4GUAA

Alphavirus p23pro-zbd
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
662
structure length
662
Chain Sequence
NPFSCKTNVCWAKALEPILATAGIVLTGCQWSELFPQFADDKPHSAIYALDVICIKFFGMDLTSGLFSKQSIPLTYHPADSARPVAHWDNSPGTRKYGYDHAIAAELSRRFPVFQLAGKGTQLDLQTGRTRVISAQHNLVPVNRNLPHALVPEYKEKQPGPVKKFLNQFKHHSVLVVSEEKIEAPRKRIEWIAPIGIAGADKNYNLAFGFPPQARYDLVFINIGTKYRNHHFQQCEDHAATLKTLSRSALNCLNPGGTLVVKSYGYADRNSEDVVTALARKFVRVSAARPDCVSSNTEMYLIFRQLDNSRTRQFTPHHLNCVISSVYEGTRDGVGAAPSYRTKRENIADCQEEAVVNAANPLGRPGEGVCRAIYKRWPTSFTDSATETGTARMTVCLGKKVIHAVGPDFRKHPEAEALKLLQNAYHAVADLVNEHNIKSVAIPLLSTGIYAAGKDRLEVSLNCLTTALDRTDADVTIYCLDKKWKERIDAALQLKESVTELKDEDMEIDDELVWIHPDSCLKGRKGFSTTKGKLYSYFEGTKFHQAAKDMAEIKVLFPNDQESNEQLCAYILGETMEAIREKCPVDHNPSSSPPKTLPCLCMYAMTPERVHRLRSNNVKEVTVCSSTPLPKHKIKNVQKVQCTKVVLFNPHTPAFVPARKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional insights into alphavirus polyprotein processing and pathogenesis.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Hydrolase
molecule keywords Non-structural polyprotein
total genus 200
structure length 662
sequence length 662
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4guaA02
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4guaA03
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4guaA01
3MCTA 3DXZA 2BR4A 4KYBA 5CVEA 3OFJA 5E3BA 2L8RA 3FTCA 4M7RA 4XUEA 2VZ9A 2ZZMA 3KQSA 4Z2YA 2ZFUA 2OO3A 3LCCA 5DTMA 2YXEA 3FUXA 4GQBA 3UBTA 1BKYA 1ORIA 3SIIA 3Q7EA 3SSOA 3SX0A 4YUZA 1N7JA 2B3TA 4HGZA 1RI2A 1M6YA 4YUXA 1XDSA 4F84A 1L3IA 2YUIA 3ER9A 4CTKA 5CVDA 3SXJA 1BC5A 3QOXA 2PX8A 1IY9A 5DXJA 5EQJB 1FJXA 3MAGA 3HA5A 4MTLA 4MWZA 4RTPA 2C7OA 4RWZA 3BZBA 1RJEA 3M70A 3ERCA 1LAPA 4E33A 1L3BA 5E1OA 1NE2A 1WY7A 1BHJA 10MHA 3P9NA 4AZWA 1G60A 3KQVA 5EOVA 4ZY1A 2H1RA 4EKIA 1JG4A 4IWNA 4QQKA 1KPHA 1I4WA 4HRAA 5EZQA 4GF5A 1JQ3A 3V8VA 1NW8A 4R76A 4PYNA 3BT7A 3EMBA 4QPNA 2YXDA 2FG1A 1RI5A 3GRVA 4GOND 3OZRA 2FK8A 2AN4A 3KKZA 4KIFA 3GRYA 4OA5A 4M37A 2WA2A 4CKCA 5CB5A 5HEKA 2CKDA 3UJ7A 1EJ6A 4E31A 5LQUA 3H8EA 5DM0A 1WXWA 3TMAA 3CJQA 4OQDA 3SIHA 3KQMA 4ZTBA 3A7DA 4CWAA 5EPEA 3HVJA 5DX8A 1QANA 5E8RA 5EC8A 4ZY0A 5JR3A 1BLLE 1SQFA 4L7VA 3UJ8A 2IBSA 1NW5A 4PIMA 1G8SA 3M6VA 3NTVA 5EZSA 4IQYA 2P41A 2NNWB 3SMQA 2ZZNA 4WVLA 1JTFA 5GIPE 2YQZA 4RTNA 4GVWA 5E9QA 3FTEA 4C03A 2ZLBA 2IH4A 3FYDA 2JH8A 1JQEA 1RJDA 1AQJA 5HILA 4ISCA 1KYZA 3LCVB 4GC9A 4PIPA 5D1HA 3NW9A 4RSRA 1X1AA 3GDHA 3KPVA 5GM2A 3SGLA 4QDJA 3BUSA 1LANA 2AOWA 3KR0A 5FCDA 4J5RA 4V0RA 5FSUA 4O29A 4FS8A 1EJ0A 5DLYA 3MB5A 3SVZA 3KZWA 4XUCA 3KQZA 5K01A 3IJ3A 5FA5A 4PWYA 3TPZA 1QAQA 1YFJA 3SR4A 1JG2A 1EIZA 3DXXA 3G5TA 1BPNA 2A14A 4RTJA 4LG1A 4R6TA 1JG1A 3T8WA 3B7PA 2P3OA 9MHTA 5C0OE 1SUSA 5B1SA 5LQAA 2ZZKA 5HIHA 4X41A 1M0EA 3TM4A 1KXZA 3ELWA 4QQNA 1HNNA 3OE4A 1P1BA 5F2NA 2NXEA 5D1NA 5CVVA 4RVHA 2K4MA 4QVKA 1F3LA 2ZIEA 2ONZA 3GPOA 2VP3A 4R05A 1O54A 3X0DA 4OX9Y 4JXJA 3HM2A 5GIOE 4QDKA 3AWIA 4ZX9A 2QRVA 2AVDA 5EMJA 4RV9A 1P1CA 3VYWA 1JTEA 2F8LA 3PVCA 3QV2A 4RYLA 3EWPA 1KYWA 3FUUA 3DXYA 3HTXA 2FXKA 3GRRA 1VPTA 2P7HA 4IV0A 4E30A 2AN5A 1KR5A 1R00A 4K0CA 1I1NA 3KPYA 3PTAA 2AS0A 5EVJA 1INLA 3PB3A 3R0QA 3EVGA 4IKPA 4EVIA 1LCPA 1UIRA 2PSSA 5CUQA 3PX3A 2AOVA 2I7CA 3I58A 3T0IA 2OY0A 3U81A 1QYRA 2WA1A 2IIPA 4E2ZA 3LX6A 4PNEA 5K0GA 5MHTA 4CTJA 2BFRA 3EWRA 2ACFA 1P91A 1ZHFA 4PCLA 2PT6A 5FSXA 3ELDA 3EPPA 4PYOA 3ELYA 2GS9A 4MIKA 5HOLA 5F2OA 1L1EA 3EGVA 1UWVA 3M6UA 3GNLA 3HCFA 5DWQA 3A25A 5FHRA 3KQPA 5F2KA 5GM1A 4GEKA 1R74A 4XUDA 3T7SA 4YUVA 5CCBA 3EGEA 5HOQA 4BY9E 2FK7A 4BP3A 3C6KA 2FAVA 1IXKA 1QAMA 5KQSA 3GU3A 3LL7A 4C08A 4F86A 3KHKA 3KQXA 3E7PA 3DP7A 3BKWA 3EVAA 3HCEA 3LECA 3C3YA 4J5SA 1WS6A 2PLWA 4DQ0A 2AFCA 2NXNA 3NVMB 5LQCA 2G72A 3UJBA 2AR0A 2AZTA 3ER8A 2EJTA 3G2OA 1M6EX 2VDUE 2V74B 1YUBA 1DUSA 4RTKA 5BXYA 3LSTA 2PT9A 2IPXA 3KPWA 3S68A 1R8YA 5CVJA 1NJRA 2UYHA 3DH0A 3H2BA 4KRGA 5KVAA 3GPQA 4NECA 3FPGA 4FZVA 3NDIA 5FUBA 5EHIA 1FBNA 4P7KA 5KYGA 3FPJA 5K03A 4OBXA 2Z6QA 2Q41A 3E05A 5FWAA 2VDWA 3GQEA 2PWPA 1X1CA 4Y30A 2QE6A 3I9FA 3IV6A 5DRTA 4AZSA 2PWYA 2HV9A 4CKEA 2AOUB 3HCCA 1AQIA 3L8DA 1JQDA 3C6MA 3O31A 2JHCA 4KWCA 5HFJA 5HIMA 1ZQ9A 1YB2A 5T6BA 3ETIA 3PS9A 1L9KA 1MJFA 1VHUA 3G89A 4V0QA 2Y1XA 2ZBRA 1NBHA 3BXOA 3DMGA 4A6EA 3SSMA 2UYCA 5DTRA 5P8WA 4ER6A 3P97A 3Q87B 4R7MA 4E2XA 1MHTA 3EEYA 5FQOA 1TW3A 1ZGAA 3R6TA 4EMSA 1Y8CA 2H11A 4DZRA 2XBMA 1VBFA 2PX2A 1ZG3A 5DPMA 1XDZA 2EEEA 4E70A 1X1DA 3UWPA 4JCAA 5K0JA 3EVCA 2O07A 3AY0A 1FPQA 2UYOA 5FTWA 3KR9A 4HTFA 3VSEA 4LWOA 5ICEA 1SKMA 2JG3A 2NYUA 2ZBQA 2PXCA 2G8NA 2ZSUA 5CCXA 3LDUA 2VS1A 1X1BA 4QPPA 3GPGA 4RTLA 4POOA 1PJZA 4J4ZA 2HTEA 4C04A 3P71T 2BZGA 2ORED 3A26A 4C07A 1KPIA 1QAOA 2Y1WA 5FQNA 5HIJA 4X1OA 2ZWVA 3EW5A 2AN3A 3KU1A 1VL5A 4KW7A 3PEIA 4AZVA 3FUVA 1ZGJA 4OBWA 1WXXA 2C7QA 1ZR3A 4EKGA 2B2CA 1RI3A 2UYQA 3KPUA 1X19A 3WSTA 2NP7A 2H00A 3UJAA 1IM8A 1VQ1A 3G8BA 2FCAA 3BWBA 3HA3A 1RI4A 3MTEA 2BR3A 3M6WA 3T7TA 4UMLA 4DCMA 2HR1A 2P3QA 3ME5A 8MHTA 3BWMA 3SIJA 5DM4A 1VP9A 3TKYA 2ZULA 4ATNA 1KPGA 4K6MA 4B17A 3HP7A 4BLWA 5C9ZA 2C7PA 2BFQA 3GRZA 2ADMA 3SIGA 5C1IA 3P2EA 4PYIA 4DCGA 3I64A 3M33A 3CVOA 5K0EA 1NW7A 2OPBA 3P2IA 1NW6A 4ZYQA 4U7TB 