4GTCA

T. maritima fdts (e144r mutant) plus fad
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
220
structure length
218
Chain Sequence
b'HHHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPRRVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 74
structure length 218
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtcA00
5IOSA 4GTBA 4GT9A 4FZBA 3N0BA 1O26A 4GTFA 1O25A 4KARA 5JFEA 3N0CA 3G4CA 2CFAA 5CHPA 1O24A 4GTAA 1O2BA 1O29A 4KASA 3N3YA 5IOTA 4GTEA 1KQ4A 4KATA 5IOQA 4P5BA 4GTCA 5IORA 3AH5A 4GTDA 3G4AA 4P5AA 2CFAB 4GTLA 1O28A 1O27A 1O2AA
chains in the Genus database with same CATH superfamily
5IOSA 5TJ3A 1YNNA 2JA8K 5L46A 3CQZK 2A6EA 1BS2A 3HOVK 2CW0A 2JA7C 3S1NC 1F9NA 4XLPA 3FHZA 3S2DK 1VJEA 3GDZA 3LAJA 4X6AC 3PO3K 4O2DA 4GTAA 1G51A 5TMCA 2R7ZC 4C3HC 4C3IC 3M3YK 1WOPA 1ZXOA 2CFAB 1HQMA 3FKIC 3HOZC 1O28A 4PABA 1XXAA 4BXXC 1B4BA 3LAPA 4KB2A 1DCPA 1IBAA 1UV7A 3N0BA 3FOFA 1PJ6A 4C2MC 4AYBD 3T01A 4KARA 4A3EK 3GTOK 1PJ7A 4OIQA 1F7VA 3CAGA 5C44C 3M4OK 2W7VA 1TWAC 2JA5A 3S17C 3TFIA 2JA8C 2A6HA 4A3CK 2A69A 4Y7NK 3S2HK 4XCHA 5EGEA 4A3FK 3S1QK 2PHCB 3LPXA 4LLGA 1HI9A 3HOUC 3GTPA 2NVXK 3PO3C 2JA6A 2XCOA 5IP9C 3H0GK 4KM8A 4LOWA 1I6HK 5C4XC 3A8JA 2RGRA 5HL8A 1Y1VK 4A3BK 1IQ0A 4KATA 4J3NA 5IORA 4BY1K 1XZPB 1JVIA 4JK1A 1J6WA 4WILA 3TTGA 1WQGA 1ISEA 4A93C 4A3EC 3L4KA 3IPJA 3I4NK 3S16K 5JVOA 3GIRA 3H3VL 2NVYA 1EQRA 3AQPA 1ZBSA 2JA7K 2V6TA 4P9SA 3S1NK 3MMLB 1SFOC 3OPFA 4A3CC 3S2HC 2A68A 3S1QC 2Y3PA 1TWFA 2P8TA 3TFJA 4P5AA 4X6AK 2NVXC 4GTLA 2R7ZK 3H0GC 3T00A 1I6HC 2FQOA 1Y1VC 3S1RK 3HOZK 2GSNA 3GTLA 1VGXA 4BY1C 1WSRA 5FJ8K 3GTPK 4DDQA 2R93A 1XZQB 4KMHA 2JA6K 3QX3A 3G4AA 3S16C 4G0WA 3I4NC 3S15C 5C44K 1BGWA 1DCHA 2D6FC 1WCMA 1TWAK 3A8KA 1J6XA 3S17K 4G0VA 1VRQC 4MEXA 4NOIA 4LK1A 4G7ZA 3HOUK 4WJ4A 4KM9A 1WQFA 1TWHA 2FQTA 5IYDC 3BUEA 1O2BA 1O29A 4LQYA 3N3YA 1F93A 4KC6A 1O2FB 5IP9K 1EFWA 4WJ3M 1J98A 5C4XK 2PPBA 2NVYK 3OREA 3S1RC 2JA5C 3JSTA 2GSOA 1WSVA 2XCQA 2YU9A 1VH2A 5M3FK 1YNJA 1L0WA 4KN4A 4KDDA 5C3EC 3GTPC 1TWFK 3AD7C 4A93K 3G4CA 5M3MK 2P5MA 3S0XA 2JA6C 1O24A 2GAHC 2VUMA 