4GT8A

Crystal structure of the catalytic and atp-binding domain from vras in complex with adp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
GAMLKDKSLGEGIKDLVIDLQKKVPMKVVHEIQDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEKLEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein vraS
publication title Structure of the Staphylococcus aureus VraS Catalytic and ATP-binding Domain
rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 40
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4gt8A00
2XX2A 3Q5LA 2IOPA 2YEIA 5M4KA 2XDUA 3VHDA 3A0YA 3BM9A 2BREA 4XKKA 1US7A 1Z5BA 3C0EA 1AH6A 1I5DA 4CWFA 3KE6A 1KZNA 2XK2A 4YKZA 2YEFA 2ZKJA 4NH7A 1UY7A 3LPSA 4EGHA 3R91A 4BIZA 2HG1A 4W7TA 2O1UA 1ZWHA 4FCPA 2Q8HA 4AWQA 5BODA 2XABA 3IEDA 3G7BA 2XCMA 4XC0A 3FT8A 2HKJA 2H8MA 3R4OA 4E00A 4XIRA 1GKXA 1TILA 1KIJA 2YEGA 4YKQA 4P7AA 1ID0A 2IWSA 5F3KA 3JZ3A 3VADA 3VHAA 4I5SA 4KTNA 5D6PA 4EEHA 1U0ZA 2YI7A 5FWKA 2CCSA 4XIQA 4FCRA 3B28A 1UYFA 2YEBA 2CH4A 2WI6A 3OWDA 5C93A 1AH8A 3K60A 4ASGA 4BIUA 4HXZA 3H4LA 4EFTA 2YKEA 4AWOA 1BGQA 1UYHA 4YKXA 4ZVIA 3B26A 3PEHA 3INWA 2XJGA 5M4MA 4WUCA 3A0TA 4E01A 2UWDA 1NHHA 5D6QA 2GQPA 2YEHA 5CF0A 1UYEA 2BU2A 3D0BA 4MP2A 4U7NA 2XDXA 2VWCA 5IDJA 4EMVA 4PRXA 3K97A 1Z59A 2ESAA 2ZBKB 3K98A 2QFOA 3D36A 1UY6A 1THNA 1EA6A 2H55A 3EKOA 1QY8A 4HZ5A 5CTXA 5D7CA 4B6CA 1MX0A 1JM6A 2WEPA 4LWEA 4GT8A 4BAEA 4GEEA 5J6AA 2WEQA 3HZ5A 4XKAA 3H80A 4FPPA 4YKRA 2QG0A 3HEKA 5L3JA 4Q20A 1Y8OA 3U67A 4XCJA 4XD8A 2XX5A 3A0RA 4XDMA 4XIPA 3O6OA 1EI1A 3CRLA 3DGEA 2FXSA 2YE3A 4O09A 4K4OA 1ZW9A 2WI2A 2IOQA 4GGLA 1AMWA 4EGIA 3D2RA 4L8ZA 4YKTA 4GFNA 2YKIA 4L90A 3EHGA 3U2DA 4O04A 1I59A 4YKYA 3B27A 2WI4A 4MPEA 2BU8A 5CTWA 3RLQA 4PL9A 1B3QA 1YT2A 2XDSA 4KP4A 2IWUA 3TZ4A 2Q8IA 4MBCA 1H7SA 4EGKA 4ASBA 1YSZA 2ZDYA 4JASA 2BTZA 4R3MA 4CWNA 3OW6A 5J71A 1AJ6A 4CE1A 1TIDA 5M4NA 1UYDA 3R4NA 4O0BA 1BKNA 1R62A 4WUBA 4YKWA 3EHFA 2YE5A 1U2OA 1A4HA 4JQLA 2BU5A 1I5BA 4XITA 2YI0A 3T1KA 2FWZA 2WI1A 3Q5JA 3ZXQA 3GIGB 3CGZA 1NHIA 3CGYA 3OMUA 4U93A 3MNRP 1Y8NA 5FNCA 4ZKIA 2Q8GA 2JJCA 2K5BA 3Q5KA 3WHAA 2IORA 4AS9A 4UROA 2XHXA 4MPCA 4E02A 2XHTA 4MOTA 2Q8FA 5CTUA 4GQTA 1TBWA 3T0ZA 2YE2A 3EHHA 4HY1A 4GCZA 2YGEA 4HY6A 4QPJA 4NH9A 4URLA 1UY9A 1Y8PA 5CTYA 3T0HA 2FWYA 4ASFA 4CWRA 4V25A 1NHJA 1TC6A 3VHCA 5D7RA 3LNUA 1QZRA 1L0OA 3ZKBA 2ZDXA 2XDKA 3RKZA 2YI6A 4MPNA 1YT0A 5M4PA 4LP0A 3U2KA 3HYZA 5CPHA 2BT0A 2YGFA 3TUHA 4O07A 1YS3A 4JAUA 3EKRA 2YECA 3SL2A 3FV5A 3BMYA 1S14A 4B7PA 2VW5A 3OWBA 1BXDA 3R4MA 3ZM7A 1H7UA 1I5CA 2BYHA 3CWVA 3FT5A 2YK2A 4CWSA 3TZ5A 2YK9A 2WERA 1YC1A 3GIGA 1OSFA 1UYCA 2YE7A 4CE2A 4LWFA 3HHUA 2YEJA 4FCQA 4AWPA 4CWTA 5D7DA 1AM1A 1ZXMA 2BZ5A 1B62A 2YEAA 5FNFA 4ASAA 2WI7A 2BU7A 4HXWA 5FNDA 4PRVA 4H81A 1YERA 2VCJA 1UY8A 4FMTA 4YKUA 2YJXA 2YE4A 1TH8A 2XJJA 4MB9A 3ZKDA 3OPDA 1TC0A 4H7QA 1S16A 1UYIA 2Q2EB 3INXA 1GJVA 4CE3A 1YC4A 4LPBA 2YE8A 3G7EA 4LWGA 4BQGA 3O2FA 2XJXA 3B24A 3A0WA 4KFGA 4HYMA 1Y4UA 1YESA 1UYMA 4P8OA 1YETA 5M4EA 2XDLA 2YEEA 3PEJA 2CCUA 4R1FA 2YKJA 3A0XA 2YEDA 3WQ9A 1QYEA 3QTFA 2WI3A 2YI5A 1Z5CA 2C2AA 2XHRA 3C11A 5M4HA 1UYGA 4HZ0A 4V26A 4QPKA 3TZ0A 1B63A 2O1VA 3O0IA 4L94A 3HYYA 3G75A 1I58A 3RLPA 2EXLA 2VCIA 