4GTCA

T. maritima fdts (e144r mutant) plus fad
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
220
structure length
218
Chain Sequence
HHHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPRRVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 74
structure length 218
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtcA00
5CHPA 3N3YA 4GTEA 4GTLA 5JFEA 1O24A 4KARA 2CFAB 1O26A 4FZBA 5IOSA 1O25A 1O27A 3G4CA 2CFAA 3G4AA 1KQ4A 4P5AA 4GTAA 3N0BA 4KASA 5IOQA 4GTBA 5IORA 3AH5A 1O28A 1O29A 5IOTA 4GT9A 1O2BA 4GTDA 4GTCA 4KATA 4GTFA 4P5BA 1O2AA 3N0CA
chains in the Genus database with same CATH superfamily
1R9TK 2VUMC 3K7AC 3GTJC 4LR2A 1TWGA 2V6TA 4BXXK 3GTLA 4FZBA 4YG2A 2W7VA 4A3CK 1EQRA 1TWHA 4C3IK 3S1NC 2XCRB 4QIWL 3GTGC 4XCHA 3I4NC 5CJ9A 1O2BA 3QX3A 2JA5A 4C3JK 2BE5A 5C44K 1J98A 3BP8C 2R93A 4LQYA 2O5IA 1L0WA 1V5VA 3H0GK 3GTQK 1PJ7A 4C2MK 3GEIA 4M1XA 3H3VD 3A8IA 5C3EK 3HOVC 5D4DA 4KASA 4A3DK 1R9TA 4BY1C 1RU0A 1WCMC 4Y7NK 3HKZD 5C4XC 2NVTC 1XXAA 5EGHA 1XZPB 1ZXOA 3S1RC 4G7OA 4WJ4A 4A3MK 4QJVA 3CQZK 4XSXA 4A3EK 1TWFC 1VLOA 3FHZA 4BBSC 4GTLA 2FQTA 5JFEA 3FKIC 1TWAC 5IP9C 1IE0A 1IQ0A 2VUMK 1Y1VC 2Y3PA 5IOSA 1WOSA 1O27A 3GEEA 4MEXA 2WAQD 3GTMK 4GZYA 3BP3A 4A3BK 1I50K 2P5MA 3Q3QA 1I3QC 2NVXC 1Y1WA 2NVYA 4KM9A 3H0GA 3JSTA 3GTQA 3S1NK 1DCOA 2JA7C 3GTGK 1VJEA 2V6UA 2PMZL 4G7HA 3LAJA 4OIOA 3GTPK 2E2IC 3HOUK 3S1QC 3GSIA 4BLAA 1SFOC 3AD9C 1UV7A 1TWGK 4Y52K 1F93A 3S2HC 2VUMA 3S17C 4QJVB 4BY1K 3GTJA 4A3JC 4BBRK 4A3LC 3M3YC 2NVTK 5IYBK 3HOXK 4G0VA 4GTCA 2ZUEA 4KATA 5IYCC 4GFQA 3PO2C 2GAGC 1I50A 2B63C 1JQWA 1TWFK 3T02A 4BBSK 4A93C 5IP9K 4O2DA 2R7ZK 3GDZA 3GTGA 3N0BA 3IPJA 4C3HC 2E2HC 3AD8C 5TMCA 1I3QK 4P5BA 3TTGA 1PJ5A 5IP7K 1K83C 3CAGA 3S15K 3GIRA 3GTKK 4KB2A 4LLGA 1DD5A 1WCMA 2R92C 1IW7A 5FLMC 2YU9C 3HOYC 4A3IC 1SFOK 3NUHA 2O5JA 4RMFA 2XCQA 2D6FC 1EK8A 2PPBA 1O29A 3EQLA 1TWFA 3RZOC 1X31C 3FKIA 3S17K 1WORA 1Y1VA 4A3JK 2R7ZA 1C0AA 4OIRA 1WOOA 4Q5SA 2JA8K 1F7VA 3S14C 5IYCK 1I6HK 3PO2K 3A8JA 3OREA 1Y1WK 2B63K 2NVYK 2A6HA 4G0WA 4KAWX 1I3QA 2NVXA 3S16C 4A93K 4GTBA 4JK1A 5IYDC 4C45A 