4GT8A

Crystal structure of the catalytic and atp-binding domain from vras in complex with adp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
133
structure length
133
Chain Sequence
GAMLKDKSLGEGIKDLVIDLQKKVPMKVVHEIQDFKVPKGIEDHLFRITQEAISNTLRHSNGTKVTVELFNKDDYLLLRIQDNGKGFNVDEKLEQSYGLKNMRERALEIGATFHIVSLPDSGTRIEVKAPLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Staphylococcus aureus VraS Catalytic and ATP-binding Domain
rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords Sensor protein vraS
total genus 40
structure length 133
sequence length 133
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4gt8A00
2CCSA 3VHDA 3O2FA 3BM9A 3B27A 2GFDA 2YGAA 2XDKA 4FMTA 3EKRA 1Y4UA 3H80A 4K4OA 2WI3A 4CWTA 4YKWA 5CTUA 4WUBA 5M4MA 2XHRA 2BREA 3HYZA 2WI2A 4MB9A 2YEFA 4JAUA 5F3KA 5F5RA 3MNRP 2XK2A 1UYCA 4CE1A 2ESAA 2YEHA 2XDXA 4L8ZA 1YETA 3CGZA 1JM6A 3R4NA 3RLQA 4CE2A 3T1KA 4KP4A 4P8OA 1THNA 1UY8A 1I5AA 3HYYA 1S14A 5IN9A 1Z5CA 3H4LA 2XHTA 3O6OA 2E0AA 5D7DA 2YI7A 2Q2EB 2YK9A 2WEQA 4PRVA 5D6PA 2IWUA 1KZNA 3WHAA 3A0TA 4L90A 3HZ5A 4BIZA 1S16A 4BIUA 4O04A 2BU7A 4X9LA 4KFGA 4E02A 2IOPA 2YE3A 4JAVA 3R91A 1UY6A 2XDSA 2YGEA 2YI6A 1Y8PA 3D36A 3RLPA 1AM1A 1US7A 1AH6A 3JZ3A 3CGYA 4YKYA 1YC1A 2YE5A 3EHGA 4MP2A 4GQTA 2JJCA 1H7UA 2BYHA 2HKJA 4AWQA 4EGHA 1KIJA 5FWKA 5M4HA 4XKAA 3VADA 2AKPA 2XJGA 3FT5A 2ZDYA 2YJWA 3B24A 1YC3A 4O0BA 2WEPA 4MOTA 3EKOA 1Z5AA 4NH8A 2CH4A 4MBCA 1U0ZA 4XTJA 4GEEA 3K60A 4HY6A 3EHHA 4BXIA 4LWEA 3R4PA 3OW6A 4CWRA 2JKIA 2XX5A 2BYIA 4NH9A 4LWHA 4B7PA 3TUHA 4CWPA 5CTWA 4CE3A 4HXZA 5CTYA 3CRLA 2YEGA 3D2RA 2QFOA 1UYMA 3C11A 1GJVA 2YE4A 4E01A 3Q5LA 5M4EA 2XCMA 1EI1A 3ZXQA 3ZKBA 1UYIA 3EHFA 3T0ZA 5D7CA 4JQLA 1UYLA 1YT0A 2PNRA 4R3MA 4YKTA 4L91A 3T0HA 4HXWA 2Q8IA 2YE8A 2YI5A 3O0IA 4YKUA 2XHXA 4MPCA 3VHCA 2ZKJA 5M4PA 2YKIA 5GGZA 4FCPA 2YK2A 4PRXA 3SL2A 1QZRA 3CWVA 4O09A 3CRKA 4QPJA 2VCJA 1UYGA 1MX0A 4URNA 3K97A 5D6QA 4LWGA 3R4MA 3WQ9A 4W7TA 3RLRA 1Y4SA 4H7QA 3ZKDA 4HYPA 4XKOA 4XD8A 1L0OA 4KQVA 1BXDA 2QG0A 1TC0A 4H85A 4GGLA 2IWXA 4LP0A 4FCRA 3QDDA 1B62A 1UYKA 3IEDA 4AWOA 1UYEA 1TIDA 4HZ5A 4XE2A 4NH7A 1OSFA 2QF6A 4GT8A 4UROA 4ASAA 2BU2A 4DZYA 5IDMA 2IOQA 3BMYA 4L94A 4CWNA 5CTXA 2YI0A 2ZDXA 1YT2A 2BT0A 1YC4A 5D7RA 4GCZA 3FV5A 5L3JA 2WI4A 2C2AA 5FNCA 1NHIA 4XCJA 4KSHA 2K5BA 4PL9A 5J71A 3GIEA 2O1VA 1Y8OA 3A0YA 4XCLA 3PEHA 4HZ0A 4EGKA 2FWYA 3D0BA 2CCTA 3A0WA 3TZ5A 2EXLA 5CF0A 4CWOA 2CG9A 4YKZA 1QYEA 1I5DA 4YKRA 3Q5JA 2BZ5A 3LNUA 1UY7A 4ZVIA 3EHJA 2YEBA 5BOCA 3HHUA 2YE6A 2ZBKB 3OWDA 4U7OA 1BYQA 1UY9A 1YSZA 4LPBA 4ASGA 1H7SA 2YE9A 3K98A 4XIPA 4R1FA 2YE2A 3A0ZA 4P7AA 1I5CA 3R92A 4AS9A 1YS3A 5M4NA 2O1WA 2HG1A 3PEJA 3NMQA 3R4OA 4ASFA 4FCQA 4E00A 1TBWA 1UYFA 2XX4A 1QY8A 3TTZA 3T10A 4KSGA 2BU6A 3B25A 1Y8NA 3A0RA 4MPNA 4EM7A 1YSRA 4EMVA 4AWPA 3B28A 4LWFA 4CWFA 1UYDA 2Q8FA 4ASBA 1R62A 4O07A 3G7EA 2VW5A 4BQJA 3TZ2A 4WUCA 2WI6A 2Q8GA 1YESA 1AH8A 2BTZA 2XABA 4U7NA 1BGQA 4URLA 4EFTA 2UWDA 4HY1A 2GQPA 2XDLA 2H8MA 1YT1A 1TILA 3FT8A 4EFUA 2XJXA 1U2OA 3VHAA 3KE6A 2XD6A 4R3AA 2VCIA 3B26A 3LPSA 3T2SA 3G7BA 1UYHA 4XIRA 2WERA 4WUDA 2BU8A 3U2DA 2WI5A 4I3HA 4CWSA 4EGIA 1NHHA 2YKCA 4XDMA 2FXSA 2YGFA 2YKBA 5CPHA 2BU5A 2FYPA 4V26A 4XITA 