4GT8A

Crystal structure of the catalytic and atp-binding domain from vras in complex with adp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
b'GAMLKDKSLGEGIKDLVIDLQKKVPMKVVHEIQDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEKLEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein vraS
publication title Structure of the Staphylococcus aureus VraS Catalytic and ATP-binding Domain
rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 40
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4gt8A00
2BU2A 1UY6A 3GIEA 3A0YA 1Z5AA 3K60A 2YEDA 3OMUA 2WI1A 4P7AA 3INWA 4ZVIA 2IWXA 1Y4UA 2QF6A 2QFOA 4EGHA 3A0TA 2YGFA 2O1WA 3A0ZA 1YSZA 4P8OA 1TC6A 5M4HA 4HYPA 5D6PA 3CGZA 3T0ZA 3HYYA 4QPJA 4BQJA 1MU5A 3A0RA 5CPHA 3EHFA 5J6AA 2HG1A 2WEPA 2XHXA 2YGEA 4CWRA 4B7PA 1QYEA 4QPKA 3T10A 5M4EA 4EGKA 3C0EA 2IOPA 2CG9A 2YE4A 3GIGB 1NHIA 3SL2A 2FWZA 3NMQA 3BMYA 1TIDA 4KQVA 4O07A 5CTUA 2YJXA 1GJVA 3DGEA 5CF0A 4O09A 2Q8HA 1YESA 5C93A 4EFUA 4R3MA 4UROA 5FNDA 1Y4SA 4HY1A 3O6OA 1YT2A 3MNRP 2PNRA 2BYIA 3HYZA 2GFDA 4LWEA 4MBCA 4CWPA 4PRVA 4AWQA 1YC3A 2CCTA 4R1FA 2YE5A 5L3JA 2ZDXA 1US7A 1JM6A 1UYMA 2VCIA 2YI7A 2O1UA 2BU8A 4URLA 2BRCA 3RLRA 1TC0A 1YSRA 1UYDA 4FCPA 1NHHA 5F3KA 3T2SA 2XJGA 4KFGA 4GFNA 2EXLA 2XJXA 4HXZA 2QG2A 5F5RA 4CWSA 4EMVA 2XX4A 1YT1A 4B6CA 2YEEA 5CTWA 3TZ0A 2UWDA 1UYIA 3FV5A 1U0ZA 5D7RA 3ZKDA 4PRXA 1YETA 2IORA 4MPNA 2XD6A 4EEHA 3EHJA 2CCSA 3HHUA 2Q8FA 3TUHA 3Q5JA 2CCUA 2WEQA 4LWIA 2XABA 2BU5A 4U93A 3R4MA 2AKPA 2IWUA 2YKEA 4EFTA 4XCLA 4BQGA 2CGFA 2IOQA 2FXSA 4L94A 1EA6A 4I3HA 1GKZA 4NH9A 1THNA 3TZ2A 4FCQA 4BIUA 3EKOA 4HY6A 3FT8A 4BXIA 4O04A 1Z59A 2QG0A 4LWGA 4V26A 2ZDYA 3VHAA 2BU6A 5M4NA 4YKYA 2HCHA 4CWOA 3IEDA 3ZKBA 4ASGA 5M4MA 1AJ6A 5FNCA 1YS3A 3HEKA 1AMWA 1YT0A 2YK9A 2YEHA 4KSGA 2YKBA 3D2RA 2ZBKB 3INXA 4FPPA 4MPCA 3R4NA 3H80A 1EI1A 4E01A 4L91A 3CRLA 3A0WA 4E00A 2WI5A 3TTZA 1B62A 1ZWHA 2VWCA 2YE9A 3ZM7A 1UYFA 5D7DA 2WERA 3PEJA 3RLPA 1UY8A 3WHAA 5D7CA 4L90A 1ZXMA 5M4PA 2YGAA 4LP0A 3G7EA 3ZXQA 1A4HA 2WI7A 4GT8A 3B28A 1TBWA 1ID0A 4EM7A 4YKXA 4BAEA 4H81A 4CWTA 4XKAA 3LPSA 3QTFA 3EKRA 1I58A 2XK2A 4CWQA 4LWFA 1PVGA 4MP2A 3R91A 2JJCA 4GQTA 1S14A 2YE3A 3R4PA 2VCJA 2YEJA 4KP4A 4ASAA 2YE8A 3OWBA 2GQPA 4JAUA 1QY8A 4URNA 2FWYA 3GIGA 2YECA 4XTJA 4MP7A 2C2AA 4YKZA 2XJJA 2YKCA 3U2DA 4DUHA 1S16A 4WUBA 3PEHA 1Z5CA 1I59A 1NHJA 3ZXOA 4HZ0A 4XIPA 1UYCA 2Q8IA 2ZKJA 1B63A 1ZXNA 2YI0A 4W7TA 2JKIA 4PU9A 1UYGA 2CH4A 1Y8NA 4KTNA 3LNUA 3R4OA 2XDXA 4AWPA 2WI2A 3VHCA 1UY7A 4XKKA 3HZ1A 4K4OA 3VHDA 3TZ5A 3O0IA 4LWHA 3U2KA 4XC0A 2BZ5A 2XDKA 4GGLA 3K97A 4KSHA 2YK2A 4URMA 4ASBA 4XE2A 1YERA 3QDDA 5M4KA 3B25A 4U7OA 2YEGA 4XD8A 3KE6A 4CWNA 4JASA 4LPBA 2XCMA 4H85A 4XKOA 4CWFA 2YEIA 2E0AA 5GGZA 2XHTA 3RKZA 3GIFA 4WUDA 3CRKA 3OWDA 1TH8A 2WI6A 4HZ5A 1ZW9A 3K99A 1I5CA 3C11A 4Q20A 3FT5A 2XDLA 1Y8PA 1AH6A 4AWOA 3O2FA 1QZRA 5BOCA 5IN9A 4MOTA 4GCZA 4BIZA 4NH7A 1U2OA 4E02A 2YKJA 4H7QA 4GEEA 3U67A 2YI6A 4CE1A 3EHGA 1BXDA 1MX0A 4X9LA 4HXWA 2Q8GA 1YC4A 4AS9A 4R3AA 2BU7A 3HZ5A 2XDSA 1H7UA 1GKXA 3A0XA 4YKRA 2BYHA 1UY9A 4XIQA 2H8MA 3R92A 2YI5A 1UYKA 3T1KA 1Y8OA 2XDUA 2O1VA 3B26A 4HYMA 5CTXA 3K98A 2HKJA 3T0HA 3G7BA 1TILA 3CWVA 1BKNA 4XDMA 