4GUAA

Alphavirus p23pro-zbd
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
662
structure length
662
Chain Sequence
NPFSCKTNVCWAKALEPILATAGIVLTGCQWSELFPQFADDKPHSAIYALDVICIKFFGMDLTSGLFSKQSIPLTYHPADSARPVAHWDNSPGTRKYGYDHAIAAELSRRFPVFQLAGKGTQLDLQTGRTRVISAQHNLVPVNRNLPHALVPEYKEKQPGPVKKFLNQFKHHSVLVVSEEKIEAPRKRIEWIAPIGIAGADKNYNLAFGFPPQARYDLVFINIGTKYRNHHFQQCEDHAATLKTLSRSALNCLNPGGTLVVKSYGYADRNSEDVVTALARKFVRVSAARPDCVSSNTEMYLIFRQLDNSRTRQFTPHHLNCVISSVYEGTRDGVGAAPSYRTKRENIADCQEEAVVNAANPLGRPGEGVCRAIYKRWPTSFTDSATETGTARMTVCLGKKVIHAVGPDFRKHPEAEALKLLQNAYHAVADLVNEHNIKSVAIPLLSTGIYAAGKDRLEVSLNCLTTALDRTDADVTIYCLDKKWKERIDAALQLKESVTELKDEDMEIDDELVWIHPDSCLKGRKGFSTTKGKLYSYFEGTKFHQAAKDMAEIKVLFPNDQESNEQLCAYILGETMEAIREKCPVDHNPSSSPPKTLPCLCMYAMTPERVHRLRSNNVKEVTVCSSTPLPKHKIKNVQKVQCTKVVLFNPHTPAFVPARKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional insights into alphavirus polyprotein processing and pathogenesis.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Hydrolase
molecule keywords Non-structural polyprotein
total genus 200
structure length 662
sequence length 662
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4guaA02
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4guaA03
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4guaA01
4UMLA 2VS1A 4UOEA 1YZ3A 3MERA 3A4TA 5KVAA 4CKBA 1BOOA 2F8LA 1YFJA 2PWPA 3M6VA 1M0EA 1AQIA 4BY9E 4EVIA 4DMGA 2AN4A 5CB5A 5CMSA 5D1NA 2BM8A 1JG4A 1X1BA 2ZIGA 4ZY0A 2PXCA 3GJYA 5CD1A 1ORHA 5DXAA 4ZYQA 4RX1A 1UWVA 3TLJA 1N7JA 1RI1A 5JUWA 3ERCA 3DLIA 2JHAA 1WY7A 5E9QA 3EJGA 4LWPA 2B25A 1V39A 2C7QA 4M7RA 5CVVA 3BT7A 1JQ3A 3LL7A 1NW5A 5EZQA 4E2YA 4RTPA 5DT2A 4PGHA 3MTEA 3UJ6A 3R6TA 2AOXA 4PCAA 4K3NA 4OQDA 1MJFA 2B2CA 2P35A 4M38A 5HOQA 4D86A 3GCZA 3EVFA 5FHQA 3Q87B 3G8AA 4POOA 4IKPA 2BFQA 1X19A 3TM4A 4PNEA 1FP1D 2UYOA 5CBMA 1TW3A 2EWBA 2OY0A 2IPXA 1KYWA 3C3PA 3B3JA 4YUYA 5LQJA 3HCEA 4CKEA 4GOLD 5E8RA 4DQ0A 4GOMD 1WS6A 3IHTA 1DCTA 5FSZA 1X1AA 3EWRA 4AZSA 3LGAA 3OU2A 2ZZKA 3KQPA 1YF3A 1JG1A 1ZGJA 1JTFA 1TXZA 5FWAA 5EMLA 3UA4A 4PYJA 4R8RA 4XUEA 3TKAA 5K05A 2OYRA 4X63A 3GIWA 3P9CA 5T67A 9MHTA 4YV2A 3GQOA 1BKYA 4EMSA 5C1IA 3GPQA 2YR0A 5EGSA 5EIWA 4KYBA 3EWQA 4Y2HA 3H2BA 3C6MA 1ZR3A 3EWPA 3DXZA 3B3GA 3UJDA 2ZVJA 3QOXA 3AY0A 1L3CA 5EMMA 5GWXA 4C07A 3HP7A 3THSA 2H1RA 3I58A 5DSXA 3VSEA 3NVKI 1NW8A 4OA5A 2R3SA 3PX3A 4GC5A 2ZLBA 1QAQA 3FTCA 2YXDA 3R3HA 3ETIA 3JWIA 5HOLA 5E1OA 4J4ZA 8MHTA 4QPNA 2ZW9A 3IIFA 1DL5A 1XDUA 2FK7A 2OBFA 4RWZA 5FULA 3FZGA 4FS8A 4PCLA 3C0KA 5FSYA 4ETJA 1KR5A 4R8SA 3TFWA 2FK8A 3M6XA 5K01A 1QANA 3C3YA 2BH2A 3HCFA 1AF7A 3Q7EA 4R05A 5EVJA 2ZZNA 5DXJA 4A6EA 2C7RA 3GQEA 2G70A 2A14A 1YB2A 2CWWA 3AXSA 2PBFA 3I64A 3OZRA 3AWIA 1R74A 3EPPA 3P9NA 4NECA 1SKMA 5BW5A 1VPTA 1M6EX 2UZ4A 4ER0A 2L8RA 5DUSA 4X1OA 5T6BA 2G72A 1EQAA 3GRUA 4BP1A 3HCAA 1O9GA 1FBNA 2QY6A 2PGXA 3R0QA 1SG9A 5E2AA 4BLWA 4KIFA 1RJGA 3BWCA 4E30A 3SM3A 5GIOE 3M70A 5D8NA 3G2PA 5JR3A 4ZX9A 2YXLA 1BHJA 5LR6A 2Z6QA 1X1CA 4MHTA 3FUWA 5FQOA 4ZY1A 3EWOA 5E3BA 3G7UA 3E7PA 3P71T 3A27A 2PLWA 4IQYA 3A7DA 4QVKA 2C7OA 4AZWA 3TMAA 5LQCA 2PX4A 2O0LA 3EMBA 4GVWA 3KQMA 4P7FA 4PINA 1U2ZA 1SVUA 5DRYA 3OZTA 2EJUA 3EGVA 4HRAA 2XD7A 4K0CA 3M6WA 3IIDA 1IXKA 3MCZA 1R18A 3TQSA 2I9KA 1KXZA 2XYQA 2OXTA 1EJ6A 2ZZMA 5GM2A 3UJ9A 3SIJA 4QTTB 2YVLA 2OPBA 3HVKA 2FHPA 3KR9A 4FP9A 3V2BA 5IKMA 3PLAE 4QTUB 1XCJA 2ZWVA 4MWZA 2JG3A 3B89A 1VLMA 3PS9A 1HNNA 3MQ2A 5EHIA 2ZULA 1YD9A 3FYCA 3FPFA 4E32A 3KR4A 3LBYA 4HSGA 1Z3CA 5HIMA 1BPNA 2CMHA 1EG2A 1XTPA 2ZBRA 3HA3A 2LGRA 5ERGB 4QDJA 4E2XA 4TU0A 3LECA 1VP9A 2G1PA 5EPEA 3MTIA 5GP1A 3BGVA 3SSNA 1KPIA 3FUTA 4F85A 3UJ7A 2HTEA 5F2NA 4R7MA 2ESRA 2EFJA 3UJ8A 5DRTA 3TKYA 1QYRA 4X60A 5EQJB 3VC1A 4U7PB 2IFTA 5DX0A 4YMGA 2UYQA 2AN3A 2CMGA 5FA8A 4YMHA 3DULA 1SUSA 1EJ0A 2AOUA 3CVOA 4X2TA 1JSXA 1AV6A 3GNLA 2AOWA 4ER7A 1JG2A 4KWCA 3FYDA 5C0OE 2JHPA 3KR2A 4PYNA 1KP9A 5K0BA 3ER9A 1P1BA 7MHTA 2FPOA 3H8FA 3KZWA 3Q6ZA 2ERCA 3KQVA 5K09A 3LSTA 2AFCA 2BFRA 2OB2A 3RW9A 3ELUA 1L3BA 2IDKA 2Z6UA 2UYHA 1FP2A 4IV0A 2YQZA 4KIGA 4R6XA 2E5WA 4OX9Y 2AOTB 3GWZA 4ZI6A 4ZY2A 2Y1XA 3FPEA 3OU7A 1JG3A 3V8VA 5CCXA 3T7SA 4PYKA 3DMHA 2NYUA 2FG1A 4EK9A 3O31A 1VHUA 5K0NA 3TPZA 4DCGA 4PGGA 3MGGA 2IH2A 4J5SA 3LCUA 4R6TA 3CJQA 3HEMA 3HNRA 3O7WA 1R8XA 4PYOA 4ESSA 3NDJA 1R00A 5EEHA 3OFJA 1RJEA 2JHCA 5EMJA 3BKWA 4H0NA 4C4AA 5BP7A 5LQNA 4JGKA 3BWYA 3DR5A 2UYCA 3E8SA 3B3FA 5CVUA 2P8JA 3LHDA 5D1HA 3E05A 5E1BA 5LSAA 3OU6A 3KQTA 5HILA 1BC5A 5E1MA 5FCDA 1X1DA 5DX8A 5LQUA 3CGGA 4HG2A 2VDUE 5FQNA 3G5LA 4HC4A 5FA5A 5K0CA 3DUWA 4LECA 5GIPE 1T43A 3NMUF 2IH4A 1LAMA 4ER6A 2I6GA 2HMYB 4PYIA 3HCCA 4O29A 1RI3A 5CM2Z 2WK1A 5E8JA 4AZTA 5DM1A 1WZNA 3KQXA 5DTMA 4RVFA 3FUVA 3BUSA 4V0QA 3HCBA 3DH0A 3C6KA 3PFGA 4DF3A 5FSXA 2GA9A 3LDFA 2N47A 4LWOA 5LQKA 2C7PA 4GQBA 2HNKA 3M6UA 4FT2A 3KR5A 3GU3A 3HTXA 4JVVA 3G5TA 3A7EA 4GEKA 3DLCA 4CKCA 1NW6A 5K0FA 4GBED 3H8GA 3KQQA 5F2KA 1VL5A 1ZKDA 2VP3A 5EG5A 2P41A 4E2ZA 1FPQA 5HIJA 4YUXA 5C9ZA 1D2HA 1Y8CA 4HGZA 5DPMA 3GPOA 4YV0A 3B5IA 3MCTA 1I9GA 2AZTA 2GS9A 2PXAA 3I5UA 2DPMA 2PX2A 3RODA 1O9HA 4OA8A 3LDUA 4YUVA 3MHTA 4WVLA 2PJDA 2ZBQA 2FYTA 3THRA 3E23A 5DTQA 