4GUAA

Alphavirus p23pro-zbd
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
662
structure length
662
Chain Sequence
b'NPFSCKTNVCWAKALEPILATAGIVLTGCQWSELFPQFADDKPHSAIYALDVICIKFFGMDLTSGLFSKQSIPLTYHPADSARPVAHWDNSPGTRKYGYDHAIAAELSRRFPVFQLAGKGTQLDLQTGRTRVISAQHNLVPVNRNLPHALVPEYKEKQPGPVKKFLNQFKHHSVLVVSEEKIEAPRKRIEWIAPIGIAGADKNYNLAFGFPPQARYDLVFINIGTKYRNHHFQQCEDHAATLKTLSRSALNCLNPGGTLVVKSYGYADRNSEDVVTALARKFVRVSAARPDCVSSNTEMYLIFRQLDNSRTRQFTPHHLNCVISSVYEGTRDGVGAAPSYRTKRENIADCQEEAVVNAANPLGRPGEGVCRAIYKRWPTSFTDSATETGTARMTVCLGKKVIHAVGPDFRKHPEAEALKLLQNAYHAVADLVNEHNIKSVAIPLLSTGIYAAGKDRLEVSLNCLTTALDRTDADVTIYCLDKKWKERIDAALQLKESVTELKDEDMEIDDELVWIHPDSCLKGRKGFSTTKGKLYSYFEGTKFHQAAKDMAEIKVLFPNDQESNEQLCAYILGETMEAIREKCPVDHNPSSSPPKTLPCLCMYAMTPERVHRLRSNNVKEVTVCSSTPLPKHKIKNVQKVQCTKVVLFNPHTPAFVPARKYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-structural polyprotein
publication title Structural and functional insights into alphavirus polyprotein processing and pathogenesis.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Hydrolase
total genus 200
structure length 662
sequence length 662
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4guaA02
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4guaA03
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4guaA01
1VP3A 4A6EA 3G2QA 1SG9A 3G89A 5HZMA 3FUTA 3NW9A 3FZGA 4PYOA 3OFKA 2BH2A 2XBMA 3QOXA 4MTLA 5E8RA 4RTMA 5FQNA 2AN5A 2FYTA 4CTJA 3OPNA 4GVWA 3TMAA 5FHRA 3GRYA 3DP7A 5CB5A 3HVJA 4ETKA 1R74A 2PJDA 4U7PB 2ZFUA 5EG5A 3R24A 2DULA 3ELYA 5E1OA 5T67A 2EG5A 2ZULA 2E5WA 5G02A 1WZNA 3V2BA 2C7QA 3E23A 4PCLA 3DXYA 1XTPA 4ER5A 1R6AA 1WXWA 4QTTB 1NW3A 2QYOA 3AJDA 3H2BA 4GVVA 2ZSUA 3TRKA 4WXHA 1XDZA 3HCAA 5EIWA 1WS6A 3C6MA 3EVBA 3A7EA 4FSXA 1AQJA 4K6MA 3EKEA 2FK7A 5DRYA 1NT2A 3KQVA 2AOUA 1NV8A 3B3GA 2CMGA 1JG1A 1U2ZA 2YVLA 3BWBA 1RJFA 3TM5A 3LCUA 4YV1A 1XCJA 1KR5A 2BR3A 3UJAA 3E7PA 3SSNA 4F84A 5FSZA 5CCBA 2ZCJA 3KZWA 1EJ0A 2EEEA 3PEIA 2QRVA 5K0CA 1Y8CA 2ACFA 3ELUA 5F2KA 3SVZA 3SIIA 1DL5A 4KW7A 2PT9A 4C04A 3NJRA 3SSMA 2EFJA 1IXKA 2XYRA 1B42A 4H0NA 3KQSA 3T7TA 3M6VA 4V0RA 2GPYA 2ZWVA 2H00A 4O29A 4X63A 2QM3A 3EJFA 3M6UA 3KU1A 5FULA 4YMHA 2DX6A 2AS0A 1ZR3A 4AZTA 5HIIA 2PWPA 2AVNA 2VDUE 4YMGA 5HIMA 4X41A 2QY6A 2NXNA 4OQDA 1NW5A 2C7OA 4EQZA 3DTNA 1KXZA 5EVJA 3BGVA 4J5RA 4DA4A 4YUXA 3MTEA 2I9KA 1KIAA 3KPJA 5K8VA 2XYVA 2O57A 1BPNA 3HCFA 4OBXA 5D1HA 3MB5A 2O07A 3NWEA 4E30A 3SR4A 5LQCA 5GIOE 4IWNA 3C0KA 5DX8A 3DLIA 4ATNA 5EPEA 4PGGA 1XXLA 3HP7A 3P2IA 4RVFA 5DPMA 1G38A 1KP9A 3EVEA 4MWZA 3GIWA 1XVAA 3AXSA 1KPGA 5E9WA 3QV2A 4YV2A 2YTZA 4OA8A 4YV0A 2VRIA 3C6KA 4P7FA 3UZUA 3G8AA 3SSOA 4RYLA 3LECA 4QQNA 3M33A 3SIHA 2P3OA 1D2CA 2VDVE 2ZZNA 5DWQA 4AUKA 3SMQA 1HMYA 2NXCA 4DCMA 1ZGAA 3G8BA 1BC5A 5DM0A 4F86A 2Y1XA 4OBWA 5DLYA 2AVDA 3JWJA 2PGXA 2XVMA 2IGTA 3P8ZA 3EEYA 1KYZA 4CXMA 1JR4A 4HC4A 3SIJA 4GEKA 5CVVA 4RV9A 4R76A 1N2XA 2YXLA 2PT6A 4K3NA 4DMGA 3LX6A 4GQBA 4HGYA 1KYWA 4C05A 3PB3A 3WSTA 4XUCA 5EMLA 4M38A 3EWRA 3FTCA 1X1AA 3CJQA 3KQWA 1ZG3A 2JJQA 3BWCA 3HA5A 2IPXA 4M7RA 4HSGA 2GS9A 2EJUA 2HMYB 3ME5A 2AZTA 3DOUA 5CD1A 4QDJA 3TOSA 2OB2A 3HCBA 1O9GA 1YF3A 3PLAE 2FXKA 5KYGA 1IM8A 2BR4A 5DRTA 3R3HA 4WVLA 2LD4A 2V7EA 4PONA 3AXTA 1ZR5A 5DSTA 1VHUA 4DF3A 3P9NA 3EGEA 3UWPA 4ETJA 2ZTHA 4KYBA 4XUEA 2K4MA 4E31A 4DM3A 5CBMA 4JVVA 4KIGA 4QDKA 4R05A 3KQOA 3NDJA 3E05A 3OU6A 5LQUA 2AOUB 5JUWA 3EPPA 2GH1A 1G6Q1 3OZSA 4G56A 2JG3A 4YUZA 5FSUA 2CKDA 2ZVJA 5EHGA 3CGGA 5ICGA 1EQAA 4PYIA 3TQSA 4ESSA 1TW3A 3G5TA 3UJ7A 2ZBRA 10MHA 5B1SA 3V45A 5KS2A 2H1RA 3EVCA 3RW9A 1FBNA 2GA9A 3LCVB 3V97A 2B2CA 3TR6A 1X1BA 2WK1A 4IV0A 2YR0A 3G5LA 2R6ZA 1IY9A 1L3CA 3K0BA 4DZRA 5K05A 5IH3A 3DXXA 1UIRA 4HH4A 3UA4A 1TXZA 4ZI6A 4PIMA 1RI2A 3LDFA 1KPHA 4ER0A 2G72A 1P91A 3UJ8A 5EOVA 4E70A 3B3FA 2O05A 4AX8A 4BP3A 3BGIA 3KHKA 3SXJA 2F8LA 1MHTA 2AN3A 1JQ3A 5LR6A 4OA5A 3ELWA 3THSA 2UYCA 5DM2A 4HTFA 4GUAA 1BPMA 3V8VA 3CCFA 3FTEA 2J9AA 2PY6A 2PX5A 4PCAA 3PTAA 2JH9A 4HGZA 5EMKA 2Z6QA 5K03A 3BUSA 4ZY0A 3GQOA 3NMUF 2ORED 2AR0A 3OU7A 3FPFA 4HG2A 1I9GA 4X61A 8MHTA 4LG1A 4FT2A 2UYQA 2NYUA 4ER7A 1YFJA 3BWMA 4C4AA 5EKXA 1HJZA 5F2OA 3KQTA 5EQJB 2A14A 5DXJA 2KW5A 4RTLA 3KR1A 5CVJA 4EMSA 3FUXA 2AOTA 5LQRA 3EWQA 3PFGA 2PWYA 1JTFA 1JSXA 5GOZA 5C0OE 2IH4A 3KR9A 1P1BA 4ZYQA 3ERCA 2CMHA 3A25A 1WG8A 3ORHA 5FSYA 4IKPA 2ESRA 4C08A 2X47A 1ORIA 2QE6A 4PYQA 5AILA 1JTEA 5GM2A 4HRAA 2JHAA 3HM2A 2G71A 3P9KA 4FSDA 1VLMA 3P2EA 3IYLW 2NP7A 3O7WA 5LQNA 3AWIA 3KR5A 1RI1A 1Z3CA 2P40A 3SX0A 3NVKI 5HEKA 3LBYA 3LGAA 4RTOA 4BLWA 4GOMD 4MIKA 1YZHA 3OCJA 4R7MA 5CIYA 3G88A 2NXEA 3IHTA 1I4WA 4B17A 4P7GA 3Q71A 5D1NA 4BLUA 2BZGA 2JHPA 4J5QA 3D2LA 3GRZA 2AOXA 2P7HA 4GBED 3TLJA 3DR5A 4RVHA 4R6TA 2B25A 5BP7A 2O0LA 3EVFA 3M6XA 3THRA 2B78A 2HTEA 3GU3A 3CC8A 3PS9A 5E1DA 1QYRA 4E32A 5HIJA 2NP6A 5DXAA 4CWAA 3I5UA 5K0BA 4KRGA 2PSSA 2PLWA 2VZ9A 1JG4A 3BKWA 3G2PA 1JQDA 3EW5A 2ZBPA 5DX1A 3DLCA 4L7VA 5EMMA 2FAVA 4BP1A 4J4ZA 4DCGA 1HNNA 4JCAA 3MGGA 5MHTA 1JQEA 2P3LA 3R6TA 4YUWA 4PWYA 4ZX8A 4PINA 2ZWAA 3LCCA 5ICEA 1LAPA 5GIPE 2HV9A 2B3TA 3LKDA 1OR8A 3CBGA 5DTRA 2OY0A 3DXZA 3FTDA 2BM9A 4Y30A 1GYTA 1EJ6A 2C7RA 4NECA 