5FLMK 5EGHA 1DD5A 1SMYA 3HOWC 1WOSA 5C4JC 3RZOK 3WODA 1ZVUA 3GTLK 1SFOK 3PO2K 4C45A 1AB4A 1IE0A 4GT9A 3H3VD 1TWGA 2EBBA 1XXBA 4OINA 4Q5SA 4RMFA 4A3JC 2PA8D 4QIWL 2CFAA 5CHPA 1WCMK 1EK8A 4M1XA 2Y0SD 5D4DA 2NVYC 1WOOA 2ZFZA 5IP7C 4A3IC 4XSXA 4FM9A 4BY7C 1O27A 1TWHK 1TWFC 3GEIA 4BLAA 1ZYRA 2V6SA 3HOXC 3GSIA 3SZZA 2E2HC 5FLMC 3S15K 1BJTA 4KMUA 4BLBA 2KWAA 3RZOC 5CJ9A 3HKZL 4G7OA 3CQZA 1I3QC 3GTLC 4GTEA 2PA8L 4P5BA 3PO2C 3HXAA 5IYCC 1IW7A 1YCLA 2Y0SL 2R93C 4A3KK 5IYDK 2V6UA 5M5WK 4BBRC 1X31C 2E2HA 2WB1L 3RZDC 1WCMC 2GSUA 5E68A 2PMZL 2JA5K 1XZPA 4ZH4A 3AD9C 1I3QA 1USOA 2R92A 4LJZA 5C3EK 3GTMC 3L4JA 4A3GC 4QJVA 5TMFA 2E2JC 1TWHC 1USMA 4A3MK 2B63A 4GTDA 3SZYA 3GTKA 1F7UA 3GTQA 3GTOA 1PJ5A 3HOYC 4Y52C 4KN7A 3AQOA 1XPPA 3HOWK 4A3LC 4FZBA 5C4JK 5IYBK 4XSZA 2ZUEA 1R9TA 4G7HA 3T02A 1O26A 3ERED 2YU9C 4MQ9A 3GTMA 1C0AA 3GTGA 3I4MK 4LR2A 4A3KC 5IOTA 3VA7A 2VUMC 4GTCA 4A3JK 3NUHA 2O5JA 1K83A 4MEYA 4KB4A 1Y1WA 3TFHA 4ILDA 1INNA 1JOEA 4QIWD 3S14K 1XZQA 5IP7K 4A3IK 4BY7K 1TWGC 1I50A 1IS1A 1O25A 3OEPA 3DXJA 3GTJA 2E2IA 4A3MC 3V4GA 3HOXK 4BBSK 1YX2A 4KMAA 4YFXA 2E2HK 1B4AA 5IYBC 2WAQD 3BP3A 5M5XK 1I6VA 1V5VA 1I3QK 5M5YK 2JA7A 2R92K 1J6VA 1EI6A 5IYCK 2JH3A 2R93K 3I4MC 1JQWA 3GEHA 4GTFA 2B63K 2NVTC 3GTKK 3HKZD 3GTQK 2R7ZA 1TWCC 3ADAC 4BBRK 3K7AC 3S1MC 2O5IA 3RZDK 4KMDA 2RH6A 4YFKA 4A3DC 3GEEA 3FKIA 1R9TK 1BDFA 4C3JK 3CQZC 3HOVC 2XCRB 2WB1D 3S14C 4PAAA 3GTMK 1O2AA 1ZQ1C 4A3GK 3GTGK 1IL2A 3S2DC 2PMZD 2E2JK 2WAQL 4Q4ZA 1TWCA 4BKWA 4GFQA 4BBSC 3HOYK 4Y52K 3FOEA 3M3YC 4A3LK 1TWAA 3N0CA 1WIHA 4OIRA 1WQHA 3A8IA 1K83K 3AD8C 1Y1WK 4AYBL 4GZYA 1KQ4A 2YU9K 2R92C 3AH5A 1I50K 4LK0A 1WORA 1DCOA 3GTJK 2E2IK 2B63C 3GTKC 4GTBA 4QJVB 2VUMK 3GTQC 3GTOC 2NVQK 1RU0A 3M4OC 1GE9A 1EH1A 1R9TC 4AH6A 2ZUFA 3Q3QA 4C3JC 4KASA 4Y7NC 1TWGK 4OIPA 4A3FC 3GTGC 4C3HK 4C3IK 1XXCA 3FKIK 3EQLA 1K83C 1Y1WC 4BXXK 4A3BC 4G0UA 2GAGC 1SFOA 5JFEA 4XLNA 2BE5A 1I50C 4C2MK 4YG2A 2NVXA 2NVTK 3GTJC 2E2IC 1TWCK 3BP8C 1VLOA 4OIOA 4YFNA 3K7AK 3H0GA 4KAWX 3S1MK 4A3DK 2NVQC 5IOQA 1Y1VA
chains in the Genus database with same CATH topology
