4GTEA

T. maritima fdts (e144r mutant) with fad and folate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
215
Chain Sequence
HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPRRVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 74
structure length 215
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gteA00
4GT9A 5IORA 2CFAB 4GTBA 5CHPA 1O25A 4FZBA 4P5AA 5IOSA 4KARA 4GTFA 3G4CA 3AH5A 3N0CA 4KATA 3G4AA 5IOTA 5JFEA 4GTAA 5IOQA 1O26A 1KQ4A 1O24A 2CFAA 4GTDA 3N0BA 4KASA 1O27A 1O29A 1O28A 1O2AA 4GTEA 4GTCA 1O2BA 4GTLA 4P5BA 3N3YA
chains in the Genus database with same CATH superfamily
4A3EK 3GTGC 2GAGC 4A3GK 4GTBA 4A3MC 1G51A 4G7HA 4YFXA 3AD7C 1F93A 4LJZA 2NVQK 3PO3K 4GTAA 3S1QC 4GZYA 1INNA 2A69A 4BBRK 3GTJA 2JA7K 3GEIA 3BUEA 2PA8D 3AQOA 1SFOC 1Y1WA 4KM8A 3TFHA 1J6XA 3HOWK 3IPJA 3GTMC 3TFIA 4A3GC 1WQGA 1VH2A 1WCMA 3GTMA 1X31C 5IP9K 4GTFA 4KDDA 1WQHA 4KMUA 3Q3QA 1J6VA 3PO3C 3HOVC 3S1RC 1ZVUA 3HKZD 1EFWA 5EGEA 3ADAC 3MMLB 3OPFA 5M5XK 3S16K 1K83C 4GTEA 4KMAA 4WJ4A 3AD9C 3K7AK 3SZZA 4YFKA 1I50A 3FOEA 2E2IK 1IBAA 2WAQD 3HXAA 4A3EC 1ZBSA 3PO2C 4QJVA 4C3IK 4XSXA 3S17K 4BBSC 2P8TA 3GTLK 3NUHA 1TWAA 2BE5A 2Y0SL 2JA8K 2A6EA 1F9NA 5C4JK 3GIRA 4KASA 5IYCK 1O29A 2JA6C 1WOPA 1O28A 1SFOA 2PMZD 1DCOA 3RZDK 1HQMA 3HOWC 1TWCC 2A6HA 3GTMK 1B4AA 1VLOA 2R92K 4C3IC 3S2HC 5IYBK 1DCPA 5M3MK 5IOSA 2V6UA 2ZUFA 3S15C 2XCOA 1SMYA 4G7OA 3HOYC 1BJTA 1IL2A 1I6HK 1KQ4A 2PPBA 1TWAC 4OIRA 2A68A 2CFAA 5HL8A 4KAWX 4LOWA 2R92A 3S1NC 4LK0A 1EH1A 1K83K 5C3EK 1TWGC 1VRQC 1TWHK 3JSTA 5IYBC 1VGXA 5IORA 3K7AC 4BKWA 1XZPB 4XLPA 4C45A 4A3MK 2PA8L 1BDFA 4KB4A 2V6SA 1K83A 4OINA 1V5VA 4A3JK 3AD8C 4BXXC 1EK8A 1XXCA 1I3QA 4O2DA 5TMFA 3S17C 3A8IA 4C2MC 1TWFK 4PABA 2JA8C 3BP3A 5C4JC 1XXBA 3S14C 1ZXOA 2XCRB 2R93A 1WOOA 1PJ6A 1EI6A 1IQ0A 1WOSA 5EGHA 3GTQK 4G0VA 3TTGA 2PMZL 3CAGA 4Y7NK 5M5YK 2KWAA 2VUMK 4A3IK 4C3JC 1TWAK 5CJ9A 5IP7K 1WSRA 1O27A 2NVYK 4GTCA 2E2JC 4KN4A 4A3FC 4OIQA 1TWGK 4G0UA 3GTGA 1RU0A 2WAQL 3GTOK 1VJEA 5CHPA 3SZYA 5JVOA 3GTOA 4P5AA 1ZQ1C 3FKIC 5FLMC 2JA6A 1DCHA 1EQRA 2VUMC 4C3JK 4OIPA 1WCMC 