4GTLA

T. maritima fdts (r174k mutant) with fad
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
220
structure length
216
Chain Sequence
HHHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLKADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Thymidylate synthase thyX
total genus 74
structure length 216
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtlA00
4GTCA 4GTFA 5IOTA 1O29A 4P5AA 5IOQA 3G4AA 4KARA 1O27A 3AH5A 1O24A 1O28A 4GTAA 1O26A 5IORA 4GT9A 3G4CA 4FZBA 5JFEA 4GTEA 2CFAB 4GTBA 4GTDA 4GTLA 4KATA 3N3YA 5CHPA 1O25A 3N0BA 1KQ4A 1O2AA 4KASA 1O2BA 3N0CA 5IOSA 4P5BA 2CFAA
chains in the Genus database with same CATH superfamily
4GTCA 4A3LK 3GTKA 4A93C 1O27A 1EQRA 1YCLA 2NVXK 3PO2C 1YNJA 5JVOA 3FHZA 1VRQC 3RZDC 1B4BA 3S16K 2RGRA 2P8TA 4KMDA 1F7UA 3S1MK 1DCPA 2A6HA 4OINA 3S15C 1BDFA 5IYBK 1I50A 5IP9C 1DCHA 2R93C 2NVXC 3GTGC 3K7AC 3H0GK 1EI6A 4YFXA 3GTKC 4A3DK 3HOZC 3FKIK 1TWFK 1YX2A 4P9SA 2V6UA 4A3KK 3GSIA 1I6HK 1HI9A 1B4AA 5IYDK 2GSNA 4DDQA 2NVYA 4Q4ZA 1VLOA 1AB4A 5EGEA 5TMCA 4C3HC 3OEPA 5C4JC 4KM9A 4BXXC 5D4DA 1VGXA 3A8KA 4LR2A 3S0XA 3HOYC 1J98A 1ZBSA 3CQZA 3HOVC 2B63C 4A3LC 4A3FC 2W7VA 4GTFA 1R9TA 4A3MK 4KMHA 1V5VA 3AH5A 3GTMA 5FLMK 3Q3QA 5C4XK 2E2HC 2NVXA 2ZUEA 4A3BC 3S2DC 2JA6C 3L4KA 1JOEA 4QIWL 3GTJK 3L4JA 1WQFA 2JH3A 4Y52K 1XPPA 2V6TA 3AQPA 2E2HA 3N0BA 2R93K 1TWGC 3S14K 1O2AA 5TJ3A 3GTJC 5C3EK 4KC6A 4C3JK 1R9TC 5C44K 2A69A 4GZYA 3ERED 4A3CK 1J6XA 1TWHC 5IP7K 2GSUA 1Y1WC 4G7HA 4LLGA 2A6EA 2XCRB 5C44C 3M4OC 5C3EC 4GTDA 1EFWA 3FOFA 3DXJA 1TWGA 3AD8C 4LOWA 1WOSA 3K7AK 2E2IA 4Q5SA 3HOWC 1KQ4A 4BY7K 1DD5A 1SFOC 1I3QA 4YFKA 4X6AC 4A3IK 5IOTA 3LAPA 3T01A 3V4GA 2JA7K 4XSZA 4A3BK 1Y1VA 3GTMC 1XZPB 4A3GK 5CJ9A 3A8IA 3G4CA 3S2HK 3HOZK 1TWCK 1VJEA 2JA7A 4A3JC 2FQTA 4Y52C 3GIRA 3T02A 1JQWA 1I50K 1WORA 2B63A 2XCOA 2PA8L 3H3VD 2GAGC 4AYBD 3GTJA 4G7OA 1K83C 3LAJA 3AD9C 4QIWD 2E2JC 1BS2A 4BY1K 1ZXOA 2PMZD 3TFHA 2R92C 2JA6A 1O28A 5M5XK 3GTGA 3QX3A 1TWFC 3CAGA 3FKIC 2GSOA 3CQZK 3LPXA 4GTBA 1F9NA 4BBSC 2NVQC 3HOUC 3BP3A 3MMLB 2Y0SL 4A3EC 4G7ZA 1XZPA 4G0WA 1IW7A 4XLNA 3CQZC 