2JA7A 3S2DC 3GTKA 3S0XA 4KM8A 2ZUFA 2Y0SL 3H3VL 3T00A 4MEYA 3M4OC 2E2HK 1J6XA 4G0UA 4GTFA 4KN7A 1SFOA 4LJZA 1SMYA 4AYBL 4OIQA 2NVQK 3HOWC 4A3FC 3K7AK 2JA6C 1O25A 3GTJK 1ZVUA 1USOA 2A68A 2EBBA 5FLMK 3WODA 3OPFA 4LOWA 4GT9A 5M5WK 2B63A 1YX2A 4KMUA 1TWHC 1ISEA 1WSRA 3I4NK 1USMA 3N3YA 3LAPA 1VRQC 4LK0A 4G7ZA 4KARA 1GE9A 3S14K 1O26A 2WB1L 1INNA 3TFJA 2E2HA 4FM9A 1F7UA 1DCHA 3SZZA 4XLPA 2KWAA 1O28A 1ZQ1C 5E68A 2PMZD 3HOVK 1BDFA 3S2DK 1TWCC 2E2JC 3GTOC 1WCMK 1EH1A 5C4XK 5JVOA 1B4AA 3S1RK 4KMAA 2R92A 2YU9A 4Q4ZA 2JH3A 5L46A 2GSUA 4YFXA 4A3CC 2CW0A 3V4GA 1HI9A 3FKIK 1TWAK 4C3IC 1B4BA 3RZDC 1Y1VK 1WSVA 4KN4A 1VGXA 2PA8L 4DDQA 4C3JC 1XZQA 5C44C 1JOEA 3TFHA 1J6VA 4KDDA 2NVXK 2GSNA 4P9SA 4ZH4A 1PJ6A 5CHPA 3GTQC 2JA7K 3AD7C 2GSOA 4C2MC 1WIHA 5M5YK 4BY7C 4BLBA 2FQOA 2E2IK 2CFAA 4P5AA 4YFNA 1EI6A 4Y7NC 3S1QK 5IOQA 4OINA 4A3MC 1O2FB 4OIPA 3CQZC 4A3EC 3S2HK 1TWAA 1TWCK 2E2JK 3GTOK 2JA6A 4KC6A 1AB4A 4A3LK 3M3YK 1WQFA 3HOZC 3GTMC 5M3FK 4A3BC 1BS2A 1I50C 3LPXA 3ADAC 3MMLB 1KQ4A 4KB4A 2P8TA 4QIWD 1G51A 1EFWA 4ILDA 1XZQB 3RZDK 1ZYRA 3I4MC 3A8KA 3PO3C 4J3NA 4LK1A 1F9NA 2PHCB 5TJ3A 3GTPC 4C3HK 2E2IA 3HOUC 5HL8A 4XSZA 1O2AA 3N0CA 3HKZL 1VH2A 4A3GC 4GTEA 4A3KC 2CFAB 1K83K 3L4JA 2RH6A 5FJ8K 4BY7K 1ZBSA 2Y0SD 1TWGC 1YNNA 4Y52C 1TWCA 3GTOA 5TMFA 3OEPA 3GTLC 2R92K 2XCOA 2YU9K 4BBRC 3AH5A 1YNJA 3HOYK 4A3IK 5IYBC 3HOXC 3S1MC 4AYBD 2WAQL 4GTDA 3GEHA 1IL2A 3AQPA 3RZOK 5C4JC 4PAAA 2JA5C 3VA7A 1O24A 2R7ZC 1WQHA 4WJ3M 2A6EA 5M3MK 3HOZK 2R93C 2V6SA 3SZYA 5IORA 3T01A 3L4KA 3HXAA 3DXJA 3S16K 4X6AC 1K83A 5IYDK 5IP7C 1J6WA 1R9TC 4PABA 2WB1D 3I4MK 3S15C 1BGWA 3GTKC 3PO3K 4NOIA 1IS1A 4BXXC 3M4OK 4MQ9A 4A3GK 3G4CA 4A3KK 3FOEA 4AH6A 1WOPA 3BUEA 3HOWK 4A3FK 3CQZA 2JA6K 5M5XK 2GAHC 3GTLK 5IOTA 1I6VA 3TFIA 4KMHA 2JA8C 3S1MK 3GTMA 1I6HC 1JVIA 3AQOA 1Y1WC 2NVYC 3ERED 1TWHK 3H0GC 5C4JK 3FOFA 2PA8D 4YFKA 2JA5K 1XPPA 5C3EC 3G4AA 4A3DC 4GTAA 1IBAA 2A69A 4WILA 1XXCA 3GTPA 2R93K 1XXBA 5EGEA 1BJTA 1DCPA 1WQGA 4BKWA 2ZFZA 4KMDA 4XLNA 1XZPA 4X6AK 2RGRA 1YCLA 1HQMA 2NVQC
chains in the Genus database with same CATH topology
