4GTUA

Ligand-free homodimeric human glutathione s-transferase m4-4
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
217
structure length
217
Chain Sequence
SMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1999-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4gtuA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4gtuA01
1OKTA 4L0WA 2PUKC 2R2JA 5H5RA 1GTAA 2RM6A 2LRTA 1QQ2A 1GTBA 1SYRA 3QOUA 1ZOFA 1ERTA 1ERVA 2IMIA 1TTZA 1TKDB 2HRNA 4ML1A 1KTEA 3M1GA 5H5SA 2PERA 3DRNA 3CTFA 1ST9A 4RI6A 4EL1A 3VPQA 5CNWA 5F06A 5B8AA 5DQYA 2PBJA 2PVOC 2C3NA 4TR4A 4K9ZA 3D5JA 4NPBA 5ID2B 3GUSA 5G5EA 3ZZXA 3P7XA 5GAPD 1B9YC 2OE0A 2IN3A 5HR1A 2RUEA 4OO5A 1XIYA 1YF0A 2F51A 1GNWA 3D21A 2H30A 3LQ7A 4MABA 3VI7A 1B48A 2L6CA 5EL8A 4KSMA 2CX4A 2HSHA 4K7NA 1F3AA 4MLYA 4OCFA 3FR3A 4NV5A 2DJKA 2X8HA 4NHZA 5CRWA 3KIJA 4I2TA 4ZBDA 4MJCA 2LQOA 2G2QA 5CYYA 4AJ6A 3I9V2 2HLSA 3AY8A 5FWGA 5GZZB 1FB6A 1WE0A 1GUHA 1F2EA 4ZIJA 3IC8A 4MZWA 4I2UA 2HYXA 4EDYA 4WBJA 1X9MB 2CVBA 4XCSA 5BMUA 1A0RP 2MZCA 3FR6A 18GSA 17GSA 5A4WA 3GFKA 3VPTA 1AW9A 2VLUA 2C3TA 1XVWA 1TK5B 1Z9HA 3TKQA 1NM3A 2OACA 2FY6A 2L4CA 2O85A 4L0UA 3FKFA 2UZ8A 1Z7PA 2ON5A 1SD8A 3ZLPA 2C80A 2JZSA 4GLTA 4EKZA 1A23A 1W89A 4GCIA 5A4UA 1BYEA 4V2NA 1XW6A 4MJAA 3EWLA 1WPIA 3MDKA 2YJ7A 1FHEA 2NBSA 2MMZA 2F8AA 4EO3A 1Y6EA 5D93A 3Q19A 4ZB8A 2DJ2A 2LV3A 3LEFA 1XWAA 4N0ZA 6GSUA 1GUKA 2XHFA 1IYHA 1J08A 1M7TA 5EPFA 2HI7A 5JCGA 3A3TA 3G9BA 5DJMA 5B7CA 1MDJA 1YEPA 1OE7A 2RM5A 1GULA 1XWCA 1OYJA 4KDYA 4PX1A 2A2RA 5ID2A 2V6OA 9GSSA 4PUAA 2X8GA 1XFLA 3ZFLA 1S3AA 4FO5A 1QK8A 1YJ6A 3UAPA 4N0VA 4PNFA 5B6NA 10GSA 2A2SA 2HT9A 2R4VA 5D8IA 1JZWA 2VLTA 1MEKA 2BTOT 1MDKA 4BPYA 4GSTA 1FAAA 4IELA 1HNCA 3DD3A 3CTGA 1Z3EA 5LCZA 4L8EA 2CVDA 3PINA 2MMOA 2HFDA 3HJOA 3L9VA 2FWGA 5DJLA 3KH9A 2P0GA 3KGKA 4OWYA 3ZIVA 4IVFA 3CSJA 3HD5A 2H71A 2D2ZA 4IJIA 3C7MA 2NVLA 5HFIA 3S9FA 1ERWA 1OC8A 1WWJA 4G19A 1GSUA 1ZMAA 5AISA 1TK8B 3SWLA 2XBQA 1K0CA 12GSA 1W4VA 5IMFA 4F0BA 4MJEA 4FIWA 3L0HA 4Q5RA 4WKWA 1R5AA 3DEXA 4XRAA 3BD2A 2H75A 3C73A 1YF1A 4KUNA 4X1UA 2M80A 4XS1A 3VWVA 1PX7A 1ACVA 1DE1A 1BG5A 3GA4A 3D22A 3GIXA 2K6VA 1XZOA 2M46A 4J56E 1UA5A 2AUVA 4G2EA 4YH2A 4F9ZA 5HQPA 5ELAA 3KTLA 3RBTA 2LJRA 1GSFA 2ZUPA 3DWVA 4JBBA 1RW1A 1VF3A 1DUGA 3QAVA 2FGXA 1YZXA 5B8BA 2B3SA 4HDEA 4J57E 4H86A 2RLIA 1ZYEA 5JWRB 5GAND 2HZFA 1K0NA 4OMVA 5GSTA 4N11A 1T7PB 2WB9A 2GQMA 2GT5A 2DJ0A 3IAS2 4Z7XA 1A0FA 2CA8A 4JEDA 3HKRA 2WULA 4ZL8A 1GLPA 1X5EA 1AAZA 1A8LA 1XWKA 2C3QA 3RPPA 4EUYA 3QR6A 2H1AA 4E8HA 2H66A 1T8EB 2YWOA 3HXSA 3GSSA 2C0FA 2H1GA 2FA4A 5ECMB 3QFAC 4K7OA 3BOAA 3KD0A 1PD21 1GSYA 1T1VA 2JU5A 4QL7A 4EDZA 4KA0A 2CX3A 5IMAA 3ME7A 3QAGA 5LNKe 3IR4A 1TRVA 4YQVA 5IO2A 4I97A 5IM9A 4L5LA 3M8NA 1H4OA 4MF7A 2HQTA 4MH3A 1X5DA 4HUAA 1HNBA 4HQZA 3IHQA 1CQGA 3HJPA 1EP8A 3ZMKA 5AIVA 2JZTA 3TKSE 3ZL5A 5ECQB 4MZBA 1E6BA 3TCOA 1X0RA 2LTKA 3VI5A 4TN8A 22GSA 1M2AA 3J7Yk 4RI7A 4EE0A 1PSQA 2CV4A 4IQ1A 2R6KA 2ON7A 1UVZA 3TRXA 4F2IA 2CAIA 2WFCA 3KEBA 1FW1A 5DCHA 2N5BA 1HD2A 5HFGA 3UARA 3ED3A 1QXHA 4IKHA 2P31A 3GN3A 4TXVA 1SK2A 1K0AA 4XS6A 3UMAA 3LXTA 1EOHA 4G9HA 2E0QA 4IP6A 3LJRA 1GL8A 4IS0A 1WRYA 4AGSA 3U5RE 5ECHB 1F3BA 1PX6A 4FYCA 1U87A 3D4MA 1S3DA 2QC7A 2AB6A 5ECKB 3UBKA 6GSTA 1AC1A 3TDGA 2FUG2 5LD0A 3EU4A 3F6DA 4IP1A 4JU5A 2B6MA 4GWRA 2I3YA 3ZVJD 4AJ8A 5GSSA 2HZEB 3GKNA 1XW9A 1XW5A 2L57A 3GRXA 4BVXB 2H76A 3HZ4A 1WP0A 2A4VA 3ZTLA 2HRKB 4O7HA 3ZRDA 2H01A 1QMVA 4GXZA 1U3IA 1THXA 3LXZA 4NMUA 5CREA 1MD3A 4IQAA 1SL2B 2OKAA 2L59A 3FZAA 2DLXA 2YPMA 4KF9A 5DVBA 3GL5A 3MNGA 4IJ3A 1EV4A 3ERFA 4K0GA 5J5NA 3GNJA 1UC7A 1JLVA 4OFNA 2GS3A 2IMKA 5HFKA 2JACA 1V40A 4EC0A 4YQUA 1EEJA 2HSNB 3FYGA 5H5QA 3MAKA 3APSA 5JWOB 1N8JA 2FWHA 1HYUA 2IL3A 1Q98A 2WRTA 5ENUA 3G7YA 4MF6A 1C72A 2JSZA 2V2GA 1J9BA 3QFBC 2DJ1A 1G7OA 3CSIA 3HZ8A 1N2AA 3N5OA 2DMMA 2E2GA 4G0IA 2F8FA 4TR1B 2CT6A 4FYUA 1G0TA 1O8WA 2YWIA 3OR5A 2IMFA 2C1YA 4NXIA 3ERGA 2LKUA 1Q4JA 3NOFA 3F0IA 1O85A 2VCXA 2FNOA 4E8EA 2H72A 1K0OA 1XVQA 5D96A 4YAPA 3EMXA 1SL1B 2MBTA 3MWHA 2HE3A 1AQVA 3UL3A 1I5GA 4JR4A 5F07A 5HR3A 3MSZA 2VIMA 3GHAA 4ECCA 4MPGA 4PURA 2HZEA 3HVSA 3GTUB 3LSZA 4Q5FA 2OE3A 1BAYA 2CZ3A 4BVXA 2HSMB 2DIZA 3WGXA 2HRKA 2QGVA 4POLA 3SBCA 3M9KA 2H74A 2GSTA 3IK7A 1SKRB 2OADA 2VD0A 1R7HA 5FT3A 4MMMA 1X9SB 3CMIA 4GQFA 5ELGA 3H8QA 1OE8A 1ZGNA 3ISOA 4DVCA 4KW6A 2GQKA 1TP9A 4FYBA 1BX9A 4K7IA 4ECBA 4OFMA 2R5GA 2DJ3A 4IGJA 1E2YA 4V2LA 2GSSA 4HI7A 1ML6A 2N5FA 2PN8A 3QPMA 1XXUA 3VLNA 2B7KA 2TIRA 2B5EA 2VAFA 5G1KA 3VWUA 3NZNA 2H1BA 1JLWA 2AYTA 4XIHA 1OC3A 1UN2A 3U6VA 1A2MA 3VURA 2REMA 1G6YA 4OO4A 2C0EA 4ML6A 5CP1A 6GSWA 2EIOA 4I5QA 2HRAA 2MMNA 4WF4A 1JZRA 4ZL7A 2LRCA 1NW2A 1PGTA 1U88A 1GNEA 2ALBA 3RAZA 4TKYA 1V98A 3UBLA 3PH9A 4OD7A 2RIIA 2X8CA 2KP2A 3IBHA 3DIEA 4CW9A 1ON4A 3GX0A 4TR1A 2OBKA 4NV2A 3TJBA 3HDCA 3F4SA 1G7EA 1XOAA 1O6JA 1FVKA 2H1DA 2VCZA 4P3YB 5DAKB 4RQRA 2O8VB 4BL7B 2K8SA 5J3RA 4PXOA 3TUEA 2CZ2A 4GQCA 4F0CA 4O92A 3ERWA 4LL1B 1GH2A 3GYKA 4N30A 1TU8A 5JCUA 2CAQA 4BVYB 2V6KA 3TOUA 4L5OA 4MDCA 1XWGA 1MDIA 2JSYA 2RUFA 1GWCA 2V32A 2IJYA 2WGRA 1XPVA 1B8XA 4K8MA 3H93A 5EY6A 1PN9A 5AGYA 5D9VA 2EIRA 2B1KA 4HU9A 1A2LA 3DXBA 2K18A 4AF2A 1K3YA 4PQ1A 3HJMA 1PRXA 3H4KA 4HU7A 2LNTA 2YWMA 5C04A 1QFNA 3TKPA 2VM1A 3VWWA 2OJLA 2HSYA 2BMXA 3DYRA 2AJQB 3LYKA 1AXDA 1ILOA 4AJ7A 1R4WA 3LYPA 1FOVA 3ZITA 2O89A 3UEMA 1MTCA 2YV9A 3LGCA 2GSRA 4WR4A 5KN1A 3US3A 4JE1A 2IWTA 4J2FA 3FEUA 3H79A 6GSYA 2VL3A 1O7UA 2YNXA 3O76A 2YZHA 4ECIA 2HRFA 1RQMA 2C0DA 3M0FA 2GGTA 2H6YA 1O81A 2H73A 5ECSA 3TRPA 1BQ7A 5IOWA 3KM6A 3FR9A 2VOCA 2C8UA 3QCPA 2WJUA 5DAKA 1GSSA 4BL7A 4LLRA 3UOMA 2GQLA 3PPUA 3CRUA 3RDWA 4HZ2A 3ZIJA 3TJGA 2EC4A 1BEDA 1SL0B 4ILFA 2YP6A 5ECPB 2YWNA 4BVYA 2WDUA 1XWBA 1J0FA 5J9BA 2VO4A 4HEA2 4XTSA 3G7IA 3DGQA 2TRXA 3D4TA 3C1SA 4QL9A 2OBIA 2FWEA 4KE3A 2ZNMA 4KCEA 3LG6A 2B5XA 5HR2A 3FHKA 6GSVA 3IV4A 5B6MA 3EURA 3QD9A 1F6MC 3DMLA 2PGTA 3R2QA 4LMWA 1YEXA 2L6DA 2BJXA 3H1NA 4PGTA 3A2XA 3M9JA 2FWFA 2JZRA 5L71A 1DE2A 4HOJA 2H0GA 1MD4A 5DCGA 4ZXGA 5ECNB 2PPTA 2X64A 5AIXA 5G31A 3C1RA 1URMA 4DSRA 2FLSA 4KDXA 2XC2A 4CHSA 5E59A 1SD9A 2H19A 4X43A 3ZREA 4MZCA 4QQ7A 3VFIA 1XOBA 1ABAA 1TW9A 1GSQA 3CYNA 2GZZA 2WZ9A 2JL4A 4G0KA 4DEJA 1R5PA 3F63A 3F4TA 4JRRA 3WGDA 2B1LA 3QDNA 1A2JA 1EGRA 2DBCA 5IPGA 1YQ1A 2VCQA 1QUWA 2FD3A 1G6WA 4G0LA 3R3EA 4WETA 3C8EA 5CAXA 1PL1A 5F05A 2GZPA 4BWSA 4WEYA 4GSSA 2GSQA 1AQWA 4G10A 3EMPA 2PU9C 3TJFA 2F3MA 5G2ZA 2H8LA 2QSIA 1GUMA 2VL2A 4KAEA 2GTUA 1EGOA 2HNLA 3HY2A 1SK1A 4K6XA 4JR6A 4KGIA 3TKRA 3IAM2 3KP9A 3LWAA 4ACSA 1PQNA 1FG4A 1WMJA 1ERUA 2KHPA 3PGTA 1GTIA 3GSTA 5KEJA 3VWXA 3Q74A 3FY7A 1U6TA 3CBUA 3L4NA 3GH9A 2IMDA 5D9TA 3EVIA 5DALB 5ECRB 1GRXA 5IIZA 4BA7A 3IXRA 3DKSA 5F0GA 20GSA 1EEMA 4HQSA 1PKZA 4I6XA 4MCUA 1K0DA 4GTUA 3KMNA 4V1Ag 4ZBAA 1M2BA 5A4VA 1A8YA 4KB3A 1JZOA 4TW5A 2I9HA 4OCEA 5J4UA 4YQMA 1WOUA 8GSSA 3RHBA 4FH8A 3BCKA 4KDUA 4NWYA 2GT6A 3TGZA 2HXKA 5D9XA 2LJKA 3HVXA 4ISDA 3IDVA 3IOSA 2C4JA 1V58A 4IW9A 4O32A 5DQSA 3A5WA 1FO5A 4OFTA 5AN1A 4POKA 3APOA 1EV9A 19GSA 2K9FA 2VM2A 1FB0A 1AQXA 5IOXA 3N9JA 4BWQA 1EWXA 4K1FA 3JCML 1EP7A 2V1MA 4K0NA 3M3MA 1U3AA 3TOTA 2YCDA 3WGEA 6GSXA 2I81A 3WD6A 3J7Yb 4DSQA 1HQOA 1F9MA 1JHBA 4X0XA 4KX4A 3TB2A 4ULXA 3EINA 3KXOA 3KCMA 3RPNA 3EE2A 3DVXA 1NHOA 3UJ1A 2QKEA 1CQHA 3F8UA 4PQIA 4F82A 3W8SA 5FHIA 3LORA 1YY7A 5IMCA 4I8BA 3ZMLA 1KBNA 3CSHA 5JWQB 5IMDA 5CRHA 5ECIB 2KOKA 3FW2A 4EXJA 2K8VA 3FZ9A 2B5YA 4XS4B 1OC9B 4YAVA 2CVKA 4ZB9A 4WF5A 5IO0A 4NAXA 1SJ6A 1Z5YE 2XPEA 3FZ5A 3GKKA 4GRFA 5IQYA 5DALA 2L5OA 4GSNA 3FK8A 4MK3A 2EIQA 3E9JB 4POBA 3BBYA 4KNDA 3TJKA 1SENA 3DVWA 2KUCA 3F4RA 5KN2A 3K8NA 1R26A 3HCZA 1NHYA 1ZCPA 1SKSB 1TI3A 2LQQA 1EZKA 6GSSA 2J9HA 4TXOB 4ZILA 3F9UA 1Z6NA 1DSBA 1PA3A 3D0ZA 1OAZA 3RHCA 3ZYWA 5HR0A 3ZVJA 5DDLA 1M9AA 2DMLA 2AHEA 1OKDA 3F6FA 3GURA 4LMVA 1T3BA 1JFUA 1X5CA 3QAWA 2YJHA 1O73A 2DSAA 4HS1A 1EOGA 2YOIA 2OA7A 4Q5QA 4ECJA 3KZQA 3IRAA 2XPDA 5COHA 2GZYA 2O7KA 2NPBA 1SU9A 4MA9A 3ZFBA 4TRXA 3EYTA 1SKWB 4KCAA 3TKSA 1YDKA 4MF5A 3D6IA 3GTUA 11GSA 5E4WA 1WJKA 5EVOA 2HSMA 4WBRD 1TRWA 1VGLA 3A2VA 2J23A 2R3XA 3P90A 1H75A 1KNGA 3I69A 4HJMA 3Q18A 5KN0A 3O6TA 1K3OA 2VCTA 3UVTA 1GTUA 2MMAA 1GP1A 3UIWA 7GSSA 4MP4A 5F8BA 1S3CA 2C0GA 1SJZA 1B4PA 1AUCA 3KJYA 4PNGA 4XS4A 1K3LA 1OC9A 1T4YA 3G7JA 5G30A 1DBYA 1RK4A 4KH7A 2G0FA 3E3EA 3F3QA 3GV1A 3A2WA 1B9XC 2KLXA 1A24A 2AAWA 4MPFA 2GVPA 1KEBA 2VL2C 1PMTA 2DJJA 1TK0B 3O3TA 2WS2A 1V9WA 3APQA 4O5RA 4HJ2A 1JZDA 2H70A 2DC5A 1TDIA 3GX8A 1YKAA 4IBPA 2E7PA 3NIVA 4PTSA 4GF0A 3L9SA 5DBQA 2ES7A 1TU7A 2VCVA 2MYGA 1GLQA 4TXOA 3ME8A 3FRCA 2IMEA 2IIYA 1ZZYA 3HVVA 3LFLA 2MBSA 1IYIA 1VF2A 3I43A 3P8WA 3IE3A 2H0IA 1TXXA 5J9CA 2DIYA 3GKMA 1SYXA 1PL2A 4D73B 4TOPA 2N5AA 4RUVA 4FQUA 1VF4A 2H6ZA 5A5KA 1GSEA 3F3RA 2JADA 1V57A 4IN0A 3BCIA 3FZ4A 2R37A 2V41A 4LA1A 2I1UA 3EC3A 1WIKA 3Q6OA 5IMVA 1SJIA 3P2AA 3WT2A 1K0BA 1ZYQB 2IPAA 3TRQA 2OE1A 3HYPA 2GDRA 2NDOA 1TRSA 5JCWA 1B4QA 2VCWA 2H0HA 1XCCA 5D9WA 2LRNA 1T4ZA 2Z9SA 3GH6A 4POMA 14GSA 2LEGA 3EU3A 3IA1A 1GSDA 3HA9A 3PR8A 2O87A 1VF1A 1O8XA 3TJJA 3CXGA 1YKCA 2TRCP 2YV7A 1ZL9A 1XBSA 2YZUA 1K0MA 3WT1A 4TR3A 2L5LA 1Z7RA 2KP1A 2FCHA 2I4AA 4TR0A 2LUSA 4DSSB 1M9BA 3W8JA 4CDOA 2PVQA 5INYA 4IHUA 5CO3A 1LBKA 1OVNA 2P5RA 1FVJA 16GSA 2IFQB 3I6AA 4V2MA 4USSA 2YN1A 2GLRA 3UVHA 1Z6MA 1NSWA 5KN3A 3KTBA 2H6XA 5ECOB 13GSA 4NHWA 4ZL9A 1TOFA 1SK0A 1LU4A 2M72A 2LSTA 1TRUA 3GMFA 3CRTA 2ZCTA 1M2DA 4ID0A 2VL9A 2XBIA 1V2AA 2B7JA 3GKXA 4RQXA 4ZB6A 2VLVA 3IK9A 3E0UA 2LNSA 4EF0A 1T00A 3IC4A 4KSOA 4D73A 2FA8A 3KMOA 3IPZA 4PQHA 1X9WB 5G5FA 4XRDA 4TVEA 5J41A 2LJAA 2L4QA 4EVMA 3WYWA 5IMZA 4HZ4A 2P5QA 5ECLB 1USBA 4K2DA 2FHEA 1HNAA 5CRGA 2NTOA 1VRSD 1THOA 1M0UA 1LJRA 1BJXA 3L9UA 5D73A 2X99A 2WCIA 3GL3A 4XHMA 3QMXA 3V1WA 3L78A 4F03A 2AV4A 4Q5NA 3C71A 2LS5A 4ZBBA 4JZQA 1TJDA 5G1LA 4LL4B 3VK9A 3KH7A 3BJ5A 3W6GA 1M99A 2PMTA 3KP8A 5CRDA 4DSSA 1PKWA 2PWJA 3TKSC 4MJBA 4MH2A 2IFQA 4N10A 2YANA 2VD1A 3HHVA 5IPHA 1F37A 4PUFC 4WR5A 5C00A 5ABRA 1AIUA 1QGVA 4WXTA 4V1Ap 2E2MA 1Y25A 1TI1A 1I9DA 2VUPA 2CQ9A 2F9SA