4ZX8A 1YZHA 4CTJA 2VRIA 1EIZA 3GXOA 2AVDA 5CVJA 3JRUA 4F84A 3GDHA 3NWBA 1ZR5A 3HA7A 3BWBA 4PYLA 1HMYA 1P1CA 2JJQA 1XJ5A 2R6ZA 3G2MA 4FR0A 3PB3A 4RVHA 4QDKA 3DP7A 3TR6A 5DLYA 1XXLA 3NWEA 3CKKA 4IV8A 3MB5A 5MHTA 3P97A 4M37A 2XVAA 2PXXA 2HR1A 3EGIA 2BM9A 4MTLA 4JXJA 4DKJA 5FWDA 1NJRA 2FXKA 2XBMA 2NXNA 4DA4A 3SIHA 3FTFA 3KPYA 5CVEA 5HZMA 3IJ3A 3L8DA 5CB3A 2ZFUA 3KR0A 3SIGA 1L1EA 4RTJA 3FTDA 3EVAA 4ER5A 2AOUB 5GM1A 5P8WA 3O4FA 5BW4A 1Q0TA 2ZSUA 5EHGA 2O07A 1TW2A 5ICGA 1G8SA 2ORED 3NVMB 5CIYA 3I9FA 5EKUA 3EW5A 2DULA 1VP3A 2AS0A 2CL5A 2O06A 3B7PA 3SVZA 2V7EA 3UWPA 4XUCA 4BLUA 2OB1A 2X47A 4ABKA 4KDRA 1SQGA 3K0BA 2PY6A 5E9WA 5DM2A 3X0DA 5DWQA 1SPVA 1WXWA 4RVGA 3UJCA 1TY8A 3I53A 1JQDA 3KR1A 1KIAA 3M33A 4GC9A 2YXEA 5FADA 1MHTA 4J5RA 5HIHA 3WSTA 3CCFA 3KQOA 2K4MA 5GINE 1JR4A 4YUWA 2FRXA 3LX6A 3VC2A 1LCPA 2KW5A 2QRVA 2YX1A 2WA1A 3ID6C 2GAFA 2XVMA 3CJTA 3HA5A 3IYLW 3OPNA 1KYZA 3Q71A 4RSRA 5FTWA 2AVNA 2BR3A 2WA2A 2I62A 3D2LA 5EMKA 4OBXA 4WXHA 3SSOA 3G8BA 4C08A 3H8EA 4ABLA 4FSDA 4QQKA 3DMFA 3ORHA 5EIFA 4C05A 4RTQA 4RTKA 1DUSA 3SMQA 2ZIFA 3LKZA 3G89A 1XCLA 5H02A 3EEYA 3FUUA 3G2QA 1RJDA 2IGTA 4RYLA 3BZBA 2P3OA 1XVAA 3EVZA 3KQWA 5KYGA 4RTOA 2ONYA 2FAVA 4M36A 1KPHA 1L9KA 4ZTBA 4OBWA 5K0EA 1QZZA 1UFKA 3AJDA 1R6AA 3PEIA 1G55A 5EC8A 1XDSA 2YTZA 3PX2A 2LD4A 3U81A 1JTEA 4BP3A 1F3LA 1JSZA 2H11A 2QM3A 3MAGA 1N2XA 5CVDA 1AQJA 2VZ9A 3UZUA 4PWYA 2PKWA 3GGDA 1WXXA 3LPMA 5F2OA 5ICFA 3AXTA 3NDIA 1OR8A 3REOA 3OE4A 4PYMA 3SGLA 3GRVA 4AZVA 3SXJA 3R9XB 2IH5A 1P39A 3DOUA 4RTSA 4FT4A 3BGIA 4XCXA 1YFLA 2P3LA 3V97A 4HH4A 2PT9A 3GPGA 3T7TA 4R6WA 4AX8A 3G88A 4FZVA 1RI5A 3KPUA 2PSSA 3OZSA 3ANXA 3KQYA 3DXYA 2AR0A 2EX4A 5K0LA 2ACFA 4PIMA 4GVVA 3T8WA 1G8AA 2ZWAA 5DX1A 4YV1A 2HV9A 3EVDA 3CJRA 4K6MA 5ICCA 4GOOD 1ZQ9A 3HVIA 3BKXA 2IBSA 4MIKA 1INLA 1H1DA 2DX6A 4C03A 2Q41A 1I1NA 1NW7A 5EEGA 1RI4A 2JH8A 3JZTA 3OCJA 4P7GA 1PJZA 4CTKA 2OZVA 4YUZA 2H00A 4J5QA 3T7RA 1BLLE 1EAMA 4JLLA 4EKGA 5AILA 1G6Q1 3S68A 5K8VA 3HVJA 5LQAA 1FJXA 1HJZA 3PVCA 3UFBA 2GPYA 3EVCA 5HEKA 5KQRA 4HTFB 1IY9A 3KHKA 2O05A 4MQ4A 4P7KA 3JWHA 3LDGA 4XUDA 4RV9A 3A26A 3FPJA 3EMDA 1JQEA 5EOVA 3TRKA 4E31A 1NBHA 2PWYA 3EEOA 3P9IA 3RIEA 3ME5A 5K0JA 2NXCA 1I4WA 3OFKA 3FRIA 4B17A 5M5BA 4X61A 3NTVA 4EKIA 3PTAA 4ETKA 3QOWA 3CBGA 4EQZA 2OO3A 5FUBA 4KVZA 4X41A 4A6DA 4KSIA 2GH1A 1ZHFA 2P7IA 3KPWA 3P8ZA 5KS2A 2PVCA 3FPHA 1VQ1A 3R24A 1VBFA 3EVGA 3UA3A 2EEEA 1NBIA 4QVGA 4ATNA 1BPMA 1VE3A 1KPGA 2EG5A 3PT9A 1UIRA 1NKVA 10MHA 2B9EA 2G8NA 3VFQA 3P9KA 3HCDA 1M6YA 1PRYA 2ZCJA 2O57A 4ISCA 5E1DA 5K03A 1B42A 1NV8A 2ADMA 4E2WA 2QYOA 1F38A 1IM8A 5BXYA 1P91A 5IH3A 1QAMA 5U4XA 5DTRA 5HIKA 2PX5A 4RTNA 4PIPA 1ZG3A 3P2IA 3EGEA 4QQNA 5HIIA 3IEIA 4GUAA 1G60A 3P2EA 2NXEA 5FSUA 3EVEA 2G71A 2I7CA 2PT6A 2VDWA 2ZBPA 5HFJA 3CC8A 1L3IA 2P3QA 2AOTA 3K6RA 4DM3A 1SQFA 2QE6A 3SR4A 3ER8A 4C06A 2BZGA 2FCAA 2QRVB 3ELWA 3FPGA 1NT2A 1G38A 2PX8A 3KPJA 4CXMA 3M4XA 1YUBA 3F4KA 2B78A 3JWGA 3LKDA 2BR4A 3KQSA 4AUKA 4DZRA 4E70A 3FTEA 2ZTHA 2B3TA 2P40A 4KRGA 3BWMA 1D2GA 4P58A 4RTMA 3HM2A 2PV0A 3GRYA 3UJAA 3IV6A 3DXXA 4LG1A 3UJBA 5ICEA 3GRZA 3G2OA 4F86A 1QAOA 3NW9A 3EJFA 4CWAA 3V45A 3JWJA 2AOVA 3EVBA 3GRRA 5B1SA 2NXJA 4G56A 2IIPA 1ORIA 3BGDA 5LQRA 1NW3A 3KPVA 4Y30A 1LAPA 2Y1WA 2NNWB 4GOND 3KKZA 3LCCA 3BXOA 2BR5A 2IBTA 3NJRA 2ONZA 1R8YA 4KDCA 5DM4A 1RJFA 5KQSA 4GF5A 2GLUA 1RI2A 4FSXA 2NP7A 3A25A 3UBTA 4R76A 3HVHA 4KW7A 3DMGA 4E33A 3PFHA 4OQEA 5E2BA 2HWKA 2IP2A 3SSMA 2Z6AA 3SIIA 2JH9A 2XYRA 5CUQA 2XYVA 3VYWA 1N7IA 5EZSA 4Z2YA 4DCMA 1SUIA 3T0IA 3OE5A 4RTRA 3LCVB 4QPPA 5E9JA 3SX0A 2GB4A 3KQZA 1GYTA 3EKEA 1D2CA 2V74B 4HTFA 1Q0SA 2CKDA 1O54A 4IWNA 2ZIEA 5K0GA 3FUXA 3LBFA 1XDZA 1ZGAA 3QV2A 1WG8A 4FGZA 4L7VA 5T64A 2P7HA 4V0RA 2YUIA 5FHRA 3TM5A 5EKXA 1NE2A 2EJTA 4C04A 3FRHA 4HGYA 4RVDA 4RTLA 2J9AA 5CCBA 3ELDA 1LANA 4P7JA 2AN5A 5G02A 4JCAA 5FSVA 2OKCA 5DM0A 4BLVA 3P2KA 1VIDA 2IDJA 3KU1A 1KHHA 4U7TB 1NV9A 4PYQA 2NP6A 1TPYA 3ELYA 3GO4A 4ER3A 2P1DA 3DTNA 5GOZA 2VDVE 5DSTA 3TOSA 4PONA
chains in the Genus database with same CATH superfamily
4G5RA 3AJRA 4JB8A 4F3KA 3SJ7A 3AVXA 1L4UA 3BG5A 1GO2A 3O1HB 4A1FA 2FUG6 3M6VA 3OC0A 4RH0A 5CFPA 3HJUA 1EFPB 2PR7A 3PCRB 4M6WA 4MJXA 1GRQA 3ABOB 5BWCA 1VSVA 5DGIA 3SZMA 3PXXA 5C51B 1YRBA 2BM8A 4OGWA 4A0HA 5AMXA 4EI2A 1NX6A 1U7WA 5DXAA 3R7SA 1KVUA 3FR8A 1W581 4IP0A 1QYVA 4J4BA 1IN4A 1U2DA 1S2DA 4U5XA 2V1UA 3AMVA 1SKUA 4NE7A 4LHEA 4WLNA 2IU0A 3AM5A 4DNQA 3IXLA 3PPYA 2DPYA 4HQKA 2RBEA 4QJ3A 4OGLA 1BSVA 5DWDA 5DT2A 4DSAA 4N3BA 3BB3A 1A1SA 3PD7A 1DBSA 4AY3A 3NEAA 1CJMA 1W85B 2P0AA 1NOIA 2XUKA 2HSJA 1S4QA 1TI7A 3AGPA 3C7KA 4LK2A 1YONA 1O6ZA 3CINA 4UVGA 3SJUA 5HE8A 2O23A 5E6SA 3TD6A 2A92A 4OXQA 5IARA 2ZJ3A 3ZY2A 4PNEA 1GTRA 2VOEA 3TRHA 2E4YA 1VPWA 1FRQA 1IPEA 3ESCA 4MV4A 1Z68A 3HY6A 3I6BA 4V0NA 4ZJYA 3B3JA 4DG5A 2FP4A 4LOJA 2JRCA 3L93A 1WNTA 1QHGA 5DH9A 2CVPA 1Z07A 3DVQX 4RO0A 3QH4A 2ZWPA 3G7SA 3AZQA 1MFPA 1R9JA 5IC5A 3WNVA 2ENWA 4KLNA 5AI9A 2NAPA 5BY2A 4TKUB 3OU2A 4ZOEA 1NVAA 2GM5A 4XYGA 4Z9YA 4BLSA 1CNMA 1FVOA 1WHTA 3FPSA 1CB5A 3M2TA 1K8QA 5C5CA 2J9YB 1JHXA 4DJEC 3OZVA 3CFYA 3GLFA 4DMFA 2CXRA 2NX2A 2HRCA 3OTOB 2YR0A 3AR3A 2XITA 1H6CA 2E18A 4BVAA 