4GTEA

T. maritima fdts (e144r mutant) with fad and folate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
215
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPRRVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 74
structure length 215
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gteA00
4GTBA 5IORA 4P5BA 3N3YA 1O2BA 3N0CA 1O28A 4GTLA 4GT9A 4P5AA 5IOTA 1O29A 3G4AA 5IOQA 4KARA 5IOSA 1O2AA 4KATA 5JFEA 5CHPA 4FZBA 3AH5A 1KQ4A 1O27A 1O25A 4GTCA 1O26A 1O24A 3N0BA 4GTAA 4KASA 3G4CA 4GTFA 2CFAB 2CFAA 4GTEA 4GTDA
chains in the Genus database with same CATH superfamily
2GSUA 4A3MC 2A68A 1O2BA 4GTLA 3AD9C 4GT9A 1F7UA 4A3CK 4BXXK 1WQHA 2FQOA 2GAGC 2FQTA 4QIWL 3H3VL 1UV7A 1DCPA 1TWAK 3HOZK 4LJZA 3QX3A 1USMA 2PPBA 3BUEA 3AQOA 2YU9K 1O25A 2BE5A 2JA6K 3PO3K 1X31C 4OINA 1WOPA 3GTKA 1XPPA 3M4OC 2V6SA 1J6VA 2B63K 3GTLC 3JSTA 3CQZC 3S1MC 3A8KA 3FKIC 1WORA 5M5YK 3S1QC 3BP8C 4OIQA 5IYCC 1VRQC 2R7ZK 4MQ9A 5IP9C 5M5WK 4G7HA 3WODA 1I3QK 1TWFA 1R9TC 1DCHA 2V6TA 2JA5A 4BY7K 4A3LK 4GTCA 3S2HC 2GSNA 1O26A 2NVYA 4Y7NK 3A8IA 4G0VA 2CFAB 2PMZL 2PHCB 3S16C 5IYDC 3SZYA 2E2IA 3MMLB 1DD5A 4G7ZA 3S1NK 1DCOA 3GTLA 1K83C 1YNJA 4Y52K 3T01A 4O2DA 4WILA 2O5IA 4A93K 3ADAC 4KC6A 3GTOC 4MEXA 1I6VA 2NVTK 4KM8A 5TMCA 2NVXA 3HOWC 1WCMC 3G4AA 2JA8K 1IQ0A 2WB1D 4FZBA 3HOYC 1VGXA 1ZXOA 4BLAA 4X6AC 3HOXK 3T02A 1JQWA 3GTGK 1J98A 3GTJK 1I6HK 3GTQA 1USOA 1SMYA 4XCHA 4LQYA 1K83A 1Y1VK 1PJ6A 5EGHA 2PMZD 3AD8C 3GEEA 2NVQC 3S14K 5JVOA 5L46A 5FLMC 1XZQB 4AYBL 2V6UA 3GEIA 3K7AC 1I50C 3ERED 3LAJA 3N0BA 3PO2K 2WAQD 3FOFA 3GTKK 2R93C 4KM9A 3H0GA 5IP7K 3GIRA 4A3MK 3S17C 2XCRB 2ZUFA 1VLOA 2JA7A 4C3HK 2XCOA 5C3EK 3SZZA 1TWGA 1Y1WA 1TWCC 4C3IK 3GTMC 5C4JC 4XSZA 1O2AA 2KWAA 3AQPA 5C44K 4A3GC 4Q5SA 1TWFK 3HOVK 1EH1A 2JA5K 1HQMA 1YCLA 1I50A 3I4MC 1TWHC 2NVYK 1XZPB 4AYBD 1WOSA 1C0AA 2E2IK 3GTLK 4WJ4A 5D4DA 3S15C 3HOUK 1ZYRA 3T00A 3S1QK 4OIOA 4KB4A 5IYCK 2NVXK 5IOSA 5IP9K 4A3EC 2EBBA 4KN7A 5CHPA 1O27A 4BBRK 4C2MK 2E2HC 3GSIA 4A3IC 4XSXA 1WSVA 4GTEA 4ZH4A 1B4AA 4P5BA 4BY1C 3S16K 3GTQK 4P5AA 2VUMC 1K83K 3RZOC 4KMAA 