2YE6A 5IDJA 4FCRA 4NH8A 3G75A 4ASFA 1H7SA 2YE2A 3EHHA 2YEFA 4MB9A 5FWKA 1YC1A 3OPDA 5IDMA 1UYHA 1Z5BA 4XITA 2H55A 3B24A 5D6QA 4I5SA 4CE2A 1UYEA 5CTYA 2YE7A 2YEAA 4U7NA 4MPEA 2XHRA 2BSMA 2VW5A 1B3QA 1BGQA 4EGIA 1R62A 4XIRA 2Q2EB 5BODA 2YJWA 4WUCA 4JAVA 4XCJA 4YKTA 2BREA 3Q5LA 2FYPA 4YKQA 2WI3A 1AM1A 1BYQA 4CE3A 3D0BA 1L0OA 3VADA 2WI4A 1KZNA 4JQLA 4YKWA 1UYLA 5FNFA 4L93A 1I5DA 2XX5A 3D36A 3OW6A 4YKUA 2YKIA 1OSFA 2YEBA 3JZ3A 2BT0A 4FMTA 4PL9A 1I5BA 2XX2A 3B27A 3CGYA 2BTZA 1I5AA 5J71A 4ZKIA 1AH8A 3WQ9A 2ESAA 1KIJA 4O05A 4DZYA 2IWSA 4V25A 4L8ZA 4O0BA 3RLQA 3BM9A 3TZ4A 3H4LA 2K5BA 3Q5KA
chains in the Genus database with same CATH superfamily
2BU2A 1UY6A 3GIEA 3A0YA 1Z5AA 3K60A 2YEDA 3OMUA 2WI1A 4P7AA 3INWA 4ZVIA 2IWXA 1Y4UA 2QF6A 2QFOA 4EGHA 3A0TA 2YGFA 2O1WA 3A0ZA 1YSZA 4P8OA 1TC6A 5M4HA 4HYPA 5D6PA 3CGZA 3T0ZA 3HYYA 4QPJA 4BQJA 1MU5A 3A0RA 5CPHA 3EHFA 5J6AA 2HG1A 2WEPA 2XHXA 2YGEA 4CWRA 4B7PA 1QYEA 4QPKA 3T10A 5M4EA 4EGKA 3C0EA 2IOPA 2CG9A 2YE4A 3GIGB 1NHIA 3SL2A 2FWZA 3NMQA 3BMYA 1TIDA 4KQVA 4O07A 5CTUA 2YJXA 1GJVA 3DGEA 5CF0A 4O09A 2Q8HA 1YESA 5C93A 4EFUA 4R3MA 4UROA 5FNDA 1Y4SA 4HY1A 3O6OA 1YT2A 5JENA 3MNRP 2PNRA 2BYIA 3HYZA 2GFDA 4LWEA 4MBCA 4CWPA 4PRVA 4AWQA 1YC3A 2CCTA 4R1FA 2YE5A 5L3JA 2ZDXA 1US7A 1JM6A 1UYMA 2VCIA 2YI7A 2O1UA 2BU8A 4URLA 2BRCA 3RLRA 1TC0A 1YSRA 1UYDA 4FCPA 1NHHA 5F3KA 3T2SA 2XJGA 4KFGA 4GFNA 2EXLA 2XJXA 4HXZA 2QG2A 5F5RA 4CWSA 4EMVA 2XX4A 1YT1A 4B6CA 2YEEA 5CTWA 3TZ0A 1IXMA 2UWDA 1UYIA 3FV5A 1U0ZA 5D7RA 3ZKDA 4PRXA 1YETA 2IORA 4MPNA 2XD6A 4EEHA 3EHJA 2CCSA 3HHUA 2Q8FA 1F51A 3TUHA 3Q5JA 2CCUA 2WEQA 4LWIA 2XABA 2BU5A 4U93A 3R4MA 2AKPA 2IWUA 2YKEA 4EFTA 4XCLA 4BQGA 2CGFA 2IOQA 2FXSA 4L94A 1EA6A 4I3HA 1GKZA 4NH9A 1THNA 3TZ2A 4FCQA 4BIUA 3EKOA 4HY6A 3FT8A 4BXIA 4O04A 1Z59A 2QG0A 4LWGA 4V26A 2ZDYA 3VHAA 2BU6A 5M4NA 4YKYA 2HCHA 4CWOA 3IEDA 3ZKBA 4ASGA 5M4MA 1AJ6A 5FNCA 1YS3A 3HEKA 1AMWA 1YT0A 2YK9A 2YEHA 4KSGA 2YKBA 3D2RA 2ZBKB 3INXA 4FPPA 4MPCA 3R4NA 3H80A 1EI1A 4E01A 4L91A 3CRLA 3A0WA 4E00A 2WI5A 3TTZA 1B62A 1ZWHA 2VWCA 2YE9A 3ZM7A 1UYFA 5D7DA 2WERA 3PEJA 3RLPA 1UY8A 3WHAA 3S5TA 5D7CA 4L90A 1ZXMA 5M4PA 2YGAA 4LP0A 3G7EA 3ZXQA 1A4HA 2WI7A 4GT8A 3B28A 1TBWA 1ID0A 4EM7A 4YKXA 4BAEA 4H81A 4CWTA 4XKAA 3LPSA 3QTFA 3EKRA 1I58A 2XK2A 4CWQA 4LWFA 1PVGA 4MP2A 3R91A 2JJCA 4GQTA 1S14A 2YE3A 3R4PA 2VCJA 2YEJA 4KP4A 4ASAA 2YE8A 3OWBA 2GQPA 4JAUA 1QY8A 4URNA 2FWYA 3GIGA 2YECA 4XTJA 4MP7A 2C2AA 4YKZA 2XJJA 2YKCA 3U2DA 4DUHA 1S16A 4WUBA 3PEHA 1Z5CA 1I59A 1NHJA 3ZXOA 4HZ0A 4XIPA 1UYCA 2Q8IA 2ZKJA 1B63A 1ZXNA 2YI0A 4W7TA 2JKIA 4PU9A 1UYGA 2CH4A 1Y8NA 4KTNA 3LNUA 3R4OA 2XDXA 4AWPA 2WI2A 3VHCA 1UY7A 4XKKA 3HZ1A 4K4OA 3VHDA 3TZ5A 3O0IA 4LWHA 3U2KA 2HHIA 4XC0A 2BZ5A 2XDKA 4GGLA 3K97A 4KSHA 2YK2A 4URMA 3LMMA 4ASBA 4XE2A 1YERA 3QDDA 5M4KA 3B25A 4U7OA 2YEGA 4XD8A 3KE6A 2C1GA 4CWNA 4JASA 4LPBA 2XCMA 4H85A 4XKOA 4CWFA 2YEIA 2FTKA 2E0AA 5GGZA 2XHTA 3RKZA 3GIFA 4WUDA 3CRKA 3OWDA 1TH8A 2WI6A 4HZ5A 1ZW9A 3K99A 1I5CA 3C11A 4Q20A 3FT5A 2XDLA 1Y8PA 1AH6A 4AWOA 3O2FA 1QZRA 5BOCA 5IN9A 4MOTA 4GCZA 4BIZA 4NH7A 1U2OA 4E02A 2YKJA 4H7QA 4GEEA 3U67A 2YI6A 4CE1A 3EHGA 1BXDA 1MX0A 4X9LA 4HXWA 2Q8GA 1YC4A 4AS9A 4R3AA 