1U9CA 3CLUC 2ZSHA 3OQ1A 1MDBA 3COSA 1X8KA 5M04A 4KR3A 3THSA 1HF3A 2XJ9A 2CLLB 3I58A 3V2HA 2DLCX 3RRNA 3FCSB 1OYVA 5KYNA 4KQEA 1JEAA 1FSSA 3U3XA 2A5FA 2OOSA 3ETGA 3WAJA 3HXTA 4PTLA 3FTCA 4HLDA 3ZHBA 2VJAA 4HJXA 5FDFA 3KAQA 3C5EA 1UPFA 4IAOA 4C7XA 1M5TA 3AF4A 1GV0A 1J6UA 2QYSA 4W4UA 1MRZA 3I4CA 4LC9A 1LLCA 2FMUA 3X1WA 4QNRA 1XAJA 4EX6A 4D9HA 2ZYWX 5DP1A 3O93A 5I7AA 3WIOA 4H35A 4IJMA 1UANA 1NNI1 5DYNA 3BRQA 3C1TA 2IIQA 3T61A 5KKAA 5BW8A 2ZAYA 1Z0DA 2UZ4A 4L0MA 1CUEA 1JQLB 1QQ5A 2ZE7A 3K2BA 5LKRA 4J5QA 3HCAA 1O9GA 1SWVA 1X6VA 3R0QA 4L8YA 1SG9A 3SC2A 3EUAA 1UK6A 3K8YA 4UEWA 4IOLA 1BRMA 5LQDA 2Z6QA 4EB6A 1WR8A 4W9NA 4JEHA 1GQSA 2GZHA 1KI8A 2IXEA 4IKOA 2NM0A 5ER6A 4BGDA 3I5XA 1YQEA 1P19A 2AN9A 3THXA 2JZDA 3KSBC 1KY2A 3RHFA 1IQPA 3ZXUB 4MUMA 2PSDA 2CXUA 3ANLA 4Y2UA 4HUJA 4TT3D 5L40A 2BUBA 1TEZA 1ZIDA 5DJ5A 1I4LD 1I1OA 3MF4A 3MQ4A 1FDOA 3PHCA 2UKDA 1PE0A 1QQ6A 5HBGA 1AK9A 3FN4A 1CDDA 1CVRA 1E94E 2XTMA 4W7HA 2NUTA 3WK8A 2QMYA 1VHDA 1YK8A 2D8AA 5K8IA 4I1SA 1Q92A 3F5VA 4R0VA 4AK9A 2JLBA 4LY9A 3PNBA 4WOKA 1W94A 3RYFA 4C5BA 2GRUA 1TU6A 3L0PA 2QN6A 1KOFA 3PLAE 4HH0A 5JD3A 1YKGA 3O1IC 4G5SA 4QXMA 1VJRA 4FFLA 2WWIA 1JYEA 1FLDA 1L8LA 1CQJB 4M0FA 4RMHA 1JJVA 5ALVA 1K86A 4MRVA 2QT1A 2E37A 4B73A 1HPLA 4KXUA 4J1NA 5AJTA 4OYYA 2GVDC 4QNMA 5BORA 4J1TC 4L2IB 2Y2UA 3BREA 2J6IA 3BHMA 4GX0A 4NH4A 5F2NA 5HM6A 4R7MA 2I99A 1VIVA 3E3AA 3P96A 1KEEB 1RJ9A 4HEQA 3A3NA 4PZPA 1RWOA 3NWPA 2OCDA 3TOCA 3VC1A 3ZLTA 2PUGA 5JRZA 1PJ2A 3SDBA 4LQDA 1AV6A 3BD7A 1LJ8A 1KFEB 2X4IA 3ED1A 4KWCA 2WAXA 2RH4A 3I8XA 8AT1A 3CQ9A 1NF9A 4S1VA 1P1BA 2PQ6A 3ER9A 2WCTA 4BNFA 1PQWA 1WKBA 3W4JA 4H6VA 3KSAC 4ND6A 4IV0A 1KS2A 2J9FA 1VBKA 2VYVA 2XPCA 4M0KA 4WOCA 1OTXA 1QH8A 2IPNA 3AI2A 4QU5A 4L50A 3B78A 3F8SA 3NTLA 3P9SA 4UHFA 1M2EA 2ZPTX 4IJ5A 4FBGA 4PGGA 4KITB 4H17A 5BW4A 1SQ6A 4DV1B 3HZOA 3FYUC 2ZJ2A 4HMPA 1C0PA 1B2LA 3D4NA 4HDNB 4ESSA 3PW3A 1TAHA 1RJEA 4J0HA 3T54A 3DWGA 4Z53A 4OKIA 1YVRA 2Q2VA 3LUCA 4RJLA 1PLLA 2WB2A 5PGMA 3H1BA 2UXDB 5HXAA 3S2UA 5J23A 4LZOA 4OQLA 2BM1A 4B7XA 4BMCA 1I7LA 3SBEA 1U1EA 2PPLA 1EF7A 1KBZA 2HQRA 2CHEA 3L0DA 4LV5B 1VKJA 4AMGA 1JKXA 3NV7A 5LLDA 1CCWA 1DWPA 1VMEA 2D5AA 2LUOA 2OE2A 3EF3A 2FPKA 4JUAA 4AN4A 1GEGA 2X2EA 1NQCA 5CFRA 2NSLA 3DUWA 3OBIA 1CZRA 1SU7A 3USCS 1T2VA 1BCRA 4IIUA 3QOYA 3J80A 1XLUA 1G8GA 2R1ZA 4D74A 2QD2A 4H6XA 4W1RA 3RVJA 4FWBA 1G8KA 3CRRA 4JVSB 4MAMA 2WUEA 2IBIA 1C3OA 3DFFA 3CLSC 2G5TA 3DE3X 3T7IA 5B58C 2ZKLA 4XDHA 4YJFB 1E63A 3F98A 3C3WA 1RXUA 2WTNA 9LDBA 1YBVA 4CF3A 4I36A 2FW7A 2F48A 2GN2A 4ZZ3A 1U3GA 1GP2A 2AG6A 1B6RA 3WGZA 2FSHA 3H6KA 3I37X 3OKPA 5HIJA 4JNKA 4YUXA 3GC6A 1D2HA 3LPAA 1LI7A 2QTVA 4S1TA 4UDNA 2PXAA 1Y4HA 1O4WA 3HU5A 4FZ3A 1Z7YA 2PFSA 1C7IA 4OGFA 1E9FA 4QT0A 1SAYA 4CL8A 4MYTA 2UZ0A 2VNKA 4MUGA 5LB2A 5IYZA 1YQWA 2VCEA 3EWNA 4ZX8A 2W5UA 1DC5A 3DKVA 4XD7D 2GFQA 5AHKA 5AVWA 4BU1A 3KZVA 1F51E 4BXOB 2DBVO 4C7BA 3DL0A 3E7FA 3LH5A 1U1CA 1RC1A 3KKLA 3K70B 3Q8KA 1RTKA 2CNOA 2H16A 4RVHA 5F78A 5FWXA 2VF8A 2XY4A 2ECOA 3PC7A 5JH7B 2JCBA 3DJYA 1RDFA 4QYMA 4ENRA 2X1LA 3VAAA 1UXGA 1VJ5A 4LWZA 4PX9A 2AB0A 4CCYB 1P1IA 2YL2A 1VLQA 3CVXA 1LC3A 4HDQB 4OXKA 5REQA 4BGEA 4D96A 3WGNA 1N77A 3D9QX 3R41A 1WB9A 3FGOA 4D9EA 4ENPA 2ILTA 1Z35A 4RTJA 1MHWA 4GLFA 2IRWA 4EQ6A 3W9UA 2R4QA 2QZPA 1QGZA 3UAZA 4F7WA 1VL1A 3N2NA 2GVNA 2HJVA 4DDWA 3UWPA 1TVMA 5TDHA 4LF6B 1BGVA 4YP1A 3GG9A 2AW3A 4RJIA 3DTVA 4G01B 4RKWA 4J2OA 5J4VA 2V0CA 3CX6A 3K9QO 2X3UA 2BFAA 4KZPA 2WAMA 1ATIA 1KIAA 1Q12A 1B2RA 2O0HA 3ZZUA 2JPDA 5ALJA 1N36B 1J90A 4FYPA 1Z5PA 3CG4A 4JKIA 3U5ZB 1OGYA 3IELA 3F2VA 3VR6D 3RIXA 1QDUA 3OPNA 3I2HA 2HQSA 5IAKA 1G21B 1OC4A 5LOVA 2MU1A 4DVGA 4BNLA 1FC0A 2AVNA 1W88B 2BR3A 2XB8A 3AV0B 5A1JA 3PVSA 3PL5A 4MA4A 3G8BA 3UBMA 1GUAA 4F12A 4QJ4A 5EIFA 1YC5A 2I6QA 1CR4A 4OQPA 2VVTA 2FUEA 4CEIB 5FBKA 2CMFA 3OEHD 2QXYA 1KS9A 4AZ0A 5BUSA 1CZHA 2Y27A 1ZN7A 5E0KB 5J2TA 2FRAA 4HDMA 2HU7A 1Y1RA 3G0GA 4GNRA 1UPXA 1Y80A 5FPHA 4IW3B 1T5TA 2LD4A 5CYFA 2JI9A 4JJIA 3OMWA 4MQFB 4LDZA 4YR9A 3EY9A 1V8OA 5KINB 2P9QA 3ROQA 2R6CA 3OC6A 3OE4A 4WXRA 3RQSA 2YJ8A 2QN1A 4AO7A 2J3EA 2IH5A 3NEJA 3H1AA 2PUJA 3JVVA 1V16B 3D59A 4NY1A 1H4VB 1WCWA 1AO3A 4UE2A 4ERNA 5JCOC 3HSKA 4EMUA 1KHTA 3GPGA 3OTIA 4YV8A 3WGTA 3QBEA 2DH6A 3BCSA 1ODJA 2CJYA 4L3OA 3BB4A 5AUQA 3GLKA 4IHJF 4D4JA 5L4NA 4Q4JB 3TO5A 2ACWA 3R3UA 2HPVA 2X8JB 4ETWA 1BJTA 4JDUA 5AJZA 2PKQO 3ABQB 4HLUA 1U6IA 4PBRA 1ESZA 1ZQ9A 3Q3HA 4K6GA 2PA0A 4I9GA 4WN3A 1RYFA 3VO2A 1GCGA 4B32A 1C1HA 3U4MA 1YBFA 1Z6AA 2V9CA 1EVZA 1TO6A 3CUKA 2H2HA 5IDXA 1HDGO 5DLEA 3GYGA 4CTKA 4NYIR 5KYTA 4JT2A 1KJWA 1ZR2A 4GOJA 1Y33E 3E9YA 3W5VA 2Q5FA 3KLPX 3EVTA 1T8RA 4KDEA 1G20B 4TT8A 1JQBA 5G0UA 1G1MA 1XZDA 2X9NA 3DZHA 1IZ0A 4C6RA 5JNSA 1JALA 1G3IA 4DLAA 1YTLA 4XR7A 4BBPA 3A26A 1W25A 4Q4DA 2C9MA 3FKQA 4JWKA 1T4GA 2C3OA 4H16A 1TLFA 4H7DA 1RABA 1M8KA 1HTBA 4LHZA 1N9GB 2H18A 2OO3A 1W35A 2RJ3A 1IONA 1V37A 2Z8YA 1EFVA 2GEFA 4K9QA 3HBMA 4A6DA 3KKOA 1L5NA 2HYDA 4DRXB 2PVCA 1AC5A 3HXLA 5AM3A 1DU4A 1F60A 1RP1A 4QVGA 3ETCA 1SQ0A 3SG0A 1MC1A 1MZVA 4R81A 1JA0A 1WB6A 1GD1O 2EG5A 2Q4BA 2YWXA 4F9FA 4R1UA 1BNCA 3MC1A 1U2SA 3ONEA 2N42A 3M1YA 4P0TA 2BF7A 1KVQA 1KXRA 5FWXB 1E9VA 2FUG1 