1PJ5A 1XXAA 5IYBC 2WB1L 3GTOK 4BBSK 1V5VA 1ISEA 1O29A 5C4XK 4A3KC 4MEYA 3S1RC 4JK1A 1INNA 1PJ7A 3HOYK 1XZQA 4LOWA 4A3BC 4KASA 4GTFA 4X6AK 2CW0A 3LPXA 1XXBA 1YNNA 4G7OA 2W7VA 4BXXC 4A3CC 4BLBA 4FM9A 3CQZA 3H0GK 3FKIA 1XXCA 1SFOC 4G0WA 2VUMA 2R92C 1TWAC 4GZYA 3HOZC 2JA7K 4NOIA 3VA7A 2YU9C 1TWGK 1Y1WK 2JA6C 3PO3C 4P9SA 5JFEA 1R9TA 1GE9A 2NVQK 2WAQL 4C3JC 1WQFA 1AB4A 1O24A 2B63C 4A3FK 3K7AK 1I50K 4A3DC 4WJ3M 1XZPA 2R7ZC 5M5XK 3GEHA 3I4NC 3GTOA 2R92A 5M3MK 4A3JK 3S17K 3S2DK 4BKWA 4KARA 3RZDC 1WCMA 4A3LC 2E2JK 2A69A 3GTMK 4Y7NC 3TFJA 3OEPA 2GAHC 4KN4A 2GSOA 2P5MA 4KMHA 4LR2A 3S1NC 1BJTA 1F93A 4Y52C 4A93C 4GTBA 1L0WA 5E68A 2PA8D 4AH6A 1ZQ1C 1WSRA 3FHZA 1ZBSA 3M3YC 3AD7C 4C45A 2XCQA 4PAAA 1IS1A 4M1XA 4YFXA 3HOXC 3GTPC 3GTGC 3GTJC 5HL8A 1I6HC 1Y1VC 4OIRA 4A3IK 4KB2A 2R93A 3M4OK 1G51A 2Y0SD 4BY1K 4KDDA 4KAWX 1J6WA 3CQZK 3S1MK 3IPJA 3FKIK 2VUMK 3RZOK 3S14C 4RMFA 5FJ8K 5IOQA 1TWCA 5IYBK 3GTMA 4KATA 1RU0A 3CAGA 1HI9A 1KQ4A 4YFKA 1B4BA 4A3KK 1R9TK 1ZVUA 3S1RK 3GTKC 4LK1A 5TMFA 3TTGA 1TWHA 3S2HK 1IBAA 4A3BK 5IP7C 4XLNA 3N3YA 5TJ3A 3N0CA 5EGEA 4C3HC 5C3EC 5IYDK 4C3IC 3BP3A 1SFOK 2R92K 5IOTA 2JH3A 5C44C 2A6EA 1TWFC 2P8TA 5CJ9A 3HOVC 3HOWK 2JA5C 3DXJA 1WCMK 4ILDA 3HKZD 2RH6A 3L4JA 2NVYC 4C3JK 2E2HA 2E2IC 4Q4ZA 2A6HA 3TFHA 4A3DK 3HOUC 1BS2A 3GDZA 1YX2A 3TFIA 4XLPA 2NVXC 1F9NA 3A8JA 1BDFA 3I4NK 4DDQA 3FOEA 5M3FK 4BBRC 4QIWD 4C2MC 2ZUEA 3OREA 3H3VD 3RZDK 3V4GA 5FLMK 2PA8L 3GTQC 1IE0A 4GTDA 2R93K 4BBSC 1WIHA 1SFOA 4LK0A 5C4XC 4KMUA 1I3QC 1TWAA 1EK8A 1EI6A 1IL2A 3M3YK 2YU9A 4BY7C 1EFWA 2JA6A 1TWCK 5C4JK 3GTPK 4QJVA 4A3GK 1J6XA 4GTAA 2B63A 2Y0SL 3I4MK 3H0GC 1WQGA 5IORA 1TWHK 3LAPA 2D6FC 2Y3PA 4KMDA 2NVTC 2JA7C 2R7ZA 1F7VA 1TWGC 1Y1WC 1I3QA 2JA8C 3S15K 4J3NA 3HXAA 1WOOA 4OIPA 4GFQA 3AH5A 4A3FC 4A3EK 1JOEA 1IW7A 3G4CA 4G0UA 2E2HK 4LLGA 1JVIA 1O28A 4A3JC 3S2DC 2E2JC 3Q3QA 2RGRA 3HKZL 2ZFZA 4YG2A 3S0XA 3GTPA 3OPFA 3NUHA 3GTGA 1EQRA 3PO2C 4QJVB 3GTJA 3EQLA 4PABA 1VJEA 4YFNA 1O2FB 2O5JA 1BGWA 3L4KA 2CFAA 1VH2A 1Y1VA
chains in the Genus database with same CATH topology