3I4MC 2E2HC 3HOXK 2CW0A 2JH3A 4G0WA 4A3JC 1J6WA 2NVYC 4NOIA 4BXXK 5TMCA 4X6AC 5L46A 2JA7A 5C44K 1ISEA 1JQWA 4A3FK 2GSUA 2JA6K 4GTLA 2NVXC 1WORA 1F7VA 4BLAA 3RZDC 2R7ZK 3BP8C 3S14K 4YG2A 4LK1A 3GTGK 4XSZA 3V4GA 4KC6A 4MEYA 2R92C 3S2HK 1WIHA 3LAJA 3GTQC 3I4NK 1WQFA 4KATA 2E2HA 3GTKC 3HOYK 2VUMA 2XCQA 3S1QK 2P5MA 4GFQA 4FM9A 4WILA 2W7VA 1XPPA 4A3LK 1I6VA 4A3BC 1TWHC 5FJ8K 5C4XK 3GEHA 1F7UA 2GSOA 3GTPA 4AYBD 2O5IA 4A3CK 4RMFA 4BY7C 3H3VL 3LAPA 1TWHA 3GSIA 5IOTA 1TWGA 1WCMK 1L0WA 4Y52C 3HOXC 4AH6A 3OEPA 1TWFC 1USOA 4A3BK 4A3KK 3CQZC 1R9TC 1WSVA 4P5BA 3EQLA 2NVTK 3M4OC 3GTKA 5D4DA 4AYBL 1IW7A 3PO2K 4KMDA 3M3YK 2NVQC 1ZYRA 3H0GC 4KN7A 4BBSK 3T02A 4BY1K 4A3IC 2JA7C 3A8KA 3N0BA 1IS1A 2YU9C 1USMA 2FQOA 4YFNA 4A3LC 2PHCB 4MQ9A 2B63K 3GTOC 1O25A 5C4XC 4KARA 3M3YC 3HOVK 3S15K 2WB1D 3AH5A 4ILDA 4A3CC 3CQZA 1R9TA 1I6HC 1O26A 5M5WK 4LQYA 3GTQA 3FHZA 3GTLA 1YNJA 4GTDA 4X6AK 4QIWD 2RH6A 4QJVB 1TWFA 5C44C 1GE9A 3WODA 2ZUEA 2NVXA 2B63C 4A3KC 3T01A 4GT9A 3GTJK 2CFAB 2E2IA 4Q4ZA 2NVYA 1YCLA 1JVIA 2YU9A 1BS2A 5JFEA 3GTPC 3GTLC 5M3FK 3GEEA 5IYDC 1XZPA 3H0GK 4A3DC 1AB4A 5IYCC 1C0AA 4C2MK 1Y1VC 3S1MC 2O5JA 3N3YA 4ZH4A 4A93C 1JOEA 2Y3PA 4XCHA 4KB2A 3G4CA 3HOUC 3HOZK 1I50K 4Y7NC 3VA7A 1XZQA 2R7ZA 3T00A 5E68A 1I3QK 3L4JA 2GAHC 5IP7C 1SFOK 1BGWA 4C3HC 3S2DC 5C3EC 2E2JK 3CQZK 1R9TK 3M4OK 2NVTC 2D6FC 3A8JA 1DD5A 4A93K 3H3VD 4DDQA 3DXJA 5IP9C 4XLNA 3GTJC 3AQPA 3ERED 2FQTA 1I50C 1Y1VA 3FKIK 4LLGA 5IOQA 3TFJA 2R93K 1PJ5A 4WJ3M 3GTPK 4BY1C 4C3HK 3S2DK 1Y1WK 2JA5C 1O2FB 2ZFZA 2WB1L 2RGRA 4A3DK 1B4BA 2YU9K 1XZQB 2Y0SD 2GSNA 2EBBA 2E2IC 5TJ3A 2R7ZC 4J3NA 3H0GA 1UV7A 4M1XA 4QIWL 4OIOA 3I4NC 3N0CA 3LPXA 4BLBA 2R93C 1YX2A 3GTKK 4Q5SA 3HOUK 4BBRC 1Y1WC 2JA5K 3RZOC 3HOZC 4G7ZA 2JA5A 1PJ7A 3OREA 1HI9A 4KM9A 1I3QC 3L4KA 1IE0A 1TWCK 3HKZL 4KMHA 1TWCA 3QX3A 4FZBA 4JK1A 5FLMK 3S1RK 4BY7K 3G4AA 4P9SA 3FOFA 3I4MK 3RZOK 2E2HK 3S0XA 3S16C 1O24A 2B63A 5IYDK 4Y52K 1J98A 1YNNA 3S1NK 3GDZA 4LR2A 1XXAA 1Y1VK 3FKIA 1O2AA 2V6TA 3S1MK 1O2BA 2NVXK 4MEXA 4PAAA
chains in the Genus database with same CATH topology