1Y3BE 2Z5VA 2I4LA 2C8LA 4H60A 4Z4QA 4P0QB 1NV8A 1ZCBA 1C1YA 2X19A 1THEA 4F4FA 1QAMA 2VJKA 4V03A 3GHYA 3V7UA 5D6NA 4QQNA 1SVNA 3IJRA 2OHGA 4M1ZA 2WG1A 1HG0A 1UKBA 4P4TA 4QASA 3I12A 4EMTA 3SR3A 1RXEA 1O87A 5K0ZA 1X8JA 1WM1A 3NYIA 4IDGA 3NC1C 1V6CA 2RGBA 1N4AA 2EZ4A 3I2GA 1YDMA 4F2GA 2QMEA 2ZT6A 1E8MA 3AETB 5GGXA 4ABYA 1P4RA 2R5FA 4MVXA 2ZQZA 3NS7A 4CEHB 2PX8A 3VZDA 2I2FA 4Q3DA 3FYUA 4QULA 1HWYA 1IM2A 3A6FA 1QGDA 2QU8A 2J7KA 4X24A 4YJ2F 3RNOA 4KR6A 4TZ0A 3KQSA 4AM8A 1RPNA 4NXNB 1IBMB 1P8AA 4JSTA 4X20B 4PXYA 5IKPA 4ZQFA 1Z5OA 4LG1A 3MCVA 3I5MA 3RNVA 5EWMB 5CDGA 2YHIB 2DHEA 2HMUA 1F2AA 3EVBA 5LP6B 4CKWB 5B1SA 2PBLA 1NP3A 4TTPA 1KY5A 1YIAA 3HBNA 3KWMA 2C5BA 2J0EA 3BXZA 5I9BA 5THKA 1N2CB 2NNWB 2HCFA 2B5OA 4YCNA 4LVCA 2JGDA 1HZZC 1TTQB 3DZ8A 3OWHA 2IV3A 1EX6A 3QYJA 3KCNA 4NEGA 3IE0A 1M34B 3DS8A 4JKOA 5DBEX 5I7UA 1IC6A 1WUYA 4G36A 5E4JA 4JGGA 4H9GA 5CEEA 1UC4B 4P31A 3D2CA 2IP2A 4EHAA 2OO5A 2XLBA 2XYVA 1ZPDA 4LOIA 1YZYA 1X13A 5DN6A 5HF9A 5BYBA 3REQB 5MGBA 4RAQA 4YAOA 4K87A 3H1PA 4EYEA 1OH8A 4MLZA 4LRWA 1X7ZB 3B2EA 1KIFA 2YINC 3SX0A 3TGWA 1E2HA 4EZEA 7YASA 1KOGA 3K92A 2WF7A 4A3SA 1Z8FA 4HZUB 2I2DA 1PWHA 3RBAA 2O2HA 1VG0B 1K7XB 2ZE8A 3VR3A 5IW8A 4D9CA 4CLDA 5C1DA 721PA 3WDSA 2BGGA 1HNWB 3OCVA 1SG6A 1DKLA 4G9GA 2XUFA 3NJ8A 4R31A 5DU2A 3ZHCA 3DKIA 2PLAA 1M2OA 3IS3A 4NIMA 3RO7A 4F21A 1PIWA 1OZAA 1NQWA 1X8LA 2PL5A 4HNVA 4M0EA 1ULZA 3H2HA 3O2QB 4OLHA 3S2FA 3SNHA 1ULSA 3OY7A 4LN1A 1QQBA 2JARA 1DKIA 1S3IA 1ZD4A 2QM7A 4KKXB 3DTVD 4JGBA 3NTXA 3DW3X 3FMFA 4R3NA 4BCDA 4GLJA 4WKCA 1Z7GA 1L4NA 1NDUA 4MX8A 4QRGA 1EQ2A 3R7FA 3VNUA 2JDID 4LNUB 4I19A 1JPNA 3VOTA 5CMSA 3LCMA 2YZNA 4MB2A 1X1BA 1OH5A 1S02A 3F6PA 3JQAD 3PR3A 3AVQA 2YUTA 3TLJA 5JI3E 1E6CA 2JA2A 5JWRA 3A9TA 4J75A 3B1JA 1ZEJA 4MEAA 5E9QA 2OQVA 4YAIA 3CPJB 5CFQA 1KQGA 4KSYA 2C7QA 2IZ0A 3HUFA 2ONKA 4NYMQ 2O3JA 2BDTA 5CVVA 5FNVA 2WE8A 3EG9B 1CP3A 1L5GB 3GQBB 4M4SA 1FH0A 2VF7A 1ECCA 2V54A 4FOTA 1ORTA 3DQQA 3NKLA 3RFXA 3RSOA 3F8TA 5IAGA 2C99A 4GMFA 5D86A 1PTJA 3PD0A 4ZO6A 2VYQA 4TLDA 3RC3A 5EJEA 5ALLA 2QVLA 5FUMA 1NN0A 4F3NA 5GJWC 2RKOA 1QKIA 3A4NA 3C8ZA 3I9V1 1KYWA 4RMGA 1HDCA 1ADJA 3W4IA 3C39A 1BYIA 2XU5A 5CITA 1Q91A 5DF1A 1QHHA 4DSNA 6GPBA 2A5YB 2PRSA 1RZVA 4GDFA 3QITA 1LGYA 3PC6A 2E00A 1A6RA 5DASA 1I0LA 2F3TA 3KQPA 2H9AA 3E7DA 3OTHA 3RIGA 5IZ4A 3VBCA 1CLEA 5FWAA 1SOMA 2ZKIA 3RI3A 3ZYZA 1I3LA 1MW9X 1ZMBA 3NBZC 4CMAA 1XCBA 2JIOA 3DBRB 1JDPA 4UARA 3ULKA 2Y9MB 5B30A 4BBZA 5JD6A 5IKXA 1FVXA 2Y6UA 2C2HA 1PGQA 2GJ9A 3RFTA 3VKUA 2F55A 1EH5A 2X8WA 3JATB 5KBYA 2XQJA 3QVUA 3V7YA 2IXDA 4HP8A 4ZICA 4K9OA 3QOXA 4QVIA 4CG0A 1GY8A 4N6OA 4G0UA 4WHMA 1FW6A 3LFYA 5TMEA 3FSJX 3A1NA 5U1PA 3SYRA 3X2SA 1VG8A 3WGVA 2GO7A 1AECA 1AU3A 2HRZA 1C8BA 1ZEMA 4PLPA 4TWJA 3LTNC 1Z2OX 1H9BA 3QNMA 2Q62A 3IMKA 4NPHA 1U4OA 1ONOA 2BRUC 1EFCA 2MSLA 2XOEA 4XIFA 2CHQA 4GS5A 4DM7A 2W58A 3IV7A 5FRDA 2EERA 2AW5A 4OXRA 3K0SA 3SYTA 1PFGA 1ZOLA 1EDEA 2FPPB 1KP3A 4CCAA 2PTGA 4HAVA 4LMPA 4NOKA 1FU7A 4PPQA 3L7AA 5TE9A 2G70A 4GPZA 4PO8A 4TXNA 2RGEA 3D3EA 2GSDA 3IP7A 4KAAA 3I42A 4JBWA 3U3KA 1X1RA 2EEPA 5KIAA 1CD5A 5DUSA 1M1ZA 2JJ1A 1KSGA 3WLHA 1X1EA 2VTVA 4NCNA 2AEFA 2RHMA 3H1FA 4G85A 4ZVRA 2PIDA 1Q83A 2QLJA 2QX7A 3VDQA 1U4SA 1KQPA 4I2NA 4MYRA 4CIWA 2X47A 3A05A 1VE7A 3BCHA 4MPPA 1ME3A 3W9YA 2PH7A 1G64A 4JKYA 2YY5A 1XD9A 3HJHA 4RHXA 1NLFA 5G1NA 3K70C 1RPZA 4YYVA 1G4AE 1JECA 1RBMA 2RGNA 4AAYA 2X2PA 5FLEX 4EA7A 4PQFA 4GVWA 4AP5A 2Y92A 5HGXA 4G81A 1L5OA 2OBMA 1NUUA 2VA8A 4NS1A 3IFSA 3ZWMA 4DABA 3GLIA 2DWOA 4HRAA 3HBAA 2SHKA 3WRYC 1SKBA 3UHPA 4LJ8A 2AMFA 2GBIA 1IDN1 1G4UR 1N8NA 1OAAA 2ZYTX 2P75A 3C85A 3HEAA 5EXTA 2V0GA 2YOHA 3ROTA 5GM2A 4D80A 1F5SA 3OHMA 3QF4A 2NQ2C 3HDJA 3WIEA 1F4LA 2PMWB 1YDHA 3BQ9A 2W71A 4KJZA 1H66A 4RGYA 2O59A 5K8TA 2QAGA 3ANSA 3RPEA 4GVPA 5EHIA 1WL8A 3V2GA 3UATA 3ROZA 3ZE2B 4Z3OA 4QGFA 4QM6A 4AJOA 2WJZB 3LL4A 3MLEA 5LZ9A 3ET5A 2CMHA 5FNVB 1EG2A 1BFDA 3BIOA 4TMWA 1KNXA 1IY2A 1JILA 2IBMA 1KPIA 3L4JA 3Q40A 4LY0A 3SJAA 4BCCA 4RA6A 4QYXA 5IDVA 3M3PA 3UT6A 4YT8A 3H99A 2IUSA 1FMFA 4BB9A 1JTVA 4UCQA 4DJAA 4N0PA 2K2QB 1UBUS 1JL3A 3C1AA 4MGIR 4RORA 4MO9A 5BQPA 1H5NA 5REQB 2PANA 5CR9A 3ZHXA 3ZBQA 2WM2A 3N7TA 2OVFA 1X14A 2W7TA 4BV3A 3CRW1 3R77A 2Z4RA 3KQVA 4L8LA 1Z83A 2JAOA 4RZXA 5KNBA 4JLPA 3RW9A 1QV6A 1X3SA 2ZJ7A 5TS3A 5K99A 2WTUA 2MSEB 3IPXA 4BE7B 4HVLA 1TF7A 1L1QA 2DX7A 1G0NA 5IUNC 2AOTB 3OTGA 5JHHB 1RM4A 1SU8A 2DFLA 5I51A 2BBOA 1Z0UA 1RYDA 4GXRA 5FUXA 4D97A 4YRZA 4LE0A 1EXMA 2UYGA 3A70A 3U7FB 3N3KA 4W63A 5SZIA 4CCYA 3S1SA 1AS0A 1QCDA 4H4EA 2GDZA 2O6HA 2WKRA 2FWAA 3DPIA 4AN1A 1W4LA 4LTNA 1OBHA 3SZGA 2VRCD 5K7SA 4J76A 4REQA 2UZJA 3T9DA 3RE1A 4BE9A 2NT4A 4OUDA 3LO5A 3UTCA 3VVBA 2C9YA 3DZDA 1QDEA 1W5SA 2B99A 5E1BA 1BN7A 4DLSA 6PFKA 4AKTA 3JQGA 4KO3S 4RKEA 4AC9A 2ZUUA 3C3XA 4YJHA 5HILA 5A6VA 3TZCA 1XTKA 4DHWA 5L7TA 3KV1A 1KH3A 5DEIA 2XIJA 4Q1CA 3VKFA 3ZS9A 2QBYB 3RVVA 5AXBA 1ZBDA 4LI0A 1A9YA 5BV1A 3RAPR 5JV5A 3VAZA 1X7HA 2J5KA 1PPOA 4E1AA 5JSZB 1GXSB 4NH0A 4EG1A 1WZNA 2A4KA 4F96A 4M1YA 2OQIA 3WL4A 1A7KA 1OROA 1YOBA 4REOA 1HDRA 4Q9NA 3SQXA 4KMMA 3DF0A 2X8AA 4D5EA 4LXYA 2F3UA 1UP6A 4BB0A 4I4IA 4F8EA 2E6KA 1DMSA 2WDZA 3OZUA 4DS3A 2F7DA 2OC9A 