4GTUA

Ligand-free homodimeric human glutathione s-transferase m4-4
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
217
structure length
217
Chain Sequence
SMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.
pubmed doi rcsb
molecule keywords GLUTATHIONE S-TRANSFERASE
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1999-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4gtuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gtuA01
5C00A 4JE1A 1NM3A 1QQ2A 2GSTA 1MDJA 3ZZXA 2PMTA 4MPGA 4PNFA 1AW9A 1TTZA 2LRNA 3EVIA 1OC9B 3LEFA 2R5GA 1K0CA 1GSQA 4L0WA 2CAIA 1IYHA 1AQWA 1PL2A 2GGTA 2IIYA 3HXSA 3QCPA 3NOFA 1ZYEA 3FEUA 3IPZA 18GSA 1U87A 5AN1A 5FT3A 2H1AA 2FHEA 4X43A 2H8LA 5CRWA 1JLWA 4ZL9A 1A8LA 4OFNA 4I2UA 1Y25A 4OMVA 3VWXA 3GX8A 5F05A 4KSMA 2VLUA 2J9HA 3UBKA 2YWNA 4J2FA 1B9YC 5B8AA 2FGXA 5GZZB 2VL9A 2YPMA 3P90A 4XHMA 2DJ0A 3BBYA 1GH2A 2RM5A 1G6WA 5H5RA 3O6TA 1O8WA 1HNCA 3QFBC 1RK4A 3I43A 1BEDA 2L4QA 4XIHA 3GIXA 2K9FA 5A4UA 1PQNA 2PPTA 4JR6A 2NPBA 1XWBA 3H4KA 1G7EA 3G9BA 1OC3A 3LORA 2AB6A 1GLPA 3GRXA 1CQGA 1KEBA 1PMTA 2WRTA 4WF5A 3ZVJA 3GL3A 4ACSA 1OC9A 2R37A 2X8HA 2MMZA 4POBA 1XW6A 2HZEA 3KTLA 2HSNB 4EDZA 4L0UA 1GUMA 2HRKB 4HDEA 1JHBA 1EP8A 2VCXA 1SJIA 3CXGA 1GULA 4G0KA 4YH2A 4ID0A 1W4VA 1M7TA 4MDCA 4TOPA 1J9BA 4GWRA 1TDIA 3GSTA 2KP1A 4POKA 4F2IA 2H76A 3FRCA 3D6IA 5COHA 3HKRA 1ZZYA 3IOSA 3TCOA 4MCUA 4TRXA 3TKQA 2H1DA 4XS1A 1U3AA 1GUHA 4V2NA 3Q19A 4ZB6A 3M3MA 5D9XA 2H0IA 4I5QA 2A2SA 3VWUA 1PKWA 4BVYB 1YKCA 5AGYA 3VPQA 3ZYWA 3C8EA 4X1UA 2OE1A 3M8NA 4QQ7A 4FYBA 4GLTA 5ECIB 5A4WA 3TJKA 2YNXA 4Q5RA 4EC0A 5J41A 1X0RA 3G7YA 4O92A 5JCWA 4GXZA 3HVSA 3EWLA 3V1WA 4K7NA 3WYWA 2K18A 1HQOA 2IMDA 2R2JA 2LNTA 3F8UA 3DYRA 2H6XA 4L8EA 3IRAA 1K0AA 14GSA 1SKRB 2BMXA 3VFIA 5KEJA 2PVQA 4FH8A 4XS6A 3TRQA 4I2TA 2C0EA 3RPNA 3UVHA 1M0UA 2FA8A 2Z9SA 3HZ8A 5DJLA 2LNSA 5GAPD 5LD0A 2I81A 2YZHA 5HFIA 3KH7A 3TRXA 3TJGA 5KN2A 2C0DA 1EZKA 1O81A 2L4CA 2DJJA 2WDUA 4BVYA 2IMKA 2WJUA 3ZREA 2HRFA 5KN0A 5ECQB 1O7UA 1GTUA 5DDLA 4USSA 5IO2A 1A2MA 5CO3A 2B6MA 3WGDA 4GSTA 5IMVA 1PA3A 2ZNMA 3CMIA 1JFUA 3I69A 4YAVA 4GRFA 2H01A 2GDRA 2VL2C 1YF0A 5J4UA 4N0VA 1YEPA 1QFNA 2CT6A 1OAZA 4XRAA 3VWWA 4FQUA 1YEXA 4AJ8A 4ZBAA 3I6AA 1A24A 5IMZA 4AJ6A 2GQMA 2H30A 2QGVA 5G30A 2R6KA 3S9FA 1DUGA 3J7Yk 3MWHA 3LJRA 3KD0A 1YJ6A 2GSSA 1FAAA 2I9HA 1AUCA 2C4JA 5EL8A 5G1KA 1X9WB 3TOTA 2H1GA 4JU5A 1WE0A 17GSA 5FWGA 3ZVJD 2GZPA 3GL5A 4RI7A 4PX1A 2MMOA 2WCIA 1PSQA 3D4MA 5IOWA 3F6FA 2EIRA 3NIVA 2LRCA 3VURA 2LTKA 3KP9A 2K8SA 2X8CA 1HYUA 4FYCA 1TRVA 3LXTA 2FD3A 1A0RP 3US3A 4V2LA 2C3NA 5DQSA 5DQYA 4K1FA 4FIWA 2V1MA 1B4QA 4N30A 2AV4A 4K7OA 4RQRA 1V40A 1N2AA 2AAWA 5LNKe 4Q5FA 3ERWA 1TW9A 4ECBA 4EXJA 4JRRA 4PGTA 1G6YA 2I1UA 2LJRA 2CQ9A 1O73A 4NV5A 1TU8A 2UZ8A 2E7PA 3EU4A 2IL3A 4IP1A 4PQHA 2OE0A 1S3AA 4IHUA 2AJQB 1EWXA 1ZL9A 3RPPA 3IHQA 4KH7A 3GH6A 4ZXGA 2HT9A 2KOKA 3W6GA 3A5WA 1B48A 5CNWA 4TKYA 2F51A 3GMFA 2VD0A 3GFKA 4G19A 2L59A 4IJ3A 3FHKA 3E3EA 3K8NA 4KB3A 2AYTA 2F8FA 2HI7A 3F4SA 1QUWA 1GRXA 1SU9A 5GSSA 5ECRB 1IYIA 3LFLA 1FB0A 1J0FA 1PL1A 2FLSA 3UARA 1O85A 2RIIA 5CAXA 1AQVA 1T7PB 1KBNA 3GTUB 3QAWA 4WBRD 1FHEA 2XPEA 1R5AA 3D0ZA 2IJYA 1FVKA 3WGEA 4IELA 1GSSA 2D2ZA 4TR4A 2IMIA 1G7OA 4HEA2 3EURA 1GL8A 2P31A 1BYEA 1C72A 1XVQA 3L9UA 2GSRA 1VRSD 1Z5YE 4O5RA 1U88A 4MZBA 5JCGA 1TU7A 4HQZA 3F3QA 1UN2A 3U5RE 4G9HA 3A3TA 13GSA 2P5QA 3C73A 2PUKC 3KJYA 2VIMA 1M9AA 2H6YA 2CV4A 4YQUA 3BCKA 3E0UA 2GQKA 3M1GA 3IK7A 1CQHA 2L5LA 2XHFA 5JWQB 4OO5A 1Y6EA 2L6DA 3W8SA 1TRSA 1AC1A 1F6MC 2VLVA 4IQAA 5CRGA 3CRTA 1EV4A 2H73A 5G31A 2XBQA 3DGQA 1I5GA 5D73A 2VO4A 2CZ3A 1ZMAA 3M0FA 3VI5A 4AJ7A 1SK0A 3EMXA 1HD2A 1OE8A 5FHIA 3DIEA 1VF2A 4BL7B 2MZCA 4LA1A 1QXHA 3GTUA 4V1Ap 5KN3A 2RUEA 4PQ1A 4KDUA 1SYXA 5INYA 3FW2A 2O85A 5IMDA 4NPBA 5HR3A 1XW9A 4JBBA 4G2EA 2R4VA 2XBIA 1WJKA 2OE3A 2WS2A 3LYKA 2WGRA 2IMFA 5D96A 5EY6A 2YANA 4OCEA 2DJ2A 3RBTA 3BOAA 2N5AA 2HQTA 3D22A 3PGTA 2VOCA 2NVLA 3ZMLA 1TI1A 3QMXA 4WBJA 1K0OA 1Z9HA 1K0BA 3CSIA 16GSA 2DBCA 2HLSA 1TXXA 1TRUA 3PPUA 1XPVA 3DEXA 4KUNA 4E8HA 5A5KA 5IIZA 2DC5A 4MZCA 4WXTA 4ML6A 2L6CA 5J5NA 2DLXA 22GSA 5DAKB 5DCGA 3LG6A 3DD3A 2HRNA 1EP7A 2HSYA 4HU9A 4ZB8A 1S3DA 5KN1A 6GSTA 3VK9A 1R5PA 3TKSC 2JSYA 1TK8B 4MJCA 3GKXA 1K0NA 4BWSA 3EINA 1XWAA 2CZ2A 6GSUA 2IWTA 3IAM2 1GUKA 3OR5A 2B1LA 3QFAC 2HNLA 3GN3A 3HDCA 3LWAA 5AISA 1ERWA 2LJAA 4K8MA 4EL1A 1ST9A 3HD5A 2LS5A 3HJPA 5HR1A 2H72A 3GNJA 3IBHA 4J57E 1X9SB 1DE2A 1E6BA 5ID2B 2H1BA 1B9XC 1K0MA 2YWMA 1LJRA 2OACA 5IMCA 3LXZA 1JZWA 4TXOB 3GURA 5ABRA 4Q5NA 5CP1A 1ML6A 2DIZA 3CRUA 5DALB 3DVXA 2IN3A 1THXA 4RQXA 3KM6A 1GSFA 3ZTLA 2YWIA 1SL2B 2GZYA 1ABAA 5A4VA 2ON7A 4Z7XA 2DJ1A 3HJOA 3TJFA 3D4TA 2FA4A 3ZFLA 1A23A 1GSDA 2GSQA 4OWYA 3SWLA 1M2AA 4DSSB 1JZRA 3FR9A 2GS3A 1Z3EA 1B8XA 3CYNA 2B7JA 2L57A 3UBLA 2CA8A 3CTFA 3ZITA 1N8JA 1NW2A 2GT6A 1X5CA 2C8UA 1ZCPA 2VCWA 2HRKA 4O32A 4TR3A 1R4WA 1PN9A 3A2WA 4MABA 2X8GA 4TR1B 2JSZA 5ID2A 3BD2A 4N11A 3IC8A 5CRDA 3TGZA 2GTUA 2YZUA 3CBUA 4MF7A 4TXOA 1O6JA 1XOAA 2CVBA 3WT1A 1QMVA 4MZWA 1QK8A 4K0GA 5DALA 1ACVA 4POLA 3ZL5A 2YJ7A 1K3YA 1PRXA 1XCCA 3EMPA 1JLVA 3ISOA 1HNAA 2HSMB 3CSJA 3EC3A 5F07A 3HZ4A 3IA1A 2PVOC 1T4ZA 2P5RA 3APSA 3BCIA 1Q98A 2B7KA 2C3TA 1YF1A 2JL4A 2OBKA 1VGLA 1GP1A 3I9V2 3TOUA 4GTUA 4AGSA 4KF9A 4ECCA 2V32A 4ISDA 1UA5A 2H0HA 4HU7A 3ME8A 1PGTA 4DSQA 1J08A 2VL2A 4DEJA 2DSAA 5D9TA 2FWFA 4EF0A 5IMFA 1KNGA 3C1SA 1SKSB 1FG4A 2TRXA 2J23A 1A2LA 5ECMB 2C0GA 2OA7A 2H75A 4JEDA 3HYPA 1XWGA 4TR1A 1V2AA 1TRWA 4ULXA 5B6MA 2F3MA 2MBTA 1BX9A 2C3QA 1BJXA 2MBSA 2ZCTA 3H8QA 2LUSA 12GSA 1PX7A 3P7XA 3TUEA 3ZIJA 1OVNA 3TKSE 2H71A 1T00A 2OJLA 3GKNA 1GSUA 1XOBA 3JCML 2I3YA 4IGJA 3L9VA 4XS4B 1XWCA 4ZBDA 5L71A 4HS1A 1ERUA 4YQMA 4XTSA 2A4VA 5D9VA 1I9DA 2HSMA 5G5FA 3IV4A 5IOXA 4EUYA 2FY6A 3LQ7A 5G5EA 4NV2A 1M2DA 2VLTA 5ECOB 4IS0A 2KUCA 4IN0A 4CHSA 4ECIA 4F0CA 1FVJA 1MDKA 3ED3A 2ALBA 3KMNA 2CVKA 5ELGA 1UVZA 1GNEA 2H6ZA 1MDIA 2F8AA 2DJ3A 4TW5A 4QL9A 3W8JA 3FK8A 3TDGA 3L9SA 4IJIA 2ZUPA 2MYGA 2M72A 4ZILA 1TK0B 2JZRA 4WEYA 3GA4A 4PUFC 5ECSA 1XIYA 4IW9A 3FYGA 1XW5A 2P0GA 3G7JA 3CSHA 3FKFA 4ILFA 4KX4A 4F9ZA 2PBJA 4F82A 4MF6A 4ZBBA 2M80A 5JCUA 4K7IA 1F2EA 4EE0A 4NMUA 2REMA 4GSSA 1ZGNA 1EOHA 1V58A 3MSZA 4BVXB 2LSTA 2VUPA 1TK5B 4NHZA 2VAFA 3DXBA 2H74A 2EC4A 4MLYA 3IC4A 1OKTA 1M2BA 4GQFA 4IVFA 2G0FA 4HJ2A 1X5EA 1B4PA 1OKDA 1X5DA 3QD9A 1THOA 1F9MA 1NHOA 2JADA 4OO4A 3R2QA 2N5BA 3PH9A 2JZSA 2KP2A 1K3OA 2AUVA 4K9ZA 4IQ1A 2CX3A 3QPMA 2VL3A 3ME7A 5D8IA 2QKEA 1XWKA 5AIXA 4KSOA 4L5LA 3VWVA 4FYUA 2FNOA 3F3RA 5CREA 3C7MA 4ZL8A 1GNWA 4RUVA 4KA0A 1ERTA 4BA7A 1SKWB 1YY7A 3GKKA 1U3IA 3FR6A 2FWEA 4X0XA 1URMA 4V1Ag 2LEGA 2O89A 3MDKA 4LLRA 3GKMA 3BJ5A 2F9SA 5B6NA 3RAZA 5IQYA 3EE2A 4O7HA 5D9WA 2K8VA 4BVXA 1F3AA 4PTSA 2B5XA 1O8XA 1EGRA 2B3SA 1WIKA 5IPHA 2HYXA 3KP8A 1SD9A 1T4YA 4JR4A 5J9BA 4WF4A 1YKAA 3ZRDA 1YQ1A 4MPFA 2JACA 4KAEA 1AQXA 2WB9A 3QOUA 2DMMA 3UVTA 3EYTA 1MTCA 7GSSA 3APQA 4MH3A 19GSA 3UIWA 1Q4JA 1H75A 4ZL7A 3GHAA 1AIUA 1PX6A 6GSXA 4MP4A 2KLXA 3GUSA 2TIRA 2YWOA 3CTGA 5HFGA 3LSZA 3HA9A 2DJKA 4I8BA 1NHYA 2OADA 2BTOT 2HZEB 4XRDA 1ZOFA 4MJBA 2YN1A 2LRTA 3DWVA 5LCZA 5IO0A 1RQMA 3O3TA 2RUFA 1A2JA 1K0DA 3IAS2 3A2XA 2V41A 4Q5QA 2LQQA 4GF0A 2FWHA 5EPFA 1YDKA 4F0BA 5F0GA 1S3CA 4PURA 3GX0A 4N10A 3IXRA 2H0GA 3AY8A 1H4OA 1Z7PA 3E9JB 1GTAA 2FCHA 4POMA 6GSWA 1M9BA 5F8BA 4ZIJA 3TKSA 4IKHA 3GV1A 4LL1B 5HQPA 4NHWA 2M46A 5IMAA 5EVOA 3UL3A 4F03A 1LBKA 3PR8A 3FR3A 2VCTA 3TJBA 4BL7A 4MH2A 3RHCA 5JWOB 1WPIA 3H79A 4PUAA 5ECNB 3HVXA 3IE3A 3KMOA 3PINA 4BWQA 1MD3A 4N0ZA 5H5QA 4AF2A 4V2MA 1OYJA 1Z6MA 2DIYA 4MA9A 2VCQA 1G0TA 2H66A 3FZ4A 1BQ7A 3KTBA 5ENUA 11GSA 2H70A 1LU4A 4YAPA 3GYKA 3KH9A 2CX4A 2TRCP 4HOJA 4E8EA 3LYPA 3QAGA 2B1KA 2I4AA 5B8BA 5J9CA 1FOVA 2H19A 1QGVA 1JZOA 3WT2A 1OE7A 5DAKA 1SL1B 1XFLA 2EIQA 2MMNA 3QR6A 1XZOA 3FY7A 4EDYA 3ERGA 3GSSA 1GSYA 4KGIA 4L5OA 3RHBA 4I97A 4OCFA 1PD21 3G7IA 3ZMKA 2XC2A 3Q18A 2LQOA 1MD4A 4LMWA 2N5FA 5DVBA 3MAKA 4PXOA 4NWYA 1OC8A 1X9MB 1BG5A 3Q6OA 5ECKB 4PNGA 2HXKA 5CYYA 3Q74A 1F3BA 4BPYA 4H86A 1EV9A 4P3YB 3TKPA 3GH9A 4TR0A 1SYRA 3KCMA 2YCDA 3ZFBA 2R3XA 2X64A 1UC7A 3VPTA 5GSTA 1EOGA 2GT5A 3HJMA 3R3EA 3P2AA 2GZZA 2YOIA 2YP6A 1USBA 1T3BA 4DSRA 4QL7A 3KIJA 1YZXA 2RLIA 3UJ1A 5D93A 3A2VA 3U6VA 2LKUA 2A2RA 2QSIA 5B7CA 1GWCA 2HE3A 2IPAA 3LGCA 3M9KA 2ES7A 1SL0B 1JZDA 4K2DA 1AXDA 1ILOA 4MJAA 4TVEA 4J56E 4GCIA 2QC7A 1Z6NA 3P8WA 10GSA 1E2YA 20GSA 6GSVA 2IFQB 5IPGA 3QDNA 4KDXA 4KDYA 4DSSA 2B5EA 2YV7A 4DVCA 2YJHA 4KNDA 3UEMA 3QAVA 1F37A 3F4TA 1V57A 1WRYA 3N9JA 5BMUA 4LMVA 4HI7A 2CAQA 1KTEA 3F4RA 3KXOA 1V98A 1TOFA 3SBCA 5GAND 2VCVA 2PWJA 4NAXA 4K6XA 2HFDA 1EEMA 1ERVA 2XPDA 2B5YA 3IK9A 1EEJA 5E59A 2V6OA 4K0NA 3H1NA 2NDOA 4OD7A 4FO5A 3TB2A 3D5JA 2OKAA 1FO5A 4MJEA 3RDWA 3TJJA 3HVVA 1PKZA 6GSYA 2PN8A 3H93A 3WGXA 1SD8A 8GSSA 1GSEA 4IBPA 3IDVA 4WETA 2V2GA 1R7HA 3J7Yb 1M99A 3HY2A 4CDOA 5G1LA 4I6XA 3ZLPA 3ZIVA 4WR5A 3L4NA 1WWJA 1DSBA 4HUAA 2PGTA 2MMAA 3F6DA 2HZFA 5AIVA 2IFQA 4WKWA 1TI3A 1SK2A 2HSHA 4TXVA 3F0IA 2RM6A 3KGKA 3ERFA 2JZTA 3N5OA 4ZB9A 1TKDB 4G0IA 4MF5A 2O87A 2VM2A 1GLQA 4PQIA 3DRNA 3FZ5A 5ECHB 5E4WA 2WZ9A 2V6KA 1AAZA 1XBSA 2G2QA 3TKRA 3DMLA 4MK3A 2VCZA 3F9UA 3NZNA 4GSNA 5ECLB 5DCHA 4RI6A 1A0FA 2IMEA 3HHVA 5HR2A 4EKZA 4HJMA 1SJZA 3HCZA 1WP0A 2PERA 1GTIA 5CRHA 3TRPA 1T8EB 4G10A 1HNBA 2FUG2 2VD1A 5IM9A 4NXIA 4YQVA 4XS4A 4KCEA 4D73B 2HRAA 2C80A 1SJ6A 5HR0A 1VF3A 3UMAA 5F06A 4EVMA 3UAPA 3MNGA 2LV3A 2C1YA 1FW1A 1U6TA 2WFCA 3KEBA 3FZAA 2O7KA 1WMJA 5J3RA 1VF4A 3WD6A 1VF1A 4KCAA 3D21A 1SK1A 2EIOA 1W89A 2O8VB 2X99A 1A8YA 4KE3A 3EU3A 1ZYQB 5HFKA 5H5SA 1Z7RA 3APOA 1FB6A 2DMLA 2E0QA 2LJKA 4KW6A 5ELAA 3VLNA 4ML1A 1BAYA 1V9WA 2GQLA 5JWRB 1DE1A 4CW9A 4OFMA 2JU5A 3L78A 1GTBA 2C0FA 2GLRA 5DJMA 5DBQA 5G2ZA 1DBYA 1T1VA 4LL4B 6GSSA 2L5OA 4MMMA 1ON4A 4HZ2A 4EO3A 4JZQA 4XCSA 3M9JA 2K6VA 3DVWA 4TN8A 2YV9A 2KHPA 2GVPA 3KZQA 1SENA 1XVWA 2NBSA 1RW1A 4IP6A 4WR4A 4D73A 1K3LA 1TJDA 3DKSA 2OBIA 1XXUA 3C1RA 1TP9A 9GSSA 3VI7A 1WOUA 2PU9C 2AHEA 2VM1A 3FZ9A 4G0LA 3F63A 4HQSA 2BJXA 2NTOA 2FWGA 3O76A 2ON5A 5ECPB 4GQCA 2E2GA 2WULA 3L0HA 4OFTA 4HZ4A 1R26A 3IR4A 4ECJA 3C71A 1NSWA 5C04A 2E2MA 1MEKA 1EGOA 2CVDA 3UOMA
