4DH2A 5E6ID 4ZO7A 3GC3A 2DTML 1UHVA 6PCYA 3GYRA 3QZWA 2J4WH 4O9HL 4APQA 1A14L 4M48L 1RZKL 1AQKH 2E47A 3EUDA 5DC4B 2BNQD 5KS9A 2I9LA 2YC1A 1S5HB 5BXFA 3WSQH 2BOCA 2X70A 1A4KA 3MOBH 4MXVE 2VCOA 4OGZA 3S8FB 4U49A 5D7JA 1X7QB 4HWZA 3IDUA 1IBGL 1JGDA 1BAFH 3ZN6A 2D73A 4GKLA 4N85A 1D6EB 4OLZH 4FYTA 1IX2A 1Y18A 5J57B 3MLZH 3LKNB 3PHQB 3IAGC 1A7BA 3FONA 3PDOB 2DQHH 3OC8A 4LP8A 2L7UA 3GUTB 5TDPA 4G5ZH 3D2UB 5FGBA 4AENB 1FIGH 3GSRA 4H7VA 3ZE1F 4BKLB 3RRQA 5E70A 2CDFA 2HRHA 3HE7C 3IJEB 5D1QE 4Z7VA 4ECNA 2WLZA 4NRXB 1KPRA 4EVNA 4Q8BA 3L4UA 1ZT1B 2MCPL 3QXUA 2FEJA 3TLRA 3K72B 4R0LA 1CLYL 2LTQC 3EBGA 4HGKC 4YXHH 1J5OH 4K0OA 1BQHA 1BXAA 4FFVD 3VXSA 5J7CC 5FA4B 4OCYH 4KWUA 4MJJA 2R1WB 4KPHL 1I3GH 4GI8A 3N50A 4OBRA 1XGQB 2IMMA 2B59B 4LEOA 5G55A 1UOLA 1UM4L 4IW4C 2YD4A 2NXZB 4FNTA 4G9FD 4IRJD 3G3LA 3GS7A 4PJHB 2HPTA 3KDMA 4AM0A 3FN9A 1IEAA 5F88A 4OFYA 1DQKA 3HG1A 3WAJA 3CSGA 2WQ8A 2R0KH 2Z8SA 3DVFA 4N0YL 4PH8A 3MRNA 2O5YL 3H56A 4G9DA 4JFXA 5DS1A 4EMZA 2DLTA 3OBAA 3HLAA 3TA4D 3X3GL 2JJWA 3BKCH 4POZD 1SBBA 2QTVA 3VWKA 1I1AD 1B2WH 4JO4L 4YEFA 3KYKH 1I9IL 2BJMH 3FUHA 5BJTB 3WNMA 2PPFA 4PRHD 3MRJB 5EF0A 1FO0H 1NPJA 1LEKB 4IMLA 4KDWA 1HOCB 4X4XB 1CI5A 4P46A 4QGTA 1MOEA 2W60A 4LVOB 1EXHA 5J6HB 1W8NA 2OBGA 3CFCH 1UA6H 2BWQA 43CAB 4G6AC 3B6SB 1Z5LA 3HN3A 2MEJB 1Q90A 4PJGF 4Y1SA 3V4VL 3QO0B 2OMWA 4L3FA 1OP3K 3LX9A 3DWTA 4W9EC 3HE7B 1WAAA 5EPMB 1J9RA 5KVGH 3L16A 5F7MC 1IV8A 2NNCA 3KWVA 2V8LA 2BOLA 2KYIA 5FLUA 3TVMC 4HUUB 5C0DA 1KCLA 4XCFL 3BISA 5I1HH 3WGVB 2XVBA 4P9MH 5D7SL 5GS1A 5I16A 1NCHA 5BNXD 3QJXA 3H7BB 4CAGA 3GHEL 1NC2A 4ZFOB 2EC9U 3LQAC 4G1MA 3L5HA 1RK1B 2CUIA 2VLRE 2GSIB 1TVBB 2WLIA 3FSAA 4K07A 3I6GA 3WY4A 1GGYA 2G5RA 3SDDC 3FQTB 4AZUA 2X09A 3SDDD 3O9WB 2A6JA 1XF2B 2W59A 2BINA 3QUZA 4HD9A 3MUJA 5I0WA 1OSZA 4NT6B 2GABA 1FFPB 3QXDA 4XP9H 5T3ZH 5C0GB 1RU9H 1T2QH 4K9EC 2ZONA 1UC6A 3NP3A 4A2HA 2ZYHA 2OW7A 4U6XA 5EOTB 4LCWD 1XZ0B 2K7PA 3B37A 4G7YH 5EZLA 4XX1E 1HCFX 1R5VA 4FEMA 5EWIL 3OB0H 4NKQB 4YK4C 1IE5A 4KKBD 1BAFL 5FCUH 2PCPA 4YO0A 1CLVA 1HQRA 1I7RB 2OSXA 1QATA 4G42B 4IBSA 3STBA 3QI9A 4Q89A 2X3BA 1J0IA 1PSKL 2JH2A 4P4KB 3CMOL 1KENH 4JN1H 5JXEA 3T6VA 1IM3A 3OWEA 2FH8A 3CIAA 1NZRA 3ISWA 5HDOA 1E4WH 1LO3L 1HHHA 4TLTA 3EGXA 1XGPB 4G5ZL 2XZZA 4NS0A 4ZUVA 2NLJA 4LRIC 4PN6A 5IB2A 1S9XB 2DLFL 3ELAT 4H0HB 4MNGB 4I3SH 5KN5A 4HS3A 3LXBA 1F4XH 3NJKA 4BQ6A 1URIA 4HG4K 1FYHB 2G60L 4FQXD 5KEZA 5EU4A 5L88H 4DZBB 1BAGA 1KBPA 2J44A 2EH7H 1B0WA 3L4ZA 1WS7A 4QKXB 3HMWH 3BFQG 3PWPB 1J1XH 3L9RA 3CJJA 3LD8C 4HJSA 4WHTB 4KX9A 2PWGA 3O4LA 3OR6A 2XQYG 3NSJA 1Q9KB 2P8PB 1WLGA 1JPTL 4HDIA 2W81C 2ILLA 2NTSP 3UO1L 3VU1A 5F0JB 3OKLB 1BQHG 4U3SA 2WJ5A 3HZVB 3D85D 1YDPA 3B34A 1RJZB 1WP6A 3BVXA 4IKIA 3OVUB 4BCXA 1PZ3A 2HKHH 2OMBA 4PQXA 2Z34A 3AROA 2YJLA 2DQFB 3W0WD 1JZGA 1MW2A 2J57A 3MODH 1PYWA 3QK0A 5IM7B 2AV7B 2QGEA 3MDJA 4AIOA 3QCTL 3E3QC 5DK0A 3F12A 2FCBA 1E28B 3DETD 4KFZC 4J28A 4KXAA 5K39A 5DMGD 3GHBL 5EPMA 1X9RA 5EA0H 4Y8DC 1NTDA 4NIKB 4NZRL 2ISDA 5JUEH 3JV6A 3IJHA 1MH5A 1T0NB 4F7CA 1R24A 1RIVL 3HFML 5I8CB 2OYLA 1OF2A 3PWUA 4RQQB 5MHSE 4L4VB 4MA1B 4J6IA 2CK0H 4FQLL 2WLMA 4ZW3A 4EUPH 3MRRB 1UM6L 2AXHA 1KGYE 3L81A 3CDYA 1EEQA 4R7NB 3NESA 3VXOB 4CC4A 2QMJA 3L5XH 4ZK8A 3U0TB 3E9UA 1SXSA 4WNQB 3A47A 4F7EB 5JQIB 3BQUD 3FT1A 1JWUA 4WEEA 3O8XA 1UACL 1PEZA 1UB5A 4G9FE 4JREB 3WUWG 3M7FB 1AYOA 3MLUH 4ORGB 3CDZA 4J23A 4PRHA 4GT0A 3UTSB 1PQZB 5DXWA 5MEQB 4Q9QL 1DSYA 5D72L 4PJ7A 4HKJB 4OLXL 3VFSA 2HMIC 1D5XA 3CX5J 4UDTB 1AQKL 1MREH 4HJ1A 2DWEA 3CU1A 4UIMA 3ZHDA 4MQSB 3S5LG 3DPDA 4WO0A 3OKKA 5I1AA 2BNRA 2ZXCA 3D9AH 3MLYH 1E4XI 5JTWA 5TGBB 1HS6A 3TCXA 1TTUA 3W82A 5IJKC 3VD3A 4ESKA 2QVMA 3NPSC 2WIIB 3OPUA 1EUUA 4MJ5A 4DGYL 32C2B 2ADGA 1B0GB 1V54B 5E8EA 5FO7A 3SJVA 5FB8B 3DURB 3BQUB 4OZ4A 2H5UA 4R5XA 5IFHL 3ZZ1A 1GAFL 1E7VA 2IGLA 4UUJB 1HN1A 2CDFB 4ILDA 3CFTA 1QWHA 3FO1B 3QFGA 4PJFB 3Q6FB 