5IORA 4BKWA 2GSOA 3GTPA 4GTBA 2Y3PA 4KB2A 3G4CA 3LAPA 4KB4A 1TWHA 1K83A 5IOTA 1TWGA 4GTAA 1EK8A 1XXCA 3VA7A 2R7ZA 1I3QA 3GTJA 3L4JA 4C2MC 3BUEA 1BGWA 3AQOA 3OEPA 4C3HC 1Y1WA 4KM8A 1XXBA 4P5BA 1ZXOA 2XCRB 3GTKA 2R93A 1DD5A 1WQGA 4DDQA 5EGHA 1WCMA 4G0VA 3GTMA 4GTFA 4KDDA 1WQHA 3AQPA 3Q3QA 3ERED 1Y1VA 3CAGA 4KMDA 1ZVUA 5IOQA 2KWAA 5EGEA 4C3JC 3MMLB 3OPFA 5CJ9A 3N0BA 1IS1A 2ZFZA 1O27A 2RGRA 1B4BA 4GTEA 4GTCA 4KMAA 2GSNA 1I50A 5TJ3A 3FOEA 4G0UA 3GTGA 2PHCB 4J3NA 3H0GA 5CHPA 4M1XA 1O25A 5JVOA 3GTOA 4P5AA 1ZBSA 4KARA 2JA6A 3N0CA 3AH5A 4ILDA 3LPXA 4BLBA 3CQZA 1R9TA 1O26A 2JH3A 4LQYA 3NUHA 4G0WA 1TWAA 3GTQA 3FHZA 3GTLA 2JA5A 4GTDA 1F9NA 4KASA 3OREA 2JA7A 1ISEA 1O29A 4KM9A 3L4KA 2RH6A 2GSUA 1O28A 1TWFA 1SFOA 4GTLA 1GE9A 2NVXA 4BLAA 4KMHA 4GT9A 1TWCA 2CFAB 1B4AA 2E2IA 4C3IC 3V4GA 3QX3A 4KC6A 4FZBA 5IOSA 2NVYA 1WIHA 3LAJA 1WQFA 2XCOA 4KATA 2YU9A 2E2HA 3G4AA 1BJTA 3FOFA 5JFEA 2VUMA 1KQ4A 2XCQA 3S0XA 2P5MA 4GFQA 1O24A 4FM9A 2B63A 2CFAA 4KAWX 1AB4A 2R92A 4LR2A 1XXAA 3FKIA 1O2AA 1EH1A 1O2BA 3N3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GT9 A;  5IOR A;  2CFA B;  4GTB A;  5CHP A;  1O25 A;  4FZB A;  4P5A A;  5IOS A;  4KAR A;  4GTF A;  3G4C A;  3AH5 A;  3N0C A;  4KAT A;  3G4A A;  5IOT A;  5JFE A;  4GTA A;  5IOQ A;  1O26 A;  1KQ4 A;  1O24 A;  2CFA A;  4GTD A;  3N0B A;  4KAS A;  1O27 A;  1O29 A;  1O28 A;  1O2A A;  4GTE A;  4GTC A;  1O2B A;  4GTL A;  4P5B A;  3N3Y A; 
#chains in the Genus database with same CATH topology
 4A3E K;  3GTG C;  2GAG C;  4A3G K;  4GTB A;  4A3M C;  1G51 A;  4G7H A;  4YFX A;  3AD7 C;  1F93 A;  4LJZ A;  2NVQ K;  3PO3 K;  4GTA A;  3S1Q C;  4GZY A;  1INN A;  2A69 A;  4BBR K;  3GTJ A;  2JA7 K;  3GEI A;  3BUE A;  2PA8 D;  3AQO A;  1SFO C;  1Y1W A;  4KM8 A;  3TFH A;  1J6X A;  3HOW K;  3IPJ A;  3GTM C;  3TFI A;  4A3G C;  1WQG A;  1VH2 A;  1WCM A;  3GTM A;  1X31 C;  5IP9 K;  4GTF A;  4KDD A;  1WQH A;  4KMU A;  3Q3Q A;  1J6V A;  3PO3 C;  3HOV C;  3S1R C;  1ZVU A;  3HKZ D;  1EFW A;  5EGE A;  3ADA C;  3MML B;  3OPF A;  5M5X K;  3S16 K;  1K83 C;  4GTE A;  4KMA A;  4WJ4 A;  3AD9 C;  