2OXTA 5EGSA 3P9CA 5E3BA 1XJ5A 3G2MA 1QAQA 3HEMA 2I7CA 1KHHA 5DM4A 2YXEA 1X1CA 3GRUA 3IJ3A 3I64A 3O31A 3EGVA 1SKMA 3P9IA 4PYMA 2P8JA 3KR4A 5CB3A 4Y2HA 4ISCA 4QVKA 3NTVA 1M6EX 3LBFA 3HCEA 3PX2A 4KDRA 4FS8A 5FWAA 2IBSA 5EC8A 4XUDA 2OPBA 2UYOA 3ETIA 1RI5A 5HFJA 4RTQA 4R8SA 5LSAA 2NNWB 2I62A 3FPJA 4ZY1A 1LANA 3TKAA 5C9ZA 1O54A 4KWCA 5CMSA 4A6DA 2G1PA 3G7UA 1L9KA 3FPHA 3HVHA 3LSTA 2P35A 4RTPA 5GWXA 3CVOA 4DQ0A 4U7TB 2OO3A 3ER8A 2UZ4A 2P7IA 4FP9A 2IDJA 3T7RA 3SIGA 3G2OA 3F4KA 2VP3A 4BLVA 3LDUA 4E2XA 2I6GA 1NBHA 2FG1A 5IKMA 2FPOA 2IIPA 5K0FA 3MHTA 3KQQA 2JH8A 4FZVA 3TKYA 5E2AA 4R6XA 1BKYA 5DX0A 3L8DA 3KQMA 4PYJA 3KPVA 5EZSA 2ADMA 3O4FA 1F38A 5FA5A 4F85A 1M0EA 3VYWA 1T43A 3BKXA 3NWBA 1PJZA 1SQGA 3Q7EA 4ZY2A 2HR1A 3EVAA 3SGLA 2OYRA 3UJBA 1JG3A 4KSIA 4D86A 5DM1A 3EGIA 2QRVB 1VL5A 3EVGA 3GXOA 4GC5A 1YUBA 4RTJA 3KQXA 3IIFA 4EVIA 2DPMA 3KPUA 3LPMA 3VC2A 4LWPA 3UBTA 1ORHA 2ZIFA 3LL7A 1L3BA 5LQAA 2XYQA 4CKEA 1P39A 3A26A 3GDHA 1L1EA 4RVGA 3RODA 3GRVA 2B9EA 1JG2A 5FCDA 5HIKA 3B5IA 2VS1A 1VBFA 5E1MA 4V0QA 4J5SA 3CKKA 3EVDA 3H8GA 3KPWA 3REOA 4AZVA 2Q41A 4POOA 1EIZA 4K0CA 3UJDA 2IH2A 3FUVA 3GO4A 4RX1A 1YZ3A 4YUVA 2Z6AA 1D2GA 5HIHA 5FUBA 2PVCA 1SUIA 3TFWA 2FCAA 3IV6A 4RTSA 3TPZA 3FRIA 3GPGA 3A27A 2PKWA 2OZVA 3GPQA 2HWKA 4P58A 2H11A 4C06A 1G55A 4RWZA 1TY8A 4EK9A 1ZQ9A 3EJGA 2FK8A 4QPPA 5EEHA 1UWVA 5EHIA 3C3PA 4FGZA 5E9QA 5GM1A 3B3JA 1G8AA 3OFJA 2IH5A 4X60A 3CJTA 2P41A 2CWWA 1XDUA 2ZLBA 4X2TA 1RJGA 2JHCA 1JSZA 5EKUA 1RJDA 5K0JA 1QAOA 3BWYA 1BHJA 3GGDA 5BW5A 2XD7A 3QOWA 4EKIA 3JRUA 3MTIA 3HNRA 3A4TA 3C3YA 3UFBA 1P1CA 4QTUB 3JWGA 3HTXA 4ABKA 3DMHA 3EVZA 3TM4A 4OQEA 1FP1D 5T64A 4FR0A 3OE4A 4FT4A 1L3IA 5DSXA 3Q6ZA 1KPIA 5K0GA 1G60A 3DMGA 1R8XA 5CVEA 2YUIA 5EMJA 3P2KA 1VE3A 1M6YA 3MQ2A 2PX8A 5HILA 3NDIA 4M37A 1WXXA 3UA3A 2UYHA 2GB4A 1XCLA 1SPVA 4KVZA 1D2HA 4CKBA 4P7KA 4M36A 5C1IA 3LHDA 3M70A 4RTRA 2EX4A 1AF7A 2ZZKA 2L8RA 3I9FA 9MHTA 1NBIA 5ICFA 3A7DA 3ER9A 3PFHA 3UJ9A 2ZIEA 5E9JA 1AQIA 3KQYA 5ICCA 5CUQA 2AOWA 1X19A 5FA8A 4ABLA 3OU2A 2ERCA 3KQZA 4KIFA 1EAMA 2HNKA 4RSRA 2ZW9A 4E2YA 2O06A 5HOQA 3FPGA 3GNLA 1YB2A 4MHTA 5K09A 1PRYA 2IP2A 2AN4A 2PX2A 3KKZA 3UJCA 4E33A 5JR3A 4PYKA 3DUWA 4PNEA 2EJTA 1QAMA 4QQKA 3FYDA 3VFQA 5K0LA 3Q87B 5FADA 5E1BA 2Z6UA 2YXDA 2IBTA 3GCZA 5DUSA 1R00A 2CL5A 3ID6C 5GP1A 2PV0A 5FSXA 1QANA 5ERGB 3CJRA 4C07A 4CKCA 4E2WA 3M6WA 3HVKA 3JWHA 3LKZA 4PYNA 1VQ1A 5BXYA 1VP9A 5FSVA 3MERA 4JLLA 5H02A 2BFQA 1SQFA 4CTKA 5DT2A 3DH0A 4DKJA 2WA1A 2IDKA 1NW7A 5KQSA 4X1OA 4Z2YA 2N47A 2OKCA 3ELDA 3B7PA 2C7PA 5GINE 2Y1WA 1NW6A 2WA2A 3PVCA 3BGDA 2PX4A 4JXJA 3T7SA 4C03A 1ZGJA 1ZKDA 1YD9A 1NJRA 4LECA 3HCCA 4BY9E 3RIEA 1VPTA 4AZWA 7MHTA 2PXXA 3EMBA 3EWOA 3DULA 3FRHA 3R0QA 4PGHA 1X1DA 3VC1A 2ZIGA 5KVAA 3E8SA 1V39A 4R8RA 1YFLA 3JWIA 4RTNA 3BT7A 2PBFA 2IFTA 5HOLA 2OB1A 1G8SA 1R18A 3GRRA 2P1DA 5FQOA 4QPNA 4MQ4A 3HVIA 4RTKA 4PYLA 2G70A 4PIPA 5EZQA 3KR2A 3MCZA 1TPYA 1O9HA 1NE2A 4OX9Y 3PX3A 3NVMB 5FWDA 2V74B 3FUUA 2XVAA 1ZHFA 3I53A 4TU0A 2ZZMA 3B89A 2BFRA 3KPYA 3K6RA 3P97A 3MAGA 4P7JA 3T8WA 2YX1A 1I1NA 2EWBA 2ZBQA 1RI3A 5CM2Z 3T0IA 4ZX9A 2BM8A 5FTWA 1BOOA 5LQJA 3M4XA 4HTFB 3BXOA 1XDSA 1MJFA 4R6WA 4GOOD 3HA3A 3KQPA 3GJYA 4JGKA 3IEIA 3BZBA 3R9XB 5CCXA 3DMFA 4IQYA 5K01A 2AOVA 1H1DA 3U81A 4GF5A 1QZZA 3IIDA 3FUWA 3GQEA 1NKVA 3VSEA 1LCPA 5CVDA 4ER6A 5E8JA 1DUSA 4AZSA 5EEGA 4ER3A 5U4XA 2FHPA 5F2NA 1Q0SA 1Q0TA 3OE5A 4GOLD 4GC9A 2BR5A 5CVUA 5E2BA 5EIFA 3I58A 2ONZA 2AFCA 1SUSA 1RJEA 3FYCA 1N7JA 3EEOA 4EKGA 1F3LA 3OZTA 2OBFA 2AOTB 3GWZA 5T6BA 5FHQA 3UJ6A 3MCTA 2LGRA 1FP2A 4UOEA 1NV9A 3GPOA 5M5BA 3OZRA 3HCDA 5K0NA 5D8NA 1FJXA 3FPEA 1SVUA 3H8EA 2P3QA 1FPQA 1UFKA 1R8YA 3P71T 4KDCA 3KR0A 1DCTA 3AY0A 1WY7A 4IV8A 5BW4A 1BLLE 1LAMA 1TW2A 5P8WA 2NXJA 3LDGA 2PXCA 3S68A 2GAFA 1EG2A 3X0DA 3HA7A 3PT9A 1AV6A 2FRXA 3SM3A 4GOND 1VIDA 2G8NA 2VDWA 4ZTBA 2R3SA 4E2ZA 1NW8A 4XCXA 4YUYA 5DTQA 5K0EA 1N7IA 5DTMA 3EMDA 4LWOA 2ONYA 5KQRA 4RVDA 3JZTA 4QVGA 5LQKA 2GLUA 3FTFA 1INLA 3H8FA 3EWPA 1RI4A 2PXAA 4UMLA 3ANXA 2YQZA
chains in the Genus database with same CATH superfamily
1KZHA 1KEEB 3GHHA 3I37X 3L1KA 3UIEA 3W2EA 3IIJA 5CVNB 2XNDD 4MUIA 3QSDA 1SVLA 2QTAA 4HFNA 1IN7A 2XNDA 1U65A 1Z82A 2Z1MA 3FUTA 3FVWA 3FZGA 1Q57A 3NW9A 2R9MA 1P62B 4PYOA 5B5SA 5AW7A 2XBMA 2PZ8A 1A50B 3DKPA 3QOXA 4PCUA 5KDLA 3WYCA 1SP4B 3RUPA 4RTMA 1LSUA 2AN5A 3KKPA 4L2IB 4CTJA 2FEOA 2HF9A 2JRLA 3OFVA 4JCOA 1FNMA 3TMAA 2RHBA 5K4GA 3QUQA 1UKYA 1NI5A 1Y1TA 5FHRA 1A8HA 2WYHA 1TVEA 4N82A 4BFSA 2C00A 3ZHZA 4UAGA 3I34X 1U8XX 3PP8A 2IOHA 3RRMA 3HVJA 2ZRGA 4QRHA 3PNMA 1LPPA 3KALA 4CIVA 1XR3A 3EQ2A 4G09A 2GZHA 5JSZA 4AO6A 1N34B 4R2JA 4G8DA 4DRXA 3O8CA 3JSAA 1XMOB 2WIGA 3ZLTA 4DLKA 1NJGA 1RMYA 3RBZA 3GPBA 4AKHA 1J0DA 1F2DA 5E1OA 1T1JA 1F9EA 3G2NA 1QVWA 2FZKA 2WF5A 1WEKA 1ESNA 2EG5A 2ZULA 3DAYA 4HAIA 1TVKA 4LXHA 4ANFA 1J8FA 3WFIA 3K1JA 3MS4A 2ZCVA 2FRAA 2VHFA 3OLYA 3SQNA 4JCCA 1FS4A 3K9CA 4PPNA 3V2BA 3R8FA 3DBHB 4N3NA 2MDTA 1EDDA 2IDMA 4DG8A 2AD1A 1LQ2A 2GZ3A 4M1SA 3AYXB 3OOHA 5LIPA 3CM0A 3GAAA 4LTMA 4RORA 2BJHA 5FTMA 1Y1KE 2JGEA 1PR4A 1YCDA 5DI3B 3TUJC 3ZCTA 4CM6A 3EFOA 3GNQA 3G6KA 5BURA 4MX8A 2VWQA 3BTSA 3KJQA 2GFOA 4X6XA 1R6AA 3TD2A 