2BU7A 3HZ5A 2XDSA 1H7UA 1GKXA 3A0XA 4YKRA 2BYHA 1UY9A 4XIQA 2H8MA 3R92A 2YI5A 1UYKA 3T1KA 1Y8OA 2XDUA 2O1VA 3B26A 4HYMA 5CTXA 3K98A 2HKJA 3T0HA 3G7BA 1TILA 3CWVA 1BKNA 4XDMA 2YE6A 5IDJA 4FCRA 4NH8A 3CYGA 3G75A 4ASFA 1H7SA 2YE2A 3EHHA 2YEFA 4MB9A 5FWKA 1YC1A 3OPDA 5IDMA 1UYHA 1Z5BA 4XITA 2H55A 3B24A 5D6QA 4I5SA 4CE2A 1UYEA 5CTYA 2YE7A 2YEAA 4U7NA 4MPEA 2XHRA 2BSMA 2VW5A 1B3QA 1BGQA 4EGIA 1R62A 4XIRA 2Q2EB 5BODA 2YJWA 4WUCA 4JAVA 4XCJA 4YKTA 2BREA 3Q5LA 2FYPA 4YKQA 2WI3A 1AM1A 1BYQA 4CE3A 3D0BA 1L0OA 2C1IA 3VADA 2WI4A 1KZNA 4JQLA 4YKWA 1UYLA 5FNFA 4L93A 1I5DA 2XX5A 3D36A 3OW6A 4YKUA 2YKIA 1OSFA 2YEBA 3JZ3A 2BT0A 4FMTA 4PL9A 1I5BA 2XX2A 3B27A 3CGYA 2BTZA 1I5AA 5J71A 4ZKIA 1AH8A 3WQ9A 4E72A 2ESAA 1KIJA 4O05A 4DZYA 2IWSA 4V25A 4L8ZA 4O0BA 3RLQA 3BM9A 3TZ4A 3H4LA 2K5BA 3Q5KA
chains in the Genus database with same CATH topology
2BU2A 1UY6A 3GIEA 3A0YA 1Z5AA 3K60A 2YEDA 3OMUA 2WI1A 4P7AA 3INWA 4ZVIA 2IWXA 1Y4UA 2QF6A 2QFOA 4EGHA 3A0TA 2YGFA 2O1WA 3A0ZA 1YSZA 4P8OA 1TC6A 5M4HA 4HYPA 5D6PA 3CGZA 3T0ZA 3HYYA 4QPJA 4BQJA 1MU5A 3A0RA 5CPHA 3EHFA 5J6AA 2HG1A 2WEPA 2XHXA 2YGEA 4CWRA 4B7PA 1QYEA 4QPKA 3T10A 5M4EA 4EGKA 3C0EA 2IOPA 2CG9A 2YE4A 3GIGB 1NHIA 3SL2A 2FWZA 3NMQA 3BMYA 1TIDA 4KQVA 4O07A 5CTUA 2YJXA 1GJVA 3DGEA 5CF0A 4O09A 2Q8HA 1YESA 5C93A 4EFUA 4R3MA 4UROA 5FNDA 1Y4SA 4HY1A 3O6OA 1YT2A 3MNRP 2PNRA 2BYIA 3HYZA 2GFDA 4LWEA 4MBCA 4CWPA 4PRVA 4AWQA 1YC3A 2CCTA 4R1FA 2YE5A 5L3JA 2ZDXA 1US7A 1JM6A 1UYMA 2VCIA 2YI7A 2O1UA 2BU8A 4URLA 2BRCA 3RLRA 1TC0A 1YSRA 1UYDA 4FCPA 1NHHA 5F3KA 3T2SA 2XJGA 4KFGA 4GFNA 2EXLA 2XJXA 4HXZA 2QG2A 5F5RA 4CWSA 4EMVA 2XX4A 1YT1A 4B6CA 2YEEA 5CTWA 3TZ0A 2UWDA 1UYIA 3FV5A 1U0ZA 5D7RA 3ZKDA 4PRXA 1YETA 2IORA 4MPNA 2XD6A 4EEHA 3EHJA 2CCSA 3HHUA 2Q8FA 3TUHA 3Q5JA 2CCUA 2WEQA 4LWIA 2XABA 2BU5A 4U93A 3R4MA 2AKPA 2IWUA 2YKEA 4EFTA 4XCLA 4BQGA 2CGFA 2IOQA 2FXSA 4L94A 1EA6A 4I3HA 1GKZA 4NH9A 1THNA 3TZ2A 4FCQA 4BIUA 3EKOA 4HY6A 3FT8A 4BXIA 4O04A 1Z59A 2QG0A 4LWGA 4V26A 2ZDYA 3VHAA 2BU6A 5M4NA 4YKYA 2HCHA 4CWOA 3IEDA 3ZKBA 4ASGA 5M4MA 1AJ6A 5FNCA 1YS3A 3HEKA 1AMWA 1YT0A 2YK9A 2YEHA 4KSGA 2YKBA 3D2RA 2ZBKB 3INXA 4FPPA 4MPCA 3R4NA 3H80A 1EI1A 4E01A 4L91A 3CRLA 3A0WA 4E00A 2WI5A 3TTZA 1B62A 1ZWHA 2VWCA 2YE9A 3ZM7A 1UYFA 5D7DA 2WERA 3PEJA 3RLPA 1UY8A 3WHAA 5D7CA 4L90A 1ZXMA 5M4PA 2YGAA 4LP0A 3G7EA 3ZXQA 1A4HA 2WI7A 4GT8A 3B28A 1TBWA 1ID0A 4EM7A 4YKXA 4BAEA 4H81A 4CWTA 4XKAA 3LPSA 3QTFA 3EKRA 1I58A 2XK2A 4CWQA 4LWFA 1PVGA 4MP2A 3R91A 2JJCA 4GQTA 1S14A 2YE3A 3R4PA 2VCJA 2YEJA 4KP4A 4ASAA 2YE8A 3OWBA 2GQPA 4JAUA 1QY8A 4URNA 2FWYA 3GIGA 2YECA 4XTJA 4MP7A 2C2AA 4YKZA 2XJJA 2YKCA 3U2DA 4DUHA 1S16A 4WUBA 3PEHA 1Z5CA 1I59A 1NHJA 3ZXOA 4HZ0A 4XIPA 1UYCA 2Q8IA 2ZKJA 1B63A 1ZXNA 2YI0A 4W7TA 2JKIA 4PU9A 1UYGA 2CH4A 1Y8NA 4KTNA 3LNUA 3R4OA 2XDXA 4AWPA 2WI2A 3VHCA 1UY7A 4XKKA 3HZ1A 4K4OA 3VHDA 3TZ5A 3O0IA 4LWHA 3U2KA 4XC0A 2BZ5A 2XDKA 4GGLA 3K97A 4KSHA 2YK2A 4URMA 4ASBA 4XE2A 1YERA 3QDDA 5M4KA 3B25A 4U7OA 2YEGA 4XD8A 3KE6A 4CWNA 4JASA 4LPBA 2XCMA 4H85A 4XKOA 4CWFA 2YEIA 2E0AA 5GGZA 2XHTA 3RKZA 3GIFA 4WUDA 3CRKA 3OWDA 1TH8A 2WI6A 4HZ5A 1ZW9A 3K99A 1I5CA 3C11A 4Q20A 3FT5A 2XDLA 1Y8PA 1AH6A 4AWOA 3O2FA 1QZRA 