3K7A K;  3SZZ A;  4YFK A;  1I50 A;  3FOE A;  2E2I K;  1IBA A;  2WAQ D;  3HXA A;  4A3E C;  1ZBS A;  3PO2 C;  4QJV A;  4C3I K;  4XSX A;  3S17 K;  4BBS C;  2P8T A;  3GTL K;  3NUH A;  1TWA A;  2BE5 A;  2Y0S L;  2JA8 K;  2A6E A;  1F9N A;  5C4J K;  3GIR A;  4KAS A;  5IYC K;  1O29 A;  2JA6 C;  1WOP A;  1O28 A;  1SFO A;  2PMZ D;  1DCO A;  3RZD K;  1HQM A;  3HOW C;  1TWC C;  2A6H A;  3GTM K;  1B4A A;  1VLO A;  2R92 K;  4C3I C;  3S2H C;  5IYB K;  1DCP A;  5M3M K;  5IOS A;  2V6U A;  2ZUF A;  3S15 C;  2XCO A;  1SMY A;  4G7O A;  3HOY C;  1BJT A;  1IL2 A;  1I6H K;  1KQ4 A;  2PPB A;  1TWA C;  4OIR A;  2A68 A;  2CFA A;  5HL8 A;  4KAW X;  4LOW A;  2R92 A;  3S1N C;  4LK0 A;  1EH1 A;  1K83 K;  5C3E K;  1TWG C;  1VRQ C;  1TWH K;  3JST A;  5IYB C;  1VGX A;  5IOR A;  3K7A C;  4BKW A;  1XZP B;  4XLP A;  4C45 A;  4A3M K;  2PA8 L;  1BDF A;  4KB4 A;  2V6S A;  1K83 A;  4OIN A;  1V5V A;  4A3J K;  3AD8 C;  4BXX C;  1EK8 A;  1XXC A;  1I3Q A;  4O2D A;  5TMF A;  3S17 C;  3A8I A;  4C2M C;  1TWF K;  4PAB A;  2JA8 C;  3BP3 A;  5C4J C;  1XXB A;  3S14 C;  1ZXO A;  2XCR B;  2R93 A;  1WOO A;  1PJ6 A;  1EI6 A;  1IQ0 A;  1WOS A;  5EGH A;  3GTQ K;  4G0V A;  3TTG A;  2PMZ L;  3CAG A;  4Y7N K;  5M5Y K;  2KWA A;  2VUM K;  4A3I K;  4C3J C;  1TWA K;  5CJ9 A;  5IP7 K;  1WSR A;  1O27 A;  2NVY K;  4GTC A;  2E2J C;  4KN4 A;  4A3F C;  4OIQ A;  1TWG K;  4G0U A;  3GTG A;  1RU0 A;  2WAQ L;  3GTO K;  1VJE A;  5CHP A;  3SZY A;  5JVO A;  3GTO A;  4P5A A;  1ZQ1 C;  3FKI C;  5FLM C;  2JA6 A;  1DCH A;  1EQR A;  2VUM C;  4C3J K;  4OIP A;  1WCM C;  3I4M C;  2E2H C;  3HOX K;  2CW0 A;  2JH3 A;  4G0W A;  4A3J C;  1J6W A;  2NVY C;  4NOI A;  4BXX K;  5TMC A;  4X6A C;  5L46 A;  2JA7 A;  5C44 K;  1ISE A;  1JQW A;  4A3F K;  2GSU A;  2JA6 K;  4GTL A;  2NVX C;  1WOR A;  1F7V A;  4BLA A;  3RZD C;  2R7Z K;  3BP8 C;  3S14 K;  4YG2 A;  4LK1 A;  3GTG K;  4XSZ A;  3V4G A;  4KC6 A;  4MEY A;  2R92 C;  3S2H K;  1WIH A;  3LAJ A;  3GTQ C;  3I4N K;  1WQF A;  4KAT A;  2E2H A;  3GTK C;  3HOY K;  2VUM A;  2XCQ A;  3S1Q K;  2P5M A;  4GFQ A;  4FM9 A;  4WIL