1XMQB 3GT3A 3HV2A 3MJVA 1MN6A 3ICEA 4IIVA 3BL8A 4G4SP 5ALQA 4P3XA 2P41A 1DC6A 5LP6F 3DDOA 1POXA 1J2JA 4W9RA 4GL4A 3G2LA 4HGZA 4MVJM 4PAGA 5KMGB 1JYFA 2C8JA 4F3TA 3GJ4A 3GPOA 1CKEA 1G8HA 1SXGA 3MCTA 2RD2A 1AGXA 1RKVA 3FFAA 4H4CA 1O9HA 2OHOA 1ZICA 1KMMA 5AW5A 3VDMA 1WEKA 1TUEA 1J9EA 4TL6A 3FG9A 2QPLA 3R6DA 3D0RA 4BKOA 2P1ZA 2M98A 3BMCB 1YQXA 3E9RA 4ITUA 4MS4B 2OORC 1MCZA 4UM8B 3OQCA 2VEOA 4X5OA 3JYNA 1TM7E 4FR0A 4JC8A 1KVTA 4PHFA 1B0UA 3OLXA 3OM8A 5HCIA 2KS6A 4BNWA 5I7RA 2ZUEA 4Y0NA 2Z9DA 3Q85A 4JR1A 5LD2B 5MHTA 1AO0A 1TMGE 4ZEWA 1Y98A 5IZCC 2FSPA 3EYAA 1M34A 4L85A 4M46A 4W5RA 2BEVA 1KMHA 2ZSBA 2OEPA 4QJIA 3VPFA 4TWZA 1EWRA 4YCMA 2BELA 1X7WA 4ZAXA 3UJHA 1LK0A 4IMJB 4CLOA 3IR5A 4FEAA 2WDPA 3EXG2 4MCIA 4OU4A 3U39A 1VKHA 4IGAA 2BH9A 1Q22A 3L4SO 2AYNA 4BLUA 3I39X 2OFOA 2C29D 2YC4C 4JVLA 5DHRA 3KDAA 3X0DA 2E4UA 3Q10A 4XX0A 5BR8B 1WETA 4ND1A 4RVSA 5MN4A 1SNKA 1ZOIA 2QJFA 3JV7A 4OQFA 3ZUPA 1E5QA 1RLMA 3EZLA 4XUGB 2Z84A 4ZOLF 1KO4A 1RJ9B 4ZCTA 4G4JA 3KELA 4D0NA 5GM1A 3DBLA 2ZRFA 4RHFA 4BLOA 4MIYA 1ZX1A 4FZJA 2FP3A 4JV5B 1EFTA 2I66A 4LDPA 2BLNA 2EBFX 2O2CA 3I01M 4JR0A 5C8XA 2ALJA 4M3NA 3MB8A 4DA9A 2HNAA 4KQCA 4D8TA 4KJXA 4BO8A 4KUHA 4LNAA 2JJ1D 3KYDB 2CUKA 2WMOB 4RYLA 2VK4A 2V6JA 3AB3A 3BK7A 3KQWA 1OC2A 4MJ7A 3VZQA 4GFDA 1KWGA 3B70A 3T9FA 1Y9AA 4M9XA 1JQKA 1VFPA 3OF5A 1QJ4A 4ZTBA 1EI9A 5ER9A 1R6AA 4WW0A 5A06A 4ARIA 1MVOA 3QW2A 5F21A 5JZEA 3GDOA 5DMXA 1L7AA 2PBZA 2JATA 2QAGB 4MGZR 5CXXA 5MN6A 1OH6A 1UBGA 3O84A 4DKXA 1A7UA 2Z2JA 2ZGVA 3LPMA 2GD6A 4MB6A 3Q1LA 4P83A 4F72A 1QWSA 2FDRA 3ZDRA 2PS0A 3UN1A 4FHFA 1O4VA 3FHTA 1X3LA 2DUNA 1TQ4A 3LKVA 1E6EA 2IXAA 3VHXA 1ORWA 4BB5A 2JFZA 3E1KA 1XALA 4O0MA 1SBZA 2Z98A 3UUEA 2I91A 1FEZA 1IXSB 4C29A 2OZ2A 1JDBC 3AFOA 2EQ5A 3I9NA 4EB3A 1CZLA 5CAEB 4M0MA 4Y6GB 4CLRB 3AHIA 3ZVRA 4Z49A 3U7RA 3M81A 3NBAA 2VHQA 4JJGA 5LYJF 1M1XB 2IHTA 3H6GA 4WURA 1OOEA 3CN7A 1QB7A 3UGKA 2DU8A 3TLGB 1C4XA 2AXEA 3WLAA 3NANA 4K7JA 1GAJA 3QRWA 5MFZA 4HHEA 4EG7A 5DXFA 4X3PA 5JAIA 4P81A 2V9PA 1T9BA 4DR7B 3QG1A 2A30A 1Z8NA 2KLBA 4ZZ2A 3L7NA 3UB2A 4NI5A 4BVKA 1TA9A 1Z3IX 4BXOA 4JLLA 1I7PA 1BMFD 2IPLA 4DXDA 1FJXA 1Q0ZA 3DV2A 3VGJA 2OO7A 1G21A 2POCA 4OMDA 4M22A 4KNVA 3JYPA 4C5CA 2HFKA 4EGJA 1VLHA 4ES6A 5FPWA 2ECKA 1DKOA 3JD0A 2P0RA 1TT7A 4RHUA 4EW6A 4NOLA 4UFOA 1NBHA 4AT1A 3BJRA 3OTWA 3R09A 2GHTA 4OX9B 5GZ1A 1OWMA 3JALA 3FTPA 3EJ6A 3EXG1 3BA6A 1IOLA 1GZ4A 3RBXA 3DYVA 1TVCA 5JA7A 1ECPA 1COZA 1M0WA 1YZUA 2XMGA 4CCWA 3CNBA 3C1UA 3R24A 5LZ4A 3U7HB 1OFUA 1SCIA 3DP9A 3OEWA 2QD5A 1UBEA 1YS1X 4TUYF 3H3XA 3NAGA 4OQNA 4C14A 4DYDA 1E32A 4LX0A 4NAVA 4YAJA 1A8IA 5AIAA 4UAGA 4ADSG 3MWYW 3V8BA 2BFOA 3CXRA 3CEHA 4HAZA 4N5IX 2G9NA 5ALZA 3LLCA 1W85A 2RSLA 3IIJA 4V1CA 3QVTA 4PPFA 3ZXIA 4B6GA 2QYOA 1CK4A 1IM8A 1IRIA 3FCOA 4IIEA 3UGJA 1P91A 2B1IA 1CB7A 4WDRA 4YYEA 4DJ5X 1X0VA 5EPUA 2NYAA 4XR9A 1O0EA 2AIMA 5HIIA 4RY0A 4E21A 4BQOA 1XMIA 1UFRA 4Q3AA 4F9GA 1FX0B 2ZM6B 1FK8A 1KY4A 2G71A 2JFXA 3DEKA 1PJQA 3C14C 3E3NA 4AJHA 2XDWA 1S2LA 2XCLA 2IS1A 2P2GA 1XROA 2VDWB 2JFOA 2YZ7A 4G5HA 4BEWA 1FQWA 4FE7A 2OA0A 3ROGA 3HJBA 2FMHA 3VO1A 1M76A 1QRSA 1OXUA 1MOSA 5JJKA 3L2OB 4DAEA 1OZGA 2IXBA 3KPJA 6LDHA 2WFLB 1YULA 2QTVB 4IO0A 4MRSA 3E3OA 3NBMA 5DHSA 1RYEA 1DKNA 4G1CA 1ILEA 5AFSA 4UXHA 3SEAA 2B4QA 1ZGBA 2XZDA 3R9WA 4CZWA 1DP4A 2RHWA 3AJ9A 4EFKA 1PJ8A 4FNGA 5CW2A 3AL2A 4UTZA 3DXXA 1QZTA 2YHUA 1CVZA 1OVMA 1VXOA 3H0CA 5FOXA 3SLKA 3GRRA 3JYHA 3FETA 3M0EA 2EKZA 4O4IF 5IVHA 3UT0A 2H1LA 1HRDA 4X1KA 1M54A 4J4TA 1LAPA 4IXWA 3FMOB 1NVXQ 5A4MS 5EJ8A 3IEMA 3RK4A 16PKA 2NO6A 3NJRA 5J58A 2W48A 5CH5A 2Q27A 3CRMA 4B3IA 2XHZA 2XCRB 1YQDA 4HWKA 2XEDA 4DIUA 1GDHA 1YI0A 3DQPA 1TL7C 2BSXA 5KYYA 3L79A 2VCYA 1PR6A 4BOYA 5DBGA 1YR1A 3F3YA 2WFZA 4ZGGA 1N2JA 5L51A 3K9CA 3A6KA 1A5ZA 4R54A 4Z9FA 4HV4A 3DT9A 2V74B 4KQFA 1YAHA 4LA4A 2INGX 4LZNA 4L7VA 3U4IA 2I4MA 4L22A 4JLMA 4AUMA 4ZYXA 5L3VA 4J94A 2BGIA 5SICE 4TX1A 4X7PA 2QOEA 4LYGA 3FM9A 4AF6A 1S96A 2WYIA 2NPFA 1RIIA 1ZOOA 2Q3DA 3H11B 5F77A 2PYZA 1YQUA 3RYIA 4BC0A 1WQ1R 4E1BA 1UXHA 2BFBA 4IHJA 4BEVA 3ACDA 2GCOA 3JYLA 1D5CA 1R6VA 3B1VA 4ND4A 4R1PA 4JQOA 5D00A 5EL0A 5AXDA 4DLZA 2FV8A 2HO4A 2Z1NA 4NYJQ 5JDCC 2GPJA 3GAMA 1GOTA 1I3KA 1T4DA 5KHAA 2IY8A 2HCBA 2QMUA 4Y8VA 3W8NA 1XO1A 4QC2A 3AO0B 3PNSA 3SBDA 3BL5A 4OHBA 4RK4A 5LIRA 3G6KA 2IU6A 4LW8A 1E5LA 3EDOA 5CLQA 4BX8A 4F45A 4CIYA 1N7JA 2QTTA 5TIIA 1HV8A 4D3ZA 5H16A 3CKYA 2WJ6A 3DDSA 1SRRA 3O4IA 4CDCB 1W6RA 3BX1A 2RHCA 2VQSA 3Q5DA 1O0CA 3IQDB 3GZ4A 5J2TF 2IX3A 2I3AA 3JVIA 2FJ0A 3Q5EA 4MPRA 1G8PA 2NGRA 4B35A 2G77B 1TAQA 3TAXA 1KYYA 1PDVA 3MWEA 4XYBA 2O2XA 2FX2A 2G7YA 3NOXA 2R9MA 4ZDIA 1CY7A 3HBLA 4P34A 1DG3A 4IF6A 1CE8A 2OY0A 2C9OA 3OOJA 4N65A 4U7JA 4YLEA 1XL0A 4JVNA 3ZV7A 3H5RA 1WPGA 3AKEA 2Q1YA 3LMKA 4L0QA 3WXEA 2OCPA 3A14A 3B1WA 2PVPA 1HE5A 1QH8B 4I8XA 2ONCA 4Q34A 2WUDA 4WRRA 3E2IA 4Y2QA 4AZ3B 4RMNA 4KYTA 2R1VA 4W8GA 3O0TA 3ILYA 4YASA 1EA5A 4U9UA 1OX6A 1ZISA 2ZVPX 4RZSA 1JHMA 1T8UA 4D41A 4ZAZA 1U28C 1XRQA 2PM8A 3HUDA 5JAQA 1TKAA 3ETHA 3Q6NA 1N57A 1Q3KA 1QYWA 4J2TA 3BMXA 4UNIA 2YOGA 3I28A 5CXSA 2B1RA 5GWXA 3K20A 3HP7A 3R5XA 5ECYA 4YWJA 3QBVA 4E5NA 2R85A 2C58A 2FMXA 1ZUNB 2A3NA 2PZEA 4FJ1A 3V4FA 