4GTLA

T. maritima fdts (r174k mutant) with fad
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
220
structure length
216
Chain Sequence
b'HHHMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLKADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Folate binding site of flavin-dependent thymidylate synthase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 74
structure length 216
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 4gtlA00
3G4AA 3N3YA 1O2BA 1O28A 1O29A 5IOSA 4KASA 4P5BA 1O26A 5CHPA 3AH5A 1O27A 2CFAA 4KATA 4GT9A 4FZBA 1O24A 4GTEA 3G4CA 3N0BA 3N0CA 2CFAB 4GTLA 5JFEA 1O25A 4GTDA 4KARA 1O2AA 4GTCA 4GTBA 5IOTA 4GTAA 4GTFA 5IORA 5IOQA 4P5AA 1KQ4A
chains in the Genus database with same CATH superfamily
4BY7K 2JA8C 1R9TC 3OREA 3GTKC 3FHZA 3GTMC 1IE0A 3RZDC 1C0AA 4X6AC 4BY7C 3HOUC 3T00A 1WIHA 1O24A 2EBBA 3GTGK 4GTLA 4G0WA 1BGWA 3GTGA 2R93K 2B63K 1XZQA 3PO2K 3A8IA 4KMDA 1I50K 5C44K 4MQ9A 2RGRA 1JVIA 3HOWK 1INNA 1EFWA 3V4GA 3T02A 4AH6A 2A6HA 2ZFZA 2Y0SD 5TJ3A 3GTGC 3T01A 3PO2C 1J6WA 4BXXK 3N0CA 1XXAA 3DXJA 5C4JK 4A3BC 2NVQC 2BE5A 4KB2A 1VH2A 4A3CK 1J6VA 4A3IC 1IQ0A 2Y0SL 3S2HK 3VA7A 1Y1WA 1B4AA 4P5BA 5C4JC 5CHPA 2GAGC 5CJ9A 3GEHA 4DDQA 3CQZK 4A3CC 4QJVA 1USOA 3S14C 1Y1WC 5JFEA 1O25A 3S2HC 2R92A 2A6EA 2GSNA 5IYDK 3OPFA 4Y7NK 4LOWA 3A8KA 1HI9A 4AYBD 3CQZC 4C2MC 5M5YK 4KASA 2R92C 3AD8C 1G51A 4BLBA 5M3MK 4LK1A 5IYDC 2ZUFA 4Y7NC 1B4BA 4NOIA 1ZYRA 1EH1A 4A3EK 1L0WA 4LR2A 3S2DC 5IOTA 4A3JK 4WJ4A 4ZH4A 3GTPK 4XLNA 1VRQC 4A3EC 3GTJA 5C4XC 5L46A 1WOPA 4A3JC 1ZVUA 3SZZA 3AH5A 1PJ7A 3I4NC 1O27A 4OIQA 4J3NA 4GT9A 2XCQA 3GTKK 4A3MK 1Y1VK 3GTJC 3I4MC 3GEEA 4P5AA 4A3GC 2FQTA 5E68A 1BS2A 3HOUK 3OEPA 4BBRK 3AQOA 3LAJA 4G7ZA 4A3MC 1WSVA 1Y1VC 3GTOA 3NUHA 4QIWD 3LAPA 4KMUA 1IS1A 3S0XA 2WAQL 1XZPA 2CFAA 3ERED 3S1NC 4BBRC 1JQWA 1TWGK 2PA8L 1TWGA 3S15C 2R7ZA 1DCOA 3HXAA 1USMA 1ISEA 3S17K 1TWHA 3JSTA 1O2BA 4XSXA 1O29A 1TWCA 5FLMC 1TWGC 1WQHA 1I3QK 2R7ZC 4A3BK 4KMHA 4XSZA 1I3QA 2NVQK 1YCLA 4GZYA 1TWHC 3S17C 2GSUA 4A3IK 4KM9A 3G4CA 1TWCC 4ILDA 3HOZK 1JOEA 1O2AA 1I3QC 4KMAA 5TMCA 2PMZD 3PO3K 4A93C 