4AIZA 3H7BA 3ZZLA 5FF6A 1GS8A 1CICA 3TN0B 2VISB 3D4YA 2BNUB 3B9KC 3GSQB 4ZPTB 3QIUA 4C59B 4LAJH 4ANUA 5HHOD 3NZSA 3S48A 1GYAA 4KBPA 3U30B 1WHPA 3BO8B 3O6KL 1U8JA 3PUUA 3X12B 2DQ6A 4X6BB 5ETUB 1QNZH 3QDJA 1L3NA 5A2IH 3ZE0F 1N6VA 4FTVE 4M00A 1UA7A 1OE2A 3KL3A 2WSKA 1M2VB 3EO1B 2JIXD 1NCCH 2W9EH 5JLZA 4OCXH 2ED7A 1KJ2A 1CLOL 1QSFD 1N70A 3Q5YA 1DANU 4QIRA 3P3RA 2IAMD 4UTBH 3AJ7A 3RFZC 4PLKD 4WI2A 3VRLF 3X1EA 4Y1TA 1FNEB 1L6PA 2XYBA 4PJ5B 3WFCL 1JRHL 2CHDA 3LPWA 3O6FA 2F54D 5I2IB 2YOCA 4P5TB 4NQDA 1QHQA 2BRQA 4OFVA 2ITCB 3W37A 5DEFB 1EDYA 1O7DE 4AGOA 2IGTA 4D0BA 3RPIA 3TCLA 1ZSHA 3FUJA 1T3FA 3S3DB 1UD5A 4A7UA 4LCIL 2O26U 3GSNL 5J3HD 2YR3A 2A7BA 4R8WL 4AL8C 1L7IL 2GHWB 3FTUA 4ZX5A 4GKSB 4QWWC 4F57H 2DBJA 3QIUB 3K74B 1AXIB 3QPQC 4LSQL 2A9BA 4X50A 4YNYB 3UMNA 2EZ0D 4ZMPA 4ZDHA 3GHBH 4MB4A 3D0VA 3BN9D 3U6XA 2X89D 5HD8C 4G43A 1ZK5A 3PNWB 3HRZB 3FXIC 1JS4A 1VFOA 4MNGE 4XNZC 3L2LA 3TZVA 2F53A 1WFNA 4PGJA 2FWUA 4NENB 1UD4A 1ERNA 2DJ4A 4JJOA 4JE0A 1E4HA 1BJ1H 4JFFB 4AEFA 1ZHNB 1QPXA 3ZO9A 3Q13A 4C56B 2H41A 2XVKA 1RSYA 3THML 4DKEL 2RA1A 2EYSA 1SQMA 1AGCA 2PW1A 1KF9B 4KX7A 3VXTA 1BLIA 1HHIA 2R0WH 2ZKYA 3QRLA 4UAHA 2RR3A 4UT9A 4HH9A 4E42A 4OI7A 4I89A 4ZG1A 2X6UA 2Y23A 4YWGH 3TCLB 1GYUA 1OB1A 4H8WH 4EXPX 2H1XA 3IYLW 4YFDB 4OLVH 5I6PA 1JV2A 4POUB 4XOAA 2Q7YB 1EVTC 3CDFA 5ISZB 1YMHA 5D1XD 3WHXB 3NIFF 1CFTB 3A6CH 1T6WA 1IMHC 2EO9A 1W72L 2X6AA 2XZQH 5FX3A 1RZJH 2YSSB 3QT2A 1X9UA 2WTRB 4JM2A 2BRRH 4A38A 1WG3A 4KKNA 1ICTA 4KROC 3SD5A 2DF3A 4KK5D 3ABMB 4ZFZB 1IKNA 1MCDA 3K5RA 4YSPA 3Q1EA 3RB7A 3JWDC 1A7RL 3AMLA 4K7PH 3ZOAA 3A3YB 5I0XA 4JFED 4O2EB 3QIBD 2PW2B 3T09A 4QOKE 3DI3B 3MBED 4MYPA 1LMIA 4JDTH 3W81A 1FV1B 3BGAA 1CR9H 3QUML 2P5WB 4HJ0D 5D6CB 1I85A 3CBRA 4PG2A 2RAMA 3L45A 3VW3L 4ZXBD 3RWEB 5TQ2L 1RUPL 4OGXH 1L9NA 5BQ7B 3R4RA 5AW2B 4XXDB 2QADC 3MRFA 2Q8BH 3OJ2C 1PIFA 1JPFB 1SJMA 4KKCD 1WO2A 2Y1ZA 5D7IA 2D31B 4NJ9L 2O5NA 3MV8E 3WKPA 5E8NA 1Y1UA 3GXMA 3IMUA 3WFDH 2LR4A 2F1EA 5D8JL 2XXCB 1HDMB 3QFJD 2ADJA 1FGVH 2NUTB 2WWKT 4Y4KC 3LZFL 4OT1H 3B8YA 4Z3TA 2UWEA 2LVEA 3D52A 4ZPVB 3PABB 3L4VA 2VXQA 3P11H 4KK9D 3QJSB 1K8IA 2WWMD 1GZPB 3OJMB 4MRCA 3FO2A 5AZUA 1OP5H 1RUMH 1WGOA 1N6QL 2R7EB 1CE6A 3ZGIA 3STZA 1AR1C 2VZSA 1FYTE 2E9JA 3CTTA 5IP4A 5IQMA 2EUVA 4OQTL 4GUPB 2YD2A 4XB7A 4OLUL 1AGDB 2H7WA 2ZPKL 3MN8A 4HCIA 5ILTL 4PWJA 3IJSA 4Z1PA 1K4DB 2BSRB 3RWIB 4QT5A 1J1PL 4NPKA 1FFOA 3WFBL 1ZOXA 4PJFE 3FBKA 5L2JA 3NPZB 1WPCA 3VRJB 5KBKA 2Y7OA 1FBIL 2HX7A 3IMBA 2FATL 3O3EA 4YX2H 2FX9L 2HFGH 3EO0A 5I16B 3FB7B 3HMXL 1QBML 5I75B 3MRHB 5MENE 2NXZC 4J3OG 1PJWA 3ARXA 3NCYP 2Q5BA 1WWBX 2B5IC 2X3AA 2ATKB 4ABWA 5K9OA 1VEMA 4LE8A 1U3NA 3WEXA 2FJSA 4LBAA 3HE6A 3OKDB 3II2A 1G6RB 2FYVA 1X5JA 4L3CB 5E23A 1U8KA 4GFXA 3KLKA 3SGJC 1JUFB 1UACH 5KS9E 3MNVB 4P5TA 3DOSA 1TJGL 5EBGA 2I7SA 2G0LA 1REIA 1HX0A 4M93C 3S4SB 9PCYA 1FORH 1UASA 1ZVHA 3OD3A 5J12B 4HC1A 1ML0A 4MA3B 1IKFH 2NX5B 4JFTA 5LXGL 3FB6B 4KJWC 4UQ2B 3MUZ1 5HI5C 4G6ML 3QFJE 4ETQB 2R4RL 3PGFL 3H2PA 5JZ7C 5D2LB 2CK0L 2MTPA 1PG7H 2Y9RT 3MQIA 3CFMA 4OM0H 4HUVA 3NTCH 4P2QD 1BQLL 2PR9A 2W60B 4AWJC 4F3FA 1V7NL 1Z9PA 4ZFOL 2R1YB 2X12A 5EU7C 1ILUA 1TYRA 5FGSA 1YO4A 3X1BA 4NQVA 3BJ91 3L95B 2C34A 1GGCH 3I50E 4XPFL 1JN6B 5LBGA 3WJLC 2F0CA 2H26B 5DMKA 4ZZKA 4HJUA 2WIMA 3S5ZA 3HE7A 4K3JL 5K1JA 3QG7L 5ACZA 4OZGB 2HLFD 5TF1L 2YHGA 4WEBL 1SHSA 3D2UD 3ZU8A 5D70H 2J43A 5DJ2A 2VQTA 4K5OA 1IFHH 2YBRB 2VDMB 3TURA 1U8PA 4PJCF 2EE3A 4YL4A 3WEAA 3BKYH 4JFFE 4QXGL 2X1QA 5T5FA 1XSJA 3PUCA 1LTXA 3UP6A 1R3KA 4HK3N 5CEYB 4LLMB 2DM2A 3SE4C 1CLZH 3P73A 2XWBB 4LIQH 2FUQA 2A2QT 1D9KB 4FI8A 4ZMLA 5B38G 3UYPB 1ZDSA 1JGLH 3IFLL 4JY5L 3LKOB 4L8BA 1MFEH 2Z31D 3BAYA 4F8QA 3L1EA 4HIHA 3VJ6B 5E2TH 5KVEE 3KCPB 3FUEA 3OLDA 4WTQA 1NKRA 2VDRB 35C8L 5IKCB 3FQRB 5TGBA 1KEMH 1QSED 3KG5A 1E4WL 1ZLVK 2CMRL 4OCNC 1MCEA 2XWZA 4X8XA 4OCRH 2MFNA 1CYGA 3VI3F 4XBGB 4N2NA 1DVTA 