4GFQA 3N3YA 1I50A 4GTEA 4LR2A 1TWGA 3LAPA 4KARA 1GE9A 2CFAB 3GTLA 1O26A 4FZBA 3L4JA 2RH6A 1ZBSA 2E2HA 4FM9A 3GTGA 1TWCA 3GTOA 3OEPA 3N0BA 2XCOA 2KWAA 3AH5A 1TWHA 1O28A 4C3HC 2XCRB 5CJ9A 1O2BA 3QX3A 4GTDA 2JA5A 1EH1A 5JVOA 1B4AA 4P5BA 3AQPA 4KMAA 2R92A 2YU9A 3CAGA 2JH3A 2R93A 2GSUA 3VA7A 1O24A 4LQYA 4KB2A 1WQHA 3V4GA 1DD5A 1WCMA 4C3IC 1B4BA 4M1XA 3NUHA 2XCQA 4KASA 1R9TA 1EK8A 5IORA 4DDQA 3L4KA 1O29A 4C3JC 1XXAA 5EGHA 1TWFA 1ZXOA 1K83A 3FKIA 4KDDA 1Y1VA 2R7ZA 1BGWA 2GSNA 1IS1A 5CHPA 3FHZA 4GTLA 2GSOA 5JFEA 1WIHA 4C2MC 2Y3PA 3OREA 5IOSA 1O27A 4BLBA 3G4CA 4G0WA 3FOEA 2CFAA 4P5AA 4KAWX 3BUEA 1I3QA 2NVXA 3CQZA 2P5MA 5IOQA 4GTBA 2JA7A 3Q3QA 3GTKA 5IOTA 4KM8A 3S0XA 1Y1WA 2NVYA 4KM9A 3H0GA 4KMHA 3GTQA 1TWAA 4G0UA 4GTFA 3GTMA 2JA6A 1SFOA 4KC6A 3AQOA 1AB4A 3ERED 3LAJA 1WQFA 3FOFA 4BLAA 1O25A 1ZVUA 3LPXA 3G4AA 1KQ4A 3MMLB 4KB4A 4GTAA 3OPFA 4ILDA 1XXCA 3GTPA 1XXBA 5EGEA 1BJTA 1WQGA 4BKWA 2ZFZA 4KMDA 2VUMA 4GT9A 3GTJA 4J3NA 2B63A 1F9NA 2PHCB 1ISEA 5TJ3A 2E2IA 4G0VA 4GTCA 2RGRA 4KATA 1O2AA 3N0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHP A;  3N3Y A;  4GTE A;  4GTL A;  5JFE A;  1O24 A;  4KAR A;  2CFA B;  1O26 A;  4FZB A;  5IOS A;  1O25 A;  1O27 A;  3G4C A;  2CFA A;  3G4A A;  1KQ4 A;  4P5A A;  4GTA A;  3N0B A;  4KAS A;  5IOQ A;  4GTB A;  5IOR A;  3AH5 A;  1O28 A;  1O29 A;  5IOT A;  4GT9 A;  1O2B A;  4GTD A;  4GTC A;  4KAT A;  4GTF A;  4P5B A;  1O2A A;  3N0C A; 
#chains in the Genus database with same CATH topology
 1R9T K;  2VUM C;  3K7A C;  3GTJ C;  4LR2 A;  1TWG A;  2V6T A;  4BXX K;  3GTL A;  4FZB A;  4YG2 A;  2W7V A;  4A3C K;  1EQR A;  1TWH A;  4C3I K;  3S1N C;  2XCR B;  4QIW L;  3GTG C;  4XCH A;  3I4N C;  5CJ9 A;  1O2B A;  3QX3 A;  2JA5 A;  4C3J K;  2BE5 A;  5C44 K;  1J98 A;  3BP8 C;  2R93 A;  4LQY A;  2O5I A;  1L0W A;  1V5V A;  3H0G K;  3GTQ K;  1PJ7 A;  4C2M K;  3GEI A;  4M1X A;  3H3V D;  3A8I A;  5C3E K;  3HOV C;  5D4D A;  4KAS A;  4A3D K;  1R9T A;  4BY1 C;  1RU0 A;  1WCM C;  4Y7N K;  3HKZ D;  5C4X C;  2NVT C;  1XXA A;  5EGH A;  1XZP B;  1ZXO A;  3S1R C;  4G7O A;  4WJ4 A;  4A3M