5LQRA 3DULA 2FHPA 3P8ZA 3A27A 4FT4A 4QTTB 3THSA 5K8VA 5CIYA 1SG9A 2NXJA 3CBGA 2P40A 1D2GA 3EVBA 3I5UA 2I6GA 2OB1A 2PV0A 3HCDA 3KPJA 3LKDA 2PXXA 3LPMA 3G2MA 4FSXA 4HG2A 3FUTA 3B3FA 3R3HA 5K09A 4MHTA 1BPMA 1QZZA 2BM9A 3G5LA 4PINA 3PLAE 2ZTHA 3TFWA 1JR4A 3P9CA 1EQAA 2OXTA 1WZNA 1Z3CA 1JSXA 5EMMA 1RJFA 2PBFA 1RI1A 2O0LA 1KIAA 1VP3A 5E9JA 5DUSA 2ESRA 2YVLA 2GLUA 3AJDA 1XTPA 5H02A 1HJZA 3BKXA 5FSYA 2P8JA 4E2YA 5K0LA 2ZW9A 4RTRA 3MQ2A 3MHTA 3JWGA 5DM2A 5ICFA 3GRUA 2PKWA 2PY6A 5E8JA 3UJDA 4YMHA 3ID6C 2O57A 5FA8A 2IBTA 3LDFA 3OU6A 4D86A 5DX0A 2DULA 3V45A 2EG5A 4ER0A 5HIIA 3TQSA 3NMUF 4ZI6A 2XD7A 5KQRA 4E2WA 3JRUA 4KIGA 3OE5A 4MQ4A 3THRA 3TM5A 3CC8A 4X2TA 2VDVE 1G55A 2ZBPA 2AVNA 3EGIA 5CB3A 5CVUA 2YX1A 2CWWA 3GWZA 4RVDA 3LHDA 5LQNA 3IIDA 1GYTA 3B89A 5GP1A 3EWOA 4IV8A 1D2CA 3K0BA 3G88A 3HA7A 3NJRA 1DL5A 2IDJA 4KVZA 3RIEA 3KR1A 4CKBA 2NP6A 1SVUA 2GH1A 3KR2A 4PYLA 5CD1A 3FZGA 4C06A 1B42A 5EMLA 3D2LA 5EKUA 1P39A 1U2ZA 3BGVA 3PFHA 4R8SA 3E8SA 4HC4A 4K3NA 4OA8A 4HTFB 1KHHA 5T67A 1Q0TA 5EEGA 1VE3A 5KS2A 3EEOA 4P7FA 1LAMA 1ORHA 3G8AA 4PYMA 3Q71A 3BWYA 1SQGA 4ZX8A 2DPMA 1XCJA 4PYJA 1L3CA 1EAMA 4X61A 2GPYA 3QOWA 1R18A 3R24A 3CJRA 3NWEA 4YMGA 1R8XA 3GO4A 1DCTA 3ORHA 5EIFA 4TU0A 1VLMA 1XXLA 2G71A 3AXTA 5E2BA 3JWJA 5CM2Z 5ERGB 2ZIGA 3HCBA 4BLVA 4EQZA 4ETKA 2YR0A 3EWQA 1RJGA 2P7IA 4DM3A 1YZHA 4ESSA 4RTQA 3FRHA 2FRXA 3GCZA 3OPNA 3FYCA 4ER3A 4X60A 1NKVA 3LKZA 4QTUB 2QY6A 1HMYA 3BWCA 4DKJA 3EVEA 2ERCA 1NV9A 2P1DA 5K0FA 5LQJA 3O4FA 1TPYA 3CCFA 4A6DA 2IH5A 2PXAA 2QM3A 3CKKA 2PX5A 1VIDA 3IEIA 3O7WA 5EHGA 1XDUA 5IH3A 5D8NA 3FTFA 2HMYB 3P9KA 4GOOD 5E9WA 3VC2A 2V7EA 2YTZA 3H8GA 1KP9A 1YZ3A 1ZKDA 3AXSA 3B3GA 4FGZA 4GOLD 3UA4A 5LR6A 2IH2A 1TXZA 3OU7A 4M36A 5JUWA 3A7EA 2XYVA 1NW3A 5DRYA 4LWPA 1F38A 4M38A 3DUWA 5HZMA 4YV0A 3SM3A 2ZIFA 3OCJA 5E1BA 3I53A 3KQTA 5E2AA 2DX6A 3IIFA 4QVGA 2I9KA 1OR8A 1WG8A 1G6Q1 3OFKA 3PFGA 5DSXA 5K05A 2ZCJA 2XVMA 3LBYA 1SPVA 5K0NA 4GBED 4ZY2A 2FYTA 2P35A 1FP1D 1Q0SA 3GGDA 3NWBA 2BR5A 5DSTA 5EMKA 3UJCA 5GWXA 4LECA 5BW5A 4BLUA 1N2XA 3KQWA 3LCUA 2YXLA 5U4XA 3EJGA 1O9GA 3DLCA 4P7JA 3EVZA 3TOSA 4GUAA 3VC1A 1ZR5A 1JG3A 4HH4A 4BP1A 5K0CA 1YFLA 3DMFA 2B78A 3EVDA 4GC5A 4R6XA 4DMGA 4C4AA 2B25A 4WXHA 1JSZA 2NXCA 3C0KA 2OB2A 2R3SA 4RVFA 3UZUA 5FSVA 4C05A 1NT2A 4PYKA 1XVAA 1YD9A 3Q6ZA 3FPHA 2C7RA 3NVKI 4H0NA 4XCXA 2N47A 1NV8A 2O05A 1D2HA 4X63A 4UOEA 2LD4A 4PCAA 4DA4A 2EWBA 4AZTA 2ZWAA 3TLJA 5ICCA 5FSZA 3HEMA 3HNRA 5ICGA 4JGKA 3JWHA 4FT2A 5BW4A 2IDKA 5LSAA 5DX1A 3B3JA 3DLIA 5EEHA 4YV1A 5DTQA 2PGXA 2GB4A 2JJQA 2LGRA 4GOMD 4R8RA 4YUWA 3GQOA 2ONYA 2PVCA 2J9AA 3CGGA 2ZVJA 3JWIA 3EMDA 2QRVB 3MTIA 5EKXA 3A4TA 3R9XB 5CMSA 2OYRA 3V97A 4JVVA 3F4KA 4GVVA 3DMHA 2R6ZA 2AOTA 5M5BA 2P3LA 4P7GA 5DXAA 3KQQA 2CMGA 5EGSA 3LDGA 3ELUA 2HWKA 3FUWA 1O9HA 2EFJA 5FULA 4RTMA 5AILA 3K6RA 4FR0A 4FSDA 2X47A 2FPOA 2AOXA 3G7UA 5EIWA 1FP2A 2G70A 1G8AA 3REOA 5GINE 1YF3A 2WK1A 3EKEA 2JHAA 4AUKA 4PGGA 5IKMA 1UFKA 3KQYA 2Z6UA 3MCZA 3MERA 5FADA 4JLLA 2OKCA 1H1DA 3G2PA 5CBMA 2EX4A 2CMHA 3LBFA 4OQEA 3UA3A 1N7IA 2IP2A 3LGAA 2VRIA 3BGIA 3ANXA 4Y2HA 1BOOA 4RX1A 4RTOA 2O06A 1XJ5A 3E23A 4DF3A 2AOUA 3IYLW 2XYRA 2IFTA 5K0BA 1EG2A 2CL5A 3P2KA 2BM8A 1I9GA 3TKAA 4R6WA 3GIWA 3TRKA 2EJUA 3BGDA 3KQOA 3OU2A 3T7RA 4E32A 2BH2A 2PX4A 5T64A 4YUYA 1TW2A 4AX8A 3H8FA 1XCLA 2XYQA 2HNKA 1PRYA 2I62A 2JH9A 3CJTA 3FRIA 2E5WA 1NBIA 4KDRA 2OZVA 2UZ4A 3GJYA 3PX2A 3HVIA 5FHQA 3DTNA 5GOZA 4KSIA 2Z6AA 3GXOA 3OZSA 3G2QA 4PONA 3TR6A 4ER5A 1T43A 3FPEA 3FTDA 3HVHA 3MGGA 4KDCA 4ETJA 4F85A 4PYQA 4FP9A 2XVAA 5DM1A 3P9IA 5DT2A 3UFBA 3UJ6A 5E1DA 3KR4A 1AV6A 3C3PA 2GAFA 4HGYA 2JHPA 3RODA 7MHTA 3KR5A 2QYOA 3V2BA 3EJFA 3FPFA 3HCAA 5FWDA 4G56A 5BP7A 4J5QA 3NDJA 3SSNA 5G02A 4ER7A 1SUIA 3RW9A 3HVKA 1TY8A 4CXMA 3OZTA 4HSGA 3IHTA 3PT9A 4U7PB 4EK9A 3VFQA 3DR5A 1V39A 2OBFA 2KW5A 4RVGA 3UJ9A 2PJDA 4P58A 3EVFA 1R6AA 5EG5A 2GA9A 4YV2A 5HIKA 3B5IA 5LQKA 1G38A 3M6XA 4ABKA 2B9EA 3M4XA 2G1PA 2IGTA 2AOTB 3JZTA 5E1MA 4PGHA 4ABLA 4RTSA 3DOUA 1AF7A
chains in the Genus database with same CATH superfamily
2BEVB 2VEOA 2CUKA 1H65A 1MEGA 1UXHA 4RD1A 5B4UA 3T7DA 2QLNA 1QZ3A 2RGNC 5GONF 1NJ2A 4JUDX 1Z0KA 2FWAA 1MT0A 3KOZA 4CMEA 4HVAA 1FXSA 4R2IA 1RCFA 2QLJA 1ORIA 1C9KA 3QJ3A 2GN9A 5KTPA 1CY6A 3ZTTA 4MQUA 4YS6A 1R2QA 2X14A 1WV0A 4TMVA 1DTSA 3H11B 1NOKA 5F3DA 2PYDA 1U0OC 2OMKA 2YBDA 3DM5A 3HZZA 4PPQA 2XGMA 3WL7A 4ARZB 2IHKA 1CR6A 1U6KA 1CHNA 2A1UB 1ZBDA 1DEXA 2W5UA 3MAGA 2SECE 4HDMA 2YHIB 1KSFX 4KN8A 4MTLA 1XXHB 4B7UA 4CR7A 5JSUA 2NZXA 3R7NA 4CEHB 1E9SA 3RNVA 5JZSA 2EVWX 5EOVA 3DL7A 5TV2A 4DR2B 5IJ9A 4NV3A 1P3Y1 4PZUA 1J9ZA 3VR5H 4I4TA 4S1VA 3ASYA 5CXUA 2B61A 1SKUA 1Z33A 3WYCA 2BFAA 3GYBA 4L02A 5JZOA 1XAJA 5JXWA 5G0TA 2FK8A 4DUZB 1RWBA 1T1JA 1U5AA 3F4LA 2ZUTA 1RBMA 2A9OA 2C58A 1H2RS 3UK1A 3OJWA 3V3KA 4YYZA 5JTTA 5KC8A 3HFJA 2CJXA 1AJEA 4O33A 3KB1A 1FLVA 3FNQA 4BEBA 4CWAA 3IIJA 3FSJX 2ZU6A 1GA4A 1BE0A 4MI6A 4QUIA 5EPEA 3UT6A 1AU0A 4F8YA 4IP3A 2FW7A 3Q3IA 5CFZA 1YQEA 2FMFA 4CG0A 3H4TA 2JAUA 4GPIB 3E4DA 3L1HA 4RCVA 4YJGB 5AQEA 3SMQA 5HR5A 4PX3A 4HNUA 4WVLA 1JTFA 2OENG 2JFHA 2MSCB 2IDZA 1XLUA 2RGAA 3PXDA 3F96A 2WYOA 4BVHA 3H8CA 1EWKA 1SCKA 4PNPA 2DX7A 