4GTEA

T. maritima fdts (e144r mutant) with fad and folate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
215
Chain Sequence
b'HHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPRRVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 74
structure length 215
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gteA00
3N0BA 5IOQA 4KARA 5IOSA 1O29A 5CHPA 4P5AA 4GTDA 4P5BA 4GTAA 5JFEA 4KATA 4FZBA 5IOTA 3N0CA 1O26A 4KASA 2CFAA 2CFAB 1O24A 4GTLA 1O25A 4GTFA 5IORA 4GTEA 4GT9A 1O2BA 1O27A 3AH5A 1O28A 4GTBA 3G4CA 1O2AA 1KQ4A 3N3YA 4GTCA 3G4AA
chains in the Genus database with same CATH superfamily
1WCMA 4KARA 1IE0A 3NUHA 5TMCA 2JA7C 2WB1D 4XSXA 1EFWA 2NVTK 1YNJA 3BUEA 3H0GK 1USMA 1I50A 4GTLA 3GTQC 3S15K 1K83A 2E2IC 3RZDK 2FQOA 3T01A 3V4GA 4LJZA 4A3EK 4O2DA 1TWCA 3HOZK 4KMUA 5C3EK 2JA7A 1WSVA 4P9SA 3OEPA 4BY1K 5D4DA 3FKIC 3I4MC 1XZQA 1IL2A 3HOWK 1YX2A 3K7AK 4BLBA 2E2JC 2KWAA 5TMFA 3HKZL 2E2HC 1HQMA 1IQ0A 3FKIA 3GTKC 1O2BA 3S2DC 2CW0A 4A3LK 3AD9C 3S16K 1WQFA 3Q3QA 1R9TC 1ZQ1C 3GTLA 1SMYA 3S1MC 3S1QK 4BBRC 4A3CK 3S14C 5M5WK 4KM9A 3LAJA 4Q4ZA 5IP7C 3RZOC 2O5IA 5C44C 4G7HA 2NVYK 4J3NA 1WQHA 3T00A 2W7VA 3GDZA 2R93K 4OIRA 1TWGA 2WAQL 3HOXC 4BY7C 5CJ9A 4OIPA 3HOUK 4KMAA 3MMLB 3M4OC 2B63C 4C3JK 3S0XA 1KQ4A 1I3QK 1G51A 1WOSA 3PO3K 3I4NK 4GTCA 3GEIA 1DCHA 4A3BK 1B4BA 4G0VA 5JVOA 4NOIA 2B63A 3H0GC 3AQPA 3S15C 1X31C 4OIQA 1ZXOA 4LOWA 3RZDC 1PJ7A 1JOEA 4A3EC 1VH2A 2JA5K 1O27A 3HOZC 3GTOA 3ADAC 4KDDA 3GTGK 4QJVA 1J6VA 4WJ4A 4BLAA 1JVIA 2GSNA 2PMZL 3HOWC 4Y52K 2GAGC 2PA8L 1XZQB 1IW7A 4ZH4A 3K7AC 2R92K 5CHPA 5L46A 4AYBL 5IYCK 1ZVUA 2A6HA 1SFOK 2CFAA 4LK1A 4A3GK 4LR2A 1TWHC 2D6FC 2NVXA 5TJ3A 2PHCB 1XXAA 3S1RC 5E68A 1O2AA 3S1QC 1AB4A 5IYBK 1TWHA 3N0BA 3TFJA 1ZYRA 4YG2A 4XLPA 4QIWD 2A68A 3IPJA 4KN7A 3GTJK 4ILDA 2V6TA 2R93C 4G0UA 4LQYA 1XZPA 1O26A 2BE5A 4LLGA 2PPBA 3GTMK 1XXBA 4C2MK 4Q5SA 3HOUC 4YFKA 4C3JC 4X6AK 4MQ9A 2R7ZC 3PO3C 2GSUA 1TWFK 1ZBSA 1DCOA 4LK0A 2P5MA 4C3IK 4KB4A 3GTQA 2GAHC 2E2IA 3GEHA 1BS2A 4P5AA 1Y1WC 2R7ZA 1Y1VK 1VJEA 4KMDA 4A3MK 4C3HK 3SZZA 3LPXA 3VA7A 3GTPK 1O28A 