K;  4QJV A;  3CQZ K;  4XSX A;  4A3E K;  1TWF C;  1VLO A;  3FHZ A;  4BBS C;  4GTL A;  2FQT A;  5JFE A;  3FKI C;  1TWA C;  5IP9 C;  1IE0 A;  1IQ0 A;  2VUM K;  1Y1V C;  2Y3P A;  5IOS A;  1WOS A;  1O27 A;  3GEE A;  4MEX A;  2WAQ D;  3GTM K;  4GZY A;  3BP3 A;  4A3B K;  1I50 K;  2P5M A;  3Q3Q A;  1I3Q C;  2NVX C;  1Y1W A;  2NVY A;  4KM9 A;  3H0G A;  3JST A;  3GTQ A;  3S1N K;  1DCO A;  2JA7 C;  3GTG K;  1VJE A;  2V6U A;  2PMZ L;  4G7H A;  3LAJ A;  4OIO A;  3GTP K;  2E2I C;  3HOU K;  3S1Q C;  3GSI A;  4BLA A;  1SFO C;  3AD9 C;  1UV7 A;  1TWG K;  4Y52 K;  1F93 A;  3S2H C;  2VUM A;  3S17 C;  4QJV B;  4BY1 K;  3GTJ A;  4A3J C;  4BBR K;  4A3L C;  3M3Y C;  2NVT K;  5IYB K;  3HOX K;  4G0V A;  4GTC A;  2ZUE A;  4KAT A;  5IYC C;  4GFQ A;  3PO2 C;  2GAG C;  1I50 A;  2B63 C;  1JQW A;  1TWF K;  3T02 A;  4BBS K;  4A93 C;  5IP9 K;  4O2D A;  2R7Z K;  3GDZ A;  3GTG A;  3N0B A;  3IPJ A;  4C3H C;  2E2H C;  3AD8 C;  5TMC A;  1I3Q K;  4P5B A;  3TTG A;  1PJ5 A;  5IP7 K;  1K83 C;  3CAG A;  3S15 K;  3GIR A;  3GTK K;  4KB2 A;  4LLG A;  1DD5 A;  1WCM A;  2R92 C;  1IW7 A;  5FLM C;  2YU9 C;  3HOY C;  4A3I C;  1SFO K;  3NUH A;  2O5J A;  4RMF A;  2XCQ A;  2D6F C;  1EK8 A;  2PPB A;  1O29 A;  3EQL A;  1TWF A;  3RZO C;  1X31 C;  3FKI A;  3S17 K;  1WOR A;  1Y1V A;  4A3J K;  2R7Z A;  1C0A A;  4OIR A;  1WOO A;  4Q5S A;  2JA8 K;  1F7V A;  3S14 C;  5IYC K;  1I6H K;  3PO2 K;  3A8J A;  3ORE A;  1Y1W K;  2B63 K;  2NVY K;  2A6H A;  4G0W A;  4KAW X;  1I3Q A;  2NVX A;  3S16 C;  4A93 K;  4GTB A;  4JK1 A;  5IYD C;  4C45 A;  2JA7 A;  3S2D C;  3GTK A;  3S0X A;  4KM8 A;  2ZUF A;  2Y0S L;  3H3V L;  3T00 A;  4MEY A;  3M4O C;  2E2H K;  1J6X A;  4G0U A;  4GTF A;  4KN7 A;  1SFO A;  4LJZ A;  1SMY A;  4AYB L;  4OIQ A;  2NVQ K;  3HOW C;  4A3F C;  3K7A K;  2JA6 C;  1O25 A;  3GTJ K;  1ZVU A;  1USO A;  2A68 A;  2EBB A;  5FLM K;  3WOD A;  3OPF A;  4LOW A;  4GT9 A;  5M5W K;  2B63 A;  1YX2 A;  4KMU A;  1TWH C;  1ISE A;  1WSR A;  3I4N K;  1USM A;  3N3Y A;  3LAP A;  1VRQ C;  4LK0 A;  4G7Z A;  4KAR A;  1GE9 A;  3S14 K;  1O26 A;  2WB1 L;  