4GTLA

T. maritima fdts (r174k mutant) with fad
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
220
structure length
216
Chain Sequence
HHHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLKADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 74
structure length 216
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtlA00
2CFAB 1O2BA 4GTLA 3G4AA 1O2AA 4GTCA 3N3YA 4GTBA 4GT9A 4KASA 4KATA 5IORA 5IOQA 1KQ4A 5CHPA 1O25A 3G4CA 1O24A 4FZBA 3N0CA 1O29A 4GTDA 4GTAA 4KARA 4P5BA 2CFAA 1O28A 3AH5A 4GTEA 4GTFA 5IOSA 5JFEA 5IOTA 3N0BA 1O26A 1O27A 4P5AA
chains in the Genus database with same CATH superfamily
3M3YC 4G0VA 2YU9C 4XLPA 2V6TA 3S15K 2JA6A 3S1RC 4C3IK 4LLGA 1UV7A 2B63C 1XZPB 1O29A 1ZVUA 3HOZC 1EK8A 3S14K 2EBBA 1R9TK 3PO3C 2GSOA 3FOEA 3GTQA 4Q5SA 4BXXC 2CFAB 4KMDA 1TWCA 1I3QA 3HOUK 3AQPA 5IYBK 3OREA 3SZYA 2V6SA 3T00A 4A3DK 3S1MC 3HOVK 3RZOK 1YCLA 2VUMK 3GTOC 3GTGC 1VGXA 1TWGK 4FM9A 1K83K 2B63K 2JA7K 3BP3A 1TWAC 2P5MA 3GTQK 3N0BA 2NVXC 1TWHC 4J3NA 1I50C 2WAQD 3S1NK 2E2HA 1I6HK 4OIQA 2GSNA 2E2IC 2E2JC 1V5VA 3HOWK 4XLNA 4PABA 2NVTC 1XXAA 2JA5K 1BJTA 3T02A 1K83A 1ZBSA 3ADAC 4KDDA 3GTOK 3S1MK 1TWAK 4M1XA 3HOXK 5C3EC 4KB4A 1IBAA 4G0WA 4XCHA 2B63A 1X31C 4GTBA 3S2HK 2E2JK 2E2IK 3GTJK 4PAAA 5L46A 4KM9A 5IYDC 3Q3QA 1HQMA 1DD5A 1XZQA 1YNJA 2CFAA 1R9TA 3GTQC 1VJEA 3WODA 2NVYK 4MEYA 3QX3A 3LPXA 4Y7NC 3GTLK 3S0XA 4KMHA 1Y1VK 1I50K 3AD9C 3CQZA 3GTPK 4O2DA 3A8KA 4G0UA 4Q4ZA 1Y1WA 2A69A 2ZFZA 3I4NK 1B4BA 4YFXA 1SMYA 3S2DK 1O28A 1TWGA 5EGHA 5TMFA 1WCMA 5IOTA 3HOUC 3M4OC 4YFNA 1VLOA 1B4AA 3N3YA 3H0GC 4BBSK 3I4MC 1BDFA 1KQ4A 2A68A 3GTGK 1IW7A 3GTGA 1G51A 3S1RK 4BKWA 3H0GK 2R93A 3AD8C 1ZXOA 4A3KK 1WQHA 5C44K 1ISEA 2V6UA 4A3DC 2E2HC 4A3CK 2A6HA 3GEHA 3S2DC 2XCOA 1O27A 4P5AA 4YFKA 1WCMC 4A3LK 3GTJC 5M5XK 2P8TA 5C44C 4BXXK 5IYDK 4NOIA 5M3FK 4LOWA 4KASA 4QIWL 4QJVB 3GEEA 1TWCC 4XSZA 4AYBD 3TFJA 2A6EA 4LK1A 3FHZA 3A8JA 1O2FB 4KARA 1HI9A 1XPPA 4ILDA 3TTGA 4GZYA 4G7OA 5E68A 3SZZA 2W7VA 4GFQA 1IQ0A 1WQGA 4A3MC 5M5WK 3GTPC 3H3VD 4DDQA 3GTLC 1RU0A 2R92A 4A3IC 5M3MK 5C4XC 3S17C 4RMFA 4GT9A 