1FFGA 1V11A 3CLHA 2DWUA 2OHXA 1KI6B 1ODCA 3M5DA 4BN5A 4C2UA 3AI8A 4QUBA 5TC4A 4PRKA 1AS2A 1JIVA 1G2PA 2NVUA 4KYIB 1BCSB 4DMMA 2Q0HA 2CDNA 3PC7A 2FFBA 4HT3B 1HRKA 4FDVA 1PGJA 3PUKA 3KELA 4IXWA 4DCJA 4F21A 3B7GA 3NHMA 1MORA 2ZYDA 1PX2A 4F92B 1NQ5A 1ABBA 3FCEA 1CF9A 4HH0A 5CX1B 4DB2A 4V0ME 4DDMA 1TZJA 2CVHA 5IHXA 2FZEA 1LZLA 1W9HA 3HCAA 4EENA 2P2SA 3NGMA 3I73A 1G5HA 1NFRA 2D13A 2EBFX 3CXRA 5DBEX 5AJUA 4OFBA 3HD3A 4LX8A 2OBMA 4QU5A 4LZLA 5ARBA 4YJDA 1QHXA 2IE0A 1M2EA 4P5EA 4WESB 2PPLA 5IDXA 1QH8A 3U6KA 2I6SA 4G86A 5A3SA 2PFSA 5LOVA 3W7AA 1H9BA 3AKEA 5HWSA 3TGPA 5F98A 3GVXA 1JBEA 4P6EA 3CLSC 5A4MS 3GJSA 3KTAB 1MGPA 3QWFA 1KQNA 2ZITA 3HV2A 3RKRA 1JFFB 2GD6A 1THZA 1FP6A 3VV2A 1XRPA 1NF8A 1M6NA 3BRQA 3AB8A 2VSNA 3I1IA 3LUKA 2JAOA 4RPHA 4RYDA 4EHHA 1H1LA 1I9CA 2AR9A 1ZA1A 1LDNA 3VHLB 4FBGA 3W5CA 3BHMA 2QIOA 4AUKA 2GJ4A 4P32A 3S8EA 2XKJE 1KY5A 2GX6A 3ZJYA 1M83A 2BGLA 3BWBA 1DEUA 3TM5A 3FFWA 5C32A 4YV1A 2KX7A 1Q6ZA 3IDOA 1XCJA 3K05A 2ZR9A 1DADA 3WGLA 1KR5A 3H1TA 2P0EA 5ED0A 4B40A 3ZLJA 2AFVA 1X14A 5LZ2A 2OT3B 3CX7A 3M49A 4J6EA 4F3TA 1M1UA 2D06A 2UYYA 3PQDA 1ID1A 4HWRA 4OGGA 3BDIA 1XZNA 5HF8A 3UJAA 2J0QA 3UG6A 4YJ3A 4W5NA 1JNYA 2QX4A 4QXRA 4U4AA 3RG2A 3O95A 4Q8HA 3JAMA 4YONB 2HW8A 2Q62A 5EMNA 4F84A 1L7MA 4OGLA 2CDCA 4EI9A 5CCBA 1DC8A 3V7FA 4KWIA 3NS7A 4JASB 1EJ0A 4ZWNA 3KYBA 2QRVA 3KZWA 3PEIA 4PI3A 2JTCA 1M8GA 2OUIA 1FQJA 1IBCA 2DUJA 4WNAB 1NPZA 1BVHA 3EOAI 4JWKA 2CFSA 1NSYA 4LZWA 2ZSAA 3DW1X 3QFCA 4GXNA 2PKEA 2WYUA 1GITA 4P1ZA 2DFKB 1B00A 3SVZA 2OCIA 2CFOA 1CV8A 1Y9AA 4TLEA 3R3JA 3VPAA 2PT9A 3QFRA 3NJRA 4DQLA 1AUPA 1CUGA 1LRJA 4EW3A 2EFJA 5F1PA 2YZ7A 3ND6A 5BO5A 4AZ0B 4NXNB 3J80A 4AJPA 1UP6A 3EBPA 4HZGA 3UKJA 1CLUA 1OWMA 5AI8A 1EFKA 4IZOA 3GMIA 3NRJA 2IV7A 4YXFA 2I34A 1XZPA 4OKSA 4V0RA 1O5TA 4PNPA 3BXPA 2TS1A 4PRYA 1SD2A 3ZV6A 2HPAA 1ZKMA 4ZVMA 1QFJA 4HVAA 1P5HA 2DPLA 4CI0B 5JTUA 2ZWVA 3WLRA 5JHGB 2E4AA 2Y2VA 4ZT7A 5CYOA 2DLCX 4FFOA 4GI1A 4L6IA 1A9YA 4XIIA 2CJFA 1G3RA 3DOIA 3EJFA 4YJHA 2FSPA 2Q3HA 3L9XA 1Z47A 4ETWA 1SKQA 4JB2A 2XUFA 1KVSA 2H4XA 1SXIA 5JH7B 2QWXA 1UBCA 2O7NA 2ORIA 3CUTA 1NPTO 2VZEA 4JR2A 4JDPA 1JDBB 1I3CA 1XA0A 1GZHB 4PC7A 3WIUA 4LF6B 2JCBA 2ZBDA 3D6JA 4ND6A 2NUAA 1TYBE 3GA7A 2OENG 4MXDA 4YCJA 4LF8B 3OVZA 4CDDB 3HUFA 4RPGA 3ZDXB 4QEDA 4R71A 3I61A 2HU5A 3IJ5A 5HIIA 3GLGE 1QG6A 2ZXEA 3A1CA 5AK0A 4O4IA 3TPCA 3ZUAA 2NO5A 1VM6A 3OY2A 1M1XB 4RZ2A 5CXXA 1QORA 1MDBA 2IGBA 3TL2A 1ZNQO 5IWCA 1RC0A 1ISHA 1AZLA 4Q9IA 1UXJA 4WN9A 1PJRA 5J3JA 1UBFA 3PHLA 1FQOA 5DI9A 5HIMA 3ZI4A 4C7JA 1G66A 1NUAA 1MW8X 5HUQA 4MZOA 1E1QD 4OQDA 4P92A 4NARA 1Q95A 1E1QA 3ZGVA 4WA8A 5AW6A 1HUCB 1YI8A 2C7OA 1P5RA 3ZLBA 3U7JA 5LP1A 4DV5B 1EP2B 1C9MA 5IVDA 3DTNA 2M1XA 2XSZD 3PHJA 3AKDA 4M6WB 1PT9A 1AN0A 2XSZA 3E9DA 5I8ZA 4FMCB 5LA6F 1JDTA 2YN2A 1TLOA 3Q2OA 3H9UA 3NKVA 4Q7JB 2R47A 5CCDA 1KSFX 2GA8A 1PL7A 3NIWA 5IYZA 4KFSA 3GRAA 3T15A 2BEKA 1I3NA 3UOWA 2NM0A 4HAUA 4Q1DA 3G68A 3LHSA 1PVDA 3VFDA 2WYWA 4PHHA 5BQ3A 5JXJA 4WKGA 5BSMA 4B3HA 3UV3A 1KJNA 1A2KC 3I6YA 1U8FO 1XNHA 4CN8A 2UVPB 4RBNA 3L7IA 1WHTB 1Z07A 2FW7A 3MIZA 2QLJA 4NYMR 1N92A 3TSYA 3DMDA 3OQMA 4D9IA 1YBMA 1KIAA 3G82C 2PNJA 4JMPA 4ZAFA 5KO2A 3KPJA 2DEUA 5T4FA 1FSGA 3WB2A 4EUKA 2GNPA 1P1RA 2O57A 3U60B 2F6RA 4GKAA 3RAFC 2QUKA 1BX0A 1V5GA 3H89A 4FZ5A 1BOFA 5TQJA 1KAHA 3MD0A 1O97C 4MGIR 4AJIA 3ILXA 4GNKA 1I6KA 3MB5A 5I7SA 3U8EA 4ZZ1A 5IASA 3AKYA 3DZDA 5DHQA 2OQRA 3RJZA 2NUTA 5LQCA 1L7OA 1SHJA 4LRXA 4QODA 3KQNA 1V8DA 3C0KA 5D2CA 5DX8A 2FKAA 3TQIA 5AHXA 1GTMA 4EX7A 1V1JA 1E94E 1UF9A 2EFGA 3EVNA 3QTLA 4RSMA 4EPXA 2O8EB 5EPEA 1JU9A 3KC2A 1MBZA 2XWPA 2GK7A 2F2TA 3O2QB 1UMBA 1EM6A 3OUUA 4MQEA 4YJGA 1WUHS 2H18A 1MZVA 3BD7A 3VBEA 3OZ7A 4IXTA 4YRSA 2A0UA 4I46A 5H1YA 3NHJA 2R7NA 1LDBA 2A30A 2H0RA 4MR8A 2CGEA 2RHTA 1PWXA 4KXNA 1ADGA 4UUQA 1AMUA 4JXXA 1Z2PX 1JECA 2R8OA 3P2IA 5AT1A 5DEIA 2EFDB 3K73O 3NHKA 5L7TA 3RR2A 4RVFA 3J81A 4DMFA 1JLKA 3SJAA 1B8UA 3WZMA 2B6HA 3G5AA 1IB0A 5E6UB 3OICA 2AZDA 4KPGA 1DG1G 1QTNA 3MK31 1PYGA 1AJEA 1CS8A 5HGXA 1O6GA 5AW0A 1WOMA 2P91A 2RGYA 2ZBUA 1QFMA 4TLDA 5C1DA 1HTTA 2RGEA 2GTPA 1NY6A 4JC5A 1H4QA 1ECJA 3I2GA 3SE0A 1R9MA 1UXKA 5BWMA 1MJ5A 3RC9A 4PX9A 3I23A 3QV2A 4NYIR 1SVMA 5CFQA 4K2AA 4BX8A 2YMPA 4G36A 4ZYLA 4QT4A 4OA8A 2D7CA 3IUQA 2IEGA 1KAEA 4QBIA 1EVKA 4MDYA 4IIUA 2BY4A 1JP7A 3PFKA 3HUDA 2FR0A 2DUWA 4O4HA 3HDVA 2EKQA 2Z04A 3C6KA 3NHRA 3UZUA 1A9TA 1N9GB 1OSNA 1ECGA 3AVPA 3QKUA 4TLMB 5IU6A 3CEMA 3ZCPA 3G8AA 1NQVA 3PGLA 4Q9HA 3ILSA 4ZO9A 3RSQA 1ENOA 1HDGO 4N01A 3LECA 4RYLA 1QYCA 4PSDA 1ZD1A 3RVKA 3DC7A 2BZSA 2G3YA 3SIHA 1CQXA 3B8HA 2GNOA 1C8LA 5DBFA 3I28A 4KUHA 5JCOA 4AU1A 3N8HA 4QAJA 1RRCA 3DEAA 4EL0A 1K7FB 3D0QA 4LYDA 4YIKA 4LY0A 2VDVE 1YNSA 2QXTA 4C87A 5FORA 2JZDA 4ZTUB 2CCGA 5KNDD 1Z0AA 3QEOA 4G0XA 4GG1A 5KNDA 5KJEA 2W6ID 1Q44A 3SDBA 5K2OA 4NCBA 2W6IA 3PENA 3R9WA 3FLAA 3Q11A 4UFNA 5FOWA 2AG0A 4F86A 5EJMA 1TLLA 2Y68A 4HTAA 1UWLA 1WLYA 2W83A 3F4BA 1PO7A 4R40A 1J0CA 2XA2A 1Q7EA 3R8CA 1VRWA 3NIFB 1YAJA 3VDMA 3HXTA 2PGXA 5ALEA 1PJQA 3AUAA 2ZAMA 2IU6A 4NBWA 3WGQA 2PL3A 4HBZA 1H0KA 3PUXA 4RO0A 1OX4A 1RWOA 2YH2A 2AXPA 4DXAA 4KH0A 1MZPA 1Q6KA 1ULHA 2D0PB 2PANA 1E6MA 2OXRA 2X5XA 3O47A 4KQWA 