4GTLA

T. maritima fdts (r174k mutant) with fad
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
220
structure length
216
Chain Sequence
HHHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLKADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 74
structure length 216
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtlA00
1O29A 3G4AA 4GTLA 3N3YA 4GTAA 1O2BA 5IOSA 1O26A 4P5BA 4GTEA 5CHPA 4GTDA 5IOTA 1O2AA 3AH5A 1O25A 4GTBA 4GTFA 5IORA 1KQ4A 1O28A 4GTCA 3N0CA 1O27A 5JFEA 4KARA 4KATA 1O24A 4FZBA 2CFAA 2CFAB 4KASA 4P5AA 5IOQA 3G4CA 4GT9A 3N0BA
chains in the Genus database with same CATH superfamily
1IW7A 1G51A 4QJVA 1WQGA 4XLPA 4GTEA 4G7HA 3GTMK 4KC6A 1PJ6A 3S0XA 2R93A 2V6UA 5IORA 3M4OC 3M4OK 3GTGK 1DCOA 3H3VL 4GTCA 2RH6A 1GE9A 4XSZA 1TWCA 5HL8A 3S2DC 3S2DK 3AD8C 5TMCA 3OPFA 3GTOA 1I3QC 3GTQA 2EBBA 2FQOA 4QIWL 3K7AK 1EI6A 4OIOA 1WCMA 3FOEA 1YNJA 3AH5A 3PO2K 1WOOA 1VJEA 4KN7A 3H0GK 3DXJA 2R92A 1XZQA 1TWGA 4X6AK 3PO3K 1XZQB 2NVTK 3HOYC 3GTLA 5C4XK 1PJ7A 4KMHA 1TWFC 1TWFK 1TWHA 3GTPC 3GTPK 3BP8C 4LR2A 1BJTA 3GEEA 4G7ZA 3M3YC 3M3YK 2R93K 2Y0SD 4YG2A 4A3JK 4A3JC 1Y1WC 1Y1WK 4A3LK 4KM9A 5IP7C 5IP7K 2CW0A 2VUMC 2VUMK 3HOVK 1R9TC 4LLGA 3AD7C 4MEXA 3EQLA 5FJ8K 2JA7C 2P8TA 3CQZA 3FOFA 5FLMK 3LAPA 3N0BA 1WCMK 3T00A 3FKIC 3FKIK 3GDZA 1USMA 1EK8A 1J6VA 1WSVA 3GTJK 1F7VA 3GTMA 2PA8D 1O27A 1J6XA 5IYDC 5IYDK 4M1XA 4C3HC 4AH6A 5IOQA 4MQ9A 3GTGA 3G4CA 3G4AA 4BBRC 3I4MC 5C44C 3CAGA 3N3YA 5C44K 5JVOA 4Q4ZA 4GZYA 2GSNA 3ERED 1I6HK 1C0AA 4YFNA 4BY1C 4BY1K 1F9NA 4WJ4A 2JA8K 1EFWA 1K83K 3S2HC 4FM9A 1BS2A 4OIQA 3S14C 3S14K 1JVIA 3L4KA 5JFEA 2ZUFA 3TTGA 4XCHA 1O24A 3GIRA 4KASA 1WQHA 3HOWC 3GTKC 3GTKK 4LK1A 3V4GA 4KN4A 3WODA 1TWFA 3GTPA 5M3MK 3IPJA 3AD9C 3S17C 5IYCC 4G0VA 4AYBL 5M5YK 3BP3A 4OIPA 2E2IC 3HKZD 2E2IK 1Y1WA 5CJ9A 4YFXA 2VUMA 3HXAA 4G7OA 1R9TA 4A93C 1SFOC 4A3CK 4A3CC 4OIRA 4GT9A 3AQOA 2XCOA 1I3QK 2PA8L 4PAAA 1VGXA 2JA7A 4A3FC 4A3FK 1IS1A 3GEIA 1UV7A 3FKIA 1O25A 3HOXC 3HOXK 2WAQL 4BBSC 4BBSK 4Y7NC 4Y7NK 3FHZA 3GTJA 1PJ5A 4C3JC 4ZH4A 4C3JK 1XXAA 2PMZD 1L0WA 3SZYA 2FQTA 3HOYK 