1I59A 5J6AA 5IDJA 2CGFA 1ZW9A 2XJJA 2YEAA 3K99A 1ZXNA 4EEHA 5M4KA 2CCUA 4V25A 2FWZA 2WI1A 3DGEA 4JASA 4KTNA 3GIFA 4YKQA 4Q20A 4L93A 2YECA 2XDUA 1PVGA 1ID0A 4BAEA 2HCHA 3G75A 4B6CA 2YEDA 4URMA 1I58A 4XIQA 3U67A 2YEJA 3TZ0A 1AJ6A 1Z59A 4YKXA 2XX2A 2YEIA 4ZKIA 3OMUA 1AMWA 1GKXA 4QPKA 3GIGA 3ZM7A 2BSMA 3INWA 5FNDA 3C0EA 1MU5A 1TH8A 1NHJA 3OWBA 4FPPA 1TC6A 4CWQA 4GFNA 2H55A 2YKEA 4LWIA 4I5SA 2VWCA 5BODA 1ZXMA 2Q8HA 1I5BA 4H81A 3HZ1A 3RKZA 3U2KA 4PU9A 1B63A 4XKKA 2YEEA 1GKZA 1A4HA 3GIGB 4U93A 4O05A 3OPDA 2QG2A 1ZWHA 1EA6A 1BKNA 4MPEA 2O1UA 1YERA 4MP7A 1Z5BA 3INXA 2BRCA 2YE7A 1B3QA 2YJXA 3TZ4A 2WI7A 4DUHA 4XC0A 2IWSA 5C93A 2YKJA 3HEKA 4HYMA 3A0XA 5FNFA 4BQGA 2IORA 3QTFA 3Q5KA 3ZXOA
chains in the Genus database with same CATH superfamily
2CCSA 3VHDA 3O2FA 3BM9A 3B27A 2GFDA 2YGAA 2XDKA 4FMTA 3EKRA 1Y4UA 3H80A 4K4OA 2WI3A 4CWTA 4YKWA 5CTUA 4WUBA 5M4MA 2XHRA 2BREA 3HYZA 2WI2A 4MB9A 2YEFA 4JAUA 5F3KA 5F5RA 3MNRP 2XK2A 1UYCA 4CE1A 2ESAA 2YEHA 2XDXA 4L8ZA 1YETA 3CGZA 1JM6A 3R4NA 3RLQA 4CE2A 3T1KA 4KP4A 4P8OA 1THNA 1UY8A 1I5AA 3HYYA 1S14A 5IN9A 1Z5CA 3H4LA 2XHTA 3O6OA 2E0AA 3CYGA 5D7DA 2YI7A 2Q2EB 2YK9A 2WEQA 2HHIA 4PRVA 5D6PA 2IWUA 1KZNA 3WHAA 3A0TA 4L90A 3HZ5A 4BIZA 1S16A 4BIUA 4O04A 2BU7A 4X9LA 4KFGA 4E02A 2IOPA 2YE3A 4JAVA 3R91A 1UY6A 2XDSA 2YGEA 2YI6A 1Y8PA 3D36A 3RLPA 1AM1A 1US7A 1AH6A 3JZ3A 3CGYA 4YKYA 1YC1A 2YE5A 3EHGA 4MP2A 4GQTA 2JJCA 2FTKA 1H7UA 2BYHA 2HKJA 4AWQA 4EGHA 1KIJA 5FWKA 5M4HA 4XKAA 3VADA 2AKPA 2XJGA 3FT5A 2ZDYA 2YJWA 3B24A 1YC3A 4O0BA 2WEPA 4MOTA 3EKOA 1Z5AA 4NH8A 2CH4A 4MBCA 1U0ZA 4XTJA 4GEEA 3K60A 4HY6A 3EHHA 4BXIA 4LWEA 3R4PA 3OW6A 4CWRA 2JKIA 2XX5A 2BYIA 4NH9A 4LWHA 4B7PA 3TUHA 4CWPA 5CTWA 4CE3A 4HXZA 5CTYA 3CRLA 2YEGA 3D2RA 2QFOA 1UYMA 3C11A 1GJVA 2YE4A 4E01A 3Q5LA 5M4EA 2XCMA 1EI1A 3ZXQA 3ZKBA 1UYIA 3EHFA 3T0ZA 5D7CA 4JQLA 1UYLA 1YT0A 2PNRA 4R3MA 4YKTA 4L91A 3T0HA 4HXWA 2Q8IA 2YE8A 2YI5A 3O0IA 4YKUA 2XHXA 4MPCA 3VHCA 2ZKJA 5M4PA 2YKIA 5GGZA 4FCPA 2YK2A 4PRXA 3SL2A 1QZRA 3CWVA 4O09A 3CRKA 4QPJA 2VCJA 1UYGA 1MX0A 4URNA 3K97A 5D6QA 4LWGA 3R4MA 3WQ9A 4W7TA 3RLRA 1Y4SA 4H7QA 3ZKDA 4HYPA 4XKOA 4XD8A 1L0OA 4KQVA 1BXDA 2QG0A 1TC0A 4H85A 4GGLA 2IWXA 4LP0A 4FCRA 3QDDA 1B62A 1UYKA 3IEDA 4AWOA 1UYEA 1TIDA 4HZ5A 4XE2A 4NH7A 1OSFA 2QF6A 4GT8A 4UROA 4ASAA 2BU2A 4DZYA 5IDMA 2IOQA 3BMYA 4L94A 4CWNA 5CTXA 2YI0A 2ZDXA 1YT2A 2BT0A 1YC4A 5D7RA 4GCZA 3FV5A 5L3JA 2WI4A 2C2AA 5FNCA 1NHIA 4XCJA 4KSHA 2K5BA 4PL9A 5J71A 3GIEA 2O1VA 2C1IA 1Y8OA 3A0YA 4XCLA 3PEHA 4HZ0A 4EGKA 2FWYA 3D0BA 2CCTA 3A0WA 3TZ5A 2EXLA 5CF0A 4CWOA 2CG9A 4YKZA 1QYEA 1I5DA 4YKRA 3Q5JA 2BZ5A 3LNUA 3S5TA 1UY7A 4ZVIA 3EHJA 2YEBA 5BOCA 3HHUA 2YE6A 2ZBKB 3OWDA 4U7OA 1YSZA 1BYQA 1UY9A 4LPBA 4ASGA 1H7SA 2YE9A 3K98A 4XIPA 4R1FA 2YE2A 3A0ZA 4P7AA 1I5CA 3R92A 4AS9A 1YS3A 5M4NA 2O1WA 2HG1A 3PEJA 3NMQA 3R4OA 4ASFA 4FCQA 4E00A 1TBWA 1UYFA 2XX4A 1QY8A 3TTZA 3LMMA 3T10A 4KSGA 2BU6A 3B25A 1Y8NA 3A0RA 4MPNA 4EM7A 1YSRA 4EMVA 4AWPA 3B28A 4LWFA 4CWFA 1UYDA 2Q8FA 4ASBA 1R62A 2C1GA 4O07A 3G7EA 2VW5A 4BQJA 3TZ2A 4WUCA 2WI6A 2Q8GA 1YESA 1AH8A 2BTZA 2XABA 4U7NA 1BGQA 4URLA 4EFTA 2UWDA 4HY1A 2GQPA 2XDLA 2H8MA 1YT1A 1TILA 3FT8A 4EFUA 2XJXA 1U2OA 3VHAA 3KE6A 2XD6A 4R3AA 