chains in the Genus database with same CATH superfamily
5C00A 4JE1A 1NM3A 1QQ2A 2GSTA 1MDJA 1PN0A 3ZZXA 2PMTA 4MPGA 4PNFA 1AW9A 1TTZA 2LRNA 3EVIA 1OC9B 3LEFA 2R5GA 1K0CA 1GSQA 4L0WA 2CAIA 1IYHA 1AQWA 2R0CA 1PL2A 1SVMA 2GGTA 4YKGA 2IIYA 3HXSA 3QCPA 3NOFA 1ZYEA 3FEUA 3IPZA 4AKHA 2WVXA 4FXYP 18GSA 1U87A 5AN1A 5FT3A 2H1AA 2FHEA 4X43A 2H8LA 5CRWA 1JLWA 4ZL9A 1A8LA 4OFNA 4I2UA 1Y25A 4OMVA 3VWXA 3GX8A 5F05A 4KSMA 2VLUA 2J9HA 3UBKA 2YWNA 4J2FA 1B9YC 5B8AA 2FGXA 5GZZB 2VL9A 2YPMA 3P90A 4XHMA 2DJ0A 3BBYA 3EPTA 1GH2A 2RM5A 1G6WA 5H5RA 3O6TA 1O8WA 1HNCA 3QFBC 1RK4A 5KOWA 3I43A 1BEDA 5A34A 2L4QA 4XIHA 3GIXA 2K9FA 5A4UA 1PQNA 2PPTA 4JR6A 2NPBA 1XWBA 3H4KA 1G7EA 1S4BP 3G9BA 1OC3A 3LORA 3MIXA 2AB6A 1GLPA 3GRXA 1CQGA 1KEBA 1PMTA 2WRTA 4WF5A 3ZVJA 3GL3A 4ACSA 1OC9A 2R37A 2X8HA 2MMZA 4POBA 1XW6A 2HZEA 3KTLA 2HSNB 4EDZA 4L0UA 1GUMA 2HRKB 4HDEA 1JHBA 1EP8A 2VCXA 1SJIA 3CXGA 1GULA 4G0KA 4YH2A 4ID0A 1W4VA 1M7TA 4MDCA 4TOPA 1J9BA 4GWRA 3IHGA 1TDIA 3GSTA 2KP1A 4POKA 4F2IA 2H76A 3FRCA 3D6IA 5COHA 3HKRA 1ZZYA 3IOSA 3TCOA 4MCUA 4TRXA 3TKQA 2H1DA 4XS1A 1U3AA 1GUHA 4V2NA 3Q19A 4ZB6A 3M3MA 5D9XA 2H0IA 4I5QA 2A2SA 3VWUA 1PKWA 4BVYB 1YKCA 5AGYA 3VPQA 2X49A 3ZYWA 3C8EA 4X1UA 2OE1A 3M8NA 4QQ7A 4FYBA 4GLTA 5ECIB 5A4WA 3TJKA 2YNXA 4Q5RA 4EC0A 5J41A 1X0RA 3G7YA 2HSNA 4O92A 5JCWA 4GXZA 3HVSA 3EWLA 3V1WA 4K7NA 3WYWA 2K18A 1HQOA 2IMDA 2R2JA 2LNTA 3F8UA 3DYRA 2H6XA 4L8EA 3IRAA 1K0AA 14GSA 1SKRB 2BMXA 3VFIA 5KEJA 2PVQA 4FH8A 4XS6A 3TRQA 4I2TA 2C0EA 3RPNA 3UVHA 1M0UA 2FA8A 2Z9SA 3HZ8A 5DJLA 2LNSA 5GAPD 5LD0A 2I81A 2YZHA 5HFIA 3KH7A 3TRXA 4YKFA 3TU3B 3TJGA 5KN2A 2C0DA 1EZKA 1O81A 2L4CA 2DJJA 2WDUA 4BVYA 2IMKA 2WJUA 3ZREA 2HRFA 5KN0A 5ECQB 1O7UA 1GTUA 4E68A 5DDLA 4USSA 5IO2A 4PHZC 1A2MA 5CO3A 2B6MA 3WGDA 4GSTA 5IMVA 1PA3A 2ZNMA 3CMIA 1JFUA 3I69A 4YAVA 4GRFA 2H01A 2GDRA 2VL2C 1YF0A 5J4UA 4N0VA 1YEPA 1QFNA 2CT6A 1OAZA 4XRAA 3VWWA 4FQUA 4A5PA 1YEXA 4AJ8A 4ZBAA 3I6AA 1A24A 5IMZA 4AJ6A 2GQMA 2H30A 2QGVA 5G30A 2R6KA 3S9FA 1DUGA 3J7Yk 3MWHA 3LJRA 3KD0A 1YJ6A 2GSSA 1FAAA 2I9HA 1AUCA 2C4JA 5EL8A 5G1KA 1X9WB 3TOTA 2H1GA 4JU5A 2O36A 1WE0A 17GSA 5FWGA 4HSCX 3ZVJD 2GZPA 3GL5A 4RI7A 4PX1A 2MMOA 4Z2RA 2WCIA 1PSQA 3D4MA 5IOWA 3F6FA 2EIRA 3NIVA 2LRCA 3VURA 2LTKA 3KP9A 2K8SA 2X8CA 1HYUA 4FYCA 1TRVA 4K5RA 3LXTA 2FD3A 1A0RP 3US3A 4V2LA 2C3NA 5DQSA 5DQYA 4MNNA 4K1FA 4FIWA 3MYDA 2V1MA 1B4QA 4N30A 2AV4A 4K7OA 4RQRA 1V40A 1N2AA 2AAWA 5LNKe 4Q5FA 3ERWA 1TW9A 4ECBA 4EXJA 4JRRA 4PGTA 1G6YA 2I1UA 2LJRA 2CQ9A 1O73A 4N3ZA 4NV5A 1TU8A 2UZ8A 2E7PA 1XG8A 3EU4A 4K2XA 2IL3A 4PQHA 4IP1A 2OE0A 5J40A 1S3AA 4IHUA 2AJQB 1EWXA 1ZL9A 3RPPA 3IHQA 4KH7A 2WVZA 3GH6A 4ZXGA 2HT9A 2KOKA 3W6GA 3RFRC 3A5WA 1B48A 5CNWA 4TKYA 4O5UA 2F51A 3GMFA 2VD0A 3GFKA 4G19A 2L59A 4IJ3A 3FHKA 3E3EA 3K8NA 4KB3A 2AYTA 2F8FA 2HI7A 3F4SA 1QUWA 1GRXA 1SU9A 5GSSA 5ECRB 1IYIA 3LFLA 1FB0A 1J0FA 1PL1A 2FLSA 3UARA 1O85A 2RIIA 5CAXA 1AQVA 1T7PB 1KBNA 3GTUB 3QAWA 4WBRD 1FHEA 2XPEA 1R5AA 3D0ZA 2IJYA 1FVKA 3WGEA 4IELA 1GSSA 2D2ZA 4TR4A 2IMIA 1G7OA 4HEA2 3EURA 4ZB7A 1GL8A 2P31A 1BYEA 1C72A 1XVQA 3L9UA 2GSRA 1VRSD 1Z5YE 4O5RA 1U88A 4MZBA 5JCGA 1TU7A 4HQZA 3F3QA 1UN2A 4ICYA 3U5RE 4G9HA 3A3TA 13GSA 5J4YA 2P5QA 3C73A 2PUKC 3KJYA 2VIMA 1M9AA 2H6YA 2VKZG 2CV4A 4YQUA 3BCKA 3E0UA 2GQKA 3M1GA 3IK7A 1CQHA 2L5LA 2XHFA 5JWQB 4OO5A 1Y6EA 2L6DA 3W8SA 1TRSA 1AC1A 1F6MC 2VLVA 4IQAA 5CRGA 3CRTA 1EV4A 2H73A 5G31A 2XBQA 3DGQA 1I5GA 5D73A 2VO4A 2CZ3A 1ZMAA 3M0FA 3VI5A 4AJ7A 1SK0A 3EMXA 1HD2A 1OE8A 5FHIA 3DIEA 1VF2A 4BL7B 2MZCA 4LA1A 1QXHA 3GTUA 4V1Ap 5KN3A 2RUEA 1ZYPA 4PQ1A 4KDUA 1SYXA 5INYA 3FW2A 2O85A 5IMDA 4NPBA 5HR3A 1XW9A 4JBBA 4G2EA 2R4VA 2XBIA 1WJKA 2OE3A 2WS2A 3LYKA 2A2PA 2WGRA 2IMFA 5D96A 5EY6A 2YANA 4OCEA 4EIPA 1Y1UA 2DJ2A 3RBTA 3BOAA 2N5AA 2HQTA 3D22A 3FMWA 3PGTA 2VOCA 2NVLA 3ZMLA 1TI1A 3QMXA 4WBJA 1K0OA 1Z9HA 1K0BA 3CSIA 16GSA 2DBCA 2HLSA 1TXXA 1TRUA 3PPUA 1XPVA 3A5IA 3DEXA 4KUNA 4E8HA 5A5KA 5IIZA 2DC5A 4BIKA 4MZCA 4WXTA 4ML6A 2L6CA 5J5NA 2DLXA 22GSA 5DAKB 5DCGA 3LG6A 3DD3A 2HRNA 1EP7A 2HSYA 4HU9A 4ZB8A 1S3DA 5KN1A 6GSTA 3VK9A 1R5PA 3TKSC 2JSYA 1TK8B 4MJCA 3GKXA 1K0NA 4BWSA 3EINA 1XWAA 2CZ2A 6GSUA 2IWTA 3IAM2 1GUKA 3OR5A 2B1LA 3QFAC 2HNLA 3GN3A 3HDCA 3LWAA 5AISA 1ERWA 2LJAA 4K8MA 4EL1A 1ST9A 3HD5A 2LS5A 3HJPA 2EFDA 5HR1A 2H72A 3GNJA 3IBHA 4J57E 1X9SB 1DE2A 1E6BA 5ID2B 2H1BA 1B9XC 1K0MA 2YWMA 1LJRA 2OACA 5IMCA 3LXZA 1JZWA 4TXOB 3GURA 5ABRA 4Q5NA 5A5HB 1ML6A 5CP1A 2DIZA 3CRUA 5DALB 3DVXA 2IN3A 1THXA 5A1NB 4RQXA 1SVOA 3KM6A 1GSFA 3ZTLA 2YWIA 1SL2B 2GZYA 1ABAA 5A4VA 2ON7A 4Z7XA 2DJ1A 3HJOA 3TJFA 3D4TA 2FA4A 4K5SA 3ZFLA 1A23A 1GSDA 2GSQA 4OWYA 3SWLA 1M2AA 4DSSB 1JZRA 3FR9A 2GS3A 1YEWC 1Z3EA 1B8XA 3CYNA 2B7JA 2L57A 3UBLA 2CA8A 3CTFA 3ZITA 1N8JA 1NW2A 2GT6A 1X5CA 2C8UA 1ZCPA 2VCWA 1N25A 2HRKA 4X4JA 4O32A 4TR3A 1R4WA 1PN9A 4PI2C 3A2WA 4MABA 2X8GA 4TR1B 2JSZA 5ID2A 3BD2A 4N11A 3IC8A 5CRDA 3TGZA 2GTUA 2YZUA 3CBUA 4MF7A 4TXOA 1O6JA 1XOAA 2CVBA 3WT1A 1QMVA 4MZWA 1QK8A 4K0GA 5DALA 1ACVA 4POLA 3ZL5A 2YJ7A 1K3YA 1PRXA 5A1NA 1XCCA 3EMPA 1JLVA 3ISOA 1HNAA 2HSMB 3CSJA 3EC3A 5F07A 3HZ4A 3IA1A 2PVOC 1T4ZA 2P5RA 3APSA 3BCIA 1Q98A 2B7KA 2C3TA 1YF1A 2JL4A 2OBKA 1VGLA 1GP1A 3I9V2 3TOUA 4GTUA 4AGSA 4KF9A 4ECCA 2V32A 4ISDA 1UA5A 2H0HA 4HU7A 3ME8A 1PGTA 4DSQA 1J08A 2VL2A 4DEJA 2DSAA 5D9TA 2FWFA 4EF0A 5IMFA 1KNGA 3C1SA 1SKSB 5KOXA 1FG4A 2TRXA 2J23A 1A2LA 5ECMB 2C0GA 2OA7A 2H75A 4JEDA 3HYPA 1XWGA 4TR1A 1V2AA 1TRWA 4ULXA 5B6MA 2F3MA 3HMJG 2MBTA 1BX9A 2C3QA 1BJXA 2MBSA 2ZCTA 3H8QA 2LUSA 12GSA 1PX7A 3P7XA 3TUEA 3ZIJA 1OVNA 3TKSE 2H71A 1T00A 1ZYNA 3GKNA 1GSUA 2OJLA 1XOBA 3JCML 2I3YA 4IGJA 3L9VA 4XS4B 1XWCA 4ZBDA 5L71A 4HS1A 1ERUA 4YQMA 4XTSA 2A4VA 5D9VA 1I9DA 2HSMA 5G5FA 3IV4A 5IOXA 4EUYA 2FY6A 3LQ7A 5G5EA 4NV2A 1M2DA 2VLTA 5ECOB 4IS0A 2KUCA 4IN0A 4CHSA 4ECIA 4F0CA 1FVJA 1MDKA 3ED3A 4PI0C 2ALBA 3KMNA 2CVKA 5ELGA 1UVZA 1GNEA 2H6ZA 1MDIA 2F8AA 2DJ3A 2WW2A 4TW5A 4QL9A 3W8JA 3FK8A 2DKHA 3TDGA 3L9SA 1S3RA 4IJIA 2ZUPA 2MYGA 2M72A 4ZILA 4CY8A 1TK0B 4AI6A 2JZRA 4WEYA 3GA4A 4PUFC 5ECSA 1XIYA 4IW9A 3FYGA 1XW5A 2P0GA 3G7JA 3CSHA 3FKFA 4ILFA 4KX4A 4F9ZA 2PBJA 4F82A 4MF6A 4ZBBA 2M80A 5JCUA 4K7IA 1F2EA 4EE0A 4NMUA 2REMA 4GSSA 1ZGNA 1EOHA 1V58A 3MSZA 4BVXB 2LSTA 2VUPA 1TK5B 4NHZA 2VAFA 3DXBA 4AKIA 2H74A 2EC4A 4MLYA 3IC4A 1OKTA 1M2BA 4GQFA 4IVFA 2G0FA 4HJ2A 1X5EA 1B4PA 1OKDA 1X5DA 3QD9A 1THOA 4Z2UA 1F9MA 1NHOA 2JADA 4OO4A 3R2QA 4O5QA 2N5BA 3PH9A 2JZSA 2KP2A 1K3OA 1I1IP 2AUVA 4K9ZA 4IQ1A 2CX3A 3QPMA 2VL3A 3ME7A 2OT3A 5D8IA 2QKEA 1XWKA 5AIXA 4KSOA 4L5LA 3VWVA 4FYUA 2FNOA 3F3RA 5CREA 3C7MA 4ZL8A 1GNWA 4RUVA 4KA0A 1ERTA 4BA7A 1SKWB 1YY7A 3GKKA 1U3IA 2WW0A 3FR6A 2FWEA 4X0XA 1URMA 4V1Ag 2LEGA 2O89A 2DKIA 3MDKA 4LLRA 1SVLA 3GKMA 3BJ5A 2F9SA 5B6NA 3RAZA 5IQYA 3EE2A 4O7HA 2O3EA 5D9WA 2K8VA 4BVXA 1F3AA 4PTSA 2B5XA 1O8XA 1EGRA 2B3SA 1WIKA 5IPHA 2HYXA 1TXUA 3KP8A 1SD9A 1T4YA 4JR4A 5J9BA 4WF4A 1YKAA 3ZRDA 1YQ1A 4MPFA 2JACA 4KAEA 1AQXA 2WB9A 5A34B 3QOUA 2DMMA 3UVTA 3EYTA 5J47A 1MTCA 7GSSA 3APQA 4MH3A 19GSA 3UIWA 1Q4JA 1H75A 4ZL7A 3GHAA 1AIUA 1PX6A 6GSXA 4MP4A 2KLXA 3GUSA 2TIRA 2YWOA 3CTGA 5HFGA 3LSZA 3HA9A 2DJKA 2WZSA 4I8BA 1NHYA 2OADA 3RGBC 2BTOT 2HZEB 4XRDA 1ZOFA 4MJBA 2YN1A 2LRTA 3DWVA 5LCZA 1FOHA 5IO0A 1RQMA 1M3IA 3O3TA 2RUFA 1A2JA 1K0DA 3IAS2 3A2XA 2V41A 4Q5QA 2LQQA 4GF0A 2FWHA 5EPFA 1YDKA 4F0BA 5F0GA 1S3CA 4PURA 3GX0A 4N10A 3IXRA 2H0GA 3AY8A 1H4OA 1Z7PA 3E9JB 1GTAA 2FCHA 4POMA 3HVNA 4Z2TA 6GSWA 1M9BA 5F8BA 4ZIJA 3TKSA 4IKHA 3GV1A 4LL1B 5HQPA 3CHXC 4NHWA 2M46A 5IMAA 5EVOA 3UL3A 4F03A 1LBKA 3PR8A 3FR3A 2VCTA 3TJBA 2H1LA 2WW3A 4BL7A 4MH2A 3RHCA 5JWOB 1WPIA 3H79A 4PUAA 5ECNB 3HVXA 3IE3A 3KMOA 3PINA 4BWQA 1MD3A 4N0ZA 5H5QA 4AF2A 4V2MA 1OYJA 1Z6MA 2DIYA 4MA9A 2VCQA 1G0TA 2H66A 3FZ4A 1BQ7A 2UV8G 3KTBA 5ENUA 11GSA 2H70A 1LU4A 4YAPA 3GYKA 3KH9A 1BF5A 2CX4A 2TRCP 4HOJA 4E8EA 3LYPA 3QAGA 2B1KA 2I4AA 5B8BA 5J9CA 1FOVA 4EIQA 2H19A 1QGVA 1JZOA 3WT2A 2EFHA 1OE7A 5DAKA 1SL1B 1XFLA 2EIQA 2MMNA 3QR6A 1XZOA 3FY7A 4EDYA 3ERGA 3GSSA 1GSYA 4AKXB 4KGIA 4L5OA 3RHBA 4G01A 4I97A 4OCFA 1PD21 3G7IA 3ZMKA 2XC2A 3Q18A 2LQOA 1MD4A 4LMWA 2N5FA 5DVBA 3MAKA 4PXOA 4NWYA 1OC8A 1X9MB 1BG1A 1BG5A 3Q6OA 5ECKB 4PNGA 2HXKA 5BMUB 5CYYA 3Q74A 2QA2A 1F3BA 4BPYA 4H86A 1EV9A 4P3YB 3TKPA 3GH9A 4TR0A 1SYRA 3KCMA 2YCDA 3ZFBA 2R3XA 2X64A 1UC7A 3VPTA 5GSTA 4CY6A 1EOGA 2GT5A 3HJMA 3R3EA 3P2AA 2GZZA 2R0PA 2A4HA 2YOIA 2YP6A 1USBA 1T3BA 4DSRA 4QL7A 5A5HA 3KIJA 1YZXA 2RLIA 3UJ1A 5D93A 3A2VA 3U6VA 2LKUA 2A2RA 3CQFA 2QSIA 5B7CA 1GWCA 2HE3A 2IPAA 3LGCA 3M9KA 2ES7A 1SL0B 1JZDA 4K2DA 1AXDA 1ILOA 4MJAA 4TVEA 4J56E 4GCIA 2QC7A 1Z6NA 3P8WA 10GSA 1E2YA 20GSA 6GSVA 2IFQB 5IPGA 3QDNA 4KDXA 4KDYA 4DSSA 2B5EA 2YV7A 4DVCA 2YJHA 4KNDA 3UEMA 3QAVA 1F37A 3F4TA 1V57A 1WRYA 3N9JA 5BMUA 4LMVA 4HI7A 2CAQA 1KTEA 3F4RA 3KXOA 1V98A 1TOFA 3SBCA 5GAND 2VCVA 2PWJA 4NAXA 4K6XA 2HFDA 1EEMA 1ERVA 2XPDA 2B5YA 3IK9A 1EEJA 5E59A 2V6OA 4K0NA 3H1NA 2NDOA 4OD7A 4FO5A 3TB2A 3D5JA 4GDFA 2OKAA 2R0GA 1FO5A 4MJEA 3RDWA 3TJJA 3HVVA 1PKZA 6GSYA 2PN8A 3H93A 3WGXA 1SD8A 