4A3KC 2O5JA 3RZOK 3S14K 1Y1WK 4C3IK 3HOZC 1IL2A 2E2IA 2XCOA 2ZUEA 1TWAK 1VJEA 4KATA 1TWAA 3PO3C 4A3DK 3ADAC 1WQFA 2JA7K 3BP3A 2JA7A 3RZOC 4C2MK 2D6FC 1BDFA 2PMZL 4LQYA 2R92K 4KARA 4GTCA 2E2IC 4C3IC 4LK0A 5IOQA 4GTEA 1KQ4A 2NVTC 1TWAC 3N3YA 5JVOA 4A3DC 2JA7C 2GAHC 4C3HK 3S2DK 5HL8A 5M5WK 3SZYA 2GSOA 4BKWA 4OINA 3H0GA 1V5VA 1RU0A 1K83K 4KB4A 4PAAA 1K83A 2YU9K 3GSIA 1WQGA 3FKIK 5M3FK 2YU9A 4C3HC 4WJ3M 3FKIA 5C4XK 4GTBA 4KN4A 4YG2A 2W7VA 4RMFA 3H0GC 1SFOA 4YFKA 3I4NK 4KAWX 2NVXA 1YX2A 5TMFA 1EQRA 4AYBL 1K83C 1F9NA 3GTJK 3I4MK 2YU9C 3FKIC 3S1RC 2NVYK 1PJ5A 4A3GK 1O26A 1SFOC 2NVYA 4OIOA 2P5MA 2NVXC 4LJZA 2E2JK 5IYBK 3LPXA 3HOYK 4A3LK 3EQLA 5D4DA 3GTQK 1DD5A 3N0BA 4XCHA 1YNJA 5C3EC 3GTQA 2JA6A 4BLAA 4Y52K 3S1MK 3TTGA 2NVYC 1WCMA 2VUMA 1SMYA 1XZQB 2E2JC 2KWAA 3S1NK 5IYBC 1PJ6A 3HOYC 4A3LC 1O2FB 3GTQC 5IOSA 3GIRA 3K7AC 3M3YK 3S15K 3GTOK 4JK1A 4KC6A 2Y3PA 2JA6C 3QX3A 3BP8C 4C45A 4FM9A 5EGEA 1F7UA 1WCMC 4Y52C 3S1MC 4OIRA 4KM8A 3L4KA 4A3FK 4MEXA 2E2HK 5FLMK 2R7ZK 2E2HA 3S1QC 3M3YC 3GTOC 4GTFA 5IORA 1IBAA 1TWHK 1F7VA 4O2DA 1ZBSA 4A3FC 3HKZD 1J6XA 2V6UA 1TWCK 2V6TA 4WILA 2E2HC 4QIWL 4BBSK 1TWFK 1XXCA 1VLOA 1TWFA 4G0VA 3S16C 1I6VA 4A93K 5EGHA 4Q5SA 4A3KK 3M4OK 1X31C 4BBSC 2R93A 2B63A 4P9SA 1TWFC 4Q4ZA 5M5XK 4QJVB 4KN7A 3Q3QA 3HKZL 3L4JA 1I50A 2A68A 1WSRA 4KDDA 5IP7K 3M4OC 5IYCK 5FJ8K 1DCPA 2PHCB 1WOSA 2E2IK 2R93C 2B63C 1XPPA 4M1XA 2NVTK 2JH3A 1I50C 3CAGA 5C44C 1IW7A 1BJTA 3HOWC 3TFHA 1GE9A 5IP7C 5IYCC 3FOFA 2JA5K 3WODA 2JA5A 2A69A 3HOVK 3G4AA 3AD7C 1F93A 4BXXC 1VGXA 4C3JK 3FOEA 4YFXA 2JA5C 3H0GK 3GDZA 3HOXK 3MMLB 3HOVC 2O5IA 1WORA 3CQZA 3H3VD 1ZQ1C 4C3JC 1XXBA 3S1RK 2WB1D 1SFOK 2NVXK 3HOXC 1WOOA 3TFIA 1HQMA 5C3EK 1J98A 2P8TA 1EI6A 3GEIA 3GTLK 4BY1K 5IP9K 3H3VL 3GTLA 1XZPB 3K7AK 4MEYA 2CFAB 1UV7A 3TFJA 2JA6K 4GTDA 2WB1L 4GTAA 4PABA 1DCHA 1WCMK 2VUMK 1ZXOA 4GFQA 3AD9C 1AB4A 4G7OA 1YNNA 3GTLC 4G7HA 4BY1C 5IP9C 4XLPA 1O28A 2V6SA 1EK8A 3GTPA 4LLGA 3S1QK 2CW0A 1I6HK 2JA8K 4YFNA 2WAQD 1R9TK 2VUMC 1R9TA 2PPBA 2RH6A 4G0UA 2FQOA 4FZBA 2XCRB 4OIPA 3GTMK 3GTKA 3GTPC 3IPJA 3BUEA 1Y1VA 3GTMA 2PA8D 3RZDK 3A8JA 3S16K 3AQPA 1I6HC 4X6AK