chains in the Genus database with same CATH superfamily
1OKTA 4L0WA 2PUKC 2R2JA 5H5RA 1GTAA 2RM6A 2LRTA 1QQ2A 1GTBA 1SYRA 3QOUA 1ZOFA 1ERTA 4AKIA 1ERVA 5KOWA 2IMIA 1TTZA 1TKDB 2HRNA 4ML1A 2WW3A 1KTEA 3M1GA 5H5SA 2PERA 3DRNA 3CTFA 1ST9A 4RI6A 4EL1A 3VPQA 5CNWA 5F06A 5B8AA 5DQYA 2PBJA 2PVOC 2C3NA 4TR4A 4K9ZA 3D5JA 4NPBA 5ID2B 3GUSA 5G5EA 3ZZXA 3P7XA 5GAPD 1B9YC 2OE0A 2IN3A 5HR1A 2RUEA 4OO5A 1XIYA 1YF0A 2F51A 1GNWA 3D21A 2H30A 3LQ7A 4MABA 3VI7A 1B48A 2L6CA 5EL8A 4KSMA 2CX4A 2HSHA 4K7NA 1F3AA 4MLYA 4OCFA 3FR3A 4NV5A 2DJKA 2X8HA 4NHZA 4N3ZA 5CRWA 3KIJA 4I2TA 4ZBDA 4MJCA 2LQOA 2G2QA 5CYYA 4AJ6A 3I9V2 2HLSA 3AY8A 5FWGA 5GZZB 1FB6A 1WE0A 1GUHA 1F2EA 4ZIJA 3IC8A 4MZWA 4I2UA 2HYXA 4EDYA 4WBJA 1X9MB 2CVBA 4XCSA 4ZB7A 5BMUA 1A0RP 2MZCA 3FR6A 18GSA 17GSA 5A4WA 3GFKA 3VPTA 1AW9A 2VLUA 2C3TA 1XVWA 1TK5B 1Z9HA 3TKQA 1NM3A 2OACA 2FY6A 2L4CA 2O85A 4L0UA 3FKFA 2UZ8A 1Z7PA 2ON5A 1SD8A 3ZLPA 2C80A 2JZSA 4GLTA 4EKZA 1A23A 1W89A 4GCIA 5A4UA 1BYEA 4V2NA 1XW6A 4MJAA 3EWLA 1WPIA 3MDKA 2YJ7A 1FHEA 2NBSA 2MMZA 2F8AA 4EO3A 1Y6EA 5D93A 3Q19A 4ZB8A 2DJ2A 2LV3A 3LEFA 1XWAA 4N0ZA 6GSUA 1GUKA 2XHFA 2WZSA 1IYHA 4AKHA 1J08A 1M7TA 5EPFA 2HI7A 5JCGA 3A3TA 3G9BA 5DJMA 5B7CA 1MDJA 1YEPA 1OE7A 2RM5A 1GULA 1XWCA 1OYJA 4KDYA 4A5PA 4PX1A 3EPTA 2A2RA 5ID2A 2V6OA 9GSSA 4PUAA 2X8GA 1XFLA 3ZFLA 1S3AA 4FO5A 1QK8A 1YJ6A 3UAPA 4N0VA 4PNFA 5B6NA 10GSA 2A2SA 2HT9A 2R4VA 5D8IA 1JZWA 2VLTA 1MEKA 2BTOT 1MDKA 4BPYA 4AI6A 4GSTA 2EFHA 1FAAA 4IELA 1HNCA 3DD3A 3CTGA 1Z3EA 5LCZA 4L8EA 2CVDA 3PINA 2MMOA 2HFDA 3HJOA 2WVZA 3L9VA 2FWGA 5DJLA 3KH9A 2P0GA 3KGKA 4OWYA 3ZIVA 4IVFA 3MIXA 3CSJA 3HD5A 2H71A 1BG1A 2D2ZA 4IJIA 3C7MA 2NVLA 5HFIA 3S9FA 1ERWA 1OC8A 1WWJA 4O5QA 4G19A 1GSUA 1ZMAA 4G01A 5AISA 2A4HA 1TK8B 3SWLA 2XBQA 1K0CA 12GSA 1W4VA 5IMFA 4F0BA 4MJEA 4FIWA 3L0HA 4FXYP 4Q5RA 4WKWA 1R5AA 3DEXA 4XRAA 3BD2A 2H75A 3C73A 1YF1A 4KUNA 4X1UA 2M80A 4XS1A 3VWVA 1PX7A 1ACVA 1DE1A 1BG5A 3GA4A 3D22A 3GIXA 2K6VA 1XZOA 2M46A 4J56E 3RFRC 1UA5A 2AUVA 4G2EA 4YH2A 4F9ZA 5HQPA 5ELAA 3KTLA 3RBTA 2LJRA 1GSFA 2ZUPA 3DWVA 4JBBA 1RW1A 1VF3A 1DUGA 3HVNA 3QAVA 2FGXA 1YZXA 5B8BA 2B3SA 4HDEA 4J57E 4H86A 2RLIA 1ZYEA 5JWRB 5GAND 1PFOA 2HZFA 1K0NA 4OMVA 5GSTA 4N11A 1T7PB 2WB9A 2GQMA 2GT5A 2DJ0A 3IAS2 4Z7XA 1A0FA 2CA8A 4JEDA 3HKRA 2WULA 4ZL8A 1GLPA 1X5EA 1AAZA 1A8LA 1XWKA 2C3QA 3RPPA 4EUYA 3QR6A 2H1AA 4E8HA 2H66A 1T8EB 2YWOA 3HXSA 3GSSA 2C0FA 2H1GA 4W66A 2FA4A 5ECMB 3QFAC 4K7OA 3BOAA 3KD0A 2O36A 1PD21 1GSYA 1T1VA 2JU5A 4QL7A 4EDZA 4KA0A 4O5UA 2CX3A 5IMAA 3ME7A 3QAGA 5LNKe 3IR4A 1TRVA 4YQVA 5IO2A 4I97A 5IM9A 4L5LA 3M8NA 1H4OA 4MF7A 2HQTA 4MH3A 1X5DA 4HUAA 1HNBA 4HQZA 3IHQA 1CQGA 3HJPA 1EP8A 3ZMKA 5AIVA 2JZTA 3TKSE 3ZL5A 5ECQB 4MZBA 1E6BA 1S3RA 3TCOA 1X0RA 2LTKA 3VI5A 4TN8A 22GSA 1M2AA 3J7Yk 5KOXA 4RI7A 4EE0A 3LW9A 1PSQA 2CV4A 4IQ1A 2R6KA 2ON7A 1UVZA 3TRXA 4F2IA 2CAIA 2WFCA 3KEBA 1FW1A 5DCHA 3RGBC 2N5BA 1HD2A 5HFGA 3UARA 1ZYNA 3ED3A 1QXHA 4IKHA 2P31A 3GN3A 4TXVA 1SK2A 1K0AA 4XS6A 3UMAA 3LXTA 1EOHA 4G9HA 2E0QA 4IP6A 3LJRA 1GL8A 4IS0A 1WRYA 4AGSA 3U5RE 5ECHB 1F3BA 1PX6A 3MYDA 4FYCA 2UV8G 1U87A 3D4MA 2WVYA 1S3DA 2QC7A 2AB6A 5ECKB 3UBKA 6GSTA 1AC1A 3TDGA 2FUG2 5LD0A 3EU4A 3F6DA 4IP1A 4JU5A 2B6MA 4GWRA 2I3YA 3ZVJD 4AJ8A 5GSSA 2HZEB 3GKNA 1XW9A 1XW5A 2L57A 3GRXA 4BVXB 2H76A 3HZ4A 1WP0A 2A4VA 3ZTLA 2HRKB 4O7HA 3ZRDA 2H01A 1QMVA 4GXZA 1U3IA 1THXA 3LXZA 4NMUA 5CREA 1MD3A 4IQAA 1ZYPA 1SL2B 2OKAA 2L59A 3FZAA 2DLXA 2YPMA 4KF9A 5DVBA 3GL5A 3MNGA 4IJ3A 1EV4A 3ERFA 4K0GA 5J5NA 3GNJA 1UC7A 1JLVA 4OFNA 2GS3A 2IMKA 5A34B 5HFKA 2JACA 1V40A 4EC0A 4YQUA 1EEJA 2HSNB 3FYGA 5H5QA 3MAKA 3APSA 5JWOB 1N25A 1N8JA 2WVXB 2FWHA 1HYUA 2IL3A 1Q98A 2WRTA 5ENUA 3G7YA 4MF6A 1C72A 2JSZA 2V2GA 1J9BA 3QFBC 2DJ1A 4K5SA 1G7OA 3CSIA 3HZ8A 1N2AA 3N5OA 2DMMA 2E2GA 4G0IA 2F8FA 4TR1B 2CT6A 4FYUA 1G0TA 1O8WA 2YWIA 3OR5A 2IMFA 2C1YA 4NXIA 3ERGA 5A5HB 2LKUA 1Q4JA 3NOFA 3F0IA 1O85A 2VCXA 2FNOA 4E8EA 2H1LA 2H72A 1K0OA 1XVQA 5D96A 4YAPA 3EMXA 1SL1B 2MBTA 3MWHA 2HE3A 1AQVA 3UL3A 1I5GA 4JR4A 5F07A 5HR3A 3MSZA 2VIMA 3GHAA 4ECCA 4MPGA 4PURA 2HZEA 3HVSA 3GTUB 3LSZA 4PI2C 4Q5FA 2OE3A 1BAYA 2CZ3A 4BVXA 2HSMB 2DIZA 3WGXA 2HRKA 2QGVA 4POLA 3SBCA 3M9KA 2H74A 2GSTA 3IK7A 1SKRB 2OADA 4EIQA 2VD0A 1R7HA 5FT3A 4MMMA 1X9SB 3CMIA 4GQFA 5ELGA 3H8QA 1OE8A 1ZGNA 3ISOA 4DVCA 4KW6A 2GQKA 1TP9A 4FYBA 1BX9A 4K7IA 4ECBA 4OFMA 2R5GA 2DJ3A 4IGJA 1E2YA 4V2LA 2GSSA 4HI7A 1ML6A 2N5FA 2PN8A 3QPMA 1XXUA 3VLNA 2B7KA 2TIRA 2B5EA 2VAFA 5G1KA 3VWUA 3NZNA 2H1BA 1JLWA 2X4AA 3CWGA 5J47A 1BF5A 2AYTA 4XIHA 5A34A 1OC3A 1UN2A 3U6VA 1A2MA 3VURA 2REMA 1G6YA 4OO4A 2C0EA 1SVOA 4ML6A 5CP1A 2HSNA 6GSWA 2EIOA 4I5QA 2HRAA 2MMNA 4WF4A 1JZRA 4ZL7A 2LRCA 1NW2A 1PGTA 1U88A 5BRTA 1GNEA 2ALBA 3RAZA 4TKYA 1V98A 3UBLA 3PH9A 4OD7A 2RIIA 2X8CA 2KP2A 3IBHA 3HMJG 3DIEA 4CW9A 1ON4A 3GX0A 4TR1A 2OBKA 4NV2A 3TJBA 3HDCA 3F4SA 1G7EA 1XOAA 1O6JA 1FVKA 2H1DA 2VCZA 4P3YB 5DAKB 4RQRA 2O8VB 4BL7B 2K8SA 5J3RA 4PXOA 3TUEA 2CZ2A 4GQCA 4Z2UA 4F0CA 1PN0A 4O92A 3ERWA 4LL1B 2O5VA 2EFDA 1GH2A 3GYKA 4N30A 1TU8A 5JCUA 2CAQA 4BVYB 2V6KA 3TOUA 4L5OA 4MDCA 1XWGA 1MDIA 2JSYA 2RUFA 1GWCA 2V32A 2IJYA 2WGRA 1XPVA 1B8XA 4K8MA 3H93A 5EY6A 1PN9A 5AGYA 5D9VA 2EIRA 2B1KA 4HU9A 1A2LA 3DXBA 2K18A 4AF2A 1K3YA 4PQ1A 3HJMA 1PRXA 3H4KA 4HU7A 2LNTA 2YWMA 5C04A 1QFNA 3TKPA 2VM1A 3VWWA 2R0CA 2OJLA 2HSYA 2BMXA 3DYRA 2AJQB 3LYKA 1AXDA 1ILOA 4AJ7A 1R4WA 3LYPA 1FOVA 3ZITA 2O89A 3UEMA 1MTCA 2YV9A 3LGCA 2GSRA 4WR4A 5KN1A 3US3A 4JE1A 2IWTA 4J2FA 3FEUA 3H79A 6GSYA 2VL3A 1O7UA 2YNXA 3O76A 2YZHA 4ECIA 2HRFA 1RQMA 2C0DA 3M0FA 2GGTA 2H6YA 1O81A 2H73A 5ECSA 3TRPA 1BQ7A 5IOWA 3KM6A 3FR9A 2VOCA 2C8UA 3QCPA 2WJUA 5DAKA 1GSSA 4BL7A 4LLRA 3UOMA 2GQLA 3PPUA 3CRUA 3RDWA 4HZ2A 3ZIJA 4ICYA 3TJGA 2EC4A 1BEDA 1SL0B 4ILFA 2YP6A 5ECPB 2YWNA 4BVYA 2WDUA 1XWBA 1J0FA 2X49A 5J9BA 2VO4A 4HEA2 4XTSA 3G7IA 3DGQA 2TRXA 1I1IP 3C1SA 3D4TA 4QL9A 2OBIA 2FWEA 4KE3A 2ZNMA 4KCEA 3LG6A 2B5XA 5HR2A 3FHKA 6GSVA 3IV4A 4AKXB 5B6MA 3EURA 3QD9A 1F6MC 3DMLA 2PGTA 3R2QA 4LMWA 1YEXA 2L6DA 2BJXA 3H1NA 4PGTA 3A2XA 3M9JA 2FWFA 2JZRA 5L71A 1DE2A 4HOJA 1FOHA 2H0GA 1MD4A 5DCGA 4ZXGA 5ECNB 2PPTA 2X64A 5AIXA 5G31A 3C1RA 1URMA 4DSRA 2FLSA 4KDXA 2XC2A 4CHSA 5E59A 1SD9A 2H19A 4X43A 3ZREA 4MZCA 4QQ7A 3VFIA 1XOBA 1ABAA 1TW9A 1GSQA 3CYNA 2GZZA 2WZ9A 2JL4A 4G0KA 4DEJA 1R5PA 3F63A 3F4TA 4JRRA 3WGDA 2B1LA 3QDNA 1A2JA 1EGRA 2EFEA 2DBCA 5IPGA 1YQ1A 2VCQA 1QUWA 2FD3A 1G6WA 4G0LA 3R3EA 4WETA 3C8EA 5CAXA 1PL1A 5F05A 2GZPA 4BWSA 4WEYA 4GSSA 2GSQA 1AQWA 4G10A 3EMPA 2PU9C 3TJFA 2F3MA 5G2ZA 2H8LA 3FMWA 2QSIA 1GUMA 2VL2A 4KAEA 2GTUA 4X4JA 1EGOA 2HNLA 3HY2A 1SK1A 4K6XA 4JR6A 4KGIA 3TKRA 3IAM2 3KP9A 2R0GA 3LWAA 4ACSA 1PQNA 1FG4A 1WMJA 1ERUA 2KHPA 3PGTA 1GTIA 3GSTA 5KEJA 3VWXA 3Q74A 4GDFA 3FY7A 1U6TA 3CBUA 3L4NA 3GH9A 2IMDA 5D9TA 3EVIA 2QA1A 5DALB 5ECRB 1GRXA 5IIZA 2WW1A 4BA7A 3IXRA 4YKGA 3DKSA 5F0GA 20GSA 1EEMA 4HQSA 1PKZA 4I6XA 4MCUA 1K0DA 4GTUA 3KMNA 4V1Ag 4ZBAA 1M2BA 5A4VA 1A8YA 4KB3A 1JZOA 4TW5A 2I9HA 4OCEA 5J4UA 4YQMA 2O3EA 1WOUA 8GSSA 3RHBA 4FH8A 3BCKA 4KDUA 4NWYA 2GT6A 3TGZA 2HXKA 5D9XA 2LJKA 3HVXA 4HSCX 4ISDA 3IDVA 3IOSA 2C4JA 1V58A 4IW9A 4O32A 5DQSA 3A5WA 1FO5A 4OFTA 3CHXC 5AN1A 4POKA 3APOA 1EV9A 19GSA 2K9FA 2VM2A 1FB0A 1AQXA 5A1NB 5IOXA 3N9JA 3TU3B 4BWQA 1EWXA 4K1FA 3JCML 1EP7A 2V1MA 4K0NA 3M3MA 1U3AA 3TOTA 2YCDA 3WGEA 6GSXA 2I81A 3WD6A 3J7Yb 4DSQA 1HQOA 1F9MA 1JHBA 4X0XA 4KX4A 3TB2A 4ULXA 3EINA 3KXOA 3KCMA 3RPNA 3EE2A 3DVXA 1NHOA 3UJ1A 2QKEA 1CQHA 3F8UA 4QMKA 4PQIA 4F82A 3W8SA 5FHIA 3LORA 1YY7A 3CQFA 5IMCA 4I8BA 3ZMLA 1KBNA 3CSHA 5JWQB 5IMDA 5CRHA 5ECIB 2KOKA 3FW2A 4EXJA 2K8VA 3FZ9A 2B5YA 4XS4B 1OC9B 4YAVA 2CVKA 4ZB9A 4WF5A 5IO0A 4NAXA 1SJ6A 1Z5YE 2XPEA 3FZ5A 3GKKA 4GRFA 5IQYA 5DALA 2L5OA 4GSNA 3FK8A 4MK3A 2EIQA 3E9JB 2R0PA 4POBA 3BBYA 4KNDA 3TJKA 1SENA 3DVWA 2KUCA 3F4RA 5KN2A 3K8NA 1R26A 4BIKA 4PHZC 3HCZA 1NHYA 1ZCPA 1SKSB 2WVXA 1TI3A 2LQQA 1EZKA 6GSSA 2J9HA 4TXOB 4ZILA 3F9UA 1Z6NA 1DSBA 1PA3A 3D0ZA 1OAZA 3RHCA 3ZYWA 5HR0A 3ZVJA 5DDLA 1M9AA 4CY6A 2DMLA 5J4VA 2AHEA 1OKDA 3F6FA 3GURA 4LMVA 1T3BA 1JFUA 1X5CA 3QAWA 2YJHA 5A5HA 1O73A 2DSAA 4HS1A 5A1NA 1EOGA 2YOIA 2OA7A 4Q5QA 4ECJA 3KZQA 3IRAA 2XPDA 5COHA 2GZYA 2O7KA 2NPBA 1SU9A 4MA9A 3ZFBA 4TRXA 3EYTA 1SKWB 4KCAA 5J40A 3TKSA 1YDKA 4MF5A 3D6IA 3GTUA 11GSA 5E4WA 1WJKA 5EVOA 2HSMA 4WBRD 1TRWA 1VGLA 3A2VA 2J23A 2QA2A 2R3XA 3P90A 1H75A 1KNGA 3I69A 1YEWC 4HJMA 3Q18A 5KN0A 3O6TA 1K3OA 2VCTA 3UVTA 1GTUA 2MMAA 3IHGA 1GP1A 3UIWA 7GSSA 4YKFA 4MP4A 5F8BA 4K2XA 1S3CA 2C0GA 5J4YA 1SJZA 1B4PA 1AUCA 3KJYA 4PNGA 4XS4A 1K3LA 1OC9A 1T4YA 3G7JA 5G30A 1DBYA 1RK4A 4KH7A 2G0FA 3E3EA 3F3QA 4E68A 3GV1A 3A2WA 1B9XC 2KLXA 1A24A 1SVMA 2AAWA 4MPFA 2GVPA 1KEBA 2VL2C 1PMTA 2DJJA 1TK0B 3O3TA 2WS2A 1V9WA 3APQA 4O5RA 4HJ2A 1JZDA 2H70A 2DC5A 1TDIA 4PI0C 3GX8A 1YKAA 4IBPA 1YVLA 2E7PA 3NIVA 4PTSA 4GF0A 3L9SA 5DBQA 2ES7A 1TU7A 2VCVA 2MYGA 1GLQA 4TXOA 3ME8A 3FRCA 2IMEA 4CY8A 2IIYA 1ZZYA 3HVVA 3LFLA 2MBSA 1IYIA 1VF2A 3I43A 3P8WA 3IE3A 2H0IA 1TXXA 5J9CA 2DIYA 3GKMA 1SYXA 1PL2A 4D73B 4TOPA 2N5AA 4RUVA 4FQUA 1VF4A 2H6ZA 5A5KA 1GSEA 3F3RA 2JADA 1V57A 4IN0A 3BCIA 3FZ4A 2R37A 4AKGA 2V41A 4LA1A 2I1UA 3EC3A 1WIKA 3Q6OA 5IMVA 1SJIA 3P2AA 3WT2A 1K0BA 1ZYQB 2IPAA 3TRQA 2OE1A 3HYPA 2GDRA 2NDOA 1TRSA 5JCWA 1S4BP 1B4QA 2VCWA 2H0HA 1XCCA 5D9WA 2LRNA 1T4ZA 2Z9SA 1Y1UA 3GH6A 4POMA 4K5RA 14GSA 2LEGA 3EU3A 3IA1A 1GSDA 3HA9A 3PR8A 2O87A 1VF1A 1O8XA 3TJJA 3CXGA 1YKCA 2TRCP 2YV7A 1ZL9A 1XBSA 2YZUA 1K0MA 3WT1A 4TR3A 2L5LA 1Z7RA 2KP1A 2FCHA 2I4AA 4TR0A 2LUSA 4DSSB 1M9BA 3W8JA 4CDOA 2DKIA 1XG8A 2PVQA 5INYA 4IHUA 5CO3A 1LBKA 1OVNA 2P5RA 1FVJA 16GSA 2IFQB 3I6AA 4V2MA 4USSA 2YN1A 2GLRA 3UVHA 1Z6MA 1NSWA 5KN3A 3KTBA 2H6XA 5ECOB 13GSA 4NHWA 4ZL9A 1TOFA 2OT3A 1SK0A 1LU4A 2M72A 2LSTA 1TRUA 3GMFA 3CRTA 2VKZG 4MNNA 2ZCTA 1TXUA 1M2DA 4ID0A 2VL9A 2XBIA 1V2AA 2B7JA 2DKHA 3GKXA 4RQXA 4ZB6A 2VLVA 3IK9A 3E0UA 2LNSA 4EF0A 1T00A 3IC4A 4KSOA 4D73A 2FA8A 3KMOA 3IPZA 4PQHA 2WW0A 1M3JA 1X9WB 5G5FA 4XRDA 4TVEA 5J41A 2LJAA 1SVLA 2L4QA 2A2PA 4EVMA 3WYWA 5IMZA 4HZ4A 2P5QA 5ECLB 1USBA 4K2DA 2FHEA 1HNAA 5CRGA 2WW2A 2NTOA 1VRSD 1THOA 3A5IA 1M0UA 1LJRA 1BJXA 3L9UA 5D73A 2X99A 2WCIA 3GL3A 4XHMA 3QMXA 3V1WA 3L78A 4F03A 2AV4A 4Q5NA 3C71A 2LS5A 4ZBBA 4JZQA 1TJDA 5G1LA 4LL4B 3VK9A 3KH7A 3BJ5A 3W6GA 1M99A 4EIPA 2PMTA 3KP8A 5CRDA 4DSSA 4Z2TA 1PKWA 2PWJA 3TKSC 5BMUB 2EFCA 4MJBA 1M3IA 4MH2A 2IFQA 4N10A 2YANA 2VD1A 3HHVA 5IPHA 1F37A 4PUFC 4WR5A 4Z2RA 5C00A 5ABRA 1AIUA 1QGVA 4WXTA 4V1Ap 2E2MA 1Y25A 1TI1A 1I9DA 2VUPA 2CQ9A 2F9SA