3GIFA 3T2SA 1I5AA 4DZYA 3HZ1A 2O1WA 3QDDA 2JKIA 3CRKA 2YGAA 4EFUA 4R3AA 2XD6A 2YE9A 1BYQA 4CWQA 4CWPA 2CCTA 4XE2A 1GKZA 4URNA 4EM7A 2YKCA 4HYPA 4NH8A 1ZXNA 3EHJA 3A0ZA 4BQJA 3R4PA 4KQVA 2E0AA 3K99A 3ZXOA 4O05A 4PU9A 3TZ2A 2BU6A 4L93A 3RLRA 2AKPA 3GIEA 4XCLA 2FYPA 4LWIA 2BYIA 3R92A 4H85A 1YT1A 5IN9A 1YSRA 2CGFA 4JAVA 4WUDA 4LWHA 2CG9A 4I3HA 5F5RA 2XX4A 2GFDA 1YC3A 2WI5A 3B25A 3T10A 1PVGA 2BRCA 3NMQA 4KSHA 4U7OA 4DUHA 4CWOA 2YKBA 5GGZA 1Y4SA 2QG2A 4MP7A 5IDMA 2IWXA 2BSMA 1UYKA 4XTJA 2HCHA 3TTZA 1MU5A 2QF6A 1UYLA 4L91A 2PNRA 4KSGA 5BOCA 4URMA 2YE6A 4XKOA 4X9LA 2YJWA 4BXIA 1Z5AA
chains in the Genus database with same CATH superfamily
2XX2A 3Q5LA 2IOPA 2YEIA 5M4KA 2XDUA 3VHDA 3A0YA 3BM9A 2BREA 4XKKA 1US7A 1Z5BA 3C0EA 1AH6A 1I5DA 4CWFA 3KE6A 1KZNA 2XK2A 4YKZA 2YEFA 2ZKJA 4NH7A 1UY7A 3LPSA 4EGHA 3R91A 4BIZA 2HG1A 4W7TA 2O1UA 1ZWHA 4FCPA 2Q8HA 4AWQA 2C1IA 5BODA 2XABA 3IEDA 3G7BA 2XCMA 4XC0A 3FT8A 2HKJA 2H8MA 3R4OA 4E00A 4XIRA 4E72A 1GKXA 1TILA 1KIJA 2YEGA 4YKQA 4P7AA 1ID0A 2IWSA 5F3KA 3JZ3A 3VADA 3VHAA 4I5SA 4KTNA 5D6PA 4EEHA 1U0ZA 2YI7A 5JENA 5FWKA 2CCSA 4XIQA 4FCRA 3B28A 1UYFA 2YEBA 2CH4A 2WI6A 3OWDA 5C93A 1AH8A 3K60A 4ASGA 4BIUA 4HXZA 3H4LA 4EFTA 2YKEA 4AWOA 1BGQA 1UYHA 4YKXA 4ZVIA 3B26A 2C1GA 3PEHA 3INWA 2XJGA 2HHIA 5M4MA 4WUCA 3A0TA 4E01A 2UWDA 1NHHA 5D6QA 2FTKA 2GQPA 2YEHA 5CF0A 1UYEA 2BU2A 3D0BA 4MP2A 4U7NA 2XDXA 2VWCA 5IDJA 4EMVA 4PRXA 3K97A 1Z59A 2ESAA 2ZBKB 3K98A 2QFOA 3D36A 1UY6A 1THNA 1EA6A 2H55A 3EKOA 1QY8A 4HZ5A 5CTXA 5D7CA 3LMMA 4B6CA 1MX0A 1JM6A 2WEPA 4LWEA 4GT8A 4BAEA 4GEEA 5J6AA 2WEQA 3HZ5A 4XKAA 3H80A 4FPPA 4YKRA 2QG0A 3HEKA 5L3JA 4Q20A 1Y8OA 3U67A 4XCJA 4XD8A 2XX5A 3A0RA 4XDMA 4XIPA 3O6OA 1EI1A 3CRLA 3DGEA 2FXSA 2YE3A 4O09A 4K4OA 1ZW9A 2WI2A 2IOQA 4GGLA 1AMWA 4EGIA 3D2RA 4L8ZA 4YKTA 4GFNA 2YKIA 4L90A 3EHGA 3U2DA 4O04A 1I59A 4YKYA 3B27A 2WI4A 4MPEA 2BU8A 5CTWA 3RLQA 4PL9A 3CYGA 1B3QA 1YT2A 2XDSA 4KP4A 2IWUA 3TZ4A 2Q8IA 4MBCA 1H7SA 4EGKA 4ASBA 1YSZA 2ZDYA 4JASA 2BTZA 4R3MA 4CWNA 3OW6A 5J71A 1AJ6A 4CE1A 1TIDA 5M4NA 1F51A 1IXMA 1UYDA 3R4NA 4O0BA 1BKNA 1R62A 4WUBA 4YKWA 3EHFA 2YE5A 1U2OA 1A4HA 4JQLA 2BU5A 1I5BA 4XITA 2YI0A 3T1KA 2FWZA 2WI1A 3Q5JA 3ZXQA 3GIGB 3CGZA 1NHIA 3CGYA 3OMUA 4U93A 3MNRP 1Y8NA 5FNCA 4ZKIA 2Q8GA 2JJCA 2K5BA 3Q5KA 3WHAA 2IORA 4AS9A 4UROA 2XHXA 4MPCA 4E02A 2XHTA 4MOTA 2Q8FA 5CTUA 4GQTA 1TBWA 3T0ZA 2YE2A 3EHHA 4HY1A 4GCZA 2YGEA 4HY6A 4QPJA 4NH9A 4URLA 1UY9A 1Y8PA 5CTYA 3T0HA 2FWYA 4ASFA 4CWRA 4V25A 1NHJA 1TC6A 3VHCA 5D7RA 3LNUA 1QZRA 1L0OA 3ZKBA 2ZDXA 2XDKA 3RKZA 2YI6A 4MPNA 1YT0A 5M4PA 4LP0A 3U2KA 3HYZA 5CPHA 2BT0A 2YGFA 3TUHA 4O07A 1YS3A 4JAUA 3EKRA 2YECA 3SL2A 3FV5A 3BMYA 1S14A 4B7PA 2VW5A 3OWBA 1BXDA 3R4MA 3ZM7A 1H7UA 1I5CA 2BYHA 3CWVA 3FT5A 2YK2A 4CWSA 3TZ5A 2YK9A 2WERA 1YC1A 3GIGA 1OSFA 1UYCA 2YE7A 4CE2A 4LWFA 3HHUA 2YEJA 4FCQA 4AWPA 4CWTA 5D7DA 1AM1A 1ZXMA 2BZ5A 1B62A 2YEAA 5FNFA 4ASAA 2WI7A 2BU7A 4HXWA 5FNDA 4PRVA 4H81A 1YERA 2VCJA 1UY8A 4FMTA 4YKUA 2YJXA 2YE4A 1TH8A 2XJJA 4MB9A 3ZKDA 3OPDA 1TC0A 4H7QA 1S16A 1UYIA 2Q2EB 3INXA 1GJVA 4CE3A 1YC4A 4LPBA 2YE8A 3G7EA 4LWGA 4BQGA 3O2FA 2XJXA 3B24A 3A0WA 4KFGA 4HYMA 1Y4UA 1YESA 1UYMA 4P8OA 1YETA 5M4EA 2XDLA 2YEEA 