3OREA 5C4JK 3L4JA 4QJVB 1Y1WA 1TWAK 1EK8A 4Y52C 1WSRA 3A8IA 2R92C 2E2HA 4PAAA 2VUMK 1I6HC 2ZUFA 3CQZK 5M3FK 2YU9K 3GTKA 5IYCC 2JA6C 1SFOC 3FHZA 4A3GC 2Y0SL 3N0CA 1R9TA 3S1NK 4A3KK 2CFAB 5IP9K 1O24A 4JK1A 5FLMK 4GTFA 2R92A 1WCMK 1VGXA 3GIRA 3HOYK 3G4CA 2JA6A 3EQLA 2JH3A 2Y3PA 1J98A 3N3YA 2WB1L 5IYDK 1I50K 3HOVK 4A3DK 3GTJC 2XCRB 4RMFA 1TWCK 2NVTC 3GTMC 3BP8C 4GTAA 2JA7K 4C2MC 5JFEA 5EGEA 1XZPB 2RH6A 2A6EA 1PJ6A 3HXAA 4OIOA 4A93K 1WOPA 4GFQA 4GTEA 4X6AC 3AQOA 3GTJA 5C3EC 1DD5A 5M5XK 3T02A 1BDFA 3GSIA 1TWFC 4BY1C 4XLNA 2XCQA 2XCOA 3H0GA 4C3IC 1J6XA 4G0WA 1HI9A 4MEYA 1YCLA 1IBAA 2JA8K 1Y1VC 4A3FK 4A3MC 1WIHA 3GTLK 4C3HC 3CAGA 4A3LC 1WOOA 1J6WA 5C4JC 2FQTA 3S16C 1TWAC 3HKZD 1Y1VA 1VRQC 4C45A 4A3CC 3S1MK 3TFHA 2VUMC 3M3YK 4DDQA 4BBSK 3CQZC 1TWGK 1F7UA 5HL8A 5IOSA 5FJ8K 1WQGA 4FM9A 2RGRA 3S1NC 4A3KC 4M1XA 2ZFZA 2NVYC 5IP9C 5FLMC 3AD7C 4KASA 5C4XK 1BGWA 1WCMC 1XPPA 3CQZA 3HOYC 3HOXK 1I3QC 4WJ3M 4A3JK 5IYDC 2NVYA 2WAQD 2B63K 3SZYA 1I50C 3I4NC 2R93A 3HOVC 4A3DC 4KM8A 1GE9A 2V6SA 3A8JA 4A3BC 1TWCC 1EQRA 1V5VA 2NVQK 4GZYA 4YFXA 3GTOK 4GTDA 1I3QA 2A69A 3PO2K 3S17K 4A93C 1B4AA 4Y7NK 4YFNA 2JA5C 1C0AA 4A3IK 3GTGC 1XXCA 4BKWA 1O2FB 4BXXK 2JA8C 1EH1A 4A3FC 2JA5A 5IOQA 1RU0A 2NVXK 3GTGA 1WORA 3GTLC 3GEEA 2PMZD 1INNA 2EBBA 2PA8D 1F93A 2ZUEA 3H3VD 3S2HK 4MEXA 1TWHK 3L4KA 4AYBD 2GSOA 1USOA 5IYBC 3S1RK 1F7VA 3M3YC 4G7ZA 4QIWL 1SFOA 4KN4A 4BBSC 1YNNA 1TWGC 3OPFA 1K83K 3FOEA 4G7OA 3AD8C 3QX3A 1EI6A 5C4XC 4P5BA 3TTGA 1UV7A 4FZBA 5IOTA 3FOFA 5M5YK 4OINA 3ERED 1BJTA 5IORA 1L0WA 3GTQK 4GTBA 4A3JC 2E2IK 2P8TA 2R7ZK 3GTMA 3JSTA 2NVQC 4PABA 3GTOC 3FKIK 1O29A 3I4MK 4XSZA 3TFIA 3PO2C 4KMHA 3BP3A 3S17C 4KATA 4Y7NC 1TWFA 1Y1WK 1JQWA 2E2JK 4A3IC 1O25A 1IS1A 3GTPC 4KC6A 2E2HK 1ISEA 1DCPA 3AH5A 3S2DK 3GTKK 1PJ5A 4BXXC 3DXJA 4KB2A 3WODA 2V6UA 1R9TK 2NVXC 3G4AA 3H3VL 4BBRK 2YU9C 3GTPA 3S14K 1I6HK 3A8KA 2O5JA 1TWAA 5IP7K 3S2HC 3LAPA 2JA6K 3RZOK 4XCHA 4AH6A 5C44K 5M3MK 5EGHA 4KAWX 4GT9A 2VUMA 1I6VA 2YU9A 2Y0SD 1F9NA 4BY7K 1VLOA 4WILA 3M4OK 1K83C
chains in the Genus database with same CATH topology