5AW8A 1A4IA 3NC1C 4I2NA 2B5WA 2VP6A 4LMAA 3OM9A 3STWA 4EFDA 1IONA 1DXHA 8ABPA 1QGAA 1NWHA 1VL1A 2HRDA 4P53A 4D80A 2LDXA 2PT6A 5E7IA 2C5HA 5LLDA 3I09A 2EBWA 4GXRA 3LWNA 3RTBA 3OCUA 3HXPA 3CG4A 3GH3A 3MCWA 4GQBA 4XQGA 3D3JA 2BJWA 3AUTA 4HGYA 3TB4A 4UU1A 5BN4A 2OKGA 2EKPA 3N0WA 1GTJ1 2WABA 1N1MA 3P45A 1OMOA 5HKOA 4K9PA 4WNIA 4FDAA 2QP3A 3P4XA 2EHDA 3H5VA 1FFSA 3K53A 3L9WA 2P67A 3HJAA 1UC8A 3GRCA 4U3JA 5CDUA 3EWRA 1PZMA 2ECOA 2Q3LA 2SKCA 3OZFA 5D6NA 2PSFA 5HS6A 2XQGA 4EUSA 3N2KB 5JQGA 1GUYA 1RQLA 2HZ7A 4JENA 5TY0A 4YCCA 5ITSA 4G0UA 1ID8A 2IXGA 3HBNA 2GI4A 4G23A 4IEIA 4OQXA 1JDSA 4M7RA 1GT6A 4C6HA 5EJ6A 2WUVA 4I5IA 3FAZA 1TQ2A 2NT4A 4F5WA 3CW9A 4IVNA 1DE0A 3G1WA 2WEKA 2AZTA 2PRIA 2BFDA 4ZAGA 1ZWKA 2ZR0A 3IHWA 3S40A 2HREA 1GA4A 3VJMA 3A2NA 3TOSA 4L1KA 3M83A 4RV5A 1Z5VA 4A8JC 3IVCA 4B34A 1CNMA 1N0IA 1T9ZA 2J3JA 3RHTA 4KAXA 4ZRDA 4GM1A 3WK4A 1IQPA 2R79A 4PZPA 3CE6A 4PQFA 2AFIA 5B1HA 1O9GA 2QM8A 1ISJA 1G5FA 3IMFA 4GPBA 3OMXA 1RLJA 5B2ZA 2VF8A 3MWYW 4M3NA 5JRZA 5KTOA 5KYGA 1XKGA 3U44B 5LXTF 3WLAA 4DDTA 2BR4A 2EJVA 3ZW8A 2Q9AA 2ZU6A 3WIVA 2OGSA 5JNWA 3BXEA 3IPCA 3EISA 3T5BA 1H3NA 4FDLA 4U9IS 1C1DB 2V7EA 3NUGA 5E9AA 4K86A 3RIMA 5IUNC 5L3QA 3KX1A 4JT9A 1VHUA 3LLCA 5I4CA 1J0EA 3C3DA 5K3DA 5EKDA 3WOHA 3RBXA 1JUDA 2B8TA 1O3YA 1QS0B 1WUTA 1G291 1WW2A 2GRJA 4Q03A 4U6NA 3VVBA 5DM60 2ZETA 4Y1RA 5AYVA 3WL7A 4XLTA 1T9HA 3S28A 4Q4AA 3P9NA 2B1NA 5GV8A 3KW9A 5FOTA 4BZWA 3H5RA 4TYQA 2HUPA 5EFOA 2OHGA 3LQKA 4Q21A 1R0CA 2ZI7A 4JVNA 3ZU5A 5FTNA 1UM8A 2BFMA 2VAVA 4YYUA 3C98A 4MKRA 5KNCH 5FA6A 4MP8A 1KYVA 4DJAA 1U98A 4XUEA 2WCTA 2K4MA 2SKEA 1HE2A 4F45A 2GKGA 2QLNA 2GHUA 4AKGA 1MTOA 2MU1A 1CXZA 1P1KA 3HZZA 4P08A 4UBOA 3ZDQA 4JS0A 3NBXX 5CBMA 1Y9ZA 1T8UA 1XMQB 3BE6A 4KIGA 1C3EA 4F5YA 2CT8A 4JI8B 4QDKA 1BVUA 5HKLA 3FPLA 4RKWA 1TAUA 4P3PA 1G4UR 3RUEA 3E05A 3E22B 3PUYA 5K45A 3WS7A 3PQEA 3HPRA 1DIBA 4ZOLA 5EJIA 1AU0A 4GMXA 5ALVA 1K3TA 2V7WA 2FFAA 3BAFA 1HQYE 4YRDA 1CZRA 4FE4A 3HB9A 5JSFA 1QXPA 1QQAA 4RF1A 2B69A 4PG5A 3RRZA 2WUFA 2GD0A 3LQ2A 1PWYE 4DMCA 2AX4A 2P2YA 2ZVJA 3G6WA 3COPA 4WLNA 2PBRA 1ICIA 2ZSEA 3SFZA 3OLXA 3PYLA 1KY3A 1YVBA 1DKLA 5IXJA 3E9SA 1EQ2A 5FJIA 5IM4F 3GEGA 3KYCB 4C0SA 2J3QA 1LWNA 2HY7A 3MCVA 3UHAA 4CMHA 2DF8A 4EHBA 4XJVA 1GPMA 1Z4MA 5COAA 4I55A 1XJWA 5ADWA 2NPIA 4ESHA 2BEUB 4DSTA 4WZAA 4AIRA 3NVDA 1A9PA 5TDHA 3WK7A 2QMOA 3G5TA 3UJ7A 3DE5X 3ICOA 1R4MB 2IHYA 2ZBRA 2YMLA 1SRQA 3BBLA 2PEYA 3EFBA 4XGIA 2RD2A 1CB7A 1VE7A 3ZVMA 1CCWA 3JQ8B 1RCFA 3LAWA 3V3TA 4S1TA 1N8SA 4AQDA 3FM9A 4BPVA 1Z56C 3FHJA 3DZCA 4YRTA 2AG6A 1W48A 4UUMA 2H1RA 1N32B 3NT5A 1ZIOA 3COYA 4EHFA 2J0SA 5LJLA 1Q11A 2PUCA 1D6MA 3I04M 3HHPA 4P2BA 3MILA 4RGYA 4AJKA 2I91A 1XD8A 2WM8A 3A9TA 2I65A 3WLJA 4XM0A 3FNEA 3N76A 1L2TA 3DCYA 4AY5A 4P5PA 1JAZA 4TV8A 1P60A 1P4AA 4B5LA 5KKCA 2PKQO 2B4QA 1SPBS 3AJAA 5FP0A 3WI7A 3QQ5A 4B87A 4S0ZA 1RWQA 3V97A 2IIVA 4CT4B 2J7QC 3H18A 4F38A 1Q7BA 3K2IA 4WZBE 4YRGA 3O3MB 1W0KD 2WYIA 3GJ6A 2LNDA 3UOGA 1W0KA 2FWJA 1ZUHA 3I9KA 1BFKA 2A1IA 2YR0A 5DULA 5KWJA 1VL0A 4MYTA 1BY8A 2PIAA 3HO1A 1R0WA 1SQ5A 2W2QA 1W5TA 2XGSA 1G2QA 4GKBA 2R6ZA 1PR3A 4K6GA 1QWOA 3RNOA 4MCIA 3S0JA 1L3CA 3FOZA 1AV7A 3FMPB 4HO1X 4IJWA 3D7SA 5AM0A 1DKQA 5K05A 2EWVA 4R2IA 1HYQA 2VNKA 2Y1FA 4RUKA 5DK6A 5EA2A 5L51A 1GDTA 3DMTA 2E4UA 3P94A 3DXXA 4EP1A 1XTBA 1KEWA 3C2QA 4P7BA 1TXZA 4WL0A 4MV8A 4EYKA 4CM3A 4LDRA 3GGSA 3L4SO 3BCNA 2X7HA 1RI2A 1SHKA 4JU8A 4RDXA 4REOA 2B4AA 3PHUA 2HCTA 5ITZA 3VMFA 5CIQA 1HTWA 1TYZA 2ATCA 1GD1O 3WLPA 2ZRJA 3G49A 2HF8A 5JU6A 1DQRA 1Z2NX 3UJ8A 4MQ5A 1FYXA 2DUUA 2BL4A 5HIAA 4KBYA 2F1IA 1FMJA 2XE6A 4DREA 4IKOA 3LIIA 3HYLA 4OUDB 2MSKA 2W2VA 3PC4A 4AX8A 3WBJA 3WZLA 4Z4QA 4CIWA 1V1MA 3FXAA 3LYHA 1O7JA 2NV0A 2AJ8A 2ZYSA 1UT6A 4LJ5A 3ENZA 1BMTA 1LQUA 3G13A 2VLIA 3K0AB 4R54A 2QMEA 5HVNA 5F9HA 1JQ3A 4L76A 1F06A 1I33A 1P0QA 2CB0A 3ZQKA 3FHLA 2JLAA 4OA5A 3EZYA 5C31A 4LJ7A 5CURA 4GE3A 2GFHA 5B2EA 1WNTA 3AF1A 4PC3A 3RDPA 4DY4A 4D8BA 3L4JA 3RU7A 1SKYB 1VZ3A 1WPRA 2QRKA 2H8KA 2YYAA 4ARUA 4D1YA 1ECBA 4MP6A 4RK6A 3G9TA 3PWTA 4CKCB 3EZ7A 2WZBA 4OQYA 4YAUA 5KNBD 4HTFA 5KNBA 2H4FA 1U3CA 5ED4A 4NDNE 3TXAA 3FLMA 3VUFA 3DD1A 2W2GA 221PA 2E4WA 1EZ4A 1GPKA 1M72A 3ITEA 4DSOA 3AVVA 2J9AA 3PKZA 1XJCA 2DETA 2FYEA 1XL1A 2PGNA 1UODA 3N9IA 3JYHA 5G0VA 3AVXA 5C3MA 5I4BA 3FPBA 1B3RA 3FVQA 1CR1A 3BTVA 1G5RA 4OL9A 4PCAA 4XWKA 1QVAA 2BTWA 2JH9A 3ZLVA 1J24A 1B8PA 1J2RA 5IT5A 4BNDA 1Q0UA 2WVJA 4JUBA 1XEAA 4QUGA 3AFMA 5EMKA 3AVUA 2KHZA 1W5FA 3PCTA 2FMKA 3OEYA 4WI1A 3AB7A 4YRQA 5LC1A 4LHSA 4MVCA 2EAUA 2XYPA 4GLJA 2AUNA 4MHSA 4D9NA 2RK6A 1OZGA 1USUA 3TRIA 5B4UA 3Q1LA 3THYA 3OU7A 2F48A 1IG0A 2P2GA 4I4LA 4IBOA 2J9XB 1MB0A 3F71A 1SZCA 3EC2A 1H2AS 1QC5A 3IV7A 2XMBA 2YS7A 4HAWA 4FLMA 5I7FA 2FZ5A 4M54A 5L3SB 1G9TA 4FI3C 1B41A 3KD3A 1GGMA 1G20B 1ZI6A 3ROEA 4EY3A 2MTBA 2XQKA 4MVJI 1FDWA 1PF7E 2DAPA 2PYZA 3B48A 4PANA 4FGSA 2E1RA 4A7PA 3DBRB 3OLZA 5T57A 3LLUA 3WYDA 3O91A 1DXQA 4L7QA 2LTAA 5I9LA 4QOFA 1JLHA 2UYQA 4HDSB 4HNRA 1KI4A 3UVEA 2FW1A 2PMWB 4Y1GA 3Q3JB 2HYDA 4XYLA 4GT1A 4XDZA 1QYDA 2QUAA 2BSQA 4JJEA 3N39C 3WC4A 1TK3A 5JISA 1MAHA 1SC9A 4X93A 3GJTA 3VR6D 4LE0A 3WA6A 5A3JA 3H1PA 3S1SA 3VR6A 3GEHA 5FFNA 1U0OC 1G98A 