chains in the Genus database with same CATH topology
1OKTA 4L0WA 2PUKC 2R2JA 5H5RA 1GTAA 2RM6A 2LRTA 1QQ2A 1GTBA 1SYRA 3QOUA 1ZOFA 1ERTA 4AKIA 1ERVA 5KOWA 2IMIA 1TTZA 1TKDB 2HRNA 4ML1A 1KTEA 3M1GA 5H5SA 2PERA 3DRNA 3CTFA 1ST9A 4RI6A 4EL1A 3VPQA 5CNWA 5F06A 5B8AA 5DQYA 2PBJA 2PVOC 2C3NA 4TR4A 4K9ZA 3D5JA 4NPBA 5ID2B 3GUSA 5G5EA 3ZZXA 3P7XA 5GAPD 1B9YC 2OE0A 2IN3A 5HR1A 2RUEA 4OO5A 1XIYA 1YF0A 2F51A 1GNWA 3D21A 2H30A 3LQ7A 4MABA 3VI7A 1B48A 2L6CA 5EL8A 4KSMA 2CX4A 2HSHA 4K7NA 1F3AA 4MLYA 4OCFA 3FR3A 4NV5A 2DJKA 2X8HA 4NHZA 4N3ZA 5CRWA 3KIJA 4I2TA 4ZBDA 4MJCA 2LQOA 2G2QA 5CYYA 4AJ6A 3I9V2 2HLSA 3AY8A 5FWGA 5GZZB 1FB6A 1WE0A 1GUHA 1F2EA 4ZIJA 3IC8A 4MZWA 4I2UA 2HYXA 4EDYA 4WBJA 1X9MB 2CVBA 4XCSA 4ZB7A 5BMUA 1A0RP 2MZCA 3FR6A 18GSA 17GSA 5A4WA 3GFKA 3VPTA 1AW9A 2VLUA 2C3TA 1XVWA 1TK5B 1Z9HA 3TKQA 1NM3A 2OACA 2FY6A 2L4CA 2O85A 4L0UA 3FKFA 2UZ8A 1Z7PA 2ON5A 1SD8A 3ZLPA 2C80A 2JZSA 4GLTA 4EKZA 1A23A 1W89A 4GCIA 5A4UA 1BYEA 4V2NA 1XW6A 4MJAA 3EWLA 1WPIA 3MDKA 2YJ7A 1FHEA 2NBSA 2MMZA 2F8AA 4EO3A 1Y6EA 5D93A 3Q19A 4ZB8A 2DJ2A 2LV3A 3LEFA 1XWAA 4N0ZA 6GSUA 1GUKA 2XHFA 1IYHA 4AKHA 1J08A 1M7TA 5EPFA 2HI7A 5JCGA 3A3TA 3G9BA 5DJMA 5B7CA 1MDJA 1YEPA 1OE7A 2RM5A 1GULA 1XWCA 1OYJA 4KDYA 4A5PA 4PX1A 3EPTA 2A2RA 5ID2A 2V6OA 9GSSA 4PUAA 2X8GA 1XFLA 3ZFLA 1S3AA 4FO5A 1QK8A 1YJ6A 3UAPA 4N0VA 4PNFA 5B6NA 10GSA 2A2SA 2HT9A 2R4VA 5D8IA 1JZWA 2VLTA 1MEKA 2BTOT 1MDKA 4BPYA 4AI6A 4GSTA 2EFHA 1FAAA 4IELA 1HNCA 3DD3A 3CTGA 1Z3EA 5LCZA 4L8EA 2CVDA 3PINA 2MMOA 2HFDA 3HJOA 3L9VA 2FWGA 5DJLA 3KH9A 2P0GA 3KGKA 4OWYA 3ZIVA 4IVFA 3MIXA 3CSJA 3HD5A 2H71A 1BG1A 2D2ZA 4IJIA 3C7MA 2NVLA 5HFIA 3S9FA 1ERWA 1OC8A 1WWJA 4O5QA 4G19A 1GSUA 1ZMAA 4G01A 5AISA 2A4HA 1TK8B 3SWLA 2XBQA 1K0CA 12GSA 1W4VA 5IMFA 4F0BA 4MJEA 4FIWA 3L0HA 4Q5RA 4WKWA 1R5AA 3DEXA 4XRAA 3BD2A 2H75A 3C73A 1YF1A 4KUNA 4X1UA 2M80A 4XS1A 3VWVA 1PX7A 1ACVA 1DE1A 1BG5A 3GA4A 3D22A 3GIXA 2K6VA 1XZOA 2M46A 4J56E 1UA5A 2AUVA 4G2EA 4YH2A 4F9ZA 5HQPA 5ELAA 3KTLA 3RBTA 2LJRA 1GSFA 2ZUPA 3DWVA 4JBBA 1RW1A 1VF3A 1DUGA 3QAVA 2FGXA 1YZXA 5B8BA 2B3SA 4HDEA 4J57E 4H86A 2RLIA 1ZYEA 5JWRB 5GAND 2HZFA 1K0NA 4OMVA 5GSTA 4N11A 1T7PB 2WB9A 2GQMA 2GT5A 2DJ0A 3IAS2 4Z7XA 1A0FA 2CA8A 4JEDA 3HKRA 2WULA 4ZL8A 1GLPA 1X5EA 1AAZA 1A8LA 1XWKA 2C3QA 3RPPA 4EUYA 3QR6A 2H1AA 4E8HA 2H66A 1T8EB 2YWOA 3HXSA 3GSSA 2C0FA 2H1GA 4W66A 2FA4A 5ECMB 3QFAC 4K7OA 3BOAA 3KD0A 1PD21 1GSYA 1T1VA 2JU5A 4QL7A 4EDZA 4KA0A 4O5UA 2CX3A 5IMAA 3ME7A 3QAGA 5LNKe 3IR4A 1TRVA 4YQVA 5IO2A 4I97A 5IM9A 4L5LA 3M8NA 1H4OA 4MF7A 2HQTA 4MH3A 1X5DA 4HUAA 1HNBA 4HQZA 3IHQA 1CQGA 3HJPA 1EP8A 3ZMKA 5AIVA 2JZTA 3TKSE 3ZL5A 5ECQB 4MZBA 1E6BA 3TCOA 1X0RA 2LTKA 3VI5A 4TN8A 22GSA 1M2AA 3J7Yk 5KOXA 4RI7A 4EE0A 3LW9A 1PSQA 2CV4A 4IQ1A 2R6KA 2ON7A 1UVZA 3TRXA 4F2IA 2CAIA 2WFCA 3KEBA 1FW1A 5DCHA 2N5BA 1HD2A 5HFGA 3UARA 1ZYNA 3ED3A 1QXHA 4IKHA 2P31A 3GN3A 4TXVA 1SK2A 1K0AA 4XS6A 3UMAA 3LXTA 1EOHA 4G9HA 2E0QA 4IP6A 3LJRA 1GL8A 4IS0A 1WRYA 4AGSA 3U5RE 5ECHB 1F3BA 1PX6A 3MYDA 4FYCA 2UV8G 1U87A 3D4MA 1S3DA 2QC7A 2AB6A 5ECKB 3UBKA 6GSTA 1AC1A 3TDGA 2FUG2 5LD0A 3EU4A 3F6DA 4IP1A 4JU5A 2B6MA 4GWRA 2I3YA 3ZVJD 4AJ8A 5GSSA 2HZEB 3GKNA 1XW9A 1XW5A 2L57A 3GRXA 4BVXB 2H76A 3HZ4A 1WP0A 2A4VA 3ZTLA 2HRKB 4O7HA 3ZRDA 2H01A 1QMVA 4GXZA 1U3IA 1THXA 3LXZA 4NMUA 5CREA 1MD3A 4IQAA 1ZYPA 1SL2B 2OKAA 2L59A 3FZAA 2DLXA 2YPMA 4KF9A 5DVBA 3GL5A 3MNGA 4IJ3A 1EV4A 3ERFA 4K0GA 5J5NA 3GNJA 1UC7A 1JLVA 4OFNA 2GS3A 2IMKA 5A34B 5HFKA 2JACA 1V40A 4EC0A 4YQUA 1EEJA 2HSNB 3FYGA 5H5QA 3MAKA 3APSA 5JWOB 1N25A 1N8JA 2FWHA 1HYUA 2IL3A 1Q98A 2WRTA 5ENUA 3G7YA 4MF6A 1C72A 2JSZA 2V2GA 1J9BA 3QFBC 2DJ1A 4K5SA 1G7OA 3CSIA 3HZ8A 1N2AA 3N5OA 2DMMA 2E2GA 4G0IA 2F8FA 4TR1B 2CT6A 4FYUA 1G0TA 1O8WA 2YWIA 3OR5A 2IMFA 2C1YA 4NXIA 3ERGA 5A5HB 2LKUA 1Q4JA 3NOFA 3F0IA 1O85A 2VCXA 2FNOA 4E8EA 2H1LA 2H72A 1K0OA 1XVQA 5D96A 4YAPA 3EMXA 1SL1B 2MBTA 3MWHA 2HE3A 1AQVA 3UL3A 1I5GA 4JR4A 5F07A 5HR3A 3MSZA 2VIMA 3GHAA 4ECCA 4MPGA 4PURA 2HZEA 3HVSA 3GTUB 3LSZA 4Q5FA 2OE3A 1BAYA 2CZ3A 4BVXA 2HSMB 2DIZA 3WGXA 2HRKA 2QGVA 4POLA 3SBCA 3M9KA 2H74A 2GSTA 3IK7A 1SKRB 2OADA 4EIQA 2VD0A 1R7HA 5FT3A 4MMMA 1X9SB 3CMIA 4GQFA 5ELGA 3H8QA 1OE8A 1ZGNA 3ISOA 4DVCA 4KW6A 2GQKA 1TP9A 4FYBA 1BX9A 4K7IA 4ECBA 4OFMA 2R5GA 2DJ3A 4IGJA 1E2YA 4V2LA 2GSSA 4HI7A 1ML6A 2N5FA 2PN8A 3QPMA 1XXUA 3VLNA 2B7KA 2TIRA 2B5EA 2VAFA 5G1KA 3VWUA 3NZNA 2H1BA 1JLWA 2X4AA 3CWGA 5J47A 1BF5A 2AYTA 4XIHA 5A34A 1OC3A 1UN2A 3U6VA 1A2MA 3VURA 2REMA 1G6YA 4OO4A 2C0EA 1SVOA 4ML6A 5CP1A 2HSNA 6GSWA 2EIOA 4I5QA 2HRAA 2MMNA 4WF4A 1JZRA 4ZL7A 2LRCA 1NW2A 1PGTA 1U88A 5BRTA 1GNEA 2ALBA 3RAZA 4TKYA 1V98A 3UBLA 3PH9A 4OD7A 2RIIA 2X8CA 2KP2A 3IBHA 3HMJG 3DIEA 4CW9A 1ON4A 3GX0A 4TR1A 2OBKA 4NV2A 3TJBA 3HDCA 3F4SA 1G7EA 1XOAA 1O6JA 1FVKA 2H1DA 2VCZA 4P3YB 5DAKB 4RQRA 2O8VB 4BL7B 2K8SA 5J3RA 4PXOA 3TUEA 2CZ2A 4GQCA 4Z2UA 4F0CA 1PN0A 4O92A 3ERWA 4LL1B 2O5VA 2EFDA 1GH2A 3GYKA 4N30A 1TU8A 5JCUA 2CAQA 4BVYB 2V6KA 3TOUA 4L5OA 4MDCA 1XWGA 1MDIA 2JSYA 2RUFA 1GWCA 2V32A 2IJYA 2WGRA 1XPVA 1B8XA 4K8MA 3H93A 5EY6A 1PN9A 5AGYA 5D9VA 2EIRA 2B1KA 4HU9A 1A2LA 3DXBA 2K18A 4AF2A 1K3YA 4PQ1A 3HJMA 1PRXA 3H4KA 4HU7A 2LNTA 2YWMA 5C04A 1QFNA 3TKPA 2VM1A 3VWWA 2R0CA 2OJLA 2HSYA 2BMXA 3DYRA 2AJQB 3LYKA 1AXDA 1ILOA 4AJ7A 1R4WA 3LYPA 1FOVA 3ZITA 2O89A 3UEMA 1MTCA 2YV9A 3LGCA 2GSRA 4WR4A 5KN1A 3US3A 4JE1A 2IWTA 4J2FA 3FEUA 3H79A 6GSYA 2VL3A 1O7UA 2YNXA 3O76A 2YZHA 4ECIA 2HRFA 1RQMA 2C0DA 3M0FA 2GGTA 2H6YA 1O81A 2H73A 5ECSA 3TRPA 1BQ7A 5IOWA 3KM6A 3FR9A 2VOCA 2C8UA 3QCPA 2WJUA 5DAKA 1GSSA 4BL7A 4LLRA 3UOMA 2GQLA 3PPUA 3CRUA 3RDWA 4HZ2A 3ZIJA 4ICYA 3TJGA 2EC4A 1BEDA 1SL0B 4ILFA 2YP6A 5ECPB 2YWNA 4BVYA 2WDUA 1XWBA 1J0FA 2X49A 5J9BA 2VO4A 4HEA2 4XTSA 3G7IA 3DGQA 2TRXA 3D4TA 3C1SA 4QL9A 2OBIA 2FWEA 4KE3A 2ZNMA 4KCEA 3LG6A 2B5XA 5HR2A 3FHKA 6GSVA 3IV4A 4AKXB 5B6MA 3EURA 3QD9A 1F6MC 3DMLA 2PGTA 3R2QA 4LMWA 1YEXA 2L6DA 2BJXA 3H1NA 4PGTA 3A2XA 3M9JA 2FWFA 2JZRA 5L71A 1DE2A 4HOJA 1FOHA 2H0GA 1MD4A 5DCGA 4ZXGA 5ECNB 2PPTA 2X64A 5AIXA 5G31A 3C1RA 1URMA 4DSRA 2FLSA 4KDXA 2XC2A 4CHSA 5E59A 1SD9A 2H19A 4X43A 3ZREA 4MZCA 4QQ7A 3VFIA 1XOBA 1ABAA 1TW9A 1GSQA 3CYNA 2GZZA 2WZ9A 2JL4A 4G0KA 4DEJA 1R5PA 3F63A 3F4TA 4JRRA 3WGDA 2B1LA 3QDNA 1A2JA 1EGRA 2EFEA 2DBCA 5IPGA 1YQ1A 2VCQA 1QUWA 2FD3A 1G6WA 4G0LA 3R3EA 4WETA 3C8EA 5CAXA 1PL1A 5F05A 2GZPA 4BWSA 4WEYA 4GSSA 2GSQA 1AQWA 4G10A 3EMPA 2PU9C 3TJFA 2F3MA 5G2ZA 2H8LA 3FMWA 2QSIA 1GUMA 2VL2A 4KAEA 2GTUA 4X4JA 1EGOA 2HNLA 3HY2A 1SK1A 4K6XA 4JR6A 4KGIA 3TKRA 3IAM2 3KP9A 2R0GA 3LWAA 4ACSA 1PQNA 1FG4A 1WMJA 1ERUA 2KHPA 3PGTA 1GTIA 3GSTA 5KEJA 3VWXA 3Q74A 4GDFA 3FY7A 1U6TA 3CBUA 3L4NA 3GH9A 2IMDA 5D9TA 3EVIA 2QA1A 5DALB 5ECRB 1GRXA 5IIZA 4BA7A 3IXRA 4YKGA 3DKSA 5F0GA 20GSA 1EEMA 4HQSA 1PKZA 4I6XA 4MCUA 1K0DA 4GTUA 3KMNA 4V1Ag 4ZBAA 1M2BA 5A4VA 1A8YA 4KB3A 1JZOA 4TW5A 2I9HA 4OCEA 5J4UA 4YQMA 1WOUA 8GSSA 3RHBA 4FH8A 3BCKA 4KDUA 4NWYA 2GT6A 3TGZA 2HXKA 5D9XA 2LJKA 3HVXA 4ISDA 3IDVA 3IOSA 2C4JA 1V58A 4IW9A 4O32A 5DQSA 3A5WA 1FO5A 4OFTA 5AN1A 4POKA 3APOA 1EV9A 19GSA 2K9FA 2VM2A 1FB0A 1AQXA 5A1NB 5IOXA 3N9JA 3TU3B 4BWQA 1EWXA 4K1FA 3JCML 1EP7A 2V1MA 4K0NA 3M3MA 1U3AA 3TOTA 2YCDA 3WGEA 6GSXA 2I81A 3WD6A 3J7Yb 4DSQA 1HQOA 1F9MA 1JHBA 4X0XA 4KX4A 3TB2A 4ULXA 3EINA 3KXOA 3KCMA 3RPNA 3EE2A 3DVXA 1NHOA 3UJ1A 2QKEA 1CQHA 3F8UA 4QMKA 4PQIA 4F82A 3W8SA 5FHIA 3LORA 1YY7A 5IMCA 4I8BA 3ZMLA 1KBNA 3CSHA 5JWQB 5IMDA 5CRHA 5ECIB 2KOKA 3FW2A 4EXJA 2K8VA 3FZ9A 2B5YA 4XS4B 1OC9B 4YAVA 2CVKA 4ZB9A 4WF5A 5IO0A 4NAXA 1SJ6A 1Z5YE 2XPEA 3FZ5A 3GKKA 4GRFA 5IQYA 5DALA 2L5OA 4GSNA 3FK8A 4MK3A 2EIQA 3E9JB 2R0PA 4POBA 3BBYA 4KNDA 3TJKA 1SENA 3DVWA 2KUCA 3F4RA 5KN2A 3K8NA 1R26A 3HCZA 1NHYA 1ZCPA 1SKSB 1TI3A 2LQQA 1EZKA 6GSSA 2J9HA 4TXOB 4ZILA 3F9UA 1Z6NA 1DSBA 1PA3A 3D0ZA 1OAZA 3RHCA 3ZYWA 5HR0A 3ZVJA 5DDLA 1M9AA 4CY6A 2DMLA 5J4VA 2AHEA 1OKDA 3F6FA 3GURA 4LMVA 1T3BA 1JFUA 1X5CA 3QAWA 2YJHA 5A5HA 1O73A 2DSAA 4HS1A 5A1NA 1EOGA 2YOIA 2OA7A 4Q5QA 4ECJA 3KZQA 3IRAA 2XPDA 5COHA 2GZYA 2O7KA 2NPBA 1SU9A 4MA9A 3ZFBA 4TRXA 3EYTA 1SKWB 4KCAA 5J40A 3TKSA 1YDKA 4MF5A 3D6IA 3GTUA 11GSA 5E4WA 1WJKA 5EVOA 2HSMA 4WBRD 1TRWA 1VGLA 3A2VA 2J23A 2QA2A 