5KX5A 1YCHA 5HILA 1U2DA 2PNJA 4U9IS 2F3UA 2PREA 4X97A 3PGJA 3NW9A 3VZRA 1V4NA 3NS7A 4IGAA 4D9GA 2HJWA 3CZPA 3SZ3A 3ZDEA 3ZD6A 2WAXA 3GFRA 1CUHA 2H29A 3I5AA 2ZJYA 4CIWA 4PICA 3ZWAA 5FRDA 1MZVA 5YASA 1WNTA 4UQLA 1TQDA 3GB9A 3TZHA 2MINB 3CBQA 3U1VA 1OF1A 1TEHA 2RHWA 3DXXA 4GX5A 3WSWA 4DJEC 5L4SA 4MJXA 3BH7A 3T9CA 1N4AA 4B9AA 4DBLE 5LBUA 1OCEA 1SC1A 2P3OA 2V6JA 2VNHA 3AHJA 2YIJA 3GLSA 1QWOA 4OXQA 3EODA 3BC3A 1CUBA 1T5BA 5IPFA 3DXFA 1KHQA 2XEDA 3LG2A 3KYDA 4WI1A 1DDGA 1H2EA 2B92A 2VCHA 3GT0A 3ES9A 1L4BA 3DKKA 2G08A 5ESXA 4OX9Y 1XDGA 1NJSA 3R41A 2EGGA 1P1CA 3V2GA 1JTEA 2YY7A 1BEEA 1W0JA 5NLLA 4U2DA 4MS1B 5F51A 4Z0HO 3OQMA 2V7VA 1GCUA 3FPCA 2FFHA 3QXXA 1KORA 4IUYA 1V8BA 2RE8A 2QTGA 1JBQA 4A16A 2Y1FA 2IHUA 4K1XA 4R2KA 4PHGA 3ROKA 3QEBZ 2BGGA 2V3CC 2I7CA 3NNSA 4H17A 5ICSA 4TXHA 3QMPA 3JAKA 3M9WA 3EWRA 2F3PA 3AEQA 4OLHA 2QG4A 2ID4A 4G5HA 1J33A 5FDFA 4PYOA 2WFLB 4WCFA 3A0UA 3H2IA 2YMPA 3FI9A 3D5TA 2C3YA 5AUOB 2ZJFA 5AI4A 4AXMA 3DZGA 1UEJA 2C77A 2VUUA 4B2IA 2FN8A 3G5AA 1PEAA 4HFJA 4A5SA 3R5TA 4RGVA 4G1CA 2NZWA 5KOIA 3DEIA 3M6MD 2DKOA 1SCNE 4Q82A 2PJZA 5JYBA 3BMQA 3K0AB 5CXSA 3ZUGA 3JRXA 1EQUA 2TS1A 3DV2A 4LZNA 5HF9A 1NBME 2NV6A 2W93A 3PRKE 4II7A 1WIWA 4KJXA 2QXTA 2AFCA 2WUEA 1RQRA 2QZPA 2OCYC 4KR9A 1RRVA 1SK8A 3A1NA 3STXA 1MTZA 2QORA 3WGMA 2FSGA 4EP1A 1RXCA 1CE8B 2A9QA 4JA2A 4J4TA 4L2IB 4OBEA 1GL3A 1IHUA 1P44A 4KRGA 4WWHA 3NYIA 1WULS 3L6RA 3FPGA 3TTSA 4RQUA 1WHTB 4KBFA 5J5VA 1UQRA 3DAGA 1Y81A 4LF9B 1JAHA 3VH2A 2ZR7A 3EMVA 4OM8A 4O4LB 5ULLA 3WWCA 4AO7A 3S70A 2PN1A 4M1EA 2IVFA 1P2SA 4WOBA 4RF5A 4KFRA 1IJFA 1KF0A 5HRCA 5JPCA 1PXVA 4XJVA 1TJNA 2J0SA 3L8ZA 2GK4A 3L7NA 3EGCA 3BXOA 4BAGA 2JGLA 5B7PA 2DJGB 3ZXSA 5IULC 5SYMA 3IQZA 1PZNA 4Q34A 3W6UA 4YH1A 5JAMA 3FDFA 3ZU5A 4MLZA 5FF9A 4CDGA 4BVKA 3T7JA 3P0RA 1C14A 1Y1QA 1XRNA 3PG5A 4JL8A 3VR2D 3U44B 4B6PA 5CH3A 2YFHA 4DIUA 3GUCA 2CBZA 1U7TA 3BFKA 2KS6A 3RUHA 2DETA 1G8GA 2ATXA 2VS1A 4JYAB 4J07A 1HKUA 1CC1S 4JLWA 4KJZA 2HBQA 2XF2A 4E13A 1O95A 2VHSA 1A95A 4WIAA 4CODB 4EBBA 1PWHA 4C07A 2Y1WA 2TMGA 3QVGA 4KZPA 5HIJA 1TYCA 2O3JA 4MITA 1KZGB 1X2BA 3L5KA 3IEUA 5HSGA 2O4CA 4NP6A 4GKJB 1NVWQ 2AJ8A 2X22A 2ZE8A 3F9CA 4Q66C 3LOQA 3EAGA 2ZDQA 1M1NA 1H0SA 1N5OX 4Q9LA 4YCJA 1PTKA 4DZZA 2C4VA 2R1VA 3Q6NA 3QJYA 2BGMA 3PR1A 4HQ6A 4IIEA 2ENUA 3MTEA 3ND6A 4W63A 5HF8A 4HEA1 2VJBA 5KYVA 3FVWA 1TXGA 5DISB 1I7DA 1EE9A 3CX3A 3PIDA 1JI0A 4RU1A 3TKYA 4K6MA 4MVJI 2EF0A 2H8KA 2ZYUX 1OGIA 2MT9A 3DE6X 2QRJA 3FBWA 3IHKA 3ZDRA 5KJFA 4UJ3A 3SIGA 5A0VA 1Z5PA 1ZDMA 2WF9A 3R4VA 1NW7A 5CFRA 3G5UA 3BWXA 3P2IA 3HRIA 3GBVA 3EXHC 4GGOA 2X4DA 3PPWA 3RV3A 3HCWA 2BEWB 3HR8A 3ZGXA 1R15A 1Z7BA 2WMNB 3PRJA 3MS7A 3P8ZA 4ZT7A 1PV4A 1CJVC 3P94A 5T3YA 2KQUA 3F6SA 3VUFA 4XCVA 3IEVA 4PQYA 4FSXA 4C5BA 4RD2A 1KO4A 4LMRA 1ENPA 2CF5A 1ESDA 3I37X 1PJLA 1R8QA 3U9LA 3GUUA 2AEMA 4JEIA 1GNRA 1P0PA 2WTNA 3QEOA 3TFWA 4C3VA 1ICEA 1AGXA 4MKZA 1EQAA 2DT5A 2NUBA 2XE6A 1GNTA 2ISSD 4UAVA 4WOCA 5G4KA 4JUCA 4B47A 3GGSA 4V03A 4BKRA 3NEYA 1CJMA 2JA1A 3WHPA 4JP5A 2AE1A 1VP3A 4QD3A 2Q8NA 5BQXA 4DIFA 3PUHA 3SSAA 5HG0A 1ESEA 3I9V1 4LHEA 4ZVOA 5C37A 3BKXA 1GSAA 3JQQA 2FUKA 3KSAC 1NF8A 2JJ2A 5H4GA 5EMNA 4NYMR 4RGBA 3VZDA 2BEKA 3T3DA 2Z2JA 5A5DA 1ZOLA 4Y1FA 5DX0A 1N6RA 3OTWA 4CIXA 1EM8A 1L8XA 3NMUF 3G3EA 1P4HA 4JBLA 1CEYA 3PQ5A 1YS6A 3JRUA 3NV9A 4ETWA 5G1PA 1B1CA 1E3SA 4U7WA 1P0FA 1PK8A 2QTAA 4TN5A 1IHXA 1GADO 2XIQA 3CFYA 2CWWA 3A6JA 3ROZA 1H66A 2LCIA 2WJVA 5LQNA 3OHPA 2MR5A 1BMDA 3S8MA 1AMOA 1WPRA 1YL5A 4MZSA 6PADA 4Y7DA 4C2TA 3HDVA 5A3SA 3EA4A 5ABPA 1Z22A 1JT9A 3S55A 3SXPA 2GGSA 1KI4A 2Y4NA 3TW8A 2WZCA 5CYPA 5CD1A 4BIMA 3HZHA 4TMZA 1PG0A 3TBFA 4NNJA 3OAAA 1Y5RA 3LUPA 3PNRA 4K3NA 4OA8A 4HTFB 4J2OA 5HDQA 5E6JA 2VLIA 1VE3A 4OFWA 2OECA 4F6LA 2YN2A 4DNQA 4BLRA 1PEYA 5KYUB 2UUOA 4P2BA 3HG7A 3NOVA 5A9SA 1B3RA 1J7JA 4F6RB 1EE1A 1YRBA 2QJTA 4ZAZA 3OFNA 1SBIA 3ROFA 1GAQA 1E0JA 1WBBA 5TARA 1NTOA 4LKRA 1R8XA 3GO4A 4IDGA 4TU0A 4BGEA 4WKCA 1KOGA 2J3EA 1MT3A 2ZG6A 1PE6A 2EW1A 2VK2A 3ANMA 3L9XA 2YR0A 1QORA 5TRTA 4CT4B 1OWPA 1AU9A 1YRHA 4P5DA 1JEAA 1KNQA 3QWHA 1T0HB 2IY9A 4FC6A 5ADHA 3P52A 1VHJA 2BSAA 5HJEA 5K4AA 3EIQA 1U8CB 3IIKA 2NMVA 1H4VB 1WCIB 3BWVA 1IZ9A 3FSEA 4GYWA 4Q9NA 4GPAA 3AYZB 4NHOA 1DUVG 4D92A 4MA4A 4YT5A 4IS3A 1XTBA 4DM4A 4GOOD 1FJGB 4KPGA 3LMKA 3B36A 3L0SA 2C5BA 1VKHA 5B7NA 1QUEA 4BGDA 1KP9A 1YZ3A 3WRXA 2Q3HA 1ZOPA 1C4WA 3AVQA 3FNIA 3I72A 1CUEA 2I67A 4ITVA 4OOFA 4JX9A 1OYVA 4Q4DA 2R0QC 2GN8A 1XTIA 2OM6A 2ATOA 1E98A 3Q0TA 4GE0A 4IXTA 5F78A 2BTWB 3DSRA 3FDZB 3ZEIA 2HKIA 3KETA 3VU9B 4M1YA 3WY9A 4R8VA 3ZG6A 2R6AA 4WBSA 4QPZA 3VC3A 2JW5A 1A2BA 4J16C 2ZCJA 2IU4A 4DRZA 2C4WA 2D1RA 3IXLA 1UMCB 4JP8A 2O52A 1N6PA 2P9EA 4Q0MA 1M66A 3Q6IA 2M1ZA 4ZOLB 5IAOA 1H1LB 2Y1CA 4JD5A 3KVVA 4LEIA 4EAQA 2XUHA 4FSHA 4MV4A 2OOKA 1ZH2A 3MBOA 4JI5B 4U1RA 3WLAA 1NVKA 4CKBB 2YV4A 5LKRA 1E0DA 4OEMA 3ETGA 2UUAB 1CUVA 4A8JB 3MJCA 4LGVA 4MDEA 2AR7A 1JSZA 4ALNA 5FSVA 3C0KA 1PL0A 2CD9A 2PVSA 1SWWA 3COYA 1SBCA 4RZIA 4MQ5A 5CA0A 1KI6A 2IYUA 1HXHA 3PXUA 4ML3A 4G0PA 5L9AA 4RM2A 4WY8A 2W22A 4PU0A 2WBLC 2VNSA 3E27A 5B3LA 3HI6A 3K15A 1L5HB 2FR0A 4LDJA 1O8BA 1QVZA 4D8WA 3SS7X 3COWA 4ABTA 4RAQA 3SC2B 1DE0A 1YOVB 