3PEJA 2CCUA 4R1FA 2YKJA 3A0XA 2YEDA 3WQ9A 1QYEA 3QTFA 2WI3A 2YI5A 1Z5CA 2C2AA 2XHRA 3C11A 5M4HA 1UYGA 4HZ0A 4V26A 4QPKA 3TZ0A 1B63A 2O1VA 3O0IA 4L94A 3HYYA 3G75A 1I58A 3RLPA 2EXLA 2VCIA 3GIFA 3S5TA 3T2SA 1I5AA 4DZYA 3HZ1A 2O1WA 3QDDA 2JKIA 3CRKA 2YGAA 4EFUA 4R3AA 2XD6A 2YE9A 1BYQA 4CWQA 4CWPA 2CCTA 4XE2A 1GKZA 4URNA 4EM7A 2YKCA 4HYPA 4NH8A 1ZXNA 3EHJA 3A0ZA 4BQJA 3R4PA 4KQVA 2E0AA 3K99A 3ZXOA 4O05A 4PU9A 3TZ2A 2BU6A 4L93A 3RLRA 2AKPA 3GIEA 4XCLA 2FYPA 4LWIA 2BYIA 3R92A 4H85A 1YT1A 5IN9A 1YSRA 2CGFA 4JAVA 4WUDA 4LWHA 2CG9A 4I3HA 5F5RA 2XX4A 2GFDA 1YC3A 2WI5A 3B25A 3T10A 1PVGA 2BRCA 3NMQA 4KSHA 4U7OA 4DUHA 4CWOA 2YKBA 5GGZA 1Y4SA 2QG2A 4MP7A 5IDMA 2IWXA 2BSMA 1UYKA 4XTJA 2HCHA 3TTZA 1MU5A 2QF6A 1UYLA 4L91A 2PNRA 4KSGA 5BOCA 4URMA 2YE6A 4XKOA 4X9LA 2YJWA 4BXIA 1Z5AA
chains in the Genus database with same CATH topology
2XX2A 3Q5LA 2IOPA 2YEIA 5M4KA 2XDUA 3VHDA 3A0YA 3BM9A 2BREA 4XKKA 1US7A 1Z5BA 3C0EA 1AH6A 1I5DA 4CWFA 3KE6A 1KZNA 2XK2A 4YKZA 2YEFA 2ZKJA 4NH7A 1UY7A 3LPSA 4EGHA 3R91A 4BIZA 2HG1A 4W7TA 2O1UA 1ZWHA 4FCPA 2Q8HA 4AWQA 5BODA 2XABA 3IEDA 3G7BA 2XCMA 4XC0A 3FT8A 2HKJA 2H8MA 3R4OA 4E00A 4XIRA 1GKXA 1TILA 1KIJA 2YEGA 4YKQA 4P7AA 1ID0A 2IWSA 5F3KA 3JZ3A 3VADA 3VHAA 4I5SA 4KTNA 5D6PA 4EEHA 1U0ZA 2YI7A 5FWKA 2CCSA 4XIQA 4FCRA 3B28A 1UYFA 2YEBA 2CH4A 2WI6A 3OWDA 5C93A 1AH8A 3K60A 4ASGA 4BIUA 4HXZA 3H4LA 4EFTA 2YKEA 4AWOA 1BGQA 1UYHA 4YKXA 4ZVIA 3B26A 3PEHA 3INWA 2XJGA 5M4MA 4WUCA 3A0TA 4E01A 2UWDA 1NHHA 5D6QA 2GQPA 2YEHA 5CF0A 1UYEA 2BU2A 3D0BA 4MP2A 4U7NA 2XDXA 2VWCA 5IDJA 4EMVA 4PRXA 3K97A 1Z59A 2ESAA 2ZBKB 3K98A 2QFOA 3D36A 1UY6A 1THNA 1EA6A 2H55A 3EKOA 1QY8A 4HZ5A 5CTXA 5D7CA 4B6CA 1MX0A 1JM6A 2WEPA 4LWEA 4GT8A 4BAEA 4GEEA 5J6AA 2WEQA 3HZ5A 4XKAA 3H80A 4FPPA 4YKRA 2QG0A 3HEKA 5L3JA 4Q20A 1Y8OA 3U67A 4XCJA 4XD8A 2XX5A 3A0RA 4XDMA 4XIPA 3O6OA 1EI1A 3CRLA 3DGEA 2FXSA 2YE3A 4O09A 4K4OA 1ZW9A 2WI2A 2IOQA 4GGLA 1AMWA 4EGIA 3D2RA 4L8ZA 4YKTA 4GFNA 2YKIA 4L90A 3EHGA 3U2DA 4O04A 1I59A 4YKYA 3B27A 2WI4A 4MPEA 2BU8A 5CTWA 3RLQA 4PL9A 1B3QA 1YT2A 2XDSA 4KP4A 2IWUA 3TZ4A 2Q8IA 4MBCA 1H7SA 4EGKA 4ASBA 1YSZA 2ZDYA 4JASA 2BTZA 4R3MA 4CWNA 3OW6A 5J71A 1AJ6A 4CE1A 1TIDA 5M4NA 1UYDA 3R4NA 4O0BA 1BKNA 1R62A 4WUBA 4YKWA 3EHFA 2YE5A 1U2OA 1A4HA 4JQLA 2BU5A 1I5BA 4XITA 2YI0A 3T1KA 2FWZA 2WI1A 3Q5JA 3ZXQA 3GIGB 3CGZA 1NHIA 3CGYA 3OMUA 4U93A 3MNRP 1Y8NA 5FNCA 4ZKIA 2Q8GA 2JJCA 2K5BA 3Q5KA 3WHAA 2IORA 4AS9A 4UROA 2XHXA 4MPCA 4E02A 2XHTA 4MOTA 2Q8FA 5CTUA 4GQTA 1TBWA 3T0ZA 2YE2A 3EHHA 4HY1A 4GCZA 2YGEA 4HY6A 4QPJA 4NH9A 4URLA 1UY9A 1Y8PA 5CTYA 3T0HA 2FWYA 4ASFA 4CWRA 4V25A 1NHJA 1TC6A 3VHCA 5D7RA 3LNUA 1QZRA 1L0OA 3ZKBA 2ZDXA 2XDKA 3RKZA 2YI6A 4MPNA 1YT0A 5M4PA 4LP0A 3U2KA 3HYZA 5CPHA 2BT0A 2YGFA 3TUHA 4O07A 1YS3A 4JAUA 3EKRA 2YECA 3SL2A 3FV5A 3BMYA 1S14A 4B7PA 2VW5A 3OWBA 1BXDA 3R4MA 3ZM7A 1H7UA 1I5CA 2BYHA 3CWVA 3FT5A 2YK2A 4CWSA 3TZ5A 2YK9A 2WERA 1YC1A 3GIGA 1OSFA 1UYCA 2YE7A 4CE2A 4LWFA 3HHUA 2YEJA 4FCQA 4AWPA 4CWTA 5D7DA 1AM1A 1ZXMA 2BZ5A 1B62A 2YEAA 5FNFA 4ASAA 2WI7A 2BU7A 4HXWA 5FNDA 4PRVA 4H81A 1YERA 2VCJA 1UY8A 4FMTA 4YKUA 2YJXA 2YE4A 1TH8A 2XJJA 4MB9A 3ZKDA 3OPDA 1TC0A 4H7QA 1S16A 1UYIA 2Q2EB 3INXA 