1IBAA 5IYBC 4P5BA 1IQ0A 2WAQL 2YU9A 3RZOK 3GTQK 3H0GC 3WODA 4WILA 1O24A 3RZDK 2Y3PA 3AD7C 1X31C 3TTGA 4WJ3M 5HL8A 4WJ4A 3I4NC 4KN4A 4PAAA 1F7VA 5M3MK 2VUMA 1WSRA 1Y1WK 1TWCA 3GTPA 4C3HK 4A93K 3PO2K 1TWFA 3BP8C 2E2JK 4BY1C 2EBBA 4XLPA 2WB1D 3S14C 3GTLC 4C3JC 4OIPA 5FJ8K 2NVTK 1XZQB 2XCQA 2E2IK 4LQYA 2YU9K 3GTGK 3S1QC 1TWHA 2FQOA 2JA6K 3HXAA 1SMYA 3HOYK 4J3NA 1WSVA 1I6HC 5IOSA 1SFOA 4MQ9A 2JA5C 4Y7NC 1WCMK 2A68A 1IE0A 4KAWX 1O26A 4C2MK 1JVIA 4PABA 2BE5A 5EGHA 1K83K 1USOA 1TWHK 4M1XA 4XSXA 4BBRK 3I4NK 1VH2A 4A3EK 5IYCC 3N3YA 1F93A 1TWCC 4A3JK 3T00A 3N0CA 3GTQC 1XXAA 3H0GA 2NVQK 1XZQA 1XXCA 3S2DK 3HOXC 4BBRC 3SZYA 3S1RC 1PJ6A 5L46A 4C3IC 4OIQA 5M5YK 1UV7A 3S17C 1WQGA 4G0VA 4KB4A 3FKIA 1USMA 4GTLA 4KMUA 3GTPC 4A3FK 1R9TK 2PA8D 4QJVB 4BKWA 3TFIA 1IL2A 1GE9A 2Y0SD 1I3QC 4LJZA 4Y7NK 2JA5K 1DCOA 4P5AA 5M3FK 3HKZD 4YFNA 1K83A 2D6FC 1O2FB 3A8JA 4A3KC 1WOPA 4KB2A 3HKZL 1WCMA 4FZBA 5JFEA 3GTOC 2NVYK 3I4MC 4ILDA 3HOWK 1G51A 1TWAC 3SZZA 5IYCK 3GTLA 2RH6A 5IP9K 4BBSK 3GEHA 1J6WA 3S1NK 5C4JK 3HOXK 3S1RK 3GTOK 2JA7C 4BLBA 5IOQA 2R7ZA 2R92A 4C2MC 2P5MA 2B63K 3OPFA 4YG2A 4A3MC 4LK0A 4KMAA 1EK8A 4GFQA 4QJVA 4BY7C 4GTEA 3S1NC 4JK1A 2JA5A 1PJ7A 4AYBL 1I50C 1WOOA 3GTKK 4A3DC 4KDDA 5CHPA 3OREA 4MEYA 1Y1VK 4KASA 1O2BA 3GTMK 3S1QK 4O2DA 1WQHA 2YU9C 1BGWA 4C3IK 1J6VA 4BLAA 1O29A 1HQMA 3S17K 1TWAA 1EH1A 1ZVUA 2PHCB 4XCHA 3I4MK 2WB1L 1ZYRA 3M3YK 1TWAK 2NVTC 1I3QK 1PJ5A 2JA8C 4OIOA 2O5IA 2R92K 5FLMC 4G0UA 2WAQD 1XXBA 1L0WA 3GEIA 2R93A 4BXXK 3GEEA 2CFAB 1WIHA 2PPBA 2R7ZK 1BJTA 3H3VL 1O25A 1Y1VC 3S15K 4MEXA 5IP7C 2E2HK 4AH6A 3VA7A 4A3CC 5C4XC 3GTLK 3HOUK 4KM8A 2CFAA 4FM9A 4KN7A 5M5WK 3M4OK 1INNA 3G4AA 4A3IC 3IPJA 4C45A 4NOIA 3TFJA 3PO3C 3AQOA 5IORA 2PMZL 4LK1A 3JSTA 3S16C 3EQLA 5E68A 1ZQ1C 3S1MC 2JA8K 5TMFA 3GTPK 1Y1WA 2O5JA 3NUHA 3PO3K 3GTQA 1WCMC 1YNNA 2ZUFA 2VUMK 3GTOA 1RU0A 2GAHC 3HOVK 4A3GC 2CW0A 2V6SA 4KARA 5IYDC 3RZOC 3S2HC 4RMFA 4GTAA 4GT9A 1TWGK 3ADAC 1C0AA 3BUEA 2VUMC 3FOEA 1I6VA 2KWAA 1SFOK 2ZFZA 4ZH4A 1ISEA 4X6AK 2R7ZC 4OIRA 4KATA 2NVYC 2E2IC 1IS1A 3GDZA 3M3YC
chains in the Genus database with same CATH topology
