4GUAA

Alphavirus p23pro-zbd
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
662
structure length
662
Chain Sequence
NPFSCKTNVCWAKALEPILATAGIVLTGCQWSELFPQFADDKPHSAIYALDVICIKFFGMDLTSGLFSKQSIPLTYHPADSARPVAHWDNSPGTRKYGYDHAIAAELSRRFPVFQLAGKGTQLDLQTGRTRVISAQHNLVPVNRNLPHALVPEYKEKQPGPVKKFLNQFKHHSVLVVSEEKIEAPRKRIEWIAPIGIAGADKNYNLAFGFPPQARYDLVFINIGTKYRNHHFQQCEDHAATLKTLSRSALNCLNPGGTLVVKSYGYADRNSEDVVTALARKFVRVSAARPDCVSSNTEMYLIFRQLDNSRTRQFTPHHLNCVISSVYEGTRDGVGAAPSYRTKRENIADCQEEAVVNAANPLGRPGEGVCRAIYKRWPTSFTDSATETGTARMTVCLGKKVIHAVGPDFRKHPEAEALKLLQNAYHAVADLVNEHNIKSVAIPLLSTGIYAAGKDRLEVSLNCLTTALDRTDADVTIYCLDKKWKERIDAALQLKESVTELKDEDMEIDDELVWIHPDSCLKGRKGFSTTKGKLYSYFEGTKFHQAAKDMAEIKVLFPNDQESNEQLCAYILGETMEAIREKCPVDHNPSSSPPKTLPCLCMYAMTPERVHRLRSNNVKEVTVCSSTPLPKHKIKNVQKVQCTKVVLFNPHTPAFVPARKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-structural polyprotein
publication title Structural and functional insights into alphavirus polyprotein processing and pathogenesis.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Hydrolase
total genus 200
structure length 662
sequence length 662
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4guaA02
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4guaA03
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4guaA01
2NXEA 3EVEA 4HGZA 5C9ZA 5HILA 3LCVB 3M4XA 2IPXA 3D2LA 4R8SA 4AX8A 3UJ6A 1YFLA 5CVEA 2JH8A 4BLWA 4XUEA 3DOUA 3CBGA 5E1DA 1IXKA 3G8AA 3GRVA 5K03A 1MHTA 3NJRA 1MJFA 4R6WA 2IH2A 3C0KA 2N47A 1VL5A 3EVBA 3T7RA 3FRHA 1I9GA 4PCLA 4K0CA 1D2HA 3A7EA 5GM1A 3TKAA 1YUBA 2YX1A 5EEGA 3EGIA 3EWPA 4HRAA 5FWAA 5BW4A 3MGGA 2NNWB 3P8ZA 2YXDA 3UWPA 1RJEA 4QTUB 4KW7A 4RTSA 2AN5A 3MB5A 4GUAA 3FYCA 3B3JA 4HTFB 1HNNA 1X1DA 5T6BA 1VP9A 2WK1A 4GQBA 3JZTA 2O07A 4QDJA 1SQFA 3P2EA 2GLUA 3HCCA 2ZZNA 3TR6A 3HA7A 2YR0A 5FSYA 3CGGA 3FPJA 5E9QA 1EG2A 1B42A 5GINE 3S68A 2C7RA 