2R3XA 3P90A 1H75A 1KNGA 3I69A 4HJMA 3Q18A 5KN0A 3O6TA 1K3OA 2VCTA 3UVTA 1GTUA 2MMAA 3IHGA 1GP1A 3UIWA 7GSSA 4YKFA 4MP4A 5F8BA 4K2XA 1S3CA 2C0GA 5J4YA 1SJZA 1B4PA 1AUCA 3KJYA 4PNGA 4XS4A 1K3LA 1OC9A 1T4YA 3G7JA 5G30A 1DBYA 1RK4A 4KH7A 2G0FA 3E3EA 3F3QA 4E68A 3GV1A 3A2WA 1B9XC 2KLXA 1A24A 1SVMA 2AAWA 4MPFA 2GVPA 1KEBA 2VL2C 1PMTA 2DJJA 1TK0B 3O3TA 2WS2A 1V9WA 3APQA 4O5RA 4HJ2A 1JZDA 2H70A 2DC5A 1TDIA 3GX8A 1YKAA 4IBPA 1YVLA 2E7PA 3NIVA 4PTSA 4GF0A 3L9SA 5DBQA 2ES7A 1TU7A 2VCVA 2MYGA 1GLQA 4TXOA 3ME8A 3FRCA 2IMEA 4CY8A 2IIYA 1ZZYA 3HVVA 3LFLA 2MBSA 1IYIA 1VF2A 3I43A 3P8WA 3IE3A 2H0IA 1TXXA 5J9CA 2DIYA 3GKMA 1SYXA 1PL2A 4D73B 4TOPA 2N5AA 4RUVA 4FQUA 1VF4A 2H6ZA 5A5KA 1GSEA 3F3RA 2JADA 1V57A 4IN0A 3BCIA 3FZ4A 2R37A 4AKGA 2V41A 4LA1A 2I1UA 3EC3A 1WIKA 3Q6OA 5IMVA 1SJIA 3P2AA 3WT2A 1K0BA 1ZYQB 2IPAA 3TRQA 2OE1A 3HYPA 2GDRA 2NDOA 1TRSA 5JCWA 1B4QA 2VCWA 2H0HA 1XCCA 5D9WA 2LRNA 1T4ZA 2Z9SA 1Y1UA 3GH6A 4POMA 4K5RA 14GSA 2LEGA 3EU3A 3IA1A 1GSDA 3HA9A 3PR8A 2O87A 1VF1A 1O8XA 3TJJA 3CXGA 1YKCA 2TRCP 2YV7A 1ZL9A 1XBSA 2YZUA 1K0MA 3WT1A 4TR3A 2L5LA 1Z7RA 2KP1A 2FCHA 2I4AA 4TR0A 2LUSA 4DSSB 1M9BA 3W8JA 4CDOA 2DKIA 2PVQA 5INYA 4IHUA 5CO3A 1LBKA 1OVNA 2P5RA 1FVJA 16GSA 2IFQB 3I6AA 4V2MA 4USSA 2YN1A 2GLRA 3UVHA 1Z6MA 1NSWA 5KN3A 3KTBA 2H6XA 5ECOB 13GSA 4NHWA 4ZL9A 1TOFA 2OT3A 1SK0A 1LU4A 2M72A 2LSTA 1TRUA 3GMFA 3CRTA 2VKZG 4MNNA 2ZCTA 1TXUA 1M2DA 4ID0A 2VL9A 2XBIA 1V2AA 2B7JA 2DKHA 3GKXA 4RQXA 4ZB6A 2VLVA 3IK9A 3E0UA 2LNSA 4EF0A 1T00A 3IC4A 4KSOA 4D73A 2FA8A 3KMOA 3IPZA 4PQHA 1X9WB 5G5FA 4XRDA 4TVEA 5J41A 2LJAA 1SVLA 2L4QA 2A2PA 4EVMA 3WYWA 5IMZA 4HZ4A 2P5QA 5ECLB 1USBA 4K2DA 2FHEA 1HNAA 5CRGA 2NTOA 1VRSD 1THOA 3A5IA 1M0UA 1LJRA 1BJXA 3L9UA 5D73A 2X99A 2WCIA 3GL3A 4XHMA 3QMXA 3V1WA 3L78A 4F03A 2AV4A 4Q5NA 3C71A 2LS5A 4ZBBA 4JZQA 1TJDA 5G1LA 4LL4B 3VK9A 3KH7A 3BJ5A 3W6GA 1M99A 4EIPA 2PMTA 3KP8A 5CRDA 4DSSA 4Z2TA 1PKWA 2PWJA 3TKSC 5BMUB 2EFCA 4MJBA 4MH2A 2IFQA 4N10A 2YANA 2VD1A 3HHVA 5IPHA 1F37A 4PUFC 4WR5A 4Z2RA 5C00A 5ABRA 1AIUA 1QGVA 4WXTA 4V1Ap 2E2MA 1Y25A 1TI1A 1I9DA 2VUPA 2CQ9A 2F9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OKT A;  4L0W A;  2PUK C;  2R2J A;  5H5R A;  1GTA A;  2RM6 A;  2LRT A;  1QQ2 A;  1GTB A;  1SYR A;  3QOU A;  1ZOF A;  1ERT A;  1ERV A;  2IMI A;  1TTZ A;  1TKD B;  2HRN A;  4ML1 A;  1KTE A;  3M1G A;  5H5S A;  2PER A;  3DRN A;  3CTF A;  1ST9 A;  4RI6 A;  4EL1 A;  3VPQ A;  5CNW A;  5F06 A;  5B8A A;  5DQY A;  2PBJ A;  2PVO C;  2C3N A;  4TR4 A;  4K9Z A;  3D5J A;  4NPB A;  5ID2 B;  3GUS A;  5G5E A;  3ZZX A;  3P7X A;  5GAP D;  1B9Y C;  2OE0 A;  2IN3 A;  5HR1 A;  2RUE A;  4OO5 A;  1XIY A;  1YF0 A;  2F51 A;  1GNW A;  3D21 A;  2H30 A;  3LQ7 A;  4MAB A;  3VI7 A;  1B48 A;  2L6C A;  5EL8 A;  4KSM A;  2CX4 A;  2HSH A;  4K7N A;  1F3A A;  4MLY A;  4OCF A;  3FR3 A;  4NV5 A;  2DJK A;  2X8H A;  4NHZ A;  5CRW A;  3KIJ A;  4I2T A;  4ZBD A;  4MJC A;  2LQO A;  2G2Q A;  5CYY A;  4AJ6 A;  3I9V 2;  2HLS A;  3AY8 A;  5FWG A;  5GZZ B;  1FB6 A;  1WE0 A;  1GUH A;  1F2E A;  4ZIJ A;  3IC8 A;  4MZW A;  4I2U A;  2HYX A;  4EDY A;  4WBJ A;  1X9M B;  2CVB A;  4XCS A;  5BMU A;  1A0R P;  2MZC A;  3FR6 A;  18GS A;  17GS A;  5A4W A;  3GFK A;  3VPT A;  1AW9 A;  2VLU A;  2C3T A;  1XVW A;  1TK5 B;  1Z9H A;  3TKQ A;  1NM3 A;  2OAC A;  2FY6 A;  2L4C A;  2O85 A;  4L0U A;  3FKF A;  2UZ8 A;  1Z7P A;  2ON5 A;  1SD8 A;  3ZLP A;  2C80 A;  2JZS A;  4GLT A;  4EKZ A;  1A23 A;  1W89 A;  4GCI A;  5A4U A;  1BYE A;  4V2N A;  1XW6 A;  4MJA A;  3EWL A;  1WPI A;  3MDK A;  2YJ7 A;  1FHE A;  2NBS A;  2MMZ A;  2F8A A;  4EO3 A;  1Y6E A;  5D93 A;  3Q19 A;  4ZB8 A;  2DJ2 A;  2LV3 A;  3LEF A;  1XWA A;  4N0Z A;  6GSU A;  1GUK A;  2XHF A;  1IYH A;  1J08 A;  1M7T A;  5EPF A;  2HI7 A;  5JCG A;  3A3T A;  3G9B A;  5DJM A;  5B7C A;  1MDJ A;  1YEP A;  1OE7 A;  2RM5 A;  1GUL A;  1XWC A;  1OYJ A;  4KDY A;  4PX1 A;  2A2R A;  5ID2 A;  2V6O A;  9GSS A;  4PUA A;  2X8G A;  1XFL A;  3ZFL A;  1S3A A;  4FO5 A;  1QK8 A;  1YJ6 A;  3UAP A;  4N0V A;  4PNF A;  5B6N A;  10GS A;  2A2S A;  2HT9 A;  2R4V A;  5D8I A;  1JZW A;  2VLT A;  1MEK A;  2BTO T;  1MDK A;  4BPY A;  4GST A;  1FAA A;  4IEL A;  1HNC A;  3DD3 A;  3CTG A;  1Z3E A;  5LCZ A;  4L8E A;  2CVD A;  3PIN A;  2MMO A;  2HFD A;  3HJO A;  3L9V A;  2FWG A;  5DJL A;  3KH9 A;  2P0G A;  3KGK A;  4OWY A;  3ZIV A;  4IVF A;  3CSJ A;  3HD5 A;  2H71 A;  2D2Z A;  4IJI A;  3C7M A;  2NVL A;  5HFI A;  3S9F A;  1ERW A;  1OC8 A;  1WWJ A;  4G19 A;  1GSU A;  1ZMA A;  5AIS A;  1TK8 B;  3SWL A;  2XBQ A;  1K0C A;  12GS A;  1W4V A;  5IMF A;  4F0B A;  4MJE A;  4FIW A;  3L0H A;  4Q5R A;  4WKW A;  1R5A A;  3DEX A;  4XRA A;  3BD2 A;  2H75 A;  3C73 A;  1YF1 A;  4KUN A;  4X1U A;  2M80 A;  4XS1 A;  3VWV A;  1PX7 A;  1ACV A;  1DE1 A;  1BG5 A;  3GA4 A;  3D22 A;  3GIX A;  2K6V A;  1XZO A;  2M46 A;  4J56 E;  1UA5 A;  2AUV A;  4G2E A;  4YH2 A;  4F9Z A;  5HQP A;  5ELA A;  3KTL A;  3RBT A;  2LJR A;  1GSF A;  2ZUP A;  3DWV A;  4JBB A;  1RW1 A;  1VF3 A;  1DUG A;  3QAV A;  2FGX A;  1YZX A;  5B8B A;  2B3S A;  4HDE A;  4J57 E;  4H86 A;  2RLI A;  1ZYE A;  5JWR B;  5GAN D;  2HZF A;  1K0N A;  4OMV A;  5GST A;  4N11 A;  1T7P B;  2WB9 A;  2GQM A;  2GT5 A;  2DJ0 A;  3IAS 2;  4Z7X A;  1A0F A;  2CA8 A;  4JED A;  3HKR A;  2WUL A;  4ZL8 A;  1GLP A;  1X5E A;  1AAZ A;  1A8L A;  1XWK A;  2C3Q A;  3RPP A;  4EUY A;  3QR6 A;  2H1A A;  4E8H A;  2H66 A;  1T8E B;  2YWO A;  3HXS A;  3GSS A;  2C0F A;  2H1G A;  2FA4 A;  5ECM B;  3QFA C;  4K7O A;  3BOA A;  3KD0 A;  1PD2 1;  1GSY A;  1T1V A;  2JU5 A;  4QL7 A;  4EDZ A;  4KA0 A;  2CX3 A;  5IMA A;  3ME7 A;  3QAG A;  5LNK e;  3IR4 A;  1TRV A;  4YQV A;  5IO2 A;  4I97 A;  5IM9 A;  4L5L A;  3M8N A;  1H4O A;  4MF7 A;  2HQT A;  4MH3 A;  1X5D A;  4HUA A;  1HNB A;  4HQZ A;  3IHQ A;  1CQG A;  3HJP A;  1EP8 A;  3ZMK A;  5AIV A;  2JZT A;  3TKS E;  3ZL5 A;  5ECQ B;  4MZB A;  1E6B A;  3TCO A;  1X0R A;  2LTK A;  3VI5 A;  4TN8 A;  22GS A;  1M2A A;  3J7Y k;  4RI7 A;  4EE0 A;  1PSQ A;  2CV4 A;  4IQ1 A;  2R6K A;  2ON7 A;  1UVZ A;  3TRX A;  4F2I A;  2CAI A;  2WFC A;  3KEB A;  1FW1 A;  5DCH A;  2N5B A;  1HD2 A;  5HFG A;  3UAR A;  3ED3 A;  1QXH A;  4IKH A;  2P31 A;  3GN3 A;  4TXV A;  1SK2 A;  1K0A A;  4XS6 A;  3UMA A;  3LXT A;  1EOH A;  4G9H A;  2E0Q A;  4IP6 A;  3LJR A;  1GL8 A;  4IS0 A;  1WRY A;  4AGS A;  3U5R E;  5ECH B;  1F3B A;  1PX6 A;  4FYC A;  1U87 A;  3D4M A;  1S3D A;  2QC7 A;  2AB6 A;  5ECK B;  3UBK A;  6GST A;  1AC1 A;  3TDG A;  2FUG 2;  5LD0 A;  3EU4 A;  3F6D A;  4IP1 A;  4JU5 A;  2B6M A;  4GWR A;  2I3Y A;  3ZVJ D;  4AJ8 A;  5GSS A;  2HZE B;  3GKN A;  1XW9 A;  1XW5 A;  2L57 A;  3GRX A;  4BVX B;  2H76 A;  3HZ4 A;  1WP0 A;  2A4V A;  3ZTL A;  2HRK B;  4O7H A;  3ZRD A;  2H01 A;  1QMV A;  4GXZ A;  1U3I A;  1THX A;  3LXZ A;  4NMU A;  5CRE A;  1MD3 A;  4IQA A;  1SL2 B;  2OKA A;  2L59 A;  3FZA A;  2DLX A;  2YPM A;  4KF9 A;  5DVB A;  3GL5 A;  3MNG A;  4IJ3 A;  1EV4 A;  3ERF A;  4K0G A;  5J5N A;  3GNJ A;  1UC7 A;  1JLV A;  4OFN A;  2GS3 A;  2IMK A;  5HFK A;  2JAC A;  1V40 A;  4EC0 A;  4YQU A;  1EEJ A;  2HSN B;  3FYG A;  5H5Q A;  3MAK A;  3APS A;  5JWO B;  1N8J A;  2FWH A;  1HYU A;  2IL3 A;  1Q98 A;  2WRT A;  5ENU A;  3G7Y A;  4MF6 A;  1C72 A;  2JSZ A;  2V2G A;  1J9B A;  3QFB C;  2DJ1 A;  1G7O A;  3CSI A;  3HZ8 A;  1N2A A;  3N5O A;  2DMM A;  2E2G A;  4G0I A;  2F8F A;  4TR1 B;  2CT6 A;  4FYU A;  1G0T A;  1O8W A;  2YWI A;  3OR5 A;  2IMF A;  2C1Y A;  4NXI A;  3ERG A;  2LKU A;  1Q4J A;  3NOF A;  3F0I A;  1O85 A;  2VCX A;  2FNO A;  4E8E A;  2H72 A;  1K0O A;  1XVQ A;  5D96 A;  4YAP A;  3EMX A;  1SL1 B;  2MBT A;  3MWH A;  2HE3 A;  1AQV A;  3UL3 A;  1I5G A;  4JR4 A;  5F07 A;  5HR3 A;  3MSZ A;  2VIM A;  3GHA A;  4ECC A;  4MPG A;  4PUR A;  2HZE A;  3HVS A;  3GTU B;  3LSZ A;  4Q5F A;  2OE3 A;  1BAY A;  2CZ3 A;  4BVX A;  2HSM B;  2DIZ A;  3WGX A;  2HRK A;  2QGV A;  4POL A;  3SBC A;  3M9K A;  2H74 A;  2GST A;  3IK7 A;  1SKR B;  2OAD A;  2VD0 A;  1R7H A;  5FT3 A;  4MMM A;  1X9S B;  3CMI A;  4GQF A;  5ELG A;  3H8Q A;  1OE8 A;  1ZGN A;  3ISO A;  4DVC A;  4KW6 A;  2GQK A;  1TP9 A;  4FYB A;  1BX9 A;  4K7I A;  4ECB A;  4OFM A;  2R5G A;  2DJ3 A;  4IGJ A;  1E2Y A;  4V2L A;  2GSS A;  4HI7 A;  1ML6 A;  2N5F A;  2PN8 A;  3QPM A;  1XXU A;  3VLN A;  2B7K A;  2TIR A;  2B5E A;  2VAF A;  5G1K A;  3VWU A;  3NZN A;  2H1B A;  1JLW A;  2AYT A;  4XIH A;  1OC3 A;  1UN2 A;  3U6V A;  1A2M A;  3VUR A;  2REM A;  1G6Y A;  4OO4 A;  2C0E A;  4ML6 A;  5CP1 A;  6GSW A;  2EIO A;  4I5Q A;  2HRA A;  2MMN A;  4WF4 A;  1JZR A;  4ZL7 A;  2LRC A;  1NW2 A;  1PGT A;  1U88 A;  1GNE A;  2ALB A;  3RAZ A;  4TKY A;  1V98 A;  3UBL A;  3PH9 A;  4OD7 A;  2RII A;  2X8C A;  2KP2 A;  3IBH A;  3DIE A;  4CW9 A;  1ON4 A;  3GX0 A;  4TR1 A;  2OBK A;  4NV2 A;  3TJB A;  3HDC A;  3F4S A;  1G7E A;  1XOA A;  1O6J A;  1FVK A;  2H1D A;  2VCZ A;  4P3Y B;  5DAK B;  4RQR A;  2O8V B;  4BL7 B;  2K8S A;  5J3R A;  4PXO A;  3TUE A;  2CZ2 A;  4GQC A;  4F0C A;  4O92 A;  3ERW A;  4LL1 B;  1GH2 A;  3GYK A;  4N30 A;  1TU8 A;  5JCU A;  2CAQ A;  4BVY B;  2V6K A;  3TOU A;  4L5O A;  4MDC A;  1XWG A;  1MDI A;  2JSY A;  2RUF A;  1GWC A;  2V32 A;  2IJY A;  2WGR A;  1XPV A;  1B8X A;  4K8M A;  3H93 A;  5EY6 A;  1PN9 A;  5AGY A;  5D9V A;  2EIR A;  2B1K A;  4HU9 A;  1A2L A;  3DXB A;  2K18 A;  4AF2 A;  1K3Y A;  4PQ1 A;  3HJM A;  1PRX A;  3H4K A;  4HU7 A;  2LNT A;  2YWM A;  5C04 A;  1QFN A;  3TKP A;  2VM1 A;  3VWW A;  2OJL A;  2HSY A;  2BMX A;  3DYR A;  2AJQ B;  3LYK