2PRKA 3BIWA 4MVJD 1CQDA 1MGOA 1NVVQ 1V95A 1OAOC 3EIWA 3HKDA 4MVJA 1DKNA 4RA6B 3V6MA 4AF8A 1U9WA 1C7FA 1G7CA 1YI1A 4DNOA 4EJSA 3LQ1A 3N0RA 1ADCA 3RSOA 4D96A 3TAUA 1YQEA 4K1LA 1S1MA 1FMFA 1L4EA 1XYYA 4EHLA 4GI3A 1O1YA 3Q5EA 3MHSA 3WICA 1MUUA 1W88B 3NHPA 3T1QA 1ML4A 1G6KA 2A14A 4Y2QA 5K3FA 2JD1A 3W5BA 4A5OA 1E9EA 1DP4A 3ETHA 2IX3A 3RTCA 1XZHA 4OYRA 4PR0A 1WZCA 4RMHA 4Z7OB 4BGDA 1RRKA 2AQHA 3KR1A 2PK3A 3OISA 5LFAA 2EXXA 1XZCA 3D8HA 2CF5A 1G7RA 2I4MA 3U13A 5KPJA 2GR9A 1AA6A 2B98A 2HCFA 4LCJA 1XGKA 1A82A 1EWRA 2JGRA 1SCIA 3C3JA 3ASYA 3BMQB 3GZTB 3ITNA 1JTFA 3R5SA 2JFPA 3K9QO 4FYXA 4JGGA 4G1BA 1QOQB 3KKQA 4WFQA 4XGNA 4E12A 1Z13A 2X14A 3FGNA 3KZNA 5ALOA 4A0SA 5JCOC 4B5KA 1ORDA 5LYJB 5EZYA 2X5JO 3N7UA 3W9UA 3WYFA 1RAFA 2KMLA 2UZ1B 4CT5A 5ES3A 4TT3D 5C8YA 4HDRA 1NFQA 3BK1A 2IYEA 5C46F 3PUVA 4TT3A 4CQNA 1CR4A 3ERCA 1EVYA 4UEQA 3H2YA 3B60A 3LMKA 4PZLA 4YA6A 3X2SA 1KO4A 2ACVA 2WDPA 3ORHA 3ANLA 3BJMA 5CH5A 5KUTA 1GLOA 3B6IA 3OKPA 2J1LA 1EFCA 4LY6A 4HNAA 3BBPA 4Q3BA 2VP0A 2YXBA 3H87A 4TKMA 5EIBD 1BXZA 3VZQA 4WFIA 2J6IA 5A2GA 3K5IA 2SICE 2PGAA 4LXUA 521PA 4F06A 4OEMA 3FIJA 2GD2A 1S2DA 1V6SA 2F1GA 4WERA 3ZEAA 3PQFA 1MC5A 1NVAA 3PNSA 1F2TA 4MMYB 4WT7A 3WK8A 2NSYA 2MSCB 2DRIA 3O3NB 4LRWA 3D3QA 3SS7X 5AUPB 1JTEA 1SC1A 1EE1A 4N0QA 3UXHA 4YYQA 2O8NA 1QGUA 2C3PA 2OXCA 4HB4A 3QX7A 1VRVA 2D1YA 2G6BA 2JHAA 3HM2A 3KZXA 4HLCA 4HDKB 1J2TA 1L4YA 3RUAA 4JYBA 4OLHA 4QBHA 3K0SA 2FWIA 2O7SA 2LIVA 2WZQA 3F5SA 3ZDYB 3BQMB 2YJBA 3P1JA 4FSDA 2REQA 3HR8A 4BGUA 5BXQC 3B52X 1TU0A 4UU0A 1G21A 2L0XA 3K0HA 1XA3A 3F6RA 4MB0A 4QIHA 1MEEA 2XB2A 1JI3A 6REQB 1DC6A 3IQHX 1E1DA 2JZEA 5EE3A 1T6YA 2YMQA 2HQRA 3QMVA 5THKA 2BCEA 1RKUA 4ZXFA 1U9YA 1H2XA 1H23A 1IBSA 1P4SA 1T3GA 2WUWE 3HJTA 4WK4B 3X1DA 5AM1A 1T6XA 4BPBA 1Z3CA 1IWPB 1GRVA 1KBZA 2ANBA 3D4IA 3E3AA 2PGOA 5F5NA 2FWPA 4A27A 3NX4A 4DC9A 5F9MA 2BKEA 3QEKA 5K3SA 3ROZA 4RDHA 2GQ0A 2BI8A 3DLAA 2FHSA 4Y9UA 1KBOA 5AOCA 1JIKA 2HNBA 1X1EA 3DQPA 3LGAA 3X43A 4L4YA 2PA0A 4TT8A 1RYHA 4GOMD 2N1BA 3OOYA 1YZHA 2ALJA 2BDEA 1MPXA 1Q16A 2LE0A 3PPXA 5EWJA 3Q85A 3FB1A 3ROXA 1ZVKA 2YN4A 1P3Y1 2PM8A 4GR5A 3IHTA 3UB4A 3UJPA 4ZK6A 3AWDA 1GG5A 5H3LA 1KMIY 3ZV7A 2JCXA 4OW0A 3Q71A 4LBVA 1Y6RA 2C2BA 3KUUA 1OWOA 1CP3A 5JWHA 1J0XO 2OV3A 3DUFA 1X7XB 2FEAA 1DJLA 1T6ZA 3RVOA 3ZWWA 4BLUA 1Y42X 4OAQA 4BBAA 1PV4A 3CHYA 4RKXA 1Z6GA 2JHPA 1V4NA 1CDDA 5JNRA 2I7VA 3D2LA 2V1UA 1OIXA 1O8BA 2VCHA 1GP2A 4OL0A 4GBED 3IT1A 4WOCA 3TLJA 4CF4A 5LQDA 4KHPB 4ZGWA 2QQEA 1FXUA 3L8YA 1YZQA 4W8OA 5LYYA 5AM3A 3N6RA 5KEIA 4LA4A 2C3UA 4O4JF 3WP1B 1V5WA 2XI4A 2OCBA 4IH4A 4HX9A 2NU9B 5BP7A 1VKRA 3L8GA 3M6XA 4MW4A 4KX3A 3TD9A 4BNTA 3QRWA 1U3VA 4I14A 2FO5A 1WXEA 2B78A 2Q21A 2VTVA 1QLJA 2VYFA 3I8XA 1MR3F 1UBKS 4TV9A 1BS9A 3CC8A 1OX5A 1PKXA 1SU6A 3QLTA 4M55A 2X9QA 1Q50A 2D0DA 2PGIA 3ZWMA 5KTYA 4HWSA 5EESA 4DV7B 4DR1B 3ONWA 3GZJA 3Q6IA 3RABA 1KDVA 1JAYA 2XTZA 1NXWA 3A3YA 4I36A 3D2AA 4WNCA 3OCWA 2NU8A 4B3FX 3QJ3A 4UVIA 3W3ZB 4Y6SA 1AU9A 4B7ZA 2WICA 3KVYA 4KSYA 2VJLA 4MS3B 3PFFA 3JS5A 3PS9A 4JJAA 4ZQIA 5U9CA 2H85A 3G0OA 4NVRA 2VK8A 5BT9A 3VR0A 4DR4B 1QYRA 2CMKA 1YDMA 3H7IA 3WRVA 1A7AA 2QE7D 1OLOA 1DRKA 1RADA 3W8RA 2QE7A 3JR7A 3O9MA 1U7ZA 5AW5A 3ZY2A 1Z36A 2ETXA 3IJPA 4TTIA 3BRWD 2QU7A 3IP7A 4BQFA 5CEJA 5LMUB 4KRGA 1P8AA 3ABRB 3G9UA 3QVKA 9PAPA 1H66A 1WMSA 5K16A 1FLNA 1XVVA 1T1SA 4PR3A 2ZB7A 5FOUA 4KLCA 3QW2A 5ILGA 3IB3A 3BKWA 3NIBA 4EYGA 2C0YA 3TTYA 4YRBA 5JY1A 3G2PA 1EFDN 1EMDA 3T5DA 1TT5B 4BJ6A 2M9MA 5LDDC 3LK6A 1T5IA 1O96B 4M8SA 4KIJA 5AR1A 1N77A 4CMCA 1F60A 2H16A 3ZK9A 4PFSA 5DX1A 3I2IA 4Y6LA 2IXFA 5B3JC 3OIYA 2FAVA 4B3GA 1CY0A 4ZD6A 3HFRA 1DPGA 4G41A 4DCGA 1IY0A 2DLDA 1SM4A 1ECCA 1JKXA 2W4QA 4J76A 3F3YA 4P4LA 2H4ZA 2P3LA 3D3WA 1FUEA 4JVSB 5HCNA 1Q12A 1EE2A 4YUWA 2Q4EA 3HFJA 4NMXB 3NHWA 3B53X 5EP3A 5KJ6A 2OHOA 3ZVKA 5DJ5A 4TRMA 2Z58A 2IU0A 2IYPA 2ZWAA 5TMEA 4DADA 2QLFA 3ZQUA 3ZWCA 1T36A 4I4TA 4LOJA 3JQGA 4KQEA 4MUNA 5L7YA 2D1FA 1V3UA 1ZMBA 3QGMA 2YYSA 4UARA 4C43A 3GLRA 5EE1A 3WX0A 1P18A 4QPCA 2B3TA 2ZM6B 4EWLA 4DTIA 1Q77A 1KOFA 2WJJA 3NOVA 1OR8A 4O2BB 3FSEA 2OBLA 2OY0A 3MGKA 4DTCA 1RXWA 2GTIA 1JEYB 4NS4A 3U4AA 4ZI3A 4D9MA 4K9KA 2D0OB 2OFWA 3QNUA 2RKOA 1QHFA 3M3PA 5FRDA 4Y30A 4BNKA 3WMWA 1RYMA 1G2OA 2CJXA 1YT5A 2WKQA 4MR9A 4TTSA 2OWEA 4D97A 3KWBX 4Q1EA 5JSYA 2C7RA 1TNDA 2WWVD 1ZD3A 3IAUA 1XDGA 3STTA 3MBOA 4RK7A 5D3MB 1K5GA 3UAWA 4CF3A 4ZCSA 1G3UA 4TWZA 3BWXA 2O0KA 2P7UA 5E6SA 5F02A 4MRNA 1ZBDA 1UWCA 4D42A 3BB4A 1X94A 4JYZA 1XJ5A 2BZ0A 4DC1A 2AT1A 2O3TA 4KL8S 4COOA 1QRSA 4YCNA 3FWYA 4LW8A 3OT1B 4RLHA 1FUYB 2V03A 4UMDA 1A8SA 2VXOA 4AN0A 1QGOA 1CULC 1K9VF 1SU4A 2AEJA 3EMKA 4FGKA 4MULA 4NH0A 2ZI6A 5H0IA 4A0QA 4B3JA 4KQJA 2I7CA 3WADA 3KB2A 1QVRA 4XWGA 3AF4A 3T9CA 4EGSA 5JNTA 2EWWA 5AKIA 1KAQA 3QVGA 3ZD7A 2HCJB 5FOQA 1NASA 5F1OA 4Y7DA 4LSWA 1Y81A 4S24A 3DE1X 1RM0A 1X0VA 1A77A 4HDCA 3K71B 2WWYA 1VDZA 1XZBA 2EX0A 4CG2A 1U90A 1RQ2A 4LVUA 5G4KB 4YCDA 1DZ3A 1L7NA 3CLUC 2IXBA 2JGDA 3OD5A 3KJNA 4LISA 1JHZA 3FZEA 1BDJA 1XTUA 4HCJA 4O4LF 4PC1A 5I9BA 4CFSA 3K70B 3PRMA 3KR4A 3OM8A 4JJFA 4FI3F 3NNDA 4UM9D 4PZYA 3CUVA 1JHVA 2PJUA 1ZRSA 4BUJA 1FXSA 1HH4A 3S4YA 3MUNA 1EF7A 4X1YB 2K87A 2EBUA 3DO5A 