2JA5A 1WCMA 4KARA 5IOQA 3NUHA 2XCRB 3GTGA 5CHPA 4GTAA 4C2MC 5JFEA 5EGEA 3BUEA 1ZVUA 2RH6A 2CFAA 4LR2A 1I50A 4GTLA 4GTEA 4GFQA 1K83A 2NVXA 3L4KA 3AQOA 3V4GA 3GTJA 1DD5A 2GSOA 5TJ3A 2PHCB 1XXAA 1TWCA 2JA7A 1O2AA 1SFOA 2XCQA 2XCOA 1AB4A 3OEPA 3H0GA 4C3IC 4G0WA 1TWHA 3OPFA 3N0BA 3FOEA 4ILDA 3QX3A 4BLBA 4P5BA 4G0UA 1WIHA 4FZBA 2KWAA 4LQYA 1O26A 4C3HC 5IOTA 3FOFA 3ERED 1XXBA 3CAGA 1BJTA 5IORA 3FKIA 1O2BA 4C3JC 4GTBA 1Y1VA 1WQFA 3Q3QA 2GSUA 3GTLA 3GTMA 1ZBSA 4DDQA 4KM9A 2P5MA 3LAJA 4KB4A 3GTQA 5IOSA 1O29A 2E2IA 1WQGA 4FM9A 2RGRA 4KMHA 4M1XA 4P5AA 2ZFZA 2R7ZA 4KATA 1TWFA 4J3NA 4KASA 1WQHA 4KMDA 1BGWA 1O25A 1IS1A 1TWGA 3CQZA 4KC6A 3LPXA 5CJ9A 3VA7A 1ISEA 3AH5A 1O28A 3OREA 4KMAA 3MMLB 3L4JA 3S0XA 1KQ4A 1Y1WA 4KB2A 2NVYA 1EK8A 2R93A 4KM8A 4GTCA 3G4AA 1GE9A 2E2HA 3GTPA 3GTKA 1B4BA 4G0VA 5JVOA 4GTDA 3FHZA 1TWAA 1I3QA 2B63A 3LAPA 3AQPA 3N0CA 1R9TA 1ZXOA 2CFAB 1B4AA 1O24A 4GTFA 5EGHA 4KAWX 4GT9A 2VUMA 2R92A 2YU9A 1O27A 1F9NA 3GTOA 4KDDA 3G4CA 2JA6A 1XXCA 2JH3A 2Y3PA 4BKWA 3N3YA 4BLAA 2GSNA 1EH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0B A;  5IOQ A;  4KAR A;  5IOS A;  1O29 A;  5CHP A;  4P5A A;  4GTD A;  4P5B A;  4GTA A;  5JFE A;  4KAT A;  4FZB A;  5IOT A;  3N0C A;  1O26 A;  4KAS A;  2CFA A;  2CFA B;  1O24 A;  4GTL A;  1O25 A;  4GTF A;  5IOR A;  4GTE A;  4GT9 A;  1O2B A;  1O27 A;  3AH5 A;  1O28 A;  4GTB A;  3G4C A;  1O2A A;  1KQ4 A;  3N3Y A;  4GTC A;  3G4A A; 
#chains in the Genus database with same CATH topology
 1WCM A;  4KAR A;  1IE0 A;  3NUH A;  5TMC A;  2JA7 C;  2WB1 D;  4XSX A;  1EFW A;  2NVT K;  1YNJ A;  3BUE A;  3H0G K;  1USM A;  1I50 A;  4GTL A;  3GTQ C;  3S15 K;  1K83 A;  2E2I C;  3RZD K;  2FQO A;  3T01 A;  3V4G A;  4LJZ A;  4A3E K;  4O2D A;  1TWC A;  3HOZ K;  4KMU A;  5C3E K;  2JA7 A;  1WSV A;  4P9S A;  3OEP A;  4BY1 K;  5D4D A;  3FKI C;  3I4M C;  1XZQ A;  1IL2 A;  3HOW K;  1YX2 A;  3K7A K;  4BLB A;  2E2J C;  2KWA A;  5TMF A;  3HKZ L;  2E2H C;  1HQM A;  1IQ0 A;  3FKI A;  3GTK C;  1O2B A;  3S2D C;  2CW0 A;  4A3L K;  3AD9 C;  3S16 K;  1WQF A;  3Q3Q A;  1R9T C;  1ZQ1 C;  3GTL A;  