1GJVA 4CE3A 1YC4A 4LPBA 2YE8A 3G7EA 4LWGA 4BQGA 3O2FA 2XJXA 3B24A 3A0WA 4KFGA 4HYMA 1Y4UA 1YESA 1UYMA 4P8OA 1YETA 5M4EA 2XDLA 2YEEA 3PEJA 2CCUA 4R1FA 2YKJA 3A0XA 2YEDA 3WQ9A 1QYEA 3QTFA 2WI3A 2YI5A 1Z5CA 2C2AA 2XHRA 3C11A 5M4HA 1UYGA 4HZ0A 4V26A 4QPKA 3TZ0A 1B63A 2O1VA 3O0IA 4L94A 3HYYA 3G75A 1I58A 3RLPA 2EXLA 2VCIA 3GIFA 3T2SA 1I5AA 4DZYA 3HZ1A 2O1WA 3QDDA 2JKIA 3CRKA 2YGAA 4EFUA 4R3AA 2XD6A 2YE9A 1BYQA 4CWQA 4CWPA 2CCTA 4XE2A 1GKZA 4URNA 4EM7A 2YKCA 4HYPA 4NH8A 1ZXNA 3EHJA 3A0ZA 4BQJA 3R4PA 4KQVA 2E0AA 3K99A 3ZXOA 4O05A 4PU9A 3TZ2A 2BU6A 4L93A 3RLRA 2AKPA 3GIEA 4XCLA 2FYPA 4LWIA 2BYIA 3R92A 4H85A 1YT1A 5IN9A 1YSRA 2CGFA 4JAVA 4WUDA 4LWHA 2CG9A 4I3HA 5F5RA 2XX4A 2GFDA 1YC3A 2WI5A 3B25A 3T10A 1PVGA 2BRCA 3NMQA 4KSHA 4U7OA 4DUHA 4CWOA 2YKBA 5GGZA 1Y4SA 2QG2A 4MP7A 5IDMA 2IWXA 2BSMA 1UYKA 4XTJA 2HCHA 3TTZA 1MU5A 2QF6A 1UYLA 4L91A 2PNRA 4KSGA 5BOCA 4URMA 2YE6A 4XKOA 4X9LA 2YJWA 4BXIA 1Z5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XX2 A;  3Q5L A;  2IOP A;  2YEI A;  5M4K A;  2XDU A;  3VHD A;  3A0Y A;  3BM9 A;  2BRE A;  4XKK A;  1US7 A;  1Z5B A;  3C0E A;  1AH6 A;  1I5D A;  4CWF A;  3KE6 A;  1KZN A;  2XK2 A;  4YKZ A;  2YEF A;  2ZKJ A;  4NH7 A;  1UY7 A;  3LPS A;  4EGH A;  3R91 A;  4BIZ A;  2HG1 A;  4W7T A;  2O1U A;  1ZWH A;  4FCP A;  2Q8H A;  4AWQ A;  5BOD A;  2XAB A;  3IED A;  3G7B A;  2XCM A;  4XC0 A;  3FT8 A;  2HKJ A;  2H8M A;  3R4O A;  4E00 A;  4XIR A;  1GKX A;  1TIL A;  1KIJ A;  2YEG A;  4YKQ A;  4P7A A;  1ID0 A;  2IWS A;  5F3K A;  3JZ3 A;  3VAD A;  3VHA A;  4I5S A;  4KTN A;  5D6P A;  4EEH A;  1U0Z A;  2YI7 A;  5FWK A;  2CCS A;  4XIQ A;  4FCR A;  3B28 A;  1UYF A;  2YEB A;  2CH4 A;  2WI6 A;  3OWD A;  5C93 A;  1AH8 A;  3K60 A;  4ASG A;  4BIU A;  4HXZ A;  3H4L A;  4EFT A;  2YKE A;  4AWO A;  1BGQ A;  1UYH A;  4YKX A;  4ZVI A;  3B26 A;  3PEH A;  3INW A;  2XJG A;  5M4M A;  4WUC A;  3A0T A;  4E01 A;  2UWD A;  1NHH A;  5D6Q A;  2GQP A;  2YEH A;  5CF0 A;  1UYE A;  2BU2 A;  3D0B A;  4MP2 A;  4U7N A;  2XDX A;  2VWC A;  5IDJ A;  4EMV A;  4PRX A;  3K97 A;  1Z59 A;  2ESA A;  2ZBK B;  3K98 A;  2QFO A;  3D36 A;  1UY6 A;  1THN A;  1EA6 A;  2H55 A;  3EKO A;  1QY8 A;  4HZ5 A;  5CTX A;  5D7C A;  4B6C A;  1MX0 A;  1JM6 A;  2WEP A;  4LWE A;  4GT8 A;  4BAE A;  4GEE A;  5J6A A;  2WEQ A;  3HZ5 A;  4XKA A;  3H80 A;  4FPP A;  4YKR A;  2QG0 A;  3HEK A;  5L3J A;  4Q20 A;  1Y8O A;  3U67 A;  4XCJ A;  4XD8 A;  2XX5 A;  3A0R A;  4XDM A;  4XIP A;  3O6O A;  1EI1 A;  3CRL A;  3DGE A;  2FXS A;  2YE3 A;  4O09 A;  4K4O A;  1ZW9 A;  2WI2 A;  2IOQ A;  4GGL A;  1AMW A;  4EGI A;  3D2R A;  4L8Z A;  4YKT A;  4GFN A;  2YKI A;  4L90 A;  3EHG A;  3U2D A;  4O04 A;  1I59 A;  4YKY A;  3B27 A;  2WI4 A;  4MPE A;  2BU8 A;  5CTW A;  3RLQ A;  4PL9 A;  1B3Q A;  1YT2 A;  2XDS A;  4KP4 A;  2IWU A;  3TZ4 A;  2Q8I A;  4MBC A;  1H7S A;  4EGK A;  4ASB A;  1YSZ A;  2ZDY A;  4JAS A;  2BTZ A;  4R3M A;  4CWN A;  3OW6 A;  5J71 A;  1AJ6 A;  4CE1 A;  1TID A;  5M4N A;  1UYD A;  3R4N A;  4O0B A;  1BKN A;  1R62 A;  4WUB A;  4YKW A;  3EHF A;  2YE5 A;  1U2O A;  1A4H A;  4JQL A;  2BU5 A;  1I5B A;  4XIT A;  2YI0 A;  3T1K A;  2FWZ A;  2WI1 A;  3Q5J A;  3ZXQ A;  