A;  1AXD A;  1ILO A;  4AJ7 A;  1R4W A;  3LYP A;  1FOV A;  3ZIT A;  2O89 A;  3UEM A;  1MTC A;  2YV9 A;  3LGC A;  2GSR A;  4WR4 A;  5KN1 A;  3US3 A;  4JE1 A;  2IWT A;  4J2F A;  3FEU A;  3H79 A;  6GSY A;  2VL3 A;  1O7U A;  2YNX A;  3O76 A;  2YZH A;  4ECI A;  2HRF A;  1RQM A;  2C0D A;  3M0F A;  2GGT A;  2H6Y A;  1O81 A;  2H73 A;  5ECS A;  3TRP A;  1BQ7 A;  5IOW A;  3KM6 A;  3FR9 A;  2VOC A;  2C8U A;  3QCP A;  2WJU A;  5DAK A;  1GSS A;  4BL7 A;  4LLR A;  3UOM A;  2GQL A;  3PPU A;  3CRU A;  3RDW A;  4HZ2 A;  3ZIJ A;  3TJG A;  2EC4 A;  1BED A;  1SL0 B;  4ILF A;  2YP6 A;  5ECP B;  2YWN A;  4BVY A;  2WDU A;  1XWB A;  1J0F A;  5J9B A;  2VO4 A;  4HEA 2;  4XTS A;  3G7I A;  3DGQ A;  2TRX A;  3D4T A;  3C1S A;  4QL9 A;  2OBI A;  2FWE A;  4KE3 A;  2ZNM A;  4KCE A;  3LG6 A;  2B5X A;  5HR2 A;  3FHK A;  6GSV A;  3IV4 A;  5B6M A;  3EUR A;  3QD9 A;  1F6M C;  3DML A;  2PGT A;  3R2Q A;  4LMW A;  1YEX A;  2L6D A;  2BJX A;  3H1N A;  4PGT A;  3A2X A;  3M9J A;  2FWF A;  2JZR A;  5L71 A;  1DE2 A;  4HOJ A;  2H0G A;  1MD4 A;  5DCG A;  4ZXG A;  5ECN B;  2PPT A;  2X64 A;  5AIX A;  5G31 A;  3C1R A;  1URM A;  4DSR A;  2FLS A;  4KDX A;  2XC2 A;  4CHS A;  5E59 A;  1SD9 A;  2H19 A;  4X43 A;  3ZRE A;  4MZC A;  4QQ7 A;  3VFI A;  1XOB A;  1ABA A;  1TW9 A;  1GSQ A;  3CYN A;  2GZZ A;  2WZ9 A;  2JL4 A;  4G0K A;  4DEJ A;  1R5P A;  3F63 A;  3F4T A;  4JRR A;  3WGD A;  2B1L A;  3QDN A;  1A2J A;  1EGR A;  2DBC A;  5IPG A;  1YQ1 A;  2VCQ A;  1QUW A;  2FD3 A;  1G6W A;  4G0L A;  3R3E A;  4WET A;  3C8E A;  5CAX A;  1PL1 A;  5F05 A;  2GZP A;  4BWS A;  4WEY A;  4GSS A;  2GSQ A;  1AQW A;  4G10 A;  3EMP A;  2PU9 C;  3TJF A;  2F3M A;  5G2Z A;  2H8L A;  2QSI A;  1GUM A;  2VL2 A;  4KAE A;  2GTU A;  1EGO A;  2HNL A;  3HY2 A;  1SK1 A;  4K6X A;  4JR6 A;  4KGI A;  3TKR A;  3IAM 2;  3KP9 A;  3LWA A;  4ACS A;  1PQN A;  1FG4 A;  1WMJ A;  1ERU A;  2KHP A;  3PGT A;  1GTI A;  3GST A;  5KEJ A;  3VWX A;  3Q74 A;  3FY7 A;  1U6T A;  3CBU A;  3L4N A;  3GH9 A;  2IMD A;  5D9T A;  3EVI A;  5DAL B;  5ECR B;  1GRX A;  5IIZ A;  4BA7 A;  3IXR A;  3DKS A;  5F0G A;  20GS A;  1EEM A;  4HQS A;  1PKZ A;  4I6X A;  4MCU A;  1K0D A;  4GTU A;  3KMN A;  4V1A g;  4ZBA A;  1M2B A;  5A4V A;  1A8Y A;  4KB3 A;  1JZO A;  4TW5 A;  2I9H A;  4OCE A;  5J4U A;  4YQM A;  1WOU A;  8GSS A;  3RHB A;  4FH8 A;  3BCK A;  4KDU A;  4NWY A;  2GT6 A;  3TGZ A;  2HXK A;  5D9X A;  2LJK A;  3HVX A;  4ISD A;  3IDV A;  3IOS A;  2C4J A;  1V58 A;  4IW9 A;  4O32 A;  5DQS A;  3A5W A;  1FO5 A;  4OFT A;  5AN1 A;  4POK A;  3APO A;  1EV9 A;  19GS A;  2K9F A;  2VM2 A;  1FB0 A;  1AQX A;  5IOX A;  3N9J A;  4BWQ A;  1EWX A;  4K1F A;  3JCM L;  1EP7 A;  2V1M A;  4K0N A;  3M3M A;  1U3A A;  3TOT A;  2YCD A;  3WGE A;  6GSX A;  2I81 A;  3WD6 A;  3J7Y b;  4DSQ A;  1HQO A;  1F9M A;  1JHB A;  4X0X A;  4KX4 A;  3TB2 A;  4ULX A;  3EIN A;  3KXO A;  3KCM A;  3RPN A;  3EE2 A;  3DVX A;  1NHO A;  3UJ1 A;  2QKE A;  1CQH A;  3F8U A;  4PQI A;  4F82 A;  3W8S A;  5FHI A;  3LOR A;  1YY7 A;  5IMC A;  4I8B A;  3ZML A;  1KBN A;  3CSH A;  5JWQ B;  5IMD A;  5CRH A;  5ECI B;  2KOK A;  3FW2 A;  4EXJ A;  2K8V A;  3FZ9 A;  2B5Y A;  4XS4 B;  1OC9 B;  4YAV A;  2CVK A;  4ZB9 A;  4WF5 A;  5IO0 A;  4NAX A;  1SJ6 A;  1Z5Y E;  2XPE A;  3FZ5 A;  3GKK A;  4GRF A;  5IQY A;  5DAL A;  2L5O A;  4GSN A;  3FK8 A;  4MK3 A;  2EIQ A;  3E9J B;  4POB A;  3BBY A;  4KND A;  3TJK A;  1SEN A;  3DVW A;  2KUC A;  3F4R A;  5KN2 A;  3K8N A;  1R26 A;  3HCZ A;  1NHY A;  1ZCP A;  1SKS B;  1TI3 A;  2LQQ A;  1EZK A;  6GSS A;  2J9H A;  4TXO B;  4ZIL A;  3F9U A;  1Z6N A;  1DSB A;  1PA3 A;  3D0Z A;  1OAZ A;  3RHC A;  3ZYW A;  5HR0 A;  3ZVJ A;  5DDL A;  1M9A A;  2DML A;  2AHE A;  1OKD A;  3F6F A;  3GUR A;  4LMV A;  1T3B A;  1JFU A;  1X5C A;  3QAW A;  2YJH A;  1O73 A;  2DSA A;  4HS1 A;  1EOG A;  2YOI A;  2OA7 A;  4Q5Q A;  4ECJ A;  3KZQ A;  3IRA A;  2XPD A;  5COH A;  2GZY A;  2O7K A;  2NPB A;  1SU9 A;  4MA9 A;  3ZFB A;  4TRX A;  3EYT A;  1SKW B;  4KCA A;  3TKS A;  1YDK A;  4MF5 A;  3D6I A;  3GTU A;  11GS A;  5E4W A;  1WJK A;  5EVO A;  2HSM A;  4WBR D;  1TRW A;  1VGL A;  3A2V A;  2J23 A;  2R3X A;  3P90 A;  1H75 A;  1KNG A;  3I69 A;  4HJM A;  3Q18 A;  5KN0 A;  3O6T A;  1K3O A;  2VCT A;  3UVT A;  1GTU A;  2MMA A;  1GP1 A;  3UIW A;  7GSS A;  4MP4 A;  5F8B A;  1S3C A;  2C0G A;  1SJZ A;  1B4P A;  1AUC A;  3KJY A;  4PNG A;  4XS4 A;  1K3L A;  1OC9 A;  1T4Y A;  3G7J A;  5G30 A;  1DBY A;  1RK4 A;  4KH7 A;  2G0F A;  3E3E A;  3F3Q A;  3GV1 A;  3A2W A;  1B9X C;  2KLX A;  1A24 A;  2AAW A;  4MPF A;  2GVP A;  1KEB A;  2VL2 C;  1PMT A;  2DJJ A;  1TK0 B;  3O3T A;  2WS2 A;  1V9W A;  3APQ A;  4O5R A;  4HJ2 A;  1JZD A;  2H70 A;  2DC5 A;  1TDI A;  3GX8 A;  1YKA A;  4IBP A;  2E7P A;  3NIV A;  4PTS A;  4GF0 A;  3L9S A;  5DBQ A;  2ES7 A;  1TU7 A;  2VCV A;  2MYG A;  1GLQ A;  4TXO A;  3ME8 A;  3FRC A;  2IME A;  2IIY A;  1ZZY A;  3HVV A;  3LFL A;  2MBS A;  1IYI A;  1VF2 A;  3I43 A;  3P8W A;  3IE3 A;  2H0I A;  1TXX A;  5J9C A;  2DIY A;  3GKM A;  1SYX A;  1PL2 A;  4D73 B;  4TOP A;  2N5A A;  4RUV A;  4FQU A;  1VF4 A;  2H6Z A;  5A5K A;  1GSE A;  3F3R A;  2JAD A;  1V57 A;  4IN0 A;  3BCI A;  3FZ4 A;  2R37 A;  2V41 A;  4LA1 A;  2I1U A;  3EC3 A;  1WIK A;  3Q6O A;  5IMV A;  1SJI A;  3P2A A;  3WT2 A;  1K0B A;  1ZYQ B;  2IPA A;  3TRQ A;  2OE1 A;  3HYP A;  2GDR A;  2NDO A;  1TRS A;  5JCW A;  1B4Q A;  2VCW A;  2H0H A;  1XCC A;  5D9W A;  2LRN A;  1T4Z A;  2Z9S A;  3GH6 A;  4POM A;  14GS A;  2LEG A;  3EU3 A;  3IA1 A;  1GSD A;  3HA9 A;  3PR8 A;  2O87 A;  1VF1 A;  1O8X A;  3TJJ A;  3CXG A;  1YKC A;  2TRC P;  2YV7 A;  1ZL9 A;  1XBS A;  2YZU A;  1K0M A;  3WT1 A;  4TR3 A;  2L5L A;  1Z7R A;  2KP1 A;  2FCH A;  2I4A A;  4TR0 A;  2LUS A;  4DSS B;  1M9B A;  3W8J A;  4CDO A;  2PVQ A;  5INY A;  4IHU A;  5CO3 A;  1LBK A;  1OVN A;  2P5R A;  1FVJ A;  16GS A;  2IFQ B;  3I6A A;  4V2M A;  4USS A;  2YN1 A;  2GLR A;  3UVH A;  1Z6M A;  1NSW A;  5KN3 A;  3KTB A;  2H6X A;  5ECO B;  13GS A;  4NHW A;  4ZL9 A;  1TOF A;  1SK0 A;  1LU4 A;  2M72 A;  2LST A;  1TRU A;  3GMF A;  3CRT A;  2ZCT A;  1M2D A;  4ID0 A;  2VL9 A;  2XBI A;  1V2A A;  2B7J A;  3GKX A;  4RQX A;  4ZB6 A;  2VLV A;  3IK9 A;  3E0U A;  2LNS A;  4EF0 A;  1T00 A;  3IC4 A;  4KSO A;  4D73 A;  2FA8 A;  3KMO A;  3IPZ A;  4PQH A;  1X9W B;  5G5F A;  4XRD A;  4TVE A;  5J41 A;  2LJA A;  2L4Q A;  4EVM A;  3WYW A;  5IMZ A;  4HZ4 A;  2P5Q A;  5ECL B;  1USB A;  4K2D A;  2FHE A;  1HNA A;  5CRG A;  2NTO A;  1VRS D;  1THO A;  1M0U A;  1LJR A;  1BJX A;  3L9U A;  5D73 A;  2X99 A;  2WCI A;  3GL3 A;  4XHM A;  3QMX A;  3V1W A;  3L78 A;  4F03 A;  2AV4 A;  4Q5N A;  3C71 A;  2LS5 A;  4ZBB A;  4JZQ A;  1TJD A;  5G1L A;  4LL4 B;  3VK9 A;  3KH7 A;  3BJ5 A;  3W6G A;  1M99 A;  2PMT A;  3KP8 A;  5CRD A;  4DSS A;  1PKW A;  2PWJ A;  3TKS C;  4MJB A;  4MH2 A;  2IFQ A;  4N10 A;  2YAN A;  2VD1 A;  3HHV A;  5IPH A;  1F37 A;  4PUF C;  4WR5 A;  5C00 A;  5ABR A;  1AIU A;  1QGV A;  4WXT A;  4V1A p;  2E2M A;  1Y25 A;  1TI1 A;  1I9D A;  2VUP A;  2CQ9 A;  2F9S A; 
#chains in the Genus database with same CATH topology
 1OKT A;  4L0W A;  2PUK C;  2R2J A;  5H5R A;  1GTA A;  2RM6 A;  2LRT A;  1QQ2 A;  1GTB A;  1SYR A;  3QOU A;  1ZOF A;  1ERT A;  4AKI A;  1ERV A;  5KOW A;  2IMI A;  1TTZ A;  1TKD B;  2HRN A;  4ML1 A;  2WW3 A;  1KTE A;  3M1G A;  5H5S A;  2PER A;  3DRN A;  3CTF A;  1ST9 A;  4RI6 A;  4EL1 A;  3VPQ A;  5CNW A;  5F06 A;  5B8A A;  5DQY A;  2PBJ A;  2PVO C;  2C3N A;  4TR4 A;  4K9Z A;  3D5J A;  4NPB A;  5ID2 B;  3GUS A;  5G5E A;  3ZZX A;  3P7X A;  5GAP D;  1B9Y C;  2OE0 A;  2IN3 A;  5HR1 A;  2RUE A;  4OO5 A;  1XIY A;  1YF0 A;  2F51 A;  1GNW A;  3D21 A;  2H30 A;  3LQ7 A;  4MAB A;  3VI7 A;  1B48 A;  2L6C A;  5EL8 A;  4KSM A;  2CX4 A;  2HSH A;  4K7N A;  1F3A A;  4MLY A;  4OCF A;  3FR3 A;  4NV5 A;  2DJK A;  2X8H A;  4NHZ A;  4N3Z A;  5CRW A;  3KIJ A;  4I2T A;  4ZBD A;  4MJC A;  2LQO A;  2G2Q A;  5CYY A;  4AJ6 A;  3I9V 2;  2HLS A;  3AY8 A;  5FWG A;  5GZZ B;  1FB6 A;  1WE0 A;  1GUH A;  1F2E A;  4ZIJ A;  3IC8 A;  4MZW A;  4I2U A;  2HYX A;  4EDY A;  4WBJ A;  1X9M B;  2CVB A;  4XCS A;  4ZB7 A;  5BMU A;  1A0R P;  2MZC A;  3FR6 A;  18GS A;  17GS A;  5A4W A;  3GFK A;  3VPT A;  1AW9 A;  2VLU A;  2C3T A;  1XVW A;  1TK5 B;  1Z9H A;  3TKQ A;  1NM3 A;  2OAC A;  2FY6 A;  2L4C A;  2O85 A;  4L0U A;  3FKF A;  2UZ8 A;  1Z7P A;  2ON5 A;  1SD8 A;  3ZLP A;  2C80 A;  2JZS A;  4GLT A;  4EKZ A;  1A23 A;  1W89 A;  4GCI A;  5A4U A;  1BYE A;  4V2N A;  1XW6 A;  4MJA A;  3EWL A;  1WPI A;  3MDK A;  2YJ7 A;  1FHE A;  2NBS A;  2MMZ A;  2F8A A;  4EO3 A;  1Y6E A;  5D93 A;  3Q19 A;  4ZB8 A;  2DJ2 A;  2LV3 A;  3LEF A;  1XWA A;  4N0Z A;  6GSU A;  1GUK A;  2XHF A;  2WZS A;  1IYH A;  4AKH A;  1J08 A;  1M7T A;  5EPF A;  2HI7 A;  5JCG A;  3A3T A;  3G9B A;  5DJM A;  5B7C A;  1MDJ A;  1YEP A;  1OE7 A;  2RM5 A;  1GUL A;  1XWC A;  1OYJ A;  4KDY A;  4A5P A;  4PX1 A;  3EPT A;  2A2R A;  5ID2 A;  2V6O A;  9GSS A;  4PUA A;  2X8G A;  1XFL A;  3ZFL A;  1S3A A;  4FO5 A;  1QK8 A;  1YJ6 A;  3UAP A;  4N0V A;  4PNF A;  5B6N A;  10GS A;  2A2S A;  2HT9 A;  2R4V A;  5D8I A;  1JZW A;  2VLT A;  1MEK A;  2BTO T;  1MDK A;  4BPY A;  4AI6 A;  4GST A;  2EFH A;  1FAA A;  4IEL A;  1HNC A;  3DD3 A;  3CTG A;  1Z3E A;  5LCZ A;  4L8E A;  2CVD A;  3PIN A;  2MMO A;  2HFD A;  3HJO A;  2WVZ A;  3L9V A;  2FWG A;  5DJL A;  3KH9 A;  2P0G A;  3KGK A;  4OWY A;  3ZIV A;  4IVF A;  3MIX A;  3CSJ A;  3HD5 A;  2H71 A;  1BG1 A;  2D2Z