5BOCA 5IN9A 4MOTA 4GCZA 4BIZA 4NH7A 1U2OA 4E02A 2YKJA 4H7QA 4GEEA 3U67A 2YI6A 4CE1A 3EHGA 1BXDA 1MX0A 4X9LA 4HXWA 2Q8GA 1YC4A 4AS9A 4R3AA 2BU7A 3HZ5A 2XDSA 1H7UA 1GKXA 3A0XA 4YKRA 2BYHA 1UY9A 4XIQA 2H8MA 3R92A 2YI5A 1UYKA 3T1KA 1Y8OA 2XDUA 2O1VA 3B26A 4HYMA 5CTXA 3K98A 2HKJA 3T0HA 3G7BA 1TILA 3CWVA 1BKNA 4XDMA 2YE6A 5IDJA 4FCRA 4NH8A 3G75A 4ASFA 1H7SA 2YE2A 3EHHA 2YEFA 4MB9A 5FWKA 1YC1A 3OPDA 5IDMA 1UYHA 1Z5BA 4XITA 2H55A 3B24A 5D6QA 4I5SA 4CE2A 1UYEA 5CTYA 2YE7A 2YEAA 4U7NA 4MPEA 2XHRA 2BSMA 2VW5A 1B3QA 1BGQA 4EGIA 1R62A 4XIRA 2Q2EB 5BODA 2YJWA 4WUCA 4JAVA 4XCJA 4YKTA 2BREA 3Q5LA 2FYPA 4YKQA 2WI3A 1AM1A 1BYQA 4CE3A 3D0BA 1L0OA 3VADA 2WI4A 1KZNA 4JQLA 4YKWA 1UYLA 5FNFA 4L93A 1I5DA 2XX5A 3D36A 3OW6A 4YKUA 2YKIA 1OSFA 2YEBA 3JZ3A 2BT0A 4FMTA 4PL9A 1I5BA 2XX2A 3B27A 3CGYA 2BTZA 1I5AA 5J71A 4ZKIA 1AH8A 3WQ9A 2ESAA 1KIJA 4O05A 4DZYA 2IWSA 4V25A 4L8ZA 4O0BA 3RLQA 3BM9A 3TZ4A 3H4LA 2K5BA 3Q5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BU2 A;  1UY6 A;  3GIE A;  3A0Y A;  1Z5A A;  3K60 A;  2YED A;  3OMU A;  2WI1 A;  4P7A A;  3INW A;  4ZVI A;  2IWX A;  1Y4U A;  2QF6 A;  2QFO A;  4EGH A;  3A0T A;  2YGF A;  2O1W A;  3A0Z A;  1YSZ A;  4P8O A;  1TC6 A;  5M4H A;  4HYP A;  5D6P A;  3CGZ A;  3T0Z A;  3HYY A;  4QPJ A;  4BQJ A;  1MU5 A;  3A0R A;  5CPH A;  3EHF A;  5J6A A;  2HG1 A;  2WEP A;  2XHX A;  2YGE A;  4CWR A;  4B7P A;  1QYE A;  4QPK A;  3T10 A;  5M4E A;  4EGK A;  3C0E A;  2IOP A;  2CG9 A;  2YE4 A;  3GIG B;  1NHI A;  3SL2 A;  2FWZ A;  3NMQ A;  3BMY A;  1TID A;  4KQV A;  4O07 A;  5CTU A;  2YJX A;  1GJV A;  3DGE A;  5CF0 A;  4O09 A;  2Q8H A;  1YES A;  5C93 A;  4EFU A;  4R3M A;  4URO A;  5FND A;  1Y4S A;  4HY1 A;  3O6O A;  1YT2 A;  3MNR P;  2PNR A;  2BYI A;  3HYZ A;  2GFD A;  4LWE A;  4MBC A;  4CWP A;  4PRV A;  4AWQ A;  1YC3 A;  2CCT A;  4R1F A;  2YE5 A;  5L3J A;  2ZDX A;  1US7 A;  1JM6 A;  1UYM A;  2VCI A;  2YI7 A;  2O1U A;  2BU8 A;  4URL A;  2BRC A;  3RLR A;  1TC0 A;  1YSR A;  1UYD A;  4FCP A;  1NHH A;  5F3K A;  3T2S A;  2XJG A;  4KFG A;  4GFN A;  2EXL A;  2XJX A;  4HXZ A;  2QG2 A;  5F5R A;  4CWS A;  4EMV A;  2XX4 A;  1YT1 A;  4B6C A;  2YEE A;  5CTW A;  3TZ0 A;  2UWD A;  1UYI A;  3FV5 A;  1U0Z A;  5D7R A;  3ZKD A;  4PRX A;  1YET A;  2IOR A;  4MPN A;  2XD6 A;  4EEH A;  3EHJ A;  2CCS A;  3HHU A;  2Q8F A;  3TUH A;  3Q5J A;  2CCU A;  2WEQ A;  4LWI A;  2XAB A;  2BU5 A;  4U93 A;  3R4M A;  2AKP A;  2IWU A;  2YKE A;  4EFT A;  4XCL A;  4BQG A;  2CGF A;  2IOQ A;  2FXS A;  4L94 A;  1EA6 A;  4I3H A;  1GKZ A;  4NH9 A;  1THN A;  3TZ2 A;  4FCQ A;  4BIU A;  3EKO A;  4HY6 A;  3FT8 A;  4BXI A;  4O04 A;  1Z59 A;  2QG0 A;  4LWG A;  4V26 A;  2ZDY A;  3VHA A;  2BU6 A;  5M4N A;  4YKY A;  2HCH A;  4CWO A;  3IED A;  3ZKB A;  4ASG A;  5M4M A;  1AJ6 A;  5FNC A;  1YS3 A;  3HEK A;  1AMW A;  1YT0 A;  2YK9 A;  2YEH A;  4KSG A;  2YKB A;  3D2R A;  2ZBK B;  3INX A;  4FPP A;  4MPC A;  3R4N A;  3H80 A;  1EI1 A;  4E01 A;  4L91 A;  3CRL A;  3A0W A;  4E00 A;  2WI5 A;  3TTZ A;  1B62 A;  1ZWH A;  2VWC A;  2YE9 A;  3ZM7 A;  1UYF A;  5D7D A;  2WER A;  3PEJ A;  3RLP A;  1UY8 A;  3WHA A;  5D7C A;  4L90 A;  1ZXM A;  5M4P A;  2YGA A;  4LP0 