2VCIA 3B26A 3LPSA 3T2SA 3G7BA 1UYHA 4XIRA 2WERA 4WUDA 2BU8A 3U2DA 2WI5A 4I3HA 4CWSA 4EGIA 1NHHA 2YKCA 4XDMA 2FXSA 2YGFA 2YKBA 5CPHA 5JENA 2BU5A 2FYPA 4V26A 4XITA 1I59A 5J6AA 5IDJA 2CGFA 1ZW9A 2XJJA 2YEAA 3K99A 1ZXNA 4E72A 4EEHA 5M4KA 2CCUA 4V25A 2FWZA 2WI1A 3DGEA 4JASA 4KTNA 3GIFA 1F51A 4YKQA 4Q20A 4L93A 2YECA 2XDUA 1PVGA 1ID0A 4BAEA 2HCHA 3G75A 4B6CA 2YEDA 4URMA 1I58A 4XIQA 3U67A 2YEJA 3TZ0A 1IXMA 1AJ6A 1Z59A 4YKXA 2XX2A 2YEIA 4ZKIA 3OMUA 1AMWA 1GKXA 4QPKA 3GIGA 3ZM7A 2BSMA 3INWA 5FNDA 3C0EA 1MU5A 1TH8A 1NHJA 3OWBA 4FPPA 1TC6A 4CWQA 4GFNA 2H55A 2YKEA 4LWIA 4I5SA 2VWCA 5BODA 1ZXMA 2Q8HA 1I5BA 4H81A 3HZ1A 3RKZA 3U2KA 4PU9A 1B63A 4XKKA 2YEEA 1GKZA 1A4HA 3GIGB 4U93A 4O05A 3OPDA 2QG2A 1ZWHA 1EA6A 1BKNA 4MPEA 2O1UA 1YERA 4MP7A 1Z5BA 3INXA 2BRCA 2YE7A 1B3QA 2YJXA 3TZ4A 2WI7A 4DUHA 4XC0A 2IWSA 5C93A 2YKJA 3HEKA 4HYMA 3A0XA 5FNFA 4BQGA 2IORA 3QTFA 3Q5KA 3ZXOA
chains in the Genus database with same CATH topology
2CCSA 3VHDA 3O2FA 3BM9A 3B27A 2GFDA 2YGAA 2XDKA 4FMTA 3EKRA 1Y4UA 3H80A 4K4OA 2WI3A 4CWTA 4YKWA 5CTUA 4WUBA 5M4MA 2XHRA 2BREA 3HYZA 2WI2A 4MB9A 2YEFA 4JAUA 5F3KA 5F5RA 3MNRP 2XK2A 1UYCA 4CE1A 2ESAA 2YEHA 2XDXA 4L8ZA 1YETA 3CGZA 1JM6A 3R4NA 3RLQA 4CE2A 3T1KA 4KP4A 4P8OA 1THNA 1UY8A 1I5AA 3HYYA 1S14A 5IN9A 1Z5CA 3H4LA 2XHTA 3O6OA 2E0AA 5D7DA 2YI7A 2Q2EB 2YK9A 2WEQA 4PRVA 5D6PA 2IWUA 1KZNA 3WHAA 3A0TA 4L90A 3HZ5A 4BIZA 1S16A 4BIUA 4O04A 2BU7A 4X9LA 4KFGA 4E02A 2IOPA 2YE3A 4JAVA 3R91A 1UY6A 2XDSA 2YGEA 2YI6A 1Y8PA 3D36A 3RLPA 1AM1A 1US7A 1AH6A 3JZ3A 3CGYA 4YKYA 1YC1A 2YE5A 3EHGA 4MP2A 4GQTA 2JJCA 1H7UA 2BYHA 2HKJA 4AWQA 4EGHA 1KIJA 5FWKA 5M4HA 4XKAA 3VADA 2AKPA 2XJGA 3FT5A 2ZDYA 2YJWA 3B24A 1YC3A 4O0BA 2WEPA 4MOTA 3EKOA 1Z5AA 4NH8A 2CH4A 4MBCA 1U0ZA 4XTJA 4GEEA 3K60A 4HY6A 3EHHA 4BXIA 4LWEA 3R4PA 3OW6A 4CWRA 2JKIA 2XX5A 2BYIA 4NH9A 4LWHA 4B7PA 3TUHA 4CWPA 5CTWA 4CE3A 4HXZA 5CTYA 3CRLA 2YEGA 3D2RA 2QFOA 1UYMA 3C11A 1GJVA 2YE4A 4E01A 3Q5LA 5M4EA 2XCMA 1EI1A 3ZXQA 3ZKBA 1UYIA 3EHFA 3T0ZA 5D7CA 4JQLA 1UYLA 1YT0A 2PNRA 4R3MA 4YKTA 4L91A 3T0HA 4HXWA 2Q8IA 2YE8A 2YI5A 3O0IA 4YKUA 2XHXA 4MPCA 3VHCA 2ZKJA 5M4PA 2YKIA 5GGZA 4FCPA 2YK2A 4PRXA 3SL2A 1QZRA 3CWVA 4O09A 3CRKA 4QPJA 2VCJA 1UYGA 1MX0A 4URNA 3K97A 5D6QA 4LWGA 3R4MA 3WQ9A 4W7TA 3RLRA 1Y4SA 4H7QA 3ZKDA 4HYPA 4XKOA 4XD8A 1L0OA 4KQVA 1BXDA 2QG0A 1TC0A 4H85A 4GGLA 2IWXA 4LP0A 4FCRA 3QDDA 1B62A 1UYKA 3IEDA 4AWOA 1UYEA 1TIDA 4HZ5A 4XE2A 4NH7A 1OSFA 2QF6A 4GT8A 4UROA 4ASAA 2BU2A 4DZYA 5IDMA 2IOQA 3BMYA 4L94A 4CWNA 5CTXA 2YI0A 2ZDXA 1YT2A 2BT0A 1YC4A 5D7RA 4GCZA 3FV5A 5L3JA 2WI4A 2C2AA 5FNCA 1NHIA 4XCJA 4KSHA 2K5BA 4PL9A 5J71A 3GIEA 2O1VA 1Y8OA 3A0YA 4XCLA 3PEHA 4HZ0A 4EGKA 2FWYA 3D0BA 2CCTA 3A0WA 3TZ5A 2EXLA 5CF0A 4CWOA 2CG9A 4YKZA 1QYEA 1I5DA 4YKRA 3Q5JA 2BZ5A 3LNUA 1UY7A 4ZVIA 3EHJA 2YEBA 5BOCA 3HHUA 2YE6A 2ZBKB 3OWDA 4U7OA 1BYQA 1UY9A 1YSZA 4LPBA 4ASGA 1H7SA 2YE9A 3K98A 4XIPA 4R1FA 2YE2A 3A0ZA 4P7AA 1I5CA 3R92A 4AS9A 1YS3A 5M4NA 2O1WA 2HG1A 3PEJA 3NMQA 3R4OA 4ASFA 4FCQA 4E00A 1TBWA 1UYFA 2XX4A 1QY8A 3TTZA 3T10A 4KSGA 2BU6A 3B25A 1Y8NA 3A0RA 4MPNA 4EM7A 1YSRA 4EMVA 4AWPA 3B28A 4LWFA 4CWFA 1UYDA 2Q8FA 4ASBA 1R62A 4O07A 3G7EA 2VW5A 4BQJA 3TZ2A 4WUCA 2WI6A 2Q8GA 1YESA 