3WHLA 1Z2EA 3X1ZA 1FK8A 1KU0A 3ZLUA 1JFSA 1EXMA 1JA9A 2FETA 4NU5A 5DTQA 4EBFA 3LD9A 4EUNA 2YMLA 1HQCA 3IUJA 2H51A 5F73A 2EKZA 1DS6A 1KARA 1GG2A 1LK5A 1GZDA 2GLXA 1U6JA 2NPOA 4IFBA 5B1YA 1ZIDA 2AOTA 3S2EA 4L72A 1AD2A 1I51A 4P7GA 4AIRA 4TOIA 1CZKA 1K1EA 1PO7A 1OJ7A 2Y0BA 4ZJPA 1KMIY 1ND6A 1JBEA 1PS8A 2X0IA 4JJGA 3E5RA 4A0QA 3ZY2A 2ZSEA 1GA6A 4TLEA 4LOJA 1V71A 4JLDA 1EGHA 4L8GA 1XA3A 3ULKA 5DNYB 3FJYA 4AG3A 4O4HA 1JE1A 2IPNA 4P54A 4EZIA 3ZJ5A 2OKCA 4GR4A 3L7OA 3OEHA 3FPSA 4XD7A 4P4SA 1QYVA 2AJDA 2GAJA 2C3MA 3QXGA 4RA6A 1OH7A 4NE2A 4PE5B 2LW7A 3IYLW 1ZN2A 1FMLA 4CDMA 5EXTA 3HA2A 4GMDA 1DCFA 1RYDA 3IOCA 4TS9A 2CXOA 5I7OA 1XCLA 1R16A 3EZ6A 4MUEA 1YI0A 3FBGA 1QUFA 1H93A 8GPBA 4MVJA 1SU7A 2JATA 2QJFA 4P82A 3STTA 1E6MA 1N75A 1ZM2A 3I0ZA 4NF2A 1AA9A 5ADWA 1NB5A 4LXTA 1VYUA 3JALB 1TMKA 1CUAA 3E18A 4HGNA 4C22A 2GSWA 1VHLA 5L40A 2AE2A 5EWMB 3CB2A 1P1FA 2Z4RA 5HPYB 2H7JA 4NPCA 3I8XA 4FI3F 2WZQA 4HGYA 5D3MA 5C52B 1M76A 3OKCA 3V2BA 5FWDA 4Q7LA 5DWDA 5F1KA 3DONA 1DKMA 4G0UA 3RUEA 5KOJA 1AUQA 1UIMA 1C9JA 2WHXA 2QUIA 4U7PB 1UF9A 3OJLA 2O8CA 3K9LA 4G1MB 2XZOA 3K1AB 1E4EA 4KXYA 3EN0A 4NZ9A 1Y8RB 2AMYA 1IAVA 2Y0PA 3FSGD 3GGCA 3HYCA 2FQXA 3INTA 1BOFA 3ILVA 4MUBA 4MWBA 3IXQA 4R5HA 4JS0A 1LSSA 4QU0A 5FFMA 4DAEA 2WB4A 2R9MA 2AOTB 1JEYA 1K88A 1XTUA 4PGHA 3R9WA 4ABLA 2QQFA 3KL4A 5ETJA 1E1RD 1F2UA 1VKZA 4NEHB 3LT0A 1TIKA 2B6NA 1G3UA 1VB5A 4WZBE 1T2NA 3H8VA 4YMLA 4WNIA 3CLKA 3R4CA 4LTNA 2XVYA 4M7RA 3H04A 1CVRA 2A1IA 1VPEA 2OZPA 1AY0A 1NZJA 1QYCA 2IZ6A 4O4HB 4Y2UA 4ZGGA 4TS4A 1R7RA 4ZVNA 1PEDA 3WB9A 3A1EA 1IN5A 3V00A 4BLSA 2EDCA 3PQDA 2XMDA 3ND8A 1IRIA 1L5VA 4TV8B 4EGQA 1Q0HA 4D81A 3RLIA 2P27A 5AVXA 3I6IA 5LZ4A 3L8GA 4I9FA 2BV3A 2HX1A 3ZZ1A 5LXTA 1HZZC 1KI2A 3SD7A 2AJCA 2QL7A 4UOZA 2ZRPA 4B84A 3GVPA 3WP0A 1CZLA 1J4AA 1XB2A 1BHJA 5CCEA 1KZHA 121PA 3PUYA 1JKFA 2YCLA 4KXFB 4NBUA 1HF3A 4EYKA 1W87A 4X20B 2IUYA 3WA7A 1Y4UA 2VCYA 3GPIA 4Q8GA 1G8MA 2R2GA 1NZFA 2ZBGA 2FZVA 2XUGA 4IIJA 4R1PA 5TF4A 3SJAA 4BFUA 1NC1A 4HYEA 5HM8A 1C3OB 4JB0A 2Q1WA 1U7WA 4HNVA 3HEAA 2FPLA 4P4UA 3RHTA 2CVFA 1E2NA 1T9CA 3CJQA 1OXSC 3SC3A 2C2GA 3OP4A 2JCYA 5FNZA 2WTMA 2QMUA 4UHKA 1G7SA 5JANA 2FPPA 3HVJA 5DX8A 4OUDB 3V6LA 1YALA 4CZ2A 3PC2A 5F64A 3WNQA 3WYAA 1P5FA 2ZRHA 5IWAB 4P6EA 1ZIYA 3EEIA 4YX9A 1ZIPA 2BGUA 1T3TA 3UBMA 4G0YA 5JI2E 3GLGE 2P41A 3KZNA 2ZUDA 3HKCA 3VSAA 2ZZNA 2BHNA 1ISRA 2P2LA 2YQZA 4IVNA 3MTBA 2KX7A 2PM8A 4L9WA 1AQJA 1STFE 1T1SA 3LCVB 5D1HA 3I9LA 4RSRA 1LLCA 3N0RA 3G68A 4NR0A 4DUGD 4II3A 1E32A 2V7UA 1K6EA 1XZEA 1KXRA 1KVUA 3UAYA 4FS8A 2BKXA 3H83A 1XQVA 3QWAA 3ZI0A 4KR3A 3LF1A 4LNHA 4FQ8A 4D3YA 3O4GA 4B6EA 2ACEA 1LCIA 4KZKA 2C5AA 1P5JA 3QBJA 2FMTA 1Z29A 1H9AA 2ZPAA 3L7JA 3B7PA 4M9ZA 1OGJA 2ZWOA 5DOZA 3ZCXA 4DT1A 4X41A 4DY4A 1M0EA 4RE6A 1EI9A 1KXZA 4UMFA 4EG3A 4ZOCA 3PNMA 3TLBA 2I4LA 2IBIA 2NW6A 3FSRA 4Q1BA 2K4MA 2O3SA 4QSHA 3Q9SA 1XPJA 3T3MB 5B5SA 4ZJYA 3K0SA 2AV6A 2XUOA 1O97D 4NATA 1HYHA 4R05A 1QK5A 1A9QA 4ZYYA 5LNK1 1TGVA 3HQ4O 3OLYA 3ORYA 4UZSA 5FR1A 3CRQA 2KLHA 1KYWA 3DOEA 3QRWA 3R77A 4UW9A 2JJ1A 2VP0A 3FY4A 4UBMA 3DBRA 4E03A 1HRDA 2CD7A 2VF2A 2G80A 4V3BA 2C4HA 1UAYA 2HLPA 3ROEA 1M0SA 1INLA 2B35A 3GQVA 3OZGA 4IDNA 1PVVA 3BICA 3DOCA 3IP7A 3LK6A 4IIVA 3BRWA 4MWGA 4WN3A 3IUTA 1XD9A 2BMEA 1P0QA 4L4YA 1PJBA 3EA5A 3UKOA 5LA6A 1E2DA 1AVTA 2XYHA 4Z3OA 2Y6EA 4PRKA 4KK3A 1PQWA 3AETB 3ELDA 3GFOA 4YCSA 2VHWA 5AVWA 2FPIB 3VZBA 3WO1A 1M6NA 2P9ZA 1T2VA 2H0QA 3GA5A 3X1XA 3GNLA 2JLWA 4PSVA 5I9IA 1R74A 4FKZA 1E9AA 1DBPA 2FAVA 4DMHA 3EUFA 2NG1A 3JYOA 4OFBA 4K7JA 1OROA 1U2PA 3MJHA 2E6KA 4O2BF 4M0UA 4B6RA 2F67A 4C0XA 4F7WA 5JS6A 4D4IA 1XRJA 2J87A 3NHLA 3BHNA 5TX7A 4DQ0A 3D7LA 3NVMB 3R5XA 3DHWC 2GN1A 1DXOA 4QTXA 4R1SA 5HZGA 4M0WA 3EFOA 3H13A 3V5NA 3T5BA 5KYNA 3HFSA 2CV0A 1NJRA 5J4LA 3FCEA 1AQ6A 2QD2A 2RIPA 2F55A 1RPAA 2H2WA 4DDUA 3QJGA 2K6GA 4DLVA 3AHEA 3K7EA 3SYNA 2FLKA 2GHTA 4CM5A 1UEXC 2XOXA 3DBIA 2JI7A 1KOFA 3ONVA 1U1GA 2WPNA 2BH9A 5HFJA 2GXQA 4DG9A 4ZU3A 3ETIA 1GGNA 1N3IA 1QG2A 3D9QX 3E3AA 4IQ0A 4IIUA 1YK7A 1Y8AA 3EF3A 1DT3A 2G28A 2F1JA 2EFDB 2DP4E 3MHPA 2O0KA 1EG7A 1FX1A 3EG9A 4TXJA 3RRXA 4EYEA 3QQPA 2PJRA 1E3JA 2QW8A 3T0GA 1OILA 2GBLA 4DQDA 1PFUA 2ODNA 2HQRA 2XVZA 4WK2B 1L8QA 1CJLA 3CLTD 4UNIA 1QHXA 1XDZA 3MF4A 3QLEA 4E70A 3HN2A 4JCAA 1X0VA 2O07A 2O1SA 3HNPA 2EHJA 3M3HA 4DR1B 4IMIB 4YAKA 1JR3E 1RWVA 4ZT3A 3H3FA 3GMDA 1ZJZA 4BJHB 3WRXC 5K16A 1BDIA 3DAYA 3VBCA 1PFVA 1JI3A 3SN6A 2VHEA 5G1NA 2BZGA 4MQLA 4K26A 4EI7A 1VLHA 2ZIWB 1QTNA 1PGQA 1TYBE 1XELA 4HX9A 4Q7KA 3WYNA 2FZ4A 2VTKA 1GT6A 3B38A 3BXPA 1S1MA 3FFAA 4G85A 4J3NA 4EDFA 4JLVA 3RFFA 2ZYHA 1OC4A 5TF0A 3STHA 3AUUA 3WSTA 4JDPA 3S7ZA 3KYJB 2NU6A 2QRGA 2K7ZA 1LFAA 2PU7A 1K5GA 1ZKMA 3GCWA 4G36A 2HNAA 1YR1A 2KWIA 2YHUA 1PSDA 3AESA 4G4IA 3ME5A 1D2AA 4HHEA 4IPTA 4ZAWA 5U9CA 5I3ZA 3SIJA 4YYVA 3IILA 4ATNA 2ATIA 4MKIA 2NUAA 1SUBA 2E3JA 4MNTA 4A4DA 5C1IA 2DHEA 1OASA 1TZJA 1QGYA 4G0NA 4REQA 1RZUA 2OD7A 2XQKA 4LCJA 1KK3A 4XYGA 3N39C 3GZNA 4C6RA 4HF7A 4BECA 1KQFA 3QF4B 4A15A 1NW6A 2FW6A 1RBZA 1KERA 3EZXA 3QX3A 1ZH8A 2GO1A 1VL8A 2YINC 1HE5A 3RYIB 4UU8A 4ESHA 2JIBA 1XQYA 4NCHA 3KEMA 1W49A 4HDKA 2AZDA 3M6AA 4JZKA 4NABA 4O5OA 1Q83A 4Y2YA 3ZLTA 2PUEA 