1INN A;  3TFJ A;  2E2H A;  4FM9 A;  1F7U A;  1DCH A;  3SZZ A;  4XLP A;  2KWA A;  1O28 A;  1ZQ1 C;  5E68 A;  2PMZ D;  3HOV K;  1BDF A;  3S2D K;  1TWC C;  2E2J C;  3GTO C;  1WCM K;  1EH1 A;  5C4X K;  5JVO A;  1B4A A;  3S1R K;  4KMA A;  2R92 A;  2YU9 A;  4Q4Z A;  2JH3 A;  5L46 A;  2GSU A;  4YFX A;  4A3C C;  2CW0 A;  3V4G A;  1HI9 A;  3FKI K;  1TWA K;  4C3I C;  1B4B A;  3RZD C;  1Y1V K;  1WSV A;  4KN4 A;  1VGX A;  2PA8 L;  4DDQ A;  4C3J C;  1XZQ A;  5C44 C;  1JOE A;  3TFH A;  1J6V A;  4KDD A;  2NVX K;  2GSN A;  4P9S A;  4ZH4 A;  1PJ6 A;  5CHP A;  3GTQ C;  2JA7 K;  3AD7 C;  2GSO A;  4C2M C;  1WIH A;  5M5Y K;  4BY7 C;  4BLB A;  2FQO A;  2E2I K;  2CFA A;  4P5A A;  4YFN A;  1EI6 A;  4Y7N C;  3S1Q K;  5IOQ A;  4OIN A;  4A3M C;  1O2F B;  4OIP A;  3CQZ C;  4A3E C;  3S2H K;  1TWA A;  1TWC K;  2E2J K;  3GTO K;  2JA6 A;  4KC6 A;  1AB4 A;  4A3L K;  3M3Y K;  1WQF A;  3HOZ C;  3GTM C;  5M3F K;  4A3B C;  1BS2 A;  1I50 C;  3LPX A;  3ADA C;  3MML B;  1KQ4 A;  4KB4 A;  2P8T A;  4QIW D;  1G51 A;  1EFW A;  4ILD A;  1XZQ B;  3RZD K;  1ZYR A;  3I4M C;  3A8K A;  3PO3 C;  4J3N A;  4LK1 A;  1F9N A;  2PHC B;  5TJ3 A;  3GTP C;  4C3H K;  2E2I A;  3HOU C;  5HL8 A;  4XSZ A;  1O2A A;  3N0C A;  3HKZ L;  1VH2 A;  4A3G C;  4GTE A;  4A3K C;  2CFA B;  1K83 K;  3L4J A;  2RH6 A;  5FJ8 K;  4BY7 K;  1ZBS A;  2Y0S D;  1TWG C;  1YNN A;  4Y52 C;  1TWC A;  3GTO A;  5TMF A;  3OEP A;  3GTL C;  2R92 K;  2XCO A;  2YU9 K;  4BBR C;  3AH5 A;  1YNJ A;  3HOY K;  4A3I K;  5IYB C;  3HOX C;  3S1M C;  4AYB D;  2WAQ L;  4GTD A;  3GEH A;  1IL2 A;  3AQP A;  3RZO K;  5C4J C;  4PAA A;  2JA5 C;  3VA7 A;  1O24 A;  2R7Z C;  1WQH A;  4WJ3 M;  2A6E A;  5M3M K;  3HOZ K;  2R93 C;  2V6S A;  3SZY A;  5IOR A;  3T01 A;  3L4K A;  3HXA A;  3DXJ A;  3S16 K;  4X6A C;  1K83 A;  5IYD K;  5IP7 C;  1J6W A;  1R9T C;  4PAB A;  2WB1 D;  3I4M K;  3S15 C;  1BGW A;  3GTK C;  3PO3 K;  4NOI A;  1IS1 A;  4BXX C;  3M4O K;  4MQ9 A;  4A3G K;  3G4C A;  4A3K K;  3FOE A;  4AH6 A;  1WOP A;  3BUE A;  3HOW K;  4A3F K;  3CQZ A;  2JA6 K;  5M5X K;  2GAH C;  3GTL K;  5IOT A;  