3USVA 5ALUA 4XLZA 1O08A 1V26A 1OCEA 2AK2A 2OK8A 1M6EX 3KJHA 3LBFA 3NTVA 3PG5A 4QEZA 4R81A 4W99A 3ZTWA 3QX3A 2P90A 1E8DA 1GG8A 1E5VA 1I80A 2PTHA 3Q3CA 4XRRA 2DX7A 2UZ3A 3PX2A 1TCAA 1L5RA 3TTVA 2QMQA 2XDQB 4JXKA 2ZSHA 1BGOA 1YK7A 4G89A 2WIKA 4JB0A 4RIHA 3B2QA 4EW6A 3JQ7A 1BGWA 4KQFA 1O95C 5DHSA 3WR5A 4Y9SA 4ENUA 1NMEA 1QRTA 3CX4A 4V03A 5PNTA 4B6JA 4BWFB 2IVZA 5HFJA 4L8GA 4OMDA 3DF7A 5EUMA 4BMSA 4BTLA 4UMVA 2RC6A 1RHUA 4PGMA 1IU9A 1MB4A 2IUUA 1KSJA 5FXMA 3UK0A 4F91B 2I62A 4B3DA 3FPJA 2GPJA 3N6XA 4M0WA 3K9NA 4RJIA 1O54A 1X87A 2HRQA 1BW9B 3I0NA 1YDHA 3AERB 3IVXA 4QGAA 3UPTA 3AVWA 3VNQA 3K35A 7REQB 5HJ5A 4A6DA 3PPYA 2O8FB 1JU4A 1K3UB 2A5YB 1BU5A 4PVDA 2DZDA 3PSHA 3IAEA 5KC9A 3CURA 4KITB 3HVHA 2ZWPA 5CAEB 4B4VA 4C76A 3LSTA 1Y08A 3GL9A 1MDWA 1ZD2P 1QP7A 3W06A 4D6PA 5GWXA 4RTPA 2V4UA 3HU1A 3PW3A 4YUAA 1DC4A 3P0EA 4M0UA 4YQYA 3QPUA 4OXKA 4EG5A 4F4IA 4FHZA 4DYDA 4NBSA 3N3GA 2OO3A 1WMAA 2JVJA 4R41A 1QOZA 2AEEA 4R1LA 1R5BA 2BH9A 5DGTA 3R9IA 3AUUA 4MYHA 4DLSA 1RHQA 1TYAE 4QLBA 2UZJA 1QP8A 1HKUA 4BMYA 1WUYA 1JXMA 2EKDA 3BMOA 1J8DA 3PGXA 4J3FA 1EBUA 2OTCA 1BH6A 2B20A 1ZY2A 3OQ6A 4PSVA 2BFNA 2IDJA 4QUIA 3T7RA 1X7WB 2IPAB 5H8WA 1G3QA 4NHEA 5EJ9A 3RYFB 4BVLA 3G2OA 2VJKA 1X42A 3JSXA 1DX6A 4BNYA 4LDJA 1A7JA 4HYTA 2QMUA 5K3EA 3THWA 2HBQA 4QYWA 4IMRA 5B1IA 2XJ9A 4ZARA 4WLOA 3H11A 4TKUA 3KQKA 2V6JA 5BOSA 4JNKA 4FJ2A 1AUXA 2FG1A 4N9QA 5K0FA 3GVIA 3F3MA 1NNI1 2ZRDA 1DFIA 4RNCA 4DIDA 1NBEA 2HSDA 3REQA 2BP7B 2D2FA 5AKHA 4NJMB 2A2ZA 5FI5A 2A94A 1N2OA 3CRZA 3U7QA 1SNKA 3L0CA 1U2QA 4G3XA 4I7EA 2CBXA 3IGFA 4DILA 2OM2A 2C0PA 1HT3A 1WSAA 1OPRA 2FEWB 2F9MA 3EAFA 3W9YA 3B82A 4FZVA 4EO4A 1EZ1A 2VUUA 4KE7A 3SKXA 3BB1A 9LDBA 3ODGA 2DQKA 1IM5A 2XMZA 3N5CA 2KPOA 4BMNA 8OHMA 2OMKA 1BKYA 1FX0B 3SQDA 1J06A 3FBTA 2CVOA 4JH0A 4H27A 4MGEA 3KYDB 1AZTA 1N6RA 2CXPA 4C2TA 3D02A 1LNSA 2ADMA 4AS3A 5HCIA 5AJWA 4AQYB 4C4TA 1HM5A 3BE5A 5DV9A 1DTSA 1KQGA 3GGJA 3GEIA 4COKA 3DFMA 3H3JA 1HC7A 1T43A 2X7XA 2XVZA 4JP5A 4DIOA 3NWBA 4WEQA 4QT0A 2DTDA 2VLBA 4PLCA 1WVGA 3H0EA 5D01A 4TYNA 2J07A 4TWJA 3H9QA 2P5YA 3IQXA 2OYRA 1NAHA 4D82A 4E5VA 1GLGA 3H9JA 3HBFA 4G84A 2G8EA 4ZDKA 4HQKA 4KSIA 4HQLA 4F4HA 1IJKA 4UDNA 4JEIA 2J6CA 4WFJA 2QAGC 1GAJA 3OX3A 1W2WB 2C2WA 4FYKA 2P2LA 3RSCA 2IPPB 2C42A 5JNLA 5KOHA 4FEAA 2O2GA 3PSEA 5TPWA 3SN6A 1ODLA 3IL2A 3GXOA 4GC5A 4LJ9A 4CYMA 2DT8A 1U6KA 1RYZA 3GPIA 2RHGB 1V5IA 2EIHA 3M4JA 1T26A 3PRHA 5DEOA 1MAVA 5CLJA 1QO7A 1JN0A 2OG1A 3HU5A 4EVIA 3I5MA 1L5SA 4EB6B 2IS1A 2FN9A 3EZ2A 5J2UF 1HFWA 3STXA 4HNTA 1HDIA 4LWPA 4D81A 3TQHA 4CIBA 2Y0DA 2PZBA 2ZIFA 4TVOA 5LQAA 1LBHA 1J0AA 4LRSB 5LA6B 1QQBA 1KMHA 1BSVA 3OIGA 4X66B 2BEJA 2WF9A 3QXSA 4NOLA 4YJFA 1P39A 3BICA 2W8BA 1X3SA 2N46A 4GWKA 1BDBA 3KAKA 4TXMA 3ZHUA 1UAGA 4OAPA 4QEKA 1B43A 1SKUA 2JI4A 3T7EA 5JXWA 2Q4DA 4OYYA 2QL6A 3EXHC 4GI5A 4CU2A 2ILVA 1OFUA 2ZEJA 4I1YA 2C5FA 3KIPA 3R77A 1D5CA 5T5QA 4L9RA 3TNFA 1JB9A 1H2FA 3IEXA 1K3FA 1ZUIA 1VECA 3L7MA 3K9MA 5C7IO 2VDPB 1WXQA 3BPMA 2FEKA 4O25A 4J0EA 4L4UA 3SPXA 4CRWB 2B1QA 2YWBA 4YQEA 4KKXB 2W70A 4AURA 4ETMA 3GPDG 5KHLB 5IKXA 1YS6A 2GHQA 3D6HA 4D8WA 2PG3A 4D4GA 4Y18A 4HRYA 2UKDA 1KFXL 3RLIA 1QOPB 3MOIA 4P82A 1P7WA 2E9SA 4FR2A 4TUYF 4AZVA 2BAGA 2IYWA 4H15A 3RTAA 2CWDA 5J2UA 4POOA 4UTRA 4P2GA 1F2BA 4B3XA 4YAFA 3C3AA 3VTKA 4DW8A 2OBBA 1PBNA 1C0IA 2Z3ZA 1FUIA 1VFNA 3MUOA 1FMTA 5F3RA 4EYOA 4CF7A 1EQUA 1UQTA 3R4VA 1BAPA 3WLTA 3FUVA 5DF1A 3GO4A 3HLTA 2PZAA 1NX9A 4ND8B 4ZV7A 3TLAA 8ADHA 3EGXA 1IC6A 1C4OA 1EK1A 3QVUA 4R7TA 4ZVLA 1QG0A 4BO9A 2ZB4A 1T29A 3BIFA 3O90A 4L0DA 5FPYA 3UV6A 4EARA 2BTQB 6NULA 2XNCA 3TFWA 3UMVA 5AKGA 3WRYA 3F6SA 4ZIRB 1QH9A 1QH1B 5J4KA 2JJMA 1TIBA 5EQDA 4Q9KA 1J5EB 1SN7A 1VKJA 1YE5A 1ZGCA 3C14C 2ATVA 1Z2DA 2WE7A 4RTSA 1XXHB 1PFKA 3PJEA 3F96A 2ZTUA 4PZAA 3TPZA 1R6XA 3A27A 4CQJA 3HWX1 4FBMA 2QN9A 3EGDA 2OZVA 2RGNA 2Y93A 3C4VA 3IJEB 4JI6B 2W9XA 4HUJA 3DL4A 4OKIA 5E7JA 2F1HA 1ZRNA 3ZEIA 4CKWB 5JBIA 4IY1A 1I10A 2H11A 5GVRA 4EHDA 5HM6A 4BO2A 4YI3A 4RWZA 3RC1A 3OPYI 5FV4A 2H06A 4KRXA 1PIWA 1QUFA 3G8CA 1MU0A 3P5XA 1AA9A 1WF6A 4X84A 1P3JA 4QJ3A 3HHAA 1BX3A 1U5AA 4NYJR 1GCGA 2Q0XA 5DYGA 3T6KA 3OZVA 1C7QA 1Q0HA 4M1OA 3ZD8A 3HBJA 1JEQB 1NYRA 2LCFA 2UVDA 3C3PA 2LUOA 3E9RA 1JEOA 2HM7A 4OH1A 1YZGA 2HMVA 3IUMA 3L84A 2QQFA 5E9QA 2D5BA 2RK4A 1JDVA 4NEGA 4RLQA 1P2VA 1C0EA 1NUQA 2QT0A 4JOQA 3B3JA 4P4NA 4XW2A 3UUGA 5EHNA 1H3FA 3A36A 3AESA 1KJZA 4RHXA 5BUZA 3O1GA 5BMVB 2QKYA 4AECA 1MRZA 3SJUA 1JQBA 4RF0A 3C48A 2WJ6A 5B55A 2I2XB 3O65A 4M8IA 3QJ5A 4X60A 1VMEA 3CJTA 4D57A 3K4QA 1DEKA 1WRBA 3OQCA 4MVWA 3T1VA 3MJFA 4JJ4A 1RXCA 1MT3A 4ME6A 4W8HA 4D99A 4LF5B 2ZLBA 1DI0A 1IHPA 3TJMA 3ZHBA 1E1LA 2AMVA 3RIGA 2YJ2A 2X22A 4OJMX 4YXWD 4YXWA 4K05A 2OCKA 4N3AA 1K68A 2GEKA 4OK6A 4DEVA 3PBHA 1CERA 4K40A 2DOSA 1CUCA 4PC6A 4B33A 3R23A 1VKNA 2AG8A 3PVZA 1N2SA 1X1TA 1PNVA 2ORWA 3ZY6A 4J16A 4YRRA 4DSNA 2WDZA 5KO3A 3G0HA 3VA7A 4K9SA 2BBSA 2PR7A 5T6MA 1E20A 2E3JA 4QHSA 3BWYA 4XX0B 3GGDA 3BJZA 3NOQA 3PIIA 4R5HA 3QA9A 4AUEA 4HI0E 4WJKB 4FIZA 4G5RA 1EVQA 1NVBA 1QHNA 3CF6R 4KQCA 5CA1F 2YL2A 5I01A 4U7FA 5BY2A 3RJMA 3WXMA 4G9EA 4GBMA 3OWXA 1UJ5A 2QQ0A 2X1LA 1H6DA 4ZI7A 2EU8A 2BHTA 2WJWA 3A4TA 3C3YA 2XU4A 2C5SA 