3BUEA 2WB1L 4A3DC 2JA6C 2JA5C 2JA5K 4A3DK 5IYBC 5IYBK 1WORA 1DCPA 1V5VA 3RZDC 3RZDK 1Y1VC 1Y1VK 2GSUA 4Y52C 4Y52K 4OINA 1TWAC 1TWAK 4Q5SA 4KMUA 5C4JC 1X31C 4LQYA 4WILA 4BLAA 4GTFA 1KQ4A 1O28A 1R9TK 2YU9K 2YU9C 1YNNA 2P5MA 4KATA 1K83A 3GSIA 2JA7K 2W7VA 2ZUEA 3A8KA 4GTAA 4LOWA 1YCLA 4KMAA 2A6HA 4LK0A 3GTKA 4C45A 3SZZA 1TWCC 1I50C 1I50K 4A3MC 4A3MK 1AB4A 1WOPA 4A3IC 4A3IK 2NVXC 4KARA 3S1RC 3S1RK 1DD5A 4C3HK 2E2IA 2XCRB 2B63C 2B63K 1VH2A 1XXBA 4BBRK 3I4MK 3H3VD 1XXCA 1VLOA 4G0UA 4C2MC 5CHPA 4KM8A 1I3QA 3GTLC 3A8JA 2D6FC 3QX3A 3S2HK 2R7ZC 2R7ZK 4QIWD 3N0CA 1XPPA 2Y0SL 2NVYC 2NVQC 2NVQK 2CFAB 1O2FB 1ZVUA 2XCQA 2GSOA 1ZQ1C 1HI9A 3HOWK 1YX2A 4ILDA 4PABA 2JA6A 2A6EA 2JA5A 3JSTA 4NOIA 5EGHA 2PHCB 2E2HC 1BGWA 5IOTA 4BKWA 3S17K 1Y1VA 5IYCK 1IL2A 4A3KC 4KDDA 1TWAA 3S16C 3S16K 2JH3A 3TFIA 4C3IC 4C3IK 1RU0A 1ZXOA 1I6VA 2A69A 4FZBA 1EH1A 3T02A 3RZOC 1JOEA 4A3GC 4A3GK 1IBAA 2YU9A 4A93K 1SFOK 4O2DA 3I4NC 3I4NK 1IE0A 4QJVB 2GAHC 5IOSA 2V6TA 2ZFZA 3GTMC 1IQ0A 1O2AA 4XSXA 4GTBA 3S15C 1F93A 1VRQC 5TJ3A 5M3FK 3GTGC 3S15K 3LAJA 1I50A 1SMYA 4P5AA 4J3NA 1B4AA 2JA6K 3LPXA 1DCHA 1HQMA 4GTLA 2NVXA 5E68A 4LJZA 3K7AC 1O2BA 1ZYRA 4MEYA 3AQPA 2B63A 3T01A 5L46A 3A8IA 3HOZC 3ADAC 3HOZK 3PO2C 5C4JK 4BXXC 4BXXK 1B4BA 1WOSA 3H0GC 2RGRA 1J6WA 4P9SA 4BLBA 3PO3C 3S1MK 3S1MC 4X6AC 2KWAA 2NVTC 3VA7A 4KB2A 4YFKA 5C4XC 2R7ZA 1INNA 4G0WA 1BDFA 2NVYA 3HKZL 4A3BC 4A3BK 3S1QC 3S1QK 2R93C 4A3LC 5IP9C 5IP9K 5D4DA 2E2JK 2E2JC 3GEHA 1TWCK 3TFHA 2Y3PA 3HOVC 2V6SA 1ZBSA 4RMFA 3GTOC 4JK1A 3GTOK 2GAGC 2E2HA 2A68A 3MMLB 3GTQK 3GTQC 2NVXK 1USOA 5FLMC 4AYBD 1WCMC 1WQFA 4XLNA 1WIHA 1O26A 2PMZL 3GTJC 4BY7C 4BY7K 4WJ3M 4C2MK 1WSRA 2R92K 1F7UA 2PPBA 1SFOA 1TWGC 1TWGK 2R92C 3TFJA 1EQRA 2O5JA 1ISEA 1XZPA 2BE5A 3GTLK 1XZPB 1TWHC 1TWHK 5M5XK 4KB4A 2NVYK 2CFAA 5EGEA 3OREA 1J98A 4DDQA 2WAQD 5C3EC 5C3EK 1O29A 4KMDA 5M5WK 1I6HC 2O5IA 4P5BA 2WB1D 3Q3QA 4KAWX 4GTDA 3NUHA 2JA8C 2E2HK 1K83C 3HOUC 3HOUK 4A3EC 4A3EK 3CQZC 3CQZK 4A3KK 3S1NC 3S1NK 1JQWA 4GFQA 3OEPA 3H0GA 3RZOK 3L4JA 5TMFA
chains in the Genus database with same CATH topology