4XFJA 4Z4IA 5H80A 1XJCA 3TR5A 2VDKB 1NQOA 2FN9A 2YXDA 1HGXA 1EXWA 1B43A 4NFHA 3G8YA 5TPZA 4IQ0A 2EEZA 5E1OA 4EMBA 2I1LA 1W4ZA 1WP9A 2D74A 2HBZA 4AN0A 5A6SB 4ZT6A 2D2EA 3DR3A 1I4TD 2UVDA 1LF5A 3TFWA 4Z51A 2IOFA 5IAAA 4ZT3A 1R4NB 3C3YA 3MTNA 1P0MA 3DBHA 2AHRA 4NSNA 3CIOA 3L8MA 1ZO8A 2BTEA 3M1LA 3V5NA 2GUGA 1FXSA 3ICVA 4LTDA 3N3AC 4F4HA 5EQTA 3F90A 2OECA 2RGXA 3INNA 3W30A 4X1OA 2NSJA 2D1SA 4UUAA 1CJBA 4Y6LA 3OP1A 4CM5A 3LGSA 1S3FA 3LC0A 1IHDA 3EDRA 4IS3A 4BV2A 2F1HA 3DPSA 4EW3A 3WKAA 5DNUA 3UOWA 2Q0XA 2XUHA 1ZMXA 1CDZA 2YMPA 3HCNA 2WHPB 4GP9A 3STWA 5L6MB 1RAAA 4KQKA 3V4RA 3U48A 3VH2A 3HHPA 4Z8YA 4IQYA 3MUNA 2H2DA 1KAMA 2ABWA 2AQHA 4KQGA 4ZOQI 2X1VA 3DE2X 1JB1A 3EMBA 3TMAA 4CU2A 4DV4B 1JAYA 3PRMA 3IBFA 1FCJA 4IDOA 1NF8A 3C3JA 1EFUA 1PUXA 4NLLA 5YASA 3F6RA 3HCPA 2R5NA 2AIRA 1U8UA 2FEAA 2WSBA 5J3JA 4XWKA 3D31A 4OQXA 3ORFA 2MYTA 4YP5A 3TIFA 3WNCA 2HF7A 1MBZA 2P27A 1B3RA 2X42A 1CZOA 1EJ6A 1QFXA 1ZKMA 1DB3A 2ZIZA 4MI6A 3OICA 3OPYI 5EA2A 3DAOA 2CXPA 4XI9A 5TQ2B 3DZFA 2UU9B 2ZWVA 2VTEA 2OFWA 2JKYA 2JG3A 4MH0R 4CM4B 4MI3A 3MQ2A 3LC2O 1BMTA 2C4WA 1S8OA 3FBWA 2GHQA 3X1YA 1U5IA 1P31A 1X7DA 4ZD6A 3CBJA 3O2SB 1X80B 3PC8C 5I6DA 3P19A 4XPIB 4C0WA 3EH1A 3HSYA 4Z2AA 2LGRA 1YK1A 4F4UA 5ERGB 1U9XA 1XL1A 1A71A 2RJNA 1N5JA 1ONBA 1QG4A 1V9CA 3OE7D 4WBNF 3KWLA 4CW7A 5I4BA 3W6PA 1F7UA 3S2SA 1CJUC 4X60A 2XAAA 4BFZA 2PZ8A 4G0OA 1FZQA 1GU0A 2RK3A 2Z30A 4NP6A 3QU7A 4NABA 3WKBA 3CVOA 1BRTA 4LZJA 1YB4A 3NAQA 1SVWA 1TFUA 3F0TA 1UMDA 1F06A 2WWTA 4PYNA 2YV2A 2D2IA 2HPZA 3PWTA 1EVYA 3VSAA 1YA6A 4AKHA 4K26A 4AFNA 2OB2A 3K0FA 3AI8A 4EHNA 1CIJA 2O0JA 2AQKA 3JTMA 5G4KA 3RFUA 5HZHA 1HZJA 1U9IC 4OX9Y 4BJHB 4MO2A 3ND9A 5CDTA 2MSKA 4ZY2A 2Y1XA 2ZYDA 1SUAA 1XCGB 4MWSA 4FMBB 4NDNE 4NJMB 4JJKA 3RG2A 2WNHA 1E9CA 1XKQA 1YJCA 2VPQA 4LJ5A 2JLUA 3O31A 3W1EA 1IHXA 3KUUA 3Q7QA 4L9AA 4Q93A 1GZ3A 2FP4B 5A62A 4RUKA 1E3WA 4M83A 3CJQA 1QHIA 4NMXB 4WINA 2A8YA 1S3GA 4Y9UA 4CZ2A 4LRYA 2C7PA 5CURA 2JHCA 4HDSB 2IUEA 2G9RA 2YIJA 4QEKA 4RZ2A 1H8ED 1RXCA 5FPSA 5G0VA 2EJCA 2O1XA 4JGKA 1JSRA 1RMQA 3RRXA 3VHLB 3RRMA 5FFMA 2QRZA 5M7EA 4ABTA 1VKRA 2Q4EA 1E7WA 3DFIA 4LV8B 2PUFA 2GCEA 1NVVR 1A4XA 1M6WA 2TMYA 3Q7RA 1J33A 2BKVA 4OHZA 3BZWA 3IPCA 2L42A 4AWXA 5JWOA 4IMIB 1QX4A 2NU6A 2R9VA 3ZU3A 3ROKA 3IEPA 1SVOA 3V1UA 3U60B 2G07A 3F8WA 4O2AA 4YCCA 5BPHA 1Q7GA 1CB0A 2FE1A 3GJ3A 4C0BA 1V8DA 3F78A 1D0VA 5BQ3A 3N07A 3DH0A 2FHSA 1NUTA 4DR5B 2CXQA 2MR5A 1YCHA 1YR2A 4POOA 4ZZ1A 3N4CA 3JSXA 1S2OA 4DSOA 3HKBA 1BJRE 1ND6A 3GVPA 5GZ3A 2I33A 3H2ZA 3PCXA 3TEJA 4R51A 1BN6A 2AC7A 2PMCA 4GBED 4YAGA 3KJGA 3KQQA 1ACMA 3H8GA 2G1KA 2HTFA 1HM5A 4RADA 1LFAA 3RRZA 4KXXA 1P0FA 2AI1A 3O4GA 5F64A 4OHXA 4A6XA 2XMSA 2GMWA 1X8XA 1Q1QA 3GP5A 4BJ1A 3STHA 2CV0A 4JEUA 1C7FA 4Y6PA 3RLFA 3LAWA 2R6R1 3W3AA 5ED0A 2HMVA 3HWSA 2RNKA 4KQIA 2B1GA 1R0YA 2I7XA 1H23A 1DDGA 3RABA 1BHO1 3NP9A 4NNJA 1EIZA 2B7CA 2AD5A 4OBEA 2ZETA 4G2TA 2Q9UA 1XJQA 1AKNA 3DHVA 5JASA 3W2HA 3PNKA 4QDKA 4XPZA 1VIMA 2IDMA 3W04A 5IM5A 2EDCA 2PYIA 5SYMA 2YJ2A 1II0A 3MB5A 3OFVA 5G2OA 3SIPA 3OX1A 1SIWA 1FFEA 3QVWA 3E9QA 3LP5A 3A9CA 4KLCA 3SIWA 4BDTA 2IEDA 2GARA 3AR2A 2EVWX 5CB3A 1KH2A 2IIVA 3OEHA 4RE5A 1E4OA 1YB6A 4N18A 4QPZA 1G5PA 4EJ6A 1PR5A 1KAOA 4ER5A 1F20A 5H82A 3RTBA 4PZYA 3R74A 4JS0A 3SKVA 3WGLA 4D79A 3C8HA 1GGHA 1XZNA 4OD0A 4ZDKA 5F1KA 1VP3A 2PWAA 3NTUA 2DZYA 4DZTA 4XGRA 3TL6A 2XU3A 3DOCA 5J5AA 1SHZA 1ZVMA 1ZGHA 1Q0QA 1WX1A 2HJGA 3PK0A 4PE5B 2W6JA 3L0CA 4HNAA 1FB5A 4PLZA 4R01A 2OCYC 4QG3A 5JQWA 2C97A 2XUDA 3M83A 4U02A 3RS9A 4JP8A 1F1BA 1T1EA 2Z04A 5GINE 4RHTA 3JPWA 1UC5B 4WUVA 2FRXA 1LCPA 1SVSA 4MV1A 4PM4A 4TYQA 3HA5A 4ZU1X 3IMCA 4UCFA 3ZXXA 1SO8A 4KYUA 3ZTYA 1H1TA 2WA2A 2I62A 4HDKB 2FSVA 2NLOA 4BZZA 2VG8A 2V7UA 4MRRA 4ZJZA 1WMAA 4QARA 3RS4A 1MGOA 2FKAA 3TZ6A 4J0DA 3UMSA 1NPYA 4LXQA 4J3NA 4CTNA 2G1UA 4BOUA 3G5MA 2GK7A 4DR4B 4HT3B 1B0PA 4IFIA 2WUVA 3CB4A 1Y42X 2UUPA 3QI7A 2EQAA 4BV8A 3T1HB 1XDWA 2XCIA 2F7SA 2I4OA 4GSKA 3U81A 2WE7A 1HLGA 4IJKA 3K5IA 3QEAZ 2FDXA 1CUHA 1S8NA 2NXWA 2VAPA 3Q9SA 3UZUA 1SCQA 1RWKA 1RRGA 3V1YA 1EK6A 1YS2X 2OCBA 2ODWA 3CNLA 3OJXA 4M0CA 4KR7A 3SFVA 1JIVA 3SGLA 1A5AB 2BP7A 1T15A 4OJKA 4TTTS 4WECA 4X84A 1VMAA 2JEYA 4ARCA 5B37A 2CSUA 1R5JA 3EXIA 3IUPA 3L1UA 4ZYYA 1Z5GA 3I45A 4FYKA 5E0OA 2X5JO 1GDTA 3TNYA 3G88A 6ADHA 2PSSA 1G66A 3OZSA 3H04A 2H08A 5CDYA 2V55B 2F3QA 3LHIA 1G8AA 4Y1RA 1C9NA 4NV1A 3ZWOA 2ES4A 3G0BA 3FUCA 4M9SA 1A82A 5C7LO 1OILA 2QQ5A 4GX2A 3H9CA 4NCXA 5BWLA 1FSGA 4R0NA 1FFHA 4C03A 1E3SA 3BJZA 3K9GA 2WBFX 4BUJA 3CO5A 5ALWA 1UOEA 1YSCA 1XZ8A 2GJAA 1DQSA 4ITRC 3RV3A 4MK4A 3KKMA 3T5GA 3VU9A 3U4QA 2J6CA 2JAUA 1MTOA 3DDUA 4AJJA 1S0UA 1P3JA 2ODBA 1G6Q1 1A5BB 2VUSA 4JJ4A 2P9YA 5KWVA 4LC1A 3SHWA 5KOHA 4JYAB 4BC1A 1MNAA 2PQ0A 2PV7A 5HEKA 3VU3A 1QS0B 3EZNA 5T3UA 5JSHA 1I6MA 3GGOA 3D7KA 5CFMA 4DYVA 4WD3A 3ZGNA 3C7AA 3EMDA 5KSZA 2Y5BA 3GJZA 3OFSA 4TTVA 3R20A 3EAGA 2ZYVX 5FPTA 1N75A 1I4WA 2V7VA 3QNUA 4UFNA 1NBEA 3JQ8B 1GNVA 5BQ5A 3PTAA 4P53A 3K96A 4RENA 2V65A 1GZ5A 5BN3A 3ONNA 1MPXA 2BEUB 3DE0X 4X41A 4B4DA 4NU6A 1E2NA 5J4HA 1AHPA 3EIOA 4BLRA 4C6SA 1HT0A 4AKIA 1KMCA 1LUAA 5ISMA 3QIAA 1UWKA 3KV3O 5F5NA 4MTCA 4P6GA 4ATNA 5AHXA 3H65A 5JS6A 1JWAB 