5IOSA 2JA7A 5TJ3A 4BLAA 2JH3A 4GTFA 2GSNA 1BJTA 1F9NA 2R7ZA 4BLBA 3FHZA 3GTLA 2KWAA 3LAJA 4GTAA 5CJ9A 4KMDA 2RH6A 3CQZA 4DDQA 2R93A 4GTEA 3FKIA 4KMHA 4P5BA 4C3HC 4C3IC 3QX3A 3G4AA 1ZXOA 2CFAB 2XCRB 4G0WA 1O28A 1BGWA 1XXAA 1O2AA 1B4BA 1WCMA 3LAPA 4KB2A 2E2HA 3N0BA 1TWCA 3FOFA 4BKWA 4GFQA 2GSUA 4G0VA 3FOEA 4C2MC 4KARA 1TWAA 3N0CA 1WIHA 4KM9A 1WQHA 1I3QA 1WQFA 2R92A 1TWHA 3CAGA 3BUEA 1O2BA 1O29A 4LQYA 3N3YA 3L4JA 4KC6A 1KQ4A 2JA5A 3AH5A 2B63A 4GTDA 3GTKA 3GTQA 3GTOA 3OREA 3AQOA 2GSOA 5EGEA 4GTBA 2PHCB 3LPXA 2XCQA 4FZBA 3GTPA 2YU9A 1R9TA 4KDDA 1O26A 2JA6A 2XCOA 1GE9A 3ERED 4KM8A 1EH1A 3G4CA 3GTMA 2P5MA 3S0XA 2VUMA 1O24A 3Q3QA 2RGRA 3GTGA 4C3JC 4LR2A 5EGHA 1DD5A 5IOTA 4KASA 3VA7A 4KATA 4J3NA 4GTCA 5IORA 1ZVUA 3NUHA 1WQGA 1K83A 1XXCA 4KB4A 1Y1WA 1ISEA 1AB4A 4GT9A 1TWGA 1XXBA 4ILDA 3L4KA 5JVOA 1I50A 4G0UA 1IS1A 1O25A 3OEPA 2NVYA 1SFOA 5JFEA 5CHPA 2CFAA 3GTJA 2E2IA 3V4GA 3AQPA 1ZBSA 4M1XA 1EK8A 4KMAA 1B4AA 3MMLB 3OPFA 2NVXA 2Y3PA 2ZFZA 3H0GA 1TWFA 4KAWX 4P5AA 4GTLA 4FM9A 5IOQA 1O27A 1Y1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOS A;  4GTB A;  4GT9 A;  4FZB A;  3N0B A;  1O26 A;  4GTF A;  1O25 A;  4KAR A;  5JFE A;  3N0C A;  3G4C A;  2CFA A;  5CHP A;  1O24 A;  4GTA A;  1O2B A;  1O29 A;  4KAS A;  3N3Y A;  5IOT A;  4GTE A;  1KQ4 A;  4KAT A;  5IOQ A;  4P5B A;  4GTC A;  5IOR A;  3AH5 A;  4GTD A;  3G4A A;  4P5A A;  2CFA B;  4GTL A;  1O28 A;  1O27 A;  1O2A A; 
#chains in the Genus database with same CATH topology
 5IOS A;  5TJ3 A;  1YNN A;  2JA8 K;  5L46 A;  3CQZ K;  2A6E A;  1BS2 A;  3HOV K;  2CW0 A;  2JA7 C;  3S1N C;  1F9N A;  4XLP A;  3FHZ A;  3S2D K;  1VJE A;  3GDZ A;  3LAJ A;  4X6A C;  3PO3 K;  4O2D A;  4GTA A;  1G51 A;  5TMC A;  2R7Z C;  4C3H C;  4C3I C;  3M3Y K;  1WOP A;  1ZXO A;  2CFA B;  1HQM A;  3FKI C;  3HOZ C;  1O28 A;  4PAB A;  1XXA A;  4BXX C;  1B4B A;  3LAP A;  4KB2 A;  1DCP A;  1IBA A;  1UV7 A;  3N0B A;  3FOF A;  1PJ6 A;  4C2M C;  4AYB D;  3T01 A;  4KAR A;  4A3E K;  3GTO K;  1PJ7 A;  4OIQ A;  1F7V A;  3CAG A;  5C44 C;  3M4O K;  2W7V A;  1TWA C;  2JA5 A;  3S17 C;  3TFI