4GTCA 5IOTA 3LAPA 3GTKA 4BLAA 1O29A 1TWAA 1O27A 3V4GA 1EH1A 1ZVUA 4KAWX 1Y1VA 5JVOA 3FHZA 1O26A 5CJ9A 2PHCB 3G4CA 5EGHA 1B4BA 4M1XA 2RGRA 2JA7A 4KMDA 3N3YA 1I50A 2B63A 2XCOA 3N0CA 3GTJA 1XXAA 4G0UA 3H0GA 3LAJA 1XXBA 1XXCA 1ZXOA 4C3IC 1B4AA 2JA6A 2GSNA 1O28A 4DDQA 2R93A 2NVYA 3GTGA 3QX3A 1WQGA 3CAGA 4G0VA 1AB4A 4KB4A 3FKIA 2GSOA 5EGEA 2CFAB 1WIHA 3LPXA 1F9NA 4GTBA 4GTLA 1BJTA 3OEPA 4C3HC 4KM9A 3MMLB 1O25A 4LR2A 4BKWA 3S0XA 1GE9A 4G0WA 1ZBSA 3VA7A 3CQZA 4P5BA 4KM8A 2CFAA 2YU9A 4FM9A 4GTFA 1R9TA 4P5AA 1K83A 3G4AA 4KMHA 3AH5A 1O24A 3GTMA 2Y3PA 3Q3QA 2NVXA 4KB2A 3AQOA 5IORA 3L4KA 1WCMA 4FZBA 5JFEA 3L4JA 1WQFA 2JH3A 4ILDA 2VUMA 3AQPA 2E2HA 3GTPA 1TWCA 3N0BA 3GTLA 2RH6A 1Y1WA 1O2AA 3NUHA 5TJ3A 3GTQA 3GTOA 4KC6A 1TWFA 4BLBA 3ERED 5IOQA 2R7ZA 2R92A 4KARA 4C2MC 2P5MA 4GTAA 3OPFA 2GSUA 4C3JC 4GT9A 4KMAA 2XCRB 1EK8A 2XCQA 4GFQA 4GTEA 3BUEA 4LQYA 3FOEA 2KWAA 4GTDA 2ZFZA 2JA5A 1ISEA 3FOFA 1TWHA 4KDDA 1TWGA 4KATA 5CHPA 2E2IA 1KQ4A 3OREA 4J3NA 1DD5A 4KASA 1O2BA 1I3QA 5IOSA 1SFOA 1IS1A 1WQHA 1BGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTC A;  4GTF A;  5IOT A;  1O29 A;  4P5A A;  5IOQ A;  3G4A A;  4KAR A;  1O27 A;  3AH5 A;  1O24 A;  1O28 A;  4GTA A;  1O26 A;  5IOR A;  4GT9 A;  3G4C A;  4FZB A;  5JFE A;  4GTE A;  2CFA B;  4GTB A;  4GTD A;  4GTL A;  4KAT A;  3N3Y A;  5CHP A;  1O25 A;  3N0B A;  1KQ4 A;  1O2A A;  4KAS A;  1O2B A;  3N0C A;  5IOS A;  4P5B A;  2CFA A; 
#chains in the Genus database with same CATH topology
 4GTC A;  4A3L K;  3GTK A;  4A93 C;  1O27 A;  1EQR A;  1YCL A;  2NVX K;  3PO2 C;  1YNJ A;  5JVO A;  3FHZ A;  1VRQ C;  3RZD C;  1B4B A;  3S16 K;  2RGR A;  2P8T A;  4KMD A;  1F7U A;  3S1M K;  1DCP A;  2A6H A;  4OIN A;  3S15 C;  1BDF A;  5IYB K;  1I50 A;  5IP9 C;  1DCH A;  2R93 C;  2NVX C;  3GTG C;  3K7A C;  3H0G K;  1EI6 A;  4YFX A;  3GTK C;  4A3D K;  3HOZ C;  3FKI K;  1TWF K;  1YX2 A;  4P9S A;  2V6U A;  4A3K K;  3GSI A;  1I6H K;  1HI9 A;  1B4A A;  5IYD K;  2GSN A;  4DDQ A;  2NVY A;  4Q4Z A;  1VLO A;  1AB4 A;  5EGE A;  5TMC A;  4C3H C;  3OEP A;  5C4J C;  4KM9 