3G4AA 2NVXA 4GTLA 3CAGA 3N3YA 4GTAA 5JVOA 1O2BA 4KMAA 2GSNA 3ERED 1WQGA 3AQPA 2B63A 4GTEA 3GTKA 1F9NA 4KC6A 3S0XA 2R93A 1B4BA 4FM9A 5IORA 1AB4A 2RGRA 4BLBA 4GTCA 2RH6A 3L4KA 5JFEA 2KWAA 1GE9A 3VA7A 4KARA 1TWCA 1O24A 4KB2A 4KASA 1DD5A 3OPFA 3GTOA 2XCRB 1WQHA 2E2IA 2R7ZA 1XXBA 4G0WA 2NVYA 3GTQA 3V4GA 1XXCA 4G0UA 4C2MC 1TWFA 3GTPA 1WCMA 5CHPA 3FOEA 4KM8A 3AH5A 1I3QA 4G0VA 2Y3PA 1ZBSA 3QX3A 1Y1WA 5CJ9A 2R92A 2E2HA 1TWGA 3N0CA 3MMLB 3GTLA 2VUMA 2CFAB 1ZVUA 4KMHA 1TWHA 2XCQA 2GSOA 1WQFA 1R9TA 4GT9A 1WIHA 3AQOA 4LR2A 2XCOA 1BJTA 4ILDA 2JA6A 2JA5A 1O26A 2JA7A 5EGHA 1IS1A 4KM9A 2PHCB 1BGWA 1SFOA 5IOTA 4BKWA 3FKIA 1O25A 1ISEA 1Y1VA 3FHZA 4KDDA 3GTJA 1TWAA 4C3JC 2JH3A 1XXAA 4C3IC 1ZXOA 4FZBA 1EH1A 4KB4A 2CFAA 3BUEA 5EGEA 3OREA 3CQZA 4DDQA 3FOFA 3LAPA 3N0BA 2YU9A 1O29A 4KMDA 2GSUA 1EK8A 5IOSA 4P5BA 2ZFZA 3Q3QA 4KAWX 4GTDA 3NUHA 1O2AA 4LQYA 4GTBA 4BLAA 4GTFA 5TJ3A 3LAJA 1KQ4A 1O28A 3GTMA 1O27A 2P5MA 4KATA 1I50A 4GFQA 4M1XA 3OEPA 4C3HC 1K83A 4P5AA 4J3NA 3H0GA 5IOQA 1B4AA 3GTGA 3L4JA 3G4CA 3LPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O29 A;  3G4A A;  4GTL A;  3N3Y A;  4GTA A;  1O2B A;  5IOS A;  1O26 A;  4P5B A;  4GTE A;  5CHP A;  4GTD A;  5IOT A;  1O2A A;  3AH5 A;  1O25 A;  4GTB A;  4GTF A;  5IOR A;  1KQ4 A;  1O28 A;  4GTC A;  3N0C A;  1O27 A;  5JFE A;  4KAR A;  4KAT A;  1O24 A;  4FZB A;  2CFA A;  2CFA B;  4KAS A;  4P5A A;  5IOQ A;  3G4C A;  4GT9 A;  3N0B A; 
#chains in the Genus database with same CATH topology
 1IW7 A;  1G51 A;  4QJV A;  1WQG A;  4XLP A;  4GTE A;  4G7H A;  3GTM K;  4KC6 A;  1PJ6 A;  3S0X A;  2R93 A;  2V6U A;  5IOR A;  3M4O C;  3M4O K;  3GTG K;  1DCO A;  3H3V L;  4GTC A;  2RH6 A;  1GE9 A;  4XSZ A;  1TWC A;  5HL8 A;  3S2D C;  3S2D K;  3AD8 C;  5TMC A;  3OPF A;  3GTO A;  1I3Q C;  3GTQ A;  2EBB A;  2FQO A;  4QIW L;  3K7A K;  1EI6 A;  4OIO A;  1WCM A;  3FOE A;  1YNJ A;  3AH5 A;  3PO2 K;  1WOO A;  1VJE A;  4KN7 A;  3H0G K;  3DXJ A;  2R92 A;  1XZQ A;  1TWG A;  4X6A K;  3PO3 K;  1XZQ B;  2NVT K;  3HOY C;  3GTL A;  5C4X K;  1PJ7 A;  4KMH A;  1TWF C;  1TWF K;  1TWH A;  3GTP