A;  2JA8 C;  2A6H A;  4A3C K;  2A69 A;  4Y7N K;  3S2H K;  4XCH A;  5EGE A;  4A3F K;  3S1Q K;  2PHC B;  3LPX A;  4LLG A;  1HI9 A;  3HOU C;  3GTP A;  2NVX K;  3PO3 C;  2JA6 A;  2XCO A;  5IP9 C;  3H0G K;  4KM8 A;  4LOW A;  1I6H K;  5C4X C;  3A8J A;  2RGR A;  5HL8 A;  1Y1V K;  4A3B K;  1IQ0 A;  4KAT A;  4J3N A;  5IOR A;  4BY1 K;  1XZP B;  1JVI A;  4JK1 A;  1J6W A;  4WIL A;  3TTG A;  1WQG A;  1ISE A;  4A93 C;  4A3E C;  3L4K A;  3IPJ A;  3I4N K;  3S16 K;  5JVO A;  3GIR A;  3H3V L;  2NVY A;  1EQR A;  3AQP A;  1ZBS A;  2JA7 K;  2V6T A;  4P9S A;  3S1N K;  3MML B;  1SFO C;  3OPF A;  4A3C C;  3S2H C;  2A68 A;  3S1Q C;  2Y3P A;  1TWF A;  2P8T A;  3TFJ A;  4P5A A;  4X6A K;  2NVX C;  4GTL A;  2R7Z K;  3H0G C;  3T00 A;  1I6H C;  2FQO A;  1Y1V C;  3S1R K;  3HOZ K;  2GSN A;  3GTL A;  1VGX A;  4BY1 C;  1WSR A;  5FJ8 K;  3GTP K;  4DDQ A;  2R93 A;  1XZQ B;  4KMH A;  2JA6 K;  3QX3 A;  3G4A A;  3S16 C;  4G0W A;  3I4N C;  3S15 C;  5C44 K;  1BGW A;  1DCH A;  2D6F C;  1WCM A;  1TWA K;  3A8K A;  1J6X A;  3S17 K;  4G0V A;  1VRQ C;  4MEX A;  4NOI A;  4LK1 A;  4G7Z A;  3HOU K;  4WJ4 A;  4KM9 A;  1WQF A;  1TWH A;  2FQT A;  5IYD C;  3BUE A;  1O2B A;  1O29 A;  4LQY A;  3N3Y A;  1F93 A;  4KC6 A;  1O2F B;  5IP9 K;  1EFW A;  4WJ3 M;  1J98 A;  5C4X K;  2PPB A;  2NVY K;  3ORE A;  3S1R C;  2JA5 C;  3JST A;  2GSO A;  1WSV A;  2XCQ A;  2YU9 A;  1VH2 A;  5M3F K;  1YNJ A;  1L0W A;  4KN4 A;  4KDD A;  5C3E C;  3GTP C;  1TWF K;  3AD7 C;  4A93 K;  3G4C A;  5M3M K;  2P5M A;  3S0X A;  2JA6 C;  1O24 A;  2GAH C;  2VUM A;  5FLM K;  5EGH A;  1DD5 A;  1SMY A;  3HOW C;  1WOS A;  5C4J C;  3RZO K;  3WOD A;  1ZVU A;  3GTL K;  1SFO K;  3PO2 K;  4C45 A;  1AB4 A;  1IE0 A;  4GT9 A;  3H3V D;  1TWG A;  2EBB A;  1XXB A;  4OIN A;  4Q5S A;  4RMF A;  4A3J C;  2PA8 D;  4QIW L;  2CFA A;  5CHP A;  1WCM K;  1EK8 A;  4M1X A;  2Y0S D;  5D4D A;  2NVY C;  1WOO A;  2ZFZ A;  5IP7 C;  4A3I C;  4XSX A;  4FM9 A;  4BY7 C;  1O27 A;  1TWH K;  1TWF C;  3GEI A;  4BLA A;  1ZYR A;  2V6S A;  3HOX C;  3GSI A;  3SZZ A;  2E2H C;  5FLM C;  3S15 K;  1BJT A;  