4BBRK 5IOQA 5IP7K 1O25A 3EQLA 1R9TC 2WAQL 3GTKK 4FZBA 3K7AK 2PMZL 4MQ9A 1I6HC 4A93K 3FOFA 3LAPA 3RZOC 2Y0SD 3GEIA 3HOYK 1YX2A 2FQOA 2GSUA 3GTMA 5CJ9A 2YU9A 3GDZA 4A3JC 3RZDC 1SFOK 1K83C 4A93C 2FQTA 4WJ4A 3FKIA 3HOYC 3GIRA 4X6AK 4JK1A 1EI6A 5TMCA 2NVYC 3HOWC 5C4JC 3A8IA 4BBRC 1C0AA 3AQOA 5IYCC 2E2HK 2D6FC 2XCRB 1IS1A 4KMAA 5D4DA 3L4KA 2R7ZA 4P9SA 4A3MK 3S2HC 4AYBL 1TWHK 3H0GA 1DCHA 4G7ZA 3L4JA 3GTMC 1BGWA 3GTKA 1WOPA 2Y0SL 3IPJA 2NVQK 1WSVA 3PO2K 3ERED 5M5YK 1JOEA 3HOVC 3FKIC 5EGEA 3TFHA 4XSXA 3GTMK 1INNA 2JA5C 1J98A 3M3YK 1EH1A 2R93K 2PA8L 4A3CC 3AD7C 4BY7K 1IE0A 4KN7A 1WCMK 3S16K 3S17K 1JVIA 4LR2A 3BP8C 4Y52C 4GTFA 2BE5A 3S14C 3NUHA 4C2MC 2WB1D 5C4XK 1ZYRA 1DCOA 3OPFA 4A3FC 3GTOA 4OIPA 1YNNA 4A3GC 4GTCA 3VA7A 3LAJA 3MMLB 1BS2A 4WILA 4A3FK 3I4MK 1F7VA 2O5IA 3GTPA 2JA6K 1F93A 2ZUFA 4C3HK 3AH5A 4A3BC 3S1QK 2RGRA 5FJ8K 2KWAA 4C3JC 1XXBA 4KN4A 1TWFC 2GAHC 4A3LC 3I4NC 4BY1K 1SFOA 3PO2C 3GTJA 2RH6A 3H3VL 3TFIA 1ZQ1C 1J6WA 3OEPA 2VUMC 4ZH4A 1VH2A 5JVOA 1WORA 4C45A 3HKZD 3GTKC 4LK0A 2PMZD 4QIWD 4BLAA 3S15C 2O5JA 3S1NC 1F9NA 4WJ3M 1L0WA 3G4AA 1WOSA 4A3EC 4A3IK 2R7ZC 5CHPA 2R93C 1TWGC 3CQZC 3GSIA 2JA8K 4BY7C 4GTAA 4C3HC 2JA6C 4KC6A 3S1QC 2Y3PA 4KAWX 3DXJA 5IP9K 1Y1WC 1I50A 5FLMC 1Y1VA 3FKIK 1JQWA 1PJ6A 3RZDK 1WIHA 1O26A 1F7UA 4Y7NK 4OIRA 1VRQC 1Y1VC 4C3JK 1AB4A 1O2AA 4QJVA 2YU9K 3JSTA 2WB1L 4A3EK 5IP7C 1USOA 5HL8A 1TWAA 4LQYA 3T01A 2NVXK 5IYCK 4P5BA 4BLBA 4KM8A 5C3EK 3CAGA 1WSRA 3HOZK 4C3IC 2PPBA 2PHCB 1EFWA 3BUEA 1IL2A 5IP9C 2XCQA 1EQRA 1Y1WK 4BY1C 1O2BA 4KMUA 5FLMK 3HKZL 4OIOA 1TWHA 2NVQC 5IORA 4KATA 4LJZA 1XXCA 3CQZK 2JA8C 3K7AC 3G4CA 2R7ZK 1O24A 3N0CA 4GTDA 3GTLA 2JA5A 2R92C 1USMA 1PJ7A 2NVTK 3PO3K 1I6VA 1PJ5A 1WQFA 2JA7A 5C4JK 3HXAA 4MEXA 5JFEA 2CW0A 2NVYA 1GE9A 3V4GA 5TJ3A 4X6AC 4A3KC 4GTLA 2NVXA 2JA7C 1WOOA 4G7HA 3HOXC 2ZUEA 4OINA 2JH3A 1XZPA 4BBSC 2VUMA 1TWFA 4A3GK 1TWFK 1J6XA 2E2IA 4A3JK 1SFOC 1XZQB 5IYBC 1DCPA 3S16C 4YG2A 1I3QK 4AH6A 1TWCK 2R92K 4C2MK 4GTEA 5IOSA 1J6VA 4A3BK 3M4OK 2PA8D 4Y52K 4KB2A 2GAGC 1I3QC
chains in the Genus database with same CATH topology