1AH8A 2BTZA 2XABA 4U7NA 1BGQA 4URLA 4EFTA 2UWDA 4HY1A 2GQPA 2XDLA 2H8MA 1YT1A 1TILA 3FT8A 4EFUA 2XJXA 1U2OA 3VHAA 3KE6A 2XD6A 4R3AA 2VCIA 3B26A 3LPSA 3T2SA 3G7BA 1UYHA 4XIRA 2WERA 4WUDA 2BU8A 3U2DA 2WI5A 4I3HA 4CWSA 4EGIA 1NHHA 2YKCA 4XDMA 2FXSA 2YGFA 2YKBA 5CPHA 2BU5A 2FYPA 4V26A 4XITA 1I59A 5J6AA 5IDJA 2CGFA 1ZW9A 2XJJA 2YEAA 3K99A 1ZXNA 4EEHA 5M4KA 2CCUA 4V25A 2FWZA 2WI1A 3DGEA 4JASA 4KTNA 3GIFA 4YKQA 4Q20A 4L93A 2YECA 2XDUA 1PVGA 1ID0A 4BAEA 2HCHA 3G75A 4B6CA 2YEDA 4URMA 1I58A 4XIQA 3U67A 2YEJA 3TZ0A 1AJ6A 1Z59A 4YKXA 2XX2A 2YEIA 4ZKIA 3OMUA 1AMWA 1GKXA 4QPKA 3GIGA 3ZM7A 2BSMA 3INWA 5FNDA 3C0EA 1MU5A 1TH8A 1NHJA 3OWBA 4FPPA 1TC6A 4CWQA 4GFNA 2H55A 2YKEA 4LWIA 4I5SA 2VWCA 5BODA 1ZXMA 2Q8HA 1I5BA 4H81A 3HZ1A 3RKZA 3U2KA 4PU9A 1B63A 4XKKA 2YEEA 1GKZA 1A4HA 3GIGB 4U93A 4O05A 3OPDA 2QG2A 1ZWHA 1EA6A 1BKNA 4MPEA 2O1UA 1YERA 4MP7A 1Z5BA 3INXA 2BRCA 2YE7A 1B3QA 2YJXA 3TZ4A 2WI7A 4DUHA 4XC0A 2IWSA 5C93A 2YKJA 3HEKA 4HYMA 3A0XA 5FNFA 4BQGA 2IORA 3QTFA 3Q5KA 3ZXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CCS A;  3VHD A;  3O2F A;  3BM9 A;  3B27 A;  2GFD A;  2YGA A;  2XDK A;  4FMT A;  3EKR A;  1Y4U A;  3H80 A;  4K4O A;  2WI3 A;  4CWT A;  4YKW A;  5CTU A;  4WUB A;  5M4M A;  2XHR A;  2BRE A;  3HYZ A;  2WI2 A;  4MB9 A;  2YEF A;  4JAU A;  5F3K A;  5F5R A;  3MNR P;  2XK2 A;  1UYC A;  4CE1 A;  2ESA A;  2YEH A;  2XDX A;  4L8Z A;  1YET A;  3CGZ A;  1JM6 A;  3R4N A;  3RLQ A;  4CE2 A;  3T1K A;  4KP4 A;  4P8O A;  1THN A;  1UY8 A;  1I5A A;  3HYY A;  1S14 A;  5IN9 A;  1Z5C A;  3H4L A;  2XHT A;  3O6O A;  2E0A A;  5D7D A;  2YI7 A;  2Q2E B;  2YK9 A;  2WEQ A;  4PRV A;  5D6P A;  2IWU A;  1KZN A;  3WHA A;  3A0T A;  4L90 A;  3HZ5 A;  4BIZ A;  1S16 A;  4BIU A;  4O04 A;  2BU7 A;  4X9L A;  4KFG A;  4E02 A;  2IOP A;  2YE3 A;  4JAV A;  3R91 A;  1UY6 A;  2XDS A;  2YGE A;  2YI6 A;  1Y8P A;  3D36 A;  3RLP A;  1AM1 A;  1US7 A;  1AH6 A;  3JZ3 A;  3CGY A;  4YKY A;  1YC1 A;  2YE5 A;  3EHG A;  4MP2 A;  4GQT A;  2JJC A;  1H7U A;  2BYH A;  2HKJ A;  4AWQ A;  4EGH A;  1KIJ A;  5FWK A;  5M4H A;  4XKA A;  3VAD A;  2AKP A;  2XJG A;  3FT5 A;  2ZDY A;  2YJW A;  3B24 A;  1YC3 A;  4O0B A;  2WEP A;  4MOT A;  3EKO A;  1Z5A A;  4NH8 A;  2CH4 A;  4MBC A;  1U0Z A;  4XTJ A;  4GEE A;  3K60 A;  4HY6 A;  3EHH A;  4BXI A;  4LWE A;  3R4P A;  3OW6 A;  4CWR A;  2JKI A;  2XX5 A;  2BYI A;  4NH9 A;  4LWH A;  4B7P A;  3TUH A;  4CWP A;  5CTW A;  4CE3 A;  4HXZ A;  5CTY A;  3CRL A;  2YEG A;  3D2R A;  2QFO A;  1UYM A;  3C11 A;  1GJV A;  2YE4 A;  4E01 A;  3Q5L A;  5M4E A;  2XCM A;  1EI1 A;  3ZXQ A;  3ZKB A;  1UYI A;  3EHF A;  3T0Z A;  5D7C A;  4JQL A;  1UYL A;  1YT0 A;  2PNR A;  4R3M A;  4YKT A;  4L91 A;  3T0H A;  4HXW A;  2Q8I A;  2YE8 A;  2YI5 A;  3O0I A;  4YKU A;  2XHX A;  4MPC A;  3VHC A;  2ZKJ A;  5M4P A;  2YKI A;  5GGZ A;  4FCP A;  2YK2 A;  4PRX A;  3SL2 A;  1QZR A;  3CWV A;  4O09 A;  3CRK A;  4QPJ A;  2VCJ A;  1UYG A;  1MX0 A;  4URN A;  3K97 A;  5D6Q A;  4LWG A;  3R4M A;  3WQ9 A;  4W7T A;  3RLR A;  1Y4S A;  4H7Q A;  3ZKD A;  4HYP A;  4XKO A;  4XD8 A;  1L0O A;  4KQV A;  1BXD A;  2QG0 A;  1TC0 A;  4H85 A;  4GGL A;  2IWX A;  4LP0 A;  4FCR A;  3QDD A;  1B62 A;  1UYK