1YB2A 3P2KA 4CKEA 4E32A 1ZKDA 3LCUA 2ESRA 2PX5A 5DM4A 3UA3A 4PGGA 5HOLA 3HVHA 2NXJA 1KPGA 2QYOA 4E2YA 5DTQA 4ZY1A 3Q7EA 4C08A 5HIIA 5DXAA 4BY9E 4ETJA 4GVWA 3A26A 4J5RA 1R74A 3BGVA 5E2AA 4ER6A 1VE3A 2ZLBA 4FP9A 1KPHA 5DRTA 1D2CA 5K0BA 4P7JA 1KP9A 5ICCA 4ISCA 5LQJA 2UYHA 2CMGA 3DLIA 4V0RA 5K0GA 1NE2A 4DM3A 3FPGA 5FADA 1I1NA 4YUXA 1JR4A 3KQTA 1KPIA 4GC9A 4M38A 5DM1A 3GPGA 4KRGA 4QPNA 3EWRA 2PVCA 2ZWAA 1TW2A 5BXYA 5M5BA 5K0EA 4KVZA 1G8SA 4ZX8A 2ZIFA 5LQKA 2VDWA 3GRRA 1F38A 2IDKA 4H0NA 1QAQA 5K8VA 2CL5A 3LHDA 4RYLA 2HWKA 4C06A 4D86A 5BW5A 1EJ6A 4X61A 5CVVA 3FTDA 1KYWA 2OKCA 3V97A 4MHTA 3KPYA 3OZSA 2UYCA 1SUSA 4XUCA 3PTAA 5F2KA 1WG8A 3SIHA 4AUKA 4K3NA 5LSAA 5E8JA 1M6EX 4R7MA 2PJDA 4F86A 3LDGA 2BFQA 2P3QA 3C3PA 2I62A 1PRYA 4FS8A 1BPNA 3QV2A 1SUIA 1AQJA 3FUTA 2PV0A 5EPEA 4GC5A 1TW3A 2G71A 2JHCA 4EQZA 3LECA 5GWXA 3AXTA 3SXJA 5AILA 1NJRA 2ZCJA 4DA4A 3GQEA 2WA1A 3GU3A 5BP7A 2ZW9A 4ER3A 10MHA 1BOOA 5E9JA 2EX4A 3IJ3A 2QE6A 5FTWA 4KYBA 4AZVA 3FUUA 1WXXA 3R9XB 1Q0SA 4OA8A 4OX9Y 4R76A 2ZVJA 1X1CA 1X1BA 2IDJA 3R6TA 2FK8A 3E23A 4BP3A 4RTRA 4ABLA 4QQNA 3M6VA 3LL7A 5FWDA 4PYQA 2ZSUA 5HEKA 3C6MA 1ZR5A 1NV9A 3FRIA 2XYRA 4NECA 5DTRA 2I7CA 3MERA 5LR6A 5CIYA 2YQZA 2C7OA 4DMGA 2PT6A 1QANA 3BGIA 2PXAA 2PSSA 3KQYA 4FR0A 3MCTA 5CUQA 3BXOA 3TRKA 2AVNA 1BC5A 3EPPA 2FK7A 2Y1WA 1U2ZA 1WS6A 4DF3A 4QQKA 2ZBPA 4M7RA 1M6YA 1O9HA 4PYJA 3SX0A 1DUSA 4ER7A 5HIKA 3OE5A 2P7HA 3DTNA 5EZSA 5JR3A 3LBYA 3A4TA 3I58A 1JG4A 3BGDA 5DSTA 2ZIGA 2ERCA 1TXZA 4Y2HA 2OYRA 3VSEA 3V2BA 3P71T 3VC2A 2ZTHA 4ETKA 4RTPA 4PIPA 3MHTA 1R8XA 1Q0TA 3TLJA 2OY0A 2PXXA 4BLVA 2VS1A 3GPQA 4KIGA 2G70A 3GJYA 4E33A 4AZSA 4E31A 5FSVA 2Z6AA 3P9CA 2A14A 1VLMA 4L7VA 2FHPA 3B5IA 4MIKA 4PWYA 3HP7A 1ZR3A 2NYUA 3KQVA 3THSA 4PYMA 5FSUA 4C07A 2F8LA 4C04A 5ICFA 5K0NA 5MHTA 3UFBA 2PY6A 3C3YA 5EMMA 3EVZA 5EVJA 4BLUA 4YV0A 4PYLA 3SR4A 3IV6A 3UJAA 2YUIA 3EVGA 5K0CA 3KZWA 2AZTA 