1F9NA 4G0VA 3G4AA 3CQZA 2JA6A 5CHPA 4G0UA 1Y1WA 2ZFZA 3AQOA 1B4BA 1O29A 2XCRB 1IS1A 4KMAA 1ZVUA 4GTAA 4C3HC 3L4KA 4KC6A 2R7ZA 2Y3PA 1O28A 1EK8A 4KAWX 1TWGA 5EGHA 1I50A 1WCMA 1Y1VA 5IOTA 3H0GA 2GSOA 3FOEA 3L4JA 1WIHA 1O26A 3GTQA 1BGWA 3GTKA 2CFAB 4KMDA 1AB4A 1O2AA 1TWCA 3ERED 1B4AA 3N3YA 5EGEA 1I3QA 3AQPA 1KQ4A 1EH1A 3OREA 3GTGA 4BKWA 1TWAA 4LQYA 2R93A 1ZXOA 4P5BA 4BLBA 4KM8A 3CAGA 4LR2A 1WQHA 1ISEA 4C3IC 4FM9A 2PHCB 4GTFA 2P5MA 3NUHA 3N0BA 4C2MC 3BUEA 4J3NA 2XCOA 1O27A 4P5AA 3OPFA 3GTOA 2XCQA 1O2BA 4GTCA 3VA7A 2E2HA 2GSNA 1TWHA 4KASA 5IORA 4KATA 3LAJA 1XXCA 3MMLB 1XXAA 3G4CA 1O24A 3FHZA 3N0CA 1BJTA 3GTPA 4GTDA 3GTLA 2JA5A 4KARA 4ILDA 1K83A 4GFQA 1ZBSA 3AH5A 1WQGA 4KDDA 2RGRA 1WQFA 4DDQA 2JA7A 2R92A 4M1XA 2KWAA 2NVYA 5JFEA 1GE9A 3V4GA 5TJ3A 4C3JC 1XXBA 4KB4A 4GTLA 2NVXA 4G0WA 1SFOA 2B63A 3GTJA 4GTBA 4GT9A 2RH6A 2JH3A 5IOQA 2VUMA 1O25A 1TWFA 4FZBA 2E2IA 4KM9A 3Q3QA 3FOFA 3LAPA 1DD5A 3OEPA 2CFAA 1R9TA 5JVOA 2GSUA 3GTMA 5CJ9A 4GTEA 5IOSA 2YU9A 4KB2A 3QX3A 3LPXA 4BLAA 3FKIA 3S0XA 4KMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFA B;  1O2B A;  4GTL A;  3G4A A;  1O2A A;  4GTC A;  3N3Y A;  4GTB A;  4GT9 A;  4KAS A;  4KAT A;  5IOR A;  5IOQ A;  1KQ4 A;  5CHP A;  1O25 A;  3G4C A;  1O24 A;  4FZB A;  3N0C A;  1O29 A;  4GTD A;  4GTA A;  4KAR A;  4P5B A;  2CFA A;  1O28 A;  3AH5 A;  4GTE A;  4GTF A;  5IOS A;  5JFE A;  5IOT A;  3N0B A;  1O26 A;  1O27 A;  4P5A A; 
#chains in the Genus database with same CATH topology
 3M3Y C;  4G0V A;  2YU9 C;  4XLP A;  2V6T A;  3S15 K;  2JA6 A;  3S1R C;  4C3I K;  4LLG A;  1UV7 A;  2B63 C;  1XZP B;  1O29 A;  1ZVU A;  3HOZ C;  1EK8 A;  3S14 K;  2EBB A;  1R9T K;  3PO3 C;  2GSO A;  3FOE A;  3GTQ A;  4Q5S A;  4BXX C;  2CFA B;  4KMD A;  1TWC A;  1I3Q A;  3HOU K;  3AQP A;  5IYB K;  3ORE A;  3SZY A;  2V6S A;  3T00 A;  4A3D K;  3S1M C;  3HOV K;  3RZO K;  1YCL A;  2VUM K;  3GTO C;  3GTG C;  1VGX A;  1TWG K;  4FM9 A;  1K83 K;  2B63 K;  2JA7 K;  3BP3 A;  1TWA C;  2P5M A;  3GTQ K;  3N0B A;  2NVX C;  1TWH C;  4J3N A;  1I50 C;  2WAQ D;  3S1N K;  2E2H A;  1I6H K;  4OIQ A;  2GSN A;  2E2I C;  2E2J C;  1V5V A;  3HOW K;  4XLN A;  4PAB A;  2NVT C;  1XXA A;  2JA5 K;  1BJT A;  3T02 A;  1K83 A;  1ZBS A;  3ADA C;  4KDD A;  3GTO K;  3S1M K;  1TWA K;  4M1X A;  3HOX K;  5C3E C;  4KB4 A;  1IBA A;  4G0W A;  4XCH A;  2B63 A;  1X31 C;  4GTB A;  3S2H K;  2E2J K;  2E2I K;  3GTJ K;  4PAA A;  5L46 A;  4KM9 A;  5IYD C;  3Q3Q A;  1HQM A;  1DD5 A;  1XZQ A;  1YNJ A;  2CFA A;  1R9T A;  3GTQ C;  1VJE A;  3WOD A;  2NVY K;  4MEY A;  3QX3 A;  3LPX A;  4Y7N C;  3GTL K;  3S0X A;  4KMH A;  1Y1V K;  1I50 K;  3AD9 C;  3CQZ A;  3GTP K;  4O2D A;  3A8K A;  4G0U A;  4Q4Z A;  1Y1W A;  2A69 A;  2ZFZ A;  3I4N K;  1B4B A;  4YFX A;  1SMY A;  3S2D K;  1O28 A;  1TWG A;  5EGH A;  5TMF A;  1WCM A;  5IOT A;  3HOU C;  3M4O C;  4YFN A;  1VLO A;  1B4A A;  3N3Y A;  3H0G C;  4BBS K;  3I4M C;  1BDF A;  1KQ4 A;  2A68 A;  3GTG K;  1IW7 A;  3GTG A;  1G51 A;  3S1R K;  4BKW A;  3H0G K;  2R93 A;  3AD8 C;  1ZXO A;  4A3K K;  1WQH A;  5C44 K;  1ISE A;  2V6U A;  4A3D C;  2E2H C;  4A3C K;  2A6H A;  3GEH A;  3S2D C;  2XCO A;  1O27 A;  4P5A A;  4YFK A;  1WCM C;  4A3L K;  3GTJ C;  5M5X K;  2P8T A;  5C44 C;  4BXX K;  5IYD K;  4NOI A;  5M3F K;  4LOW A;  4KAS A;  4QIW L;  4QJV B;  3GEE A;  1TWC C;  4XSZ A;  4AYB D;  3TFJ A;  2A6E A;  4LK1 A;  3FHZ A;  3A8J A;  1O2F B;  4KAR A;  1HI9 A;  1XPP A;  4ILD A;  3TTG A;  4GZY A;  4G7O A;  5E68 A;  3SZZ A;  2W7V A;  4GFQ A;  1IQ0 A;  1WQG A;  4A3M C;  5M5W K;  3GTP C;  3H3V D;  4DDQ A;  3GTL C;  1RU0 A;  2R92 A;  4A3I C;  5M3M K;  5C4X C;  3S17 C;  4RMF A;  4GT9 A;  4BBR K;  5IOQ A;  5IP7 K;  1O25 A;  3EQL A;  1R9T C;  2WAQ L;  3GTK K;  4FZB A;  3K7A K;  2PMZ L;  4MQ9 A;  1I6H C;  4A93 K;  3FOF A;  3LAP A;  3RZO C;  2Y0S D;  3GEI A;  3HOY K;  1YX2 A;  2FQO A;  2GSU A;  3GTM A;  5CJ9 A;  2YU9 A;  3GDZ A;  4A3J C;  3RZD C;  1SFO K;  1K83 C;  4A93 C;  2FQT A;  4WJ4 A;  3FKI A;  3HOY C;  3GIR A;  4X6A K;  4JK1 A;  1EI6 A;  5TMC A;  2NVY C;  3HOW C;  5C4J C;  3A8I A;  4BBR C;  1C0A A;  3AQO A;  5IYC C;  2E2H K;  2D6F C;  2XCR B;  1IS1 A;  4KMA A;  5D4D A;  3L4K A;  