8GSSA 1GSEA 4IBPA 3IDVA 4WETA 2V2GA 1R7HA 3J7Yb 1M99A 3HY2A 4CDOA 5G1LA 4I6XA 3ZLPA 3ZIVA 4WR5A 3L4NA 5BRTA 1WWJA 1DSBA 4HUAA 2PGTA 5J4VA 2EFEA 2MMAA 3F6DA 2HZFA 5AIVA 2IFQA 4WKWA 1TI3A 1SK2A 2QA1A 2HSHA 4TXVA 3F0IA 3CWGA 1YVLA 2RM6A 3KGKA 1M3JA 3ERFA 2JZTA 3N5OA 4ZB9A 1TKDB 4G0IA 4MF5A 2O87A 2VM2A 1GLQA 4PQIA 3DRNA 1PFOA 3FZ5A 5ECHB 5E4WA 2WZ9A 2V6KA 1AAZA 1XBSA 2G2QA 3TKRA 3DMLA 4MK3A 2VCZA 3F9UA 3NZNA 4GSNA 5ECLB 5DCHA 4RI6A 1A0FA 2IMEA 3HHVA 5HR2A 4EKZA 4HJMA 1SJZA 3HCZA 1WP0A 2PERA 1GTIA 5CRHA 3TRPA 1T8EB 4G10A 1HNBA 2FUG2 2VD1A 2WVYA 5IM9A 2EFCA 4NXIA 4YQVA 4XS4A 4KCEA 4D73B 4AKGA 2HRAA 2C80A 1SJ6A 5HR0A 1VF3A 3UMAA 5F06A 4EVMA 3UAPA 3MNGA 2LV3A 2C1YA 1FW1A 1U6TA 2WFCA 3KEBA 3FZAA 2O7KA 1WMJA 5J3RA 1VF4A 3WD6A 4QMKA 1VF1A 4KCAA 3D21A 1SK1A 2EIOA 1W89A 2O8VB 2X99A 1A8YA 4KE3A 3EU3A 1ZYQB 5HFKA 5H5SA 1Z7RA 3APOA 1FB6A 2DMLA 2E0QA 2LJKA 2O5VA 4KW6A 5ELAA 3VLNA 4ML1A 1BAYA 1V9WA 2GQLA 5JWRB 1DE1A 4W66A 4CW9A 4OFMA 2JU5A 3L78A 1GTBA 2C0FA 2GLRA 5DJMA 5DBQA 5G2ZA 1DBYA 1T1VA 4LL4B 6GSSA 2L5OA 4MMMA 2WVXB 1ON4A 4HZ2A 2X4AA 4EO3A 4JZQA 4XCSA 3M9JA 2K6VA 3DVWA 4TN8A 3LW9A 2YV9A 2KHPA 2GVPA 3KZQA 1SENA 1XVWA 2NBSA 1RW1A 4IP6A 2WW1A 4WR4A 4D73A 1K3LA 1TJDA 3DKSA 2OBIA 1XXUA 3C1RA 1TP9A 9GSSA 3VI7A 1WOUA 2PU9C 2AHEA 2VM1A 3FZ9A 4G0LA 3F63A 4HQSA 2BJXA 2NTOA 2FWGA 3O76A 2ON5A 5ECPB 4GQCA 2E2GA 2WULA 3L0HA 4OFTA 4HZ4A 1R26A 3IR4A 4ECJA 3C71A 1NSWA 5C04A 2E2MA 1MEKA 1EGOA 2CVDA 3UOMA
chains in the Genus database with same CATH topology
5C00A 4JE1A 1NM3A 1QQ2A 2GSTA 1MDJA 1PN0A 3ZZXA 2PMTA 4MPGA 4PNFA 1AW9A 1TTZA 2LRNA 3EVIA 1OC9B 3LEFA 2R5GA 1K0CA 1GSQA 4L0WA 2CAIA 1IYHA 1AQWA 2R0CA 1PL2A 1SVMA 2GGTA 4YKGA 2IIYA 3HXSA 3QCPA 3NOFA 1ZYEA 3FEUA 3IPZA 4AKHA 18GSA 1U87A 5AN1A 5FT3A 2H1AA 2FHEA 4X43A 2H8LA 5CRWA 1JLWA 4ZL9A 1A8LA 4OFNA 4I2UA 1Y25A 4OMVA 3VWXA 3GX8A 5F05A 4KSMA 2VLUA 2J9HA 3UBKA 2YWNA 4J2FA 1B9YC 5B8AA 2FGXA 5GZZB 2VL9A 2YPMA 3P90A 4XHMA 2DJ0A 3BBYA 3EPTA 1GH2A 2RM5A 1G6WA 5H5RA 3O6TA 1O8WA 1HNCA 3QFBC 1RK4A 5KOWA 3I43A 1BEDA 5A34A 2L4QA 4XIHA 3GIXA 2K9FA 5A4UA 1PQNA 2PPTA 4JR6A 2NPBA 1XWBA 3H4KA 1G7EA 3G9BA 1OC3A 3LORA 3MIXA 2AB6A 1GLPA 3GRXA 1CQGA 1KEBA 1PMTA 2WRTA 4WF5A 3ZVJA 3GL3A 4ACSA 1OC9A 2R37A 2X8HA 2MMZA 4POBA 1XW6A 2HZEA 3KTLA 2HSNB 4EDZA 4L0UA 1GUMA 2HRKB 4HDEA 1JHBA 1EP8A 2VCXA 1SJIA 3CXGA 1GULA 4G0KA 4YH2A 4ID0A 1W4VA 1M7TA 4MDCA 4TOPA 1J9BA 4GWRA 3IHGA 1TDIA 3GSTA 2KP1A 4POKA 4F2IA 2H76A 3FRCA 3D6IA 5COHA 3HKRA 1ZZYA 3IOSA 3TCOA 4MCUA 4TRXA 3TKQA 2H1DA 4XS1A 1U3AA 1GUHA 4V2NA 3Q19A 4ZB6A 3M3MA 5D9XA 2H0IA 4I5QA 2A2SA 3VWUA 1PKWA 4BVYB 1YKCA 5AGYA 3VPQA 2X49A 3ZYWA 3C8EA 4X1UA 2OE1A 3M8NA 4QQ7A 4FYBA 4GLTA 5ECIB 5A4WA 3TJKA 2YNXA 4Q5RA 4EC0A 5J41A 1X0RA 3G7YA 2HSNA 4O92A 5JCWA 4GXZA 3HVSA 3EWLA 3V1WA 4K7NA 3WYWA 2K18A 1HQOA 2IMDA 2R2JA 2LNTA 3F8UA 3DYRA 2H6XA 4L8EA 3IRAA 1K0AA 14GSA 1SKRB 2BMXA 3VFIA 5KEJA 2PVQA 4FH8A 4XS6A 3TRQA 4I2TA 2C0EA 3RPNA 3UVHA 1M0UA 2FA8A 2Z9SA 3HZ8A 5DJLA 2LNSA 5GAPD 5LD0A 2I81A 2YZHA 5HFIA 3KH7A 3TRXA 4YKFA 3TU3B 3TJGA 5KN2A 2C0DA 1EZKA 1O81A 2L4CA 2DJJA 2WDUA 4BVYA 2IMKA 2WJUA 3ZREA 2HRFA 5KN0A 5ECQB 1O7UA 1GTUA 4E68A 5DDLA 4USSA 5IO2A 1A2MA 5CO3A 2B6MA 3WGDA 4GSTA 5IMVA 1PA3A 2ZNMA 3CMIA 1JFUA 3I69A 4YAVA 4GRFA 2H01A 2GDRA 2VL2C 1YF0A 5J4UA 4N0VA 1YEPA 1QFNA 2CT6A 1OAZA 4XRAA 3VWWA 4FQUA 4A5PA 1YEXA 4AJ8A 4ZBAA 3I6AA 1A24A 5IMZA 4AJ6A 2GQMA 2H30A 2QGVA 5G30A 2R6KA 3S9FA 1DUGA 3J7Yk 3MWHA 3LJRA 3KD0A 1YJ6A 2GSSA 1FAAA 2I9HA 1AUCA 2C4JA 5EL8A 5G1KA 1X9WB 3TOTA 2H1GA 4JU5A 1WE0A 17GSA 5FWGA 3ZVJD 2GZPA 3GL5A 4RI7A 4PX1A 2MMOA 4Z2RA 2WCIA 1PSQA 3D4MA 5IOWA 3F6FA 2EIRA 3NIVA 2LRCA 3VURA 2LTKA 3KP9A 2K8SA 2X8CA 1HYUA 4FYCA 1TRVA 4K5RA 3LXTA 2FD3A 1A0RP 3US3A 4V2LA 2C3NA 5DQSA 5DQYA 4MNNA 4K1FA 4FIWA 3MYDA 2V1MA 1B4QA 4N30A 2AV4A 4K7OA 4RQRA 1V40A 1N2AA 2AAWA 5LNKe 4Q5FA 3ERWA 1TW9A 4ECBA 4EXJA 4JRRA 4PGTA 1G6YA 2I1UA 2LJRA 2CQ9A 1O73A 4N3ZA 4NV5A 1TU8A 2UZ8A 2E7PA 3EU4A 4K2XA 2IL3A 4PQHA 4IP1A 2OE0A 5J40A 1S3AA 4IHUA 2AJQB 1EWXA 1ZL9A 3RPPA 3IHQA 4KH7A 3GH6A 4ZXGA 2HT9A 2KOKA 3W6GA 3A5WA 1B48A 5CNWA 4TKYA 4O5UA 2F51A 3GMFA 2VD0A 3GFKA 4G19A 2L59A 4IJ3A 3FHKA 3E3EA 3K8NA 4KB3A 2AYTA 2F8FA 2HI7A 3F4SA 1QUWA 1GRXA 1SU9A 5GSSA 5ECRB 1IYIA 3LFLA 1FB0A 1J0FA 1PL1A 2FLSA 3UARA 1O85A 2RIIA 5CAXA 1AQVA 1T7PB 1KBNA 3GTUB 3QAWA 4WBRD 1FHEA 2XPEA 1R5AA 3D0ZA 2IJYA 1FVKA 3WGEA 4IELA 1GSSA 2D2ZA 4TR4A 2IMIA 1G7OA 4HEA2 3EURA 4ZB7A 1GL8A 2P31A 1BYEA 1C72A 1XVQA 3L9UA 2GSRA 1VRSD 1Z5YE 4O5RA 1U88A 4MZBA 5JCGA 1TU7A 4HQZA 3F3QA 1UN2A 4ICYA 3U5RE 4G9HA 3A3TA 13GSA 5J4YA 2P5QA 3C73A 2PUKC 3KJYA 2VIMA 1M9AA 2H6YA 2VKZG 2CV4A 4YQUA 3BCKA 3E0UA 2GQKA 3M1GA 3IK7A 1CQHA 2L5LA 2XHFA 5JWQB 4OO5A 1Y6EA 2L6DA 3W8SA 1TRSA 1AC1A 1F6MC 2VLVA 4IQAA 5CRGA 3CRTA 1EV4A 2H73A 5G31A 2XBQA 3DGQA 1I5GA 5D73A 2VO4A 2CZ3A 1ZMAA 3M0FA 3VI5A 4AJ7A 1SK0A 3EMXA 1HD2A 1OE8A 5FHIA 3DIEA 1VF2A 4BL7B 2MZCA 4LA1A 1QXHA 3GTUA 4V1Ap 5KN3A 2RUEA 1ZYPA 4PQ1A 4KDUA 1SYXA 5INYA 3FW2A 2O85A 5IMDA 4NPBA 5HR3A 1XW9A 4JBBA 4G2EA 2R4VA 2XBIA 1WJKA 2OE3A 2WS2A 3LYKA 2A2PA 2WGRA 2IMFA 5D96A 5EY6A 2YANA 4OCEA 4EIPA 1Y1UA 2DJ2A 3RBTA 3BOAA 2N5AA 2HQTA 3D22A 3FMWA 3PGTA 2VOCA 2NVLA 3ZMLA 1TI1A 3QMXA 4WBJA 1K0OA 1Z9HA 1K0BA 3CSIA 16GSA 2DBCA 2HLSA 1TXXA 1TRUA 3PPUA 1XPVA 3A5IA 3DEXA 4KUNA 4E8HA 5A5KA 5IIZA 2DC5A 4MZCA 4WXTA 4ML6A 2L6CA 5J5NA 2DLXA 22GSA 5DAKB 5DCGA 3LG6A 3DD3A 2HRNA 1EP7A 2HSYA 4HU9A 4ZB8A 1S3DA 5KN1A 6GSTA 3VK9A 1R5PA 3TKSC 2JSYA 1TK8B 4MJCA 3GKXA 1K0NA 4BWSA 3EINA 1XWAA 2CZ2A 6GSUA 2IWTA 3IAM2 1GUKA 3OR5A 2B1LA 3QFAC 2HNLA 3GN3A 3HDCA 3LWAA 5AISA 1ERWA 2LJAA 4K8MA 4EL1A 1ST9A 3HD5A 2LS5A 3HJPA 2EFDA 5HR1A 2H72A 3GNJA 3IBHA 4J57E 1X9SB 1DE2A 1E6BA 5ID2B 2H1BA 1B9XC 1K0MA 2YWMA 1LJRA 2OACA 5IMCA 3LXZA 1JZWA 4TXOB 3GURA 5ABRA 4Q5NA 5A5HB 1ML6A 5CP1A 2DIZA 3CRUA 5DALB 3DVXA 2IN3A 1THXA 5A1NB 4RQXA 1SVOA 3KM6A 1GSFA 3ZTLA 2YWIA 1SL2B 2GZYA 1ABAA 5A4VA 2ON7A 4Z7XA 2DJ1A 3HJOA 3TJFA 3D4TA 2FA4A 4K5SA 3ZFLA 1A23A 1GSDA 2GSQA 4OWYA 3SWLA 1M2AA 4DSSB 1JZRA 3FR9A 2GS3A 1Z3EA 1B8XA 3CYNA 2B7JA 2L57A 3UBLA 2CA8A 3CTFA 3ZITA 1N8JA 1NW2A 2GT6A 1X5CA 2C8UA 1ZCPA 2VCWA 1N25A 2HRKA 4X4JA 4O32A 4TR3A 1R4WA 1PN9A 3A2WA 4MABA 2X8GA 4TR1B 2JSZA 5ID2A 3BD2A 4N11A 3IC8A 5CRDA 3TGZA 2GTUA 2YZUA 3CBUA 4MF7A 4TXOA 1O6JA 1XOAA 2CVBA 3WT1A 1QMVA 4MZWA 1QK8A 4K0GA 5DALA 1ACVA 4POLA 3ZL5A 2YJ7A 1K3YA 1PRXA 5A1NA 1XCCA 3EMPA 1JLVA 3ISOA 1HNAA 2HSMB 3CSJA 3EC3A 5F07A 3HZ4A 3IA1A 2PVOC 1T4ZA 2P5RA 3APSA 3BCIA 1Q98A 2B7KA 2C3TA 1YF1A 2JL4A 2OBKA 1VGLA 1GP1A 3I9V2 3TOUA 4GTUA 4AGSA 4KF9A 4ECCA 2V32A 4ISDA 1UA5A 2H0HA 4HU7A 3ME8A 1PGTA 4DSQA 1J08A 2VL2A 4DEJA 2DSAA 5D9TA 2FWFA 4EF0A 5IMFA 1KNGA 3C1SA 1SKSB 5KOXA 1FG4A 2TRXA 2J23A 1A2LA 5ECMB 2C0GA 2OA7A 2H75A 4JEDA 3HYPA 1XWGA 4TR1A 1V2AA 1TRWA 4ULXA 5B6MA 2F3MA 3HMJG 2MBTA 1BX9A 2C3QA 1BJXA 2MBSA 2ZCTA 3H8QA 2LUSA 12GSA 1PX7A 3P7XA 3TUEA 3ZIJA 1OVNA 3TKSE 2H71A 1T00A 1ZYNA 3GKNA 1GSUA 2OJLA 1XOBA 3JCML 2I3YA 4IGJA 3L9VA 4XS4B 1XWCA 4ZBDA 5L71A 4HS1A 1ERUA 4YQMA 4XTSA 2A4VA 5D9VA 1I9DA 2HSMA 5G5FA 3IV4A 5IOXA 4EUYA 2FY6A 3LQ7A 5G5EA 4NV2A 1M2DA 2VLTA 5ECOB 4IS0A 2KUCA 4IN0A 4CHSA 4ECIA 4F0CA 1FVJA 1MDKA 3ED3A 2ALBA 3KMNA 2CVKA 5ELGA 1UVZA 1GNEA 2H6ZA 1MDIA 2F8AA 2DJ3A 4TW5A 4QL9A 3W8JA 3FK8A 2DKHA 3TDGA 3L9SA 4IJIA 2ZUPA 2MYGA 2M72A 4ZILA 4CY8A 1TK0B 4AI6A 2JZRA 4WEYA 3GA4A 4PUFC 5ECSA 1XIYA 4IW9A 3FYGA 1XW5A 2P0GA 3G7JA 3CSHA 3FKFA 4ILFA 4KX4A 4F9ZA 2PBJA 4F82A 4MF6A 4ZBBA 2M80A 5JCUA 4K7IA 1F2EA 4EE0A 4NMUA 2REMA 4GSSA 1ZGNA 1EOHA 1V58A 3MSZA 4BVXB 2LSTA 2VUPA 1TK5B 4NHZA 2VAFA 3DXBA 4AKIA 2H74A 2EC4A 4MLYA 3IC4A 1OKTA 1M2BA 4GQFA 4IVFA 2G0FA 4HJ2A 1X5EA 1B4PA 1OKDA 1X5DA 3QD9A 1THOA 4Z2UA 1F9MA 1NHOA 2JADA 4OO4A 3R2QA 4O5QA 2N5BA 3PH9A 2JZSA 2KP2A 1K3OA 2AUVA 4K9ZA 4IQ1A 2CX3A 3QPMA 2VL3A 3ME7A 2OT3A 5D8IA 2QKEA 1XWKA 5AIXA 4KSOA 4L5LA 3VWVA 4FYUA 2FNOA 3F3RA 5CREA 3C7MA 4ZL8A 1GNWA 4RUVA 4KA0A 1ERTA 4BA7A 1SKWB 1YY7A 3GKKA 1U3IA 3FR6A 2FWEA 4X0XA 1URMA 4V1Ag 2LEGA 2O89A 2DKIA 3MDKA 4LLRA 1SVLA 3GKMA 3BJ5A 2F9SA 5B6NA 3RAZA 5IQYA 3EE2A 4O7HA 5D9WA 2K8VA 4BVXA 1F3AA 4PTSA 2B5XA 1O8XA 1EGRA 2B3SA 1WIKA 5IPHA 2HYXA 1TXUA 3KP8A 1SD9A 1T4YA 4JR4A 5J9BA 4WF4A 1YKAA 3ZRDA 1YQ1A 4MPFA 2JACA 4KAEA 1AQXA 2WB9A 5A34B 3QOUA 2DMMA 3UVTA 3EYTA 5J47A 1MTCA 7GSSA 3APQA 4MH3A 19GSA 3UIWA 1Q4JA 1H75A 4ZL7A 3GHAA 1AIUA 1PX6A 6GSXA 4MP4A 2KLXA 3GUSA 2TIRA 2YWOA 3CTGA 5HFGA 3LSZA 3HA9A 2DJKA 4I8BA 1NHYA 2OADA 2BTOT 2HZEB 4XRDA 1ZOFA 4MJBA 2YN1A 2LRTA 3DWVA 5LCZA 1FOHA 5IO0A 1RQMA 3O3TA 2RUFA 1A2JA 1K0DA 3IAS2 3A2XA 2V41A 4Q5QA 2LQQA 4GF0A 2FWHA 5EPFA 1YDKA 4F0BA 5F0GA 1S3CA 4PURA 3GX0A 4N10A 3IXRA 2H0GA 3AY8A 1H4OA 1Z7PA 3E9JB 1GTAA 2FCHA 4POMA 4Z2TA 6GSWA 1M9BA 5F8BA 4ZIJA 3TKSA 4IKHA 3GV1A 4LL1B 5HQPA 4NHWA 2M46A 5IMAA 5EVOA 3UL3A 4F03A 1LBKA 3PR8A 3FR3A 2VCTA 3TJBA 2H1LA 4BL7A 4MH2A 3RHCA 5JWOB 1WPIA 3H79A 4PUAA 5ECNB 3HVXA 3IE3A 3KMOA 3PINA 4BWQA 1MD3A 4N0ZA 5H5QA 4AF2A 4V2MA 1OYJA 1Z6MA 2DIYA 4MA9A 2VCQA 1G0TA 2H66A 3FZ4A 1BQ7A 2UV8G 3KTBA 5ENUA 11GSA 2H70A 1LU4A 4YAPA 3GYKA 3KH9A 1BF5A 2CX4A 2TRCP 4HOJA 4E8EA 3LYPA 3QAGA 2B1KA 2I4AA 5B8BA 5J9CA 1FOVA 4EIQA 2H19A 1QGVA 1JZOA 3WT2A 2EFHA 1OE7A 5DAKA 1SL1B 1XFLA 2EIQA 2MMNA 3QR6A 1XZOA 3FY7A 4EDYA 3ERGA 3GSSA 1GSYA 4AKXB 4KGIA 4L5OA 3RHBA 4G01A 4I97A 4OCFA 1PD21 3G7IA 3ZMKA 2XC2A 3Q18A 2LQOA 1MD4A 4LMWA 2N5FA 5DVBA 3MAKA 4PXOA 4NWYA 1OC8A 1X9MB 1BG1A 1BG5A 3Q6OA 5ECKB 4PNGA 2HXKA 5BMUB 5CYYA 3Q74A 2QA2A 1F3BA 4BPYA 4H86A 1EV9A 4P3YB 3TKPA 3GH9A 4TR0A 1SYRA 3KCMA 2YCDA 3ZFBA 