1E9QA 3N5AA 1I8LA 1V7MH 3QEGL 4YXHL 4KQ0A 5IVXB 3ECBB 1G7HB 1KPVA 1V5JA 3S3BB 5FGRA 2D31A 2VDPL 2EH7L 5CD3B 3RVUD 1A6VL 1TFPA 4PHXA 2RMNA 4ZMOA 2IOIA 3KPLB 1J1OH 4LAQH 3BN3B 5GGSB 2ADYA 1ZIAA 2VWEC 4I3RL 4XPGL 1ODAA 1KG0A 5DJ0A 2WCSA 3BT2L 3F58L 4Z7WB 1P4LB 4JM0A 3LKQA 5C0BD 4PJEB 1XB8A 2WNGA 4N5UA 5D7JB 3WN6A 4YPJA 4KKQA 3V8OA 4LCIH 1Y07A 5AOLA 1O75A 4R96B 1HXYB 4GRLA 5D2LF 1SJHA 4UBDC 2VKXA 4RWYH 3AGWA 1ZPLA 5FYJH 1LE5B 4H8WL 1B9ZA 4HZAA 1H6UA 5I15H 1WUZA 3AUVA 1K4CA 5JW4M 5GGTL 4UQBA 3VRJA 5DJCA 3T6WA 5DO8A 4B53A 2F2HA 3O45A 4MMZA 3N85H 4DNLA 5IHWA 1J05B 1FYTD 5ECJE 4KTDL 3CHQA 3QI9C 5CD5C 3D4ZA 1R1CA 4QDGA 3D51A 5GSRB 2CXGA 4LHUB 3WAKA 4JPWL 2CO3A 1RHHA 5LQBH 4GRMB 3ZHNA 1UKTA 1GW6A 1RJLB 2NXZD 4G9FB 1A02N 1KFAH 2EXWC 2PO6C 2K8QA 1N2RA 4KRPC 3SE6A 5IQ9B 1OSZB 4KZ0A 4YDKL 5DMIL 5FKAA 3I74A 1EHXA 1RK0A 4EI6A 5IEKA 4NKOB 4OLVL 2W65A 3QCVL 4IRSD 1NBZA 4UNIA 2X53A 5HHME 3Q6GH 4J2XA 4DKFH 4DPBX 2DOCA 1QG3A 4XMTA 5AL8A 1OP9A 2Z93B 2CR0A 1DZBA 4G7QB 1ZS2A 3PDOA 5E9DA 2BP3A 1KIPB 4XVTH 1U41A 1KBVA 2FD6L 2K9FB 4H4NA 2DMCA 2ZUYA 1JGLL 2BO0A 3FONB 5F21B 2HRGA 4H26B 5CSZB 4EI5D 5CLWA 4LGSB 5FPIA 5FUOL 3C6LD 1YJDH 2BDNL 3MX0A 1OGAA 2YGNA 5SWZD 1ZEAH 5CHNA 4E0RB 1ZT4B 3GF8A 3KVQA 4OTXH 4U1SA 4EUPB 4E5XG 3S2CA 1DVXA 1DLFH 2A6KA 2OI9C 3DO7B 1IAKA 1RIHL 3TS8A 3T1FB 1YYLL 2IH3A 2AQ1A 1WE5A 4K3GA 5HHVH 3QZOA 2Z0BA 2IH1B 2Q8AL 1NCWH 4TMPA 5GZNC 3ULUD 3HJEA 1O9ZA 4KHTH 1L9MA 2EH8H 4IU3B 3SCMA 3NJIA 2ZUUA 2QQKH 4OF8A 4W81A 3KVPA 3VG0H 4Z7WF 4JVWA 1MSPA 4IBZA 1J5DA 2F8VA 2XZAH 5D7JD 5FR3A 4JFDA 3D07A 3SEPA 4OF5A 5MEOA 3X12A 4TQEL 3G5XA 3QWQB 4U3HA 4ISVB 5JIDA 2VE6A 5E2UL 3ML8A 4IOSA 4GG8B 1OGSA 2CO7B 1AHWC 4AUJA 5C09B 2X6CA 3U2IA 1LEIA 1HXYA 5JORA 4P3DA 3B9KB 3EFDH 4FTVD 4DESA 3BE1H 5C07D 3VXMD 3MLXL 1RCYA 4KKLC 1CFSA 2G2PA 1U8IA 3PJLA 1AFVL 2B14A 1V3KA 5B8CA 5KW9L 2HKHL 1SFHA 4GLRI 4PRPB 1T66D 4JX0A 4NQCE 5EU6B 3ZUNC 2A73A 4ANVA 2MCG1 5DS2A 1G84A 3QO1B 3S3PA 3EHBD 4OJDH 4KK8D 5F7DA 5FECB 1EMTL 1XCXA 3P02A 3NBNA 2XN9D 4FERA 4WCYH 4BFEA 3IF1B 2R15A 3G6JA 5BO1H 4W6WB 4YGVA 2JSFA 2V5YA 2X7LA 3R0MA 5D6DA 2LU3A 4PLNC 5IBUG 2XKNB 1I8LC 5FA4A 4HAKA 3B5GA 5DRWA 4ZMZA 2EXTA 5B39G 1A1NA 3PYCA 2Y36L 1BYOA 3ZMRA 3ZKSD 5DVOA 1JYWA 2F68X 5E1IA 3H53A 3QCUH 5EC2A 1M9SA 3WNOA 4EI0A 4JR9H 3ZDYB 3QJZA 3VXUB 1T04A 4NZFA 3B1TA 4RLDA 2GC4C 1S78D 3HR5A 1HCZA 2IQ9L 4TNEA 4JRWA 5CEYA 1XL6A 1ZHNA 2RQ8A 1I53A 4ZX6A 4Z3IA 3H3BC 1YN6B 2R29H 2RB8A 3C09C 4E9LA 5EZIH 2VL5B 1S7WA 2PCFB 4K4KA 3WS3B 2XWTB 4R97B 3H2WA 5T33H 4J3TA 4J1UB 4WNJA 4LMQI 4CGTA 2NSQA 3ISRA 1ZLEA 3OKMA 3KPOA 2CLZA 3V4UL 1LO4H 2OTWA 4FKEA 4MJ6A 1OAUL 3FTSA 2P3YA 4R9HA 5LAPA 4NKDB 4B27A 1N59B 2JCCE 4M5SA 3DGCR 1BJ8A 1EO8H 3A5VA 5AFAA 3FO9B 3BYYA 1TTBA 2BSDA 1J9QA 4IOFC 5FS5A 2EE0A 5HVWA 4TLSA 5FDYA 3CFBB 1EHLH 1OSPL 2V4LA 1QVOB 2DQJL 4U05A 1CQYA 4NC2B 4X99B 3PHOB 5BW7C 3R0NA 1E50A 5D1XE 5IOKA 5IZ7A 3PS6A 5GGQL 3P0GB 4JAMB 1KB5H 4QXVA 1CR9L 4YHZH 1BVKB 3DMMC 2ZKHH 1HTYA 2CJUH 2QZQA 1KIUB 3B3IA 2YJQA 4D0CB 4CADB 3B5TA 3EFOA 1BQUA 3WO3B 1WC7A 1TJMA 2GBVA 1BD2E 4QMEA 4QGYA 4WFGD 5EOCL 5DWPA 2WANA 4NO3A 4OR1A 4YHIB 3PWLB 3LIUA 3K6IA 4HIEA 5JXAL 4H13C 1G6RA 1CFVH 2ICEC 1PG7X 3FT4B 4LQFL 3CVDA 2EUXA 3BSGA 3CZJA 3BDYL 1D9KD 5GRWA 3IGFA 3G04A 4HZLA 2Y69B 1BOGB 3QRBA 2WQVA 3TEZA 1J1XL 2XWBA 3S36L 1JRHH 2VLKA 3UABA 4A2MA 3BZEA 3HN8A 1RZ8A 2Y06L 1WZ1L 1XIWA 1FIGL 1GA2A 3B2PA 7PAZA 1TZGH 5IW1A 5HGAB 1TO4A 1UVQB 1ZV5A 3RGVD 1JYXA 2PPAA 2JCCA 3QJHB 1GPOL 4I0PA 3CVHB 5HYIA 2V2TB 2Z4QB 1DBBH 2DL2A 2BIIA 3CPLB 3HRZA 4KH2A 4XO4A 5JQ6H 1A6PA 2AVFA 3BKJL 4R7DA 4YHOL 5KAQF 4R5VA 5E6SB 3T3ME 3CFJB 1J1OL 4QOKA 2YPLB 1OP5K 2FX9H 2HFGL 4AIEA 3N85L 4RISL 4F9PA 5DMKB 4N6QA 3QQDB 3IN2A 3O6FD 4UINH 3WUZA 5FC9A 1FFOB 1G1KA 3QAQA 5IF0B 4NOBA 5IGXL 4W93A 2VXUH 1E90A 5DA4A 4KO9A 2A4CA 4N0YH 4BFIB 3SJVE 1PF3A 2JK5B 1A1OA 5AKSA 2VXQL 1NOFA 