1SMY A;  3S1M C;  3S1Q K;  4BBR C;  4A3C K;  3S14 C;  5M5W K;  4KM9 A;  3LAJ A;  4Q4Z A;  5IP7 C;  3RZO C;  2O5I A;  5C44 C;  4G7H A;  2NVY K;  4J3N A;  1WQH A;  3T00 A;  2W7V A;  3GDZ A;  2R93 K;  4OIR A;  1TWG A;  2WAQ L;  3HOX C;  4BY7 C;  5CJ9 A;  4OIP A;  3HOU K;  4KMA A;  3MML B;  3M4O C;  2B63 C;  4C3J K;  3S0X A;  1KQ4 A;  1I3Q K;  1G51 A;  1WOS A;  3PO3 K;  3I4N K;  4GTC A;  3GEI A;  1DCH A;  4A3B K;  1B4B A;  4G0V A;  5JVO A;  4NOI A;  2B63 A;  3H0G C;  3AQP A;  3S15 C;  1X31 C;  4OIQ A;  1ZXO A;  4LOW A;  3RZD C;  1PJ7 A;  1JOE A;  4A3E C;  1VH2 A;  2JA5 K;  1O27 A;  3HOZ C;  3GTO A;  3ADA C;  4KDD A;  3GTG K;  4QJV A;  1J6V A;  4WJ4 A;  4BLA A;  1JVI A;  2GSN A;  2PMZ L;  3HOW C;  4Y52 K;  2GAG C;  2PA8 L;  1XZQ B;  1IW7 A;  4ZH4 A;  3K7A C;  2R92 K;  5CHP A;  5L46 A;  4AYB L;  5IYC K;  1ZVU A;  2A6H A;  1SFO K;  2CFA A;  4LK1 A;  4A3G K;  4LR2 A;  1TWH C;  2D6F C;  2NVX A;  5TJ3 A;  2PHC B;  1XXA A;  3S1R C;  5E68 A;  1O2A A;  3S1Q C;  1AB4 A;  5IYB K;  1TWH A;  3N0B A;  3TFJ A;  1ZYR A;  4YG2 A;  4XLP A;  4QIW D;  2A68 A;  3IPJ A;  4KN7 A;  3GTJ K;  4ILD A;  2V6T A;  2R93 C;  4G0U A;  4LQY A;  1XZP A;  1O26 A;  2BE5 A;  4LLG A;  2PPB A;  3GTM K;  1XXB A;  4C2M K;  4Q5S A;  3HOU C;  4YFK A;  4C3J C;  4X6A K;  4MQ9 A;  2R7Z C;  3PO3 C;  2GSU A;  1TWF K;  1ZBS A;  1DCO A;  4LK0 A;  2P5M A;  4C3I K;  4KB4 A;  3GTQ A;  2GAH C;  2E2I A;  3GEH A;  1BS2 A;  4P5A A;  1Y1W C;  2R7Z A;  1Y1V K;  1VJE A;  4KMD A;  4A3M K;  4C3H K;  3SZZ A;  3LPX A;  3VA7 A;  3GTP K;  1O28 A;  3ORE A;  5C4J K;  3L4J A;  4QJV B;  1Y1W A;  1TWA K;  1EK8 A;  4Y52 C;  1WSR A;  3A8I A;  2R92 C;  2E2H A;  4PAA A;  2VUM K;  1I6H C;  2ZUF A;  3CQZ K;  5M3F K;  2YU9 K;  3GTK A;  5IYC C;  2JA6 C;  1SFO C;  3FHZ A;  4A3G C;  2Y0S L;  3N0C A;  1R9T A;  3S1N K;  4A3K K;  2CFA B;  5IP9 K;  1O24 A;  4JK1 A;  5FLM K;  4GTF A;  2R92 A;  1WCM K;  1VGX A;  3GIR A;  3HOY K;  3G4C A;  2JA6 A;  3EQL A;  2JH3 A;  2Y3P A;  1J98 A;  3N3Y A;  2WB1 L;  5IYD K;  1I50 K;  3HOV K;  4A3D K;  3GTJ C;  2XCR B;  4RMF