A;  3G7E A;  3ZXQ A;  1A4H A;  2WI7 A;  4GT8 A;  3B28 A;  1TBW A;  1ID0 A;  4EM7 A;  4YKX A;  4BAE A;  4H81 A;  4CWT A;  4XKA A;  3LPS A;  3QTF A;  3EKR A;  1I58 A;  2XK2 A;  4CWQ A;  4LWF A;  1PVG A;  4MP2 A;  3R91 A;  2JJC A;  4GQT A;  1S14 A;  2YE3 A;  3R4P A;  2VCJ A;  2YEJ A;  4KP4 A;  4ASA A;  2YE8 A;  3OWB A;  2GQP A;  4JAU A;  1QY8 A;  4URN A;  2FWY A;  3GIG A;  2YEC A;  4XTJ A;  4MP7 A;  2C2A A;  4YKZ A;  2XJJ A;  2YKC A;  3U2D A;  4DUH A;  1S16 A;  4WUB A;  3PEH A;  1Z5C A;  1I59 A;  1NHJ A;  3ZXO A;  4HZ0 A;  4XIP A;  1UYC A;  2Q8I A;  2ZKJ A;  1B63 A;  1ZXN A;  2YI0 A;  4W7T A;  2JKI A;  4PU9 A;  1UYG A;  2CH4 A;  1Y8N A;  4KTN A;  3LNU A;  3R4O A;  2XDX A;  4AWP A;  2WI2 A;  3VHC A;  1UY7 A;  4XKK A;  3HZ1 A;  4K4O A;  3VHD A;  3TZ5 A;  3O0I A;  4LWH A;  3U2K A;  4XC0 A;  2BZ5 A;  2XDK A;  4GGL A;  3K97 A;  4KSH A;  2YK2 A;  4URM A;  4ASB A;  4XE2 A;  1YER A;  3QDD A;  5M4K A;  3B25 A;  4U7O A;  2YEG A;  4XD8 A;  3KE6 A;  4CWN A;  4JAS A;  4LPB A;  2XCM A;  4H85 A;  4XKO A;  4CWF A;  2YEI A;  2E0A A;  5GGZ A;  2XHT A;  3RKZ A;  3GIF A;  4WUD A;  3CRK A;  3OWD A;  1TH8 A;  2WI6 A;  4HZ5 A;  1ZW9 A;  3K99 A;  1I5C A;  3C11 A;  4Q20 A;  3FT5 A;  2XDL A;  1Y8P A;  1AH6 A;  4AWO A;  3O2F A;  1QZR A;  5BOC A;  5IN9 A;  4MOT A;  4GCZ A;  4BIZ A;  4NH7 A;  1U2O A;  4E02 A;  2YKJ A;  4H7Q A;  4GEE A;  3U67 A;  2YI6 A;  4CE1 A;  3EHG A;  1BXD A;  1MX0 A;  4X9L A;  4HXW A;  2Q8G A;  1YC4 A;  4AS9 A;  4R3A A;  2BU7 A;  3HZ5 A;  2XDS A;  1H7U A;  1GKX A;  3A0X A;  4YKR A;  2BYH A;  1UY9 A;  4XIQ A;  2H8M A;  3R92 A;  2YI5 A;  1UYK A;  3T1K A;  1Y8O A;  2XDU A;  2O1V A;  3B26 A;  4HYM A;  5CTX A;  3K98 A;  2HKJ A;  3T0H A;  3G7B A;  1TIL A;  3CWV A;  1BKN A;  4XDM A;  2YE6 A;  5IDJ A;  4FCR A;  4NH8 A;  3G75 A;  4ASF A;  1H7S A;  2YE2 A;  3EHH A;  2YEF A;  4MB9 A;  5FWK A;  1YC1 A;  3OPD A;  5IDM A;  1UYH A;  1Z5B A;  4XIT A;  2H55 A;  3B24 A;  5D6Q A;  4I5S A;  4CE2 A;  1UYE A;  5CTY A;  2YE7 A;  2YEA A;  4U7N A;  4MPE A;  2XHR A;  2BSM A;  2VW5 A;  1B3Q A;  1BGQ A;  4EGI A;  1R62 A;  4XIR A;  2Q2E B;  5BOD A;  2YJW A;  4WUC A;  4JAV A;  4XCJ A;  4YKT A;  2BRE A;  3Q5L A;  2FYP A;  4YKQ A;  2WI3 A;  1AM1 A;  1BYQ A;  4CE3 A;  3D0B A;  1L0O A;  3VAD A;  2WI4 A;  1KZN A;  4JQL A;  4YKW A;  1UYL A;  5FNF A;  4L93 A;  1I5D A;  2XX5 A;  3D36 A;  3OW6 A;  4YKU A;  2YKI A;  1OSF A;  2YEB A;  3JZ3 A;  2BT0 A;  4FMT A;  4PL9 A;  1I5B A;  2XX2 A;  3B27 A;  3CGY A;  2BTZ A;  1I5A A;  5J71 A;  4ZKI A;  1AH8 A;  3WQ9 A;  2ESA A;  1KIJ A;  4O05 A;  4DZY A;  2IWS A;  4V25 A;  4L8Z A;  4O0B A;  3RLQ A;  3BM9 A;  3TZ4 A;  3H4L A;  2K5B A;  3Q5K A; 
#chains in the Genus database with same CATH topology