A;  3IED A;  4AWO A;  1UYE A;  1TID A;  4HZ5 A;  4XE2 A;  4NH7 A;  1OSF A;  2QF6 A;  4GT8 A;  4URO A;  4ASA A;  2BU2 A;  4DZY A;  5IDM A;  2IOQ A;  3BMY A;  4L94 A;  4CWN A;  5CTX A;  2YI0 A;  2ZDX A;  1YT2 A;  2BT0 A;  1YC4 A;  5D7R A;  4GCZ A;  3FV5 A;  5L3J A;  2WI4 A;  2C2A A;  5FNC A;  1NHI A;  4XCJ A;  4KSH A;  2K5B A;  4PL9 A;  5J71 A;  3GIE A;  2O1V A;  1Y8O A;  3A0Y A;  4XCL A;  3PEH A;  4HZ0 A;  4EGK A;  2FWY A;  3D0B A;  2CCT A;  3A0W A;  3TZ5 A;  2EXL A;  5CF0 A;  4CWO A;  2CG9 A;  4YKZ A;  1QYE A;  1I5D A;  4YKR A;  3Q5J A;  2BZ5 A;  3LNU A;  1UY7 A;  4ZVI A;  3EHJ A;  2YEB A;  5BOC A;  3HHU A;  2YE6 A;  2ZBK B;  3OWD A;  4U7O A;  1BYQ A;  1UY9 A;  1YSZ A;  4LPB A;  4ASG A;  1H7S A;  2YE9 A;  3K98 A;  4XIP A;  4R1F A;  2YE2 A;  3A0Z A;  4P7A A;  1I5C A;  3R92 A;  4AS9 A;  1YS3 A;  5M4N A;  2O1W A;  2HG1 A;  3PEJ A;  3NMQ A;  3R4O A;  4ASF A;  4FCQ A;  4E00 A;  1TBW A;  1UYF A;  2XX4 A;  1QY8 A;  3TTZ A;  3T10 A;  4KSG A;  2BU6 A;  3B25 A;  1Y8N A;  3A0R A;  4MPN A;  4EM7 A;  1YSR A;  4EMV A;  4AWP A;  3B28 A;  4LWF A;  4CWF A;  1UYD A;  2Q8F A;  4ASB A;  1R62 A;  4O07 A;  3G7E A;  2VW5 A;  4BQJ A;  3TZ2 A;  4WUC A;  2WI6 A;  2Q8G A;  1YES A;  1AH8 A;  2BTZ A;  2XAB A;  4U7N A;  1BGQ A;  4URL A;  4EFT A;  2UWD A;  4HY1 A;  2GQP A;  2XDL A;  2H8M A;  1YT1 A;  1TIL A;  3FT8 A;  4EFU A;  2XJX A;  1U2O A;  3VHA A;  3KE6 A;  2XD6 A;  4R3A A;  2VCI A;  3B26 A;  3LPS A;  3T2S A;  3G7B A;  1UYH A;  4XIR A;  2WER A;  4WUD A;  2BU8 A;  3U2D A;  2WI5 A;  4I3H A;  4CWS A;  4EGI A;  1NHH A;  2YKC A;  4XDM A;  2FXS A;  2YGF A;  2YKB A;  5CPH A;  2BU5 A;  2FYP A;  4V26 A;  4XIT A;  1I59 A;  5J6A A;  5IDJ A;  2CGF A;  1ZW9 A;  2XJJ A;  2YEA A;  3K99 A;  1ZXN A;  4EEH A;  5M4K A;  2CCU A;  4V25 A;  2FWZ A;  2WI1 A;  3DGE A;  4JAS A;  4KTN A;  3GIF A;  4YKQ A;  4Q20 A;  4L93 A;  2YEC A;  2XDU A;  1PVG A;  1ID0 A;  4BAE A;  2HCH A;  3G75 A;  4B6C A;  2YED A;  4URM A;  1I58 A;  4XIQ A;  3U67 A;  2YEJ A;  3TZ0 A;  1AJ6 A;  1Z59 A;  4YKX A;  2XX2 A;  2YEI A;  4ZKI A;  3OMU A;  1AMW A;  1GKX A;  4QPK A;  3GIG A;  3ZM7 A;  2BSM A;  3INW A;  5FND A;  3C0E A;  1MU5 A;  1TH8 A;  1NHJ A;  3OWB A;  4FPP A;  1TC6 A;  4CWQ A;  4GFN A;  2H55 A;  2YKE A;  4LWI A;  4I5S A;  2VWC A;  5BOD A;  1ZXM A;  2Q8H A;  1I5B A;  4H81 A;  3HZ1 A;  3RKZ A;  3U2K A;  4PU9 A;  1B63 A;  4XKK A;  2YEE A;  1GKZ A;  1A4H A;  3GIG B;  4U93 A;  4O05 A;  3OPD A;  2QG2 A;  1ZWH A;  1EA6 A;  1BKN A;  4MPE A;  2O1U A;  1YER A;  4MP7 A;  1Z5B A;  3INX A;  2BRC A;  2YE7 A;  1B3Q A;  2YJX A;  3TZ4 A;  2WI7 A;  4DUH A;  4XC0 A;  2IWS A;  5C93 A;  2YKJ A;  3HEK A;  4HYM A;  3A0X A;  5FNF A;  4BQG A;  2IOR A;  3QTF A;  3Q5K A;  3ZXO A; 
#chains in the Genus database with same CATH topology