2R3XA 2X64A 1UC7A 3VPTA 5GSTA 4CY6A 1EOGA 2GT5A 3HJMA 3R3EA 3P2AA 2GZZA 2R0PA 2A4HA 2YOIA 2YP6A 1USBA 1T3BA 4DSRA 4QL7A 5A5HA 3KIJA 1YZXA 2RLIA 3UJ1A 5D93A 3A2VA 3U6VA 2LKUA 2A2RA 2QSIA 5B7CA 1GWCA 2HE3A 2IPAA 3LGCA 3M9KA 2ES7A 1SL0B 1JZDA 4K2DA 1AXDA 1ILOA 4MJAA 4TVEA 4J56E 4GCIA 2QC7A 1Z6NA 3P8WA 10GSA 1E2YA 20GSA 6GSVA 2IFQB 5IPGA 3QDNA 4KDXA 4KDYA 4DSSA 2B5EA 2YV7A 4DVCA 2YJHA 4KNDA 3UEMA 3QAVA 1F37A 3F4TA 1V57A 1WRYA 3N9JA 5BMUA 4LMVA 4HI7A 2CAQA 1KTEA 3F4RA 3KXOA 1V98A 1TOFA 3SBCA 5GAND 2VCVA 2PWJA 4NAXA 4K6XA 2HFDA 1EEMA 1ERVA 2XPDA 2B5YA 3IK9A 1EEJA 5E59A 2V6OA 4K0NA 3H1NA 2NDOA 4OD7A 4FO5A 3TB2A 3D5JA 4GDFA 2OKAA 2R0GA 1FO5A 4MJEA 3RDWA 3TJJA 3HVVA 1PKZA 6GSYA 2PN8A 3H93A 3WGXA 1SD8A 8GSSA 1GSEA 4IBPA 3IDVA 4WETA 2V2GA 1R7HA 3J7Yb 1M99A 3HY2A 4CDOA 5G1LA 4I6XA 3ZLPA 3ZIVA 4WR5A 3L4NA 5BRTA 1WWJA 1DSBA 4HUAA 2PGTA 5J4VA 2EFEA 2MMAA 3F6DA 2HZFA 5AIVA 2IFQA 4WKWA 1TI3A 1SK2A 2QA1A 2HSHA 4TXVA 3F0IA 3CWGA 1YVLA 2RM6A 3KGKA 3ERFA 2JZTA 3N5OA 4ZB9A 1TKDB 4G0IA 4MF5A 2O87A 2VM2A 1GLQA 4PQIA 3DRNA 3FZ5A 5ECHB 5E4WA 2WZ9A 2V6KA 1AAZA 1XBSA 2G2QA 3TKRA 3DMLA 4MK3A 2VCZA 3F9UA 3NZNA 4GSNA 5ECLB 5DCHA 4RI6A 1A0FA 2IMEA 3HHVA 5HR2A 4EKZA 4HJMA 1SJZA 3HCZA 1WP0A 2PERA 1GTIA 5CRHA 3TRPA 1T8EB 4G10A 1HNBA 2FUG2 2VD1A 5IM9A 2EFCA 4NXIA 4YQVA 4XS4A 4KCEA 4D73B 4AKGA 2HRAA 2C80A 1SJ6A 5HR0A 1VF3A 3UMAA 5F06A 4EVMA 3UAPA 3MNGA 2LV3A 2C1YA 1FW1A 1U6TA 2WFCA 3KEBA 3FZAA 2O7KA 1WMJA 5J3RA 1VF4A 3WD6A 4QMKA 1VF1A 4KCAA 3D21A 1SK1A 2EIOA 1W89A 2O8VB 2X99A 1A8YA 4KE3A 3EU3A 1ZYQB 5HFKA 5H5SA 1Z7RA 3APOA 1FB6A 2DMLA 2E0QA 2LJKA 2O5VA 4KW6A 5ELAA 3VLNA 4ML1A 1BAYA 1V9WA 2GQLA 5JWRB 1DE1A 4W66A 4CW9A 4OFMA 2JU5A 3L78A 1GTBA 2C0FA 2GLRA 5DJMA 5DBQA 5G2ZA 1DBYA 1T1VA 4LL4B 6GSSA 2L5OA 4MMMA 1ON4A 4HZ2A 2X4AA 4EO3A 4JZQA 4XCSA 3M9JA 2K6VA 3DVWA 4TN8A 3LW9A 2YV9A 2KHPA 2GVPA 3KZQA 1SENA 1XVWA 2NBSA 1RW1A 4IP6A 4WR4A 4D73A 1K3LA 1TJDA 3DKSA 2OBIA 1XXUA 3C1RA 1TP9A 9GSSA 3VI7A 1WOUA 2PU9C 2AHEA 2VM1A 3FZ9A 4G0LA 3F63A 4HQSA 2BJXA 2NTOA 2FWGA 3O76A 2ON5A 5ECPB 4GQCA 2E2GA 2WULA 3L0HA 4OFTA 4HZ4A 1R26A 3IR4A 4ECJA 3C71A 1NSWA 5C04A 2E2MA 1MEKA 1EGOA 2CVDA 3UOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C00 A;  4JE1 A;  1NM3 A;  1QQ2 A;  2GST A;  1MDJ A;  3ZZX A;  2PMT A;  4MPG A;  4PNF A;  1AW9 A;  1TTZ A;  2LRN A;  3EVI A;  1OC9 B;  3LEF A;  2R5G A;  1K0C A;  1GSQ A;  4L0W A;  2CAI A;  1IYH A;  1AQW A;  1PL2 A;  2GGT A;  2IIY A;  3HXS A;  3QCP A;  3NOF A;  1ZYE A;  3FEU A;  3IPZ A;  18GS A;  1U87 A;  5AN1 A;  5FT3 A;  2H1A A;  2FHE A;  4X43 A;  2H8L A;  5CRW A;  1JLW A;  4ZL9 A;  1A8L A;  4OFN A;  4I2U A;  1Y25 A;  4OMV A;  3VWX A;  3GX8 A;  5F05 A;  4KSM A;  2VLU A;  2J9H A;  3UBK A;  2YWN A;  4J2F A;  1B9Y C;  5B8A A;  2FGX A;  5GZZ B;  2VL9 A;  2YPM A;  3P90 A;  4XHM A;  2DJ0 A;  3BBY A;  1GH2 A;  2RM5 A;  1G6W A;  5H5R A;  3O6T A;  1O8W A;  1HNC A;  3QFB C;  1RK4 A;  3I43 A;  1BED A;  2L4Q A;  4XIH A;  3GIX A;  2K9F A;  5A4U A;  1PQN A;  2PPT A;  4JR6 A;  2NPB A;  1XWB A;  3H4K A;  1G7E A;  3G9B A;  1OC3 A;  3LOR A;  2AB6 A;  1GLP A;  3GRX A;  1CQG A;  1KEB A;  1PMT A;  2WRT A;  4WF5 A;  3ZVJ A;  3GL3 A;  4ACS A;  1OC9 A;  2R37 A;  2X8H A;  2MMZ A;  4POB A;  1XW6 A;  2HZE A;  3KTL A;  2HSN B;  4EDZ A;  4L0U A;  1GUM A;  2HRK B;  4HDE A;  1JHB A;  1EP8 A;  2VCX A;  1SJI A;  3CXG A;  1GUL A;  4G0K A;  4YH2 A;  4ID0 A;  1W4V A;  1M7T A;  4MDC A;  4TOP A;  1J9B A;  4GWR A;  1TDI A;  3GST A;  2KP1 A;  4POK A;  4F2I A;  2H76 A;  3FRC A;  3D6I A;  5COH A;  3HKR A;  1ZZY A;  3IOS A;  3TCO A;  4MCU A;  4TRX A;  3TKQ A;  2H1D A;  4XS1 A;  1U3A A;  1GUH A;  4V2N A;  3Q19 A;  4ZB6 A;  3M3M A;  5D9X A;  2H0I A;  4I5Q A;  2A2S A;  3VWU A;  1PKW A;  4BVY B;  1YKC A;  5AGY A;  3VPQ A;  3ZYW A;  3C8E A;  4X1U A;  2OE1 A;  3M8N A;  4QQ7 A;  4FYB A;  4GLT A;  5ECI B;  5A4W A;  3TJK A;  2YNX A;  4Q5R A;  4EC0 A;  5J41 A;  1X0R A;  3G7Y A;  4O92 A;  5JCW A;  4GXZ A;  3HVS A;  3EWL A;  3V1W A;  4K7N A;  3WYW A;  2K18 A;  1HQO A;  2IMD A;  2R2J A;  2LNT A;  3F8U A;  3DYR A;  2H6X A;  4L8E A;  3IRA A;  1K0A A;  14GS A;  1SKR B;  2BMX A;  3VFI A;  5KEJ A;  2PVQ A;  4FH8 A;  4XS6 A;  3TRQ A;  4I2T A;  2C0E A;  3RPN A;  3UVH A;  1M0U A;  2FA8 A;  2Z9S A;  3HZ8 A;  5DJL A;  2LNS A;  5GAP D;  5LD0 A;  2I81 A;  2YZH A;  5HFI A;  3KH7 A;  3TRX A;  3TJG A;  5KN2 A;  2C0D A;  1EZK A;  1O81 A;  2L4C A;  2DJJ A;  2WDU A;  4BVY A;  2IMK A;  2WJU A;  3ZRE A;  2HRF A;  5KN0 A;  5ECQ B;  1O7U A;  1GTU A;  5DDL A;  4USS A;  5IO2 A;  1A2M A;  5CO3 A;  2B6M A;  3WGD A;  4GST A;  5IMV A;  1PA3 A;  2ZNM A;  3CMI A;  1JFU A;  3I69 A;  4YAV A;  4GRF A;  2H01 A;  2GDR A;  2VL2 C;  1YF0 A;  5J4U A;  4N0V A;  1YEP A;  1QFN A;  2CT6 A;  1OAZ A;  4XRA A;  3VWW A;  4FQU A;  1YEX A;  4AJ8 A;  4ZBA A;  3I6A A;  1A24 A;  5IMZ A;  4AJ6 A;  2GQM A;  2H30 A;  2QGV A;  5G30 A;  2R6K A;  3S9F A;  1DUG A;  3J7Y k;  3MWH A;  3LJR A;  3KD0 A;  1YJ6 A;  2GSS A;  1FAA A;  2I9H A;  1AUC A;  2C4J A;  5EL8 A;  5G1K A;  1X9W B;  3TOT A;  2H1G A;  4JU5 A;  1WE0 A;  17GS A;  5FWG A;  3ZVJ D;  2GZP A;  3GL5 A;  4RI7 A;  4PX1 A;  2MMO A;  2WCI A;  1PSQ A;  3D4M A;  5IOW A;  3F6F A;  2EIR A;  3NIV A;  2LRC A;  3VUR A;  2LTK A;  3KP9 A;  2K8S A;  2X8C A;  1HYU A;  4FYC A;  1TRV A;  3LXT A;  2FD3 A;  1A0R P;  3US3 A;  4V2L A;  2C3N A;  5DQS A;  5DQY A;  4K1F A;  4FIW A;  2V1M A;  1B4Q A;  4N30 A;  2AV4 A;  4K7O A;  4RQR A;  1V40 A;  1N2A A;  2AAW A;  5LNK e;  4Q5F A;  3ERW A;  1TW9 A;  4ECB A;  4EXJ A;  4JRR A;  4PGT A;  1G6Y A;  2I1U A;  2LJR A;  2CQ9 A;  1O73 A;  4NV5 A;  1TU8 A;  2UZ8 A;  2E7P A;  3EU4 A;  2IL3 A;  4IP1 A;  4PQH A;  2OE0 A;  1S3A A;  4IHU A;  2AJQ B;  1EWX A;  1ZL9 A;  3RPP A;  3IHQ A;  4KH7 A;  3GH6 A;  4ZXG A;  2HT9 A;  2KOK A;  3W6G A;  3A5W A;  1B48 A;  5CNW A;  4TKY A;  2F51 A;  3GMF A;  2VD0 A;  3GFK A;  4G19 A;  2L59 A;  4IJ3 A;  3FHK A;  3E3E A;  3K8N A;  4KB3 A;  2AYT A;  2F8F A;  2HI7 A;  3F4S A;  1QUW A;  1GRX A;  1SU9 A;  5GSS A;  5ECR B;  1IYI A;  3LFL A;  1FB0 A;  1J0F A;  1PL1 A;  2FLS A;  3UAR A;  1O85 A;  2RII A;  5CAX A;  1AQV A;  1T7P B;  1KBN A;  3GTU B;  3QAW A;  4WBR D;  1FHE A;  2XPE A;  1R5A A;  3D0Z A;  2IJY A;  1FVK A;  3WGE A;  4IEL A;  1GSS A;  2D2Z A;  4TR4 A;  2IMI A;  1G7O A;  4HEA 2;  3EUR A;  1GL8 A;  2P31 A;  1BYE A;  1C72 A;  1XVQ A;  3L9U A;  2GSR A;  1VRS D;  1Z5Y E;  4O5R A;  1U88 A;  4MZB A;  5JCG A;  1TU7 A;  4HQZ A;  3F3Q A;  1UN2 A;  3U5R E;  4G9H A;  3A3T A;  13GS A;  2P5Q A;  3C73 A;  2PUK C;  3KJY A;  2VIM A;  1M9A A;  2H6Y A;  2CV4 A;  4YQU A;  3BCK A;  3E0U A;  2GQK A;  3M1G A;  3IK7 A;  1CQH A;  2L5L A;  2XHF A;  5JWQ B;  4OO5 A;  1Y6E A;  2L6D A;  3W8S A;  1TRS A;  1AC1 A;  1F6M C;  2VLV A;  4IQA A;  5CRG A;  3CRT A;  1EV4 A;  2H73 A;  5G31 A;  2XBQ A;  3DGQ A;  1I5G A;  5D73 A;  2VO4 A;  2CZ3 A;  1ZMA A;  3M0F A;  3VI5 A;  4AJ7 A;  1SK0 A;  3EMX A;  1HD2 A;  1OE8 A;  5FHI A;  3DIE A;  1VF2 A;  4BL7 B;  2MZC A;  4LA1 A;  1QXH A;  3GTU A;  4V1A p;  5KN3 A;  2RUE A;  4PQ1 A;  4KDU A;  1SYX A;  5INY A;  3FW2 A;  2O85 A;  5IMD A;  4NPB A;  5HR3 A;  1XW9 A;  4JBB A;  4G2E A;  2R4V A;  2XBI A;  1WJK A;  2OE3 A;  2WS2 A;  3LYK A;  2WGR A;  2IMF A;  5D96 A;  5EY6 A;  2YAN A;  4OCE A;  2DJ2 A;  3RBT A;  3BOA A;  2N5A A;  2HQT A;  3D22 A;  3PGT A;  2VOC A;  2NVL A;  3ZML A;  1TI1 A;  3QMX A;  4WBJ A;  1K0O A;  1Z9H A;  1K0B A;  3CSI A;  16GS A;  2DBC A;  2HLS A;  1TXX A;  1TRU A;  3PPU A;  1XPV A;  3DEX A;  4KUN A;  4E8H A;  5A5K A;  5IIZ A;  2DC5 A;  4MZC A;  4WXT A;  4ML6 A;  2L6C A;  5J5N A;  2DLX A;  22GS A;  5DAK B;  5DCG A;  3LG6 A;  3DD3 A;  2HRN A;  1EP7 A;  2HSY A;  4HU9 A;  4ZB8 A;  1S3D A;  5KN1 A;  6GST A;  3VK9 A;  1R5P A;  3TKS C;  2JSY A;  1TK8 B;  4MJC A;  3GKX A;  1K0N A;  4BWS A;  3EIN A;  1XWA A;  2CZ2 A;  6GSU A;  2IWT A;  3IAM 2;  1GUK A;  3OR5 A;  2B1L A;  3QFA C;  2HNL A;  3GN3 A;  3HDC A;  3LWA A;  5AIS A;  1ERW A;  2LJA A;  4K8M A;  4EL1 A;  1ST9 A;  3HD5 A;  2LS5 A;  3HJP A;  5HR1 A;  2H72 A;  3GNJ A;  3IBH A;  4J57 E;  1X9S B;  1DE2 A;  1E6B A;  5ID2 B;  2H1B A;  1B9X C;  1K0M A;  2YWM A;  1LJR A;  2OAC A;  5IMC A;  3LXZ A;  1JZW A;  4TXO B;  3GUR A;  5ABR A;  4Q5N A;  5CP1 A;  1ML6 A;  2DIZ A;  3CRU A;  5DAL B;  3DVX A;  2IN3 A;  1THX A;  4RQX A;  3KM6 A;  1GSF A;  3ZTL A;  2YWI A;  1SL2 B;  2GZY A;  1ABA A;  5A4V A;  2ON7 A;  4Z7X A;  2DJ1 A;  3HJO A;  3TJF A;  3D4T A;  2FA4 A;  3ZFL A;  1A23 A;  1GSD A;  2GSQ A;  4OWY A;  3SWL A;  1M2A A;  4DSS B;  1JZR A;  3FR9 A;  2GS3 A;  1Z3E A;  1B8X A;  3CYN A;  2B7J A;  2L57 A;  3UBL A;  2CA8 A;  3CTF A;  3ZIT A;  1N8J A;  1NW2 A;  2GT6 A;  1X5C A;  2C8U A;  1ZCP A;  2VCW A;  2HRK A;  4O32 A;  4TR3 A;  1R4W A;  1PN9 A;  3A2W A;  4MAB A;  2X8G A;  4TR1 B;  2JSZ A;  5ID2 A;  3BD2 A;  4N11 A;  3IC8 A;  5CRD A;  3TGZ A;  2GTU A;  2YZU A;  3CBU A;  4MF7 A;  4TXO A;  1O6J A;  1XOA A;  2CVB A;  3WT1 A;  1QMV A;  4MZW A;  1QK8 A;  4K0G A;  5DAL A;  1ACV A;  4POL A;  3ZL5 A;  2YJ7 A;  1K3Y A;  1PRX A;  1XCC A;  3EMP A;  1JLV A;  3ISO A;  1HNA A;  2HSM B;  3CSJ A;  3EC3 A;  5F07 A;  3HZ4 A;  3IA1 A;  2PVO C;  1T4Z A;  2P5R A;  3APS A;  3BCI A;  1Q98 A;  2B7K A;  2C3T A;  1YF1 A;  2JL4 A;  2OBK A;  1VGL A;  1GP1 A;  3I9V 2;  3TOU A;  4GTU A;  4AGS A;  4KF9 A;  4ECC A;  2V32 A;  4ISD A;  1UA5 A;  2H0H A;  4HU7 A;  3ME8 A;  1PGT A;  4DSQ A;  1J08 A;  2VL2 A;  4DEJ A;  2DSA A;  5D9T A;  