4KM9A 2GSUA 3H0GA 1O2BA 4GTLA 4GT9A 2XCRB 1WQHA 2JA7A 3GTOA 2R92A 2XCOA 1F9NA 1TWGA 1Y1WA 4DDQA 3FOEA 4BKWA 4KARA 1WCMA 4C2MC 1O2AA 2KWAA 3QX3A 3AQPA 3OREA 3BUEA 3AQOA 3OEPA 1O25A 3V4GA 1EH1A 2GSOA 2P5MA 4KMHA 4LR2A 3GTKA 1I50A 1BJTA 4GTDA 4GTBA 3FHZA 1WIHA 1SFOA 1ZBSA 1TWAA 4KB4A 1EK8A 2XCQA 5IOSA 1IS1A 4M1XA 1TWFA 2YU9A 2JA6A 5CHPA 2JA5A 1O27A 4GTCA 2GSNA 1O26A 2NVYA 4GTAA 4G0VA 2B63A 2CFAB 4GTEA 2PHCB 4KB2A 2R93A 2E2IA 1WQGA 1B4AA 5IORA 3MMLB 1DD5A 4P5BA 3GTLA 3LAPA 2Y3PA 4KMDA 4KC6A 4P5AA 4KDDA 4KAWX 2R7ZA 4KMAA 4KM8A 1XXAA 2NVXA 1I3QA 1ISEA 1O29A 3G4AA 1TWCA 4J3NA 5IOQA 3GTMA 4KATA 4GFQA 4FZBA 3AH5A 3CAGA 1KQ4A 1B4BA 1ZXOA 4BLAA 1ZVUA 4KASA 3G4CA 4GTFA 1TWHA 3LPXA 1XXBA 4G0UA 3GTQA 4LQYA 4BLBA 3N3YA 5TJ3A 3N0CA 5EGEA 4C3HC 4FM9A 1O28A 1K83A 3CQZA 5EGHA 4G0WA 3FKIA 1XXCA 2VUMA 4C3IC 3Q3QA 5IOTA 2JH3A 2RGRA 3VA7A 2ZFZA 5CJ9A 5JVOA 5JFEA 1R9TA 3S0XA 1GE9A 4ILDA 3GTPA 3OPFA 3NUHA 3GTGA 2RH6A 3L4JA 4C3JC 3GTJA 1WQFA 1AB4A 1O24A 3ERED 3LAJA 3N0BA 1BGWA 3L4KA 2E2HA 2CFAA 3FOFA 1Y1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTB A;  5IOR A;  4P5B A;  3N3Y A;  1O2B A;  3N0C A;  1O28 A;  4GTL A;  4GT9 A;  4P5A A;  5IOT A;  1O29 A;  3G4A A;  5IOQ A;  4KAR A;  5IOS A;  1O2A A;  4KAT A;  5JFE A;  5CHP A;  4FZB A;  3AH5 A;  1KQ4 A;  1O27 A;  1O25 A;  4GTC A;  1O26 A;  1O24 A;  3N0B A;  4GTA A;  4KAS A;  3G4C A;  4GTF A;  2CFA B;  2CFA A;  4GTE A;  4GTD A; 
#chains in the Genus database with same CATH topology
 2GSU A;  4A3M C;  2A68 A;  1O2B A;  4GTL A;  3AD9 C;  4GT9 A;  1F7U A;  4A3C K;  4BXX K;  1WQH A;  2FQO A;  2GAG C;  2FQT A;  4QIW L;  3H3V L;  1UV7 A;  1DCP A;  1TWA K;  3HOZ K;  4LJZ A;  3QX3 A;  1USM A;  2PPB A;  3BUE A;  3AQO A;  2YU9 K;  1O25 A;  2BE5 A;  2JA6 K;  3PO3 K;  1X31 C;  4OIN A;  1WOP A;  3GTK A;  1XPP A;  3M4O C;  2V6S A;  1J6V A;  2B63 K;  3GTL C;  3JST A;  3CQZ C;  3S1M C;  3A8K A;  3FKI C;  1WOR A;  5M5Y K;  3S1Q C;  3BP8 C;  4OIQ A;  5IYC C;  1VRQ C;  2R7Z K;  4MQ9 A;  5IP9 C;  5M5W K;  4G7H A;  3WOD A;  1I3Q K;  1TWF A;  1R9T C;  1DCH A;  2V6T A;  2JA5 A;  4BY7 K;  4A3L K;  4GTC A;  3S2H C;  2GSN A;  1O26 A;  2NVY A;  4Y7N K;  3A8I A;  4G0V A;  2CFA B;  2PMZ L;  2PHC B;  3S16 C;  5IYD C;  3SZY A;  2E2I A;  3MML B;  1DD5 A;  4G7Z A;  3S1N K;  1DCO A;  3GTL A;  1K83 C;  1YNJ A;  4Y52 K;  3T01 A;  4O2D A;  4WIL A;  2O5I A;  4A93 K;  3ADA C;  4KC6 A;  3GTO C;  4MEX A;  1I6V A;  2NVT K;  4KM8 A;  5TMC A;  2NVX A;  3HOW C;  1WCM C;  3G4A A;  2JA8 K;  1IQ0 A;  2WB1 D;  4FZB A;  3HOY C;  1VGX A;  1ZXO A;  4BLA A;  4X6A C;  3HOX K;  3T02 A;  1JQW A;  3GTG K;  1J98 A;  3GTJ K;  1I6H K;  3GTQ A;  1USO A;  1SMY A;  4XCH A;  4LQY A;  1K83 A;  1Y1V K;  1PJ6 A;  5EGH A;  2PMZ D;  3AD8 C;  3GEE A;  2NVQ C;  3S14 K;  5JVO A;  5L46 A;  5FLM C;  1XZQ B;  4AYB L;  2V6U A;  3GEI A;  3K7A C;  1I50 C;  3ERE D;  3LAJ A;  3N0B A;  3PO2 K;  2WAQ D;  3FOF A;  3GTK K;  2R93 C;  4KM9 A;  3H0G A;  5IP7 K;  3GIR A;  4A3M K;  3S17 C;  2XCR B;  2ZUF A;  1VLO A;  2JA7 A;  4C3H K;  2XCO A;  5C3E K;  3SZZ A;  1TWG A;  1Y1W A;  1TWC C;  4C3I K;  3GTM C;  5C4J C;  4XSZ A;  1O2A A;  2KWA A;  3AQP A;  5C44 K;  4A3G C;  4Q5S A;  1TWF K;  3HOV K;  1EH1 A;  2JA5 K;  1HQM A;  1YCL A;  1I50 A;  3I4M C;  1TWH C;  2NVY K;  1XZP B;  4AYB D;  1WOS A;  1C0A A;  2E2I K;  3GTL K;  4WJ4 A;  5D4D A;  3S15 C;  3HOU K;  1ZYR A;  3T00 A;  3S1Q K;  4OIO A;  4KB4 A;  5IYC K;  2NVX K;  5IOS A;  5IP9 K;  4A3E C;  2EBB A;  4KN7 A;  5CHP A;  1O27 A;  4BBR K;  4C2M K;  2E2H C;  3GSI A;  4A3I C;  4XSX A;  1WSV A;  4GTE A;  4ZH4 A;  1B4A A;  4P5B A;  4BY1 C;  3S16 K;  3GTQ K;  4P5A A;  2VUM C;  1K83 K;  3RZO C;  4KMA A;  1PJ5 A;  1XXA A;  5IYB C;  2WB1 L;  3GTO K;  4BBS K;  1V5V A;  1ISE A;  1O29 A;  5C4X K;  4A3K C;  4MEY A;  3S1R C;  4JK1 A;  1INN A;  1PJ7 A;  3HOY K;  1XZQ A;  4LOW A;  4A3B C;  4KAS A;  4GTF A;  4X6A K;  2CW0 A;  3LPX A;  1XXB A;  1YNN A;  4G7O A;  2W7V A;  4BXX C;  4A3C C;  4BLB A;  4FM9 A;  3CQZ A;  3H0G K;  3FKI A;  1XXC A;  1SFO C;  4G0W A;  2VUM A;  2R92 C;  1TWA C;  4GZY A;  3HOZ C;  2JA7 K;  4NOI A;  3VA7 A;  2YU9 C;  1TWG K;  1Y1W K;  2JA6 C;  3PO3 C;  4P9S A;  5JFE