A;  4IJI A;  3C7M A;  2NVL A;  5HFI A;  3S9F A;  1ERW A;  1OC8 A;  1WWJ A;  4O5Q A;  4G19 A;  1GSU A;  1ZMA A;  4G01 A;  5AIS A;  2A4H A;  1TK8 B;  3SWL A;  2XBQ A;  1K0C A;  12GS A;  1W4V A;  5IMF A;  4F0B A;  4MJE A;  4FIW A;  3L0H A;  4FXY P;  4Q5R A;  4WKW A;  1R5A A;  3DEX A;  4XRA A;  3BD2 A;  2H75 A;  3C73 A;  1YF1 A;  4KUN A;  4X1U A;  2M80 A;  4XS1 A;  3VWV A;  1PX7 A;  1ACV A;  1DE1 A;  1BG5 A;  3GA4 A;  3D22 A;  3GIX A;  2K6V A;  1XZO A;  2M46 A;  4J56 E;  3RFR C;  1UA5 A;  2AUV A;  4G2E A;  4YH2 A;  4F9Z A;  5HQP A;  5ELA A;  3KTL A;  3RBT A;  2LJR A;  1GSF A;  2ZUP A;  3DWV A;  4JBB A;  1RW1 A;  1VF3 A;  1DUG A;  3HVN A;  3QAV A;  2FGX A;  1YZX A;  5B8B A;  2B3S A;  4HDE A;  4J57 E;  4H86 A;  2RLI A;  1ZYE A;  5JWR B;  5GAN D;  1PFO A;  2HZF A;  1K0N A;  4OMV A;  5GST A;  4N11 A;  1T7P B;  2WB9 A;  2GQM A;  2GT5 A;  2DJ0 A;  3IAS 2;  4Z7X A;  1A0F A;  2CA8 A;  4JED A;  3HKR A;  2WUL A;  4ZL8 A;  1GLP A;  1X5E A;  1AAZ A;  1A8L A;  1XWK A;  2C3Q A;  3RPP A;  4EUY A;  3QR6 A;  2H1A A;  4E8H A;  2H66 A;  1T8E B;  2YWO A;  3HXS A;  3GSS A;  2C0F A;  2H1G A;  4W66 A;  2FA4 A;  5ECM B;  3QFA C;  4K7O A;  3BOA A;  3KD0 A;  2O36 A;  1PD2 1;  1GSY A;  1T1V A;  2JU5 A;  4QL7 A;  4EDZ A;  4KA0 A;  4O5U A;  2CX3 A;  5IMA A;  3ME7 A;  3QAG A;  5LNK e;  3IR4 A;  1TRV A;  4YQV A;  5IO2 A;  4I97 A;  5IM9 A;  4L5L A;  3M8N A;  1H4O A;  4MF7 A;  2HQT A;  4MH3 A;  1X5D A;  4HUA A;  1HNB A;  4HQZ A;  3IHQ A;  1CQG A;  3HJP A;  1EP8 A;  3ZMK A;  5AIV A;  2JZT A;  3TKS E;  3ZL5 A;  5ECQ B;  4MZB A;  1E6B A;  1S3R A;  3TCO A;  1X0R A;  2LTK A;  3VI5 A;  4TN8 A;  22GS A;  1M2A A;  3J7Y k;  5KOX A;  4RI7 A;  4EE0 A;  3LW9 A;  1PSQ A;  2CV4 A;  4IQ1 A;  2R6K A;  2ON7 A;  1UVZ A;  3TRX A;  4F2I A;  2CAI A;  2WFC A;  3KEB A;  1FW1 A;  5DCH A;  3RGB C;  2N5B A;  1HD2 A;  5HFG A;  3UAR A;  1ZYN A;  3ED3 A;  1QXH A;  4IKH A;  2P31 A;  3GN3 A;  4TXV A;  1SK2 A;  1K0A A;  4XS6 A;  3UMA A;  3LXT A;  1EOH A;  4G9H A;  2E0Q A;  4IP6 A;  3LJR A;  1GL8 A;  4IS0 A;  1WRY A;  4AGS A;  3U5R E;  5ECH B;  1F3B A;  1PX6 A;  3MYD A;  4FYC A;  2UV8 G;  1U87 A;  3D4M A;  2WVY A;  1S3D A;  2QC7 A;  2AB6 A;  5ECK B;  3UBK A;  6GST A;  1AC1 A;  3TDG A;  2FUG 2;  5LD0 A;  3EU4 A;  3F6D A;  4IP1 A;  4JU5 A;  2B6M A;  4GWR A;  2I3Y A;  3ZVJ D;  4AJ8 A;  5GSS A;  2HZE B;  3GKN A;  1XW9 A;  1XW5 A;  2L57 A;  3GRX A;  4BVX B;  2H76 A;  3HZ4 A;  1WP0 A;  2A4V A;  3ZTL A;  2HRK B;  4O7H A;  3ZRD A;  2H01 A;  1QMV A;  4GXZ A;  1U3I A;  1THX A;  3LXZ A;  4NMU A;  5CRE A;  1MD3 A;  4IQA A;  1ZYP A;  1SL2 B;  2OKA A;  2L59 A;  3FZA A;  2DLX A;  2YPM A;  4KF9 A;  5DVB A;  3GL5 A;  3MNG A;  4IJ3 A;  1EV4 A;  3ERF A;  4K0G A;  5J5N A;  3GNJ A;  1UC7 A;  1JLV A;  4OFN A;  2GS3 A;  2IMK A;  5A34 B;  5HFK A;  2JAC A;  1V40 A;  4EC0 A;  4YQU A;  1EEJ A;  2HSN B;  3FYG A;  5H5Q A;  3MAK A;  3APS A;  5JWO B;  1N25 A;  1N8J A;  2WVX B;  2FWH A;  1HYU A;  2IL3 A;  1Q98 A;  2WRT A;  5ENU A;  3G7Y A;  4MF6 A;  1C72 A;  2JSZ A;  2V2G A;  1J9B A;  3QFB C;  2DJ1 A;  4K5S A;  1G7O A;  3CSI A;  3HZ8 A;  1N2A A;  3N5O A;  2DMM A;  2E2G A;  4G0I A;  2F8F A;  4TR1 B;  2CT6 A;  4FYU A;  1G0T A;  1O8W A;  2YWI A;  3OR5 A;  2IMF A;  2C1Y A;  4NXI A;  3ERG A;  5A5H B;  2LKU A;  1Q4J A;  3NOF A;  3F0I A;  1O85 A;  2VCX A;  2FNO A;  4E8E A;  2H1L A;  2H72 A;  1K0O A;  1XVQ A;  5D96 A;  4YAP A;  3EMX A;  1SL1 B;  2MBT A;  3MWH A;  2HE3 A;  1AQV A;  3UL3 A;  1I5G A;  4JR4 A;  5F07 A;  5HR3 A;  3MSZ A;  2VIM A;  3GHA A;  4ECC A;  4MPG A;  4PUR A;  2HZE A;  3HVS A;  3GTU B;  3LSZ A;  4PI2 C;  4Q5F A;  2OE3 A;  1BAY A;  2CZ3 A;  4BVX A;  2HSM B;  2DIZ A;  3WGX A;  2HRK A;  2QGV A;  4POL A;  3SBC A;  3M9K A;  2H74 A;  2GST A;  3IK7 A;  1SKR B;  2OAD A;  4EIQ A;  2VD0 A;  1R7H A;  5FT3 A;  4MMM A;  1X9S B;  3CMI A;  4GQF A;  5ELG A;  3H8Q A;  1OE8 A;  1ZGN A;  3ISO A;  4DVC A;  4KW6 A;  2GQK A;  1TP9 A;  4FYB A;  1BX9 A;  4K7I A;  4ECB A;  4OFM A;  2R5G A;  2DJ3 A;  4IGJ A;  1E2Y A;  4V2L A;  2GSS A;  4HI7 A;  1ML6 A;  2N5F A;  2PN8 A;  3QPM A;  1XXU A;  3VLN A;  2B7K A;  2TIR A;  2B5E A;  2VAF A;  5G1K A;  3VWU A;  3NZN A;  2H1B A;  1JLW A;  2X4A A;  3CWG A;  5J47 A;  1BF5 A;  2AYT A;  4XIH A;  5A34 A;  1OC3 A;  1UN2 A;  3U6V A;  1A2M A;  3VUR A;  2REM A;  1G6Y A;  4OO4 A;  2C0E A;  1SVO A;  4ML6 A;  5CP1 A;  2HSN A;  6GSW A;  2EIO A;  4I5Q A;  2HRA A;  2MMN A;  4WF4 A;  1JZR A;  4ZL7 A;  2LRC A;  1NW2 A;  1PGT A;  1U88 A;  5BRT A;  1GNE A;  2ALB A;  3RAZ A;  4TKY A;  1V98 A;  3UBL A;  3PH9 A;  4OD7 A;  2RII A;  2X8C A;  2KP2 A;  3IBH A;  3HMJ G;  3DIE A;  4CW9 A;  1ON4 A;  3GX0 A;  4TR1 A;  2OBK A;  4NV2 A;  3TJB A;  3HDC A;  3F4S A;  1G7E A;  1XOA A;  1O6J A;  1FVK A;  2H1D A;  2VCZ A;  4P3Y B;  5DAK B;  4RQR A;  2O8V B;  4BL7 B;  2K8S A;  5J3R A;  4PXO A;  3TUE A;  2CZ2 A;  4GQC A;  4Z2U A;  4F0C A;  1PN0 A;  4O92 A;  3ERW A;  4LL1 B;  2O5V A;  2EFD A;  1GH2 A;  3GYK A;  4N30 A;  1TU8 A;  5JCU A;  2CAQ A;  4BVY B;  2V6K A;  3TOU A;  4L5O A;  4MDC A;  1XWG A;  1MDI A;  2JSY A;  2RUF A;  1GWC A;  2V32 A;  2IJY A;  2WGR A;  1XPV A;  1B8X A;  4K8M A;  3H93 A;  5EY6 A;  1PN9 A;  5AGY A;  5D9V A;  2EIR A;  2B1K A;  4HU9 A;  1A2L A;  3DXB A;  2K18 A;  4AF2 A;  1K3Y A;  4PQ1 A;  3HJM A;  1PRX A;  3H4K A;  4HU7 A;  2LNT A;  2YWM A;  5C04 A;  1QFN A;  3TKP A;  2VM1 A;  3VWW A;  2R0C A;  2OJL A;  2HSY A;  2BMX A;  3DYR A;  2AJQ B;  3LYK A;  1AXD A;  1ILO A;  4AJ7 A;  1R4W A;  3LYP A;  1FOV A;  3ZIT A;  2O89 A;  3UEM A;  1MTC A;  2YV9 A;  3LGC A;  2GSR A;  4WR4 A;  5KN1 A;  3US3 A;  4JE1 A;  2IWT A;  4J2F A;  3FEU A;  3H79 A;  6GSY A;  2VL3 A;  1O7U A;  2YNX A;  3O76 A;  2YZH A;  4ECI A;  2HRF A;  1RQM A;  2C0D A;  3M0F A;  2GGT A;  2H6Y A;  1O81 A;  2H73 A;  5ECS A;  3TRP A;  1BQ7 A;  5IOW A;  3KM6 A;  3FR9 A;  2VOC A;  2C8U A;  3QCP A;  2WJU A;  5DAK A;  1GSS A;  4BL7 A;  4LLR A;  3UOM A;  2GQL A;  3PPU A;  3CRU A;  3RDW A;  4HZ2 A;  3ZIJ A;  4ICY A;  3TJG A;  2EC4 A;  1BED A;  1SL0 B;  4ILF A;  2YP6 A;  5ECP B;  2YWN A;  4BVY A;  2WDU A;  1XWB A;  1J0F A;  2X49 A;  5J9B A;  2VO4 A;  4HEA 2;  4XTS A;  3G7I A;  3DGQ A;  2TRX A;  1I1I P;  3C1S A;  3D4T A;  4QL9 A;  2OBI A;  2FWE A;  4KE3 A;  2ZNM A;  4KCE A;  3LG6 A;  2B5X A;  5HR2 A;  3FHK A;  6GSV A;  3IV4 A;  4AKX B;  5B6M A;  3EUR A;  3QD9 A;  1F6M C;  3DML A;  2PGT A;  3R2Q A;  4LMW A;  1YEX A;  2L6D A;  2BJX A;  3H1N A;  4PGT A;  3A2X A;  3M9J A;  2FWF A;  2JZR A;  5L71 A;  1DE2 A;  4HOJ A;  1FOH A;  2H0G A;  1MD4 A;  5DCG A;  4ZXG A;  5ECN B;  2PPT A;  2X64 A;  5AIX A;  5G31 A;  3C1R A;  1URM A;  4DSR A;  2FLS A;  4KDX A;  2XC2 A;  4CHS A;  5E59 A;  1SD9 A;  2H19 A;  4X43 A;  3ZRE A;  4MZC A;  4QQ7 A;  3VFI A;  1XOB A;  1ABA A;  1TW9 A;  1GSQ A;  3CYN A;  2GZZ A;  2WZ9 A;  2JL4 A;  4G0K A;  4DEJ A;  1R5P A;  3F63 A;  3F4T A;  4JRR A;  3WGD A;  2B1L A;  3QDN A;  1A2J A;  1EGR A;  2EFE A;  2DBC A;  5IPG A;  1YQ1 A;  2VCQ A;  1QUW A;  2FD3 A;  1G6W A;  4G0L A;  3R3E A;  4WET A;  3C8E A;  5CAX A;  1PL1 A;  5F05 A;  2GZP A;  4BWS A;  4WEY A;  4GSS A;  2GSQ A;  1AQW A;  4G10 A;  3EMP A;  2PU9 C;  3TJF A;  2F3M A;  5G2Z A;  2H8L A;  3FMW A;  2QSI A;  1GUM A;  2VL2 A;  4KAE A;  2GTU A;  4X4J A;  1EGO A;  2HNL A;  3HY2 A;  1SK1 A;  4K6X A;  4JR6 A;  4KGI A;  3TKR A;  3IAM 2;  3KP9 A;  2R0G A;  3LWA A;  4ACS A;  1PQN A;  1FG4 A;  1WMJ A;  1ERU A;  2KHP A;  3PGT A;  1GTI A;  3GST A;  5KEJ A;  3VWX A;  3Q74 A;  4GDF A;  3FY7 A;  1U6T A;  3CBU A;  3L4N A;  3GH9 A;  2IMD A;  5D9T A;  3EVI A;  2QA1 A;  5DAL B;  5ECR B;  1GRX A;  5IIZ A;  2WW1 A;  4BA7 A;  3IXR A;  4YKG A;  3DKS A;  5F0G A;  20GS A;  1EEM A;  4HQS A;  1PKZ A;  4I6X A;  4MCU A;  1K0D A;  4GTU A;  3KMN A;  4V1A g;  4ZBA A;  1M2B A;  5A4V A;  1A8Y A;  4KB3 A;  1JZO A;  4TW5 A;  2I9H A;  4OCE A;  5J4U A;  4YQM A;  2O3E A;  1WOU A;  8GSS A;  3RHB A;  4FH8 A;  3BCK A;  4KDU A;  4NWY A;  2GT6 A;  3TGZ A;  2HXK A;  5D9X A;  2LJK A;  3HVX A;  4HSC X;  4ISD A;  3IDV A;  3IOS A;  2C4J A;  1V58 A;  4IW9 A;  4O32 A;  5DQS A;  3A5W A;  1FO5 A;  4OFT A;  3CHX C;  5AN1 A;  4POK A;  3APO A;  1EV9 A;  19GS A;  2K9F A;  2VM2 A;  1FB0 A;  1AQX A;  5A1N B;  5IOX A;  3N9J A;  3TU3 B;  4BWQ A;  1EWX A;  4K1F A;  3JCM L;  1EP7 A;  2V1M A;  4K0N A;  3M3M A;  1U3A A;  3TOT A;  2YCD A;  3WGE A;  6GSX A;  2I81 A;  3WD6 A;  3J7Y b;  4DSQ A;  1HQO A;  1F9M A;  1JHB A;  4X0X A;  4KX4 A;  3TB2 A;  4ULX A;  3EIN A;  3KXO A;  3KCM A;  3RPN A;  3EE2 A;  3DVX A;  1NHO A;  3UJ1 A;  2QKE A;  1CQH A;  3F8U A;  4QMK A;  4PQI A;  4F82 A;  3W8S A;  5FHI A;  3LOR A;  1YY7 A;  3CQF A;  5IMC A;  4I8B A;  3ZML A;  1KBN A;  3CSH A;  5JWQ B;  5IMD A;  5CRH A;  5ECI B;  2KOK A;  3FW2 A;  4EXJ A;  2K8V A;  3FZ9 A;  2B5Y A;  4XS4 B;  1OC9 B;  4YAV A;  2CVK A;  4ZB9 A;  4WF5 A;  5IO0 A;  4NAX A;  1SJ6 A;  1Z5Y E;  2XPE A;  3FZ5 A;  3GKK A;  4GRF A;  5IQY A;  5DAL A;  2L5O A;  4GSN A;  3FK8 A;  4MK3 A;  2EIQ A;  3E9J B;  2R0P A;  4POB A;  3BBY A;  4KND A;  3TJK A;  1SEN A;  3DVW A;  2KUC A;  3F4R A;  5KN2 A;  3K8N A;  1R26 A;  4BIK A;  4PHZ C;  3HCZ A;  1NHY A;  1ZCP A;  1SKS B;  2WVX A;  1TI3 A;  2LQQ A;  1EZK A;  6GSS A;  2J9H A;  4TXO B;  4ZIL A;  3F9U A;  1Z6N A;  1DSB A;  1PA3 A;  3D0Z A;  1OAZ A;  3RHC A;  3ZYW A;  5HR0 A;  3ZVJ A;  5DDL A;  1M9A A;  4CY6 A;  2DML A;  5J4V A;  2AHE A;  1OKD A;  3F6F A;  3GUR A;  4LMV A;  1T3B A;  