chains in the Genus database with same CATH topology
3Q3QA 3L4JA 3N3YA 1I50A 3OREA 5JVOA 4KDDA 3FHZA 2PHCB 3GTJA 2GSOA 4BKWA 1ZVUA 4M1XA 3H0GA 3AH5A 2JH3A 1O27A 3CAGA 4KB4A 4J3NA 4GT9A 2XCQA 1WIHA 1K83A 1O24A 4GTEA 1BJTA 1WQGA 1GE9A 4GTLA 4C3HC 2YU9A 3FOFA 3FKIA 4G0WA 1BGWA 3GTGA 4GTBA 4P5AA 2JA5A 1SFOA 5IOQA 3G4AA 4KMDA 4KAWX 2NVXA 3OEPA 3AQOA 1F9NA 2RGRA 3LAJA 3V4GA 3GTOA 3NUHA 2ZFZA 5TJ3A 3LAPA 1IS1A 3FOEA 3S0XA 1O26A 2NVYA 3MMLB 2P5MA 2CFAA 3LPXA 3ERED 1DD5A 3CQZA 3N0CA 1XXAA 3N0BA 3GTQA 1TWGA 2R7ZA 2JA6A 4C3JC 1XXBA 4BLAA 1ISEA 1WCMA 1TWHA 2VUMA 4KB2A 1O2BA 2KWAA 1O29A 1TWCA 5IOSA 1WQHA 3VA7A 4KC6A 1Y1WA 2Y3PA 4KMHA 1B4AA 4P5BA 3QX3A 1I3QA 4FM9A 5EGEA 5CHPA 4KM8A 3L4KA 5CJ9A 2GSUA 3GTLA 4DDQA 4KM9A 3G4CA 4ILDA 2CFAB 2E2HA 5JFEA 1O25A 4GTDA 1O2AA 2R92A 4KMAA 4GTAA 2GSNA 4GTFA 3OPFA 5IORA 1ZXOA 4GFQA 1AB4A 1ZBSA 1O28A 1EK8A 3GTPA 4C2MC 4KASA 1XXCA 2E2IA 2XCOA 4BLBA 1TWFA 4G0VA 5EGHA 4KATA 1TWAA 1R9TA 1B4BA 2RH6A 1WQFA 4G0UA 4FZBA 2XCRB 1EH1A 3GTKA 2JA7A 3BUEA 1Y1VA 4LR2A 3GTMA 4LQYA 5IOTA 4KARA 4GTCA 4C3IC 2R93A 2B63A 3AQPA 1KQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4A A;  3N3Y A;  1O2B A;  1O28 A;  1O29 A;  5IOS A;  4KAS A;  4P5B A;  1O26 A;  5CHP A;  3AH5 A;  1O27 A;  2CFA A;  4KAT A;  4GT9 A;  4FZB A;  1O24 A;  4GTE A;  3G4C A;  3N0B A;  3N0C A;  2CFA B;  4GTL A;  5JFE A;  1O25 A;  4GTD A;  4KAR A;  1O2A A;  4GTC A;  4GTB A;  5IOT A;  4GTA A;  4GTF A;  5IOR A;  5IOQ A;  4P5A A;  1KQ4 A; 
#chains in the Genus database with same CATH topology
 4BY7 K;  2JA8 C;  1R9T C;  3ORE A;  3GTK C;  3FHZ A;  3GTM C;  1IE0 A;  3RZD C;  1C0A A;  4X6A C;  4BY7 C;  3HOU C;  3T00 A;  1WIH A;  1O24 A;  2EBB A;  3GTG K;  4GTL A;  4G0W A;  1BGW A;  3GTG A;  2R93 K;  2B63 K;  1XZQ A;  3PO2 K;  3A8I A;  4KMD A;  1I50 K;  5C44 K;  4MQ9 A;  2RGR A;  1JVI A;  3HOW K;  1INN A;  1EFW A;  3V4G A;  3T02 A;  4AH6 A;  2A6H A;  2ZFZ A;  2Y0S D;  5TJ3 A;  3GTG C;  3T01 A;  3PO2 C;  1J6W A;  4BXX K;  3N0C A;  1XXA A;  3DXJ A;  5C4J K;  4A3B C;  2NVQ C;  2BE5 A;  4KB2 A;  1VH2 A;  4A3C K;  