A;  4BXX C;  5D4D A;  1VGX A;  3A8K A;  4LR2 A;  3S0X A;  3HOY C;  1J98 A;  1ZBS A;  3CQZ A;  3HOV C;  2B63 C;  4A3L C;  4A3F C;  2W7V A;  4GTF A;  1R9T A;  4A3M K;  4KMH A;  1V5V A;  3AH5 A;  3GTM A;  5FLM K;  3Q3Q A;  5C4X K;  2E2H C;  2NVX A;  2ZUE A;  4A3B C;  3S2D C;  2JA6 C;  3L4K A;  1JOE A;  4QIW L;  3GTJ K;  3L4J A;  1WQF A;  2JH3 A;  4Y52 K;  1XPP A;  2V6T A;  3AQP A;  2E2H A;  3N0B A;  2R93 K;  1TWG C;  3S14 K;  1O2A A;  5TJ3 A;  3GTJ C;  5C3E K;  4KC6 A;  4C3J K;  1R9T C;  5C44 K;  2A69 A;  4GZY A;  3ERE D;  4A3C K;  1J6X A;  1TWH C;  5IP7 K;  2GSU A;  1Y1W C;  4G7H A;  4LLG A;  2A6E A;  2XCR B;  5C44 C;  3M4O C;  5C3E C;  4GTD A;  1EFW A;  3FOF A;  3DXJ A;  1TWG A;  3AD8 C;  4LOW A;  1WOS A;  3K7A K;  2E2I A;  4Q5S A;  3HOW C;  1KQ4 A;  4BY7 K;  1DD5 A;  1SFO C;  1I3Q A;  4YFK A;  4X6A C;  4A3I K;  5IOT A;  3LAP A;  3T01 A;  3V4G A;  2JA7 K;  4XSZ A;  4A3B K;  1Y1V A;  3GTM C;  1XZP B;  4A3G K;  5CJ9 A;  3A8I A;  3G4C A;  3S2H K;  3HOZ K;  1TWC K;  1VJE A;  2JA7 A;  4A3J C;  2FQT A;  4Y52 C;  3GIR A;  3T02 A;  1JQW A;  1I50 K;  1WOR A;  2B63 A;  2XCO A;  2PA8 L;  3H3V D;  2GAG C;  4AYB D;  3GTJ A;  4G7O A;  1K83 C;  3LAJ A;  3AD9 C;  4QIW D;  2E2J C;  1BS2 A;  4BY1 K;  1ZXO A;  2PMZ D;  3TFH A;  2R92 C;  2JA6 A;  1O28 A;  5M5X K;  3GTG A;  3QX3 A;  1TWF C;  3CAG A;  3FKI C;  2GSO A;  3CQZ K;  3LPX A;  4GTB A;  1F9N A;  4BBS C;  2NVQ C;  3HOU C;  3BP3 A;  3MML B;  2Y0S L;  4A3E C;  4G7Z A;  1XZP A;  4G0W A;  1IW7 A;  4XLN A;  3CQZ C;  1IBA A;  5IYB C;  4P5B A;  1IQ0 A;  2WAQ L;  2YU9 A;  3RZO K;  3GTQ K;  3H0G C;  3WOD A;  4WIL A;  1O24 A;  3RZD K;  2Y3P A;  3AD7 C;  1X31 C;  3TTG A;  4WJ3 M;  5HL8 A;  4WJ4 A;  3I4N C;  4KN4 A;  4PAA A;  1F7V A;  5M3M K;  2VUM A;  1WSR A;  1Y1W K;  1TWC A;  3GTP A;  4C3H K;  4A93 K;  3PO2 K;  1TWF A;  3BP8 C;  2E2J K;  4BY1 C;  2EBB A;  4XLP A;  2WB1 D;  3S14 C;  3GTL C;  4C3J C;  4OIP A;  5FJ8 K;  2NVT K;  1XZQ B;  2XCQ A;  2E2I K;  4LQY A;  2YU9 K;  3GTG K;  3S1Q C;  1TWH A;  2FQO A;  2JA6 K;  3HXA A;  1SMY A;  3HOY K;  4J3N A;  