C;  3GTP K;  3BP8 C;  4LR2 A;  1BJT A;  3GEE A;  4G7Z A;  3M3Y C;  3M3Y K;  2R93 K;  2Y0S D;  4YG2 A;  4A3J K;  4A3J C;  1Y1W C;  1Y1W K;  4A3L K;  4KM9 A;  5IP7 C;  5IP7 K;  2CW0 A;  2VUM C;  2VUM K;  3HOV K;  1R9T C;  4LLG A;  3AD7 C;  4MEX A;  3EQL A;  5FJ8 K;  2JA7 C;  2P8T A;  3CQZ A;  3FOF A;  5FLM K;  3LAP A;  3N0B A;  1WCM K;  3T00 A;  3FKI C;  3FKI K;  3GDZ A;  1USM A;  1EK8 A;  1J6V A;  1WSV A;  3GTJ K;  1F7V A;  3GTM A;  2PA8 D;  1O27 A;  1J6X A;  5IYD C;  5IYD K;  4M1X A;  4C3H C;  4AH6 A;  5IOQ A;  4MQ9 A;  3GTG A;  3G4C A;  3G4A A;  4BBR C;  3I4M C;  5C44 C;  3CAG A;  3N3Y A;  5C44 K;  5JVO A;  4Q4Z A;  4GZY A;  2GSN A;  3ERE D;  1I6H K;  1C0A A;  4YFN A;  4BY1 C;  4BY1 K;  1F9N A;  4WJ4 A;  2JA8 K;  1EFW A;  1K83 K;  3S2H C;  4FM9 A;  1BS2 A;  4OIQ A;  3S14 C;  3S14 K;  1JVI A;  3L4K A;  5JFE A;  2ZUF A;  3TTG A;  4XCH A;  1O24 A;  3GIR A;  4KAS A;  1WQH A;  3HOW C;  3GTK C;  3GTK K;  4LK1 A;  3V4G A;  4KN4 A;  3WOD A;  1TWF A;  3GTP A;  5M3M K;  3IPJ A;  3AD9 C;  3S17 C;  5IYC C;  4G0V A;  4AYB L;  5M5Y K;  3BP3 A;  4OIP A;  2E2I C;  3HKZ D;  2E2I K;  1Y1W A;  5CJ9 A;  4YFX A;  2VUM A;  3HXA A;  4G7O A;  1R9T A;  4A93 C;  1SFO C;  4A3C K;  4A3C C;  4OIR A;  4GT9 A;  3AQO A;  2XCO A;  1I3Q K;  2PA8 L;  4PAA A;  1VGX A;  2JA7 A;  4A3F C;  4A3F K;  1IS1 A;  3GEI A;  1UV7 A;  3FKI A;  1O25 A;  3HOX C;  3HOX K;  2WAQ L;  4BBS C;  4BBS K;  4Y7N C;  4Y7N K;  3FHZ A;  3GTJ A;  1PJ5 A;  4C3J C;  4ZH4 A;  4C3J K;  1XXA A;  2PMZ D;  1L0W A;  3SZY A;  2FQT A;  3HOY K;  3BUE A;  2WB1 L;  4A3D C;  2JA6 C;  2JA5 C;  2JA5 K;  4A3D K;  5IYB C;  5IYB K;  1WOR A;  1DCP A;  1V5V A;  3RZD C;  3RZD K;  1Y1V C;  1Y1V K;  2GSU A;  4Y52 C;  4Y52 K;  4OIN A;  1TWA C;  1TWA K;  4Q5S A;  4KMU A;  5C4J C;  1X31 C;  4LQY A;  4WIL A;  4BLA A;  4GTF A;  1KQ4 A;  1O28 A;  1R9T K;  2YU9 K;  2YU9 C;  1YNN A;  2P5M A;  4KAT A;  1K83 A;  3GSI A;  2JA7 K;  2W7V A;  2ZUE A;  3A8K A;  4GTA A;  4LOW A;  1YCL A;  4KMA A;  2A6H A;  4LK0 A;  3GTK A;  4C45 A;  3SZZ A;  1TWC C;  1I50 C;  1I50 K;  