3GIG B;  3CGZ A;  1NHI A;  3CGY A;  3OMU A;  4U93 A;  3MNR P;  1Y8N A;  5FNC A;  4ZKI A;  2Q8G A;  2JJC A;  2K5B A;  3Q5K A;  3WHA A;  2IOR A;  4AS9 A;  4URO A;  2XHX A;  4MPC A;  4E02 A;  2XHT A;  4MOT A;  2Q8F A;  5CTU A;  4GQT A;  1TBW A;  3T0Z A;  2YE2 A;  3EHH A;  4HY1 A;  4GCZ A;  2YGE A;  4HY6 A;  4QPJ A;  4NH9 A;  4URL A;  1UY9 A;  1Y8P A;  5CTY A;  3T0H A;  2FWY A;  4ASF A;  4CWR A;  4V25 A;  1NHJ A;  1TC6 A;  3VHC A;  5D7R A;  3LNU A;  1QZR A;  1L0O A;  3ZKB A;  2ZDX A;  2XDK A;  3RKZ A;  2YI6 A;  4MPN A;  1YT0 A;  5M4P A;  4LP0 A;  3U2K A;  3HYZ A;  5CPH A;  2BT0 A;  2YGF A;  3TUH A;  4O07 A;  1YS3 A;  4JAU A;  3EKR A;  2YEC A;  3SL2 A;  3FV5 A;  3BMY A;  1S14 A;  4B7P A;  2VW5 A;  3OWB A;  1BXD A;  3R4M A;  3ZM7 A;  1H7U A;  1I5C A;  2BYH A;  3CWV A;  3FT5 A;  2YK2 A;  4CWS A;  3TZ5 A;  2YK9 A;  2WER A;  1YC1 A;  3GIG A;  1OSF A;  1UYC A;  2YE7 A;  4CE2 A;  4LWF A;  3HHU A;  2YEJ A;  4FCQ A;  4AWP A;  4CWT A;  5D7D A;  1AM1 A;  1ZXM A;  2BZ5 A;  1B62 A;  2YEA A;  5FNF A;  4ASA A;  2WI7 A;  2BU7 A;  4HXW A;  5FND A;  4PRV A;  4H81 A;  1YER A;  2VCJ A;  1UY8 A;  4FMT A;  4YKU A;  2YJX A;  2YE4 A;  1TH8 A;  2XJJ A;  4MB9 A;  3ZKD A;  3OPD A;  1TC0 A;  4H7Q A;  1S16 A;  1UYI A;  2Q2E B;  3INX A;  1GJV A;  4CE3 A;  1YC4 A;  4LPB A;  2YE8 A;  3G7E A;  4LWG A;  4BQG A;  3O2F A;  2XJX A;  3B24 A;  3A0W A;  4KFG A;  4HYM A;  1Y4U A;  1YES A;  1UYM A;  4P8O A;  1YET A;  5M4E A;  2XDL A;  2YEE A;  3PEJ A;  2CCU A;  4R1F A;  2YKJ A;  3A0X A;  2YED A;  3WQ9 A;  1QYE A;  3QTF A;  2WI3 A;  2YI5 A;  1Z5C A;  2C2A A;  2XHR A;  3C11 A;  5M4H A;  1UYG A;  4HZ0 A;  4V26 A;  4QPK A;  3TZ0 A;  1B63 A;  2O1V A;  3O0I A;  4L94 A;  3HYY A;  3G75 A;  1I58 A;  3RLP A;  2EXL A;  2VCI A;  3GIF A;  3T2S A;  1I5A A;  4DZY A;  3HZ1 A;  2O1W A;  3QDD A;  2JKI A;  3CRK A;  2YGA A;  4EFU A;  4R3A A;  2XD6 A;  2YE9 A;  1BYQ A;  4CWQ A;  4CWP A;  2CCT A;  4XE2 A;  1GKZ A;  4URN A;  4EM7 A;  2YKC A;  4HYP A;  4NH8 A;  1ZXN A;  3EHJ A;  3A0Z A;  4BQJ A;  3R4P A;  4KQV A;  2E0A A;  3K99 A;  3ZXO A;  4O05 A;  4PU9 A;  3TZ2 A;  2BU6 A;  4L93 A;  3RLR A;  2AKP A;  3GIE A;  4XCL A;  2FYP A;  4LWI A;  2BYI A;  3R92 A;  4H85 A;  1YT1 A;  5IN9 A;  1YSR A;  2CGF A;  4JAV A;  4WUD A;  4LWH A;  2CG9 A;  4I3H A;  5F5R A;  2XX4 A;  2GFD A;  1YC3 A;  2WI5 A;  3B25 A;  3T10 A;  1PVG A;  2BRC A;  3NMQ A;  4KSH A;  4U7O A;  4DUH A;  4CWO A;  2YKB A;  5GGZ A;  1Y4S A;  2QG2 A;  4MP7 A;  5IDM A;  2IWX A;  2BSM A;  1UYK A;  4XTJ A;  2HCH A;  3TTZ A;  1MU5 A;  2QF6 A;  1UYL A;  4L91 A;  2PNR A;  4KSG A;  5BOC A;  4URM A;  2YE6 A;  4XKO A;  4X9L A;  2YJW A;  4BXI A;  1Z5A A; 
#chains in the Genus database with same CATH topology