5ICXB 1NA8A 4Y1AD 5EU3B 4BDVA 2MPVA 3TASA 5FYJE 4NO2B 2P8PA 4LLMA 1Q9KA 4OGAC 2Y1AA 1A6TA 3ATEA 4WI0B 1G4RA 1OAQH 4XH2B 3SGEI 2J20A 3KS0H 3VYOA 2C1PA 1XGUA 1D5RA 1QHOA 3KXFD 5I30L 3AITA 4B9CA 2OAAA 4RMUA 4Z0XB 4DKFL 1J8HE 7FABH 1ZLSH 2XTSA 2AKRA 1FAKT 2X4SA 2E8ZA 3VQ2C 1NMAL 2LU5A 3QIBB 3FRPG 5EU5B 3FF7A 4AGLA 3SO3B 2EDJA 4NQCD 2ZSVA 2NTFA 3UZEC 4WWNA 3EGDB 3BUPA 3DTXA 2VISA 4IU2A 4X42A 1NINA 5F3HA 5HDBF 4OLYL 4QHNA 3IDJA 5DVLA 4O02A 2X9WA 4Z7UF 1GGBL 2IH3B 3VM5A 4OKDA 1IM3B 1DVFD 5C0AE 1T22A 4K15A 3DV4A 4IK6A 3TFKD 3CFKB 5DC0A 1QSEB 1YYLH 4TKWA 2H2SD 5CILH 4X9BA 1NGWB 2ITFA 2CBPA 3C60B 3IXTA 4P0DA 4L3ED 2Y22A 4ELMF 4K7PX 1C7SA 5DEGA 4XOEA 4O4YL 3GWJA 1QLEH 1L7TH 1MI5B 3BUYA 2B15A 1EPFA 2IFFH 1T83A 2J4WL 3C2SA 1XB6A 4UZGA 4CBZA 2F5AH 3BWUF 3MV8A 3PABA 4FA6A 3II3A 4HKJA 1KULA 1COBA 3H0TB 4HGMA 4PD4J 5AYUH 2GAZB 2LU4A 1RLBA 3U46A 1MJJB 1M1XA 3KGSA 4BGLA 2CQVA 2GJRA 3LN5B 1PY9A 1UJ3B 4YH6A 3J7HA 3NFNB 5DK2B 2PYED 1JPST 1PY4A 2BXYA 1MWOA 5C0RL 3WL9B 4PG9B 3UPCA 2B1OA 3P4NA 2H1PL 5KJ4A 3U9PH 4ATWA 5TK4A 5A2KH 4XTRD 2CMRH 1HHGB 3LDBC 1R0AL 3RURA 1E6JL 3BAIA 4AMKH 2MOVA 2IDQA 5KSBB 2NCEA 3CC1A 3L9EA 3KPPB 5E2VL 5GISH 3MAWA 4GXVL 2A9ML 1NOAA 5HJBA 4ODTH 1NFDB 2WKOF 4XXWA 1F4XL 3RPKA 2VDMH 2PW2A 2ARJQ 3BRFA 4WSKA 2OS7A 3FFCA 2XETA 3EKCA 2YA1A 3L8QA 4XN5A 5KSAD 1CGXA 1AAJA 4UIKL 5CR8A 4P2QB 5E0FA 1IRAY 1QBMH 4Z7OB 1BM7A 4JDVA 4KNSA 4JG1H 1G9MC 2J5LB 3IKCA 3BIAX 3GRBA 1OAXH 1D7DA 3OAUL 4N6RB 3N55A 3BT2H 3F58H 6CGTA 3BMVA 2DH2A 2K6ZA 3G5VA 3PP4H 5KYNA 2GIXA 4UQDA 1GMEA 5LAXA 2JXMA 3N0AA 1MIEH 1KXQE 3LAFA 3VFTA 4MA3A 5F89A 2EDNA 4DVBB 2HMID 2EICA 5FYKL 3WSQL 4Z95H 5MHSD 3BP7B 2E4TA 2OSLB 3L3HB 1KIRB 4P2OD 1FP5A 3NSXA 4DGVH 3MV01 4QNPE 3SE4A 4E2OA 5HPMB 4NN7C 5HDBE 3HPJB 4PBXA 1CDGA 1FWXA 4KAQH 2TRYA 3B43A 3FH7A 1IZJA 2A5UA 1J8SA 4YBQC 3NFSL 5IV2A 1NIDA 5DLLA 3C5ZB 1RIVH 3HFMH 2UXGA 3GMMB 1T89C 5D1QC 3CH8A 3L5IA 5IB5B 4GW4A 2VDNH 1N5YH 1ZK9A 3BQUA 3KL5A 1KB9K 1A9VA 4KUZL 3U0WH 3WXVL 2IPTL 4G43B 2EIMB 5E99L 3TVMD 3RX9A 4XO8A 3FBQA 1E40A 3UERA 4JRXD 5A6LA 2WB7A 4KKRA 5EN2A 3CSBA 1Z3RA 2QSCL 4GINA 4IRJC 4DK6A 2IWEA 2QVFB 4HULB 4HP5A 3RVXD 4R4NC 2ZQKA 1PZBA 4XVJH 4LLDA 3KYNA 4PJIF 1GIGH 3AS2A 4KJPC 4Z3FA 1YY8A 2PYFA 4JPQA 3VXTB 4HV8B 3KNBA 5EOQL 3VE0B 2VN7A 1NICA 4BINA 5L2KD 2G75A 2Y2YA 3D39D 1AR1D 1D9KC 1ULVA 5JHDB 5IR1A 3GJFB 1JNLH 1FFNB 5IK3B 3JWDL 4KO7A 4EIUA 4JO4H 5DZ9A 3UJIL 3MO1B 2TSAA 3SDCC 2HN7A 3REVB 4XGZA 3RUGA 1XGRB 3EJCA 3C9NB 5DJAB 4FQ1L 5CMAB 3F7QA 1N3NA 4UQ3A 4L1BA 5I18H 5HYQA 4IRSA 5CZRA 4U1IA 2PN5A 4K9EH 1KGWA 5MERA 4ZMWA 4WAFA 2QPEB 3L08A 2VUOA 3IMRA 3NZHH 4J2QA 5SWZB 1CBJA 1TZGL 2ROYA 4D9RE 3MV9D 3OZLA 4LU5H 1KYAA 3BFOA 4F91B 3NUKA 1PD6A 3SCMD 4PTUB 3NOIA 2Z6FA 4Q6YA 2WUBL 3O3DA 3UZQA 3FQNB 3QIBC 1NCAH 1PTZA 5CD3A 2C9AA 1CGSH 1AXTL 2WN3A 2XQBL 4Y5VB 1AZNA 1EVUA 3BZ4B 3ESUF 1TETH 4X5LA 4CN1A 3WFHB 3OKDA 1BIIA 4Z7WA 1U8JB 2NY6C 2YC1B 2KDYA 5BZDA 2YGPA 4F7PA 4P8QA 2GHZA 4APQB 4TULL 1UWXK 2DQDH 4Q2ZB 3HG1D 2DQEH 1KCUL 2CO6B 3CVIL 3F2LA 3EJRA 1R3LB 4YC2C 3T8XA 4LOFA 2EVHA 2Q1EA 4PS4L 2WQAA 5CM1A 2XX1A 4TPRL 3S7GA 3VWKB 5JDJA 2CG9X 3EYOA 1JK8A 2QPUA 2P5EA 4U1HA 4XODA 2LTQB 3HW7A 3DIFA 1GY2A 4MJIE 1MJUH 2V9RA 5IHBA 1I9JL 5PAZA 3PQYD 1ZSDA 1UJTA 4MZ2A 5F0LB 1MDTA 4N68A 4ALAH 4F2MA 1GL4B 3MRGB 4X6CF 5TE7H 4GSRA 5KSAB 4UM8A 4MHHI 1J5OL 2EIJB 1SOXA 5KYUA 2YN5A 4M5ZL 5KUMA 1NBVH 2CU9A 2MQ3A 4Y2OB 1U58B 3U6RB 4XP4H 5JR1H 3ECVA 4G82A 3BWAA 8CGTA 5IGXH 3W2DH 3ZSSA 3PL6A 4BKSC 1Z9SA 3V0WH 5L2JB 1H6EA 4QXTB 1JK9B 2ZYSA 3TO4A 4YZFE 3MACH 5H35B 4WI9A 3PNWA 5KSVB 4I2XA 4TTGA 3S5LA 5IB3B 2A6IB 1A4JA 2BIQA 3P9LB 1QZ1A 1OT2A 1P5UA 1U8OB 2XN0A 2YMOA 1AKPA 4NCDA 1Q0YL 1OAQL 3D09A 4P59L 5H94B 2W0LA 4Q0XH 1PGRB 5B22A 1RZGB 2FAUA 3KYAA 2GKIA 4YZWA 3STLA 3BN9C 4MAZA 2A3TA 1U4EA 1MI5A 3IN0A 4KNTA 4JKKA 1J88A 4CDGC 2COQA 2WZ6A 1NFAA 1N26A 5IBTL 