A;  1TWC K;  2NVT C;  3GTM C;  3BP8 C;  4GTA A;  2JA7 K;  4C2M C;  5JFE A;  5EGE A;  1XZP B;  2RH6 A;  2A6E A;  1PJ6 A;  3HXA A;  4OIO A;  4A93 K;  1WOP A;  4GFQ A;  4GTE A;  4X6A C;  3AQO A;  3GTJ A;  5C3E C;  1DD5 A;  5M5X K;  3T02 A;  1BDF A;  3GSI A;  1TWF C;  4BY1 C;  4XLN A;  2XCQ A;  2XCO A;  3H0G A;  4C3I C;  1J6X A;  4G0W A;  1HI9 A;  4MEY A;  1YCL A;  1IBA A;  2JA8 K;  1Y1V C;  4A3F K;  4A3M C;  1WIH A;  3GTL K;  4C3H C;  3CAG A;  4A3L C;  1WOO A;  1J6W A;  5C4J C;  2FQT A;  3S16 C;  1TWA C;  3HKZ D;  1Y1V A;  1VRQ C;  4C45 A;  4A3C C;  3S1M K;  3TFH A;  2VUM C;  3M3Y K;  4DDQ A;  4BBS K;  3CQZ C;  1TWG K;  1F7U A;  5HL8 A;  5IOS A;  5FJ8 K;  1WQG A;  4FM9 A;  2RGR A;  3S1N C;  4A3K C;  4M1X A;  2ZFZ A;  2NVY C;  5IP9 C;  5FLM C;  3AD7 C;  4KAS A;  5C4X K;  1BGW A;  1WCM C;  1XPP A;  3CQZ A;  3HOY C;  3HOX K;  1I3Q C;  4WJ3 M;  4A3J K;  5IYD C;  2NVY A;  2WAQ D;  2B63 K;  3SZY A;  1I50 C;  3I4N C;  2R93 A;  3HOV C;  4A3D C;  4KM8 A;  1GE9 A;  2V6S A;  3A8J A;  4A3B C;  1TWC C;  1EQR A;  1V5V A;  2NVQ K;  4GZY A;  4YFX A;  3GTO K;  4GTD A;  1I3Q A;  2A69 A;  3PO2 K;  3S17 K;  4A93 C;  1B4A A;  4Y7N K;  4YFN A;  2JA5 C;  1C0A A;  4A3I K;  3GTG C;  1XXC A;  4BKW A;  1O2F B;  4BXX K;  2JA8 C;  1EH1 A;  4A3F C;  2JA5 A;  5IOQ A;  1RU0 A;  2NVX K;  3GTG A;  1WOR A;  3GTL C;  3GEE A;  2PMZ D;  1INN A;  2EBB A;  2PA8 D;  1F93 A;  2ZUE A;  3H3V D;  3S2H K;  4MEX A;  1TWH K;  3L4K A;  4AYB D;  2GSO A;  1USO A;  5IYB C;  3S1R K;  1F7V A;  3M3Y C;  4G7Z A;  4QIW L;  1SFO A;  4KN4 A;  4BBS C;  1YNN A;  1TWG C;  3OPF A;  1K83 K;  3FOE A;  4G7O A;  3AD8 C;  3QX3 A;  1EI6 A;  5C4X C;  4P5B A;  3TTG A;  1UV7 A;  4FZB A;  5IOT A;  3FOF A;  5M5Y K;  4OIN A;  3ERE D;  1BJT A;  5IOR A;  1L0W A;  3GTQ K;  4GTB A;  4A3J C;  2E2I K;  2P8T A;  2R7Z K;  3GTM A;  3JST A;  2NVQ C;  4PAB A;  3GTO C;  3FKI K;  1O29 A;  3I4M K;  4XSZ A;  3TFI A;  3PO2 C;  4KMH A;  3BP3 A;  3S17 C;  4KAT A;  4Y7N C;  1TWF A;  1Y1W K;  1JQW A;  2E2J K;  4A3I C;  1O25 A;  1IS1 A;  3GTP C;  4KC6 A;  2E2H K;  