2FWF A;  4EF0 A;  5IMF A;  1KNG A;  3C1S A;  1SKS B;  1FG4 A;  2TRX A;  2J23 A;  1A2L A;  5ECM B;  2C0G A;  2OA7 A;  2H75 A;  4JED A;  3HYP A;  1XWG A;  4TR1 A;  1V2A A;  1TRW A;  4ULX A;  5B6M A;  2F3M A;  2MBT A;  1BX9 A;  2C3Q A;  1BJX A;  2MBS A;  2ZCT A;  3H8Q A;  2LUS A;  12GS A;  1PX7 A;  3P7X A;  3TUE A;  3ZIJ A;  1OVN A;  3TKS E;  2H71 A;  1T00 A;  2OJL A;  3GKN A;  1GSU A;  1XOB A;  3JCM L;  2I3Y A;  4IGJ A;  3L9V A;  4XS4 B;  1XWC A;  4ZBD A;  5L71 A;  4HS1 A;  1ERU A;  4YQM A;  4XTS A;  2A4V A;  5D9V A;  1I9D A;  2HSM A;  5G5F A;  3IV4 A;  5IOX A;  4EUY A;  2FY6 A;  3LQ7 A;  5G5E A;  4NV2 A;  1M2D A;  2VLT A;  5ECO B;  4IS0 A;  2KUC A;  4IN0 A;  4CHS A;  4ECI A;  4F0C A;  1FVJ A;  1MDK A;  3ED3 A;  2ALB A;  3KMN A;  2CVK A;  5ELG A;  1UVZ A;  1GNE A;  2H6Z A;  1MDI A;  2F8A A;  2DJ3 A;  4TW5 A;  4QL9 A;  3W8J A;  3FK8 A;  3TDG A;  3L9S A;  4IJI A;  2ZUP A;  2MYG A;  2M72 A;  4ZIL A;  1TK0 B;  2JZR A;  4WEY A;  3GA4 A;  4PUF C;  5ECS A;  1XIY A;  4IW9 A;  3FYG A;  1XW5 A;  2P0G A;  3G7J A;  3CSH A;  3FKF A;  4ILF A;  4KX4 A;  4F9Z A;  2PBJ A;  4F82 A;  4MF6 A;  4ZBB A;  2M80 A;  5JCU A;  4K7I A;  1F2E A;  4EE0 A;  4NMU A;  2REM A;  4GSS A;  1ZGN A;  1EOH A;  1V58 A;  3MSZ A;  4BVX B;  2LST A;  2VUP A;  1TK5 B;  4NHZ A;  2VAF A;  3DXB A;  2H74 A;  2EC4 A;  4MLY A;  3IC4 A;  1OKT A;  1M2B A;  4GQF A;  4IVF A;  2G0F A;  4HJ2 A;  1X5E A;  1B4P A;  1OKD A;  1X5D A;  3QD9 A;  1THO A;  1F9M A;  1NHO A;  2JAD A;  4OO4 A;  3R2Q A;  2N5B A;  3PH9 A;  2JZS A;  2KP2 A;  1K3O A;  2AUV A;  4K9Z A;  4IQ1 A;  2CX3 A;  3QPM A;  2VL3 A;  3ME7 A;  5D8I A;  2QKE A;  1XWK A;  5AIX A;  4KSO A;  4L5L A;  3VWV A;  4FYU A;  2FNO A;  3F3R A;  5CRE A;  3C7M A;  4ZL8 A;  1GNW A;  4RUV A;  4KA0 A;  1ERT A;  4BA7 A;  1SKW B;  1YY7 A;  3GKK A;  1U3I A;  3FR6 A;  2FWE A;  4X0X A;  1URM A;  4V1A g;  2LEG A;  2O89 A;  3MDK A;  4LLR A;  3GKM A;  3BJ5 A;  2F9S A;  5B6N A;  3RAZ A;  5IQY A;  3EE2 A;  4O7H A;  5D9W A;  2K8V A;  4BVX A;  1F3A A;  4PTS A;  2B5X A;  1O8X A;  1EGR A;  2B3S A;  1WIK A;  5IPH A;  2HYX A;  3KP8 A;  1SD9 A;  1T4Y A;  4JR4 A;  5J9B A;  4WF4 A;  1YKA A;  3ZRD A;  1YQ1 A;  4MPF A;  2JAC A;  4KAE A;  1AQX A;  2WB9 A;  3QOU A;  2DMM A;  3UVT A;  3EYT A;  1MTC A;  7GSS A;  3APQ A;  4MH3 A;  19GS A;  3UIW A;  1Q4J A;  1H75 A;  4ZL7 A;  3GHA A;  1AIU A;  1PX6 A;  6GSX A;  4MP4 A;  2KLX A;  3GUS A;  2TIR A;  2YWO A;  3CTG A;  5HFG A;  3LSZ A;  3HA9 A;  2DJK A;  4I8B A;  1NHY A;  2OAD A;  2BTO T;  2HZE B;  4XRD A;  1ZOF A;  4MJB A;  2YN1 A;  2LRT A;  3DWV A;  5LCZ A;  5IO0 A;  1RQM A;  3O3T A;  2RUF A;  1A2J A;  1K0D A;  3IAS 2;  3A2X A;  2V41 A;  4Q5Q A;  2LQQ A;  4GF0 A;  2FWH A;  5EPF A;  1YDK A;  4F0B A;  5F0G A;  1S3C A;  4PUR A;  3GX0 A;  4N10 A;  3IXR A;  2H0G A;  3AY8 A;  1H4O A;  1Z7P A;  3E9J B;  1GTA A;  2FCH A;  4POM A;  6GSW A;  1M9B A;  5F8B A;  4ZIJ A;  3TKS A;  4IKH A;  3GV1 A;  4LL1 B;  5HQP A;  4NHW A;  2M46 A;  5IMA A;  5EVO A;  3UL3 A;  4F03 A;  1LBK A;  3PR8 A;  3FR3 A;  2VCT A;  3TJB A;  4BL7 A;  4MH2 A;  3RHC A;  5JWO B;  1WPI A;  3H79 A;  4PUA A;  5ECN B;  3HVX A;  3IE3 A;  3KMO A;  3PIN A;  4BWQ A;  1MD3 A;  4N0Z A;  5H5Q A;  4AF2 A;  4V2M A;  1OYJ A;  1Z6M A;  2DIY A;  4MA9 A;  2VCQ A;  1G0T A;  2H66 A;  3FZ4 A;  1BQ7 A;  3KTB A;  5ENU A;  11GS A;  2H70 A;  1LU4 A;  4YAP A;  3GYK A;  3KH9 A;  2CX4 A;  2TRC P;  4HOJ A;  4E8E A;  3LYP A;  3QAG A;  2B1K A;  2I4A A;  5B8B A;  5J9C A;  1FOV A;  2H19 A;  1QGV A;  1JZO A;  3WT2 A;  1OE7 A;  5DAK A;  1SL1 B;  1XFL A;  2EIQ A;  2MMN A;  3QR6 A;  1XZO A;  3FY7 A;  4EDY A;  3ERG A;  3GSS A;  1GSY A;  4KGI A;  4L5O A;  3RHB A;  4I97 A;  4OCF A;  1PD2 1;  3G7I A;  3ZMK A;  2XC2 A;  3Q18 A;  2LQO A;  1MD4 A;  4LMW A;  2N5F A;  5DVB A;  3MAK A;  4PXO A;  4NWY A;  1OC8 A;  1X9M B;  1BG5 A;  3Q6O A;  5ECK B;  4PNG A;  2HXK A;  5CYY A;  3Q74 A;  1F3B A;  4BPY A;  4H86 A;  1EV9 A;  4P3Y B;  3TKP A;  3GH9 A;  4TR0 A;  1SYR A;  3KCM A;  2YCD A;  3ZFB A;  2R3X A;  2X64 A;  1UC7 A;  3VPT A;  5GST A;  1EOG A;  2GT5 A;  3HJM A;  3R3E A;  3P2A A;  2GZZ A;  2YOI A;  2YP6 A;  1USB A;  1T3B A;  4DSR A;  4QL7 A;  3KIJ A;  1YZX A;  2RLI A;  3UJ1 A;  5D93 A;  3A2V A;  3U6V A;  2LKU A;  2A2R A;  2QSI A;  5B7C A;  1GWC A;  2HE3 A;  2IPA A;  3LGC A;  3M9K A;  2ES7 A;  1SL0 B;  1JZD A;  4K2D A;  1AXD A;  1ILO A;  4MJA A;  4TVE A;  4J56 E;  4GCI A;  2QC7 A;  1Z6N A;  3P8W A;  10GS A;  1E2Y A;  20GS A;  6GSV A;  2IFQ B;  5IPG A;  3QDN A;  4KDX A;  4KDY A;  4DSS A;  2B5E A;  2YV7 A;  4DVC A;  2YJH A;  4KND A;  3UEM A;  3QAV A;  1F37 A;  3F4T A;  1V57 A;  1WRY A;  3N9J A;  5BMU A;  4LMV A;  4HI7 A;  2CAQ A;  1KTE A;  3F4R A;  3KXO A;  1V98 A;  1TOF A;  3SBC A;  5GAN D;  2VCV A;  2PWJ A;  4NAX A;  4K6X A;  2HFD A;  1EEM A;  1ERV A;  2XPD A;  2B5Y A;  3IK9 A;  1EEJ A;  5E59 A;  2V6O A;  4K0N A;  3H1N A;  2NDO A;  4OD7 A;  4FO5 A;  3TB2 A;  3D5J A;  2OKA A;  1FO5 A;  4MJE A;  3RDW A;  3TJJ A;  3HVV A;  1PKZ A;  6GSY A;  2PN8 A;  3H93 A;  3WGX A;  1SD8 A;  8GSS A;  1GSE A;  4IBP A;  3IDV A;  4WET A;  2V2G A;  1R7H A;  3J7Y b;  1M99 A;  3HY2 A;  4CDO A;  5G1L A;  4I6X A;  3ZLP A;  3ZIV A;  4WR5 A;  3L4N A;  1WWJ A;  1DSB A;  4HUA A;  2PGT A;  2MMA A;  3F6D A;  2HZF A;  5AIV A;  2IFQ A;  4WKW A;  1TI3 A;  1SK2 A;  2HSH A;  4TXV A;  3F0I A;  2RM6 A;  3KGK A;  3ERF A;  2JZT A;  3N5O A;  4ZB9 A;  1TKD B;  4G0I A;  4MF5 A;  2O87 A;  2VM2 A;  1GLQ A;  4PQI A;  3DRN A;  3FZ5 A;  5ECH B;  5E4W A;  2WZ9 A;  2V6K A;  1AAZ A;  1XBS A;  2G2Q A;  3TKR A;  3DML A;  4MK3 A;  2VCZ A;  3F9U A;  3NZN A;  4GSN A;  5ECL B;  5DCH A;  4RI6 A;  1A0F A;  2IME A;  3HHV A;  5HR2 A;  4EKZ A;  4HJM A;  1SJZ A;  3HCZ A;  1WP0 A;  2PER A;  1GTI A;  5CRH A;  3TRP A;  1T8E B;  4G10 A;  1HNB A;  2FUG 2;  2VD1 A;  5IM9 A;  4NXI A;  4YQV A;  4XS4 A;  4KCE A;  4D73 B;  2HRA A;  2C80 A;  1SJ6 A;  5HR0 A;  1VF3 A;  3UMA A;  5F06 A;  4EVM A;  3UAP A;  3MNG A;  2LV3 A;  2C1Y A;  1FW1 A;  1U6T A;  2WFC A;  3KEB A;  3FZA A;  2O7K A;  1WMJ A;  5J3R A;  1VF4 A;  3WD6 A;  1VF1 A;  4KCA A;  3D21 A;  1SK1 A;  2EIO A;  1W89 A;  2O8V B;  2X99 A;  1A8Y A;  4KE3 A;  3EU3 A;  1ZYQ B;  5HFK A;  5H5S A;  1Z7R A;  3APO A;  1FB6 A;  2DML A;  2E0Q A;  2LJK A;  4KW6 A;  5ELA A;  3VLN A;  4ML1 A;  1BAY A;  1V9W A;  2GQL A;  5JWR B;  1DE1 A;  4CW9 A;  4OFM A;  2JU5 A;  3L78 A;  1GTB A;  2C0F A;  2GLR A;  5DJM A;  5DBQ A;  5G2Z A;  1DBY A;  1T1V A;  4LL4 B;  6GSS A;  2L5O A;  4MMM A;  1ON4 A;  4HZ2 A;  4EO3 A;  4JZQ A;  4XCS A;  3M9J A;  2K6V A;  3DVW A;  4TN8 A;  2YV9 A;  2KHP A;  2GVP A;  3KZQ A;  1SEN A;  1XVW A;  2NBS A;  1RW1 A;  4IP6 A;  4WR4 A;  4D73 A;  1K3L A;  1TJD A;  3DKS A;  2OBI A;  1XXU A;  3C1R A;  1TP9 A;  9GSS A;  3VI7 A;  1WOU A;  2PU9 C;  2AHE A;  2VM1 A;  3FZ9 A;  4G0L A;  3F63 A;  4HQS A;  2BJX A;  2NTO A;  2FWG A;  3O76 A;  2ON5 A;  5ECP B;  4GQC A;  2E2G A;  2WUL A;  3L0H A;  4OFT A;  4HZ4 A;  1R26 A;  3IR4 A;  4ECJ A;  3C71 A;  1NSW A;  5C04 A;  2E2M A;  1MEK A;  1EGO A;  2CVD A;  3UOM A; 
#chains in the Genus database with same CATH topology
 5C00 A;  4JE1 A;  1NM3 A;  1QQ2 A;  2GST A;  1MDJ A;  1PN0 A;  3ZZX A;  2PMT A;  4MPG A;  4PNF A;  1AW9 A;  1TTZ A;  2LRN A;  3EVI A;  1OC9 B;  3LEF A;  2R5G A;  1K0C A;  1GSQ A;  4L0W A;  2CAI A;  1IYH A;  1AQW A;  2R0C A;  1PL2 A;  1SVM A;  2GGT A;  4YKG A;  2IIY A;  3HXS A;  3QCP A;  3NOF A;  1ZYE A;  3FEU A;  3IPZ A;  4AKH A;  2WVX A;  4FXY P;  18GS A;  1U87 A;  5AN1 A;  5FT3 A;  2H1A A;  2FHE A;  4X43 A;  2H8L A;  5CRW A;  1JLW A;  4ZL9 A;  1A8L A;  4OFN A;  4I2U A;  1Y25 A;  4OMV A;  3VWX A;  3GX8 A;  5F05 A;  4KSM A;  2VLU A;  2J9H A;  3UBK A;  2YWN A;  4J2F A;  1B9Y C;  5B8A A;  2FGX A;  5GZZ B;  2VL9 A;  2YPM A;  3P90 A;  4XHM A;  2DJ0 A;  3BBY A;  3EPT A;  1GH2 A;  2RM5 A;  1G6W A;  5H5R A;  3O6T A;  1O8W A;  1HNC A;  3QFB C;  1RK4 A;  5KOW A;  3I43 A;  1BED A;  5A34 A;  2L4Q A;  4XIH A;  3GIX A;  2K9F A;  5A4U A;  1PQN A;  2PPT A;  4JR6 A;  2NPB A;  1XWB A;  3H4K A;  1G7E A;  1S4B P;  3G9B A;  1OC3 A;  3LOR A;  3MIX A;  2AB6 A;  1GLP A;  3GRX A;  1CQG A;  1KEB A;  1PMT A;  2WRT A;  4WF5 A;  3ZVJ A;  3GL3 A;  4ACS A;  1OC9 A;  2R37 A;  2X8H A;  2MMZ A;  4POB A;  1XW6 A;  2HZE A;  3KTL A;  2HSN B;  4EDZ A;  4L0U A;  1GUM A;  2HRK B;  4HDE A;  1JHB A;  1EP8 A;  2VCX A;  1SJI A;  3CXG A;  1GUL A;  4G0K A;  4YH2 A;  4ID0 A;  1W4V A;  1M7T A;  4MDC A;  4TOP A;  1J9B A;  4GWR A;  3IHG A;  1TDI A;  3GST A;  2KP1 A;  4POK A;  4F2I A;  2H76 A;  3FRC A;  3D6I A;  5COH A;  3HKR A;  1ZZY A;  3IOS A;  3TCO A;  4MCU A;  4TRX A;  3TKQ A;  2H1D A;  4XS1 A;  1U3A A;  1GUH A;  4V2N A;  3Q19 A;  4ZB6 A;  3M3M A;  5D9X A;  2H0I A;  4I5Q A;  2A2S A;  3VWU A;  1PKW A;  4BVY B;  1YKC A;  5AGY A;  3VPQ A;  2X49 A;  3ZYW A;  3C8E A;  4X1U A;  2OE1 A;  3M8N A;  4QQ7 A;  4FYB A;  4GLT A;  5ECI B;  5A4W A;  3TJK A;  2YNX A;  4Q5R A;  4EC0 A;  5J41 A;  1X0R A;  3G7Y A;  2HSN A;  4O92 A;  5JCW A;  4GXZ A;  3HVS A;  3EWL A;  3V1W A;  4K7N A;  3WYW A;  2K18 A;  1HQO A;  2IMD A;  2R2J A;  2LNT A;  3F8U A;  3DYR A;  2H6X A;  4L8E A;  3IRA A;  1K0A A;  14GS A;  1SKR B;  2BMX A;  3VFI A;  5KEJ A;  2PVQ A;  4FH8 A;  4XS6 A;  3TRQ A;  4I2T A;  2C0E A;  3RPN A;  3UVH A;  1M0U A;  2FA8 A;  2Z9S A;  3HZ8 A;  5DJL A;  2LNS A;  5GAP D;  5LD0 A;  2I81 A;  2YZH A;  5HFI A;  3KH7 A;  3TRX A;  4YKF A;  3TU3 B;  3TJG A;  5KN2 A;  