4A3M C;  4A3M K;  1AB4 A;  1WOP A;  4A3I C;  4A3I K;  2NVX C;  4KAR A;  3S1R C;  3S1R K;  1DD5 A;  4C3H K;  2E2I A;  2XCR B;  2B63 C;  2B63 K;  1VH2 A;  1XXB A;  4BBR K;  3I4M K;  3H3V D;  1XXC A;  1VLO A;  4G0U A;  4C2M C;  5CHP A;  4KM8 A;  1I3Q A;  3GTL C;  3A8J A;  2D6F C;  3QX3 A;  3S2H K;  2R7Z C;  2R7Z K;  4QIW D;  3N0C A;  1XPP A;  2Y0S L;  2NVY C;  2NVQ C;  2NVQ K;  2CFA B;  1O2F B;  1ZVU A;  2XCQ A;  2GSO A;  1ZQ1 C;  1HI9 A;  3HOW K;  1YX2 A;  4ILD A;  4PAB A;  2JA6 A;  2A6E A;  2JA5 A;  3JST A;  4NOI A;  5EGH A;  2PHC B;  2E2H C;  1BGW A;  5IOT A;  4BKW A;  3S17 K;  1Y1V A;  5IYC K;  1IL2 A;  4A3K C;  4KDD A;  1TWA A;  3S16 C;  3S16 K;  2JH3 A;  3TFI A;  4C3I C;  4C3I K;  1RU0 A;  1ZXO A;  1I6V A;  2A69 A;  4FZB A;  1EH1 A;  3T02 A;  3RZO C;  1JOE A;  4A3G C;  4A3G K;  1IBA A;  2YU9 A;  4A93 K;  1SFO K;  4O2D A;  3I4N C;  3I4N K;  1IE0 A;  4QJV B;  2GAH C;  5IOS A;  2V6T A;  2ZFZ A;  3GTM C;  1IQ0 A;  1O2A A;  4XSX A;  4GTB A;  3S15 C;  1F93 A;  1VRQ C;  5TJ3 A;  5M3F K;  3GTG C;  3S15 K;  3LAJ A;  1I50 A;  1SMY A;  4P5A A;  4J3N A;  1B4A A;  2JA6 K;  3LPX A;  1DCH A;  1HQM A;  4GTL A;  2NVX A;  5E68 A;  4LJZ A;  3K7A C;  1O2B A;  1ZYR A;  4MEY A;  3AQP A;  2B63 A;  3T01 A;  5L46 A;  3A8I A;  3HOZ C;  3ADA C;  3HOZ K;  3PO2 C;  5C4J K;  4BXX C;  4BXX K;  1B4B A;  1WOS A;  3H0G C;  2RGR A;  1J6W A;  4P9S A;  4BLB A;  3PO3 C;  3S1M K;  3S1M C;  4X6A C;  2KWA A;  2NVT C;  3VA7 A;  4KB2 A;  4YFK A;  5C4X C;  2R7Z A;  1INN A;  4G0W A;  1BDF A;  2NVY A;  3HKZ L;  4A3B C;  4A3B K;  3S1Q C;  3S1Q K;  2R93 C;  4A3L C;  5IP9 C;  5IP9 K;  5D4D A;  2E2J K;  2E2J C;  3GEH A;  1TWC K;  3TFH A;  2Y3P A;  3HOV C;  2V6S A;  1ZBS A;  4RMF A;  3GTO C;  4JK1 A;  3GTO K;  2GAG C;  2E2H A;  2A68 A;  3MML B;  3GTQ K;  3GTQ C;  2NVX K;  1USO A;  5FLM C;  4AYB D;  1WCM C;  1WQF A;  4XLN A;  1WIH A;  1O26 A;  2PMZ L;  3GTJ C;  4BY7 C;  4BY7 K;  4WJ3 M;  4C2M K;  1WSR A;  2R92 K;  1F7U A;  2PPB A;  1SFO A;  1TWG C;  1TWG K;  2R92 C;  3TFJ A;  1EQR A;  2O5J A;  1ISE A;  1XZP A;  2BE5 A;  