1ISE A;  1DCP A;  3AH5 A;  3S2D K;  3GTK K;  1PJ5 A;  4BXX C;  3DXJ A;  4KB2 A;  3WOD A;  2V6U A;  1R9T K;  2NVX C;  3G4A A;  3H3V L;  4BBR K;  2YU9 C;  3GTP A;  3S14 K;  1I6H K;  3A8K A;  2O5J A;  1TWA A;  5IP7 K;  3S2H C;  3LAP A;  2JA6 K;  3RZO K;  4XCH A;  4AH6 A;  5C44 K;  5M3M K;  5EGH A;  4KAW X;  4GT9 A;  2VUM A;  1I6V A;  2YU9 A;  2Y0S D;  1F9N A;  4BY7 K;  1VLO A;  4WIL A;  3M4O K;  1K83 C; 
#chains in the Genus database with same CATH homology
 2JA5 A;  1WCM A;  4KAR A;  5IOQ A;  3NUH A;  2XCR B;  3GTG A;  5CHP A;  4GTA A;  4C2M C;  5JFE A;  5EGE A;  3BUE A;  1ZVU A;  2RH6 A;  2CFA A;  4LR2 A;  1I50 A;  4GTL A;  4GTE A;  4GFQ A;  1K83 A;  2NVX A;  3L4K A;  3AQO A;  3V4G A;  3GTJ A;  1DD5 A;  2GSO A;  5TJ3 A;  2PHC B;  1XXA A;  1TWC A;  2JA7 A;  1O2A A;  1SFO A;  2XCQ A;  2XCO A;  1AB4 A;  3OEP A;  3H0G A;  4C3I C;  4G0W A;  1TWH A;  3OPF A;  3N0B A;  3FOE A;  4ILD A;  3QX3 A;  4BLB A;  4P5B A;  4G0U A;  1WIH A;  4FZB A;  2KWA A;  4LQY A;  1O26 A;  4C3H C;  5IOT A;  3FOF A;  3ERE D;  1XXB A;  3CAG A;  1BJT A;  5IOR A;  3FKI A;  1O2B A;  4C3J C;  4GTB A;  1Y1V A;  1WQF A;  3Q3Q A;  2GSU A;  3GTL A;  3GTM A;  1ZBS A;  4DDQ A;  4KM9 A;  2P5M A;  3LAJ A;  4KB4 A;  3GTQ A;  5IOS A;  1O29 A;  2E2I A;  1WQG A;  4FM9 A;  2RGR A;  4KMH A;  4M1X A;  4P5A A;  2ZFZ A;  2R7Z A;  4KAT A;  1TWF A;  4J3N A;  4KAS A;  1WQH A;  4KMD A;  1BGW A;  1O25 A;  1IS1 A;  1TWG A;  3CQZ A;  4KC6 A;  3LPX A;  5CJ9 A;  3VA7 A;  1ISE A;  3AH5 A;  1O28 A;  3ORE A;  4KMA A;  3MML B;  3L4J A;  3S0X A;  1KQ4 A;  1Y1W A;  4KB2 A;  2NVY A;  1EK8 A;  2R93 A;  4KM8 A;  4GTC A;  3G4A A;  1GE9 A;  2E2H A;  3GTP A;  3GTK A;  1B4B A;  4G0V A;  5JVO A;  4GTD A;  3FHZ A;  1TWA A;  1I3Q A;  2B63 A;  3LAP A;  3AQP A;  3N0C A;  1R9T A;  1ZXO A;  2CFA B;  1B4A A;  1O24 A;  4GTF A;  5EGH A;  4KAW X;  4GT9 A;  2VUM A;  2R92 A;  2YU9 A;  1O27 A;  1F9N A;  3GTO A;  4KDD A;  3G4C A;  2JA6 A;  1XXC A;  2JH3 A;  2Y3P A;  4BKW A;  3N3Y A;  4BLA A;  2GSN A;  1EH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...