2C0D A;  1EZK A;  1O81 A;  2L4C A;  2DJJ A;  2WDU A;  4BVY A;  2IMK A;  2WJU A;  3ZRE A;  2HRF A;  5KN0 A;  5ECQ B;  1O7U A;  1GTU A;  4E68 A;  5DDL A;  4USS A;  5IO2 A;  4PHZ C;  1A2M A;  5CO3 A;  2B6M A;  3WGD A;  4GST A;  5IMV A;  1PA3 A;  2ZNM A;  3CMI A;  1JFU A;  3I69 A;  4YAV A;  4GRF A;  2H01 A;  2GDR A;  2VL2 C;  1YF0 A;  5J4U A;  4N0V A;  1YEP A;  1QFN A;  2CT6 A;  1OAZ A;  4XRA A;  3VWW A;  4FQU A;  4A5P A;  1YEX A;  4AJ8 A;  4ZBA A;  3I6A A;  1A24 A;  5IMZ A;  4AJ6 A;  2GQM A;  2H30 A;  2QGV A;  5G30 A;  2R6K A;  3S9F A;  1DUG A;  3J7Y k;  3MWH A;  3LJR A;  3KD0 A;  1YJ6 A;  2GSS A;  1FAA A;  2I9H A;  1AUC A;  2C4J A;  5EL8 A;  5G1K A;  1X9W B;  3TOT A;  2H1G A;  4JU5 A;  2O36 A;  1WE0 A;  17GS A;  5FWG A;  4HSC X;  3ZVJ D;  2GZP A;  3GL5 A;  4RI7 A;  4PX1 A;  2MMO A;  4Z2R A;  2WCI A;  1PSQ A;  3D4M A;  5IOW A;  3F6F A;  2EIR A;  3NIV A;  2LRC A;  3VUR A;  2LTK A;  3KP9 A;  2K8S A;  2X8C A;  1HYU A;  4FYC A;  1TRV A;  4K5R A;  3LXT A;  2FD3 A;  1A0R P;  3US3 A;  4V2L A;  2C3N A;  5DQS A;  5DQY A;  4MNN A;  4K1F A;  4FIW A;  3MYD A;  2V1M A;  1B4Q A;  4N30 A;  2AV4 A;  4K7O A;  4RQR A;  1V40 A;  1N2A A;  2AAW A;  5LNK e;  4Q5F A;  3ERW A;  1TW9 A;  4ECB A;  4EXJ A;  4JRR A;  4PGT A;  1G6Y A;  2I1U A;  2LJR A;  2CQ9 A;  1O73 A;  4N3Z A;  4NV5 A;  1TU8 A;  2UZ8 A;  2E7P A;  1XG8 A;  3EU4 A;  4K2X A;  2IL3 A;  4PQH A;  4IP1 A;  2OE0 A;  5J40 A;  1S3A A;  4IHU A;  2AJQ B;  1EWX A;  1ZL9 A;  3RPP A;  3IHQ A;  4KH7 A;  2WVZ A;  3GH6 A;  4ZXG A;  2HT9 A;  2KOK A;  3W6G A;  3RFR C;  3A5W A;  1B48 A;  5CNW A;  4TKY A;  4O5U A;  2F51 A;  3GMF A;  2VD0 A;  3GFK A;  4G19 A;  2L59 A;  4IJ3 A;  3FHK A;  3E3E A;  3K8N A;  4KB3 A;  2AYT A;  2F8F A;  2HI7 A;  3F4S A;  1QUW A;  1GRX A;  1SU9 A;  5GSS A;  5ECR B;  1IYI A;  3LFL A;  1FB0 A;  1J0F A;  1PL1 A;  2FLS A;  3UAR A;  1O85 A;  2RII A;  5CAX A;  1AQV A;  1T7P B;  1KBN A;  3GTU B;  3QAW A;  4WBR D;  1FHE A;  2XPE A;  1R5A A;  3D0Z A;  2IJY A;  1FVK A;  3WGE A;  4IEL A;  1GSS A;  2D2Z A;  4TR4 A;  2IMI A;  1G7O A;  4HEA 2;  3EUR A;  4ZB7 A;  1GL8 A;  2P31 A;  1BYE A;  1C72 A;  1XVQ A;  3L9U A;  2GSR A;  1VRS D;  1Z5Y E;  4O5R A;  1U88 A;  4MZB A;  5JCG A;  1TU7 A;  4HQZ A;  3F3Q A;  1UN2 A;  4ICY A;  3U5R E;  4G9H A;  3A3T A;  13GS A;  5J4Y A;  2P5Q A;  3C73 A;  2PUK C;  3KJY A;  2VIM A;  1M9A A;  2H6Y A;  2VKZ G;  2CV4 A;  4YQU A;  3BCK A;  3E0U A;  2GQK A;  3M1G A;  3IK7 A;  1CQH A;  2L5L A;  2XHF A;  5JWQ B;  4OO5 A;  1Y6E A;  2L6D A;  3W8S A;  1TRS A;  1AC1 A;  1F6M C;  2VLV A;  4IQA A;  5CRG A;  3CRT A;  1EV4 A;  2H73 A;  5G31 A;  2XBQ A;  3DGQ A;  1I5G A;  5D73 A;  2VO4 A;  2CZ3 A;  1ZMA A;  3M0F A;  3VI5 A;  4AJ7 A;  1SK0 A;  3EMX A;  1HD2 A;  1OE8 A;  5FHI A;  3DIE A;  1VF2 A;  4BL7 B;  2MZC A;  4LA1 A;  1QXH A;  3GTU A;  4V1A p;  5KN3 A;  2RUE A;  1ZYP A;  4PQ1 A;  4KDU A;  1SYX A;  5INY A;  3FW2 A;  2O85 A;  5IMD A;  4NPB A;  5HR3 A;  1XW9 A;  4JBB A;  4G2E A;  2R4V A;  2XBI A;  1WJK A;  2OE3 A;  2WS2 A;  3LYK A;  2A2P A;  2WGR A;  2IMF A;  5D96 A;  5EY6 A;  2YAN A;  4OCE A;  4EIP A;  1Y1U A;  2DJ2 A;  3RBT A;  3BOA A;  2N5A A;  2HQT A;  3D22 A;  3FMW A;  3PGT A;  2VOC A;  2NVL A;  3ZML A;  1TI1 A;  3QMX A;  4WBJ A;  1K0O A;  1Z9H A;  1K0B A;  3CSI A;  16GS A;  2DBC A;  2HLS A;  1TXX A;  1TRU A;  3PPU A;  1XPV A;  3A5I A;  3DEX A;  4KUN A;  4E8H A;  5A5K A;  5IIZ A;  2DC5 A;  4BIK A;  4MZC A;  4WXT A;  4ML6 A;  2L6C A;  5J5N A;  2DLX A;  22GS A;  5DAK B;  5DCG A;  3LG6 A;  3DD3 A;  2HRN A;  1EP7 A;  2HSY A;  4HU9 A;  4ZB8 A;  1S3D A;  5KN1 A;  6GST A;  3VK9 A;  1R5P A;  3TKS C;  2JSY A;  1TK8 B;  4MJC A;  3GKX A;  1K0N A;  4BWS A;  3EIN A;  1XWA A;  2CZ2 A;  6GSU A;  2IWT A;  3IAM 2;  1GUK A;  3OR5 A;  2B1L A;  3QFA C;  2HNL A;  3GN3 A;  3HDC A;  3LWA A;  5AIS A;  1ERW A;  2LJA A;  4K8M A;  4EL1 A;  1ST9 A;  3HD5 A;  2LS5 A;  3HJP A;  2EFD A;  5HR1 A;  2H72 A;  3GNJ A;  3IBH A;  4J57 E;  1X9S B;  1DE2 A;  1E6B A;  5ID2 B;  2H1B A;  1B9X C;  1K0M A;  2YWM A;  1LJR A;  2OAC A;  5IMC A;  3LXZ A;  1JZW A;  4TXO B;  3GUR A;  5ABR A;  4Q5N A;  5A5H B;  1ML6 A;  5CP1 A;  2DIZ A;  3CRU A;  5DAL B;  3DVX A;  2IN3 A;  1THX A;  5A1N B;  4RQX A;  1SVO A;  3KM6 A;  1GSF A;  3ZTL A;  2YWI A;  1SL2 B;  2GZY A;  1ABA A;  5A4V A;  2ON7 A;  4Z7X A;  2DJ1 A;  3HJO A;  3TJF A;  3D4T A;  2FA4 A;  4K5S A;  3ZFL A;  1A23 A;  1GSD A;  2GSQ A;  4OWY A;  3SWL A;  1M2A A;  4DSS B;  1JZR A;  3FR9 A;  2GS3 A;  1YEW C;  1Z3E A;  1B8X A;  3CYN A;  2B7J A;  2L57 A;  3UBL A;  2CA8 A;  3CTF A;  3ZIT A;  1N8J A;  1NW2 A;  2GT6 A;  1X5C A;  2C8U A;  1ZCP A;  2VCW A;  1N25 A;  2HRK A;  4X4J A;  4O32 A;  4TR3 A;  1R4W A;  1PN9 A;  4PI2 C;  3A2W A;  4MAB A;  2X8G A;  4TR1 B;  2JSZ A;  5ID2 A;  3BD2 A;  4N11 A;  3IC8 A;  5CRD A;  3TGZ A;  2GTU A;  2YZU A;  3CBU A;  4MF7 A;  4TXO A;  1O6J A;  1XOA A;  2CVB A;  3WT1 A;  1QMV A;  4MZW A;  1QK8 A;  4K0G A;  5DAL A;  1ACV A;  4POL A;  3ZL5 A;  2YJ7 A;  1K3Y A;  1PRX A;  5A1N A;  1XCC A;  3EMP A;  1JLV A;  3ISO A;  1HNA A;  2HSM B;  3CSJ A;  3EC3 A;  5F07 A;  3HZ4 A;  3IA1 A;  2PVO C;  1T4Z A;  2P5R A;  3APS A;  3BCI A;  1Q98 A;  2B7K A;  2C3T A;  1YF1 A;  2JL4 A;  2OBK A;  1VGL A;  1GP1 A;  3I9V 2;  3TOU A;  4GTU A;  4AGS A;  4KF9 A;  4ECC A;  2V32 A;  4ISD A;  1UA5 A;  2H0H A;  4HU7 A;  3ME8 A;  1PGT A;  4DSQ A;  1J08 A;  2VL2 A;  4DEJ A;  2DSA A;  5D9T A;  2FWF A;  4EF0 A;  5IMF A;  1KNG A;  3C1S A;  1SKS B;  5KOX A;  1FG4 A;  2TRX A;  2J23 A;  1A2L A;  5ECM B;  2C0G A;  2OA7 A;  2H75 A;  4JED A;  3HYP A;  1XWG A;  4TR1 A;  1V2A A;  1TRW A;  4ULX A;  5B6M A;  2F3M A;  3HMJ G;  2MBT A;  1BX9 A;  2C3Q A;  1BJX A;  2MBS A;  2ZCT A;  3H8Q A;  2LUS A;  12GS A;  1PX7 A;  3P7X A;  3TUE A;  3ZIJ A;  1OVN A;  3TKS E;  2H71 A;  1T00 A;  1ZYN A;  3GKN A;  1GSU A;  2OJL A;  1XOB A;  3JCM L;  2I3Y A;  4IGJ A;  3L9V A;  4XS4 B;  1XWC A;  4ZBD A;  5L71 A;  4HS1 A;  1ERU A;  4YQM A;  4XTS A;  2A4V A;  5D9V A;  1I9D A;  2HSM A;  5G5F A;  3IV4 A;  5IOX A;  4EUY A;  2FY6 A;  3LQ7 A;  5G5E A;  4NV2 A;  1M2D A;  2VLT A;  5ECO B;  4IS0 A;  2KUC A;  4IN0 A;  4CHS A;  4ECI A;  4F0C A;  1FVJ A;  1MDK A;  3ED3 A;  4PI0 C;  2ALB A;  3KMN A;  2CVK A;  5ELG A;  1UVZ A;  1GNE A;  2H6Z A;  1MDI A;  2F8A A;  2DJ3 A;  2WW2 A;  4TW5 A;  4QL9 A;  3W8J A;  3FK8 A;  2DKH A;  3TDG A;  3L9S A;  1S3R A;  4IJI A;  2ZUP A;  2MYG A;  2M72 A;  4ZIL A;  4CY8 A;  1TK0 B;  4AI6 A;  2JZR A;  4WEY A;  3GA4 A;  4PUF C;  5ECS A;  1XIY A;  4IW9 A;  3FYG A;  1XW5 A;  2P0G A;  3G7J A;  3CSH A;  3FKF A;  4ILF A;  4KX4 A;  4F9Z A;  2PBJ A;  4F82 A;  4MF6 A;  4ZBB A;  2M80 A;  5JCU A;  4K7I A;  1F2E A;  4EE0 A;  4NMU A;  2REM A;  4GSS A;  1ZGN A;  1EOH A;  1V58 A;  3MSZ A;  4BVX B;  2LST A;  2VUP A;  1TK5 B;  4NHZ A;  2VAF A;  3DXB A;  4AKI A;  2H74 A;  2EC4 A;  4MLY A;  3IC4 A;  1OKT A;  1M2B A;  4GQF A;  4IVF A;  2G0F A;  4HJ2 A;  1X5E A;  1B4P A;  1OKD A;  1X5D A;  3QD9 A;  1THO A;  4Z2U A;  1F9M A;  1NHO A;  2JAD A;  4OO4 A;  3R2Q A;  4O5Q A;  2N5B A;  3PH9 A;  2JZS A;  2KP2 A;  1K3O A;  1I1I P;  2AUV A;  4K9Z A;  4IQ1 A;  2CX3 A;  3QPM A;  2VL3 A;  3ME7 A;  2OT3 A;  5D8I A;  2QKE A;  1XWK A;  5AIX A;  4KSO A;  4L5L A;  3VWV A;  4FYU A;  2FNO A;  3F3R A;  5CRE A;  3C7M A;  4ZL8 A;  1GNW A;  4RUV A;  4KA0 A;  1ERT A;  4BA7 A;  1SKW B;  1YY7 A;  3GKK A;  1U3I A;  2WW0 A;  3FR6 A;  2FWE A;  4X0X A;  1URM A;  4V1A g;  2LEG A;  2O89 A;  2DKI A;  3MDK A;  4LLR A;  1SVL A;  3GKM A;  3BJ5 A;  2F9S A;  5B6N A;  3RAZ A;  5IQY A;  3EE2 A;  4O7H A;  2O3E A;  5D9W A;  2K8V A;  4BVX A;  1F3A A;  4PTS A;  2B5X A;  1O8X A;  1EGR A;  2B3S A;  1WIK A;  5IPH A;  2HYX A;  1TXU A;  3KP8 A;  1SD9 A;  1T4Y A;  4JR4 A;  5J9B A;  4WF4 A;  1YKA A;  3ZRD A;  1YQ1 A;  4MPF A;  2JAC A;  4KAE A;  1AQX A;  2WB9 A;  5A34 B;  3QOU A;  2DMM A;  3UVT A;  3EYT A;  5J47 A;  1MTC A;  7GSS A;  3APQ A;  4MH3 A;  19GS A;  3UIW A;  1Q4J A;  1H75 A;  4ZL7 A;  3GHA A;  1AIU A;  1PX6 A;  6GSX A;  4MP4 A;  2KLX A;  3GUS A;  2TIR A;  2YWO A;  3CTG A;  5HFG A;  3LSZ A;  3HA9 A;  2DJK A;  2WZS A;  4I8B A;  1NHY A;  2OAD A;  3RGB C;  2BTO T;  2HZE B;  4XRD A;  1ZOF A;  4MJB A;  2YN1 A;  2LRT A;  3DWV A;  5LCZ A;  1FOH A;  5IO0 A;  1RQM A;  1M3I A;  3O3T A;  2RUF A;  1A2J A;  1K0D A;  3IAS 2;  3A2X A;  2V41 A;  4Q5Q A;  2LQQ A;  4GF0 A;  2FWH A;  5EPF A;  1YDK A;  4F0B A;  5F0G A;  1S3C A;  4PUR A;  3GX0 A;  4N10 A;  3IXR A;  2H0G A;  3AY8 A;  1H4O A;  1Z7P A;  3E9J B;  1GTA A;  2FCH A;  4POM A;  3HVN A;  4Z2T A;  6GSW A;  1M9B A;  5F8B A;  4ZIJ A;  3TKS A;  4IKH A;  3GV1 A;  4LL1 B;  5HQP A;  3CHX C;  4NHW A;  2M46 A;  5IMA A;  5EVO A;  3UL3 A;  4F03 A;  1LBK A;  3PR8 A;  3FR3 A;  2VCT A;  3TJB A;  2H1L A;  2WW3 A;  4BL7 A;  4MH2 A;  3RHC A;  5JWO B;  1WPI A;  3H79 A;  4PUA A;  5ECN B;  3HVX A;  3IE3 A;  3KMO A;  3PIN A;  4BWQ A;  1MD3 A;  4N0Z A;  5H5Q A;  4AF2 A;  4V2M A;  1OYJ A;  1Z6M A;  2DIY A;  4MA9 A;  2VCQ A;  1G0T A;  2H66 A;  3FZ4 A;  1BQ7 A;  2UV8 G;  3KTB A;  5ENU A;  11GS A;  2H70 A;  1LU4 A;  4YAP A;  3GYK A;  3KH9 A;  1BF5 A;  2CX4 A;  2TRC P;  4HOJ A;  4E8E A;  3LYP A;  3QAG A;  2B1K A;  2I4A A;  5B8B A;  5J9C A;  1FOV A;  4EIQ A;  2H19 A;  1QGV A;  1JZO A;  3WT2 A;  2EFH A;  1OE7 A;  5DAK A;  1SL1 B;  1XFL A;  2EIQ A;  2MMN A;  3QR6 A;  1XZO A;  3FY7 A;  4EDY A;  3ERG A;  3GSS A;  1GSY A;  4AKX B;  4KGI A;  4L5O A;  3RHB A;  4G01 A;  