1JZ5A 4GMSH 4A37A 3ARBA 1JD9A 4O9HH 3DARA 4DGUA 4PLJD 4Y4KB 1I1RA 2OMTA 3GS4A 1VFAA 2WO4A 3BIKA 4D3CL 1O0VA 5GGTA 2VLRA 1EXUB 1TLMA 1UB6A 1WD8A 4FFZA 4QXGH 4DTGL 3VXQB 3QIWD 4N8VA 5FYLH 5I8EB 4H2AA 5ENWB 1USQA 1INDL 1TCMA 2BVTA 2F1AA 1IBGH 3CN1A 5DFTA 4J5VA 4PV8B 5C0FA 4DVRH 4XC1L 1B0IA 4MAYB 3TJEL 2DMBA 1OO2A 4HUVB 3ZK0A 5LCVH 2HTLD 4LL4A 4IGBD 3SN6N 5I1LA 3KZ8A 4L37A 4PJ9A 4UTBA 1T7ZA 4HQQL 4WO4C 4YDVA 5CU5A 4N90E 4YBLC 1U3YA 3M8OH 2LFGA 2MQ0A 1EJOL 4HBQA 4UV7L 4ELKB 3VD0A 3O3DB 3LPGA 3UZQB 4YEEA 1QACA 3LD8B 2Y1VA 3KLQA 3KGTA 4D8PB 2P5ED 3ULUF 1A6UH 3I9GL 3QUMA 4BFRA 5I6MA 3FT0A 2GJ6E 4F37K 4X6DB 3NEEA 3UTTD 2JFCA 4QHLA 3E2HC 1YG9A 3VTMA 1GZQB 1KTLB 4NQQA 2WLYA 4TNFA 1C1EH 5FYKD 5IJBC 2VXSH 4NP4L 4WU5B 1IIIA 1NDGA 1FF5A 4TQPA 3B2VL 5H8DA 1VFAB 1TTFA 1VCAA 1XR8A 4AJVA 4FNSA 4PJHF 1GW0A 5C6TH 3ULVE 5I1JH 2YLHA 3DXAE 3HNTH 1KXVA 5HHXH 2OFQA 5JHLL 4LCWB 3OZ9L 2AXFA 1AGBA 3U1SL 2XFXA 5DJ6A 5CCHE 1OV8A 4U1GC 1Q9OA 3FB5B 4RH4A 4OZIF 3ENEA 4FDWA 5ELIA 4QRPD 5BO0D 3RDTD 3K91A 2AJXH 3UAJD 3CH1B 4XRCA 4X5PA 3RZCC 2XPYA 1KIQA 1M1XB 3CHXA 1M42A 1ZHKB 1LWJA 3QFDA 2QQQA 3T71A 2X7LB 4BHUA 2VKWA 1NCUA 3WMSA 1QBLL 4FE9A 5J89A 3PL6B 3GSNH 3EGXB 2CCWA 5I1CH 4MD0B 4KK5C 2APVA 4N3TA 1GY1A 1TCRA 2EUZA 1F41A 4JKLA 1G6RL 1NCOA 3OGOE 4JB9L 3S5LB 2Q0ZX 2V7HA 3ARDD 4IRZA 1N4XL 4XMLH 5GS2D 4LLVA 1U8MB 3Q8BA 4AQZA 2VAAB 2ZF9A 1E5ZA 1L9OA 1YSOA 1K5NA 1Q0XH 1PD1A 4LASH 3U4EA 3V8CA 5IEKB 3DIDA 4EDXA 2GSIA 2D03H 2ESVE 4K23H 4XMPH 3PQYB 3SKNB 2BP0B 5DD6A 2VDQH 1FRGH 2C4FU 4JPWH 4Z7OE 2E7HA 4CL7A 1MFUA 4MGXA 5DYFA 1DO5A 1KG0B 4KRNA 5DJ0B 4ZMYA 3JWOL 3TEUA 1U2YA 3R1GH 1M1SA 2MNJB 5IHUL 3A4FA 2FB4H 4PR5A 4HMCA 1W0YT 5CN1A 5A7BA 5I73C 2DQFA 1T3FB 9CGTA 4A2FA 4XNUL 2M8XA 2OZ4H 4WKXA 4RRPA 4XB8A 5E6UB 1X44A 3MJ6A 2FO8A 4DVBA 4PMFA 1CIUA 3V55A 5HDWA 3GMPB 4AGQA 3VQLA 5EEUA 5D2LE 3RPBA 4PAZA 2ID5A 2JJUA 4KK9C 4UQ2A 5F7UA 1V7NH 5E8EB 3T4AA 4HT1H 1G9EA 4DK5A 1HOCA 5LBSL 3PXHA 3AB0B 2D2CC 2ZKWA 3AS1A 3IGUA 4UQCA 1HU8A 4HK0B 4AE0A 1IGML 4KKAD 1AG6A 3GKWH 1XIWC 4LCCB 3RWGB 2WXMA 3TJEH 1WFMA 5K5YA 3IVKB 3K6SA 2P7TA 2ZOTA 1QO3A 1C8PA 1A6WH 1DQLL 4MS8C 4XVJL 3ZLQC 4WEBH 3WN5C 3X14B 3K2UH 2RIKA 4NZDA 3WV0A 3CFEB 4HS3B 1XR9A 3FU7A 5JOPD 2NY5L 3TH2T 4QLWA 2GQHA 1G9NC 2A38A 3BO8A 1ETA1 4FP8L 1JDDA 3EFFB 4ORGA 5DVMA 4WUUE 3EJYD 3KJ4B 2VWEE 4TVPH 3O8XB 1BF5A 4RNRA 2IFFL 4UZUA 3V0HA 2RFXB 4G6KL 3NH7L 4L3EA 2CGYA 5MENB 4ADJA 4I5BB 1EWHA 1NBZB 2X3CA 3B2VH 1NGPL 3VGBA 2ICEB 4UDTA 1F90L 1QI4A 2ZKXA 5FO8B 3TBVB 4NO0D 3WTXA 4QXWA 3UYRH 2XG5A 2WOBA 4FZEH 1V3JA 3MYJA 1KYFA 2PTTA 3C75A 5E2TL 3HZYA 1JPTH 3FSVA 2OR7A 4S1DD 1DO6A 1T0MB 4WHYH 4WWKB 4Y5YC 1OM3H 1GZHA 4G80A 1KBGH 4U6XB 5EOTA 2BCKB 1DSFH 3RWGA 2X4UA 3DRQA 3SPIA 5KYUB 5FM5O 1P6AB 1JHLH 2BZCA 2WLNA 4WFHE 5DK0B 3M1CA 4ABUA 1P7QD 1YPZF 4EUPG 5JIPA 4MMXB 3ZDXE 4NLAA 2IADA 2IIJA 2NY1D 4WTZG 2B2XL 5T1MA 2AXGB 2FWOA 1DDTA 1NBVL 5CAYB 2GTZB 1R24B 4FAAB 3JUYA 4MCNA 3BW9B 2C3XA 1JE6A 4AENA 5DD5H 1O6SA 1PKQB 4JVPA 1EFXA 1JWSA 1QLEB 4WDIA 1D5IH 3RY6C 4I1NB 4NQCB 3BMWA 1MIMH 1G6RH 8FABB 3OGCB 1I7TB 4XMXA 4OV5B 3UAJA 2Y6TE 4CN6A 1BFOB 2AQ2A 4GFTB 5JLZB 3FAXA 2BMKA 5A3IC 1JXKA 1DE4A 1EFQA 1SF3A 4XWGL 3HBZA 1QW9A 4HIEB 1SYVA 3GSXB 3ESOA 3MUGA 4F9LA 1JNHB 1OD9A 3KPNA 1RZFL 5ECGA 1IBBA 3K2IA 3N44F 4XP6L 1QHPA 3BPOC 2FZ3A 4LLWB 2CO7A 3BKCL 3EH1A 4HS6A 1PX3A 4GMTH 1RERA 1AY1H 5IOPA 4N26A 4GBXC 5FIEA 1N12A 1A65A 1VRSA 3K5SA 3LEVL 5JPNA 3GJFA 1NFIB 4FQJH 4X6FB 5BS0B 3SDAB 2EIZB 1FGVL 3KPRD 2ICWA 4GW5B 4ODSH 4PVLA 2KKQA 7FABL 2P4AB 5FK9B 4EIGB 3LZOA 3WNNA 4E9XA 1CF8L 4LCUB 4YBLB 1IGIH 3LXCA 1N3NB 4UNUA 3BRDA 4AGMA 5F6IC 4KTDH 1AR1B 2QQLL 3OAWA 1VZGA 1SHMA 3ARED 1INDH 3VX0A 1NC4B 5IEHA 3UGXA 4LSTL 5I8KH 3KYMA 3QQ9C 4Y16C 3E80A 5H2BB 5DLML 4MXWH 1G7LB 4L8DA 1OWWA 3BP4B 4YDZA 1YMMD 1G7PB 2DQUL 1GAFH 5IB2B 2WSDA 5I1HL 3RYMA 1MFBL 3AXIA 2BVPA 1X5ZA 5ERWB 