 2XX2 A;  3Q5L A;  2IOP A;  2YEI A;  5M4K A;  2XDU A;  3VHD A;  3A0Y A;  3BM9 A;  2BRE A;  4XKK A;  1US7 A;  1Z5B A;  3C0E A;  1AH6 A;  1I5D A;  4CWF A;  3KE6 A;  1KZN A;  2XK2 A;  4YKZ A;  2YEF A;  2ZKJ A;  4NH7 A;  1UY7 A;  3LPS A;  4EGH A;  3R91 A;  4BIZ A;  2HG1 A;  4W7T A;  2O1U A;  1ZWH A;  4FCP A;  2Q8H A;  4AWQ A;  2C1I A;  5BOD A;  2XAB A;  3IED A;  3G7B A;  2XCM A;  4XC0 A;  3FT8 A;  2HKJ A;  2H8M A;  3R4O A;  4E00 A;  4XIR A;  4E72 A;  1GKX A;  1TIL A;  1KIJ A;  2YEG A;  4YKQ A;  4P7A A;  1ID0 A;  2IWS A;  5F3K A;  3JZ3 A;  3VAD A;  3VHA A;  4I5S A;  4KTN A;  5D6P A;  4EEH A;  1U0Z A;  2YI7 A;  5JEN A;  5FWK A;  2CCS A;  4XIQ A;  4FCR A;  3B28 A;  1UYF A;  2YEB A;  2CH4 A;  2WI6 A;  3OWD A;  5C93 A;  1AH8 A;  3K60 A;  4ASG A;  4BIU A;  4HXZ A;  3H4L A;  4EFT A;  2YKE A;  4AWO A;  1BGQ A;  1UYH A;  4YKX A;  4ZVI A;  3B26 A;  2C1G A;  3PEH A;  3INW A;  2XJG A;  2HHI A;  5M4M A;  4WUC A;  3A0T A;  4E01 A;  2UWD A;  1NHH A;  5D6Q A;  2FTK A;  2GQP A;  2YEH A;  5CF0 A;  1UYE A;  2BU2 A;  3D0B A;  4MP2 A;  4U7N A;  2XDX A;  2VWC A;  5IDJ A;  4EMV A;  4PRX A;  3K97 A;  1Z59 A;  2ESA A;  2ZBK B;  3K98 A;  2QFO A;  3D36 A;  1UY6 A;  1THN A;  1EA6 A;  2H55 A;  3EKO A;  1QY8 A;  4HZ5 A;  5CTX A;  5D7C A;  3LMM A;  4B6C A;  1MX0 A;  1JM6 A;  2WEP A;  4LWE A;  4GT8 A;  4BAE A;  4GEE A;  5J6A A;  2WEQ A;  3HZ5 A;  4XKA A;  3H80 A;  4FPP A;  4YKR A;  2QG0 A;  3HEK A;  5L3J A;  4Q20 A;  1Y8O A;  3U67 A;  4XCJ A;  4XD8 A;  2XX5 A;  3A0R A;  4XDM A;  4XIP A;  3O6O A;  1EI1 A;  3CRL A;  3DGE A;  2FXS A;  2YE3 A;  4O09 A;  4K4O A;  1ZW9 A;  2WI2 A;  2IOQ A;  4GGL A;  1AMW A;  4EGI A;  3D2R A;  4L8Z A;  4YKT A;  4GFN A;  2YKI A;  4L90 A;  3EHG A;  3U2D A;  4O04 A;  1I59 A;  4YKY A;  3B27 A;  2WI4 A;  4MPE A;  2BU8 A;  5CTW A;  3RLQ A;  4PL9 A;  3CYG A;  1B3Q A;  1YT2 A;  2XDS A;  4KP4 A;  2IWU A;  3TZ4 A;  2Q8I A;  4MBC A;  1H7S A;  4EGK A;  4ASB A;  1YSZ A;  2ZDY A;  4JAS A;  2BTZ A;  4R3M A;  4CWN A;  3OW6 A;  5J71 A;  1AJ6 A;  4CE1 A;  1TID A;  5M4N A;  1F51 A;  1IXM A;  1UYD A;  3R4N A;  4O0B A;  1BKN A;  1R62 A;  4WUB A;  4YKW A;  3EHF A;  2YE5 A;  1U2O A;  1A4H A;  4JQL A;  2BU5 A;  1I5B A;  4XIT A;  2YI0 A;  3T1K A;  2FWZ A;  2WI1 A;  3Q5J A;  3ZXQ A;  3GIG B;  3CGZ A;  1NHI A;  3CGY A;  3OMU A;  4U93 A;  3MNR P;  1Y8N A;  5FNC A;  4ZKI A;  2Q8G A;  2JJC A;  2K5B A;  3Q5K A;  3WHA A;  2IOR A;  4AS9 A;  4URO A;  2XHX A;  4MPC A;  4E02 A;  2XHT A;  4MOT A;  2Q8F A;  5CTU A;  4GQT A;  1TBW A;  3T0Z A;  2YE2 A;  3EHH A;  4HY1 A;  4GCZ A;  2YGE A;  4HY6 A;  4QPJ A;  4NH9 A;  4URL A;  1UY9 A;  1Y8P A;  5CTY A;  3T0H A;  2FWY A;  4ASF A;  4CWR A;  4V25 A;  1NHJ A;  1TC6 A;  3VHC A;  5D7R A;  3LNU A;  1QZR A;  1L0O A;  3ZKB A;  2ZDX A;  2XDK A;  3RKZ A;  2YI6 A;  4MPN A;  1YT0 A;  5M4P A;  4LP0 A;  3U2K A;  3HYZ A;  5CPH A;  2BT0 A;  2YGF A;  3TUH A;  4O07 A;  1YS3 A;  4JAU A;  3EKR A;  2YEC A;  3SL2 A;  3FV5 A;  3BMY A;  1S14 A;  4B7P A;  2VW5 A;  3OWB A;  1BXD A;  3R4M A;  3ZM7 A;  1H7U A;  1I5C A;  2BYH A;  3CWV A;  3FT5 A;  2YK2 A;  4CWS A;  3TZ5 A;  2YK9 A;  2WER A;  1YC1 A;  3GIG A;  1OSF A;  1UYC A;  2YE7 A;  4CE2 A;  4LWF A;  3HHU A;  2YEJ A;  4FCQ A;  4AWP A;  4CWT A;  5D7D A;  1AM1 A;  1ZXM A;  2BZ5 A;  1B62 A;  2YEA A;  5FNF A;  4ASA A;  2WI7 A;  2BU7 A;  4HXW A;  5FND A;  4PRV A;  4H81 A;  1YER A;  2VCJ A;  1UY8 A;  4FMT A;  4YKU A;  2YJX A;  2YE4 A;  1TH8 A;  2XJJ A;  4MB9 A;  3ZKD A;  3OPD A;  1TC0 A;  4H7Q A;  1S16 A;  1UYI A;  2Q2E B;  3INX A;  1GJV A;  4CE3 A;  1YC4 A;  4LPB A;  2YE8 A;  