4WLUA 1FYXA 4OFZA 4DHWA 3JD3A 3KYIB 4FE4A 4EHHA 2YW2A 2DPYA 4R31A 4IDQA 2TYSB 5JFTA 1FSSA 3G2JA 1BWRA 3GRFA 4OHCA 4ZEXA 5LLSA 3WDLA 5AI8A 4YYSA 1SUPA 3GJ7A 1QZZA 1GPMA 2XQFA 3BIWA 3D7RA 3G9UA 2B7BA 5G3ZA 4QUBA 3RF7A 1FP6A 1KQOA 4J91A 1HNZB 3PDIB 2V5AA 3O8BA 1NB3A 5G53C 4WNCA 1XZBA 2I2WA 2UVQA 4LYEA 4A03A 1AZSC 5FWYA 5HFNA 2FZLA 4IEEA 4QRDA 2OZKA 5KO2A 3K2QA 3ZJ4A 4PZZA 4I4TB 2XZLA 1GU1A 4NQRA 1CDOA 2H7YA 4YO8A 2WAAA 2IE0A 2AMFA 3D2CA 1GZ3A 1IM2A 3AFHA 4UBOA 1X7YA 3L40A 1LLUA 2HZBA 3IV9A 3LIIA 5DM2A 3GLTA 4O4IA 1K6IA 1B76A 2ZR8A 3CINA 3CUEF 4Q1EA 4WV3A 2C2MA 2RD2A 4RIFA 4FLEA 3VTFA 5H9WA 1CJTC 5IU6A 3KAKA 3PSHA 5EQTA 4YYUA 2J3KA 4I5DA 2XD7A 4Y1RB 1X1TA 3GJRA 4KIGA 2I1WA 2PX0A 3L06A 1HWYA 3TM5A 4HT3B 5GTDA 3J7AC 3AVTA 2B69A 3CRNA 1GGVA 1GRVA 2C5LA 1Z6ZA 2GJSA 3M7IA 3T8WA 4H6XA 1Q7RA 3DO6A 3E9NA 3H75A 4WXYB 3IKLA 2ZKIA 1A71A 3EIXA 1OTXA 3EGDB 3F5MA 3GD5A 4IIYA 4OVKA 4URYR 4LJSA 4N3CA 4WY5A 4AD8A 1X38A 2PANA 2JFBA 1N57A 5BOSA 2X7XA 2AA3A 3DAOA 3OPXA 1M2WA 1VLLA 2HA0A 3KR2A 2FRVA 4PLGA 3DMYA 5G0SA 2IEZA 4Y9TA 3Q3VA 4W6ZA 2DBZA 3EQ8A 3EY4A 3HYLA 2YFQA 3YASA 2G9QA 4CN9A 1KHHA 2VP5A 3WG9A 4AN1A 2PUBA 4N4ZA 4D46A 5CEEA 2YV2A 5HQJA 3IL2A 1ORHA 2LTAA 1PT7A 1UM9B 6PFKA 1B2LA 1VDZA 4BQRA 2GHUA 4INAA 1SQGA 1FTQA 4K03A 1U3FA 3B70A 4IHJA 4MPDA 1E2IA 3TJRA 2YWHA 2LBPA 1MH1A 4EA6A 3ETNA 4WOKA 1MIOB 2ZIXA 3CUTA 1YVPA 4J76A 3CJRA 3H7IA 1P62B 4YMGA 4CDFB 4FFNA 2P3SA 2FUG6 4LHZA 3FYHA 2J9XB 3D8RA 4YJDA 5EIFA 3GJ6A 3ANLA 5BSGA 4WK0B 1NVUQ 2ZIGA 3OA2A 4HN9A 2X6TA 2C4KA 5ITZB 3O4IA 3K0HA 4DLRA 4ESSA 2HEIA 1QZUA 3SIWA 2PZFA 2E5FA 4X60A 2HPVA 2Q3BA 3FMOB 5EUQB 5JDCC 5L7YA 4W9MC 3C98A 2JZFA 3L7MA 3HRHA 4WESA 3SEZA 1P3DA 4W5BA 2JD2A 3LRPA 3OG9A 4XVHA 5EI5A 2VUTA 2ZYDA 4MP3A 1DEOA 1JEYB 2O50A 3MINA 4YFYA 2ATVA 2I2XB 5E9WA 3M3DA 3TD2A 4R83A 2R7MA 2OORC 3M99A 1CUYA 3BDIA 5G0VA 1DAEA 3L8EA 1UXJA 1VMDA 4QAQA 1SZPA 4NJEA 1M34A 4C4YA 1DRVA 1XDWA 1QF7A 5HUJA 2VYND 1ODSA 4YBZA 3DUWA 2F00A 3NHMA 3NHJA 2FUDA 1I36A 1JDJA 1FS6A 1RLJA 1E1YA 1UL1X 4LTDA 1Z5UA 2PPLA 3CO0S 4K9LA 1SIUA 1U9ZA 4NDNE 3S27A 4CR6A 1EA5A 4Q9KA 1XD2A 3EIEA 2VYFA 4ZY2A 4Q3OA 3GGDA 1EX1A 2B82A 4E3ZA 3QM1A 4D96A 4M8KA 4WZAB 3SLRA 2J3DA 4H1VA 3H9CA 3DEYX 4BLUA 2YXLA 3IP8A 5J5AA 4N76A 2GOYA 3DLCA 3LBAA 3MWKA 3RFUA 4RL4A 1YDFA 5TQ2B 2VDNB 3L4EA 1XUOA 1AKYA 1RYNA 4M9UA 5HQ3A 1NA5A 1VIYA 5A3RA 1E3IA 1VKRA 4UVHA 2CUTA 1CE8A 1FNBA 4L2IA 3G49A 1YKGA 16PKA 2NUPA 2OB2A 4MCJA 2INGX 4FBGA 4MR8B 4ZARA 1ZM4A 2IYRA 3K16A 1V45E 5CH5A 3PHXA 2WD8A 5EYPA 2PGNA 4X8MA 2IX9A 2ZATA 5DOVA 4D41A 4EENA 2EFHB 1H0KA 5A5FA 1MJ5A 2RAFA 3KUUA 4DQKA 3MZ0A 3LO5A 1JG7A 1B4DA 3GVCA 1FFDA 1KDOA 4IXWA 4OHXA 4RK1A 4U6NA 1IHOA 3D0OA 4ALIA 2O54A 5CNIA 5KOHB 4ZRDA 1LF5A 3UXYA 3KVOA 3OCYA 3ZWPA 1Y8RA 1LS1A 1ZIXA 2GB4A 3SR3A 1MX9A 3U37A 3GRPA 4H1TA 3F2IA 3EMDA 5AW8A 3DFMA 3A4TA 4QSMA 2M6SA 4AMYA 3T5PA 5LFAA 2EYUA 1MGPA 3NBFA 1NXWA 1UBEA 2OHIA 3R5SA 1GILA 4WSOA 1O6BA 5JMOA 4I0WB 4KWTA 4KNVA 4KK4A 5A9TA 3EYAA 5EP2A 3UV7A 3W7BA 5F21A 3OIYA 3TDKA 1J20A 4RDXA 1Y6RA 3RKUA 4ZI5A 3B82A 2FPOA 1T8SA 2BM1A 4YJ2B 3QKSA 2I03A 1G8AA 3MGCA 3WFJA 3CF6R 3ORRA 3N28A 4X1KB 5AXDA 4H35A 3QUSA 1YZTA 3ADCA 1NX6A 1UP6A 3LP5A 5AW9A 5CBMA 2G0NA 3PPVA 4KH0A 3K31A 3UA3A 3WIBA 3GV0A 4OI4A 3L4JA 3MLBA 4BOZA 2ZTLA 2AC4A 1OZGA 4ZJUA 2H1OA 1H05A 1NDHA 3P2MA 2I3AA 3E5HA 3UT5A 5FWXB 1YBAA 3E9QA 5K3DA 1GZ4A 1RWMA 4X45A 4MEJA 1YTLA 2FF5A 4UTZA 4AX8A 1F51E 4C0JA 3Q71A 1PRYA 2HUPA 3CJTA 1SJ9A 3E9YA 3TQFA 3WFIA 5JYDA 1DG1G 1SBYA 2C2KA 3PXEA 4GGPA 5A6SA 2BU3A 1A9OA 1RCTE 3NT4A 4M1WA 1GPBA 3CXUA 3UK6A 4NE9A 2ZQYA 2RG7A 3DDOA 1KI1A 2A0KA 2HA4A 3I32A 3LUKA 4R9NA 4FP9A 1HYEA 1KJWA 4YLEA 2ORVA 2HLDD 2QV7A 3C3PA 2OZEA 4QQRA 4WDQA 3ICEA 3P9YA 4ZQFA 3TIFA 1JECA 1G1MA 1P7CA 1BNCA 3C14C 1KJYA 5TC4A 2XCTB 3T99A 3QEAZ 1P72A 5B4VA 1B00A 1D07A 1T4DA 3UJPA 4YVAA 3PRMA 1JW9B 2ZWIA 2XDWA 4EF5A 3QXCA 1T10A 3RUPA 3SJUA 4XRGA 2Q6LA 4FK8A 4QEKA 2ZRIA 2B98A 2BLLA 2KW5A 4LBYA 3ZHSA 2EU8A 1U2DC 4B2YA 5A4MS 3IHPA 4I9UA 4E3WA 3PDCA 5IN5A 3N2LA 4LJ8A 3DGFC 2X8BA 2VZ8A 3HWSA 3NOOA 3T3GA 3FJ1A 2RAVA 1ZPDA 3HCNA 1SELA 3FFBA 3L8HA 3QEMB 4G07A 3VUEA 2B9VA 2F3TA 2X5OA 3LI2A 4RHFA 3O1JC 5K4HA 3S1LA 4I7EA 1HYBA 2LWIA 1NASA 1LPPA 1SBHA 2HF7A 3FMIA 4BMZA 5LP6A 1RC0A 4D8EA 4RANA 1R6VA 3RSOA 1PU2A 3PCTA 4Z7QB 1TC1A 4N3NA 3HK2A 1Z5ZA 4HN4B 3TG2A 1LPOA 2E37A 4Z1OA 1SKAA 1YVEI 4KQMA 1QS0B 2KYRA 2WTAA 3K9WA 4FW9A 1YB4A 3I04M 2QMHA 3GVXA 1P9WA 1G2QA 2J3JA 2PT7A 2XYGA 3Q4GA 4BRWA 2UV8A 3VHXA 2H06A 3PU6A 1SXQA 1UQUA 3S99A 4OMDA 1C29B 1AUOA 3IMEA 2YUIA 3O83A 4FPXA 1FVOA 4ZVUA 4F7DA 1OX6A 1U9VA 2GTIA 4EB6A 5IUNC 2PX8A 1T9HA 1CPJA 4MARA 4TYQA 1REQA 1J0AA 1R4NB 2VDRB 2O3UA 3EW9A 3NKFA 3P0FA 5BMVB 1OTHA 4W82A 1CQIA 2QTBA 3FKJA 2XNHA 4IXNA 5I9LA 1ITOA 1T4BA 3QVSA 2VHVA 4GUDA 2NZ2A 4AJ2A 2Q21A 3ND5A 4PBRA 1I4WA 5FTLA 5ALMA 4LZWA 5EAIA 3ZW7A 1NW8A 3P26A 5FBHA 3AIKA 4JX8A 3JQBA 4LJ7A 4P3NA 4YA6A 1JMVA 4U2GA 5CVTA 2PFKA 4XGQA 5ARDA 3ZE0B 2AYYA 1DTWB 1QFZA 4I66A 4W7HA 1BHSA 5DM0A 4MR7B 1FDVA 3REQA 4F6RA 3TQCA 5FNVA 3CG0A 1U9JA 4M1TA 4GRDA 3TQHA 5TVGA 4FIDA 3RFCA 4V2UA 1SQFA 3Q1LA 4PXAA 4B7AA 5K6AC 4MYDA 1T26A 4C4TA 1OZHA 4IQYA 