3WY3A 4JPVL 2BW4A 3GSOB 4PY7A 4AV0A 1FZOB 4YMPA 3HE6B 1M05B 3I6LD 5GSVA 2F15A 4YX2L 2WXQA 5KSVA 2AQQA 1MEXH 3F5WB 1E6OH 1TO5A 5CFAA 1ADWA 3SKOA 2RHEA 5J5EA 1ORQB 3O2VH 3UTSD 5EBMB 3PJSB 2ESVD 4Q6IC 1TG8A 3BSZH 1E42A 5EUOE 4TVPL 2VJ8A 5BMFL 1A7NL 4NI3A 4I77H 2VABA 3GBLA 3CG8A 3MA7A 5J9PB 2Z7YA 3PHQA 4JRYB 4NKMA 2FDBP 3WL9A 3I84A 1T1YA 3IRZA 2IMNA 4RAUB 2WNXA 3O2DL 4XPHH 4OZIB 3F7LA 2AS5M 2YAHA 3W38A 3O41B 2Z4TA 3Q2WA 4OCMC 1PW3A 2WINA 3OKOB 3DYOA 1I7UA 1ZSDB 4KKCC 4AVIA 4QJ4B 1CFVL 4JFOA 4EZMA 1YNKH 1BSIA 1IC4H 3FHAA 2J1WA 3FCUB 4LKXB 1TZHA 3QULB 4YXKL 4QTHB 1KFGA 2HJKA 2CDGA 4Y5XC 2BY3A 3X11A 5EUOB 1NOLA 4GEJA 3VACA 1OW0C 3C5SA 3O11A 1RP8A 3DX0A 2VO8A 2KLSA 3HNVH 4H88L 3PJNA 3Q2NA 3R06A 3TA3B 1UYWL 1XEUA 4JAMA 3G6AB 4UNTA 5E7FA 3QRGL 3QHZH 1JVOA 4PV9A 2YGVA 1A21A 2JK5A 3T9WA 3EJPA 2IDTA 4RFNB 5AVRB 2YK1L 1BM3L 2XZAL 4U7SA 2XPGB 4R3SA 4PRDB 1AIFA 4KJQC 1A5FH 3ZYZA 3TBYB 3AABA 2ZUTA 1KCRH 2J25A 4EDWL 5ICYA 3SPHA 5I73B 3TIEB 4G83A 1TR7A 2VLLB 1ZJBA 3C87A 5C0BB 4KV5F 5E94A 2VDQL 2GYSA 3DTDA 2Y3AA 3BEWA 1I8AA 4TSBH 3EDEA 1MF2H 1SN0A 1Q94B 3GLEA 3KPSB 1YPZB 1L0PA 1GOHA 4WNSA 3BDXA 5C2BL 5FYKH 3Q8AA 2Q7AA 1B4JL 3MGAA 3RUGE 12E8H 2G9HB 3L1GA 3HAEA 1TZIB 1RAMA 1SOQA 2ZNXA 4FHBD 2CD0A 5EUOA 3H9SA 1XIWB 4Q9BA 4KITB 1LP9E 3ULUL 3CZNA 2J56A 3H6JA 1JNNH 1CFTA 4YHNB 4LSUH 1KEGL 2X0WA 1I82A 3QCTH 1MAMH 5M7QA 5D1ZA 2VQUA 2KPWA 1BGXH 3IWUA 4NN6C 2AJVL 1WEJL 3ARBD 7PCYA 5KVEL 1PDKA 1XD0A 1XF5B 5C09E 4PI0A 1FRGL 4MLIA 1CB4A 5F1NB 1IEBA 3QB7C 2GK2A 1KLUA 3OHXA 1S3KL 1DJYA 1D7BA 2XKNA 4Y7OC 3QQDA 1FFRA 3BFWA 4NQTA 2ENYA 2YZ1A 1N10A 4MWFA 1WSST 4IOIB 5FYKU 1RULH 1OCRB 3EBHA 3O4OB 1AGEB 2QSCH 1DBAL 3VRIB 1R9FA 1GR7A 4MQ7A 4NO5B 1FAIL 4Z6AT 3VXRB 4HBCH 5FGBC 2X1OA 2OKMA 2R69H 4JRYD 4AM0Q 4Z8FH 3IDXH 3ZDXB 5T3ZL 2I32A 1GXEA 1J9SA 2XWCA 4Q9RL 3Q43A 4AYFA 5I0VA 1XBDA 3PWLA 3CCHB 2LOEA 3QQNA 4M61A 2MH4A 4DN3H 1FNLA 3WE6A 2NR6C 3D1MC 4JHVA 1KPUA 3NCMA 4OF6A 2VW6A 1NCTA 2H3NA 4HCFA 3LQAH 4IKJA 4OF3A 4KDVA 4U1KB 4Q58C 4E9SA 2FJGA 3MLTB 2V33A 3GBNH 1DQLH 3ZL2A 3TT1L 1G7JA 1B9KA 1XSOA 5DUBA 5EU5A 3RJOA 3UBGA 1TJHL 3KAAA 2GJ6A 5CN2A 4WF7A 1ZLWH 4Z76B 3LEYH 1E4XH 5E0QA 5KUKA 1KTBA 4L4TE 4Y16A 1WJ3A 2R1XA 4PM1A 4HPOH 1DBML 3EOTH 2ED8A 3ETTA 1ZE3H 5T1MB 3SPVA 4CSZA 1RZ7H 1U9KA 3CNKA 1E9QB 4L4TA 4YHLH 3SJVB 5C07A 3VXMA 4DEPB 3LTVA 2VDRH 4HK0A 3U9PL 2SODB 3S37H 1MXGA 1BFSA 3M1OA 4JFHE 3FO0H 5EC1A 4J3SA 4IIQA 4PJFF 1M3JA 3DRTB 2NNRA 2R4SL 4NQED 2FK9A 4BK5C 4X4YA 3Q2VA 1NIAA 2V0AA 5HHOE 3D3VA 4QYOA 4MDJB 5EOCJ 4AGNA 1T1WB 2XLLA 1HHJB 1X6LA 2C3VA 4FFZL 5SX5H 5EHFA 3RLSA 3B7YA 3M17B 4AYFB 1DE4B 2EEAA 3I6LE 2XXGA 5DFVD 4PJ8B 1HFUA 3MGTB 4DP1X 2DLHA 2D3LA 1HZKA 4LF3A 3GZKA 1E8YA 1KBGL 2EDFA 4K55A 2JQZA 1PLGL 2VDLL 1OAZH 4GIAA 4KKPA 3ZO0A 1XH2A 3ZDWA 3AACA 3HS9A 1N68A 4XPBL 2V5MA 2YD6A 4JRYE 1WAPA 3NSDA 2V17L 3SBQA 2WKLA 4LVNB 4L8SA 3BPOB 2VZOA 4ODXA 5FO8A 1QI5A 3LZQA 4NI6A 4XVTL 3GMMA 1OHQA 3QJVB 5B3NA 1WITA 5HGGS 1CFQB 2AQTA 1IJNA 3LRLA 2ZUQB 3D7PA 1T4WA 3FQUB 2D7TH 3FUKA 5JXED 3JTBA 3VUAA 4HHGA 3QUZC 3HE7D 3O0RH 2WTPA 2R7EA 3GXIA 2Q3XA 3BGFC 3L9BA 3V79C 4AL8L 5KYWB 3QH3A 4J39A 5F7EH 3CC5B 1RUAH 1YZZA 2CCLA 3OHXB 3N43B 4R26L 4XBMA 5CU9A 4Y2DC 5FOBA 3B2XA 1WFOA 3UIYA 1LP9A 4BQCA 3QPXH 4ZUSB 3FUMA 4HS8L 2UX7A 3HFFA 1GGCL 1YRKA 3IDIA 1TPXC 2NY7H 4WWKD 2VQ1A 3GTTA 4M6ML 4YK4B 4KHTL 3V6ZA 2H2PC 1TVBA 2WLIB 3D3VE 3CFDA 4PI2A 2LGNA 4WKZB 4PBWD 1AQHA 2NY2C 3MLUL 1WZMA 5C09A 4U31A 1IFHL 1J10A 3EJJX 3F7YA 4DIXA 1W6WA 1KBBA 4I2XE 5DJYA 4EN2A 4R7LA 3F04A 5B1BB 3FUNA 5E6IC 2OZ4L 3ETSA 5AAMA 3A22A 2VJ0A 4KRPD 4TSAH 2D0FA 4NRYB 4PR5B 1NLBH 3C5ZC 2I60L 5DTFA 1I8UA 3B6SA 1VLXA 4JRXE 4QKTA 3QG6B 2NLJB 4MKTA 5T1KB 4N8PA 4IM8A 5ANHA 1DQJA 1KGCD 1HH9B 1KB5B 3WG7B 5A1AA 1U8LB 2ZCLL 5KG9B 2JF1A 1DEDA 1AACA 3QNZA 1A64A 2GTZA 3LKSB 4PVNA 1C5DA 3HHMA 3QA3A 4JANB 2GTWA 3NGBB 5LVEA 3U2GA 3VD1A 