4KMU A;  4BLB A;  2KWA A;  3RZO C;  5CJ9 A;  3HKZ L;  4G7O A;  3CQZ A;  1I3Q C;  3GTL C;  4GTE A;  2PA8 L;  4P5B A;  3PO2 C;  3HXA A;  5IYC C;  1IW7 A;  1YCL A;  2Y0S L;  2R93 C;  4A3K K;  5IYD K;  2V6U A;  5M5W K;  4BBR C;  1X31 C;  2E2H A;  2WB1 L;  3RZD C;  1WCM C;  2GSU A;  5E68 A;  2PMZ L;  2JA5 K;  1XZP A;  4ZH4 A;  3AD9 C;  1I3Q A;  1USO A;  2R92 A;  4LJZ A;  5C3E K;  3GTM C;  3L4J A;  4A3G C;  4QJV A;  5TMF A;  2E2J C;  1TWH C;  1USM A;  4A3M K;  2B63 A;  4GTD A;  3SZY A;  3GTK A;  1F7U A;  3GTQ A;  3GTO A;  1PJ5 A;  3HOY C;  4Y52 C;  4KN7 A;  3AQO A;  1XPP A;  3HOW K;  4A3L C;  4FZB A;  5C4J K;  5IYB K;  4XSZ A;  2ZUE A;  1R9T A;  4G7H A;  3T02 A;  1O26 A;  3ERE D;  2YU9 C;  4MQ9 A;  3GTM A;  1C0A A;  3GTG A;  3I4M K;  4LR2 A;  4A3K C;  5IOT A;  3VA7 A;  2VUM C;  4GTC A;  4A3J K;  3NUH A;  2O5J A;  1K83 A;  4MEY A;  4KB4 A;  1Y1W A;  3TFH A;  4ILD A;  1INN A;  1JOE A;  4QIW D;  3S14 K;  1XZQ A;  5IP7 K;  4A3I K;  4BY7 K;  1TWG C;  1I50 A;  1IS1 A;  1O25 A;  3OEP A;  3DXJ A;  3GTJ A;  2E2I A;  4A3M C;  3V4G A;  3HOX K;  4BBS K;  1YX2 A;  4KMA A;  4YFX A;  2E2H K;  1B4A A;  5IYB C;  2WAQ D;  3BP3 A;  5M5X K;  1I6V A;  1V5V A;  1I3Q K;  5M5Y K;  2JA7 A;  2R92 K;  1J6V A;  1EI6 A;  5IYC K;  2JH3 A;  2R93 K;  3I4M C;  1JQW A;  3GEH A;  4GTF A;  2B63 K;  2NVT C;  3GTK K;  3HKZ D;  3GTQ K;  2R7Z A;  1TWC C;  3ADA C;  4BBR K;  3K7A C;  3S1M C;  2O5I A;  3RZD K;  4KMD A;  2RH6 A;  4YFK A;  4A3D C;  3GEE A;  3FKI A;  1R9T K;  1BDF A;  4C3J K;  3CQZ C;  3HOV C;  2XCR B;  2WB1 D;  3S14 C;  4PAA A;  3GTM K;  1O2A A;  1ZQ1 C;  4A3G K;  3GTG K;  1IL2 A;  3S2D C;  2PMZ D;  2E2J K;  2WAQ L;  4Q4Z A;  1TWC A;  4BKW A;  4GFQ A;  4BBS C;  3HOY K;  4Y52 K;  3FOE A;  3M3Y C;  4A3L K;  1TWA A;  3N0C A;  1WIH A;  4OIR A;  1WQH A;  3A8I A;  1K83 K;  3AD8 C;  1Y1W K;  4AYB L;  4GZY A;  1KQ4 A;  2YU9 K;  2R92 C;  3AH5 A;  1I50 K;  4LK0 A;  1WOR A;  1DCO A;  3GTJ K;  2E2I K;  2B63 C;  3GTK C;  4GTB A;  4QJV B;  2VUM K;  3GTQ C;  3GTO C;  2NVQ K;  1RU0 A;  3M4O C;  1GE9 A;  1EH1 A;  1R9T C;  