 2BU2 A;  1UY6 A;  3GIE A;  3A0Y A;  1Z5A A;  3K60 A;  2YED A;  3OMU A;  2WI1 A;  4P7A A;  3INW A;  4ZVI A;  2IWX A;  1Y4U A;  2QF6 A;  2QFO A;  4EGH A;  3A0T A;  2YGF A;  2O1W A;  3A0Z A;  1YSZ A;  4P8O A;  1TC6 A;  5M4H A;  4HYP A;  5D6P A;  3CGZ A;  3T0Z A;  3HYY A;  4QPJ A;  4BQJ A;  1MU5 A;  3A0R A;  5CPH A;  3EHF A;  5J6A A;  2HG1 A;  2WEP A;  2XHX A;  2YGE A;  4CWR A;  4B7P A;  1QYE A;  4QPK A;  3T10 A;  5M4E A;  4EGK A;  3C0E A;  2IOP A;  2CG9 A;  2YE4 A;  3GIG B;  1NHI A;  3SL2 A;  2FWZ A;  3NMQ A;  3BMY A;  1TID A;  4KQV A;  4O07 A;  5CTU A;  2YJX A;  1GJV A;  3DGE A;  5CF0 A;  4O09 A;  2Q8H A;  1YES A;  5C93 A;  4EFU A;  4R3M A;  4URO A;  5FND A;  1Y4S A;  4HY1 A;  3O6O A;  1YT2 A;  5JEN A;  3MNR P;  2PNR A;  2BYI A;  3HYZ A;  2GFD A;  4LWE A;  4MBC A;  4CWP A;  4PRV A;  4AWQ A;  1YC3 A;  2CCT A;  4R1F A;  2YE5 A;  5L3J A;  2ZDX A;  1US7 A;  1JM6 A;  1UYM A;  2VCI A;  2YI7 A;  2O1U A;  2BU8 A;  4URL A;  2BRC A;  3RLR A;  1TC0 A;  1YSR A;  1UYD A;  4FCP A;  1NHH A;  5F3K A;  3T2S A;  2XJG A;  4KFG A;  4GFN A;  2EXL A;  2XJX A;  4HXZ A;  2QG2 A;  5F5R A;  4CWS A;  4EMV A;  2XX4 A;  1YT1 A;  4B6C A;  2YEE A;  5CTW A;  3TZ0 A;  1IXM A;  2UWD A;  1UYI A;  3FV5 A;  1U0Z A;  5D7R A;  3ZKD A;  4PRX A;  1YET A;  2IOR A;  4MPN A;  2XD6 A;  4EEH A;  3EHJ A;  2CCS A;  3HHU A;  2Q8F A;  1F51 A;  3TUH A;  3Q5J A;  2CCU A;  2WEQ A;  4LWI A;  2XAB A;  2BU5 A;  4U93 A;  3R4M A;  2AKP A;  2IWU A;  2YKE A;  4EFT A;  4XCL A;  4BQG A;  2CGF A;  2IOQ A;  2FXS A;  4L94 A;  1EA6 A;  4I3H A;  1GKZ A;  4NH9 A;  1THN A;  3TZ2 A;  4FCQ A;  4BIU A;  3EKO A;  4HY6 A;  3FT8 A;  4BXI A;  4O04 A;  1Z59 A;  2QG0 A;  4LWG A;  4V26 A;  2ZDY A;  3VHA A;  2BU6 A;  5M4N A;  4YKY A;  2HCH A;  4CWO A;  3IED A;  3ZKB A;  4ASG A;  5M4M A;  1AJ6 A;  5FNC A;  1YS3 A;  3HEK A;  1AMW A;  1YT0 A;  2YK9 A;  2YEH A;  4KSG A;  2YKB A;  3D2R A;  2ZBK B;  3INX A;  4FPP A;  4MPC A;  3R4N A;  3H80 A;  1EI1 A;  4E01 A;  4L91 A;  3CRL A;  3A0W A;  4E00 A;  2WI5 A;  3TTZ A;  1B62 A;  1ZWH A;  2VWC A;  2YE9 A;  3ZM7 A;  1UYF A;  5D7D A;  2WER A;  3PEJ A;  3RLP A;  1UY8 A;  3WHA A;  3S5T A;  5D7C A;  4L90 A;  1ZXM A;  5M4P A;  2YGA A;  4LP0 A;  3G7E A;  3ZXQ A;  1A4H A;  2WI7 A;  4GT8 A;  3B28 A;  1TBW A;  1ID0 A;  4EM7 A;  4YKX A;  4BAE A;  4H81 A;  4CWT A;  4XKA A;  3LPS A;  3QTF A;  3EKR A;  1I58 A;  2XK2 A;  4CWQ A;  4LWF A;  1PVG A;  4MP2 A;  3R91 A;  2JJC A;  4GQT A;  1S14 A;  2YE3 A;  3R4P A;  2VCJ A;  2YEJ A;  4KP4 A;  4ASA A;  2YE8 A;  3OWB A;  2GQP A;  4JAU A;  1QY8 A;  4URN A;  2FWY A;  3GIG A;  2YEC A;  4XTJ A;  4MP7 A;  2C2A A;  4YKZ A;  2XJJ A;  2YKC A;  3U2D A;  4DUH A;  1S16 A;  4WUB A;  3PEH A;  1Z5C A;  1I59 A;  1NHJ A;  3ZXO A;  4HZ0 A;  4XIP A;  1UYC A;  2Q8I A;  2ZKJ A;  1B63 A;  1ZXN A;  2YI0 A;  4W7T A;  2JKI A;  4PU9 A;  1UYG A;  2CH4 A;  1Y8N A;  4KTN A;  3LNU A;  3R4O A;  2XDX A;  4AWP A;  2WI2 A;  3VHC A;  1UY7 A;  4XKK A;  3HZ1 A;  4K4O A;  3VHD A;  3TZ5 A;  3O0I A;  4LWH A;  3U2K A;  2HHI A;  4XC0 A;  2BZ5 A;  2XDK A;  4GGL A;  3K97 A;  4KSH A;  2YK2 A;  4URM A;  3LMM A;  4ASB A;  4XE2 A;  1YER A;  3QDD A;  5M4K A;  3B25 A;  4U7O A;  2YEG A;  4XD8 A;  3KE6 A;  2C1G A;  4CWN A;  4JAS A;  4LPB A;  2XCM A;  4H85 A;  4XKO A;  4CWF A;  2YEI A;  2FTK A;  2E0A A;  5GGZ A;  2XHT A;  3RKZ A;  3GIF A;  4WUD A;  3CRK A;  3OWD A;  1TH8 A;  2WI6 A;  4HZ5 A;  1ZW9 A;  3K99 A;  1I5C A;  3C11 A;  4Q20 A;  3FT5 A;  2XDL A;  1Y8P A;  1AH6 A;  4AWO A;  3O2F A;  1QZR A;  5BOC A;  5IN9 A;  4MOT A;  4GCZ A;  4BIZ A;  4NH7 A;  1U2O A;  4E02 A;  2YKJ A;  4H7Q A;  4GEE A;  3U67 A;  2YI6 A;  4CE1 A;  3EHG A;  1BXD A;  1MX0 A;  4X9L A;  4HXW A;  2Q8G A;  1YC4 A;  4AS9 A;  4R3A A;  2BU7 A;  3HZ5 A;  2XDS A;  1H7U A;  1GKX A;  3A0X A;  4YKR A;  2BYH A;  1UY9 A;  4XIQ A;  2H8M A;  3R92 A;  2YI5 A;  1UYK A;  3T1K A;  1Y8O A;  2XDU A;  2O1V A;  3B26 A;  4HYM A;  5CTX A;  3K98 A;  2HKJ A;  3T0H A;  3G7B A;  1TIL A;  3CWV A;  1BKN A;  4XDM A;  2YE6 A;  5IDJ A;  4FCR A;  4NH8 A;  3CYG A;  3G75 A;  4ASF A;  1H7S A;  2YE2 A;  3EHH A;  2YEF A;  4MB9 A;  5FWK A;  1YC1 A;  3OPD A;  5IDM A;  1UYH A;  1Z5B A;  4XIT A;  2H55 A;  3B24 A;  5D6Q A;  4I5S A;  4CE2 A;  1UYE A;  5CTY A;  2YE7 A;  2YEA A;  4U7N A;  4MPE A;  2XHR A;  2BSM A;  2VW5 A;  1B3Q A;  1BGQ A;  4EGI A;  1R62 A;  4XIR A;  2Q2E B;  5BOD A;  2YJW A;  4WUC A;  4JAV A;  4XCJ A;  4YKT A;  2BRE A;  3Q5L A;  2FYP A;  4YKQ A;  2WI3 A;  1AM1 A;  1BYQ A;  4CE3 A;  3D0B A;  1L0O A;  2C1I A;  3VAD A;  2WI4 A;  1KZN A;  4JQL A;  4YKW A;  1UYL A;  5FNF A;  4L93 A;  1I5D A;  2XX5 A;  3D36 A;  3OW6 A;  4YKU A;  2YKI A;  1OSF A;  2YEB A;  3JZ3 A;  2BT0 A;  4FMT A;  4PL9 A;  1I5B A;  2XX2 A;  3B27 A;  3CGY A;  2BTZ A;  1I5A A;  5J71 A;  4ZKI A;  1AH8 A;  3WQ9 A;  4E72 A;  2ESA A;  1KIJ A;  4O05 A;  4DZY A;  2IWS A;  4V25 A;  4L8Z A;  4O0B A;  3RLQ A;  3BM9 A;  3TZ4 A;  3H4L A;  2K5B A;  3Q5K A; 
#chains in the Genus database with same CATH homology
 2BU2 A;  1UY6 A;  3GIE A;  3A0Y A;  1Z5A A;  3K60 A;  2YED A;  3OMU A;  2WI1 A;  4P7A A;  3INW A;  4ZVI A;  2IWX A;  1Y4U A;  2QF6 A;  2QFO A;  4EGH A;  3A0T A;  2YGF A;  2O1W A;  3A0Z A;  1YSZ A;  4P8O A;  1TC6 A;  5M4H A;  4HYP A;  5D6P A;  3CGZ A;  3T0Z A;  3HYY A;  4QPJ A;  4BQJ A;  1MU5 A;  3A0R A;  5CPH A;  3EHF A;  5J6A A;  2HG1 A;  2WEP A;  2XHX A;  2YGE A;  4CWR A;  4B7P A;  1QYE A;  4QPK A;  3T10 A;  5M4E A;  4EGK A;  3C0E A;  2IOP A;  2CG9 A;  2YE4 A;  3GIG B;  1NHI A;  3SL2 A;  2FWZ A;  3NMQ A;  3BMY A;  1TID A;  4KQV A;  4O07 A;  5CTU A;  2YJX A;  1GJV A;  3DGE A;  5CF0 A;  4O09 A;  2Q8H A;  1YES A;  5C93 A;  4EFU A;  4R3M A;  4URO A;  5FND A;  1Y4S A;  4HY1 A;  3O6O A;  1YT2 A;  3MNR P;  2PNR A;  2BYI A;  3HYZ A;  2GFD A;  4LWE A;  4MBC A;  4CWP A;  4PRV A;  4AWQ A;  1YC3 A;  2CCT A;  4R1F A;  2YE5 A;  5L3J A;  2ZDX A;  1US7 A;  1JM6 A;  1UYM A;  2VCI A;  2YI7 A;  2O1U A;  2BU8 A;  4URL A;  2BRC A;  3RLR A;  1TC0 A;  1YSR A;  1UYD A;  4FCP A;  1NHH A;  5F3K A;  3T2S A;  2XJG A;  4KFG A;  4GFN A;  2EXL A;  2XJX A;  4HXZ A;  2QG2 A;  5F5R A;  4CWS A;  4EMV A;  2XX4 A;  1YT1 A;  4B6C A;  2YEE A;  5CTW A;  3TZ0 A;  2UWD A;  1UYI A;  3FV5 A;  1U0Z A;  5D7R A;  3ZKD A;  4PRX A;  1YET A;  2IOR A;  4MPN A;  2XD6 A;  4EEH A;  3EHJ A;  2CCS A;  3HHU A;  2Q8F A;  3TUH A;  3Q5J A;  2CCU A;  2WEQ A;  4LWI A;  2XAB A;  2BU5 A;  4U93 A;  3R4M A;  2AKP A;  2IWU A;  2YKE A;  4EFT A;  4XCL A;  4BQG A;  2CGF A;  2IOQ A;  2FXS A;  4L94 A;  1EA6 A;  4I3H A;  1GKZ A;  4NH9 A;  1THN A;  3TZ2 A;  4FCQ A;  4BIU A;  3EKO A;  4HY6 A;  3FT8 A;  4BXI A;  4O04 A;  1Z59 A;  2QG0 A;  4LWG A;  4V26 A;  2ZDY A;  3VHA A;  2BU6 A;  5M4N A;  4YKY A;  2HCH A;  4CWO A;  3IED