1WSV A;  1I6H C;  5IOS A;  1SFO A;  4MQ9 A;  2JA5 C;  4Y7N C;  1WCM K;  2A68 A;  1IE0 A;  4KAW X;  1O26 A;  4C2M K;  1JVI A;  4PAB A;  2BE5 A;  5EGH A;  1K83 K;  1USO A;  1TWH K;  4M1X A;  4XSX A;  4BBR K;  3I4N K;  1VH2 A;  4A3E K;  5IYC C;  3N3Y A;  1F93 A;  1TWC C;  4A3J K;  3T00 A;  3N0C A;  3GTQ C;  1XXA A;  3H0G A;  2NVQ K;  1XZQ A;  1XXC A;  3S2D K;  3HOX C;  4BBR C;  3SZY A;  3S1R C;  1PJ6 A;  5L46 A;  4C3I C;  4OIQ A;  5M5Y K;  1UV7 A;  3S17 C;  1WQG A;  4G0V A;  4KB4 A;  3FKI A;  1USM A;  4GTL A;  4KMU A;  3GTP C;  4A3F K;  1R9T K;  2PA8 D;  4QJV B;  4BKW A;  3TFI A;  1IL2 A;  1GE9 A;  2Y0S D;  1I3Q C;  4LJZ A;  4Y7N K;  2JA5 K;  1DCO A;  4P5A A;  5M3F K;  3HKZ D;  4YFN A;  1K83 A;  2D6F C;  1O2F B;  3A8J A;  4A3K C;  1WOP A;  4KB2 A;  3HKZ L;  1WCM A;  4FZB A;  5JFE A;  3GTO C;  2NVY K;  3I4M C;  4ILD A;  3HOW K;  1G51 A;  1TWA C;  3SZZ A;  5IYC K;  3GTL A;  2RH6 A;  5IP9 K;  4BBS K;  3GEH A;  1J6W A;  3S1N K;  5C4J K;  3HOX K;  3S1R K;  3GTO K;  2JA7 C;  4BLB A;  5IOQ A;  2R7Z A;  2R92 A;  4C2M C;  2P5M A;  2B63 K;  3OPF A;  4YG2 A;  4A3M C;  4LK0 A;  4KMA A;  1EK8 A;  4GFQ A;  4QJV A;  4BY7 C;  4GTE A;  3S1N C;  4JK1 A;  2JA5 A;  1PJ7 A;  4AYB L;  1I50 C;  1WOO A;  3GTK K;  4A3D C;  4KDD A;  5CHP A;  3ORE A;  4MEY A;  1Y1V K;  4KAS A;  1O2B A;  3GTM K;  3S1Q K;  4O2D A;  1WQH A;  2YU9 C;  1BGW A;  4C3I K;  1J6V A;  4BLA A;  1O29 A;  1HQM A;  3S17 K;  1TWA A;  1EH1 A;  1ZVU A;  2PHC B;  4XCH A;  3I4M K;  2WB1 L;  1ZYR A;  3M3Y K;  1TWA K;  2NVT C;  1I3Q K;  1PJ5 A;  2JA8 C;  4OIO A;  2O5I A;  2R92 K;  5FLM C;  4G0U A;  2WAQ D;  1XXB A;  1L0W A;  3GEI A;  2R93 A;  4BXX K;  3GEE A;  2CFA B;  1WIH A;  2PPB A;  2R7Z K;  1BJT A;  3H3V L;  1O25 A;  1Y1V C;  3S15 K;  4MEX A;  5IP7 C;  2E2H K;  4AH6 A;  3VA7 A;  4A3C C;  5C4X C;  3GTL K;  3HOU K;  4KM8 A;  2CFA A;  4FM9 A;  4KN7 A;  5M5W K;  3M4O K;  1INN A;  3G4A A;  4A3I C;  3IPJ A;  4C45 A;  4NOI A;  3TFJ A;  3PO3 C;  3AQO A;  5IOR A;  2PMZ L;  4LK1 A;  3JST A;  3S16 C;  3EQL A;  5E68 A;  1ZQ1 C;  3S1M C;  2JA8 K;  