A;  1R9T A;  1GE9 A;  2NVQ K;  2WAQ L;  4C3J C;  1WQF A;  1AB4 A;  1O24 A;  2B63 C;  4A3F K;  3K7A K;  1I50 K;  4A3D C;  4WJ3 M;  1XZP A;  2R7Z C;  5M5X K;  3GEH A;  3I4N C;  3GTO A;  2R92 A;  5M3M K;  4A3J K;  3S17 K;  3S2D K;  4BKW A;  4KAR A;  3RZD C;  1WCM A;  4A3L C;  2E2J K;  2A69 A;  3GTM K;  4Y7N C;  3TFJ A;  3OEP A;  2GAH C;  4KN4 A;  2GSO A;  2P5M A;  4KMH A;  4LR2 A;  3S1N C;  1BJT A;  1F93 A;  4Y52 C;  4A93 C;  4GTB A;  1L0W A;  5E68 A;  2PA8 D;  4AH6 A;  1ZQ1 C;  1WSR A;  3FHZ A;  1ZBS A;  3M3Y C;  3AD7 C;  4C45 A;  2XCQ A;  4PAA A;  1IS1 A;  4M1X A;  4YFX A;  3HOX C;  3GTP C;  3GTG C;  3GTJ C;  5HL8 A;  1I6H C;  1Y1V C;  4OIR A;  4A3I K;  4KB2 A;  2R93 A;  3M4O K;  1G51 A;  2Y0S D;  4BY1 K;  4KDD A;  4KAW X;  1J6W A;  3CQZ K;  3S1M K;  3IPJ A;  3FKI K;  2VUM K;  3RZO K;  3S14 C;  4RMF A;  5FJ8 K;  5IOQ A;  1TWC A;  5IYB K;  3GTM A;  4KAT A;  1RU0 A;  3CAG A;  1HI9 A;  1KQ4 A;  4YFK A;  1B4B A;  4A3K K;  1R9T K;  1ZVU A;  3S1R K;  3GTK C;  4LK1 A;  5TMF A;  3TTG A;  1TWH A;  3S2H K;  1IBA A;  4A3B K;  5IP7 C;  4XLN A;  3N3Y A;  5TJ3 A;  3N0C A;  5EGE A;  4C3H C;  5C3E C;  5IYD K;  4C3I C;  3BP3 A;  1SFO K;  2R92 K;  5IOT A;  2JH3 A;  5C44 C;  2A6E A;  1TWF C;  2P8T A;  5CJ9 A;  3HOV C;  3HOW K;  2JA5 C;  3DXJ A;  1WCM K;  4ILD A;  3HKZ D;  2RH6 A;  3L4J A;  2NVY C;  4C3J K;  2E2H A;  2E2I C;  4Q4Z A;  2A6H A;  3TFH A;  4A3D K;  3HOU C;  1BS2 A;  3GDZ A;  1YX2 A;  3TFI A;  4XLP A;  2NVX C;  1F9N A;  3A8J A;  1BDF A;  3I4N K;  4DDQ A;  3FOE A;  5M3F K;  4BBR C;  4QIW D;  4C2M C;  2ZUE A;  3ORE A;  3H3V D;  3RZD K;  3V4G A;  5FLM K;  2PA8 L;  3GTQ C;  1IE0 A;  4GTD A;  2R93 K;  4BBS C;  1WIH A;  1SFO A;  4LK0 A;  5C4X C;  4KMU A;  1I3Q C;  1TWA A;  1EK8 A;  1EI6 A;  1IL2 A;  3M3Y K;  2YU9 A;  4BY7 C;  1EFW A;  2JA6 A;  1TWC K;  5C4J K;  3GTP K;  4QJV A;  4A3G K;  1J6X A;  4GTA A;  2B63 A;  2Y0S L;  3I4M K;  3H0G C;  1WQG A;  5IOR A;  1TWH K;  3LAP A;  2D6F C;  2Y3P A;  4KMD A;  2NVT C;  2JA7 C;  2R7Z A;  1F7V A;  1TWG C;  1Y1W C;  1I3Q A;  2JA8 C;  3S15 