2R7Z A;  4P9S A;  4A3M K;  3S2H C;  4AYB L;  1TWH K;  3H0G A;  1DCH A;  4G7Z A;  3L4J A;  3GTM C;  1BGW A;  3GTK A;  1WOP A;  2Y0S L;  3IPJ A;  2NVQ K;  1WSV A;  3PO2 K;  3ERE D;  5M5Y K;  1JOE A;  3HOV C;  3FKI C;  5EGE A;  3TFH A;  4XSX A;  3GTM K;  1INN A;  2JA5 C;  1J98 A;  3M3Y K;  1EH1 A;  2R93 K;  2PA8 L;  4A3C C;  3AD7 C;  4BY7 K;  1IE0 A;  4KN7 A;  1WCM K;  3S16 K;  3S17 K;  1JVI A;  4LR2 A;  3BP8 C;  4Y52 C;  4GTF A;  2BE5 A;  3S14 C;  3NUH A;  4C2M C;  2WB1 D;  5C4X K;  1ZYR A;  1DCO A;  3OPF A;  4A3F C;  3GTO A;  4OIP A;  1YNN A;  4A3G C;  4GTC A;  3VA7 A;  3LAJ A;  3MML B;  1BS2 A;  4WIL A;  4A3F K;  3I4M K;  1F7V A;  2O5I A;  3GTP A;  2JA6 K;  1F93 A;  2ZUF A;  4C3H K;  3AH5 A;  4A3B C;  3S1Q K;  2RGR A;  5FJ8 K;  2KWA A;  4C3J C;  1XXB A;  4KN4 A;  1TWF C;  2GAH C;  4A3L C;  3I4N C;  4BY1 K;  1SFO A;  3PO2 C;  3GTJ A;  2RH6 A;  3H3V L;  3TFI A;  1ZQ1 C;  1J6W A;  3OEP A;  2VUM C;  4ZH4 A;  1VH2 A;  5JVO A;  1WOR A;  4C45 A;  3HKZ D;  3GTK C;  4LK0 A;  2PMZ D;  4QIW D;  4BLA A;  3S15 C;  2O5J A;  3S1N C;  1F9N A;  4WJ3 M;  1L0W A;  3G4A A;  1WOS A;  4A3E C;  4A3I K;  2R7Z C;  5CHP A;  2R93 C;  1TWG C;  3CQZ C;  3GSI A;  2JA8 K;  4BY7 C;  4GTA A;  4C3H C;  2JA6 C;  4KC6 A;  3S1Q C;  2Y3P A;  4KAW X;  3DXJ A;  5IP9 K;  1Y1W C;  1I50 A;  5FLM C;  1Y1V A;  3FKI K;  1JQW A;  1PJ6 A;  3RZD K;  1WIH A;  1O26 A;  1F7U A;  4Y7N K;  4OIR A;  1VRQ C;  1Y1V C;  4C3J K;  1AB4 A;  1O2A A;  4QJV A;  2YU9 K;  3JST A;  2WB1 L;  4A3E K;  5IP7 C;  1USO A;  5HL8 A;  1TWA A;  4LQY A;  3T01 A;  2NVX K;  5IYC K;  4P5B A;  4BLB A;  4KM8 A;  5C3E K;  3CAG A;  1WSR A;  3HOZ K;  4C3I C;  2PPB A;  2PHC B;  1EFW A;  3BUE A;  1IL2 A;  5IP9 C;  2XCQ A;  1EQR A;  1Y1W K;  4BY1 C;  1O2B A;  4KMU A;  5FLM K;  3HKZ L;  4OIO A;  1TWH A;  2NVQ C;  5IOR A;  4KAT A;  4LJZ A;  1XXC A;  3CQZ K;  2JA8 C;  3K7A C;  3G4C A;  2R7Z K;  1O24 A;  3N0C A;  4GTD A;  3GTL A;  2JA5 A;  2R92 C;  1USM A;  1PJ7 A;  2NVT K;  3PO3 K;  1I6V A;  1PJ5 A;  1WQF A;  2JA7 A;  5C4J K;  3HXA A;  4MEX A;  5JFE A;  2CW0 A;  