1J6V A;  4A3I C;  1IQ0 A;  2Y0S L;  3S2H K;  3VA7 A;  1Y1W A;  1B4A A;  4P5B A;  5C4J C;  5CHP A;  2GAG C;  5CJ9 A;  3GEH A;  4DDQ A;  3CQZ K;  4A3C C;  4QJV A;  1USO A;  3S14 C;  1Y1W C;  5JFE A;  1O25 A;  3S2H C;  2R92 A;  2A6E A;  2GSN A;  5IYD K;  3OPF A;  4Y7N K;  4LOW A;  3A8K A;  1HI9 A;  4AYB D;  3CQZ C;  4C2M C;  5M5Y K;  4KAS A;  2R92 C;  3AD8 C;  1G51 A;  4BLB A;  5M3M K;  4LK1 A;  5IYD C;  2ZUF A;  4Y7N C;  1B4B A;  4NOI A;  1ZYR A;  1EH1 A;  4A3E K;  1L0W A;  4LR2 A;  3S2D C;  5IOT A;  4A3J K;  4WJ4 A;  4ZH4 A;  3GTP K;  4XLN A;  1VRQ C;  4A3E C;  3GTJ A;  5C4X C;  5L46 A;  1WOP A;  4A3J C;  1ZVU A;  3SZZ A;  3AH5 A;  1PJ7 A;  3I4N C;  1O27 A;  4OIQ A;  4J3N A;  4GT9 A;  2XCQ A;  3GTK K;  4A3M K;  1Y1V K;  3GTJ C;  3I4M C;  3GEE A;  4P5A A;  4A3G C;  2FQT A;  5E68 A;  1BS2 A;  3HOU K;  3OEP A;  4BBR K;  3AQO A;  3LAJ A;  4G7Z A;  4A3M C;  1WSV A;  1Y1V C;  3GTO A;  3NUH A;  4QIW D;  3LAP A;  4KMU A;  1IS1 A;  3S0X A;  2WAQ L;  1XZP A;  2CFA A;  3ERE D;  3S1N C;  4BBR C;  1JQW A;  1TWG K;  2PA8 L;  1TWG A;  3S15 C;  2R7Z A;  1DCO A;  3HXA A;  1USM A;  1ISE A;  3S17 K;  1TWH A;  3JST A;  1O2B A;  4XSX A;  1O29 A;  1TWC A;  5FLM C;  1TWG C;  1WQH A;  1I3Q K;  2R7Z C;  4A3B K;  4KMH A;  4XSZ A;  1I3Q A;  2NVQ K;  1YCL A;  4GZY A;  1TWH C;  3S17 C;  2GSU A;  4A3I K;  4KM9 A;  3G4C A;  1TWC C;  4ILD A;  3HOZ K;  1JOE A;  1O2A A;  1I3Q C;  4KMA A;  5TMC A;  2PMZ D;  3PO3 K;  4A93 C;  4A3K C;  2O5J A;  3RZO K;  3S14 K;  1Y1W K;  4C3I K;  3HOZ C;  1IL2 A;  2E2I A;  2XCO A;  2ZUE A;  1TWA K;  1VJE A;  4KAT A;  1TWA A;  3PO3 C;  4A3D K;  3ADA C;  1WQF A;  2JA7 K;  3BP3 A;  2JA7 A;  3RZO C;  4C2M K;  2D6F C;  1BDF A;  2PMZ L;  4LQY A;  2R92 K;  4KAR A;  4GTC A;  2E2I C;  4C3I C;  4LK0 A;  5IOQ A;  4GTE A;  1KQ4 A;  2NVT C;  1TWA C;  3N3Y A;  5JVO A;  4A3D C;  2JA7 C;  2GAH C;  4C3H K;  3S2D K;  5HL8 A;  5M5W K;  3SZY A;  2GSO A;  4BKW A;  4OIN A;  3H0G A;  1V5V A;  1RU0 A;  1K83 K;  4KB4 A;  4PAA A;  1K83 A;  2YU9 K;  3GSI A;  1WQG A;  3FKI K;  5M3F K;  2YU9 A;  4C3H C;  4WJ3 M;  3FKI A;  