1JFU A;  1X5C A;  3QAW A;  2YJH A;  5A5H A;  1O73 A;  2DSA A;  4HS1 A;  5A1N A;  1EOG A;  2YOI A;  2OA7 A;  4Q5Q A;  4ECJ A;  3KZQ A;  3IRA A;  2XPD A;  5COH A;  2GZY A;  2O7K A;  2NPB A;  1SU9 A;  4MA9 A;  3ZFB A;  4TRX A;  3EYT A;  1SKW B;  4KCA A;  5J40 A;  3TKS A;  1YDK A;  4MF5 A;  3D6I A;  3GTU A;  11GS A;  5E4W A;  1WJK A;  5EVO A;  2HSM A;  4WBR D;  1TRW A;  1VGL A;  3A2V A;  2J23 A;  2QA2 A;  2R3X A;  3P90 A;  1H75 A;  1KNG A;  3I69 A;  1YEW C;  4HJM A;  3Q18 A;  5KN0 A;  3O6T A;  1K3O A;  2VCT A;  3UVT A;  1GTU A;  2MMA A;  3IHG A;  1GP1 A;  3UIW A;  7GSS A;  4YKF A;  4MP4 A;  5F8B A;  4K2X A;  1S3C A;  2C0G A;  5J4Y A;  1SJZ A;  1B4P A;  1AUC A;  3KJY A;  4PNG A;  4XS4 A;  1K3L A;  1OC9 A;  1T4Y A;  3G7J A;  5G30 A;  1DBY A;  1RK4 A;  4KH7 A;  2G0F A;  3E3E A;  3F3Q A;  4E68 A;  3GV1 A;  3A2W A;  1B9X C;  2KLX A;  1A24 A;  1SVM A;  2AAW A;  4MPF A;  2GVP A;  1KEB A;  2VL2 C;  1PMT A;  2DJJ A;  1TK0 B;  3O3T A;  2WS2 A;  1V9W A;  3APQ A;  4O5R A;  4HJ2 A;  1JZD A;  2H70 A;  2DC5 A;  1TDI A;  4PI0 C;  3GX8 A;  1YKA A;  4IBP A;  1YVL A;  2E7P A;  3NIV A;  4PTS A;  4GF0 A;  3L9S A;  5DBQ A;  2ES7 A;  1TU7 A;  2VCV A;  2MYG A;  1GLQ A;  4TXO A;  3ME8 A;  3FRC A;  2IME A;  4CY8 A;  2IIY A;  1ZZY A;  3HVV A;  3LFL A;  2MBS A;  1IYI A;  1VF2 A;  3I43 A;  3P8W A;  3IE3 A;  2H0I A;  1TXX A;  5J9C A;  2DIY A;  3GKM A;  1SYX A;  1PL2 A;  4D73 B;  4TOP A;  2N5A A;  4RUV A;  4FQU A;  1VF4 A;  2H6Z A;  5A5K A;  1GSE A;  3F3R A;  2JAD A;  1V57 A;  4IN0 A;  3BCI A;  3FZ4 A;  2R37 A;  4AKG A;  2V41 A;  4LA1 A;  2I1U A;  3EC3 A;  1WIK A;  3Q6O A;  5IMV A;  1SJI A;  3P2A A;  3WT2 A;  1K0B A;  1ZYQ B;  2IPA A;  3TRQ A;  2OE1 A;  3HYP A;  2GDR A;  2NDO A;  1TRS A;  5JCW A;  1S4B P;  1B4Q A;  2VCW A;  2H0H A;  1XCC A;  5D9W A;  2LRN A;  1T4Z A;  2Z9S A;  1Y1U A;  3GH6 A;  4POM A;  4K5R A;  14GS A;  2LEG A;  3EU3 A;  3IA1 A;  1GSD A;  3HA9 A;  3PR8 A;  2O87 A;  1VF1 A;  1O8X A;  3TJJ A;  3CXG A;  1YKC A;  2TRC P;  2YV7 A;  1ZL9 A;  1XBS A;  2YZU A;  1K0M A;  3WT1 A;  4TR3 A;  2L5L A;  1Z7R A;  2KP1 A;  2FCH A;  2I4A A;  4TR0 A;  2LUS A;  4DSS B;  1M9B A;  3W8J A;  4CDO A;  2DKI A;  1XG8 A;  2PVQ A;  5INY A;  4IHU A;  5CO3 A;  1LBK A;  1OVN A;  2P5R A;  1FVJ A;  16GS A;  2IFQ B;  3I6A A;  4V2M A;  4USS A;  2YN1 A;  2GLR A;  3UVH A;  1Z6M A;  1NSW A;  5KN3 A;  3KTB A;  2H6X A;  5ECO B;  13GS A;  4NHW A;  4ZL9 A;  1TOF A;  2OT3 A;  1SK0 A;  1LU4 A;  2M72 A;  2LST A;  1TRU A;  3GMF A;  3CRT A;  2VKZ G;  4MNN A;  2ZCT A;  1TXU A;  1M2D A;  4ID0 A;  2VL9 A;  2XBI A;  1V2A A;  2B7J A;  2DKH A;  3GKX A;  4RQX A;  4ZB6 A;  2VLV A;  3IK9 A;  3E0U A;  2LNS A;  4EF0 A;  1T00 A;  3IC4 A;  4KSO A;  4D73 A;  2FA8 A;  3KMO A;  3IPZ A;  4PQH A;  2WW0 A;  1M3J A;  1X9W B;  5G5F A;  4XRD A;  4TVE A;  5J41 A;  2LJA A;  1SVL A;  2L4Q A;  2A2P A;  4EVM A;  3WYW A;  5IMZ A;  4HZ4 A;  2P5Q A;  5ECL B;  1USB A;  4K2D A;  2FHE A;  1HNA A;  5CRG A;  2WW2 A;  2NTO A;  1VRS D;  1THO A;  3A5I A;  1M0U A;  1LJR A;  1BJX A;  3L9U A;  5D73 A;  2X99 A;  2WCI A;  3GL3 A;  4XHM A;  3QMX A;  3V1W A;  3L78 A;  4F03 A;  2AV4 A;  4Q5N A;  3C71 A;  2LS5 A;  4ZBB A;  4JZQ A;  1TJD A;  5G1L A;  4LL4 B;  3VK9 A;  3KH7 A;  3BJ5 A;  3W6G A;  1M99 A;  4EIP A;  2PMT A;  3KP8 A;  5CRD A;  4DSS A;  4Z2T A;  1PKW A;  2PWJ A;  3TKS C;  5BMU B;  2EFC A;  4MJB A;  1M3I A;  4MH2 A;  2IFQ A;  4N10 A;  2YAN A;  2VD1 A;  3HHV A;  5IPH A;  1F37 A;  4PUF C;  4WR5 A;  4Z2R A;  5C00 A;  5ABR A;  1AIU A;  1QGV A;  4WXT A;  4V1A p;  2E2M A;  1Y25 A;  1TI1 A;  1I9D A;  2VUP A;  2CQ9 A;  2F9S A; 
#chains in the Genus database with same CATH homology
 1OKT A;  4L0W A;  2PUK C;  2R2J A;  5H5R A;  1GTA A;  2RM6 A;  2LRT A;  1QQ2 A;  1GTB A;  1SYR A;  3QOU A;  1ZOF A;  1ERT A;  4AKI A;  1ERV A;  5KOW A;  2IMI A;  1TTZ A;  1TKD B;  2HRN A;  4ML1 A;  1KTE A;  3M1G A;  5H5S A;  2PER A;  3DRN A;  3CTF A;  1ST9 A;  4RI6 A;  4EL1 A;  3VPQ A;  5CNW A;  5F06 A;  5B8A A;  5DQY A;  2PBJ A;  2PVO C;  2C3N A;  4TR4 A;  4K9Z A;  3D5J A;  4NPB A;  5ID2 B;  3GUS A;  5G5E A;  3ZZX A;  3P7X A;  5GAP D;  1B9Y C;  2OE0 A;  2IN3 A;  5HR1 A;  2RUE A;  4OO5 A;  1XIY A;  1YF0 A;  2F51 A;  1GNW A;  3D21 A;  2H30 A;  3LQ7 A;  4MAB A;  3VI7 A;  1B48 A;  2L6C A;  5EL8 A;  4KSM A;  2CX4 A;  2HSH A;  4K7N A;  1F3A A;  4MLY A;  4OCF A;  3FR3 A;  4NV5 A;  2DJK A;  2X8H A;  4NHZ A;  4N3Z A;  5CRW A;  3KIJ A;  4I2T A;  4ZBD A;  4MJC A;  2LQO A;  2G2Q A;  5CYY A;  4AJ6 A;  3I9V 2;  2HLS A;  3AY8 A;  5FWG A;  5GZZ B;  1FB6 A;  1WE0 A;  1GUH A;  1F2E A;  4ZIJ A;  3IC8 A;  4MZW A;  4I2U A;  2HYX A;  4EDY A;  4WBJ A;  1X9M B;  2CVB A;  4XCS A;  4ZB7 A;  5BMU A;  1A0R P;  2MZC A;  3FR6 A;  18GS A;  17GS A;  5A4W A;  3GFK A;  3VPT A;  1AW9 A;  2VLU A;  2C3T A;  1XVW A;  1TK5 B;  1Z9H A;  3TKQ A;  1NM3 A;  2OAC A;  2FY6 A;  2L4C A;  2O85 A;  4L0U A;  3FKF A;  2UZ8 A;  1Z7P A;  2ON5 A;  1SD8 A;  3ZLP A;  2C80 A;  2JZS A;  4GLT A;  4EKZ A;  1A23 A;  1W89 A;  4GCI A;  5A4U A;  1BYE A;  4V2N A;  1XW6 A;  4MJA A;  3EWL A;  1WPI A;  3MDK A;  2YJ7 A;  1FHE A;  2NBS A;  2MMZ A;  2F8A A;  4EO3 A;  1Y6E A;  5D93 A;  3Q19 A;  4ZB8 A;  2DJ2 A;  2LV3 A;  3LEF A;  1XWA A;  4N0Z A;  6GSU A;  1GUK A;  2XHF A;  1IYH A;  4AKH A;  1J08 A;  1M7T A;  5EPF A;  2HI7 A;  5JCG A;  3A3T A;  3G9B A;  5DJM A;  5B7C A;  1MDJ A;  1YEP A;  1OE7 A;  2RM5 A;  1GUL A;  1XWC A;  1OYJ A;  4KDY A;  4A5P A;  4PX1 A;  3EPT A;  2A2R A;  5ID2 A;  2V6O A;  9GSS A;  4PUA A;  2X8G A;  1XFL A;  3ZFL A;  1S3A A;  4FO5 A;  1QK8 A;  1YJ6 A;  3UAP A;  4N0V A;  4PNF A;  5B6N A;  10GS A;  2A2S A;  2HT9 A;  2R4V A;  5D8I A;  1JZW A;  2VLT A;  1MEK A;  2BTO T;  1MDK A;  4BPY A;  4AI6 A;  4GST A;  2EFH A;  1FAA A;  4IEL A;  1HNC A;  3DD3 A;  3CTG A;  1Z3E A;  5LCZ A;  4L8E A;  2CVD A;  3PIN A;  2MMO A;  2HFD A;  3HJO A;  3L9V A;  2FWG A;  5DJL A;  3KH9 A;  2P0G A;  3KGK A;  4OWY A;  3ZIV A;  4IVF A;  3MIX A;  3CSJ A;  3HD5 A;  2H71 A;  1BG1 A;  2D2Z A;  4IJI A;  3C7M A;  2NVL A;  5HFI A;  3S9F A;  1ERW A;  1OC8 A;  1WWJ A;  4O5Q A;  4G19 A;  1GSU A;  1ZMA A;  4G01 A;  5AIS A;  2A4H A;  1TK8 B;  3SWL A;  2XBQ A;  1K0C A;  12GS A;  1W4V A;  5IMF A;  4F0B A;  4MJE A;  4FIW A;  3L0H A;  4Q5R A;  4WKW A;  1R5A A;  3DEX A;  4XRA A;  3BD2 A;  2H75 A;  3C73 A;  1YF1 A;  4KUN A;  4X1U A;  2M80 A;  4XS1 A;  3VWV A;  1PX7 A;  1ACV A;  1DE1 A;  1BG5 A;  3GA4 A;  3D22 A;  3GIX A;  2K6V A;  1XZO A;  2M46 A;  4J56 E;  1UA5 A;  2AUV A;  4G2E A;  4YH2 A;  4F9Z A;  5HQP A;  5ELA A;  3KTL A;  3RBT A;  2LJR A;  1GSF A;  2ZUP A;  3DWV A;  4JBB A;  1RW1 A;  1VF3 A;  1DUG A;  3QAV A;  2FGX A;  1YZX A;  5B8B A;  2B3S A;  4HDE A;  4J57 E;  4H86 A;  2RLI A;  1ZYE A;  5JWR B;  5GAN D;  2HZF A;  1K0N A;  4OMV A;  5GST A;  4N11 A;  1T7P B;  2WB9 A;  2GQM A;  2GT5 A;  2DJ0 A;  3IAS 2;  4Z7X A;  1A0F A;  2CA8 A;  4JED A;  3HKR A;  2WUL A;  4ZL8 A;  1GLP A;  1X5E A;  1AAZ A;  1A8L A;  1XWK A;  2C3Q A;  3RPP A;  4EUY A;  3QR6 A;  2H1A A;  4E8H A;  2H66 A;  1T8E B;  2YWO A;  3HXS A;  3GSS A;  2C0F A;  2H1G A;  4W66 A;  2FA4 A;  5ECM B;  3QFA C;  4K7O A;  3BOA A;  3KD0 A;  1PD2 1;  1GSY A;  1T1V A;  2JU5 A;  4QL7 A;  4EDZ A;  4KA0 A;  4O5U A;  2CX3 A;  5IMA A;  3ME7 A;  3QAG A;  5LNK e;  3IR4 A;  1TRV A;  4YQV A;  5IO2 A;  4I97 A;  5IM9 A;  4L5L A;  3M8N A;  1H4O A;  4MF7 A;  2HQT A;  4MH3 A;  1X5D A;  4HUA A;  1HNB A;  4HQZ A;  3IHQ A;  1CQG A;  3HJP A;  1EP8 A;  3ZMK A;  5AIV A;  2JZT A;  3TKS E;  3ZL5 A;  5ECQ B;  4MZB A;  1E6B A;  3TCO A;  1X0R A;  2LTK A;  3VI5 A;  4TN8 A;  22GS A;  1M2A A;  3J7Y k;  5KOX A;  4RI7 A;  4EE0 A;  3LW9 A;  1PSQ A;  2CV4 A;  4IQ1 A;  2R6K A;  2ON7 A;  1UVZ A;  3TRX A;  4F2I A;  2CAI A;  2WFC A;  3KEB A;  1FW1 A;  5DCH A;  2N5B A;  1HD2 A;  5HFG A;  3UAR A;  1ZYN A;  3ED3 A;  1QXH A;  4IKH A;  2P31 A;  3GN3 A;  4TXV A;  1SK2 A;  1K0A A;  4XS6 A;  3UMA A;  3LXT A;  1EOH A;  4G9H A;  2E0Q A;  4IP6 A;  3LJR A;  1GL8 A;  4IS0 A;  1WRY A;  4AGS A;  3U5R E;  5ECH B;  1F3B A;  1PX6 A;  3MYD A;  4FYC A;  2UV8 G;  1U87 A;  3D4M A;  1S3D A;  2QC7 A;  2AB6 A;  5ECK B;  3UBK A;  6GST A;  1AC1 A;  3TDG A;  2FUG 2;  5LD0 A;  3EU4 A;  3F6D A;  4IP1 A;  4JU5 A;  2B6M A;  4GWR A;  2I3Y A;  3ZVJ D;  4AJ8 A;  5GSS A;  2HZE B;  3GKN A;  1XW9 A;  1XW5 A;  2L57 A;  3GRX A;  4BVX B;  2H76 A;  3HZ4 A;  1WP0 A;  2A4V A;  3ZTL A;  2HRK B;  4O7H A;  3ZRD A;  2H01 A;  1QMV A;  4GXZ A;  1U3I A;  1THX A;  3LXZ A;  4NMU A;  5CRE A;  1MD3 A;  4IQA A;  1ZYP A;  1SL2 B;  2OKA A;  2L59 A;  3FZA A;  2DLX A;  2YPM A;  4KF9 A;  5DVB A;  3GL5 A;  3MNG A;  4IJ3 A;  1EV4 A;  3ERF A;  4K0G A;  5J5N A;  3GNJ A;  1UC7 A;  1JLV A;  4OFN A;  2GS3 A;  2IMK A;  5A34 B;  5HFK A;  2JAC A;  1V40 A;  4EC0 A;  4YQU A;  1EEJ A;  2HSN B;  3FYG A;  5H5Q A;  3MAK A;  3APS A;  5JWO B;  1N25 A;  1N8J A;  2FWH A;  1HYU A;  2IL3 A;  1Q98 A;  2WRT A;  5ENU A;  3G7Y A;  4MF6 A;  1C72 A;  2JSZ A;  2V2G A;  1J9B A;  3QFB C;  2DJ1 A;  4K5S A;  1G7O A;  3CSI A;  3HZ8 A;  1N2A A;  3N5O A;  2DMM A;  2E2G A;  4G0I A;  2F8F A;  4TR1 B;  2CT6 A;  4FYU A;  1G0T A;  1O8W A;  2YWI A;  3OR5 A;  2IMF A;  2C1Y A;  4NXI A;  3ERG A;  5A5H B;  2LKU A;  1Q4J A;  3NOF A;  3F0I A;  1O85 A;  2VCX A;  2FNO A;  4E8E A;  2H1L A;  2H72 A;  1K0O A;  1XVQ A;  5D96 A;  4YAP A;  3EMX A;  1SL1 B;  2MBT A;  3MWH A;  2HE3 A;  1AQV A;  3UL3 A;  1I5G A;  4JR4 A;  5F07 A;  