4I97 A;  4OCF A;  1PD2 1;  3G7I A;  3ZMK A;  2XC2 A;  3Q18 A;  2LQO A;  1MD4 A;  4LMW A;  2N5F A;  5DVB A;  3MAK A;  4PXO A;  4NWY A;  1OC8 A;  1X9M B;  1BG1 A;  1BG5 A;  3Q6O A;  5ECK B;  4PNG A;  2HXK A;  5BMU B;  5CYY A;  3Q74 A;  2QA2 A;  1F3B A;  4BPY A;  4H86 A;  1EV9 A;  4P3Y B;  3TKP A;  3GH9 A;  4TR0 A;  1SYR A;  3KCM A;  2YCD A;  3ZFB A;  2R3X A;  2X64 A;  1UC7 A;  3VPT A;  5GST A;  4CY6 A;  1EOG A;  2GT5 A;  3HJM A;  3R3E A;  3P2A A;  2GZZ A;  2R0P A;  2A4H A;  2YOI A;  2YP6 A;  1USB A;  1T3B A;  4DSR A;  4QL7 A;  5A5H A;  3KIJ A;  1YZX A;  2RLI A;  3UJ1 A;  5D93 A;  3A2V A;  3U6V A;  2LKU A;  2A2R A;  3CQF A;  2QSI A;  5B7C A;  1GWC A;  2HE3 A;  2IPA A;  3LGC A;  3M9K A;  2ES7 A;  1SL0 B;  1JZD A;  4K2D A;  1AXD A;  1ILO A;  4MJA A;  4TVE A;  4J56 E;  4GCI A;  2QC7 A;  1Z6N A;  3P8W A;  10GS A;  1E2Y A;  20GS A;  6GSV A;  2IFQ B;  5IPG A;  3QDN A;  4KDX A;  4KDY A;  4DSS A;  2B5E A;  2YV7 A;  4DVC A;  2YJH A;  4KND A;  3UEM A;  3QAV A;  1F37 A;  3F4T A;  1V57 A;  1WRY A;  3N9J A;  5BMU A;  4LMV A;  4HI7 A;  2CAQ A;  1KTE A;  3F4R A;  3KXO A;  1V98 A;  1TOF A;  3SBC A;  5GAN D;  2VCV A;  2PWJ A;  4NAX A;  4K6X A;  2HFD A;  1EEM A;  1ERV A;  2XPD A;  2B5Y A;  3IK9 A;  1EEJ A;  5E59 A;  2V6O A;  4K0N A;  3H1N A;  2NDO A;  4OD7 A;  4FO5 A;  3TB2 A;  3D5J A;  4GDF A;  2OKA A;  2R0G A;  1FO5 A;  4MJE A;  3RDW A;  3TJJ A;  3HVV A;  1PKZ A;  6GSY A;  2PN8 A;  3H93 A;  3WGX A;  1SD8 A;  8GSS A;  1GSE A;  4IBP A;  3IDV A;  4WET A;  2V2G A;  1R7H A;  3J7Y b;  1M99 A;  3HY2 A;  4CDO A;  5G1L A;  4I6X A;  3ZLP A;  3ZIV A;  4WR5 A;  3L4N A;  5BRT A;  1WWJ A;  1DSB A;  4HUA A;  2PGT A;  5J4V A;  2EFE A;  2MMA A;  3F6D A;  2HZF A;  5AIV A;  2IFQ A;  4WKW A;  1TI3 A;  1SK2 A;  2QA1 A;  2HSH A;  4TXV A;  3F0I A;  3CWG A;  1YVL A;  2RM6 A;  3KGK A;  1M3J A;  3ERF A;  2JZT A;  3N5O A;  4ZB9 A;  1TKD B;  4G0I A;  4MF5 A;  2O87 A;  2VM2 A;  1GLQ A;  4PQI A;  3DRN A;  1PFO A;  3FZ5 A;  5ECH B;  5E4W A;  2WZ9 A;  2V6K A;  1AAZ A;  1XBS A;  2G2Q A;  3TKR A;  3DML A;  4MK3 A;  2VCZ A;  3F9U A;  3NZN A;  4GSN A;  5ECL B;  5DCH A;  4RI6 A;  1A0F A;  2IME A;  3HHV A;  5HR2 A;  4EKZ A;  4HJM A;  1SJZ A;  3HCZ A;  1WP0 A;  2PER A;  1GTI A;  5CRH A;  3TRP A;  1T8E B;  4G10 A;  1HNB A;  2FUG 2;  2VD1 A;  2WVY A;  5IM9 A;  2EFC A;  4NXI A;  4YQV A;  4XS4 A;  4KCE A;  4D73 B;  4AKG A;  2HRA A;  2C80 A;  1SJ6 A;  5HR0 A;  1VF3 A;  3UMA A;  5F06 A;  4EVM A;  3UAP A;  3MNG A;  2LV3 A;  2C1Y A;  1FW1 A;  1U6T A;  2WFC A;  3KEB A;  3FZA A;  2O7K A;  1WMJ A;  5J3R A;  1VF4 A;  3WD6 A;  4QMK A;  1VF1 A;  4KCA A;  3D21 A;  1SK1 A;  2EIO A;  1W89 A;  2O8V B;  2X99 A;  1A8Y A;  4KE3 A;  3EU3 A;  1ZYQ B;  5HFK A;  5H5S A;  1Z7R A;  3APO A;  1FB6 A;  2DML A;  2E0Q A;  2LJK A;  2O5V A;  4KW6 A;  5ELA A;  3VLN A;  4ML1 A;  1BAY A;  1V9W A;  2GQL A;  5JWR B;  1DE1 A;  4W66 A;  4CW9 A;  4OFM A;  2JU5 A;  3L78 A;  1GTB A;  2C0F A;  2GLR A;  5DJM A;  5DBQ A;  5G2Z A;  1DBY A;  1T1V A;  4LL4 B;  6GSS A;  2L5O A;  4MMM A;  2WVX B;  1ON4 A;  4HZ2 A;  2X4A A;  4EO3 A;  4JZQ A;  4XCS A;  3M9J A;  2K6V A;  3DVW A;  4TN8 A;  3LW9 A;  2YV9 A;  2KHP A;  2GVP A;  3KZQ A;  1SEN A;  1XVW A;  2NBS A;  1RW1 A;  4IP6 A;  2WW1 A;  4WR4 A;  4D73 A;  1K3L A;  1TJD A;  3DKS A;  2OBI A;  1XXU A;  3C1R A;  1TP9 A;  9GSS A;  3VI7 A;  1WOU A;  2PU9 C;  2AHE A;  2VM1 A;  3FZ9 A;  4G0L A;  3F63 A;  4HQS A;  2BJX A;  2NTO A;  2FWG A;  3O76 A;  2ON5 A;  5ECP B;  4GQC A;  2E2G A;  2WUL A;  3L0H A;  4OFT A;  4HZ4 A;  1R26 A;  3IR4 A;  4ECJ A;  3C71 A;  1NSW A;  5C04 A;  2E2M A;  1MEK A;  1EGO A;  2CVD A;  3UOM A; 
#chains in the Genus database with same CATH homology
 5C00 A;  4JE1 A;  1NM3 A;  1QQ2 A;  2GST A;  1MDJ A;  1PN0 A;  3ZZX A;  2PMT A;  4MPG A;  4PNF A;  1AW9 A;  1TTZ A;  2LRN A;  3EVI A;  1OC9 B;  3LEF A;  2R5G A;  1K0C A;  1GSQ A;  4L0W A;  2CAI A;  1IYH A;  1AQW A;  2R0C A;  1PL2 A;  1SVM A;  2GGT A;  4YKG A;  2IIY A;  3HXS A;  3QCP A;  3NOF A;  1ZYE A;  3FEU A;  3IPZ A;  4AKH A;  18GS A;  1U87 A;  5AN1 A;  5FT3 A;  2H1A A;  2FHE A;  4X43 A;  2H8L A;  5CRW A;  1JLW A;  4ZL9 A;  1A8L A;  4OFN A;  4I2U A;  1Y25 A;  4OMV A;  3VWX A;  3GX8 A;  5F05 A;  4KSM A;  2VLU A;  2J9H A;  3UBK A;  2YWN A;  4J2F A;  1B9Y C;  5B8A A;  2FGX A;  5GZZ B;  2VL9 A;  2YPM A;  3P90 A;  4XHM A;  2DJ0 A;  3BBY A;  3EPT A;  1GH2 A;  2RM5 A;  1G6W A;  5H5R A;  3O6T A;  1O8W A;  1HNC A;  3QFB C;  1RK4 A;  5KOW A;  3I43 A;  1BED A;  5A34 A;  2L4Q A;  4XIH A;  3GIX A;  2K9F A;  5A4U A;  1PQN A;  2PPT A;  4JR6 A;  2NPB A;  1XWB A;  3H4K A;  1G7E A;  3G9B A;  1OC3 A;  3LOR A;  3MIX A;  2AB6 A;  1GLP A;  3GRX A;  1CQG A;  1KEB A;  1PMT A;  2WRT A;  4WF5 A;  3ZVJ A;  3GL3 A;  4ACS A;  1OC9 A;  2R37 A;  2X8H A;  2MMZ A;  4POB A;  1XW6 A;  2HZE A;  3KTL A;  2HSN B;  4EDZ A;  4L0U A;  1GUM A;  2HRK B;  4HDE A;  1JHB A;  1EP8 A;  2VCX A;  1SJI A;  3CXG A;  1GUL A;  4G0K A;  4YH2 A;  4ID0 A;  1W4V A;  1M7T A;  4MDC A;  4TOP A;  1J9B A;  4GWR A;  3IHG A;  1TDI A;  3GST A;  2KP1 A;  4POK A;  4F2I A;  2H76 A;  3FRC A;  3D6I A;  5COH A;  3HKR A;  1ZZY A;  3IOS A;  3TCO A;  4MCU A;  4TRX A;  3TKQ A;  2H1D A;  4XS1 A;  1U3A A;  1GUH A;  4V2N A;  3Q19 A;  4ZB6 A;  3M3M A;  5D9X A;  2H0I A;  4I5Q A;  2A2S A;  3VWU A;  1PKW A;  4BVY B;  1YKC A;  5AGY A;  3VPQ A;  2X49 A;  3ZYW A;  3C8E A;  4X1U A;  2OE1 A;  3M8N A;  4QQ7 A;  4FYB A;  4GLT A;  5ECI B;  5A4W A;  3TJK A;  2YNX A;  4Q5R A;  4EC0 A;  5J41 A;  1X0R A;  3G7Y A;  2HSN A;  4O92 A;  5JCW A;  4GXZ A;  3HVS A;  3EWL A;  3V1W A;  4K7N A;  3WYW A;  2K18 A;  1HQO A;  2IMD A;  2R2J A;  2LNT A;  3F8U A;  3DYR A;  2H6X A;  4L8E A;  3IRA A;  1K0A A;  14GS A;  1SKR B;  2BMX A;  3VFI A;  5KEJ A;  2PVQ A;  4FH8 A;  4XS6 A;  3TRQ A;  4I2T A;  2C0E A;  3RPN A;  3UVH A;  1M0U A;  2FA8 A;  2Z9S A;  3HZ8 A;  5DJL A;  2LNS A;  5GAP D;  5LD0 A;  2I81 A;  2YZH A;  5HFI A;  3KH7 A;  3TRX A;  4YKF A;  3TU3 B;  3TJG A;  5KN2 A;  2C0D A;  1EZK A;  1O81 A;  2L4C A;  2DJJ A;  2WDU A;  4BVY A;  2IMK A;  2WJU A;  3ZRE A;  2HRF A;  5KN0 A;  5ECQ B;  1O7U A;  1GTU A;  4E68 A;  5DDL A;  4USS A;  5IO2 A;  1A2M A;  5CO3 A;  2B6M A;  3WGD A;  4GST A;  5IMV A;  1PA3 A;  2ZNM A;  3CMI A;  1JFU A;  3I69 A;  4YAV A;  4GRF A;  2H01 A;  2GDR A;  2VL2 C;  1YF0 A;  5J4U A;  4N0V A;  1YEP A;  1QFN A;  2CT6 A;  1OAZ A;  4XRA A;  3VWW A;  4FQU A;  4A5P A;  1YEX A;  4AJ8 A;  4ZBA A;  3I6A A;  1A24 A;  5IMZ A;  4AJ6 A;  2GQM A;  2H30 A;  2QGV A;  5G30 A;  2R6K A;  3S9F A;  1DUG A;  3J7Y k;  3MWH A;  3LJR A;  3KD0 A;  1YJ6 A;  2GSS A;  1FAA A;  2I9H A;  1AUC A;  2C4J A;  5EL8 A;  5G1K A;  1X9W B;  3TOT A;  2H1G A;  4JU5 A;  1WE0 A;  17GS A;  5FWG A;  3ZVJ D;  2GZP A;  3GL5 A;  4RI7 A;  4PX1 A;  2MMO A;  4Z2R A;  2WCI A;  1PSQ A;  3D4M A;  5IOW A;  3F6F A;  2EIR A;  3NIV A;  2LRC A;  3VUR A;  2LTK A;  3KP9 A;  2K8S A;  2X8C A;  1HYU A;  4FYC A;  1TRV A;  4K5R A;  3LXT A;  2FD3 A;  1A0R P;  3US3 A;  4V2L A;  2C3N A;  5DQS A;  5DQY A;  4MNN A;  4K1F A;  4FIW A;  3MYD A;  2V1M A;  1B4Q A;  4N30 A;  2AV4 A;  4K7O A;  4RQR A;  1V40 A;  1N2A A;  2AAW A;  5LNK e;  4Q5F A;  3ERW A;  1TW9 A;  4ECB A;  4EXJ A;  4JRR A;  4PGT A;  1G6Y A;  2I1U A;  2LJR A;  2CQ9 A;  1O73 A;  4N3Z A;  4NV5 A;  1TU8 A;  2UZ8 A;  2E7P A;  3EU4 A;  4K2X A;  2IL3 A;  4PQH A;  4IP1 A;  2OE0 A;  5J40 A;  1S3A A;  4IHU A;  2AJQ B;  1EWX A;  1ZL9 A;  3RPP A;  3IHQ A;  4KH7 A;  3GH6 A;  4ZXG A;  2HT9 A;  2KOK A;  3W6G A;  3A5W A;  1B48 A;  5CNW A;  4TKY A;  4O5U A;  2F51 A;  3GMF A;  2VD0 A;  3GFK A;  4G19 A;  2L59 A;  4IJ3 A;  3FHK A;  3E3E A;  3K8N A;  4KB3 A;  2AYT A;  2F8F A;  2HI7 A;  3F4S A;  1QUW A;  1GRX A;  1SU9 A;  5GSS A;  5ECR B;  1IYI A;  3LFL A;  1FB0 A;  1J0F A;  1PL1 A;  2FLS A;  3UAR A;  1O85 A;  2RII A;  5CAX A;  1AQV A;  1T7P B;  1KBN A;  3GTU B;  3QAW A;  4WBR D;  1FHE A;  2XPE A;  1R5A A;  3D0Z A;  2IJY A;  1FVK A;  3WGE A;  4IEL A;  1GSS A;  2D2Z A;  4TR4 A;  2IMI A;  1G7O A;  4HEA 2;  3EUR A;  4ZB7 A;  1GL8 A;  2P31 A;  1BYE A;  1C72 A;  1XVQ A;  3L9U A;  2GSR A;  1VRS D;  1Z5Y E;  4O5R A;  1U88 A;  4MZB A;  5JCG A;  1TU7 A;  4HQZ A;  3F3Q A;  1UN2 A;  4ICY A;  3U5R E;  4G9H A;  3A3T A;  13GS A;  5J4Y A;  2P5Q A;  3C73 A;  2PUK C;  3KJY A;  2VIM A;  1M9A A;  2H6Y A;  2VKZ G;  2CV4 A;  4YQU A;  3BCK A;  3E0U A;  2GQK A;  3M1G A;  3IK7 A;  1CQH A;  2L5L A;  2XHF A;  5JWQ B;  4OO5 A;  1Y6E A;  2L6D A;  3W8S A;  1TRS A;  1AC1 A;  1F6M C;  2VLV A;  4IQA A;  5CRG A;  3CRT A;  1EV4 A;  2H73 A;  5G31 A;  2XBQ A;  3DGQ A;  1I5G A;  5D73 A;  2VO4 A;  2CZ3 A;  1ZMA A;  3M0F A;  3VI5 A;  4AJ7 A;  1SK0 A;  3EMX A;  1HD2 A;  1OE8 A;  5FHI A;  3DIE A;  1VF2 A;  4BL7 B;  2MZC A;  4LA1 A;  1QXH A;  3GTU A;  4V1A p;  5KN3 A;  2RUE A;  1ZYP A;  4PQ1 A;  4KDU A;  1SYX A;  5INY A;  3FW2 A;  2O85 A;  5IMD A;  4NPB A;  5HR3 A;  1XW9 A;  4JBB A;  4G2E A;  2R4V A;  2XBI A;  1WJK A;  2OE3 A;  2WS2 A;  3LYK A;  2A2P A;  2WGR A;  2IMF A;  5D96 A;  5EY6 A;  2YAN A;  4OCE A;  4EIP A;  1Y1U A;  2DJ2 A;  3RBT A;  3BOA A;  2N5A A;  2HQT A;  3D22 A;  3FMW A;  3PGT A;  2VOC A;  2NVL A;  3ZML A;  1TI1 A;  3QMX A;  4WBJ A;  1K0O A;  1Z9H A;  1K0B A;  3CSI A;  16GS A;  2DBC A;  2HLS A;  1TXX A;  1TRU A;  3PPU A;  1XPV A;  3A5I A;  3DEX A;  4KUN A;  4E8H A;  5A5K A;  5IIZ A;  2DC5 A;  4MZC A;  4WXT A;  4ML6 A;  2L6C A;  5J5N A;  2DLX A;  22GS A;  5DAK B;  5DCG