1MFCH 4FD0A 1LXMA 2E7BA 3NQKA 1WCQA 3DJ9A 3TU6A 3EO0B 2PYEE 2MRYA 1L9QA 3C2AL 4CMHB 1RZKH 1U33A 1RPKA 3FZUD 4HAFA 1ZVSA 1EJ6A 2OP4H 1H5BB 2FJFA 5I5MA 1FH5H 2EDBA 2X05A 1BXXA 4AYID 3E0GA 3ISYA 3K1DA 2FLBT 1PX4A 3ZT6A 2XN9B 2ADIB 4LGRB 3CK0L 3INUL 4JFWA 5E4OA 2G9KA 4LHQB 3C6SB 2ZOOA 5C7XH 4TQ8A 3G5ZA 3ZX1A 2JQMA 4TULH 2C9SA 4LPXA 2WY3B 4PWKA 4M03A 2R56L 1BYPA 2GBAA 3OMZA 25C8L 1DSFL 4JM2C 5AQ0A 4GG6B 1CDCA 3NA9H 2FNWA 3QO1A 4MASA 3P3UA 1MVUA 1H15A 3IMVA 3GK8H 2BSBA 3MKGA 3MC0A 4CNIB 1PX8A 5J1SC 1R34A 2FGZA 2GT9A 5DHYA 1F42A 1NC4A 4GAYA 3BP6A 3G6DL 1DQTA 4XAKD 1F4WL 4OY9A 3MRCA 4P9HC 3GB7B 4JZNB 3HAEG 3T3MB 4MNHB 4WFHD 1E8WA 3CN2A 4NFDA 4PJXE 5D7LA 4JG1L 4A7GF 2D3VA 4QRPA 3ARPA 1U30A 4ZFFB 2AK4E 3UTTB 4AKPA 2C7UB 4PGCB 3BJLA 4HWBH 2RCSH 4M9PA 4NJAL 1G43A 1S3RA 3QRFM 5T1DH 3QYMA 3T2NL 2OYKA 4JZJA 3N06B 5HJDA 4Y4KA 4K9JA 3L5JA 3SQBA 5FLVA 1RURL 2EVIA 2BJML 4IKLA 1CGVA 3KBEA 3KW8A 5ESAA 3DYMA 4FKKA 3ULVC 2VERN 3ES6B 1DLHA 1LLAA 1V10A 2VYRE 1WBYA 4TF4A 1XH0A 4XVSL 1YMHB 1ZE3C 4D8OA 3BSZA 4HD5A 3VD2A 1D7FA 3UPRA 4AKOA 4PUBH 2PP7A 4A6YL 2WWMC 4QY8A 4Z78B 2ESVB 2FTAA 3DX9A 2E7CA 3QR0A 3MNVA 4AQAA 1D5ZB 2LE9A 4TUJA 1CFNB 1CF8H 4GMSL 5JDSA 4EI5C 2P8LA 4PJ9B 3ORJA 1AGFB 2EXYD 3VWJD 4HEPG 4L8CA 4L0YA 3K6DA 5IMLA 1NLDL 2ZCHL 4MAYA 4M5YL 4LSTH 5FW6A 5I8KL 3TXAA 5DJDB 2PPCA 1IZKA 1P1VA 1I1YB 3JTSA 5EMYA 1GZHC 5LCVA 3WUWB 1A9BB 2L0DA 5E99H 2H4EA 3O6MH 4HF5L 2JKIS 5EF1A 3NQIA 4PY8I 3MA9L 5JW5A 4APQC 2DLGA 3D69A 4Y2DA 1IAIH 3V6ZB 4P5TD 3IE4A 4R97C 4PLOB 2VRQA 2BSSB 2YFOA 4KTGA 4JQVA 1IEBB 1J5CA 4QRRB 3A0OA 3OMNB 3RIKA 3P69A 1UFUA 1KZYA 1MFCL 4PGZA 2FJFB 1OCWL 1TOXA 3STLB 1B6DA 4ONHB 4OZGA 3V4LA 4ANKA 1P1ZA 4WI7A 5F9OH 2FX7L 2JKTM 3RY6A 5HYJE 4ZODA 5F96L 3ZHKA 5JYLA 1AZRA 4OVVA 4UT6L 3U79A 3VI4E 3T77B 3UXFA 1EO8L 4HLJA 1IGJA 1JRHI 1RVFL 5AUMB 2DWSA 3KLAA 2M26A 2DTSA 3OXRA 3HHRB 5FW7A 1YEHH 3PGDB 2X4QB 3E7JA 1JL8A 4L8SB 3D48R 4F33B 1GJIA 4BKLA 1NANH 1RIUH 2GB2A 4QHKI 3T0AA 4Y19E 1YA5A 2YD0A 4GO8A 2WXKA 1KYOK 1N64H 3VFVA 5IROC 3ZKNC 2VZUA 4QRSB 3T0EA 2XXMB 5D2NE 3HPJA 5DMGC 4G1EA 3GBDA 3FQYA 2IDUA 5CIPA 3QIUD 2ZD0A 4YFLI 3RWHB 2GC7C 4BK4A 4CUCA 5KYYA 4RZCA 4Y88A 5FF6B 4AW7A 2Y6SC 3CN3A 5ICUA 2XQBH 3QO0A 5E2VH 5GISL 4XCCH 5B39B 1E2ZA 1KGIA 1YYMH 3PQYA 3N9GL 2F08A 5AEAA 1BP3B 2P52A 3MTRA 5ESQB 4GQRA 1CXLA 2VLJB 2YUWA 5IVZA 4CADA 3R06B 1HINH 2NR6D 3D0AA 4KFMA 1U95B 2VDPH 1P4IH 3QWNA 1B90A 1PBYA 5FXCH 2JTYA 4OKVB 4PIBA 1A3LL 4PS4H 3PDGA 3ECBA 1YEIL 2BIOA 4QXUL 1UGNA 1RSFA 3MXVL 1I8KA 1PLCA 5HYJB 4GI9A 2X4QA 3LS5L 4K2UH 1IC0A 1O5PA 1SDDA 3GLAA 3T4YA 2AABH 2B4CC 3QJQB 1EGJH 3P54A 2KZ1B 1CYWA 1K8DA 2XYCA 4ZXBC 3I02B 3BGFB 4HKXA 1J7VR 2P26A 4JPIA 1H15B 4I0PD 2AQSA 4QRSA 1RJCA 4PJ6A 4ZAKA 4G80B 3QXAA 3UC0H 4OZIE 2E56A 2QLYA 2R39A 2Q76B 4H1LH 4PCKA 3ZTNH 1MJ8H 4C54A 2HZHA 2Z4QA 2YD5A 1WBXA 2HRPH 3FPYA 3JVFC 4J6RL 3L5WB 4XO9A 1YEFL 3SGEH 2YPLD 3OJDB 3W3BA 2ADGB 32C2A 5FO7B 4BFGA 4ONFL 2IO5A 5D5MA 3W39B 4BZ2H 3JV6B 5D4QA 4UWQB 3X14A 5F9WC 3MTXA 4XCFH 1OTSD 3TT3L 3U0WL 4Q0XL 1XO8A 5J0BA 4KXDA 1H3TA 5DURB 2CIKA 4UMGA 1KLUB 4J3UA 4FLRA 1AR2A 5DEGB 3QDMA 1NFDE 4WFED 1A1NB 3DBXA 3AT0A 1Z9LA 3MRBA 1DJWA 2WZ5A 3K2UL 3D8MA 3BH4A 3M17A 4J3XA 1ZLSL 2H47C 2OQJB 2WMPA 3CN0A 3COOA 3OZKA 3RB5A 2BC4A 1RUQH 1MREL 3GJFH 2J12B 2X70B 1CD9B 5IJCC 1PZAA 3MJ9H 4YOKA 4H0GA 5F6IB 4NDMB 3LN4A 1ZIBA 3RY5A 5SWQA 1OD7A 5G2NA 2CBOA 5AAWC 3QAZC 5E9AA 5BRZB 4MCYB 2IWKA 3NYKA 5C07E 3VXME 2FD6H 2Y24A 3N6YA 5I8OL 2AK4B 3GXPA 3BDYH 3MLRH 3UTTE 2MPAL 4OGQC 4YDLB 1CU4H 5HI5D 5ISZA 4WEUD 1I1FB 4L29A 4N8CL 3T8MA 4ODBD 5F9JB 4UTBL 3M8OL 4JL1A 3V6OA 2B9AA 5EIIG 4Q4EA 3RWHA 2DJSA 3RIAK 4D0DA 4ZTOH 5GS1B 2XACC 4H26A 5CSZA 4HHWA 4AC2A 1S7SA 5SWZE 1BQ5A 2PWDA 1OM3L 4GSUA 3D06A 3NZHL 1UA3A 2ZX8A 1ODUA 3D85B 1LHZA 2DKMA 1EUTA 2BIPA 1F00I 5F8QC 1MDAA 2H9GB 4A67A 2X87A 4J27A 4I4WA 1ZTXL 3DVGB 3WJJA 1HJCA 