 2CCS A;  3VHD A;  3O2F A;  3BM9 A;  3B27 A;  2GFD A;  2YGA A;  2XDK A;  4FMT A;  3EKR A;  1Y4U A;  3H80 A;  4K4O A;  2WI3 A;  4CWT A;  4YKW A;  5CTU A;  4WUB A;  5M4M A;  2XHR A;  2BRE A;  3HYZ A;  2WI2 A;  4MB9 A;  2YEF A;  4JAU A;  5F3K A;  5F5R A;  3MNR P;  2XK2 A;  1UYC A;  4CE1 A;  2ESA A;  2YEH A;  2XDX A;  4L8Z A;  1YET A;  3CGZ A;  1JM6 A;  3R4N A;  3RLQ A;  4CE2 A;  3T1K A;  4KP4 A;  4P8O A;  1THN A;  1UY8 A;  1I5A A;  3HYY A;  1S14 A;  5IN9 A;  1Z5C A;  3H4L A;  2XHT A;  3O6O A;  2E0A A;  3CYG A;  5D7D A;  2YI7 A;  2Q2E B;  2YK9 A;  2WEQ A;  2HHI A;  4PRV A;  5D6P A;  2IWU A;  1KZN A;  3WHA A;  3A0T A;  4L90 A;  3HZ5 A;  4BIZ A;  1S16 A;  4BIU A;  4O04 A;  2BU7 A;  4X9L A;  4KFG A;  4E02 A;  2IOP A;  2YE3 A;  4JAV A;  3R91 A;  1UY6 A;  2XDS A;  2YGE A;  2YI6 A;  1Y8P A;  3D36 A;  3RLP A;  1AM1 A;  1US7 A;  1AH6 A;  3JZ3 A;  3CGY A;  4YKY A;  1YC1 A;  2YE5 A;  3EHG A;  4MP2 A;  4GQT A;  2JJC A;  2FTK A;  1H7U A;  2BYH A;  2HKJ A;  4AWQ A;  4EGH A;  1KIJ A;  5FWK A;  5M4H A;  4XKA A;  3VAD A;  2AKP A;  2XJG A;  3FT5 A;  2ZDY A;  2YJW A;  3B24 A;  1YC3 A;  4O0B A;  2WEP A;  4MOT A;  3EKO A;  1Z5A A;  4NH8 A;  2CH4 A;  4MBC A;  1U0Z A;  4XTJ A;  4GEE A;  3K60 A;  4HY6 A;  3EHH A;  4BXI A;  4LWE A;  3R4P A;  3OW6 A;  4CWR A;  2JKI A;  2XX5 A;  2BYI A;  4NH9 A;  4LWH A;  4B7P A;  3TUH A;  4CWP A;  5CTW A;  4CE3 A;  4HXZ A;  5CTY A;  3CRL A;  2YEG A;  3D2R A;  2QFO A;  1UYM A;  3C11 A;  1GJV A;  2YE4 A;  4E01 A;  3Q5L A;  5M4E A;  2XCM A;  1EI1 A;  3ZXQ A;  3ZKB A;  1UYI A;  3EHF A;  3T0Z A;  5D7C A;  4JQL A;  1UYL A;  1YT0 A;  2PNR A;  4R3M A;  4YKT A;  4L91 A;  3T0H A;  4HXW A;  2Q8I A;  2YE8 A;  2YI5 A;  3O0I A;  4YKU A;  2XHX A;  4MPC A;  3VHC A;  2ZKJ A;  5M4P A;  2YKI A;  5GGZ A;  4FCP A;  2YK2 A;  4PRX A;  3SL2 A;  1QZR A;  3CWV A;  4O09 A;  3CRK A;  4QPJ A;  2VCJ A;  1UYG A;  1MX0 A;  4URN A;  3K97 A;  5D6Q A;  4LWG A;  3R4M A;  3WQ9 A;  4W7T A;  3RLR A;  1Y4S A;  4H7Q A;  3ZKD A;  4HYP A;  4XKO A;  4XD8 A;  1L0O A;  4KQV A;  1BXD A;  2QG0 A;  1TC0 A;  4H85 A;  4GGL A;  2IWX A;  4LP0 A;  4FCR A;  3QDD A;  1B62 A;  1UYK A;  3IED A;  4AWO A;  1UYE A;  1TID A;  4HZ5 A;  4XE2 A;  4NH7 A;  1OSF A;  2QF6 A;  4GT8 A;  4URO A;  4ASA A;  2BU2 A;  4DZY A;  5IDM A;  2IOQ A;  3BMY A;  4L94 A;  4CWN A;  5CTX A;  2YI0 A;  2ZDX A;  1YT2 A;  2BT0 A;  1YC4 A;  5D7R A;  4GCZ A;  3FV5 A;  5L3J A;  2WI4 A;  2C2A A;  5FNC A;  1NHI A;  4XCJ A;  4KSH A;  2K5B A;  4PL9 A;  5J71 A;  3GIE A;  2O1V A;  2C1I A;  1Y8O A;  3A0Y A;  4XCL A;  3PEH A;  4HZ0 A;  4EGK A;  2FWY A;  3D0B A;  2CCT A;  3A0W A;  3TZ5 A;  2EXL A;  5CF0 A;  4CWO A;  2CG9 A;  4YKZ A;  1QYE A;  1I5D A;  4YKR A;  3Q5J A;  2BZ5 A;  3LNU A;  3S5T A;  1UY7 A;  4ZVI A;  3EHJ A;  2YEB A;  5BOC A;  3HHU A;  2YE6 A;  2ZBK B;  3OWD A;  4U7O A;  1YSZ A;  1BYQ A;  1UY9 A;  4LPB A;  4ASG A;  1H7S A;  2YE9 A;  3K98 A;  4XIP A;  4R1F A;  2YE2 A;  3A0Z A;  4P7A A;  1I5C A;  3R92 A;  4AS9 A;  1YS3 A;  5M4N A;  2O1W A;  2HG1 A;  3PEJ A;  3NMQ A;  3R4O A;  4ASF A;  4FCQ A;  4E00 A;  1TBW A;  1UYF A;  2XX4 A;  1QY8 A;  3TTZ A;  3LMM A;  3T10 A;  4KSG A;  2BU6 A;  3B25 A;  1Y8N A;  3A0R A;  4MPN A;  4EM7 A;  1YSR A;  4EMV A;  4AWP A;  3B28 A;  4LWF A;  4CWF A;  1UYD A;  2Q8F A;  4ASB A;  1R62 A;  2C1G A;  4O07 A;  3G7E A;  2VW5 A;  4BQJ A;  3TZ2 A;  4WUC A;  2WI6 A;  2Q8G A;  1YES A;  1AH8 A;  2BTZ A;  2XAB A;  4U7N A;  1BGQ A;  4URL A;  4EFT A;  2UWD A;  4HY1 A;  2GQP A;  2XDL A;  2H8M A;  1YT1 A;  1TIL A;  3FT8 A;  4EFU A;  2XJX A;  