A;  3ZKB A;  4ASG A;  5M4M A;  1AJ6 A;  5FNC A;  1YS3 A;  3HEK A;  1AMW A;  1YT0 A;  2YK9 A;  2YEH A;  4KSG A;  2YKB A;  3D2R A;  2ZBK B;  3INX A;  4FPP A;  4MPC A;  3R4N A;  3H80 A;  1EI1 A;  4E01 A;  4L91 A;  3CRL A;  3A0W A;  4E00 A;  2WI5 A;  3TTZ A;  1B62 A;  1ZWH A;  2VWC A;  2YE9 A;  3ZM7 A;  1UYF A;  5D7D A;  2WER A;  3PEJ A;  3RLP A;  1UY8 A;  3WHA A;  5D7C A;  4L90 A;  1ZXM A;  5M4P A;  2YGA A;  4LP0 A;  3G7E A;  3ZXQ A;  1A4H A;  2WI7 A;  4GT8 A;  3B28 A;  1TBW A;  1ID0 A;  4EM7 A;  4YKX A;  4BAE A;  4H81 A;  4CWT A;  4XKA A;  3LPS A;  3QTF A;  3EKR A;  1I58 A;  2XK2 A;  4CWQ A;  4LWF A;  1PVG A;  4MP2 A;  3R91 A;  2JJC A;  4GQT A;  1S14 A;  2YE3 A;  3R4P A;  2VCJ A;  2YEJ A;  4KP4 A;  4ASA A;  2YE8 A;  3OWB A;  2GQP A;  4JAU A;  1QY8 A;  4URN A;  2FWY A;  3GIG A;  2YEC A;  4XTJ A;  4MP7 A;  2C2A A;  4YKZ A;  2XJJ A;  2YKC A;  3U2D A;  4DUH A;  1S16 A;  4WUB A;  3PEH A;  1Z5C A;  1I59 A;  1NHJ A;  3ZXO A;  4HZ0 A;  4XIP A;  1UYC A;  2Q8I A;  2ZKJ A;  1B63 A;  1ZXN A;  2YI0 A;  4W7T A;  2JKI A;  4PU9 A;  1UYG A;  2CH4 A;  1Y8N A;  4KTN A;  3LNU A;  3R4O A;  2XDX A;  4AWP A;  2WI2 A;  3VHC A;  1UY7 A;  4XKK A;  3HZ1 A;  4K4O A;  3VHD A;  3TZ5 A;  3O0I A;  4LWH A;  3U2K A;  4XC0 A;  2BZ5 A;  2XDK A;  4GGL A;  3K97 A;  4KSH A;  2YK2 A;  4URM A;  4ASB A;  4XE2 A;  1YER A;  3QDD A;  5M4K A;  3B25 A;  4U7O A;  2YEG A;  4XD8 A;  3KE6 A;  4CWN A;  4JAS A;  4LPB A;  2XCM A;  4H85 A;  4XKO A;  4CWF A;  2YEI A;  2E0A A;  5GGZ A;  2XHT A;  3RKZ A;  3GIF A;  4WUD A;  3CRK A;  3OWD A;  1TH8 A;  2WI6 A;  4HZ5 A;  1ZW9 A;  3K99 A;  1I5C A;  3C11 A;  4Q20 A;  3FT5 A;  2XDL A;  1Y8P A;  1AH6 A;  4AWO A;  3O2F A;  1QZR A;  5BOC A;  5IN9 A;  4MOT A;  4GCZ A;  4BIZ A;  4NH7 A;  1U2O A;  4E02 A;  2YKJ A;  4H7Q A;  4GEE A;  3U67 A;  2YI6 A;  4CE1 A;  3EHG A;  1BXD A;  1MX0 A;  4X9L A;  4HXW A;  2Q8G A;  1YC4 A;  4AS9 A;  4R3A A;  2BU7 A;  3HZ5 A;  2XDS A;  1H7U A;  1GKX A;  3A0X A;  4YKR A;  2BYH A;  1UY9 A;  4XIQ A;  2H8M A;  3R92 A;  2YI5 A;  1UYK A;  3T1K A;  1Y8O A;  2XDU A;  2O1V A;  3B26 A;  4HYM A;  5CTX A;  3K98 A;  2HKJ A;  3T0H A;  3G7B A;  1TIL A;  3CWV A;  1BKN A;  4XDM A;  2YE6 A;  5IDJ A;  4FCR A;  4NH8 A;  3G75 A;  4ASF A;  1H7S A;  2YE2 A;  3EHH A;  2YEF A;  4MB9 A;  5FWK A;  1YC1 A;  3OPD A;  5IDM A;  1UYH A;  1Z5B A;  4XIT A;  2H55 A;  3B24 A;  5D6Q A;  4I5S A;  4CE2 A;  1UYE A;  5CTY A;  2YE7 A;  2YEA A;  4U7N A;  4MPE A;  2XHR A;  2BSM A;  2VW5 A;  1B3Q A;  1BGQ A;  4EGI A;  1R62 A;  4XIR A;  2Q2E B;  5BOD A;  2YJW A;  4WUC A;  4JAV A;  4XCJ A;  4YKT A;  2BRE A;  3Q5L A;  2FYP A;  4YKQ A;  2WI3 A;  1AM1 A;  1BYQ A;  4CE3 A;  3D0B A;  1L0O A;  3VAD A;  2WI4 A;  1KZN A;  4JQL A;  4YKW A;  1UYL A;  5FNF A;  4L93 A;  1I5D A;  2XX5 A;  3D36 A;  3OW6 A;  4YKU A;  2YKI A;  1OSF A;  2YEB A;  3JZ3 A;  2BT0 A;  4FMT A;  4PL9 A;  1I5B A;  2XX2 A;  3B27 A;  3CGY A;  2BTZ A;  1I5A A;  5J71 A;  4ZKI A;  1AH8 A;  3WQ9 A;  2ESA A;  1KIJ A;  4O05 A;  4DZY A;  2IWS A;  4V25 A;  4L8Z A;  4O0B A;  3RLQ A;  3BM9 A;  3TZ4 A;  3H4L A;  2K5B A;  3Q5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...