5HR3 A;  3MSZ A;  2VIM A;  3GHA A;  4ECC A;  4MPG A;  4PUR A;  2HZE A;  3HVS A;  3GTU B;  3LSZ A;  4Q5F A;  2OE3 A;  1BAY A;  2CZ3 A;  4BVX A;  2HSM B;  2DIZ A;  3WGX A;  2HRK A;  2QGV A;  4POL A;  3SBC A;  3M9K A;  2H74 A;  2GST A;  3IK7 A;  1SKR B;  2OAD A;  4EIQ A;  2VD0 A;  1R7H A;  5FT3 A;  4MMM A;  1X9S B;  3CMI A;  4GQF A;  5ELG A;  3H8Q A;  1OE8 A;  1ZGN A;  3ISO A;  4DVC A;  4KW6 A;  2GQK A;  1TP9 A;  4FYB A;  1BX9 A;  4K7I A;  4ECB A;  4OFM A;  2R5G A;  2DJ3 A;  4IGJ A;  1E2Y A;  4V2L A;  2GSS A;  4HI7 A;  1ML6 A;  2N5F A;  2PN8 A;  3QPM A;  1XXU A;  3VLN A;  2B7K A;  2TIR A;  2B5E A;  2VAF A;  5G1K A;  3VWU A;  3NZN A;  2H1B A;  1JLW A;  2X4A A;  3CWG A;  5J47 A;  1BF5 A;  2AYT A;  4XIH A;  5A34 A;  1OC3 A;  1UN2 A;  3U6V A;  1A2M A;  3VUR A;  2REM A;  1G6Y A;  4OO4 A;  2C0E A;  1SVO A;  4ML6 A;  5CP1 A;  2HSN A;  6GSW A;  2EIO A;  4I5Q A;  2HRA A;  2MMN A;  4WF4 A;  1JZR A;  4ZL7 A;  2LRC A;  1NW2 A;  1PGT A;  1U88 A;  5BRT A;  1GNE A;  2ALB A;  3RAZ A;  4TKY A;  1V98 A;  3UBL A;  3PH9 A;  4OD7 A;  2RII A;  2X8C A;  2KP2 A;  3IBH A;  3HMJ G;  3DIE A;  4CW9 A;  1ON4 A;  3GX0 A;  4TR1 A;  2OBK A;  4NV2 A;  3TJB A;  3HDC A;  3F4S A;  1G7E A;  1XOA A;  1O6J A;  1FVK A;  2H1D A;  2VCZ A;  4P3Y B;  5DAK B;  4RQR A;  2O8V B;  4BL7 B;  2K8S A;  5J3R A;  4PXO A;  3TUE A;  2CZ2 A;  4GQC A;  4Z2U A;  4F0C A;  1PN0 A;  4O92 A;  3ERW A;  4LL1 B;  2O5V A;  2EFD A;  1GH2 A;  3GYK A;  4N30 A;  1TU8 A;  5JCU A;  2CAQ A;  4BVY B;  2V6K A;  3TOU A;  4L5O A;  4MDC A;  1XWG A;  1MDI A;  2JSY A;  2RUF A;  1GWC A;  2V32 A;  2IJY A;  2WGR A;  1XPV A;  1B8X A;  4K8M A;  3H93 A;  5EY6 A;  1PN9 A;  5AGY A;  5D9V A;  2EIR A;  2B1K A;  4HU9 A;  1A2L A;  3DXB A;  2K18 A;  4AF2 A;  1K3Y A;  4PQ1 A;  3HJM A;  1PRX A;  3H4K A;  4HU7 A;  2LNT A;  2YWM A;  5C04 A;  1QFN A;  3TKP A;  2VM1 A;  3VWW A;  2R0C A;  2OJL A;  2HSY A;  2BMX A;  3DYR A;  2AJQ B;  3LYK A;  1AXD A;  1ILO A;  4AJ7 A;  1R4W A;  3LYP A;  1FOV A;  3ZIT A;  2O89 A;  3UEM A;  1MTC A;  2YV9 A;  3LGC A;  2GSR A;  4WR4 A;  5KN1 A;  3US3 A;  4JE1 A;  2IWT A;  4J2F A;  3FEU A;  3H79 A;  6GSY A;  2VL3 A;  1O7U A;  2YNX A;  3O76 A;  2YZH A;  4ECI A;  2HRF A;  1RQM A;  2C0D A;  3M0F A;  2GGT A;  2H6Y A;  1O81 A;  2H73 A;  5ECS A;  3TRP A;  1BQ7 A;  5IOW A;  3KM6 A;  3FR9 A;  2VOC A;  2C8U A;  3QCP A;  2WJU A;  5DAK A;  1GSS A;  4BL7 A;  4LLR A;  3UOM A;  2GQL A;  3PPU A;  3CRU A;  3RDW A;  4HZ2 A;  3ZIJ A;  4ICY A;  3TJG A;  2EC4 A;  1BED A;  1SL0 B;  4ILF A;  2YP6 A;  5ECP B;  2YWN A;  4BVY A;  2WDU A;  1XWB A;  1J0F A;  2X49 A;  5J9B A;  2VO4 A;  4HEA 2;  4XTS A;  3G7I A;  3DGQ A;  2TRX A;  3D4T A;  3C1S A;  4QL9 A;  2OBI A;  2FWE A;  4KE3 A;  2ZNM A;  4KCE A;  3LG6 A;  2B5X A;  5HR2 A;  3FHK A;  6GSV A;  3IV4 A;  4AKX B;  5B6M A;  3EUR A;  3QD9 A;  1F6M C;  3DML A;  2PGT A;  3R2Q A;  4LMW A;  1YEX A;  2L6D A;  2BJX A;  3H1N A;  4PGT A;  3A2X A;  3M9J A;  2FWF A;  2JZR A;  5L71 A;  1DE2 A;  4HOJ A;  1FOH A;  2H0G A;  1MD4 A;  5DCG A;  4ZXG A;  5ECN B;  2PPT A;  2X64 A;  5AIX A;  5G31 A;  3C1R A;  1URM A;  4DSR A;  2FLS A;  4KDX A;  2XC2 A;  4CHS A;  5E59 A;  1SD9 A;  2H19 A;  4X43 A;  3ZRE A;  4MZC A;  4QQ7 A;  3VFI A;  1XOB A;  1ABA A;  1TW9 A;  1GSQ A;  3CYN A;  2GZZ A;  2WZ9 A;  2JL4 A;  4G0K A;  4DEJ A;  1R5P A;  3F63 A;  3F4T A;  4JRR A;  3WGD A;  2B1L A;  3QDN A;  1A2J A;  1EGR A;  2EFE A;  2DBC A;  5IPG A;  1YQ1 A;  2VCQ A;  1QUW A;  2FD3 A;  1G6W A;  4G0L A;  3R3E A;  4WET A;  3C8E A;  5CAX A;  1PL1 A;  5F05 A;  2GZP A;  4BWS A;  4WEY A;  4GSS A;  2GSQ A;  1AQW A;  4G10 A;  3EMP A;  2PU9 C;  3TJF A;  2F3M A;  5G2Z A;  2H8L A;  3FMW A;  2QSI A;  1GUM A;  2VL2 A;  4KAE A;  2GTU A;  4X4J A;  1EGO A;  2HNL A;  3HY2 A;  1SK1 A;  4K6X A;  4JR6 A;  4KGI A;  3TKR A;  3IAM 2;  3KP9 A;  2R0G A;  3LWA A;  4ACS A;  1PQN A;  1FG4 A;  1WMJ A;  1ERU A;  2KHP A;  3PGT A;  1GTI A;  3GST A;  5KEJ A;  3VWX A;  3Q74 A;  4GDF A;  3FY7 A;  1U6T A;  3CBU A;  3L4N A;  3GH9 A;  2IMD A;  5D9T A;  3EVI A;  2QA1 A;  5DAL B;  5ECR B;  1GRX A;  5IIZ A;  4BA7 A;  3IXR A;  4YKG A;  3DKS A;  5F0G A;  20GS A;  1EEM A;  4HQS A;  1PKZ A;  4I6X A;  4MCU A;  1K0D A;  4GTU A;  3KMN A;  4V1A g;  4ZBA A;  1M2B A;  5A4V A;  1A8Y A;  4KB3 A;  1JZO A;  4TW5 A;  2I9H A;  4OCE A;  5J4U A;  4YQM A;  1WOU A;  8GSS A;  3RHB A;  4FH8 A;  3BCK A;  4KDU A;  4NWY A;  2GT6 A;  3TGZ A;  2HXK A;  5D9X A;  2LJK A;  3HVX A;  4ISD A;  3IDV A;  3IOS A;  2C4J A;  1V58 A;  4IW9 A;  4O32 A;  5DQS A;  3A5W A;  1FO5 A;  4OFT A;  5AN1 A;  4POK A;  3APO A;  1EV9 A;  19GS A;  2K9F A;  2VM2 A;  1FB0 A;  1AQX A;  5A1N B;  5IOX A;  3N9J A;  3TU3 B;  4BWQ A;  1EWX A;  4K1F A;  3JCM L;  1EP7 A;  2V1M A;  4K0N A;  3M3M A;  1U3A A;  3TOT A;  2YCD A;  3WGE A;  6GSX A;  2I81 A;  3WD6 A;  3J7Y b;  4DSQ A;  1HQO A;  1F9M A;  1JHB A;  4X0X A;  4KX4 A;  3TB2 A;  4ULX A;  3EIN A;  3KXO A;  3KCM A;  3RPN A;  3EE2 A;  3DVX A;  1NHO A;  3UJ1 A;  2QKE A;  1CQH A;  3F8U A;  4QMK A;  4PQI A;  4F82 A;  3W8S A;  5FHI A;  3LOR A;  1YY7 A;  5IMC A;  4I8B A;  3ZML A;  1KBN A;  3CSH A;  5JWQ B;  5IMD A;  5CRH A;  5ECI B;  2KOK A;  3FW2 A;  4EXJ A;  2K8V A;  3FZ9 A;  2B5Y A;  4XS4 B;  1OC9 B;  4YAV A;  2CVK A;  4ZB9 A;  4WF5 A;  5IO0 A;  4NAX A;  1SJ6 A;  1Z5Y E;  2XPE A;  3FZ5 A;  3GKK A;  4GRF A;  5IQY A;  5DAL A;  2L5O A;  4GSN A;  3FK8 A;  4MK3 A;  2EIQ A;  3E9J B;  2R0P A;  4POB A;  3BBY A;  4KND A;  3TJK A;  1SEN A;  3DVW A;  2KUC A;  3F4R A;  5KN2 A;  3K8N A;  1R26 A;  3HCZ A;  1NHY A;  1ZCP A;  1SKS B;  1TI3 A;  2LQQ A;  1EZK A;  6GSS A;  2J9H A;  4TXO B;  4ZIL A;  3F9U A;  1Z6N A;  1DSB A;  1PA3 A;  3D0Z A;  1OAZ A;  3RHC A;  3ZYW A;  5HR0 A;  3ZVJ A;  5DDL A;  1M9A A;  4CY6 A;  2DML A;  5J4V A;  2AHE A;  1OKD A;  3F6F A;  3GUR A;  4LMV A;  1T3B A;  1JFU A;  1X5C A;  3QAW A;  2YJH A;  5A5H A;  1O73 A;  2DSA A;  4HS1 A;  5A1N A;  1EOG A;  2YOI A;  2OA7 A;  4Q5Q A;  4ECJ A;  3KZQ A;  3IRA A;  2XPD A;  5COH A;  2GZY A;  2O7K A;  2NPB A;  1SU9 A;  4MA9 A;  3ZFB A;  4TRX A;  3EYT A;  1SKW B;  4KCA A;  5J40 A;  3TKS A;  1YDK A;  4MF5 A;  3D6I A;  3GTU A;  11GS A;  5E4W A;  1WJK A;  5EVO A;  2HSM A;  4WBR D;  1TRW A;  1VGL A;  3A2V A;  2J23 A;  2QA2 A;  2R3X A;  3P90 A;  1H75 A;  1KNG A;  3I69 A;  4HJM A;  3Q18 A;  5KN0 A;  3O6T A;  1K3O A;  2VCT A;  3UVT A;  1GTU A;  2MMA A;  3IHG A;  1GP1 A;  3UIW A;  7GSS A;  4YKF A;  4MP4 A;  5F8B A;  4K2X A;  1S3C A;  2C0G A;  5J4Y A;  1SJZ A;  1B4P A;  1AUC A;  3KJY A;  4PNG A;  4XS4 A;  1K3L A;  1OC9 A;  1T4Y A;  3G7J A;  5G30 A;  1DBY A;  1RK4 A;  4KH7 A;  2G0F A;  3E3E A;  3F3Q A;  4E68 A;  3GV1 A;  3A2W A;  1B9X C;  2KLX A;  1A24 A;  1SVM A;  2AAW A;  4MPF A;  2GVP A;  1KEB A;  2VL2 C;  1PMT A;  2DJJ A;  1TK0 B;  3O3T A;  2WS2 A;  1V9W A;  3APQ A;  4O5R A;  4HJ2 A;  1JZD A;  2H70 A;  2DC5 A;  1TDI A;  3GX8 A;  1YKA A;  4IBP A;  1YVL A;  2E7P A;  3NIV A;  4PTS A;  4GF0 A;  3L9S A;  5DBQ A;  2ES7 A;  1TU7 A;  2VCV A;  2MYG A;  1GLQ A;  4TXO A;  3ME8 A;  3FRC A;  2IME A;  4CY8 A;  2IIY A;  1ZZY A;  3HVV A;  3LFL A;  2MBS A;  1IYI A;  1VF2 A;  3I43 A;  3P8W A;  3IE3 A;  2H0I A;  1TXX A;  5J9C A;  2DIY A;  3GKM A;  1SYX A;  1PL2 A;  4D73 B;  4TOP A;  2N5A A;  4RUV A;  4FQU A;  1VF4 A;  2H6Z A;  5A5K A;  1GSE A;  3F3R A;  2JAD A;  1V57 A;  4IN0 A;  3BCI A;  3FZ4 A;  2R37 A;  4AKG A;  2V41 A;  4LA1 A;  2I1U A;  3EC3 A;  1WIK A;  3Q6O A;  5IMV A;  1SJI A;  3P2A A;  3WT2 A;  1K0B A;  1ZYQ B;  2IPA A;  3TRQ A;  2OE1 A;  3HYP A;  2GDR A;  2NDO A;  1TRS A;  5JCW A;  1B4Q A;  2VCW A;  2H0H A;  1XCC A;  5D9W A;  2LRN A;  1T4Z A;  2Z9S A;  1Y1U A;  3GH6 A;  4POM A;  4K5R A;  14GS A;  2LEG A;  3EU3 A;  3IA1 A;  1GSD A;  3HA9 A;  3PR8 A;  2O87 A;  1VF1 A;  1O8X A;  3TJJ A;  3CXG A;  1YKC A;  2TRC P;  2YV7 A;  1ZL9 A;  1XBS A;  2YZU A;  1K0M A;  3WT1 A;  4TR3 A;  2L5L A;  1Z7R A;  2KP1 A;  2FCH A;  2I4A A;  4TR0 A;  2LUS A;  4DSS B;  1M9B A;  3W8J A;  4CDO A;  2DKI A;  2PVQ A;  5INY A;  4IHU A;  5CO3 A;  1LBK A;  1OVN A;  2P5R A;  1FVJ A;  16GS A;  2IFQ B;  3I6A A;  4V2M A;  4USS A;  2YN1 A;  2GLR A;  3UVH A;  1Z6M A;  1NSW A;  5KN3 A;  3KTB A;  2H6X A;  5ECO B;  13GS A;  4NHW A;  4ZL9 A;  1TOF A;  2OT3 A;  1SK0 A;  1LU4 A;  2M72 A;  2LST A;  1TRU A;  3GMF A;  3CRT A;  2VKZ G;  4MNN A;  2ZCT A;  1TXU A;  1M2D A;  4ID0 A;  2VL9 A;  2XBI A;  1V2A A;  2B7J A;  2DKH A;  3GKX A;  4RQX A;  4ZB6 A;  2VLV A;  3IK9 A;  3E0U A;  2LNS A;  4EF0 A;  1T00 A;  3IC4 A;  4KSO A;  4D73 A;  2FA8 A;  3KMO A;  3IPZ A;  4PQH A;  1X9W B;  5G5F A;  4XRD A;  4TVE A;  5J41 A;  2LJA A;  1SVL A;  2L4Q A;  2A2P A;  4EVM A;  3WYW A;  5IMZ A;  4HZ4 A;  2P5Q A;  5ECL B;  1USB A;  4K2D A;  2FHE A;  1HNA A;  5CRG A;  2NTO A;  1VRS D;  1THO A;  3A5I A;  1M0U A;  1LJR A;  1BJX A;  3L9U A;  5D73 A;  2X99 A;  2WCI A;  3GL3 A;  4XHM A;  3QMX A;  3V1W A;  3L78 A;  4F03 A;  2AV4 A;  4Q5N A;  3C71 A;  2LS5 A;  4ZBB A;  4JZQ A;  1TJD A;  5G1L A;  4LL4 B;  3VK9 A;  3KH7 A;  3BJ5 A;  3W6G A;  1M99 A;  4EIP A;  2PMT A;  3KP8 A;  5CRD A;  4DSS A;  4Z2T A;  1PKW A;  2PWJ A;  3TKS C;  5BMU B;  2EFC A;  4MJB A;  4MH2 A;  2IFQ A;  4N10 A;  2YAN A;  2VD1 A;  3HHV A;  5IPH A;  1F37 A;  4PUF C;  4WR5 A;  4Z2R A;  5C00 A;  5ABR A;  1AIU A;  1QGV A;  4WXT A;  4V1A p;  2E2M A;  1Y25 A;  1TI1 A;  1I9D A;  2VUP A;  2CQ9 A;  2F9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...