3G7E A;  4LWG A;  4BQG A;  3O2F A;  2XJX A;  3B24 A;  3A0W A;  4KFG A;  4HYM A;  1Y4U A;  1YES A;  1UYM A;  4P8O A;  1YET A;  5M4E A;  2XDL A;  2YEE A;  3PEJ A;  2CCU A;  4R1F A;  2YKJ A;  3A0X A;  2YED A;  3WQ9 A;  1QYE A;  3QTF A;  2WI3 A;  2YI5 A;  1Z5C A;  2C2A A;  2XHR A;  3C11 A;  5M4H A;  1UYG A;  4HZ0 A;  4V26 A;  4QPK A;  3TZ0 A;  1B63 A;  2O1V A;  3O0I A;  4L94 A;  3HYY A;  3G75 A;  1I58 A;  3RLP A;  2EXL A;  2VCI A;  3GIF A;  3S5T A;  3T2S A;  1I5A A;  4DZY A;  3HZ1 A;  2O1W A;  3QDD A;  2JKI A;  3CRK A;  2YGA A;  4EFU A;  4R3A A;  2XD6 A;  2YE9 A;  1BYQ A;  4CWQ A;  4CWP A;  2CCT A;  4XE2 A;  1GKZ A;  4URN A;  4EM7 A;  2YKC A;  4HYP A;  4NH8 A;  1ZXN A;  3EHJ A;  3A0Z A;  4BQJ A;  3R4P A;  4KQV A;  2E0A A;  3K99 A;  3ZXO A;  4O05 A;  4PU9 A;  3TZ2 A;  2BU6 A;  4L93 A;  3RLR A;  2AKP A;  3GIE A;  4XCL A;  2FYP A;  4LWI A;  2BYI A;  3R92 A;  4H85 A;  1YT1 A;  5IN9 A;  1YSR A;  2CGF A;  4JAV A;  4WUD A;  4LWH A;  2CG9 A;  4I3H A;  5F5R A;  2XX4 A;  2GFD A;  1YC3 A;  2WI5 A;  3B25 A;  3T10 A;  1PVG A;  2BRC A;  3NMQ A;  4KSH A;  4U7O A;  4DUH A;  4CWO A;  2YKB A;  5GGZ A;  1Y4S A;  2QG2 A;  4MP7 A;  5IDM A;  2IWX A;  2BSM A;  1UYK A;  4XTJ A;  2HCH A;  3TTZ A;  1MU5 A;  2QF6 A;  1UYL A;  4L91 A;  2PNR A;  4KSG A;  5BOC A;  4URM A;  2YE6 A;  4XKO A;  4X9L A;  2YJW A;  4BXI A;  1Z5A A; 
#chains in the Genus database with same CATH homology
 2XX2 A;  3Q5L A;  2IOP A;  2YEI A;  5M4K A;  2XDU A;  3VHD A;  3A0Y A;  3BM9 A;  2BRE A;  4XKK A;  1US7 A;  1Z5B A;  3C0E A;  1AH6 A;  1I5D A;  4CWF A;  3KE6 A;  1KZN A;  2XK2 A;  4YKZ A;  2YEF A;  2ZKJ A;  4NH7 A;  1UY7 A;  3LPS A;  4EGH A;  3R91 A;  4BIZ A;  2HG1 A;  4W7T A;  2O1U A;  1ZWH A;  4FCP A;  2Q8H A;  4AWQ A;  5BOD A;  2XAB A;  3IED A;  3G7B A;  2XCM A;  4XC0 A;  3FT8 A;  2HKJ A;  2H8M A;  3R4O A;  4E00 A;  4XIR A;  1GKX A;  1TIL A;  1KIJ A;  2YEG A;  4YKQ A;  4P7A A;  1ID0 A;  2IWS A;  5F3K A;  3JZ3 A;  3VAD A;  3VHA A;  4I5S A;  4KTN A;  5D6P A;  4EEH A;  1U0Z A;  2YI7 A;  5FWK A;  2CCS A;  4XIQ A;  4FCR A;  3B28 A;  1UYF A;  2YEB A;  2CH4 A;  2WI6 A;  3OWD A;  5C93 A;  1AH8 A;  3K60 A;  4ASG A;  4BIU A;  4HXZ A;  3H4L A;  4EFT A;  2YKE A;  4AWO A;  1BGQ A;  1UYH A;  4YKX A;  4ZVI A;  3B26 A;  3PEH A;  3INW A;  2XJG A;  5M4M A;  4WUC A;  3A0T A;  4E01 A;  2UWD A;  1NHH A;  5D6Q A;  2GQP A;  2YEH A;  5CF0 A;  1UYE A;  2BU2 A;  3D0B A;  4MP2 A;  4U7N A;  2XDX A;  2VWC A;  5IDJ A;  4EMV A;  4PRX A;  3K97 A;  1Z59 A;  2ESA A;  2ZBK B;  3K98 A;  2QFO A;  3D36 A;  1UY6 A;  1THN A;  1EA6 A;  2H55 A;  3EKO A;  1QY8 A;  4HZ5 A;  5CTX A;  5D7C A;  4B6C A;  1MX0 A;  1JM6 A;  2WEP A;  4LWE A;  4GT8 A;  4BAE A;  4GEE A;  5J6A A;  2WEQ A;  3HZ5 A;  4XKA A;  3H80 A;  4FPP A;  4YKR A;  2QG0 A;  3HEK A;  5L3J A;  4Q20 A;  1Y8O A;  3U67 A;  4XCJ A;  4XD8 A;  2XX5 A;  3A0R A;  4XDM A;  4XIP A;  3O6O A;  1EI1 A;  3CRL A;  3DGE A;  2FXS A;  2YE3 A;  4O09 A;  4K4O A;  1ZW9 A;  2WI2 A;  2IOQ A;  4GGL A;  1AMW A;  4EGI A;  3D2R A;  4L8Z A;  4YKT A;  4GFN A;  2YKI A;  4L90 A;  3EHG A;  3U2D A;  4O04 A;  1I59 A;  4YKY A;  3B27 A;  2WI4 A;  4MPE A;  2BU8 A;  5CTW