1QHNA 1IN4A 1YS9A 3NAQA 4HAOA 1TAUA 4CNQA 4GRAA 1GLNA 2NWQA 1Y3CE 3KTFA 3AQIA 1C0PA 4UDOA 1KYIA 3HB9A 4NDAA 4F5WA 1M54A 4GC9A 1AQNA 1FRZA 3IS3A 2QRHA 3SGLA 5ESDA 5FCDA 1AF4A 2A35A 3OTHA 5D86A 2IITA 3VKVA 2AFIE 2JKZA 1TA0A 2RK4A 3KKKA 5HUQA 2PX3A 4XWKA 1YQWA 2VPYA 3PNYA 2G63A 3FZEA 4LV5B 4MQEB 2H85A 4LC9A 1EIZA 4R1UA 2C03A 5FPHA 3N87A 5FOSA 4AG6A 1A77A 1NXQA 4HDNB 4CLHA 2FFAA 4N1AA 3QTLA 3WZMA 2Y9PB 1Q1AA 1QGED 1P9OA 2EWVA 2EZUA 3AM5A 3TMYA 4Y1EA 3VZCA 1CY2A 1HNNA 5F2NA 1BG6A 5HKOA 5MGBA 2X7HA 3DM9B 2XQJA 4EKDA 2AKYA 2VP3A 3TIGA 4Y2TA 1QV6A 3EWNA 2QRVA 3U7FB 1GLGA 2CXSA 3QMWA 4QRXA 4MUYA 1FYDA 1X80B 3JTMA 3SDSA 4RYLA 4KQEA 2CEKA 5KIAA 2SKEA 3DXYA 1QFJA 3ONNA 1JF8A 5JCOC 5COAA 1QGZA 3O94A 4I5FA 3JARB 3BE8A 3L0IB 1LCPA 2F48A 1UIRA 1UAAA 2W7TA 1N2IA 3W5IA 1ZC4A 3AX6A 5EL0A 5K0GA 3LVFO 3D6JA 3P5UA 2JZEA 4LJKA 2HDNB 5K2OA 1KI6B 4ZAYA 2CVHA 1SO8A 3EVNA 1KAEA 2YNMC 1ZAYA 1DIBA 2VF4X 4KXXA 4MULA 5I3CA 1LSOA 5HOLA 4Y9UA 3SOPA 1CF2O 5F2KA 4GEKA 3AUKA 5CK5A 1CSBB 2B5VA 3GXBA 2GD6A 4XVCA 4B3GA 1QTQA 4FD3A 2TRSB 3UQZA 2W2PA 1JNXX 3KHKA 5KWSA 1X7XA 4ETNA 5JNTA 3MNFA 3BKWA 3EVAA 4R9SA 3D3WB 1ENOA 2NO6A 3FNEA 1Q57A 4YP6A 4ZVSA 3DR3A 2GETA 3REGA 3VPSA 5B1IA 4UTRA 2GWHA 2QN7A 1TUIA 2MSDB 2WI8A 1RE0A 1RQGA 5ALTA 2VDUE 3I12A 4IDDA 5BXYA 1ZZEA 1ZI8A 2ZETA 3WLIA 3DH0A 3GPQA 2GEBA 3OMWA 4GEGA 4ND2A 4YGYA 1N7HA 3HY6A 4JLBA 4YT2A 2WTBA 1JHVA 2C8LA 2R8XA 3LT2A 4JQOA 3W3AH 3RUCA 4KUGA 1CY4A 4RF1A 3ZQUA 3H2YA 1YRYE 3DE5X 4R3NA 2CNOA 3D7SA 1I94B 4MWSA 1J0BA 2OESA 3NCHA 4MIYA 4H18A 4L4SA 2GK3A 4S0XA 4D9EA 4RH1A 1P5RA 1COZA 4ZMBA 2CNDA 3ZDYB 2GEJA 3LDAA 2UYCA 1ZSYA 2DZZA 2F3QA 1KP3A 2RHGB 2GDJA 4Q4HA 4BKMA 3DCJA 5GV8A 4FILA 4AXBA 3I06A 5IMBA 3SC4A 1MAWA 3SFZA 4EF4A 4CLRA 4EMSA 1GVHA 4TN1A 1LBHA 1PZGA 3WGLA 4BVBA 4DYVA 3BXXA 3HP4A 4F9EA 3ZVNA 3HBLA 2D4AA 3MIIA 5DPMA 4WXEA 4PGFA 1JEQA 3KDPA 2OXCA 4G2NA 5AKEA 5B2ZA 1I7PA 3D4IA 3PR2B 3PFFA 1MS6A 3GF4A 3AY0A 4JHXA 1Z4OA 1HPLA 2P9CA 5JQGA 1Z4MA 2X42A 1V1RB 4KVGA 3EXEA 1OU0A 1CS4C 1L7OA 4RKYA 4M7PA 5DGHA 3SJZA 3QIVA 1BZYA 4ZOAA 2HXZA 4LDPA 1EUQA 4AJKA 1J06A 3Q40A 2EATA 5EWJA 4BE4A 3A26A 3GEBA 3ETCA 1Y9EA 3V1MA 3DJFA 4KW7A 3T8YA 2XCLA 4GZLA 2J9RA 2WU8A 3DBLA 3MMPA 1XTKA 4R4JA 4OF4A 2Q5JA 4RADA 5B3JA 1X19A 4WLNA 1GZHB 1E92A 3VYRB 3Q12A 4RFLA 3J80A 2MDTA 2R00A 5I8PA 3ZDCA 1OZ0A 4V0OA 3KSUA 3V1TC 3DHVA 3NIBA 5JD4A 1JHXA 5JXJA 3RK1A 4CQJA 3NIGB 5IP5A 4TQUS 5JEEA 2FSIA 4H4DA 2WP8J 3SJBA 1DIOB 1KY4A 2BFQA 3MT7A 4PSDA 4FM9A 3PKJA 2X9GA 3SKYA 1RWPA 1OT5A 1P7ZA 3Q0EA 2ZUBA 2A2ZA 2XTMA 3L84A 3H97A 2OCPA 3F74A 2PKQO 5EHZA 3AB7A 3HKEB 2WIJA 3GN2A 1J5PA 2P9YA 4XEHA 2QZJA 5AYVA 3SCZA 3DG9A 3THSA 2IYXA 3R0JA 5J2TB 3KSRA 1JIKA 4O4LA 5MFZA 5EMLA 1YSCA 4YR7A 3JQ7B 4NDZA 2LIPA 5FIUA 1JILA 4F8EA 4BWVA 4K9KA 4RAOA 5NULA 2N3ZA 1A88A 4ZO7A 1TX4B 2XWPA 5HNKA 1U0TA 2PZJA 3RYCB 4PO1A 2JAPA 1UZLA 2YQ4A 3P9CA 4CV3A 5TMPA 3DQPA 2IEAA 1YJQA 1QRAA 2FMIA 1WBJB 1A76A 3S7TA 1BS1A 1Y6FA 4C3UA 3D1VA 3GL9A 3BB3A 1M6VA 3JS5A 3A2NA 4AYWA 1DNPA 4CKWA 5GM2A 1MENA 4CVNA 5K4GA 1K9VF 2HH9A 4UC0A 1E3MA 3PSEA 1LBEA 1QQTA 2WDZA 3RC3A 3SWWA 1WSAA 3LUBA 5A71A 2EKBA 4NJEB 4YMHA 2BGJA 2O57A 1OUMA 2IXAA 3FCCA 3LDFA 2WW8A 4JOSA 3UHJA 3B9RA 3EZGA 1PJRA 3WDKA 4E11A 1FNDA 1L4YA 4ZI6A 3RH0A 3MYYA 3S3RA 2ZPUA 2XQIA 4GSLA 4JUBA 4OB8A 5AW5A 2CNWD 5K20A 3VBEA 3A6ZA 3CIOA 5EUMA 1PT5A 4RE5A 1JLLB 2IUSA 1WCXA 3OZDA 3PRPA 2G4CA 3B89A 5GP1A 3TZEA 2OP3A 4IICA 2HPZA 1LA2A 1GCIA 4Q6WA 3NAZA 2YZ7A 2ID8A 1F2VA 1QCYA 1VKNA 4MKRA 3NHBA 4DEVA 3B7WA 1NHGA 2B1NA 1DRWA 4L76A 2VK8A 2P86A 4AU1A 3E5NA 4LDQA 4J0FA 4NU6A 2V65A 4RLFA 5A03A 2XDYA 5CB4A 3TMPA 1Q15A 3K8YA 3AR3A 3P2JA 1NQWA 4PX9A 3T5CA 1ZEJA 3TTVA 4W5QA 2W4QA 4R0VA 5J2UF 1L3CA 3GX1A 1F20A 3N8GA 3TPFA 3NOXA 4WLVA 2UZ1B 1HETA 3ECCA 1YBVA 1J70A 2Q1YA 4YPVA 1V3VA 2H65A 2RI6A 4JEUA 1O0EA 1NRWA 1ZJ5A 3CUYA 4EA9A 4DDVA 3ZE8A 2B5OA 2H2AA 2GAAA 3VVCA 3W8DA 2W2VA 2JGDB 3I9NA 4RTQA 1DO0A 2FKNA 2R00C 5K8LA 1VLZA 2NAPA 1XZ8A 3MLEA 1NP7A 4XWOA 3WXEA 4HEJA 2A0UA 5KJ6A 1JJVA 1U3DA 5EZYF 3RIYA 2DUMA 2VT6A 1R37A 5AKJA 4BO3A 4Z4EA 3TVYA 2ZQ5A 5LQMA 3MS2A 5LU8A 4LYHA 1A82A 3BDVA 4LW8A 2QM3A 2GZSA 1XDUA 4WHMA 5D8NA 4Z51A 3H6KA 3AF4A 1ODIA 4MP8A 1KVSA 2GEVA 3KC2A 3PRYA 3OE7D 3Q15C 2SNIE 2HK9A 3AF6A 1IYZA 2XH8A 3AM4A 3JW8A 4ODIA 1I4OA 4OSOA 1DSSG 4XQCA 1M2OA 2PSJA 1NW3A 5A3VA 1MC1A 3LZDA 1PV1A 4RPLA 2PGJA 1BE6A 5HZMA 4I2VA 4MV1A 3B21A 1CX9B 4PZPA 3JPYA 2W8BA 2W4IA 4LRTB 3RSGA 4RDIA 2GN6A 1DLJA 1Z2AA 1UBHS 1G6Q1 3IT2A 3T9FA 4EKNB 1XPOA 1Z8FA 1UZMA 2XVMA 2H1IA 3AJEA 1YZNA 5CDGA 4QRVA 1JXOA 3LSYA 4OVZB 4NOKA 4WKPA 4NHEA 2Z8XA 4U4AA 3VO9A 1ZIVA 1ZIOA 2WNHA 1SRRA 2BM0A 3CUWA 1A0OA 3A06A 4CM3A 5TGZA 4D9MA 2AUXA 2DZDA 2Q62A 5LM3A 2QT1A 3WQRA 4D57A 3QHQA 3HHIA 3HBJA 2IZOA 5AI9A 2P30A 3WWOA 3EVDA 3P9QA 3A6GA 3NCTA 4JP1A 1GPUA 4WXHA 3R9KA 1WZEA 1JH9A 3PC6A 3UZUA 2R3SA 2UVDA 1GKKA 1ESZA 4FHFA 4H60A 4HXGA 1Y0BA 1NUTA 2HDHA 1XVAA 5GJVC 1BEZA 2GT1A 1ODCA 2CDAA 2RGUA 2ZRGA 3I52A 4YHHB 4PN7A 1SN7A 3CPSA 2HD4A 5HKKD 2ZAOA 1B8PA 2SKDA 1U7ZA 5ICGA 4JGKA 1GGKA 1YB7A 1Q91A 1QG6A 1UWKA 2AQIA 2C2YA 2WUDA 1B93A 3IGFA 5FLEX 4C4XA 4YV1A 1A1SA 4F9TA 3ZCSA 3P4UA 3G9TA 1KMCA 