5TMF A;  3GTP K;  1Y1W A;  2O5J A;  3NUH A;  3PO3 K;  3GTQ A;  1WCM C;  1YNN A;  2ZUF A;  2VUM K;  3GTO A;  1RU0 A;  2GAH C;  3HOV K;  4A3G C;  2CW0 A;  2V6S A;  4KAR A;  5IYD C;  3RZO C;  3S2H C;  4RMF A;  4GTA A;  4GT9 A;  1TWG K;  3ADA C;  1C0A A;  3BUE A;  2VUM C;  3FOE A;  1I6V A;  2KWA A;  1SFO K;  2ZFZ A;  4ZH4 A;  1ISE A;  4X6A K;  2R7Z C;  4OIR A;  4KAT A;  2NVY C;  2E2I C;  1IS1 A;  3GDZ A;  3M3Y C; 
#chains in the Genus database with same CATH homology
 4GTC A;  5IOT A;  3LAP A;  3GTK A;  4BLA A;  1O29 A;  1TWA A;  1O27 A;  3V4G A;  1EH1 A;  1ZVU A;  4KAW X;  1Y1V A;  5JVO A;  3FHZ A;  1O26 A;  5CJ9 A;  2PHC B;  3G4C A;  5EGH A;  1B4B A;  4M1X A;  2RGR A;  2JA7 A;  4KMD A;  3N3Y A;  1I50 A;  2B63 A;  2XCO A;  3N0C A;  3GTJ A;  1XXA A;  4G0U A;  3H0G A;  3LAJ A;  1XXB A;  1XXC A;  1ZXO A;  4C3I C;  1B4A A;  2JA6 A;  2GSN A;  1O28 A;  4DDQ A;  2R93 A;  2NVY A;  3GTG A;  3QX3 A;  1WQG A;  3CAG A;  4G0V A;  1AB4 A;  4KB4 A;  3FKI A;  2GSO A;  5EGE A;  2CFA B;  1WIH A;  3LPX A;  1F9N A;  4GTB A;  4GTL A;  1BJT A;  3OEP A;  4C3H C;  4KM9 A;  3MML B;  1O25 A;  4LR2 A;  4BKW A;  3S0X A;  1GE9 A;  4G0W A;  1ZBS A;  3VA7 A;  3CQZ A;  4P5B A;  4KM8 A;  2CFA A;  2YU9 A;  4FM9 A;  4GTF A;  1R9T A;  4P5A A;  1K83 A;  3G4A A;  4KMH A;  3AH5 A;  1O24 A;  3GTM A;  2Y3P A;  3Q3Q A;  2NVX A;  4KB2 A;  3AQO A;  5IOR A;  3L4K A;  1WCM A;  4FZB A;  5JFE A;  3L4J A;  1WQF A;  2JH3 A;  4ILD A;  2VUM A;  3AQP A;  2E2H A;  3GTP A;  1TWC A;  3N0B A;  3GTL A;  2RH6 A;  1Y1W A;  1O2A A;  3NUH A;  5TJ3 A;  3GTQ A;  3GTO A;  4KC6 A;  1TWF A;  4BLB A;  3ERE D;  5IOQ A;  2R7Z A;  2R92 A;  4KAR A;  4C2M C;  2P5M A;  4GTA A;  3OPF A;  2GSU A;  4C3J C;  4GT9 A;  4KMA A;  2XCR B;  1EK8 A;  2XCQ A;  4GFQ A;  4GTE A;  3BUE A;  4LQY A;  3FOE A;  2KWA A;  4GTD A;  2ZFZ A;  2JA5 A;  1ISE A;  3FOF A;  1TWH A;  4KDD A;  1TWG A;  4KAT A;  5CHP A;  2E2I A;  1KQ4 A;  3ORE A;  4J3N A;  1DD5 A;  4KAS A;  1O2B A;  1I3Q A;  5IOS A;  1SFO A;  1IS1 A;  1WQH A;  1BGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...