2OUIA 3GDWA 3QU5A 3IEVA 1J07A 1OXTA 2UUAB 2JZEA 5DGHA 3P9KA 1QGUB 4RIIA 4LRQA 4HNAB 1QUEA 1BDJA 1U8FO 2WVJA 3GJSA 2ATCA 3FNIA 1HDIA 4BP8A 3IO3A 2ZYSA 1N1EA 1JLLA 3MUOA 3L46A 4W1SA 5IT0A 5BXYA 3EX7C 3PQ4A 2CEKA 3X1MA 5DTRA 2QR3A 3CSDA 3FYTA 1UM9B 4W8OA 4TVBA 1N1DA 3IEIA 1WHTB 1XKLA 1ZVJA 3WWCA 3ADBA 2A78A 3P2EA 2VF4X 2Y4NA 2I3DA 3DYIA 2RGRA 1XVVA 1IH8A 2I7CA 3C8UA 3IDZA 5H3CA 1MTZA 1UBTS 3L8YA 4Y9SA 1HQCA 3CUTA 2ZDQA 6YASA 2CJWA 2Q6KA 2RCYA 3FWKA 4L9WA 5B57C 2QQGA 1Y63A 2Q6OA 3ELWA 2BEKA 3GLFE 5DN6D 1P5FA 1SVMA 1XEXB 1Y5NA 2OKGA 5KHLB 2ZRJA 3E22B 3M4XA 1BXRB 3IUJA 1GFZA 3ZJVA 5JVDA 4J0JA 1RMTA 1Z88A 2HM7A 2PCJA 2V58A 3EWIA 3R0XA 3UV6A 3WL7A 4E4RA 2PV0A 3C48A 4EO4A 5C1OA 1DGQA 3BERA 1CRLA 2R7MA 4ZOBA 4QYIB 4R83A 4X8MA 3KHSA 2MYPA 3LSYA 2OLKA 5K1ZA 5I5EA 4K6HA 4H7KA 2QF7A 1GCUA 2YXBA 2ZUBA 2A9FA 4QOJA 2B6HA 1J23A 2QRNA 4P32A 4FYHA 2B5VA 4KPUA 4D3DA 3W3AD 2YNMA 1FQJA 2WP0A 2GLUA 2DPXA 1EUCA 1XI2A 4U6SA 4KW7A 2QN8A 4YJDA 4HH3C 2D0IA 2R7NA 5G3ZA 1PL0A 3UY4A 5FORA 1Q77A 1C29B 3PEUA 2O50A 5C4IA 3OWOA 3CUVA 1W9MA 2ISQA 4LIPD 5C32A 1H5QA 1OYOA 2GB4A 1QOPB 3EXHA 2QL5A 3ANTA 4NZZA 2R96A 4Y1RB 3CWQA 3RVNA 2EC5A 4L6IA 1SHKA 1K5GA 2JZOA 1D7AA 2W6CX 2AZMA 4CLRA 2P65A 5IXJA 3OZAA 2J08A 1GT91 1Z6QA 1U0GA 2X9QA 5G02A 3R8CA 1JA9A 3MYRA 2EJVA 2OKCA 2VAVA 2CBGA 1VIDA 3ZTWA 3HVUA 4WY5A 4XVQA 1KO5A 1Z5ZA 4EA8A 3ADCA 2HGZA 4M54A 5ESRA 3RQIA 3OZBA 3MUEA 2P1DA 3VJRA 1HDXA 3IDSA 1UH5A 3GEEA 3QLUC 3EFOB 2GPWA 4MDYA 3K9BA 4N54A 3VUEA 2E03A 4PC3A 3B20A 2FW9A 1PSWA 2Q8QA 5LNK1 2VXYA 4TWIA 4UUMA 3H87A 4B4UA 1EM8B 4Z8XA 5B36A 4PO1A 4JP5A 2JIQA 3GMIA 2QPAA 4NV3A 3I0MA 4MR9A 3ZOZA 2A33A 4X85A 1T3LA 2OV2A 1NMXA 2PJUA 2JFBA 1JG4A 3CR3C 3KYDA 4NC9A 5LB4A 2G5PA 3O5AA 4X45A 4D2IA 1MEOA 5CT8A 2B35A 1M83A 2VQDA 3IV9A 2GZMA 4NU0A 4ZVKA 4JI6B 4ZT5A 4RD1A 1I4DD 5JUWA 1ATKA 1KDPA 3OY2A 2AFIA 1UIMA 1QG2A 2LGJA 1DLIA 1VB3A 3KEGA 5A7HA 1HETA 3PQ3A 1FFCA 5C7IO 1N1GA 3GA0A 2XCUA 3NI2A 4M1KA 4K3NA 3IQHX 2R84A 5BVGB 2P86A 1EVEA 1L5FA 1XGKA 1YDGA 1K8XB 1US8A 1JSLA 4GOXA 4WAUA 4CT0A 1CUYA 2H29A 4KN5A 1MH9A 1U0EA 2NPIA 4R7ZA 2OCXA 1JAZA 3HHIA 3QVSA 3F97A 1PI3A 4G5QA 3R0JA 3WRYA 4B3SB 1Q3HA 1P7PA 5E7JA 2Y93A 4F60A 1YL5A 4YYQA 2ZTUA 3LF2A 4GOMD 1VMIA 1DCTA 3B6IA 4YRAA 2VC2B 2ZZKA 3PP8A 1Z0SA 2HLDD 4G09A 4PNZA 3AR6A 5K05A 1LPBB 3AV3A 2JLAA 4KOEC 2XGJA 1JR3E 1UF9A 2Q9BA 2E21A 5E38A 2VYND 3ZNOA 5JIBA 1RRVA 1QLHA 1ZU5A 1JLMA 4RGBA 5A0VA 1ITOA 4COKA 1BH6A 1EFRD 3FOCA 4BECA 3HC7A 2AEMA 1PS9A 2XU1A 1Q20A 4PZEA 4Y2TA 1Z12A 3MSCA 3AY0A 1O08A 1Q1BA 5I8PA 2VSOA 1V35A 4KBGA 3H1GA 5DSXA 3QIVA 5AJUA 2WU1A 4A0FA 4KFTA 4OGKA 4DSTA 1AKVA 2HU5A 1NMYA 1SUCA 4YJGB 1Z62A 3USZA 5CM8B 2YJGA 3N75A 1M9NA 2BJWA 2GCNA 2VH2A 3H2YA 3K2EA 3KXKA 3GELA 4X1YB 5JSQA 2ZW9A 1DL5A 4C4OA 3EARA 1L1FA 4OHWA 3QE0A 1RHUA 2K87A 4FOPA 4BKMA 4EHDA 1OA0A 2A59A 3QLVA 2QYHA 4B6EA 1C3EA 1NI5A 2NZXA 1LKZA 1QE3A 5FUYA 3EGOA 1KI6B 3B1FA 1RWVA 2H2AA 3B8EA 1XWWA 1G17A 3N8KA 1P1RA 5CDSA 4I50A 4NQRA 1KRWA 3RASA 2BGNA 5CT9A 5LL6P 1SD5A 3I23A 3AWIA 4INOA 4LCEA 5TJ9A 3U0BA 4HUTA 2R8BA 1N0VC 1I10A 2A5GA 3HLKA 4GICA 4L6AA 5DEOA 5T8KC 1EHYA 3I9LA 3V32A 5BV2P 5HRUA 2CXNA 5L7YA 3QJYA 4FM9A 2DEUA 4FC6A 1M5RA 3MPUA 4E5KA 5I47A 4ZY1A 4B6RA 1DG9A 1O2DA 1FE8A 3LF1A 3CPEA 3TIVA 4BVJA 5IU6A 2RHTA 3A7DA 4KNWA 1DFIA 3G8DA 4MPJA 2WHYA 4QVKA 2R9NA 1DCMA 2GAOA 4LBWA 3ELBA 3LQKA 1HFWA 2BHTA 1L1RA 1YZQA 2WWFA 3GJXC 1DAIA 2W6ID 1IAQA 2WPDA 5BRAA 1H4QA 1H5UA 1SVUA 3HADA 1NMZA 1OBFO 4OL0A 3RVQA 3BMCA 3G9QA 3AFNA 3VR2D 4MYCA 5EWLA 3H3JA 2GAJA 4A92A 3WNQA 2I9KA 2O54A 3HEBA 1AVTA 1FJ2A 1RVDA 1GZ6A 2XYQA 3F5MA 4HDAA 5KNBD 1RPTA 3DAPA 3SIJA 1B0ZA 4O4LF 3BMQB 2CNLA 2OPBA 3HVKA 1J5PA 3PTLA 3QKTA 1F2BA 1X86B 5LBUA 1I80A 1WMDA 1XCJA 4QGGA 2QJOA 4EY7A 1SXPA 1DBPA 3AF5A 2GJ8A 4D56A 5DW3A 2HPAA 4BN5A 2X40A 3ISJA 3JARA 1M73E 4HSGA 1I14A 2QGNA 1R0KA 3OOSA 3AFHA 1XZFA 1DF0A 1F29A 2FPSA 1Q6YA 2XH8A 2BHNA 3WNDA 3DMDA 2C0QA 3LT0A 5GP1A 1DHRA 1PVDA 3BGVA 1PG5A 4ZV9A 1V7ZA 2JLRA 2O7QA 3U2QA 4CIDA 4CDDB 1JQJC 3E9EA 3RAEC 3BMOA 1JBKA 1Z4QA 4ZOLB 3MJDA 4ZQIA 5EJ6A 5C7OO 5B4VA 4YMHA 2E48A 1X0XA 3C16C 4YREA 1LJLA 4IDFA 5JQGB 2FETA 3MBKA 2H48A 5I48A 5U9CA 2CB9A 2WRZA 3GLRA 1PL8A 3KR2A 3R3VA 2P78A 1Y6GA 1BXZA 4E3WA 2ERCA 1K6IA 3K5WA 4IF4A 3NBKA 3Q4GA 2UZAA 4NZOA 3L43A 1XHFA 3QMVA 1BE8A 5AR1A 2QVXX 1P17A 1JAHA 3ZQJA 2ZBUA 1FYWA 3NM6B 3STXA 3FPEA 4QAJA 3T7SA 4CM7A 4WJLA 3OECA 1ZNYA 3LGXA 2OGTA 4IS2A 4OLFA 1DXQA 3QFRA 3W5HA 3OF8A 3M49A 2XQFA 3QUAA 1ZGGA 4IRMA 4BZXA 1QHNA 3A3PA 3HEMA 2JLVA 2R65A 4HL6A 1VLJA 1I9CA 1PGJA 3DBOB 2A94A 5FNZA 3D8UA 5EMJA 1IHPA 2IPPB 2J85A 5G0TA 1ZY2A 3DDZX 4GMDA 1F8FA 2YS7A 3GLHE 4NS4A 3IB3A 4IINA 1NXPA 3W5CA 2JS7A 3D8NA 5JARA 2YZGA 3LHDA 4IGFA 1B8UA 1KBOA 3O8LA 2JGJA 4BQQA 5H1YA 1TC2A 1YZVA 4HC4A 3AW9A 1A9OA 4ZHQA 4MZOA 2YS6A 4JI0B 2Q7DA 2QE7D 2IEBA 3HCCA 2PGJA 1SP4B 1RI3A 1P7YA 3DMTC 2AMVA 1L5HB 2FOXA 5DNVA 4OL9A 3EXHC 5JBNA 2P3SA 3WXFA 4DDVA 4V0QA 3T5BA 1LDGA 3HCBA 3EOAI 3ENVA 2IEIA 3PFGA 4LWOA 4AP9A 5HK9A 2ZJ4A 1VJ1A 4LJSA 2VAMA 5TB5A 421PA 4DQXA 3IAS1 3FOFC 3DBHB 3OOEA 1IBRA 4J9VA 4W7IA 3RGWS 4BMDA 3K9FC 3KX2A 4Q12A 3L0BA 4RCZA 1ZK3A 1JT9A 1HE2A 3GRKA 5I7FA 