1JYSA 1IIRA 3EIHA 4ZU1X 2DF8A 4A0SA 3MUNA 4EWLA 4BOQA 1V3TA 3WZLA 4JC5A 2J6HA 2ZVJA 3PUXA 2A1TR 1G2PA 3CWQA 3F46A 4XASA 5EIBD 1XZIA 4UXHA 1NRIA 2OYRA 2B4KA 1K3FA 4ZEOA 4MZXA 1KE1A 1JSRA 3ACBA 4C0BA 2C8KA 4XTRA 2VWPA 4BFZA 1XLTC 4RPHA 1J09A 2YV1A 4QUJA 4YYRA 3G1UA 4AY3A 2IZ0A 3Q7RA 4LY0A 2JIPA 4FOOA 1YZLA 5FBQB 1XE3A 1USVA 2ZRMA 3EULA 5CT9A 5H59A 5AVYA 2XCOA 2RCYA 4QFMA 3DZBA 1QKIA 1QGAA 4WA6A 4RK0A 2CNWA 4U63A 3CQ9A 3LGAA 4UDXX 4D6YA 4Y2GA 3BGIA 7REQA 4LDRA 4B6SA 4S1TA 3NNDA 3QLVA 4NBSA 1PKXA 1MXFA 1AUVA 3A58B 4TL8A 5BR1A 5JCOA 3CR3C 4O63O 1YIAA 4L0MA 1Z5WA 5GZ3A 2GEFA 2C98A 1UAGA 5D01A 5F9HA 1GPYA 2IKQA 5M2QA 2RB5A 2HBRA 2OGZA 1RPZA 4BGUA 2JIRA 1PJSA 3AKZA 2NN3C 1P17A 4P86A 4FR5A 1NIPA 2ZBEA 2PG3A 3RIXA 3E0XA 4QODA 1WXFA 3NHAA 3CM0A 2G76A 1YOBA 4PONA 5JOQA 3QFFA 1F12A 2H9AA 2CF6A 1AM4D 2Q6VA 3FGNA 3HVHA 4YAIA 3B48A 5E0KB 3C6ZA 4PYQA 4U5XA 4Y8VA 1N32B 4HYQA 4LI0A 4DA8A 1PQUA 4XR7A 3AM3A 2YXNA 2FSSA 4DADA 4IMPA 3FHOA 2AW3A 1K68A 2DBQA 4UOQA 3GZTB 1ZY2A 2AEFA 4I50B 5G02A 2O48X 1ZMXA 4UEOA 3HFRA 2ZDGA 3HVKA 1OVMA 3OWOA 3LGXA 4GKKB 2CDCA 2J9YB 5CVMA 4KPEC 1SMKA 3PT9A 3WMXA 2X8WA 2AIMA 1Y4DE 4PC1A 5BV8A 3V1UA 5A9RA 1QG4A 2I8AA 1SUEA 4URHA 3WR5A 4CIVA 1A5ZA 1MAUA 2I6UA 1U1FA 1N5IA 2F3SA 4TKLA 4X3CA 1OBOA 4NS1A 4Z3DA 4QPDA 1BX1A 5AJYA 3ZD9A 4YP0A 4QDTA 2V6GA 3VR4H 5C7IO 2V7GA 5BR4A 1VJ1A 3TXAA 2WM9B 3NGLA 3PEYA 1AX9A 1QO7A 1U0NA 2W6JA 1QYXA 4KPUB 4PO8A 1EE2A 1GFZA 3IV2A 4K9NA 3IRVA 3VI3B 3L0YA 2C0QA 4HZGA 3PQFA 1P5HA 4QULA 1ZUHA 3U3DA 1DQNA 3ZD7A 4TTJA 1AN9A 2ZSIA 4IGKA 4KQKA 1KZ4A 4K86A 4R0MA 3SX0A 3HB5X 4AO8A 5B7GA 3GFPA 2B1JA 1HT3A 4ZQIA 1LEHA 4N0MA 3GP3A 1HE2A 2VTDA 1FTYA 1M75A 1WMSA 3ER9A 2BGKA 2HD5A 3JQPA 3SXJA 2Y1OA 2ZJ3A 3SKVA 5DXJA 1U8ZA 4FFOA 1STOA 1ME3A 3EGXB 4NBRA 4YIHA 1CQDA 3V48A 3RG8A 3IQWA 3QUAA 4PZ0A 4B3XA 1WMFA 2IPAB 2QAGB 3N70A 4AZWA 5B3KA 3EASA 1JLMA 4G8CA 4XA8A 4BS9A 2VJYA 3O73A 2BI8A 3HC7A 3T54A 1MB3A 3DVLA 1RLIA 1DJOA 1EDBA 2J59A 1FFYA 1SD5A 2DC9A 2A94A 1TI7A 2CDBA 1FLDA 5A4FS 4H31A 4QPNA 2HIHA 4RF3A 1A4IA 2E03A 4ZT5A 3C8DA 3OZRA 5TMEA 3MM4A 3DTTA 4GMGA 3VZSA 4WRRA 2NTVA 3JD0A 3VYVA 5D3MB 3PXGA 4ZKEA 3L77A 4RSGA 1TM7E 5HTOA 3DE0X 4RLHA 1CIJA 4IJWA 1U2SA 1OA1A 5FOWA 4LE0A 2N1BA 1NC3A 2BAGA 2W58A 3ROXA 1BVHA 4ZY0A 3SYTA 6Q21A 1A2QA 3EZFA 3N3GA 4RY8A 4XPIA 2GXUA 3WI7A 4C4ZA 2IBSA 1IN8A 3ZHBA 1TADA 1XZFA 2PGOA 3L6OO 5EERA 4CQLA 4IEFB 2GZAA 3TO5A 4ZYXA 2A9RA 2NNWB 5EJ7A 1J22A 1OI4A 2PZLA 4RTNA 1H8EA 2VC2B 3A6DA 3GA7A 3DDNA 3D6TB 3PJGA 4ZYZA 5KTMA 3LK7A 3K2EA 2JH8A 1NNEA 1EHIA 5AXAA 3ROPA 1KYZA 1JH8A 3JD4A 1T2UA 1IY0A 4Q7EA 1F48A 1FYFA 4XX1A 2IZ1A 1NJ6A 1GUAA 6REQA 1P6QA 1QIMA 2J4FA 3A3PA 4Q12A 1JG2A 3GLHB 1NMXA 1P18A 4OHUA 3IODA 4DR3B 2R6FA 3KD3A 2OHFA 3GJTA 3QBTA 6GPBA 2VQFB 5LQAA 3IOQA 2ZZKA 3F7TA 1VFPA 3OD1A 2YV3A 2VAVA 3TM4A 1WF3A 4DV6B 3ELWA 2AWOA 1Z4NA 2NXEA 4G4SP 3SICE 3VQTA 3SQWA 1FDRA 4DR7B 4P84A 2OHHA 4N6NA 3W30A 3K70B 3UCEA 1ES9A 4Z9YA 2C31A 1FMJA 2UYYA 5EMJA 4BMOB 1KJZA 1TJ4A 3HB1A 4ZMSA 1R4MB 2ZRQA 2PGAA 3PVCA 2NSLA 2Q28A 3K8ZA 2DR3A 1WP9A 2R44A 4JMPA 1UBFA 2WJ6A 3WK4A 1KFUL 3QH4A 1XNHA 5AXCA 1LPNA 2X41A 3K0EA 2R66A 5EJ4A 3HXLA 5EVJA 3GRAA 2F90A 3OM1A 3AFNA 2GVNA 2C3PA 4WZBB 2M6LA 5DHSA 4W5NA 3BN3A 4W5TA 2NUPB 5T8KA 2YHBA 2Z57A 1HFWA 4ZV7A 5HF6A 1HUCB 2FQ9A 1QCZA 1KOJA 1G5QA 2JEYA 3M82A 4S2EA 5FSXA 3KV3O 3L7AA 3RVXA 1COWD 4IDFA 4UBIA 1BVYF 3W8EA 3M6UA 2XUPA 1B6RA 1NQVA 1XVIA 1T3HA 1JDZA 2N75A 4OAPA 5DWQA 1E63A 1UMBA 4M0FA 3LFTA 3V9AA 1QAMA 5KQSA 3PVSA 4AJIA 1QOPB 2OBYA 2CMDA 2Q3CA 4DJJA 1QKKA 4NYIQ 5DIFA 3E6AA 3NEAA 4GWGA 4GYKA 521PA 3VA7A 3C74A 2QQ5A 2VDLB 2DLCX 3T34A 1XWWA 3OJEA 1IC6A 1LW7A 4QEZA 1BGXT 1BYUA 4Z7OB 1S96A 2BFBA 4X0EA 2WIAA 2KSQA 4CMIB 5LN1A 2IP4A 1DUSA 1C7JA 1H42A 3Q88A 4LVUA 2OSVA 3T1HB 2UAGA 4KWHA 4MKFA 5CVJA 1W4CA 1ISFA 1DAIA 4C4RA 3X1KA 4JBWA 5CB8A 2QDKA 1ATZA 1YMQA 2DERA 3FA2A 2FPSA 4E6EA 4YDHB 3T5MA 4CMCA 1IEWA 2MYUA 2DX6A 5BUSA 4Q3KA 5DRTA 5JTUA 2PWYA 3FPLA 3AO0B 3OO0A 4JJ7A 3BIOA 2EZ9A 4OH7A 2CE7A 1FNSA 1G6KA 4JBYA 5JSKA 4BLTA 4CUKA 2LP4Y 5B2FA 1QP7A 5LOVF 1HE3A 5C8ZA 3ZGVA 5C7YA 3PS9A 1L9KA 2ADOA 3DFKA 2Y99A 3MTJA 5THQA 2OUIA 4RPIA 1OVGA 1HL7A 3CLUD 2RHJA 4O2BA 2PRIA 4JI6B 5P8WA 1Y63A 2ZANA 3QIAA 1ORDA 4FJ2A 4GPZA 2IXTA 4AICA 1GQRA 1Q1BA 2WY2D 3OUTA 2B0JA 1N25A 2CJWB 3PW3A 4BVJA 4OEHA 4GI1A 4KI7A 2XBMA 1MA0A 4N7JA 1YWGO 4BKPA 5BN5A 1ZG3A 1TQ4A 4HDQB 3UG6A 2WMDA 3KYCB 1QR2A 3CO5A 3EVCA 3C4VA 3MJ4A 2BEJA 3DKRA 1E61A 2BRUA 4XWGA 2ZI6A 3VSEA 2O8BB 2ZB2A 1Q5PA 2ZBQA 3KUXA 1OAOA 2JGFA 5FOQA 4BVAA 2WE8A 3E1KA 5JARA 3GPGA 1T1IA 2HTEA 3RC1A 2DBYA 1WD5A 3EPHA 1H3EA 1NI3A 1ZUNB 3CA8A 2QVYX 3K9NA 3C5CA 1FRQA 1XZAA 3PEIA 2ODAA 2VHYA 4IVQA 3LVRE 4WK6A 4B3JA 1Y9ZA 3L8MA 2H1FA 3OEHD 4XTCS 2H6EA 2OWEA 3H4MA 3KKMA 3R7FA 3E3MA 2VJMB 2WHRA 3BXHA 2WG1A 3UJAA 3BVPA 2CXQA 5JDCA 5JWHA 1ZL0A 4YBRA 4B6QA 5BYKA 1THEA 1P0CA 1DIRA 1M2JA 1M7BA 3HSKA 5JS7A 3WGIA 1KZ6A 3V8PA 2WU4A 3UWKA 4C9BA 4YLYA 5I01A 1BJRE 4KAAA 4Z4QA 2Z6VA 3PNKA 4FC7A 1YQUA 4OMUA 3OOSA 3CN9A 4LSZA 1IN6A 3U4AA 3C97A 1XNQB 4LPKA 1BMFA 2GCEA 4ECAA 1F6WA 2OHXA 2XAAA 4Z49A 1DGQA 1WA5A 3F5VA 4QGGA 2HA2A 1KFCB 1XNGA 3T1QA 3FGOA 2YNMA 3CR7A 