A;  2W7V A;  1XPP A;  4A3L K;  1I6V A;  4A3B C;  1TWH C;  5FJ8 K;  5C4X K;  3GEH A;  1F7U A;  2GSO A;  3GTP A;  4AYB D;  2O5I A;  4A3C K;  4RMF A;  4BY7 C;  3H3V L;  3LAP A;  1TWH A;  3GSI A;  5IOT A;  1TWG A;  1WCM K;  1L0W A;  4Y52 C;  3HOX C;  4AH6 A;  3OEP A;  1TWF C;  1USO A;  4A3B K;  4A3K K;  3CQZ C;  1R9T C;  1WSV A;  4P5B A;  3EQL A;  2NVT K;  3M4O C;  3GTK A;  5D4D A;  4AYB L;  1IW7 A;  3PO2 K;  4KMD A;  3M3Y K;  2NVQ C;  1ZYR A;  3H0G C;  4KN7 A;  4BBS K;  3T02 A;  4BY1 K;  4A3I C;  2JA7 C;  3A8K A;  3N0B A;  1IS1 A;  2YU9 C;  1USM A;  2FQO A;  4YFN A;  4A3L C;  2PHC B;  4MQ9 A;  2B63 K;  3GTO C;  1O25 A;  5C4X C;  4KAR A;  3M3Y C;  3HOV K;  3S15 K;  2WB1 D;  3AH5 A;  4ILD A;  4A3C C;  3CQZ A;  1R9T A;  1I6H C;  1O26 A;  5M5W K;  4LQY A;  3GTQ A;  3FHZ A;  3GTL A;  1YNJ A;  4GTD A;  4X6A K;  4QIW D;  2RH6 A;  4QJV B;  1TWF A;  5C44 C;  1GE9 A;  3WOD A;  2ZUE A;  2NVX A;  2B63 C;  4A3K C;  3T01 A;  4GT9 A;  3GTJ K;  2CFA B;  2E2I A;  4Q4Z A;  2NVY A;  1YCL A;  1JVI A;  2YU9 A;  1BS2 A;  5JFE A;  3GTP C;  3GTL C;  5M3F K;  3GEE A;  5IYD C;  1XZP A;  3H0G K;  4A3D C;  1AB4 A;  5IYC C;  1C0A A;  4C2M K;  1Y1V C;  3S1M C;  2O5J A;  3N3Y A;  4ZH4 A;  4A93 C;  1JOE A;  2Y3P A;  4XCH A;  4KB2 A;  3G4C A;  3HOU C;  3HOZ K;  1I50 K;  4Y7N C;  3VA7 A;  1XZQ A;  2R7Z A;  3T00 A;  5E68 A;  1I3Q K;  3L4J A;  2GAH C;  5IP7 C;  1SFO K;  1BGW A;  4C3H C;  3S2D C;  5C3E C;  2E2J K;  3CQZ K;  1R9T K;  3M4O K;  2NVT C;  2D6F C;  3A8J A;  1DD5 A;  4A93 K;  3H3V D;  4DDQ A;  3DXJ A;  5IP9 C;  4XLN A;  3GTJ C;  3AQP A;  3ERE D;  2FQT A;  1I50 C;  1Y1V A;  3FKI K;  4LLG A;  5IOQ A;  3TFJ A;  2R93 K;  1PJ5 A;  4WJ3 M;  3GTP K;  4BY1 C;  4C3H K;  3S2D K;  1Y1W K;  2JA5 C;  1O2F B;  2ZFZ A;  2WB1 L;  2RGR A;  4A3D K;  1B4B A;  2YU9 K;  1XZQ B;  2Y0S D;  2GSN A;  2EBB A;  2E2I C;  5TJ3 A;  2R7Z C;  4J3N A;  3H0G A;  1UV7 A;  4M1X A;  4QIW L;  4OIO A;  3I4N C;  3N0C A;  3LPX A;  4BLB A;  2R93 C;  1YX2 A;  3GTK K;  4Q5S A;  3HOU K;  4BBR C;  1Y1W C;  2JA5 K;  3RZO C;  3HOZ C;  4G7Z A;  