1PX2A 1YUNA 1FPMA 2JIDA 4L07A 1NVMB 4DTIA 2D4HA 1GLOA 4I05A 3ENNA 4Q1AA 3RBVA 1G8MA 5WRFA 1U31A 1SBNE 2LE0A 3C8MA 3CXUA 4RF5A 2JK1A 2H52A 4OA8A 2ZCUA 4CUZA 3EAQA 3RSSA 2FN8A 1YV9A 3R5HA 2IYYA 4EX7A 2VXBA 1QX3A 4GKAA 3ZU5A 3C3KA 1SCAA 3LUDA 4U6QA 3GXOA 2WINI 3RARA 3JRUA 5LMNB 3VFDA 3PEVA 4IJUA 2BPOA 2ECPA 4IFEA 5DIFA 3BWBA 3PQ6A 3GLIB 2JJQA 3G2MA 2FFQA 3AESA 3IILA 1JSCA 3GUYA 2CXOA 4P38A 3BL6A 1A9ZA 3ICOA 5FWYA 1D6SA 1FFAA 5HBRA 1Y4UA 3DC2A 1TAUA 3HN2A 2XVAA 3Q9UA 3PX7A 4BOQA 5H5JA 3WLFA 3P5UA 4BQEA 1Q6ZA 3CONA 4RL6A 1W29A 3HNOA 5B2EA 5CBPB 1X7XB 2AUNA 3N0VA 4P4SA 2FG7C 2PJZA 3TBKA 5AVXA 4Z1MA 4PLWA 2PUCA 1DZ3A 1OX4A 1Z17A 3FTDA 1T9AA 1IZZA 1PT5A 1C9EA 2AYXA 2GKGA 2HXYA 3DE1X 1T8TA 3HDGA 3QUTA 3SXUB 4XZXA 2GDJA 3RC9A 2ORED 3NVMB 5JAZA 2FU5C 2IS4A 3KOWA 2Z56A 4R9RA 2WIGA 4YYZA 3B1ZA 3WJAA 5HS6A 4H6WA 2X4LA 2ANBA 2LTAA 3OCUA 3TMKA 3WDLA 5KCZA 3UCXA 2WTXA 2ZJ8A 4E22A 1V8BA 2C2GA 2Y1KA 2OT3B 1CY2A 1IAVA 2R6JA 4IFBA 1MJNA 1OXSC 1RCTE 2HIGA 1AN9A 1XVUA 3TKYA 2WC1A 2CVOA 1W5EA 1JLHA 4AD8A 1QLJA 1M2JA 2YX1A 4FSDA 3IYLW 2GAFA 4KC0A 1ZK0A 2K2WA 4KYBA 4QRHA 1A98A 1KQOA 5T4EA 1RKUA 4B46A 3L07A 1W46A 2VUUA 3OCYA 1GQQA 1PJCA 1DIOB 3EUEA 4NE9A 4WXHA 3T6KA 2HRBA 1TCAA 1Z18A 3RV4A 3ORHA 1WHSA 5KI6A 2OZKA 3TSWA 2VDPB 4DWWA 3OD5A 3DKRA 5H02A 2XTNA 1G9XA 3GUCA 4JP1A 1LRKA 1OTHA 5CNJA 1XRPA 1U2PA 2GHIA 1TLTA 3HY3A 4FSHA 3R7WB 4CFYA 1DXOA 4LNUA 4OHKA 2ZPAA 3PEIA 4CM9A 1LX7A 2R66A 2VNIA 4X64B 2QDXA 4Q82A 2XKAA 1BMFA 3RVRA 2FZ4A 5AVRA 5CNMA 4JBHA 4PWYA 4B3BA 4KPFC 1OYYA 1E99A 2YHBA 3IDQA 3OQBA 4K8OA 2I3BA 3WYNA 3VZSA 3FCCA 1QYXA 3CPHA 1VL8A 3LWDA 1C3LA 2B7LA 4PYMA 1ONPA 4OKSA 1C9DB 3FF4A 2W6IA 3DOUA 3HDYA 5LQMA 3NPMA 3BGIA 3DO8A 3OLCX 4BRSA 1XP5A 4TLAA 1Z28A 5AIBA 2AGAA 2P2SA 1ABBA 1E1NA 3L49A 4FZVA 3QSGA 4A27A 2IEZA 5JMPA 2PR2A 1FRFS 5DULA 2X22A 3CLUD 4GYYA 2VSQA 4BGUA 4DIMA 5KHOC 5KQPA 1HYEA 4QBFA 1C50A 2W43A 3C87A 2NTVA 4FOLA 1GSIA 5FBWB 2IBSA 1IOZA 4BWYA 1WQ4A 1H1DA 2B6NA 5FOTA 2FFRA 4ARUA 3LK7A 3ISTA 3T35A 5AD1A 1PJZA 2H00A 1I94B 4Y6SA 1HA3A 2B83A 5AILA 3LHFA 4ROTA 3ND6A 4XLLA 3B8HA 4UDXX 1ZD8A 4UE6A 1ANKA 3KKNA 5GPBA 3RRYA 1GWNA 1T0PA 3KZMA 4YJKA 1CS4C 4QTZA 3TXXA 4HLUC 2XU4A 4CM1A 3L0ZA 1N25A 3N3BC 2QUZA 2SKEA 3ME5A 1E2UA 2IVFA 3FRIA 2OV4A 2R68A 3TTVA 4O5OA 3THWB 1LVGA 2GPBA 1E4EB 2GH1A 4WXYB 4WK6A 3O26A 5EZ6B 3P5VA 1O89A 3FPHA 1RQLA 4C30A 1NY5A 1NFFA 3QM1A 3JD2A 1U8ZA 4RBNA 4PR0A 4OSPA 3IKTA 5LXTA 1IZ8A 4S2EA 1S5PA 1ZW6A 3SBXA 3CH7A 3G3EA 3KO8A 3PEEA 3BF7A 4WESB 1KI1A 1GQRA 4QOGA 5CP8A 3T7CA 2JLZA 3ECCA 1XB2A 4AKGA 2O57A 2YH2A 5IJ9B 4KXQA 2B4KA 1YZBA 2JJ2D 2O2IA 1TU0A 4WXEA 4UNRA 3G82C 2BAGA 3U31A 2OK8A 4XDGA 3WHLA 1FUYB 1X38A 3LVBA 5JCOA 2JFGA 4I81A 1PK9A 3QW4B 4P0PB 4MI7A 4I46A 4OVZB 2PKCA 5HWSA 1NN1A 5F35A 1EUDA 4JJEA 4YRMA 2CHFA 4DIFA 3VX4A 4D42A 5AVKA 1MB2A 4I8IA 4XW2A 2VA9A 2RH5A 4ZODA 3S70A 1F2UA 2O8NA 2QTRA 5C3UA 2V4ZA 3A9SA 1RU3A 3NM5A 3SR4A 3VZCA 2G7ZA 4B44A 4EHBA 1E5DA 2FCAA 2HSWA 4DAOA 5TARA 5BQFA 5JAUA 2ZIUB 3CF4A 3PLRA 5KREA 2XUPA 3S40A 3ICCA 1P0IA 1KYQA 4YJ3A 5AM1A 2HHNA 4IDBA 4TSKA 3LBAA 2W37A 5KTYA 1YRAA 1JEQA 1IHYA 1IIRA 2P62A 2VF5X 2DQKA 3KNZA 3VH4A 2X76A 4HQLA 4YHHB 4KHPB 5CLJA 5EXPA 3T9AA 4BYMA 4GPTA 3QPAA 1U7UA 3H5TA 2CN1A 1G7RA 4DV5B 1BGWA 4EUHA 4EKEA 1QAOA 3UMVA 4X90A 2ZRDA 4WFJA 4DEXA 2AI3A 5JJCA 1QGUA 3VJKA 4FCCA 1H69A 4L4UA 4TTQA 3RYFB 3U9SA 2ON6A 1PFVA 4US1R 4XIIA 4EO9A 5JNUA 2JTCA 3OCCA 2ONZA 2YY6A 5AK0A 4HNTA 3RH0A 1GQOA 3EH2A 3KAKA 4JLBA 1AQYA 1KEWA 1RI2A 4INJA 2RHJA 3IO5A 2I6XA 5HZKA 3CVYA 1ZAYA 1HC7A 4NBVA 2C04A 4W5WA 1N9GA 3DEHA 1M1YE 1SKAA 3EGDA 3PFHA 4HEA1 4UTRA 3M99A 4MA5A 5AJVB 1TOAA 2M6RA 5EZSA 3RS0A 4GGMX 1U98A 1ZMTA 4NVRA 1M67A 4M53A 4BZPA 3QVGB 3L7KA 2FVXA 1QTIA 2FQXA 3ZLUA 5A6SA 1E58A 4WPGA 3L06A 2G76A 1H2YA 3FOBA 3CF2A 3KYJB 5ES4B 4RNAA 4IXDA 3JSAA 3RSCA 1YI1A 2ECQA 2OXCA 2VTKA 4YP0A 3B12A 1LSJA 4GVXA 5ALTA 5SY9A 1P45A 4Y2VA 1DBVO 3ZWXA 4RTLA 7MDHA 3ELDA 1K08A 5LD2C 4OH7A 1T6ZA 4B34A 2FW8A 4H7PA 2WTAA 5IJWA 4DPLA 1ORVA 1E9EA 3KALA 4JUBA 2GKSA 2XB9A 3S4YA 4J8PA 3W1WA 3T3NA 3VISA 4Q3LA 3IAFA 5DNEA 2ZANA 1TUBB 1ESDA 4P33A 3WK6A 2EGGA 1EWKA 1FFWA 1V4BA 4RMIA 3TIXB 1H4SA 3OCWA 3BB7A 1IE3A 4BNMA 1YFJA 1EX1A 2A1UA 1WDLA 3NNDA 2ZUTA 3TW4A 7ADHA 2ATEA 3DOEA 3GFVA 4H1UA 5C52B 2OBNA 3O8DA 1CY4A 1PUJA 4JJ8A 3MWJA 4MVJI 4XTCS 2O0MA 2WD9A 1NURA 3CIFA 4KFUA 4BMYA 1EG7A 4J0FA 2D62A 4DT1B 4MM3B 2VP6A 3OLZA 1KI6A 3TLAA 3SEFA 5K3FA 3FE2A 4ZYQA 4YI5A 2HPHA 2WSMA 3T38A 1Z4OA 1E1YA 2PO5A 1V11B 2LP4Y 4D4LA 4JD5A 1PHPA 3H5NA 5B2ZA 2JVKA 3CVUA 4RTPA 4PSDA 3TMPA 1D8TA 3R6TA 4MUAA 2JGKA 2VQFB 2DTDA 4PCAA 3ZH2A 2H1SA 2P35A 4BAGA 4D86A 1SU4A 1N6HA 3LCRA 2WUGA 1Q19A 3U56A 2BEWB 4HNGA 4YVAA 2DPLA 1NJ2A 2OO5C 3ICPA 1KYVA 1C4OA 3T06B 3NGLA 1X2BA 3PGXA 4LBZA 1L7NA 1YQGA 4G8JA 4LSZA 1HK7A 1GNQA 1RBZA 4WNAB 4C3UA 5EE0A 1LTHR 4Z7NB 5E8RA 2JCVA 4CI0B 4RIGA 1ZNWA 2H06A 2C4KA 3C41J 1OUMA 4OUKX 1SIUA 3KXDA 4QX6A 3IIKA 2F1JA 3UNXA 4DG8A 1QFYA 3F7NA 1QWOA 3F96A 5JXGA 2IWHA 2FQYA 3W6UA 1T5LA 3Q8MA 1N5RA 1JXAA 5B7PA 4MAAA 2GCOB 4OHVA 1P6XA 4O63O 1L5YA 1NVVQ 4NARA 3G23A 1BWQA 4DA8A 4ZT7A 5HMLA 1AQ6A 3P0HA 2VSNA 1JIKA 5DHFA 1RHRA 2VDR<