4BLQA 1ZONA 1OXTA 3TBKA 4M87A 3ED5A 2J3HA 5K8VA 1XDBA 2QMQA 4QUKA 5TQJA 4GLJA 2IHVA 1FL9A 1IZYA 1RMQA 1D2GA 1ZM7A 1I4EB 1CRZA 1FQOA 1I0ZA 3G2IA 3HDQA 5SYAA 1B43A 4O4JF 1CDZA 3FUCA 4D8XA 3KQKA 1IBRA 2YVAA 2I6XA 1NDUA 1GY8A 4MVJP 1N3LA 4GS5A 3L46A 5FP0A 5IDVA 3W1VA 1XZMA 3G5LA 1V0JA 2RH8A 3EFBA 3CHYA 3HVRA 1OPXA 3BXZA 1TK2A 4MR9A 3DKIA 3SEQA 3UOWA 1L4MA 5H0IA 3BK7A 3NTRA 4FCTA 2H5JA 5A06A 3PUKA 3KKEA 4B5LA 4AO6A 4C21A 1CQWA 3OKPA 1V11A 1J8DA 1GKIA 1XTPA 1UXKA 2OEPA 3TQTA 3O8RA 3D1JA 3RYFB 4OM7A 1G5RA 1V8FA 2UZ0A 3AILA 4TL6A 3MHTA 1Z7WA 2QSYA 2IT1A 1XZCA 4INZA 3RI3A 3WJ1A 3R3WA 1XQXA 4FEEA 1MRZA 4YRFA 2DTEA 3RTCA 1BFDA 5JWRA 4KMSA 2AHOA 2VN8A 4B85A 2GFIA 2F3RA 3L41A 1UDAA 1Z2DA 4YB8A 2GD2A 1FXUA 5E4FA 5EE9A 3THRA 3IBGA 4QDOA 2J5KA 1TT5B 2JKVA 5BW6B 1PFKA 3PHJA 3ABIA 3JQAA 2QA5A 1M8GA 7ADHA 5KVCA 2UXDB 4OVZA 3BE5A 3PQCA 2C9DA 1XMIA 4ZO6A 4PQRA 2Z5GA 2AXQA 2HF8A 2V8BA 2CCKA 3NJRA 1ZCBA 1ZC3A 1SVUA 4I99A 1LTHR 3O8QA 3B9PA 1QX3A 1JDBB 3BGWA 1USWA 3KXLA 4I9GA 4JI3B 4R8SA 1P75A 1U99A 4L4UA 2CW5A 2DRIA 3Q7QA 1GTJ1 3MAJA 1EGAA 1E3EA 3EF0A 1YZUA 4YC7A 3T3NA 5AVVA 5C53B 1ZK2A 2HO4A 4AQ7A 3L02A 3AW9A 4PYJA 2YJ4A 2EKLA 3H1FA 1NMQA 3ONEA 3LM8A 1R18A 3KDAA 3GZ4A 1B74A 5L95A 2LIVA 3JQBC 2G71A 4DLTA 5LVAA 4IZOA 1ULZA 5FOTA 1XAHA 3IDQA 2Z8ZA 4S24A 4DE5A 2PD6A 2B36A 1OFUA 1NQOA 2PL9A 1HNXB 1F6BA 4ER3A 3LFYA 1E9RA 5CLFA 4KSCA 5H8WA 3RB8A 4DM7A 4I9HA 3QEJA 1KAMA 3F6PA 3ZHOA 1DKNA 1BJTA 3WL6A 1UJ4A 1XOIA 1GNVA 4A6DA 4N5MA 3KB6A 3AF5A 4YRPA 1K3UB 1SQ0A 4RXTA 1CUUA 1WF6A 3CLRD 3I4LA 1QDLB 2FW8A 2GEUA 2Q1SA 4GG1A 2D13A 1W2WB 3KXIA 4G09A 4XGNA 5FWNA 3EPRA 4P0QB 1E5LA 1K8QA 4YI5A 2OGSA 1KI7A 1F3OA 1GG9A 2C20A 3A7EA 3M34A 3N7AA 1P80A 2E49A 3NFYA 4JC0A 5HQTA 4QATA 1GOTA 1MQSA 1ZM3A 2R5FA 2H5LA 2PGDA 5HJ5A 1Z0FA 2JHFA 2CGEA 2VYNA 3KAJA 2FG5A 3TL6A 3T1YB 1XFAA 4MI1A 1E60A 1OREA 4NCAA 2QUZA 4GBED 4AF6A 1YCGA 2HWYA 3L7KA 3U0BA 1KY5A 5DSTA 3ESCA 2HZ7A 1FRNA 4YRQA 1LWNA 5IKOA 3VOAA 5BW5A 1QG0A 1VLJA 4Q4JB 2PIAA 1XI2A 1F9AA 3QLUC 3RQIA 3TUZC 3L9WA 5BOSB 4IL5A 3TOSA 2WV7A 5BY2A 1EWVA 1VFNA 3DMFA 1C8KA 2B78A 3LO8A 1F1JA 3PIRA 1BD4A 1Z0UA 2VPTA 2ZBDA 3OQ1A 4R2JA 4YAEA 5F5XA 4DMGA 4E21A 4XR4A 4FOLA 1B6GA 1L7PA 1VZ3A 2JCVA 4BFLA 1EQ2A 2N42A 4JWTA 1G9SA 4H0NA 2KHZA 5I6DA 3MP2A 4JGBA 4R3WA 4HVTA 4XSGA 2QRMA 4PCAA 1U7PA 3RVDA 1IEQA 2G4VA 1W85A 2QYTA 4W7IA 1A9TA 2AD5A 3FMGA 2FZCA 4G24A 3OF8A 4LF4B 1NT4A 4ICIA 2XTAA 4EEKA 4A5UA 4FNOA 1FMCA 3HKBB 1F5SA 3QQ5A 5DGDA 2ZJ8A 4R8RA 1ZZGA 3EG9B 4L8WB 2ONYA 3MN1A 4JQYA 5GQSA 1T34A 1GDHA 1Q1EA 5B2EA 1M67A 2GN4A 1LBIA 1OIXA 1J21A 1URPA 1PL6A 1WCIA 1YZKA 3QYAA 4AT1A 3O1GA 1MDWA 1S8FA 2AKAB 2CYAA 3HLKA 3LRTA 3KQQA 3OZAA 3W5HA 3PFWO 3T4EA 5BWCA 4DYDA 2JJ2D 3LW7A 2EG9A 2AN1A 3EZ2A 4MINA 1CV2A 2Z9CA 4FR0A 2Z1DA 4NSNA 3R7SA 5LR6A 1FP2A 1BMTA 4UMLA 4J6EA 4PPYA 2JIZD 2VYVD 4MK4A 3TLYA 1YF3A 2WYUA 3JYPA 4GI2A 1ANKA 1LPBB 1TLLA 1MNAA 3OETA 2CMHA 2D5LA 1A5TA 3NLLA 3L1VA 4LJLA 3ZUAA 4O4JB 2IRWA 4Y2HA 1E1LA 2BT4A 3T7CA 2UUPA 2Q0XA 3TVDA 1PWYE 3T15A 4XYMA 1R6DA 1VKJA 1O95D 4RETA 2O5EA 2IYAA 3GJ8A 3P2KA 3Q3EA 2BM8A 3Q5EA 4QARA 5AP9A 1EK5A 3D8SA 4R6WA 4IFIA 2DBRA 3KQOA 2DSTA 3PE6A 3QKWA 4GI3A 2PX4A 3TSYA 3VYUB 4YUYA 2FOXA 1J42A 3Q9LA 1ZLXA 2H2GA 3L49A 1JPUA 1T8YA 4LX8A 2E5WA 2VJKA 3D3EA 3GJYA 4M99A 4MQMA 1OFIA 5CGZA 1K98A 1O2DA 2GCOB 2D3WA 4PCUA 2Q7DA 3QG5A 3KJHA 4PADA 1ACLA 1Q0ZA 4QJIA 3G7SA 3MGGA 1MC5A 4ID3A 5KVSA 1ZD8A 4ZHQF 4J1TA 4DRXB 1G2OA 1MQ8B 4CR8A 5DNUA 2ZU0C 4PQGA 2BFFB 4MS3B 3UFBA 3TZCA 1NRJB 2YQ5A 5A1TA 2ZOSA 3I42A 4HDKB 1RXEA 3R7WB 5EHQA 4Z4CA 3OCZA 4L74A 4MI9A 3RS0A 3W1EA 1MQAA 5JNUA 3VJLA 3RTBA 1QYWA 1ZN8A 3HKBA 3FOAA 3UWSA 2YJ2A 1OKKA 1R1DA 5CFLA 3AVWA 4QRGA 2FGJA 1G2IA 1XJQA 2DUJA 4UVGA 3G6WA 3TJMA 4YUAA 1ZGZA 3MWLA 3NZEA 5FUXA 1R6AA 3OZBA 3IHLA 2QK4A 1VG0B 4ZCIA 3Q72A 5E4JA 1R50A 2BUAA 4PBSA 5KWEA 1KGSA 1ZR4A 2FVYA 3UM9A 3VR6H 3G0OA 1D8TA 3D1LA 4JI1B 3W2IA 2JK0A 5C8VA 4JI7B 3IAXA 1CHDA 5E3BA 3BSYA 5AM1A 3X2EA 3CEPB 5JATA 3BORA 4HNRA 1AHNA 1O0SA 4LAFA 1T6XA 4OCZA 4R2MA 2ZFUA 4WN9B 2GASA 4QGHA 5DTMA 4DV0B 4YP9A 3QKSB 3CW8X 3VNBA 5EJ9A 5J2UA 3AEQB 4AMZA 4UNSA 2WHPB 2QTCA 3GY0A 1ZH4A 421PA 3CZQA 2C0PA 4WCFB 1FXWF 1FTNA 3UATA 3WMRA 4YUXA 2I22A 1M8FA 2PQ6A 3IQXA 2V6FA 5EPOA 4TMTA 4IHAA 3NBXX 1GCAA 4DVJA 2QX8A 1MAAA 2WIGA 1E2LA 3V4SA 4AJ4A 1NHWA 1T6BY 4MUJA 1IRXA 2PQ2A 1DWOA 1NUSA 5K6TA 4RTPA 3ERCA 1WM1A 4ND7A 5FXMA 2EBHX 3F9IA 3D5EA 2CNKA 2V4MA 3FPAA 2G9UA 4J0DA 2OYSA 4TRMA 1JIVA 2WVHA 4AUNA 1DC7A 1QRDA 3N7UA 5G0WA 5C3UA 1HZZA 1E2UA 1D6NA 2YZGA 4A91A 2FX2A 2YRWA 4ZCMA 1BE1A 1SBZA 3ILYA 3LE8A 3ABQB 5U4XA 3VHQA 1EXDA 4KFCA 2AUZA 3O8DA 3LQ4A 3V8VA 4FONA 2GBFA 2IOHA 3DEJA 4PYNA 3K70D 4V24A 1KDYA 3WL4A 3RUAA 4NFSA 1FFGA 3PFIA 4KIFA 5DHFA 1LDEA 4F4DA 4TVSA 2I4TA 3Q2OA 2FLWA 4MVWA 2P0RA 3K94A 1TM3E 3PQ8A 2NYRA 4R8MA 2VSQA 4DAOA 5BQ3A 4OU5A 4QGAA 3LHFA 5AK4A 5JU6A 1Y4ZA 2O3QA 2ZRJA 3UCXA 1UOPA 3BXFA 1FU4A 1GGMA 1RKXA 4LQ4A 4YCLA 3ZV6A 1QRSA 4KV9A 4OHVA 2LDBA 4N47A 4HXYA 2E0IA 3V4VB 2SCUB 3CCCA 2E4AA 3BWEA 4OATA 1AUPA 1P1IA 5EJ6A 1Q3TA 2QBYA 2C7VA 3B52X 2CYBA 1VB3A 2IU6A 3BF7A 3DBOB 1Q7TA 4RJJA 1U8TA 3PUJA 5AM5A 3SI7A 4YRNA 5C51B 3WE7<