5BRZD 3WEXB 1YYML 4O5LL 4S0HA 3HMWL 3QQ9D 1NBYA 2G3MA 4Y16D 5I1JL 5C6TL 5I1IL 4IGBB 4MQTB 2F53B 2DLIA 2G60H 2J6EA 2YMXL 4KVCL 2Q2LA 2ZSWA 4NNYB 5BVPH 3QEHB 4JFHD 2EDDA 3H42H 5JHDA 1X9LA 1KUMA 4HWBA 4PRIB 4U1MA 4X7CC 4X0KA 4NO2A 4YHPA 4M7LL 4XMKH 5HYFA 1FH2A 4JY6B 1PLBA 2ENJA 3TEXA 1F0LA 2F74B 3FU0A 1YEEL 4HUXA 1C08A 3P9MB 3VXSE 2DYRB 5H37H 1RURH 5GGUB 3I02A 4HKXB 3QBTB 4PJEE 4BSJA 1PQZA 2PTTB 3OKOA 3ARBB 3VWJB 2CM6A 4P5KB 5CCKH 4MVBD 4PJ7B 4XWOC 1F4WH 4X7TA 3FRPB 5CJOL 2OLDA 3WN5B 1FL5B 4FMFA 1J05A 1ONQA 1BFTA 3SDXE 4HA1A 4NM8H 4OCYL 1LM8V 4HIJB 4ZUVB 3ULUH 3UBXB 1JSYA 4L5FL 4GIPD 1ORSB 4CC4C 3RTQB 3X1FA 1GKOA 4XNMB 4BE5A 2JKSA 2EXWD 3CPUA 1XAUA 3MRRA 5BOZG 2IAAC 1TSHA 2OR9H 1MI5D 4ADGA 1OGAE 4DN4H 5D71H 1CFQA 3PGCB 3O8XC 4F8PA 4BZ1H 3GS0A 2KZBA 2FBRA 1HEJC 4OLWL 2D7OA 5EZOL 4LNRB 1T5WB 4EBQH 4UCFA 3O2WL 2FJHB 3D39B 4KXZH 4YQXH 4QRRD 3WYRA 2RQEA 4EN3A 4PJXF 1RI8A 1A0QH 4HU2A 5B21A 5EZJA 2WUBH 1FFQA 1BVNT 1U92A 2Y36H 3D12B 4D7BA 2VDNB 3AG2B 1I85C 1QLRB 2MJWA 1A6ZB 3F62A 1UM6H 3SBWC 2ZWSA 1EXGA 2F6AA 3CFQA 1INQA 1OVZA 2X1XR 4IIQC 5LLIC 1YAZA 5D6CA 5LGHL 5C0CA 5K9JH 1UWGH 1JZFA 5BRZE 4OIIL 1VIWA 1CE1L 1N5AA 5F97E 1NLDH 3SO3C 1NCDH 4PJ5E 1HQ4A 1KLGB 2BOCB 1QFWL 4PJBA 1R3IL 1Q9WA 3DURA 1TIUA 3EG9A 4OZ4B 4XGZB 2EIZA 4X4XA 4KKBC 5T1LB 3W11C 4NQSA 4UAOB 3ABLB 3NJLA 4MD4B 3ARTA 4M4RA 1KTDB 2ZUVA 3CZGA 4LMQE 4URKA 4L4TB 2W1NA 2XN9E 2O6CA 3WOVA 1ROWA 3T6XA 3DDGA 5C0RH 5IBLC 3K8LA 1JDAA 1JJUA 3CSFA 4ICXA 1S8DB 5DQDL 5TDNA 5IJVB 2GT9B 5CGYC 4N2FA 5DHYB 4ZYKA 4I88A 2B0SH 3H9YA 2PXYB 2X1WL 3LS4H 4AC4A 3LEXB 2NY5H 4FHKA 1BBJA 1E6JH 3JBG7 1HAWA 3ARRA 4M8QB 3FT2B 4YDJA 3VSTA 3HZMA 5J12C 1QTYT 2A74B 4IK7A 4QRUB 1T5XB 4MMYB 1J0YA 1F56A 5DRNB 3P2TA 3VRIA 4WV1C 4XXCA 3AVEA 4OV6F 3RDTA 3DX7B 1IT9H 4XCEA 3JYBA 2KS0A 2MWCA 1QZNA 3E9TA 4A6YB 4TVPE 4MFHA 4F15B 1H8LA 2DWEB 2O6FA 3HE6C 4P4KD 3QZNA 3A6BL 3SE9L 4HIPA 4Z5RA 1EERB 3OMAB 3DTUB 2A83A 4JDEA 4V33A 1AS6A 3P3YA 5B1CA 4PSRA 2P5EB 4U1HB 4ZSOA 2A77L 1EIBA 1OAJA 1BZDA 2VSKB 2FWLB 2VN6A 5JPMB 4FQXC 4XO5A 2CUHA 2F58H 4NLHA 5E56A 1T66C 5HPMA 5ABZA 5BZWA 2JE8A 1XL4A 3H54A 3H9SB 3UDWC 3V5KA 3PPSA 1PAMA 1URLA 2IF7A 1L9PA 5E6IA 4H2CA 1UXSA 4PJ5D 1BZ7A 2CGRL 2UZIH 4LOVA 4X98B 3VSUA 5D93B 5L2KA 4B3VA 4N28A 3RX5A 2XTJC 3V6OC 3AQXA 3TZVC 4Y16B 4KQ4L 3C5ZA 3D2TA 1JZJA 2QPDB 4Z7AA 4G7VH 3ECWA 4NC1C 2B16A 4OJEH 3C08H 4DERA 2QV2A 5EEXA 3AC0A 1KTLA 3OHMB 4H8HA 3GMQA 1JNNL 1XSIA 1SMAA 3SDXB 2HA1A 5B3JE 3TEYA 2VDQB 4FYQA 2UVFA 1PIGA 2AEPH 4B60A 5BZDB 5SWSA 3EIFA 5C0NC 3QNYB 2YKKA 5B1KA 4BZ2L 4EBQL 1X6NA 4DP2X 1WD9A 3APCA 3SB3A 3QEQD 3ZTCC 3V0GA 4KJPD 1EO7A 1FCGA 3LRGA 5CJ8A 5E1QA 3O4LE 4OJFH 3MROB 5HP5A 3IJYA 3RTQD 2WXFA 1VDGA 2DAVA 3MV7A 3EHBC 4MRBA 4RGND 3VFPA 2CLZB 1EZVX 3SGDH 3KDPB 5F7HA 4HMDA 4TVPD 2EE6A 4HWUA 2FX8H 4OQ1A 2XSKA 4M5TA 1MFVA 3WKQA 3MRLB 5A16A 3U36A 1CC3A 2GSMB 4YHYB 3OSKA 3KXFE 2VMCA 5TQ0L 3KXFA 1XGRA 1BQLH 1G7JB 4ZO6A 5DUBB 4M5YH 2QKSA 3HG4A 3FCSA 4R84A 4YSTA 3TBSB 4BH8B 4TSCL 2A1WL 1JPGB 2V5RA 3MNDA 4KI5C 2IBZY 1T4KB 2DN7A 2XI9A 5JW3H 3VFOB 2DIEA 2BHYA 1ZA6B 4MSWA 4NYLB 3RL2B 3RVVC 4RIRB 3F84A 3QULA 1KMGA 3MJ7A 1AHWA 5LUMA 4L9LB 1TQBC 2N1TE 1BQHB 3VI3B 3Q9QA 4O58H 5D5MB 4MB5A 5D1XA 1NKOA 4YSCA 1TMQA 4UV4L 2QDVA 3RDTB 2X5PA 4JFYA 2EDEA 5EOCH 2B4CL 2ZNWA 4FJYA 2B1HL 5EBWA 1SBSH 1T04B 4F7TA 1NC2B 5C3TA 2R2HB 3HPLB 4GG8A 3WMQA 3E6FB 5AOZA 4LF3B 1K9TA 2DM4A 4OD3H 2WP3T 3QR2A 4G8AC 5LN4A 3WTTA 3L54A 3O6LH 4AG4L 1FA4A 4E5XB 3O2DA 4ORZC 1U8IB 5B8CB 1CTNA 1IB5A 3TEWA 3V9FA 1MFDL 3NRPA 1AVAA 4N3UA 5GGUA 3GEWB 4LAQL 3UYRL 4YE0A 3TWCH 1U42A 3WBDA 4YFLF 1SVBA 4HEPA 5LKNA 2Q2EB 1N67A 4MSWB 5I26A 3BVNA 4JKMA 3WJMA 2CH8A 4FNLL 5C08E 1IQWH 3MV8D 2GI7A 2B3IA 3KPTA 4N5EC 3V0IA 4XO3A 5TH2B 4U1SB 3HS0B 2UY7B 3QC6X 4ALAC 4OCSH 4BUGA 1LMKA 2QV4A 2XY1A 5JIHA 2OJEA 5F93C 2YEZB 2GCYB 2HB0A 3KWWB 3IKKA 3QNFA 4OCXL 3KPPA