5C4X K;  4GTB A;  4KN4 A;  4YG2 A;  2W7V A;  4RMF A;  3H0G C;  1SFO A;  4YFK A;  3I4N K;  4KAW X;  2NVX A;  1YX2 A;  5TMF A;  1EQR A;  4AYB L;  1K83 C;  1F9N A;  3GTJ K;  3I4M K;  2YU9 C;  3FKI C;  3S1R C;  2NVY K;  1PJ5 A;  4A3G K;  1O26 A;  1SFO C;  2NVY A;  4OIO A;  2P5M A;  2NVX C;  4LJZ A;  2E2J K;  5IYB K;  3LPX A;  3HOY K;  4A3L K;  3EQL A;  5D4D A;  3GTQ K;  1DD5 A;  3N0B A;  4XCH A;  1YNJ A;  5C3E C;  3GTQ A;  2JA6 A;  4BLA A;  4Y52 K;  3S1M K;  3TTG A;  2NVY C;  1WCM A;  2VUM A;  1SMY A;  1XZQ B;  2E2J C;  2KWA A;  3S1N K;  5IYB C;  1PJ6 A;  3HOY C;  4A3L C;  1O2F B;  3GTQ C;  5IOS A;  3GIR A;  3K7A C;  3M3Y K;  3S15 K;  3GTO K;  4JK1 A;  4KC6 A;  2Y3P A;  2JA6 C;  3QX3 A;  3BP8 C;  4C45 A;  4FM9 A;  5EGE A;  1F7U A;  1WCM C;  4Y52 C;  3S1M C;  4OIR A;  4KM8 A;  3L4K A;  4A3F K;  4MEX A;  2E2H K;  5FLM K;  2R7Z K;  2E2H A;  3S1Q C;  3M3Y C;  3GTO C;  4GTF A;  5IOR A;  1IBA A;  1TWH K;  1F7V A;  4O2D A;  1ZBS A;  4A3F C;  3HKZ D;  1J6X A;  2V6U A;  1TWC K;  2V6T A;  4WIL A;  2E2H C;  4QIW L;  4BBS K;  1TWF K;  1XXC A;  1VLO A;  1TWF A;  4G0V A;  3S16 C;  1I6V A;  4A93 K;  5EGH A;  4Q5S A;  4A3K K;  3M4O K;  1X31 C;  4BBS C;  2R93 A;  2B63 A;  4P9S A;  1TWF C;  4Q4Z A;  5M5X K;  4QJV B;  4KN7 A;  3Q3Q A;  3HKZ L;  3L4J A;  1I50 A;  2A68 A;  1WSR A;  4KDD A;  5IP7 K;  3M4O C;  5IYC K;  5FJ8 K;  1DCP A;  2PHC B;  1WOS A;  2E2I K;  2R93 C;  2B63 C;  1XPP A;  4M1X A;  2NVT K;  2JH3 A;  1I50 C;  3CAG A;  5C44 C;  1IW7 A;  1BJT A;  3HOW C;  3TFH A;  1GE9 A;  5IP7 C;  5IYC C;  3FOF A;  2JA5 K;  3WOD A;  2JA5 A;  2A69 A;  3HOV K;  3G4A A;  3AD7 C;  1F93 A;  4BXX C;  1VGX A;  4C3J K;  3FOE A;  4YFX A;  2JA5 C;  3H0G K;  3GDZ A;  3HOX K;  3MML B;  3HOV C;  2O5I A;  1WOR A;  3CQZ A;  3H3V D;  1ZQ1 C;  4C3J C;  1XXB A;  3S1R K;  2WB1 D;  1SFO K;  2NVX K;  3HOX C;  1WOO A;  3TFI A;  1HQM A;  5C3E K;  1J98 A;  2P8T A;  1EI6 A;  3GEI A;  3GTL K;  4BY1 K;  5IP9 K;  3H3V L;  3GTL A;  1XZP B;  3K7A K;  4MEY A;  2CFA B;  1UV7 A;  3TFJ A;  2JA6 K;  4GTD A;  2WB1 L;  4GTA A;  4PAB A;  1DCH A;  1WCM