2H1RA 5DLYA 3LKZA 1F3LA 2CKDA 2O06A 1PJZA 3HA3A 4TU0A 2PLWA 3HVKA 4RTKA 3BWCA 1NW7A 2IBTA 4JLLA 4KWCA 4ZY2A 4QVKA 3BWYA 3GO4A 3C6KA 3EW5A 1L3CA 3V8VA 2GA9A 3LSTA 2P40A 3ME5A 2AN4A 5DTMA 4UMLA 3P9KA 3TM5A 2AN3A 1P1CA 3QOXA 1RI5A 1TPYA 3HCBA 5GP1A 5F2NA 4FZVA 1VIDA 1ZGAA 4HGYA 3UJ7A 1NT2A 2IGTA 4M36A 2AVDA 2CMHA 4C05A 2UYOA 1JSZA 2OB2A 4RTMA 3R3HA 5CB3A 2YXLA 3KQZA 1H1DA 1VPTA 3KPUA 3UJDA 5JUWA 1JQEA 3PLAE 4JGKA 5FSXA 2GS9A 2QRVB 5K0FA 3BWMA 3PX3A 3KR2A 2OBFA 4RSRA 4P7FA 3M6UA 4FT2A 4E2WA 3NVKI 3LPMA 3NWEA 2FAVA 2NP7A 5DX0A 2JH9A 1JG1A 1SG9A 1SPVA 3KR9A 3G88A 5EIFA 4CKCA 2O05A 3ID6C 1L3BA 4QDKA 3OE4A 3TKYA 2G8NA 2PBFA 2CWWA 2AOXA 2DPMA 1P1BA 3BWBA 1ZGJA 2EJTA 3FYDA 5G02A 3KPWA 3HVJA 1R18A 1ZHFA 3HM2A 1YFJA 4ABKA 5DRYA 5CMSA 3E05A 3UZUA 4LECA 2GB4A 3SMQA 3DMGA 4PINA 3JWIA 4EKIA 1KR5A 1AQIA 5FSZA 3BKXA 3HCAA 2PX2A 3ELUA 4PYOA 3ELYA 3OPNA 2R6ZA 3HEMA 3JRUA 5C1IA 1G60A 2OPBA 3PFHA 5LQNA 5DXJA 1EAMA 1RI2A 1ORIA 2HTEA 4E70A 3KR5A 4GOOD 1X19A 1JQDA 2ONZA 4AZWA 2B3TA 4PONA 3T0IA 4HTFA 1NBHA 2J9AA 4YUYA 4UOEA 3AXSA 5CBMA 2AOTB 1G55A 3KHKA 2UZ4A 1Y8CA 1NW3A 1VBFA 3UBTA 5EMJA 1ORHA 2NXCA 3MCZA 3AWIA 3G8BA 4IV0A 3GWZA 3TOSA 3G7UA 1SVUA 1KHHA 3KKZA 3U81A 3DMFA 3E7PA 1NKVA 2P8JA 4CTKA 3DMHA 2BM8A 3DXYA 2VDVE 1ZG3A 1JSXA 1XDUA 1KIAA 3SM3A 4F84A 2B9EA 5ERGB 4R6TA 4ZYQA 5ICEA 2XVAA 3JWJA 4U7TB 3EVAA 3LDUA 3GIWA 5D8NA 1NW6A 4CTJA 2FRXA 2B2CA 3MAGA 3PVCA 4OQEA 3UJ8A 3UJ9A 1LAMA 1DL5A 4O29A 3BUSA 2PXCA 1YD9A 2QY6A 1VHUA 5GIOE 3PEIA 5FA8A 2GAFA 3T8WA 2NP6A 1R6AA 2YXEA 1EIZA 3P2IA 3ORHA 5FCDA 2WA2A 1O54A 5CCXA 5E1MA 2FCAA 4IKPA 3NWBA 3NDJA 4X63A 3EWOA 3KQWA 4M37A 5EG5A 5DM2A 2P1DA 2PT9A 3MQ2A 2AFCA 2XYQA 3G2QA 3FTCA 4RTQA 5HOQA 3SSNA 5FUBA 4B17A 5EKUA 2AOWA 5K09A 1QAMA 4GOLD 3EGVA 5LQUA 3PFGA 5D1HA 1RI3A 3Q71A 5DM0A 3FPHA 3MTEA 2AOTA 4J4ZA 1R8YA 3NVMB 3JWHA 4F85A 4X60A 3MTIA 4PGHA 4JCAA 5CVJA 4KDCA 2I9KA 3VFQA 