4ZDJA 1P1CA 3HA2A 3ZHXA 2FF7A 1IRIA 3HTXA 3TUZC 5AVXA 1L4BA 3WRXA 1FE8A 2IEIA 3PQ2A 3VO9A 4E1VA 4ABKA 1EVJA 1XKXA 2J33A 2OECA 3DMHA 4KGDA 2QW8A 3K8ZA 4ROSA 4A0HA 4INAA 3L1VA 1MC8A 4QOJA 4MV9A 2NSJA 2PQ6A 3MWGA 3WGJA 3FTQA 1USIA 3GFOA 3PJGA 1NP6A 3P9QA 1F8GA 4FT4A 1OF1A 4NTZA 4W9NC 4DCPA 4Z9AA 121PA 3PHBE 4DNPA 4LV8B 3IDSA 4B83A 1MXHA 2VR1A 1KPIA 1WIWA 2Q45A 3SZUA 3T41A 3CH6A 4TMXA 4BO1A 5JCJD 1OLUA 3DMGA 1GGEA 2PRJA 1E7RA 1R8XA 5JCJA 4L72A 1L5HB 3H42B 1CP2A 4G0OA 1KI7A 4YQFA 3EPKA 1ZH8A 3ADDA 4US1R 3P0JA 2Q3BA 3IHPA 2PQ2A 2JAPA 1UK9A 4GO1A 1ITZA 1CE8B 2Z5FA 1C3XA 5G0TA 1NHWA 4CM5A 2O54A 1S2NA 3NIDB 1CNFA 1YAHA 3AIKA 3RVVA 1CQZA 3W2HA 4NCJA 2Y27A 5AXAA 4AXXA 1WETA 3IE0A 3P0IA 1SWWA 1YR9A 2P2ZA 2YJGA 1WXXA 4B8ZA 4BKMA 2RCYA 4I99A 2BD0A 3KXLA 3Q40A 4GHWA 3W6PA 2OD2A 3BMNA 4N76A 2IW1A 1SBZA 1SVWA 3K1AB 5DMXA 3AU8A 4Q0MA 3TAHA 4BUZA 4EW2A 3HHEA 5GADl 1TMOA 3KFLA 1KI8A 4AJOA 1F4VA 1L5WA 3T9EA 4ZHQA 1Z25A 1U5CA 2YJ8A 3L92A 3ZW9A 1B8OA 4HNUA 4LY3A 4MWEA 1JF8A 1V2GA 1F5SA 3QXCA 5A9RA 2IUFA 5M29A 4TROA 4IWYA 3GV0A 4Z1OA 4UOQA 3ZH9B 1PDWA 5H70A 1A2BA 4WK2B 1NG1A 2E4ZA 3SHTA 3WGKA 2XB6A 5JHHB 3OC0A 2VP2A 4GXQA 1QG4A 4FXPA 5CGZA 1L4HA 1J90A 5F7JA 2EX4A 4QYSA 2X0NA 5IWAB 3NETA 3SEAA 1RHJA 2ZI9A 1EU1A 4X62B 2L8RA 1E9SA 3HCPA 3KOOA 3E5RA 5EP2A 1WR8A 2VQFB 3KZVA 1W30A 2KWIA 3ZKAA 3ZTYA 2IC5A 1Y4DE 4EUHA 1Z3IX 1GZ5A 5I7AA 1MV5A 3AJRA 2R9CA 2P4UA 4YVAA 1VLZA 4YCSA 2Q29A 1APBA 2C1ZA 1QF9A 1RQPA 5M34A 3TDNA 1VIMA 1Z83A 1ZD9A 4JX8A 2NUPA 3K8UA 2OVBA 3EXAA 4I8XA 2Z98A 2IYLD 4PG6A 3EMVA 2GEJA 3D8BA 4ARZA 1RIFA 2B61A 4AVYA 4KK3A 3SZGA 1ONSA 1YZYA 3THXB 2ZIEA 4ZAXA 3LSYA 5KQMA 4Q3NA 4CEIA 4I07A 3QBDA 4X71A 4P6VF 1YD7A 2QROA 2HB6A 4GWLA 2O2HA 1NMZA 4S04A 5F2EA 3ZGYA 5SZJA 3GOQA 2A5GA 3F5MA 4UJ5A 1FXWA 3CWCA 5EGNA 3WQHA 5ICCA 3U5ZB 4XTCS 5LMCA 5J5AA 3QOFA 5CG1A 1Z7BA 1ZJZA 2HA3A 2VDMB 4MJXA 1RC1A 3A3PA 1XU9A 2ODEA 3OU2A 2ERCA 5FR1A 4BB5A 5L4SA 3G7SA 4CUJA 1CR6A 3EJ6A 4B9EA 1IBRA 1EAMA 2ADOA 1C7RA 1UDAA 2P0RA 2ACKA 3ETNA 3H2SA 4ZGGA 5JXHA 2NPOA 1KBQA 1BFUA 2A1TR 3IV2A 2P6OA 4L8LA 2JVKA 3U62A 4TL7A 4Q93A 4ENTA 3P5VA 3AHCA 3OZIA 2Q5QA 4K9QA 3WYBA 4ZU3A 1SUPA 4WDQA 2Z5GA 2NACA 1YB2A 3FF4A 1WB9A 4B31A 3RAEC 1DBSA 4AXLA 2IVFA 1SBIA 4C0LA 1PR6A 1LNZA 4I4IA 1I7NA 3KZMA 4C4RA 4IKEA 1FTWA 2PX2A 4X8MA 5DO9A 3WQQA 2ZUFA 2FZ4A 4GW3A 3KKZA 2XMQA 4I6EA 3ETCA 3OBBA 1GZUA 4HQFA 4FMPA 4DWWA 1EFTA 3DVSX 2V0NA 2Y66A 3F5QA 4DLZA 4J0KA 1UBUS 3Q9SA 3VOTA 3FWPA 1N6PA 1JJFA 4B7XA 3N75A 3ORSA 3ZX5A 3OVMA 3L6RA 4E14A 3FYDA 3GP8A 2VT7A 3V00A 4Q48A 3IA7A 1GAQA 1NBMD 3DOFA 3H5OA 1PZXA 3JPYA 4ZANA 2QUBA 1NBMA 2P2DA 1QFXA 1IZYA 2IKQA 4WN3A 5JD3A 3QWHA 2Z6UA 2JIOA 4B79A 4C2AA 6ABPA 5L9AA 1XNQB 2X3FA 4H1HA 1CEQA 4DY6A 4MSXA 2OE2A 1OVGA 1EE9A 1QIEA 1EEHA 4EI2A 1JE1A 1R00A 1E5QA 1YBFA 2HQ1A 5DT9A 4BOYA 2FR8A 4Q3CA 2VJAA 4RD0A 3KZ1E 1HWYA 3CLTC 5GP1A 3SBDA 4E1AA 3Q8XB 5AW2A 3DHWC 1R10A 2ZUUA 1S0UA 4KV7A 5ERGB 1IN4A 1JZSA 1LRKA 4E2WA 5J2TA 3M6WA 4QDTA 4MTCA 2AW3A 3CNBA 3DOHA 5BWOA 3EPLA 5EKSA 3CUUA 1WSBA 2ZTSA 1N9ZA 4N1AA 4MV0A 2B3DA 4MKFA 5IF9A 3V48A 3ZZUA 1YZFA 3MFQA 3OFSA 3PRPA 4PRZA 2BFCA 3CX8A 2WHPA 3N2GA 1CY7A 1XQ9A 1QRDA 4X1KB 5E4FA 2BFQA 1F8UA 1M2WA 2JFVA 2RSLA 1G59A 2IUEA 4DKJA 3QU2A 2CJYA 1UJCA 4RELA 3UENA 3LG2A 1KI6A 1WCV1 2ZRBA 2JCGA 4TSKA 4BRSA 2GM3A 2FW8A 3UJHA 3U4QB 1A8IA 1DF0A 4QKQA 1CEXA 1C3LA 4JWTA 3IVGA 3C3EA 2X8JB 3NV9A 4UZSA 7AT1A 4WCFA 3ELDA 1PE6A 3TGLA 2CLLB 1HFKA 4HEA1 1WCYA 1NP3A 2V54A 1Z0JA 2X19A 3DGFC 1MS6A 2QG6A 2FQXA 1WKBA 2QTBA 3H4VA 1OBOA 1S02A 2FKNA 3U4HA 4D8UA 4F2GA 1LPNA 5MGNA 3VC7A 2PX4A 4GNRA 1RXIA 1U2DA 1GXSA 3A1VA 1ME3A 1A2QA 1EVIA 1J7KA 1XVLA 1KP2A 2PBZA 2WJYA 1FL9A 1E2NA 1P61B 1S8FA 1WPQA 3CXUA 2VH1A 4MMXB 2DTXA 3SLGA 3WMGA 5K8UA 1GAXA 1Z2CA 1ZGJA 5E6RA 1DDIA 1UK6A 4J03A 1EFLA 4HN4B 1ETUA 1NRJB 2HBYA 3CSSA 3ECAA 3KLMX 1GSHA 3O92A 3P2YA 4JBNA 4WESA 5HK8A 1RWVA 2HAEA 4BY9E 1ATKA 2YHAA 3O1HB 2QS9A 2QJFA 3EUWA 4AZWA 3LPLA 4R9RA 4CM1A 3PC8A 1UFQA 3EXIB 4IMPA 4LQDA 3GW8A 1LK7A 5EGWA 3B1JA 3GMSA 3MD9A 3A06A 3KTAA 1E2GA 4BLSA 4CDMA 1FSSA 1S2LA 2JGNA 3RREA 3NEJA 4IYJA 1XKLA 3HR4A 3PUHA 4LCEA 4R8RA 1RD4A 3MXOA 3NM5A 3JWIA 4RTNA 3F75A 3IXQA 1PK7A 1U2TA 2WMOB 1IN6A 3ZJ5A 3JVUA 1N8TA 2BKLA 3UAYA 4P3YA 4IGIA 1M10A 1I0ZA 3GG9A 3IERA 1CVLA 1EFPA 3GRRA 3EXFA 3L7AA 1QLHA 3AP1A 1FTSA 2AQKA 3C7DB 1FFEA 3GJ7A 1CLEA 4AF7A 4MQ4A 5KVQA 3D6NB 1T3TA 4BAZA 1YRQA 2KQVA 4M9ZA 4UEOA 3DLBA 4J9UE 3RKSA 1DOZA 1KARA 2JKYA 5EZQA 2OVFA 3QUSA 1QONA 4UEWA 2P62A 3ABZA 4UBKA 4LDPA 4TMZA 3VSDA 3T99A 4OKNA 4JL5A 2GBLA 2BUBA 1ND6A 4OJTA 4NNJA 2Q07A 5IH7A 4OX9Y 3I6ZA 3GX1A 2FLVA 3PJFA 3PX3A 5D3ZA 2J3LA 1P3DA 3QI2A 3SM9A 4ALLA 2XCUA 2XCSB 2W6OA 3BSWA 3MBKA 1T9GR 4BB0A 3TPFA 1W87A 1TCVA 1ZHFA 3Q1KA 2CXUA 2HDHA 4KAJA 4TU0A 3VPGA 3WG9A 4ZI2A 3AFHA 3WHIA 1I32A 2NWQA 3KB8A 2IZ7A 3B89A 4PXYA 3ZWKA 4LS3A 1ZJWA 3DYBA 4WNAA 3R7WB 4DT1B 4HGNA 1CW2B 3V8MA 1PVVA 1JV2B 1CV2A 3B1XA 3GZ4A 4MA5A 4QNMA 4DLYA 1Y98A 4I0WB 1RR6A 4QUDA 5THQA 1XCPA 1IAQA 1R1DA 2IKSA 3FROA 4K7JA 3TGWA 2V7UA 3JQQA 3EG9A 1CJVC 4DIMA 3TN7A 3QT4A 4MWCA 2VWPA 3UHOA 2Z4TA 3ZNOA 1Z8HA 1SEVA 2YX1A 5D85A 2A9KA 3U7EB 3LUJA 2F00A 3GLHB 2DB3A 