K;  2VUM K;  1ZXO A;  4GFQ A;  3AD9 C;  1AB4 A;  4G7O A;  1YNN A;  3GTL C;  4G7H A;  4BY1 C;  5IP9 C;  4XLP A;  1O28 A;  2V6S A;  1EK8 A;  3GTP A;  4LLG A;  3S1Q K;  2CW0 A;  1I6H K;  2JA8 K;  4YFN A;  2WAQ D;  1R9T K;  2VUM C;  1R9T A;  2PPB A;  2RH6 A;  4G0U A;  2FQO A;  4FZB A;  2XCR B;  4OIP A;  3GTM K;  3GTK A;  3GTP C;  3IPJ A;  3BUE A;  1Y1V A;  3GTM A;  2PA8 D;  3RZD K;  3A8J A;  3S16 K;  3AQP A;  1I6H C;  4X6A K; 
#chains in the Genus database with same CATH homology
 3Q3Q A;  3L4J A;  3N3Y A;  1I50 A;  3ORE A;  5JVO A;  4KDD A;  3FHZ A;  2PHC B;  3GTJ A;  2GSO A;  4BKW A;  1ZVU A;  4M1X A;  3H0G A;  3AH5 A;  2JH3 A;  1O27 A;  3CAG A;  4KB4 A;  4J3N A;  4GT9 A;  2XCQ A;  1WIH A;  1K83 A;  1O24 A;  4GTE A;  1BJT A;  1WQG A;  1GE9 A;  4GTL A;  4C3H C;  2YU9 A;  3FOF A;  3FKI A;  4G0W A;  1BGW A;  3GTG A;  4GTB A;  4P5A A;  2JA5 A;  1SFO A;  5IOQ A;  3G4A A;  4KMD A;  4KAW X;  2NVX A;  3OEP A;  3AQO A;  1F9N A;  2RGR A;  3LAJ A;  3V4G A;  3GTO A;  3NUH A;  2ZFZ A;  5TJ3 A;  3LAP A;  1IS1 A;  3FOE A;  3S0X A;  1O26 A;  2NVY A;  3MML B;  2P5M A;  2CFA A;  3LPX A;  3ERE D;  1DD5 A;  3CQZ A;  3N0C A;  1XXA A;  3N0B A;  3GTQ A;  1TWG A;  2R7Z A;  2JA6 A;  4C3J C;  1XXB A;  4BLA A;  1ISE A;  1WCM A;  1TWH A;  2VUM A;  4KB2 A;  1O2B A;  2KWA A;  1O29 A;  1TWC A;  5IOS A;  1WQH A;  3VA7 A;  4KC6 A;  1Y1W A;  2Y3P A;  4KMH A;  1B4A A;  4P5B A;  3QX3 A;  1I3Q A;  4FM9 A;  5EGE A;  5CHP A;  4KM8 A;  3L4K A;  5CJ9 A;  2GSU A;  3GTL A;  4DDQ A;  4KM9 A;  3G4C A;  4ILD A;  2CFA B;  2E2H A;  5JFE A;  1O25 A;  4GTD A;  1O2A A;  2R92 A;  4KMA A;  4GTA A;  2GSN A;  4GTF A;  3OPF A;  5IOR A;  1ZXO A;  4GFQ A;  1AB4 A;  1ZBS A;  1O28 A;  1EK8 A;  3GTP A;  4C2M C;  4KAS A;  1XXC A;  2E2I A;  2XCO A;  4BLB A;  1TWF A;  4G0V A;  5EGH A;  4KAT A;  1TWA A;  1R9T A;  1B4B A;  2RH6 A;  1WQF A;  4G0U A;  4FZB A;  2XCR B;  1EH1 A;  3GTK A;  2JA7 A;  3BUE A;  1Y1V A;  4LR2 A;  3GTM A;  4LQY A;  5IOT A;  4KAR A;  4GTC A;  4C3I C;  2R93 A;  2B63 A;  3AQP A;  1KQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...