A;  3LG6 A;  3DD3 A;  2HRN A;  1EP7 A;  2HSY A;  4HU9 A;  4ZB8 A;  1S3D A;  5KN1 A;  6GST A;  3VK9 A;  1R5P A;  3TKS C;  2JSY A;  1TK8 B;  4MJC A;  3GKX A;  1K0N A;  4BWS A;  3EIN A;  1XWA A;  2CZ2 A;  6GSU A;  2IWT A;  3IAM 2;  1GUK A;  3OR5 A;  2B1L A;  3QFA C;  2HNL A;  3GN3 A;  3HDC A;  3LWA A;  5AIS A;  1ERW A;  2LJA A;  4K8M A;  4EL1 A;  1ST9 A;  3HD5 A;  2LS5 A;  3HJP A;  2EFD A;  5HR1 A;  2H72 A;  3GNJ A;  3IBH A;  4J57 E;  1X9S B;  1DE2 A;  1E6B A;  5ID2 B;  2H1B A;  1B9X C;  1K0M A;  2YWM A;  1LJR A;  2OAC A;  5IMC A;  3LXZ A;  1JZW A;  4TXO B;  3GUR A;  5ABR A;  4Q5N A;  5A5H B;  1ML6 A;  5CP1 A;  2DIZ A;  3CRU A;  5DAL B;  3DVX A;  2IN3 A;  1THX A;  5A1N B;  4RQX A;  1SVO A;  3KM6 A;  1GSF A;  3ZTL A;  2YWI A;  1SL2 B;  2GZY A;  1ABA A;  5A4V A;  2ON7 A;  4Z7X A;  2DJ1 A;  3HJO A;  3TJF A;  3D4T A;  2FA4 A;  4K5S A;  3ZFL A;  1A23 A;  1GSD A;  2GSQ A;  4OWY A;  3SWL A;  1M2A A;  4DSS B;  1JZR A;  3FR9 A;  2GS3 A;  1Z3E A;  1B8X A;  3CYN A;  2B7J A;  2L57 A;  3UBL A;  2CA8 A;  3CTF A;  3ZIT A;  1N8J A;  1NW2 A;  2GT6 A;  1X5C A;  2C8U A;  1ZCP A;  2VCW A;  1N25 A;  2HRK A;  4X4J A;  4O32 A;  4TR3 A;  1R4W A;  1PN9 A;  3A2W A;  4MAB A;  2X8G A;  4TR1 B;  2JSZ A;  5ID2 A;  3BD2 A;  4N11 A;  3IC8 A;  5CRD A;  3TGZ A;  2GTU A;  2YZU A;  3CBU A;  4MF7 A;  4TXO A;  1O6J A;  1XOA A;  2CVB A;  3WT1 A;  1QMV A;  4MZW A;  1QK8 A;  4K0G A;  5DAL A;  1ACV A;  4POL A;  3ZL5 A;  2YJ7 A;  1K3Y A;  1PRX A;  5A1N A;  1XCC A;  3EMP A;  1JLV A;  3ISO A;  1HNA A;  2HSM B;  3CSJ A;  3EC3 A;  5F07 A;  3HZ4 A;  3IA1 A;  2PVO C;  1T4Z A;  2P5R A;  3APS A;  3BCI A;  1Q98 A;  2B7K A;  2C3T A;  1YF1 A;  2JL4 A;  2OBK A;  1VGL A;  1GP1 A;  3I9V 2;  3TOU A;  4GTU A;  4AGS A;  4KF9 A;  4ECC A;  2V32 A;  4ISD A;  1UA5 A;  2H0H A;  4HU7 A;  3ME8 A;  1PGT A;  4DSQ A;  1J08 A;  2VL2 A;  4DEJ A;  2DSA A;  5D9T A;  2FWF A;  4EF0 A;  5IMF A;  1KNG A;  3C1S A;  1SKS B;  5KOX A;  1FG4 A;  2TRX A;  2J23 A;  1A2L A;  5ECM B;  2C0G A;  2OA7 A;  2H75 A;  4JED A;  3HYP A;  1XWG A;  4TR1 A;  1V2A A;  1TRW A;  4ULX A;  5B6M A;  2F3M A;  3HMJ G;  2MBT A;  1BX9 A;  2C3Q A;  1BJX A;  2MBS A;  2ZCT A;  3H8Q A;  2LUS A;  12GS A;  1PX7 A;  3P7X A;  3TUE A;  3ZIJ A;  1OVN A;  3TKS E;  2H71 A;  1T00 A;  1ZYN A;  3GKN A;  1GSU A;  2OJL A;  1XOB A;  3JCM L;  2I3Y A;  4IGJ A;  3L9V A;  4XS4 B;  1XWC A;  4ZBD A;  5L71 A;  4HS1 A;  1ERU A;  4YQM A;  4XTS A;  2A4V A;  5D9V A;  1I9D A;  2HSM A;  5G5F A;  3IV4 A;  5IOX A;  4EUY A;  2FY6 A;  3LQ7 A;  5G5E A;  4NV2 A;  1M2D A;  2VLT A;  5ECO B;  4IS0 A;  2KUC A;  4IN0 A;  4CHS A;  4ECI A;  4F0C A;  1FVJ A;  1MDK A;  3ED3 A;  2ALB A;  3KMN A;  2CVK A;  5ELG A;  1UVZ A;  1GNE A;  2H6Z A;  1MDI A;  2F8A A;  2DJ3 A;  4TW5 A;  4QL9 A;  3W8J A;  3FK8 A;  2DKH A;  3TDG A;  3L9S A;  4IJI A;  2ZUP A;  2MYG A;  2M72 A;  4ZIL A;  4CY8 A;  1TK0 B;  4AI6 A;  2JZR A;  4WEY A;  3GA4 A;  4PUF C;  5ECS A;  1XIY A;  4IW9 A;  3FYG A;  1XW5 A;  2P0G A;  3G7J A;  3CSH A;  3FKF A;  4ILF A;  4KX4 A;  4F9Z A;  2PBJ A;  4F82 A;  4MF6 A;  4ZBB A;  2M80 A;  5JCU A;  4K7I A;  1F2E A;  4EE0 A;  4NMU A;  2REM A;  4GSS A;  1ZGN A;  1EOH A;  1V58 A;  3MSZ A;  4BVX B;  2LST A;  2VUP A;  1TK5 B;  4NHZ A;  2VAF A;  3DXB A;  4AKI A;  2H74 A;  2EC4 A;  4MLY A;  3IC4 A;  1OKT A;  1M2B A;  4GQF A;  4IVF A;  2G0F A;  4HJ2 A;  1X5E A;  1B4P A;  1OKD A;  1X5D A;  3QD9 A;  1THO A;  4Z2U A;  1F9M A;  1NHO A;  2JAD A;  4OO4 A;  3R2Q A;  4O5Q A;  2N5B A;  3PH9 A;  2JZS A;  2KP2 A;  1K3O A;  2AUV A;  4K9Z A;  4IQ1 A;  2CX3 A;  3QPM A;  2VL3 A;  3ME7 A;  2OT3 A;  5D8I A;  2QKE A;  1XWK A;  5AIX A;  4KSO A;  4L5L A;  3VWV A;  4FYU A;  2FNO A;  3F3R A;  5CRE A;  3C7M A;  4ZL8 A;  1GNW A;  4RUV A;  4KA0 A;  1ERT A;  4BA7 A;  1SKW B;  1YY7 A;  3GKK A;  1U3I A;  3FR6 A;  2FWE A;  4X0X A;  1URM A;  4V1A g;  2LEG A;  2O89 A;  2DKI A;  3MDK A;  4LLR A;  1SVL A;  3GKM A;  3BJ5 A;  2F9S A;  5B6N A;  3RAZ A;  5IQY A;  3EE2 A;  4O7H A;  5D9W A;  2K8V A;  4BVX A;  1F3A A;  4PTS A;  2B5X A;  1O8X A;  1EGR A;  2B3S A;  1WIK A;  5IPH A;  2HYX A;  1TXU A;  3KP8 A;  1SD9 A;  1T4Y A;  4JR4 A;  5J9B A;  4WF4 A;  1YKA A;  3ZRD A;  1YQ1 A;  4MPF A;  2JAC A;  4KAE A;  1AQX A;  2WB9 A;  5A34 B;  3QOU A;  2DMM A;  3UVT A;  3EYT A;  5J47 A;  1MTC A;  7GSS A;  3APQ A;  4MH3 A;  19GS A;  3UIW A;  1Q4J A;  1H75 A;  4ZL7 A;  3GHA A;  1AIU A;  1PX6 A;  6GSX A;  4MP4 A;  2KLX A;  3GUS A;  2TIR A;  2YWO A;  3CTG A;  5HFG A;  3LSZ A;  3HA9 A;  2DJK A;  4I8B A;  1NHY A;  2OAD A;  2BTO T;  2HZE B;  4XRD A;  1ZOF A;  4MJB A;  2YN1 A;  2LRT A;  3DWV A;  5LCZ A;  1FOH A;  5IO0 A;  1RQM A;  3O3T A;  2RUF A;  1A2J A;  1K0D A;  3IAS 2;  3A2X A;  2V41 A;  4Q5Q A;  2LQQ A;  4GF0 A;  2FWH A;  5EPF A;  1YDK A;  4F0B A;  5F0G A;  1S3C A;  4PUR A;  3GX0 A;  4N10 A;  3IXR A;  2H0G A;  3AY8 A;  1H4O A;  1Z7P A;  3E9J B;  1GTA A;  2FCH A;  4POM A;  4Z2T A;  6GSW A;  1M9B A;  5F8B A;  4ZIJ A;  3TKS A;  4IKH A;  3GV1 A;  4LL1 B;  5HQP A;  4NHW A;  2M46 A;  5IMA A;  5EVO A;  3UL3 A;  4F03 A;  1LBK A;  3PR8 A;  3FR3 A;  2VCT A;  3TJB A;  2H1L A;  4BL7 A;  4MH2 A;  3RHC A;  5JWO B;  1WPI A;  3H79 A;  4PUA A;  5ECN B;  3HVX A;  3IE3 A;  3KMO A;  3PIN A;  4BWQ A;  1MD3 A;  4N0Z A;  5H5Q A;  4AF2 A;  4V2M A;  1OYJ A;  1Z6M A;  2DIY A;  4MA9 A;  2VCQ A;  1G0T A;  2H66 A;  3FZ4 A;  1BQ7 A;  2UV8 G;  3KTB A;  5ENU A;  11GS A;  2H70 A;  1LU4 A;  4YAP A;  3GYK A;  3KH9 A;  1BF5 A;  2CX4 A;  2TRC P;  4HOJ A;  4E8E A;  3LYP A;  3QAG A;  2B1K A;  2I4A A;  5B8B A;  5J9C A;  1FOV A;  4EIQ A;  2H19 A;  1QGV A;  1JZO A;  3WT2 A;  2EFH A;  1OE7 A;  5DAK A;  1SL1 B;  1XFL A;  2EIQ A;  2MMN A;  3QR6 A;  1XZO A;  3FY7 A;  4EDY A;  3ERG A;  3GSS A;  1GSY A;  4AKX B;  4KGI A;  4L5O A;  3RHB A;  4G01 A;  4I97 A;  4OCF A;  1PD2 1;  3G7I A;  3ZMK A;  2XC2 A;  3Q18 A;  2LQO A;  1MD4 A;  4LMW A;  2N5F A;  5DVB A;  3MAK A;  4PXO A;  4NWY A;  1OC8 A;  1X9M B;  1BG1 A;  1BG5 A;  3Q6O A;  5ECK B;  4PNG A;  2HXK A;  5BMU B;  5CYY A;  3Q74 A;  2QA2 A;  1F3B A;  4BPY A;  4H86 A;  1EV9 A;  4P3Y B;  3TKP A;  3GH9 A;  4TR0 A;  1SYR A;  3KCM A;  2YCD A;  3ZFB A;  2R3X A;  2X64 A;  1UC7 A;  3VPT A;  5GST A;  4CY6 A;  1EOG A;  2GT5 A;  3HJM A;  3R3E A;  3P2A A;  2GZZ A;  2R0P A;  2A4H A;  2YOI A;  2YP6 A;  1USB A;  1T3B A;  4DSR A;  4QL7 A;  5A5H A;  3KIJ A;  1YZX A;  2RLI A;  3UJ1 A;  5D93 A;  3A2V A;  3U6V A;  2LKU A;  2A2R A;  2QSI A;  5B7C A;  1GWC A;  2HE3 A;  2IPA A;  3LGC A;  3M9K A;  2ES7 A;  1SL0 B;  1JZD A;  4K2D A;  1AXD A;  1ILO A;  4MJA A;  4TVE A;  4J56 E;  4GCI A;  2QC7 A;  1Z6N A;  3P8W A;  10GS A;  1E2Y A;  20GS A;  6GSV A;  2IFQ B;  5IPG A;  3QDN A;  4KDX A;  4KDY A;  4DSS A;  2B5E A;  2YV7 A;  4DVC A;  2YJH A;  4KND A;  3UEM A;  3QAV A;  1F37 A;  3F4T A;  1V57 A;  1WRY A;  3N9J A;  5BMU A;  4LMV A;  4HI7 A;  2CAQ A;  1KTE A;  3F4R A;  3KXO A;  1V98 A;  1TOF A;  3SBC A;  5GAN D;  2VCV A;  2PWJ A;  4NAX A;  4K6X A;  2HFD A;  1EEM A;  1ERV A;  2XPD A;  2B5Y A;  3IK9 A;  1EEJ A;  5E59 A;  2V6O A;  4K0N A;  3H1N A;  2NDO A;  4OD7 A;  4FO5 A;  3TB2 A;  3D5J A;  4GDF A;  2OKA A;  2R0G A;  1FO5 A;  4MJE A;  3RDW A;  3TJJ A;  3HVV A;  1PKZ A;  6GSY A;  2PN8 A;  3H93 A;  3WGX A;  1SD8 A;  8GSS A;  1GSE A;  4IBP A;  3IDV A;  4WET A;  2V2G A;  1R7H A;  3J7Y b;  1M99 A;  3HY2 A;  4CDO A;  5G1L A;  4I6X A;  3ZLP A;  3ZIV A;  4WR5 A;  3L4N A;  5BRT A;  1WWJ A;  1DSB A;  4HUA A;  2PGT A;  5J4V A;  2EFE A;  2MMA A;  3F6D A;  2HZF A;  5AIV A;  2IFQ A;  4WKW A;  1TI3 A;  1SK2 A;  2QA1 A;  2HSH A;  4TXV A;  3F0I A;  3CWG A;  1YVL A;  2RM6 A;  3KGK A;  3ERF A;  2JZT A;  3N5O A;  4ZB9 A;  1TKD B;  4G0I A;  4MF5 A;  2O87 A;  2VM2 A;  1GLQ A;  4PQI A;  3DRN A;  3FZ5 A;  5ECH B;  5E4W A;  2WZ9 A;  2V6K A;  1AAZ A;  1XBS A;  2G2Q A;  3TKR A;  3DML A;  4MK3 A;  2VCZ A;  3F9U A;  3NZN A;  4GSN A;  5ECL B;  5DCH A;  4RI6 A;  1A0F A;  2IME A;  3HHV A;  5HR2 A;  4EKZ A;  4HJM A;  1SJZ A;  3HCZ A;  1WP0 A;  2PER A;  1GTI A;  5CRH A;  3TRP A;  1T8E B;  4G10 A;  1HNB A;  2FUG 2;  2VD1 A;  5IM9 A;  2EFC A;  4NXI A;  4YQV A;  4XS4 A;  4KCE A;  4D73 B;  4AKG A;  2HRA A;  2C80 A;  1SJ6 A;  5HR0 A;  1VF3 A;  3UMA A;  5F06 A;  4EVM A;  3UAP A;  3MNG A;  2LV3 A;  2C1Y A;  1FW1 A;  1U6T A;  2WFC A;  3KEB A;  3FZA A;  2O7K A;  1WMJ A;  5J3R A;  1VF4 A;  3WD6 A;  4QMK A;  1VF1 A;  4KCA A;  3D21 A;  1SK1 A;  2EIO A;  1W89 A;  2O8V B;  2X99 A;  1A8Y A;  4KE3 A;  3EU3 A;  1ZYQ B;  5HFK A;  5H5S A;  1Z7R A;  3APO A;  1FB6 A;  2DML A;  2E0Q A;  2LJK A;  2O5V A;  4KW6 A;  5ELA A;  3VLN A;  4ML1 A;  1BAY A;  1V9W A;  2GQL A;  5JWR B;  1DE1 A;  4W66 A;  4CW9 A;  4OFM A;  2JU5 A;  3L78 A;  1GTB A;  2C0F A;  2GLR A;  5DJM A;  5DBQ A;  5G2Z A;  1DBY A;  1T1V A;  4LL4 B;  6GSS A;  2L5O A;  4MMM A;  1ON4 A;  4HZ2 A;  2X4A A;  4EO3 A;  4JZQ A;  4XCS A;  3M9J A;  2K6V A;  3DVW A;  4TN8 A;  3LW9 A;  2YV9 A;  2KHP A;  2GVP A;  3KZQ A;  1SEN A;  1XVW A;  2NBS A;  1RW1 A;  4IP6 A;  4WR4 A;  4D73 A;  1K3L A;  1TJD A;  3DKS A;  2OBI A;  1XXU A;  3C1R A;  1TP9 A;  9GSS A;  3VI7 A;  1WOU A;  2PU9 C;  2AHE A;  2VM1 A;  3FZ9 A;  4G0L A;  3F63 A;  4HQS A;  2BJX A;  2NTO A;  2FWG A;  3O76 A;  2ON5 A;  5ECP B;  4GQC A;  2E2G A;  2WUL A;  3L0H A;  4OFT A;  4HZ4 A;  1R26 A;  3IR4 A;  4ECJ A;  3C71 A;  1NSW A;  5C04 A;  2E2M A;  1MEK A;  1EGO A;  2CVD A;  3UOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...