2JA5 A;  1PJ7 A;  3ORE A;  1HI9 A;  4KM9 A;  1I3Q C;  3L4K A;  1IE0 A;  1TWC K;  3HKZ L;  4KMH A;  1TWC A;  3QX3 A;  4FZB A;  4JK1 A;  5FLM K;  3S1R K;  4BY7 K;  3G4A A;  4P9S A;  3FOF A;  3I4M K;  3RZO K;  2E2H K;  3S0X A;  3S16 C;  1O24 A;  2B63 A;  5IYD K;  4Y52 K;  1J98 A;  1YNN A;  3S1N K;  3GDZ A;  4LR2 A;  1XXA A;  1Y1V K;  3FKI A;  1O2A A;  2V6T A;  3S1M K;  1O2B A;  2NVX K;  4MEX A;  4PAA A; 
#chains in the Genus database with same CATH homology
 5IOR A;  4BKW A;  2GSO A;  3GTP A;  4GTB A;  2Y3P A;  4KB2 A;  3G4C A;  3LAP A;  4KB4 A;  1TWH A;  1K83 A;  5IOT A;  1TWG A;  4GTA A;  1EK8 A;  1XXC A;  3VA7 A;  2R7Z A;  1I3Q A;  3GTJ A;  3L4J A;  4C2M C;  3BUE A;  1BGW A;  3AQO A;  3OEP A;  4C3H C;  1Y1W A;  4KM8 A;  1XXB A;  4P5B A;  1ZXO A;  2XCR B;  3GTK A;  2R93 A;  1DD5 A;  1WQG A;  4DDQ A;  5EGH A;  1WCM A;  4G0V A;  3GTM A;  4GTF A;  4KDD A;  1WQH A;  3AQP A;  3Q3Q A;  3ERE D;  1Y1V A;  3CAG A;  4KMD A;  1ZVU A;  5IOQ A;  2KWA A;  5EGE A;  4C3J C;  3MML B;  3OPF A;  5CJ9 A;  3N0B A;  1IS1 A;  2ZFZ A;  1O27 A;  2RGR A;  1B4B A;  4GTE A;  4GTC A;  4KMA A;  2GSN A;  1I50 A;  5TJ3 A;  3FOE A;  4G0U A;  3GTG A;  2PHC B;  4J3N A;  3H0G A;  5CHP A;  4M1X A;  1O25 A;  5JVO A;  3GTO A;  4P5A A;  1ZBS A;  4KAR A;  2JA6 A;  3N0C A;  3AH5 A;  4ILD A;  3LPX A;  4BLB A;  3CQZ A;  1R9T A;  1O26 A;  2JH3 A;  4LQY A;  3NUH A;  4G0W A;  1TWA A;  3GTQ A;  3FHZ A;  3GTL A;  2JA5 A;  4GTD A;  1F9N A;  4KAS A;  3ORE A;  2JA7 A;  1ISE A;  1O29 A;  4KM9 A;  3L4K A;  2RH6 A;  2GSU A;  1O28 A;  1TWF A;  1SFO A;  4GTL A;  1GE9 A;  2NVX A;  4BLA A;  4KMH A;  4GT9 A;  1TWC A;  2CFA B;  1B4A A;  2E2I A;  4C3I C;  3V4G A;  3QX3 A;  4KC6 A;  4FZB A;  5IOS A;  2NVY A;  1WIH A;  3LAJ A;  1WQF A;  2XCO A;  4KAT A;  2YU9 A;  2E2H A;  3G4A A;  1BJT A;  3FOF A;  5JFE A;  2VUM A;  1KQ4 A;  2XCQ A;  3S0X A;  2P5M A;  4GFQ A;  1O24 A;  4FM9 A;  2B63 A;  2CFA A;  4KAW X;  1AB4 A;  2R92 A;  4LR2 A;  1XXA A;  3FKI A;  1O2A A;  1EH1 A;  1O2B A;  3N3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...