2NVY A;  1GE9 A;  3V4G A;  5TJ3 A;  4X6A C;  4A3K C;  4GTL A;  2NVX A;  2JA7 C;  1WOO A;  4G7H A;  3HOX C;  2ZUE A;  4OIN A;  2JH3 A;  1XZP A;  4BBS C;  2VUM A;  1TWF A;  4A3G K;  1TWF K;  1J6X A;  2E2I A;  4A3J K;  1SFO C;  1XZQ B;  5IYB C;  1DCP A;  3S16 C;  4YG2 A;  1I3Q K;  4AH6 A;  1TWC K;  2R92 K;  4C2M K;  4GTE A;  5IOS A;  1J6V A;  4A3B K;  3M4O K;  2PA8 D;  4Y52 K;  4KB2 A;  2GAG C;  1I3Q C; 
#chains in the Genus database with same CATH homology
 1F9N A;  4G0V A;  3G4A A;  3CQZ A;  2JA6 A;  5CHP A;  4G0U A;  1Y1W A;  2ZFZ A;  3AQO A;  1B4B A;  1O29 A;  2XCR B;  1IS1 A;  4KMA A;  1ZVU A;  4GTA A;  4C3H C;  3L4K A;  4KC6 A;  2R7Z A;  2Y3P A;  1O28 A;  1EK8 A;  4KAW X;  1TWG A;  5EGH A;  1I50 A;  1WCM A;  1Y1V A;  5IOT A;  3H0G A;  2GSO A;  3FOE A;  3L4J A;  1WIH A;  1O26 A;  3GTQ A;  1BGW A;  3GTK A;  2CFA B;  4KMD A;  1AB4 A;  1O2A A;  1TWC A;  3ERE D;  1B4A A;  3N3Y A;  5EGE A;  1I3Q A;  3AQP A;  1KQ4 A;  1EH1 A;  3ORE A;  3GTG A;  4BKW A;  1TWA A;  4LQY A;  2R93 A;  1ZXO A;  4P5B A;  4BLB A;  4KM8 A;  3CAG A;  4LR2 A;  1WQH A;  1ISE A;  4C3I C;  4FM9 A;  2PHC B;  4GTF A;  2P5M A;  3NUH A;  3N0B A;  4C2M C;  3BUE A;  4J3N A;  2XCO A;  1O27 A;  4P5A A;  3OPF A;  3GTO A;  2XCQ A;  1O2B A;  4GTC A;  3VA7 A;  2E2H A;  2GSN A;  1TWH A;  4KAS A;  5IOR A;  4KAT A;  3LAJ A;  1XXC A;  3MML B;  1XXA A;  3G4C A;  1O24 A;  3FHZ A;  3N0C A;  1BJT A;  3GTP A;  4GTD A;  3GTL A;  2JA5 A;  4KAR A;  4ILD A;  1K83 A;  4GFQ A;  1ZBS A;  3AH5 A;  1WQG A;  4KDD A;  2RGR A;  1WQF A;  4DDQ A;  2JA7 A;  2R92 A;  4M1X A;  2KWA A;  2NVY A;  5JFE A;  1GE9 A;  3V4G A;  5TJ3 A;  4C3J C;  1XXB A;  4KB4 A;  4GTL A;  2NVX A;  4G0W A;  1SFO A;  2B63 A;  3GTJ A;  4GTB A;  4GT9 A;  2RH6 A;  2JH3 A;  5IOQ A;  2VUM A;  1O25 A;  1TWF A;  4FZB A;  2E2I A;  4KM9 A;  3Q3Q A;  3FOF A;  3LAP A;  1DD5 A;  3OEP A;  2CFA A;  1R9T A;  5JVO A;  2GSU A;  3GTM A;  5CJ9 A;  4GTE A;  5IOS A;  2YU9 A;  4KB2 A;  3QX3 A;  3LPX A;  4BLA A;  3FKI A;  3S0X A;  4KMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...