3QEMA 1ISSA 4URHA 1KJIA 2C2GA 4X8HA 4HWPA 5CDGA 2FQWA 2NTNA 1EHCA 1KGDA 1AU4A 1RCTE 3FYSA 3NBKA 2G80A 1CRZA 1U0TA 3H19A 4BMDA 4HUQB 2ORVA 3E27A 2AD5A 2O2DA 4Y6OA 4PFQA 5FFFA 4DARA 2VK1A 2YQ5A 4UXJA 1LX7A 2I8AA 3CEHA 4LHWA 3T54A 2BM8A 2JS7A 5FTWA 3V33A 4Z7QB 1TQ6A 2J48A 3D1JA 1RRFA 1KFBB 3OM0A 1GPAA 3G8DA 2ZSDA 3DW3X 4I50F 3DBIA 4RK5A 4UVDA 4LZZA 5CM9C 4QZVA 4PQGA 4Y9DA 4W7HA 5TF4A 4G1CA 1QKJA 2YY5A 3SNHA 1MJFA 2XQJA 4QASA 3WKEA 1NMYA 1S6YA 3LQ4A 3K94A 2XNSA 2DBZA 1PFYA 3FHOA 2YV5A 2YY6A 4XVQA 4NI5A 2CCKA 3PD7A 3LBIA 2A0KA 2PSDA 4PC2A 1T9DA 4BVEA 3BZBA 3R9XB 2JCYA 5KNBH 3UXEA 5JYEA 2DKNA 2V5AA 3KLNA 1Y5LA 4J94A 4M22A 4LSMA 2NIPA 4GRIA 3DMYA 4OY3A 1B3BA 1DRUA 3FLEA 3RU2A 3W1EA 2Y6UA 1OXBB 2ZBEA 2XT9A 1Q7GA 3IR5A 4EJ6A 1L5FA 3PRKE 5JPCA 2HIAA 4M0LA 3HACA 3LIPA 4JQCA 2AOVA 3EC1A 1E18A 2ODWA 1H1DA 3A05A 4HDNA 4U02A 3LYLA 4B48A 1SH7A 4GAEA 2VHSA 1XZMA 1YR1A 5FL7A 3WIBA 2J4DA 1X8KA 2Y9PB 1PWHA 4CLXA 3M5PA 1NHGA 3VSEA 4D79A 5EYPB 3VU8A 4E6EA 2NZXA 2OV2A 3T7KA 4X6IA 1EFVB 3JQ6A 3F3KA 3JD1A 3WY9A 1OH5A 1XEWX 4H6PA 2PX6A 3UMSA 3IOCA 2CE7A 5EJ8A 5FWXB 2Q5JA 2BMFA 3AG6A 3DE4X 4P38A 1X1RA 2BKAA 4KVFA 4Y2YA 4LYYA 4WV3A 2O3SA 3N58A 4A8JB 3TG2A 3QX8A 3PF9A 1XKQA 4EA9A 1DUSA 1YZVA 2Q6TA 2ZBFA 4AM8A 3U7RA 3MPUA 3B36A 4ER3A 3E9YA 5J5CA 4C4PA 3LY7A 2GBIA 1RQ7A 3SBEA 2Q2WA 4O5OA 4RM2A 2EZTA 5ILQA 2GF9A 4P4SB 2VUHB 1MPTA 2UVPA 4TQAA 4N3CA 3MTVA 2BR5A 1WHTA 1XCGB 3KKMA 5CPFA 2QMYA 2BV3A 3FAKA 2YV4A 4YNBA 1GMYA 3IQWA 4WFKA 1JSLA 3CS3A 1XF1A 1V35A 3GQBB 5ER6A 3OE7D 1SUSA 3RHSA 2DSTA 1RJEA 4O08A 4RIEA 3OE7A 3ZH2A 1FRFS 5LQNA 4O2AA 1EWMA 4LVCA 3MS2A 4JROA 4KXFB 4OHVA 2W2KB 4Q9NA 5HJ7A 5J4LA 4BMVA 3SD7A 1I94B 1GAWA 2IPLA 2ATXA 1PEKE 4F4CA 2YJ9A 2V98A 3WKDA 3ERVA 4WASA 1UXOA 4H1WA 4B7UA 3ENVA 2UXCB 2FW9A 2M6KA 1VL8A 4CM8A 4F97A 4YRMA 5TGZA 2H3EA 4F2PA 3ONDA 4JT4A 2ETVA 4JKYA 5AP9A 3IUNA 1SKYE 4WUTA 1KH1A 4OSPA 4M1TA 1LBQA 1XEXB 3ABQB 5BUQA 4G5GA 4YS6A 5DCUA 2LIPA 3JQBA 4W7IA 3U3DA 1VG9B 2XR1A 3CE9A 3SIWA 2JLXA 3PV0A 5IANA 3AMVA 4LNHA 2IX9A 1HQKA 3KG2A 1VJ5A 2GCIA 2RG7A 1PJ4A 2GLTA 3G2HA 3MCTA 1SBCA 5HE8A 3AEZA 3RH0A 3OKFA 1JW9B 4OHYA 4FKZA 2EV9A 4EEKA 1OBVA 3OZRA 2PLAA 4X6YA 5IUJC 3ZGXA 5JBNA 2H1IA 4MVXA 4FFLA 1FZTA 1M2HA 1J1IA 5D8NA 1F29A 3NXKA 1O6BA 2FSSA 1VLLA 1HDCA 3V4SA 2HXGA 1T4CB 1ZH2A 2V3VA 1DKMA 1W2GA 3L02A 1EM8B 1A9OA 2P3QA 3MOGA 2OGWA 3VR1A 1LTKA 4QTYA 5K0ZA 2ODPA 2GM4A 4J0JA 2Q6OA 2X3UA 5MF6A 3HR7A 4HWTA 5FBLB 4B9AA 5HR5A 3RC2A 2ZE6A 3TW6A 2WFMA 4KDCA 1QXSA 1GECE 3GELA 3QUCA 4J9VA 1CFZA 3R3YA 2OQ2A 3BWKA 2Y9MB 2B36A 4FGUA 4MW1A 3ZQ6A 4MJLA 2EEZA 3M34A 3W2IA 2G40A 3N8KA 2RBGA 4HXFB 1W0CA 3LDGA 4G0PA 4IJKA 3T1NA 3UUEA 4X45A 4M99A 2GAFA 3SP1A 1QYIA 4YPVA 4DPKA 1OFTA 1EG2A 5LKRA 2ATEA 2WD8A 1FFWA 1PWEA 3HA7A 5FUWA 5KHAA 1PPOA 1EJBA 2RGAA 3LBAA 4IGKA 3JY6A 4WZ6A 4ACBA 4R84A 3HEAA 1G8JA 2VCEA 2R48A 3A1UA 3E18A 3FKJA 1M2OB 4LJ8A 3RYHB 4H77A 3F47A 2NQDB 2FUDA 5C1PA 2VPTA 3JX9A 3A31A 4KXVA 4OO3A 1OZFA 3KJIA 5LNK1 5KOYA 2BFPA 4E2ZA 1HYHA 1QK4A 2R60A 1NVDA 2CXNA 2NZVG 2VNAA 3CW2A 1Z06A 3OZXA 2A86A 3RUIA 4YUYA 2ISSD 3AQIA 3W5VA 3KU4A 1XL0A 1N7IA 2HD4A 3I32A 5T3UA 4H35A 5AVJA 1NQWA 2QAIA 4O5AA 4BX3A 4C6TA 2Q6IA 3I52A 4UU7A 4C0WA 1P7CA 2CLMB 5FLEX 4HPXB 2ZPUA 5KQRA 1GT91 3K32A 2LBPA 3E53A 1JA9A 1UJBA 2DPGA 2ZRAA 3TNJA 4C0QC 3KUXA 1EWOA 4JHXA 4QVGA 4N3GA 1CVZA 1SQ6A 4M76B 2O7QA 2DR3A 4PS0A 3L6EA 1TF7A 1IBKB 1T0PA 5IFKA 2YJTD 3ECCA 4S35A 2XMGA 2J8ZA 4Q12A 3TBKA 4UMLA 2ZJZA 2VBCA 2VCYA 3MJEA 5ULLA 3WJ7A 4ON9A 4QYXA 4RA9B 1YR7A 1UMCB 3E9ZA 3VZDA 2A9FA 2J9ZB 1TA0A 4K6FA 5FIUA 1VSBA 5L3RA 1BQEA 5H83A 3ZI7A 4XVCA 2C04A 3DAFA 3LTNC 4TS4A 2XU3A 3TZEA 1NIPA 2YZGA 2FFJA 3W4IA 4CEHA 4GYWA 4ZVKA 2BH2A 3C5CA 4QDZA 2YV1A 2GVZC 4MTLA 4P84A 3TDMA 2HRBA 5E8RA 4UPEA 2NXWA 1QIMA 5FLXA 3WKBA 1GDDA 3OECA 4DQXA 2FYTA 5J47A 1JEAA 5IMBA 3S1LA 1NQAO 1ZGHA 3PFBA 2J0VA 3FFTA 3HKBA 4UDYX 1M74A 2Z8YM 3IUBA 3GRYA 5KYYA 4DR7B 3AF3A 4BNLA 1I2MA 5BQOA 1XRMA 1RZUA 3I01M 4WGGA 4Y67A 2NPFA 3SE7A 3N2KA 4NOKA 4QO8A 1R74A 2ZFUA 3N28A 1C4KA 5EG5A 5BNWA 2W0SA 4GGPA 2BEWA 1HNWB 2H1OA 3ZW7A 4LKOA 5JVDF 4CQLA 2Z8ZA 1RP1A 4KO4S 3RSHA 1EUDB 4QATA 5B58T 2DOKA 2QYHA 2D1SA 4W1PA 4E13A 4ERXA 3NQ41 3E8XA 1IG3A 2TRSB 2JFYA 4JITA 4M1ZA 2XPCA 1LLCA 1NLUA 2E5WA 2P6UA 2INGX 2PMBA 4PZUA 3V3KA 2X8WA 1C5KA 4ZEOA 3KSDO 4E32A 1JL3A 2QSJA 2VHUA 4TTTS 2OPHA 5HIJA 2PADA 4LI3X 1R64A 2V96A 3D9QX 3IVRA 1NVGA 3C24A 2YW9A 2K2QB 4IFBA 4HV4A 2OCPA 2PSEA 4PCLA 4WBNF 5BN5A 1U5IA 1CJTC 3MF4A 1K2VN 2GDJA 4F2DA 1I6MA 1C1YA 1F8FA 2A4MA 3FDZA 3MEQA 4ER5A 4C29A 1CSBB 3U44A 3A4VA 3UAVA 2Z2YA 2SNIE 4G0ZA 1DWOA 2ZJ1A 1NJ5A 1C1XB 3NAZA 2NSHA 4AROA 1NW3A 2QYOA 4UU8A 1I6WA 2CCJA 1R0LA 5BPHA 1C1DA 3S8MA 3H2BA 1CJSA 3OEHD 2WZCA 1WEHA 2OSVA 3OEHA 1FSZA 2C4VA 3L8MA 3EYWA 5IJAA 3ZV3A 4GVVA 2E4VA 3S3QA 3HU3A 3ND9A 1JSRA 5EFZA 1QS0A 2HIGA 2ZSUA 3JQ9A 4JLWA 4MNTA 1OTYA 3TRKA 3LT5A 5ALGA 2AMLA 4BVBA 1XDZA 3MRTA 4IUYA 2ZBGA 4R2WA 2NMVA 1X92A 4GEGA 3N74A 4J7XA 4RF4A 3MT0A 4L95C 3U31A 1WP9A 4NG5A 2HU2A 4QECA 1FP4B 1TIPA 4O4LB 1TO2E 2R6R1 4CG1A 4LTDA 2FQQA 2N42A 3WYNA 4EZEA 2Y0CA 1RVDA 3IAM1 3MQ4A 4Q4JA 4XR4A 3S44A 1RZRD 5AVRA 2YN0A 1XVTA 4CUZA <