3FUXA 2DULA 4K6MA 3CKKA 5EQJB 3VC1A 4IV8A 1P39A 1V39A 4AZTA 3Q87B 3EJFA 5EZQA 3P97A 2XBMA 2BR3A 1NV8A 2BFRA 4R8RA 4MWZA 3KQXA 4U7PB 2AOUB 3E8SA 3A27A 3I64A 5GM2A 3DULA 4KIFA 3PX2A 3ANXA 3B7PA 5E2BA 4OBWA 4GOMD 2IIPA 4Y30A 1JG2A 2BH2A 3NTVA 3NW9A 3K0BA 5HIMA 2PWPA 4ER5A 3DXZA 5DUSA 3IYLW 1XCLA 3TFWA 5E9WA 3EEYA 2Z6UA 3H8FA 1HMYA 4RVGA 5CD1A 3DP7A 3CJRA 3R0QA 4EK9A 4YV1A 4RX1A 4GF5A 1BKYA 1FP2A 2ZZMA 2BR5A 3KPVA 2H11A 3KPJA 1UIRA 4ZY0A 5E3BA 1N7JA 3OFKA 3P9IA 3FZGA 5C0OE 5CVUA 1JQ3A 2C7PA 1FJXA 2IP2A 3HCFA 2GH1A 4P7GA 2R3SA 1JG3A 4EVIA 4RVDA 4WVLA 3O7WA 2PGXA 2G1PA 3ERCA 1QAOA 4X1OA 1T43A 2YTZA 2H00A 5KVAA 3SSOA 4P7KA 3DH0A 4HG2A 5EMLA 4C4AA 4PYIA 5E8RA 4R6XA 1WXWA 4E2XA 3NMUF 2AOVA 3KQMA 2G72A 1R00A 3I53A 5K01A 2OO3A 2AOUA 3OZRA 5FHQA 2QM3A 2I6GA 4ATNA 3ER8A 3GGDA 4YUZA 3UJBA 3KQOA 4OBXA 1QYRA 3L8DA 1XDZA 1GYTA 5DT2A 5DX8A 2IH5A 3EMBA 4C03A 4OA5A 5GIPE 1INLA 3EVCA 1SQGA 3GDHA 5KYGA 3DXXA 3PB3A 1BHJA 3K6RA 5FQNA 4PYNA 5HIJA 3IIFA 3KR1A 2V7EA 4J5SA 2B78A 1M0EA 5EGSA 1RJGA 1VP3A 3OZTA 4RTOA 4LWPA 3ER9A 2P41A 5DWQA 3FTFA 2LD4A 4RV9A 4MQ4A 2GPYA 1BPMA 1AV6A 3LDFA 5K0JA 3RIEA 2ONYA 3SSMA 5DX1A 4E30A 2YVLA 5FA5A 4JXJA 4EKGA 3HVIA 5U4XA 2HNKA 3HNRA 3GNLA 5KQSA 3B3FA 2AS0A 2XD7A 2VZ9A 3UJCA 3CCFA 4QTTB 3T7SA 4DKJA 4V0QA 3FPEA 1XXLA 3I9FA 3GXOA 4X41A 2ZIEA 2XYVA 2IFTA 1X1AA 3EVDA 3OCJA 1XCJA 4GBED 5IH3A 2EJUA 4PNEA 3DUWA 3BZBA 4DQ0A 2V74B 4XUDA 3M6XA 4RVFA 3M6WA 4RVHA 1N7IA 5E1OA 1EQAA 4QVGA 1Z3CA 2PWYA 5F2OA 5CM2Z 4G56A 3CC8A 2VP3A 5CB5A 2IH4A 2ADMA 3KQQA 3THRA 3KR4A 3V45A 2JHAA 1AF7A 3G2MA 1G6Q1 1IY9A 2X47A 1DCTA 4PIMA 5HFJA 4DZRA 3H8EA 3FUWA 2P7IA 3B3GA 3O4FA 1TY8A 3HA5A 1N2XA 4CKBA 5T64A 2EEEA 3OU6A 4YUVA 3EVFA 3H8GA 2EWBA 2EG5A 3KR0A 3I5UA 3A7DA 3EKEA 4ZTBA 3CJQA 2P3OA 3SIJA 2FPOA 3IHTA 2JG3A 1P91A 1RI4A 3ELDA 3FUVA 5EHGA 5CCBA 4RTNA 4IQYA 4XCXA 2PX4A 4GVVA 3LCCA 4KSIA 3KQSA 3FPFA 1VQ1A 