K;  4J3N A;  3HXA A;  1WOO A;  4OIP A;  4GFQ A;  3AH5 A;  4A3F C;  4A3E K;  1JOE A;  1IW7 A;  3G4C A;  4G0U A;  2E2H K;  4LLG A;  1JVI A;  1O28 A;  4A3J C;  3S2D C;  2E2J C;  3Q3Q A;  2RGR A;  3HKZ L;  2ZFZ A;  4YG2 A;  3S0X A;  3GTP A;  3OPF A;  3NUH A;  3GTG A;  1EQR A;  3PO2 C;  4QJV B;  3GTJ A;  3EQL A;  4PAB A;  1VJE A;  4YFN A;  1O2F B;  2O5J A;  1BGW A;  3L4K A;  2CFA A;  1VH2 A;  1Y1V A; 
#chains in the Genus database with same CATH homology
 4KM9 A;  2GSU A;  3H0G A;  1O2B A;  4GTL A;  4GT9 A;  2XCR B;  1WQH A;  2JA7 A;  3GTO A;  2R92 A;  2XCO A;  1F9N A;  1TWG A;  1Y1W A;  4DDQ A;  3FOE A;  4BKW A;  4KAR A;  1WCM A;  4C2M C;  1O2A A;  2KWA A;  3QX3 A;  3AQP A;  3ORE A;  3BUE A;  3AQO A;  3OEP A;  1O25 A;  3V4G A;  1EH1 A;  2GSO A;  2P5M A;  4KMH A;  4LR2 A;  3GTK A;  1I50 A;  1BJT A;  4GTD A;  4GTB A;  3FHZ A;  1WIH A;  1SFO A;  1ZBS A;  1TWA A;  4KB4 A;  1EK8 A;  2XCQ A;  5IOS A;  1IS1 A;  4M1X A;  1TWF A;  2YU9 A;  2JA6 A;  5CHP A;  2JA5 A;  1O27 A;  4GTC A;  2GSN A;  1O26 A;  2NVY A;  4GTA A;  4G0V A;  2B63 A;  2CFA B;  4GTE A;  2PHC B;  4KB2 A;  2R93 A;  2E2I A;  1WQG A;  1B4A A;  5IOR A;  3MML B;  1DD5 A;  4P5B A;  3GTL A;  3LAP A;  2Y3P A;  4KMD A;  4KC6 A;  4P5A A;  4KDD A;  4KAW X;  2R7Z A;  4KMA A;  4KM8 A;  1XXA A;  2NVX A;  1I3Q A;  1ISE A;  1O29 A;  3G4A A;  1TWC A;  4J3N A;  5IOQ A;  3GTM A;  4KAT A;  4GFQ A;  4FZB A;  3AH5 A;  3CAG A;  1KQ4 A;  1B4B A;  1ZXO A;  4BLA A;  1ZVU A;  4KAS A;  3G4C A;  4GTF A;  1TWH A;  3LPX A;  1XXB A;  4G0U A;  3GTQ A;  4LQY A;  4BLB A;  3N3Y A;  5TJ3 A;  3N0C A;  5EGE A;  4C3H C;  4FM9 A;  1O28 A;  1K83 A;  3CQZ A;  5EGH A;  4G0W A;  3FKI A;  1XXC A;  2VUM A;  4C3I C;  3Q3Q A;  5IOT A;  2JH3 A;  2RGR A;  3VA7 A;  2ZFZ A;  5CJ9 A;  5JVO A;  5JFE A;  1R9T A;  3S0X A;  1GE9 A;  4ILD A;  3GTP A;  3OPF A;  3NUH A;  3GTG A;  2RH6 A;  3L4J A;  4C3J C;  3GTJ A;  1WQF A;  1AB4 A;  1O24 A;  3ERE D;  3LAJ A;  3N0B A;  1BGW A;  3L4K A;  2E2H A;  2CFA A;  3FOF A;  1Y1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...