3GTL K;  1XZP B;  1TWH C;  1TWH K;  5M5X K;  4KB4 A;  2NVY K;  2CFA A;  5EGE A;  3ORE A;  1J98 A;  4DDQ A;  2WAQ D;  5C3E C;  5C3E K;  1O29 A;  4KMD A;  5M5W K;  1I6H C;  2O5I A;  4P5B A;  2WB1 D;  3Q3Q A;  4KAW X;  4GTD A;  3NUH A;  2JA8 C;  2E2H K;  1K83 C;  3HOU C;  3HOU K;  4A3E C;  4A3E K;  3CQZ C;  3CQZ K;  4A3K K;  3S1N C;  3S1N K;  1JQW A;  4GFQ A;  3OEP A;  3H0G A;  3RZO K;  3L4J A;  5TMF A; 
#chains in the Genus database with same CATH homology
 3G4A A;  2NVX A;  4GTL A;  3CAG A;  3N3Y A;  4GTA A;  5JVO A;  1O2B A;  4KMA A;  2GSN A;  3ERE D;  1WQG A;  3AQP A;  2B63 A;  4GTE A;  3GTK A;  1F9N A;  4KC6 A;  3S0X A;  2R93 A;  1B4B A;  4FM9 A;  5IOR A;  1AB4 A;  2RGR A;  4BLB A;  4GTC A;  2RH6 A;  3L4K A;  5JFE A;  2KWA A;  1GE9 A;  3VA7 A;  4KAR A;  1TWC A;  1O24 A;  4KB2 A;  4KAS A;  1DD5 A;  3OPF A;  3GTO A;  2XCR B;  1WQH A;  2E2I A;  2R7Z A;  1XXB A;  4G0W A;  2NVY A;  3GTQ A;  3V4G A;  1XXC A;  4G0U A;  4C2M C;  1TWF A;  3GTP A;  1WCM A;  5CHP A;  3FOE A;  4KM8 A;  3AH5 A;  1I3Q A;  4G0V A;  2Y3P A;  1ZBS A;  3QX3 A;  1Y1W A;  5CJ9 A;  2R92 A;  2E2H A;  1TWG A;  3N0C A;  3MML B;  3GTL A;  2VUM A;  2CFA B;  1ZVU A;  4KMH A;  1TWH A;  2XCQ A;  2GSO A;  1WQF A;  1R9T A;  4GT9 A;  1WIH A;  3AQO A;  4LR2 A;  2XCO A;  1BJT A;  4ILD A;  2JA6 A;  2JA5 A;  1O26 A;  2JA7 A;  5EGH A;  1IS1 A;  4KM9 A;  2PHC B;  1BGW A;  1SFO A;  5IOT A;  4BKW A;  3FKI A;  1O25 A;  1ISE A;  1Y1V A;  3FHZ A;  4KDD A;  3GTJ A;  1TWA A;  4C3J C;  2JH3 A;  1XXA A;  4C3I C;  1ZXO A;  4FZB A;  1EH1 A;  4KB4 A;  2CFA A;  3BUE A;  5EGE A;  3ORE A;  3CQZ A;  4DDQ A;  3FOF A;  3LAP A;  3N0B A;  2YU9 A;  1O29 A;  4KMD A;  2GSU A;  1EK8 A;  5IOS A;  4P5B A;  2ZFZ A;  3Q3Q A;  4KAW X;  4GTD A;  3NUH A;  1O2A A;  4LQY A;  4GTB A;  4BLA A;  4GTF A;  5TJ3 A;  3LAJ A;  1KQ4 A;  1O28 A;  3GTM A;  1O27 A;  2P5M A;  4KAT A;  1I50 A;  4GFQ A;  4M1X A;  3OEP A;  4C3H C;  1K83 A;  4P5A A;  4J3N A;  3H0G A;  5IOQ A;  1B4A A;  3GTG A;  3L4J A;  3G4C A;  3LPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...