1I6V A;  3TFI A;  4KMH A;  2JA8 C;  3S1M K;  3GTM A;  1I6H C;  1JVI A;  3AQO A;  1Y1W C;  2NVY C;  3ERE D;  1TWH K;  3H0G C;  5C4J K;  3FOF A;  2PA8 D;  4YFK A;  2JA5 K;  1XPP A;  5C3E C;  3G4A A;  4A3D C;  4GTA A;  1IBA A;  2A69 A;  4WIL A;  1XXC A;  3GTP A;  2R93 K;  1XXB A;  5EGE A;  1BJT A;  1DCP A;  1WQG A;  4BKW A;  2ZFZ A;  4KMD A;  4XLN A;  1XZP A;  4X6A K;  2RGR A;  1YCL A;  1HQM A;  2NVQ C; 
#chains in the Genus database with same CATH homology
 4GFQ A;  3N3Y A;  1I50 A;  4GTE A;  4LR2 A;  1TWG A;  3LAP A;  4KAR A;  1GE9 A;  2CFA B;  3GTL A;  1O26 A;  4FZB A;  3L4J A;  2RH6 A;  1ZBS A;  2E2H A;  4FM9 A;  3GTG A;  1TWC A;  3GTO A;  3OEP A;  3N0B A;  2XCO A;  2KWA A;  3AH5 A;  1TWH A;  1O28 A;  4C3H C;  2XCR B;  5CJ9 A;  1O2B A;  3QX3 A;  4GTD A;  2JA5 A;  1EH1 A;  5JVO A;  1B4A A;  4P5B A;  3AQP A;  4KMA A;  2R92 A;  2YU9 A;  3CAG A;  2JH3 A;  2R93 A;  2GSU A;  3VA7 A;  1O24 A;  4LQY A;  4KB2 A;  1WQH A;  3V4G A;  1DD5 A;  1WCM A;  4C3I C;  1B4B A;  4M1X A;  3NUH A;  2XCQ A;  4KAS A;  1R9T A;  1EK8 A;  5IOR A;  4DDQ A;  3L4K A;  1O29 A;  4C3J C;  1XXA A;  5EGH A;  1TWF A;  1ZXO A;  1K83 A;  3FKI A;  4KDD A;  1Y1V A;  2R7Z A;  1BGW A;  2GSN A;  1IS1 A;  5CHP A;  3FHZ A;  4GTL A;  2GSO A;  5JFE A;  1WIH A;  4C2M C;  2Y3P A;  3ORE A;  5IOS A;  1O27 A;  4BLB A;  3G4C A;  4G0W A;  3FOE A;  2CFA A;  4P5A A;  4KAW X;  3BUE A;  1I3Q A;  2NVX A;  3CQZ A;  2P5M A;  5IOQ A;  4GTB A;  2JA7 A;  3Q3Q A;  3GTK A;  5IOT A;  4KM8 A;  3S0X A;  1Y1W A;  2NVY A;  4KM9 A;  3H0G A;  4KMH A;  3GTQ A;  1TWA A;  4G0U A;  4GTF A;  3GTM A;  2JA6 A;  1SFO A;  4KC6 A;  3AQO A;  1AB4 A;  3ERE D;  3LAJ A;  1WQF A;  3FOF A;  4BLA A;  1O25 A;  1ZVU A;  3LPX A;  3G4A A;  1KQ4 A;  3MML B;  4KB4 A;  4GTA A;  3OPF A;  4ILD A;  1XXC A;  3GTP A;  1XXB A;  5EGE A;  1BJT A;  1WQG A;  4BKW A;  2ZFZ A;  4KMD A;  2VUM A;  4GT9 A;  3GTJ A;  4J3N A;  2B63 A;  1F9N A;  2PHC B;  1ISE A;  5TJ3 A;  2E2I A;  4G0V A;  4GTC A;  2RGR A;  4KAT A;  1O2A A;  3N0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...