A;  3RLQ A;  4PL9 A;  1B3Q A;  1YT2 A;  2XDS A;  4KP4 A;  2IWU A;  3TZ4 A;  2Q8I A;  4MBC A;  1H7S A;  4EGK A;  4ASB A;  1YSZ A;  2ZDY A;  4JAS A;  2BTZ A;  4R3M A;  4CWN A;  3OW6 A;  5J71 A;  1AJ6 A;  4CE1 A;  1TID A;  5M4N A;  1UYD A;  3R4N A;  4O0B A;  1BKN A;  1R62 A;  4WUB A;  4YKW A;  3EHF A;  2YE5 A;  1U2O A;  1A4H A;  4JQL A;  2BU5 A;  1I5B A;  4XIT A;  2YI0 A;  3T1K A;  2FWZ A;  2WI1 A;  3Q5J A;  3ZXQ A;  3GIG B;  3CGZ A;  1NHI A;  3CGY A;  3OMU A;  4U93 A;  3MNR P;  1Y8N A;  5FNC A;  4ZKI A;  2Q8G A;  2JJC A;  2K5B A;  3Q5K A;  3WHA A;  2IOR A;  4AS9 A;  4URO A;  2XHX A;  4MPC A;  4E02 A;  2XHT A;  4MOT A;  2Q8F A;  5CTU A;  4GQT A;  1TBW A;  3T0Z A;  2YE2 A;  3EHH A;  4HY1 A;  4GCZ A;  2YGE A;  4HY6 A;  4QPJ A;  4NH9 A;  4URL A;  1UY9 A;  1Y8P A;  5CTY A;  3T0H A;  2FWY A;  4ASF A;  4CWR A;  4V25 A;  1NHJ A;  1TC6 A;  3VHC A;  5D7R A;  3LNU A;  1QZR A;  1L0O A;  3ZKB A;  2ZDX A;  2XDK A;  3RKZ A;  2YI6 A;  4MPN A;  1YT0 A;  5M4P A;  4LP0 A;  3U2K A;  3HYZ A;  5CPH A;  2BT0 A;  2YGF A;  3TUH A;  4O07 A;  1YS3 A;  4JAU A;  3EKR A;  2YEC A;  3SL2 A;  3FV5 A;  3BMY A;  1S14 A;  4B7P A;  2VW5 A;  3OWB A;  1BXD A;  3R4M A;  3ZM7 A;  1H7U A;  1I5C A;  2BYH A;  3CWV A;  3FT5 A;  2YK2 A;  4CWS A;  3TZ5 A;  2YK9 A;  2WER A;  1YC1 A;  3GIG A;  1OSF A;  1UYC A;  2YE7 A;  4CE2 A;  4LWF A;  3HHU A;  2YEJ A;  4FCQ A;  4AWP A;  4CWT A;  5D7D A;  1AM1 A;  1ZXM A;  2BZ5 A;  1B62 A;  2YEA A;  5FNF A;  4ASA A;  2WI7 A;  2BU7 A;  4HXW A;  5FND A;  4PRV A;  4H81 A;  1YER A;  2VCJ A;  1UY8 A;  4FMT A;  4YKU A;  2YJX A;  2YE4 A;  1TH8 A;  2XJJ A;  4MB9 A;  3ZKD A;  3OPD A;  1TC0 A;  4H7Q A;  1S16 A;  1UYI A;  2Q2E B;  3INX A;  1GJV A;  4CE3 A;  1YC4 A;  4LPB A;  2YE8 A;  3G7E A;  4LWG A;  4BQG A;  3O2F A;  2XJX A;  3B24 A;  3A0W A;  4KFG A;  4HYM A;  1Y4U A;  1YES A;  1UYM A;  4P8O A;  1YET A;  5M4E A;  2XDL A;  2YEE A;  3PEJ A;  2CCU A;  4R1F A;  2YKJ A;  3A0X A;  2YED A;  3WQ9 A;  1QYE A;  3QTF A;  2WI3 A;  2YI5 A;  1Z5C A;  2C2A A;  2XHR A;  3C11 A;  5M4H A;  1UYG A;  4HZ0 A;  4V26 A;  4QPK A;  3TZ0 A;  1B63 A;  2O1V A;  3O0I A;  4L94 A;  3HYY A;  3G75 A;  1I58 A;  3RLP A;  2EXL A;  2VCI A;  3GIF A;  3T2S A;  1I5A A;  4DZY A;  3HZ1 A;  2O1W A;  3QDD A;  2JKI A;  3CRK A;  2YGA A;  4EFU A;  4R3A A;  2XD6 A;  2YE9 A;  1BYQ A;  4CWQ A;  4CWP A;  2CCT A;  4XE2 A;  1GKZ A;  4URN A;  4EM7 A;  2YKC A;  4HYP A;  4NH8 A;  1ZXN A;  3EHJ A;  3A0Z A;  4BQJ A;  3R4P A;  4KQV A;  2E0A A;  3K99 A;  3ZXO A;  4O05 A;  4PU9 A;  3TZ2 A;  2BU6 A;  4L93 A;  3RLR A;  2AKP A;  3GIE A;  4XCL A;  2FYP A;  4LWI A;  2BYI A;  3R92 A;  4H85 A;  1YT1 A;  5IN9 A;  1YSR A;  2CGF A;  4JAV A;  4WUD A;  4LWH A;  2CG9 A;  4I3H A;  5F5R A;  2XX4 A;  2GFD A;  1YC3 A;  2WI5 A;  3B25 A;  3T10 A;  1PVG A;  2BRC A;  3NMQ A;  4KSH A;  4U7O A;  4DUH A;  4CWO A;  2YKB A;  5GGZ A;  1Y4S A;  2QG2 A;  4MP7 A;  5IDM A;  2IWX A;  2BSM A;  1UYK A;  4XTJ A;  2HCH A;  3TTZ A;  1MU5 A;  2QF6 A;  1UYL A;  4L91 A;  2PNR A;  4KSG A;  5BOC A;  4URM A;  2YE6 A;  4XKO A;  4X9L A;  2YJW A;  4BXI A;  1Z5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...