1U2O A;  3VHA A;  3KE6 A;  2XD6 A;  4R3A A;  2VCI A;  3B26 A;  3LPS A;  3T2S A;  3G7B A;  1UYH A;  4XIR A;  2WER A;  4WUD A;  2BU8 A;  3U2D A;  2WI5 A;  4I3H A;  4CWS A;  4EGI A;  1NHH A;  2YKC A;  4XDM A;  2FXS A;  2YGF A;  2YKB A;  5CPH A;  5JEN A;  2BU5 A;  2FYP A;  4V26 A;  4XIT A;  1I59 A;  5J6A A;  5IDJ A;  2CGF A;  1ZW9 A;  2XJJ A;  2YEA A;  3K99 A;  1ZXN A;  4E72 A;  4EEH A;  5M4K A;  2CCU A;  4V25 A;  2FWZ A;  2WI1 A;  3DGE A;  4JAS A;  4KTN A;  3GIF A;  1F51 A;  4YKQ A;  4Q20 A;  4L93 A;  2YEC A;  2XDU A;  1PVG A;  1ID0 A;  4BAE A;  2HCH A;  3G75 A;  4B6C A;  2YED A;  4URM A;  1I58 A;  4XIQ A;  3U67 A;  2YEJ A;  3TZ0 A;  1IXM A;  1AJ6 A;  1Z59 A;  4YKX A;  2XX2 A;  2YEI A;  4ZKI A;  3OMU A;  1AMW A;  1GKX A;  4QPK A;  3GIG A;  3ZM7 A;  2BSM A;  3INW A;  5FND A;  3C0E A;  1MU5 A;  1TH8 A;  1NHJ A;  3OWB A;  4FPP A;  1TC6 A;  4CWQ A;  4GFN A;  2H55 A;  2YKE A;  4LWI A;  4I5S A;  2VWC A;  5BOD A;  1ZXM A;  2Q8H A;  1I5B A;  4H81 A;  3HZ1 A;  3RKZ A;  3U2K A;  4PU9 A;  1B63 A;  4XKK A;  2YEE A;  1GKZ A;  1A4H A;  3GIG B;  4U93 A;  4O05 A;  3OPD A;  2QG2 A;  1ZWH A;  1EA6 A;  1BKN A;  4MPE A;  2O1U A;  1YER A;  4MP7 A;  1Z5B A;  3INX A;  2BRC A;  2YE7 A;  1B3Q A;  2YJX A;  3TZ4 A;  2WI7 A;  4DUH A;  4XC0 A;  2IWS A;  5C93 A;  2YKJ A;  3HEK A;  4HYM A;  3A0X A;  5FNF A;  4BQG A;  2IOR A;  3QTF A;  3Q5K A;  3ZXO A; 
#chains in the Genus database with same CATH homology
 2CCS A;  3VHD A;  3O2F A;  3BM9 A;  3B27 A;  2GFD A;  2YGA A;  2XDK A;  4FMT A;  3EKR A;  1Y4U A;  3H80 A;  4K4O A;  2WI3 A;  4CWT A;  4YKW A;  5CTU A;  4WUB A;  5M4M A;  2XHR A;  2BRE A;  3HYZ A;  2WI2 A;  4MB9 A;  2YEF A;  4JAU A;  5F3K A;  5F5R A;  3MNR P;  2XK2 A;  1UYC A;  4CE1 A;  2ESA A;  2YEH A;  2XDX A;  4L8Z A;  1YET A;  3CGZ A;  1JM6 A;  3R4N A;  3RLQ A;  4CE2 A;  3T1K A;  4KP4 A;  4P8O A;  1THN A;  1UY8 A;  1I5A A;  3HYY A;  1S14 A;  5IN9 A;  1Z5C A;  3H4L A;  2XHT A;  3O6O A;  2E0A A;  5D7D A;  2YI7 A;  2Q2E B;  2YK9 A;  2WEQ A;  4PRV A;  5D6P A;  2IWU A;  1KZN A;  3WHA A;  3A0T A;  4L90 A;  3HZ5 A;  4BIZ A;  1S16 A;  4BIU A;  4O04 A;  2BU7 A;  4X9L A;  4KFG A;  4E02 A;  2IOP A;  2YE3 A;  4JAV A;  3R91 A;  1UY6 A;  2XDS A;  2YGE A;  2YI6 A;  1Y8P A;  3D36 A;  3RLP A;  1AM1 A;  1US7 A;  1AH6 A;  3JZ3 A;  3CGY A;  4YKY A;  1YC1 A;  2YE5 A;  3EHG A;  4MP2 A;  4GQT A;  2JJC A;  1H7U A;  2BYH A;  2HKJ A;  4AWQ A;  4EGH A;  1KIJ A;  5FWK A;  5M4H A;  4XKA A;  3VAD A;  2AKP A;  2XJG A;  3FT5 A;  2ZDY A;  2YJW A;  3B24 A;  1YC3 A;  4O0B A;  2WEP A;  4MOT A;  3EKO A;  1Z5A A;  4NH8 A;  2CH4 A;  4MBC A;  1U0Z A;  4XTJ A;  4GEE A;  3K60 A;  4HY6 A;  3EHH A;  4BXI A;  4LWE A;  3R4P A;  3OW6 A;  4CWR A;  2JKI A;  2XX5 A;  2BYI A;  4NH9 A;  4LWH A;  4B7P A;  3TUH A;  4CWP A;  5CTW A;  4CE3 A;  4HXZ A;  5CTY A;  3CRL A;  2YEG A;  3D2R A;  2QFO A;  1UYM A;  3C11 A;  1GJV A;  2YE4 A;  4E01 A;  3Q5L A;  5M4E A;  2XCM A;  1EI1 A;  3ZXQ A;  3ZKB A;  1UYI A;  3EHF A;  3T0Z A;  5D7C A;  4JQL A;  1UYL A;  1YT0 A;  2PNR A;  4R3M A;  4YKT A;  4L91 A;  3T0H A;  4HXW A;  2Q8I A;  2YE8 A;  2YI5 A;  3O0I A;  4YKU A;  2XHX A;  4MPC A;  3VHC A;  2ZKJ A;  5M4P A;  2YKI A;  5GGZ A;  4FCP A;  2YK2 A;  4PRX A;  3SL2 A;  1QZR A;  3CWV A;  4O09 A;  3CRK A;  4QPJ A;  2VCJ A;  1UYG A;  1MX0 A;  4URN A;  3K97 A;  5D6Q A;  4LWG A;  3R4M A;  3WQ9 A;  4W7T A;  3RLR A;  1Y4S A;  4H7Q A;  3ZKD A;  4HYP A;  4XKO A;  4XD8 A;  1L0O A;  4KQV A;  1BXD A;  2QG0 A;  1TC0 A;  4H85 A;  4GGL A;  2IWX A;  4LP0 A;  4FCR A;  3QDD A;  1B62 A;  1UYK A;  3IED A;  4AWO A;  1UYE A;  1TID A;  4HZ5 A;  4XE2 A;  4NH7 A;  1OSF A;  2QF6 A;  4GT8 A;  4URO A;  4ASA A;  2BU2 A;  4DZY A;  5IDM A;  2IOQ A;  3BMY A;  4L94 A;  4CWN A;  5CTX A;  2YI0 A;  2ZDX A;  1YT2 A;  2BT0 A;  1YC4 A;  5D7R A;  4GCZ A;  3FV5 A;  5L3J A;  2WI4 A;  2C2A A;  5FNC A;  1NHI A;  4XCJ A;  4KSH A;  2K5B A;  4PL9 A;  5J71 A;  3GIE A;  2O1V A;  1Y8O A;  3A0Y A;  4XCL A;  3PEH A;  4HZ0 A;  4EGK A;  2FWY A;  3D0B A;  2CCT A;  3A0W A;  3TZ5 A;  2EXL A;  5CF0 A;  4CWO A;  2CG9 A;  4YKZ A;  1QYE A;  1I5D A;  4YKR A;  3Q5J A;  2BZ5 A;  3LNU A;  1UY7 A;  4ZVI A;  3EHJ A;  2YEB A;  5BOC A;  3HHU A;  2YE6 A;  2ZBK B;  3OWD A;  4U7O A;  1BYQ A;  1UY9 A;  1YSZ A;  4LPB A;  4ASG A;  1H7S A;  2YE9 A;  3K98 A;  4XIP A;  4R1F A;  2YE2 A;  3A0Z A;  4P7A A;  1I5C A;  3R92 A;  4AS9 A;  1YS3 A;  5M4N A;  2O1W A;  2HG1 A;  3PEJ A;  3NMQ A;  3R4O A;  4ASF A;  4FCQ A;  4E00 A;  1TBW A;  1UYF A;  2XX4 A;  1QY8 A;  3TTZ A;  3T10 A;  4KSG A;  2BU6 A;  3B25 A;  1Y8N A;  3A0R A;  4MPN A;  4EM7 A;  1YSR A;  4EMV A;  4AWP A;  3B28 A;  4LWF A;  4CWF A;  1UYD A;  2Q8F A;  4ASB A;  1R62 A;  4O07 A;  3G7E A;  2VW5 A;  4BQJ A;  3TZ2 A;  4WUC A;  2WI6 A;  2Q8G A;  1YES A;  1AH8 A;  2BTZ A;  2XAB A;  4U7N A;  1BGQ A;  4URL A;  4EFT A;  2UWD A;  4HY1 A;  2GQP A;  2XDL A;  2H8M A;  1YT1 A;  1TIL A;  3FT8 A;  4EFU A;  2XJX A;  1U2O A;  3VHA A;  3KE6 A;  2XD6 A;  4R3A A;  2VCI A;  3B26 A;  3LPS A;  3T2S A;  3G7B A;  1UYH A;  4XIR A;  2WER A;  4WUD A;  2BU8 A;  3U2D A;  2WI5 A;  4I3H A;  4CWS A;  4EGI A;  1NHH A;  2YKC A;  4XDM A;  2FXS A;  2YGF A;  2YKB A;  5CPH A;  2BU5 A;  2FYP A;  4V26 A;  4XIT A;  1I59 A;  5J6A A;  5IDJ A;  2CGF A;  1ZW9 A;  2XJJ A;  2YEA A;  3K99 A;  1ZXN A;  4EEH A;  5M4K A;  2CCU A;  4V25 A;  2FWZ A;  2WI1 A;  3DGE A;  4JAS A;  4KTN A;  3GIF A;  4YKQ A;  4Q20 A;  4L93 A;  2YEC A;  2XDU A;  1PVG A;  1ID0 A;  4BAE A;  2HCH A;  3G75 A;  4B6C A;  2YED A;  4URM A;  1I58 A;  4XIQ A;  3U67 A;  2YEJ A;  3TZ0 A;  1AJ6 A;  1Z59 A;  4YKX A;  2XX2 A;  2YEI A;  4ZKI A;  3OMU A;  1AMW A;  1GKX A;  4QPK A;  3GIG A;  3ZM7 A;  2BSM A;  3INW A;  5FND A;  3C0E A;  1MU5 A;  1TH8 A;  1NHJ A;  3OWB A;  4FPP A;  1TC6 A;  4CWQ A;  4GFN A;  2H55 A;  2YKE A;  4LWI A;  4I5S A;  2VWC A;  5BOD A;  1ZXM A;  2Q8H A;  1I5B A;  4H81 A;  3HZ1 A;  3RKZ A;  3U2K A;  4PU9 A;  1B63 A;  4XKK A;  2YEE A;  1GKZ A;  1A4H A;  3GIG B;  4U93 A;  4O05 A;  3OPD A;  2QG2 A;  1ZWH A;  1EA6 A;  1BKN A;  4MPE A;  2O1U A;  1YER A;  4MP7 A;  1Z5B A;  3INX A;  2BRC A;  2YE7 A;  1B3Q A;  2YJX A;  3TZ4 A;  2WI7 A;  4DUH A;  4XC0 A;  2IWS A;  5C93 A;  2YKJ A;  3HEK A;  4HYM A;  3A0X A;  5FNF A;  4BQG A;  2IOR A;  3QTF A;  3Q5K A;  3ZXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...