4AH6 A;  2ZUF A;  3Q3Q A;  4C3J C;  4KAS A;  4Y7N C;  1TWG K;  4OIP A;  4A3F C;  3GTG C;  4C3H K;  4C3I K;  1XXC A;  3FKI K;  3EQL A;  1K83 C;  1Y1W C;  4BXX K;  4A3B C;  4G0U A;  2GAG C;  1SFO A;  5JFE A;  4XLN A;  2BE5 A;  1I50 C;  4C2M K;  4YG2 A;  2NVX A;  2NVT K;  3GTJ C;  2E2I C;  1TWC K;  3BP8 C;  1VLO A;  4OIO A;  4YFN A;  3K7A K;  3H0G A;  4KAW X;  3S1M K;  4A3D K;  2NVQ C;  5IOQ A;  1Y1V A; 
#chains in the Genus database with same CATH homology
 5IOS A;  2JA7 A;  5TJ3 A;  4BLA A;  2JH3 A;  4GTF A;  2GSN A;  1BJT A;  1F9N A;  2R7Z A;  4BLB A;  3FHZ A;  3GTL A;  2KWA A;  3LAJ A;  4GTA A;  5CJ9 A;  4KMD A;  2RH6 A;  3CQZ A;  4DDQ A;  2R93 A;  4GTE A;  3FKI A;  4KMH A;  4P5B A;  4C3H C;  4C3I C;  3QX3 A;  3G4A A;  1ZXO A;  2CFA B;  2XCR B;  4G0W A;  1O28 A;  1BGW A;  1XXA A;  1O2A A;  1B4B A;  1WCM A;  3LAP A;  4KB2 A;  2E2H A;  3N0B A;  1TWC A;  3FOF A;  4BKW A;  4GFQ A;  2GSU A;  4G0V A;  3FOE A;  4C2M C;  4KAR A;  1TWA A;  3N0C A;  1WIH A;  4KM9 A;  1WQH A;  1I3Q A;  1WQF A;  2R92 A;  1TWH A;  3CAG A;  3BUE A;  1O2B A;  1O29 A;  4LQY A;  3N3Y A;  3L4J A;  4KC6 A;  1KQ4 A;  2JA5 A;  3AH5 A;  2B63 A;  4GTD A;  3GTK A;  3GTQ A;  3GTO A;  3ORE A;  3AQO A;  2GSO A;  5EGE A;  4GTB A;  2PHC B;  3LPX A;  2XCQ A;  4FZB A;  3GTP A;  2YU9 A;  1R9T A;  4KDD A;  1O26 A;  2JA6 A;  2XCO A;  1GE9 A;  3ERE D;  4KM8 A;  1EH1 A;  3G4C A;  3GTM A;  2P5M A;  3S0X A;  2VUM A;  1O24 A;  3Q3Q A;  2RGR A;  3GTG A;  4C3J C;  4LR2 A;  5EGH A;  1DD5 A;  5IOT A;  4KAS A;  3VA7 A;  4KAT A;  4J3N A;  4GTC A;  5IOR A;  1ZVU A;  3NUH A;  1WQG A;  1K83 A;  1XXC A;  4KB4 A;  1Y1W A;  1ISE A;  1AB4 A;  4GT9 A;  1TWG A;  1XXB A;  4ILD A;  3L4K A;  5JVO A;  1I50 A;  4G0U A;  1IS1 A;  1O25 A;  3OEP A;  2NVY A;  1SFO A;  5JFE A;  5CHP A;  2CFA A;  3GTJ A;  2E2I A;  3V4G A;  3AQP A;  1ZBS A;  4M1X A;  1EK8 A;  4KMA A;  1B4A A;  3MML B;  3OPF A;  2NVX A;  2Y3P A;  2ZFZ A;  3H0G A;  1TWF A;  4KAW X;  4P5A A;  4GTL A;  4FM9 A;  5IOQ A;  1O27 A;  1Y1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...