5FQOA 4DCMA 3DLCA 5DPMA 1JTFA 3SIGA 1WY7A 2K4MA 2PX8A 5FHRA 2JJQA 2AR0A 3O31A 4ZI6A 4EMSA 3AY0A 3OFJA 4YUWA 5T67A 2QRVA 3QOWA 4HH4A 2VRIA 4OQDA 3M70A 5EOVA 1G38A 3GQOA 4QPPA 4LWOA 2EFJA 5GOZA 5EEHA 9MHTA 8MHTA 4IWNA 3JWGA 2E5WA 1YF3A 1L9KA 5EC8A 4ER0A 4LG1A 2DX6A 1IM8A 1KXZA 5KQRA 4POOA 4GOND 3HTXA 3UA4A 5EKXA 5LQAA 5H02A 5B1SA 1FPQA 3HCDA 3ELWA 3GRUA 4FGZA 4MTLA 5K05A 1EJ0A 4WXHA 1NBIA 1RJDA 2BZGA 1HJZA 1I4WA 1NW8A 3KU1A 2FYTA 4GEKA 4ESSA 3NDIA 5EIWA 1JTEA 3T7TA 3P9NA 5HIHA 1XDSA 5EHIA 2ZFUA 1ZQ9A 2OB1A 4FSXA 2FXKA 3PT9A 3PS9A 2OZVA 5EMKA 1LCPA 4KDRA 2ACFA 3TM4A 2O57A 3SIIA 4FSDA 2B25A 2C7QA 1LAPA 3RW9A 5CVDA 1YZ3A 2HR1A 3F4KA 3SVZA 2ZBQA 3CJTA 4X2TA 3GRZA 4HC4A 2UYQA 1OR8A 1FBNA 3VYWA 3IIDA 2VDUE 1L3IA 2P35A 1YZHA 1XTPA 3TQSA 1BLLE 4JVVA 5D1NA 3H2BA 4A6EA 4CXMA 5ICGA 7MHTA 3X0DA 5LQRA 3EGEA 3GRYA 3OU7A 4YV2A 2XVMA 2Q41A 2O0LA 3LGAA 3TMAA 4RWZA 3BKWA 4P58A 2ZZKA 4CWAA 2P3LA 4BP1A 4DCGA 3A25A 2HV9A 4PYKA 3FTEA 2Z6QA 3ETIA 1XVAA 3EWQA 5P8WA 3B89A 3G89A 3AJDA 4E2ZA 1RI1A 2HMYB 3G5LA 3GCZA 1XJ5A 3REOA 2KW5A 4FT4A 3OU2A 2L8RA 3SGLA 1KYZA 3CVOA 4RTLA 4A6DA 1LANA 3LX6A 2IBSA 4Z2YA 4ZX9A 1G8AA 5HZMA 1UFKA 1WZNA 5LQCA 3HCEA 3LBFA 1O9GA 1RJFA 2ORED 3GPOA 3G2OA 4YMGA 5K0LA 4J5QA 5E1BA 3G5TA 3RODA 2ZWVA 3TPZA 1UWVA 3IEIA 3EJGA 5KS2A 2Y1XA 3G2PA 3EEOA 4RTJA 1FP1D 2ZULA 3KQPA 3DR5A 4R05A 5IKMA 1SKMA 2FG1A 5DSXA 3Q6ZA 2JHPA 3BT7A 2BM9A 1NW5A 3R24A 2NXNA 4YMHA 3M33A 2LGRA 2BR4A 3EMDA 4HSGA 3WSTA 3LKDA 1L1EA 2ZBRA 5FULA 1D2GA 1QZZA 2PKWA 2OXTA 4PCAA
chains in the Genus database with same CATH superfamily
1LVHA 3RVQA 3KSEA 1GXSA 5BQ3A 4QD3A 1ABEA 4B6GA 2BELA 1HY3A 4IMPA 4Y0VA 1Y6RA 2CLDX 3O3CA 4HQRA 1BDMA 1N6KA 1Y8QA 3QK7A 1KO5A 3QXGA 2WWXA 2IHVA 4JR0A 5HILA 3DCIA 3MCVA 3NTQA 5FXMA 4DR5B 2NO0A 4M1ZA 4QXQA 5AI8A 4ZRNA 5BSTA 4BV3A 5DN9A 4Z5XA 4MRSA 2JIPA 3K2EA 2Z3VA 4AX8A 1WMDA 4U2KA 4OHXA 1E2LA 5CJ2A 2QZSA 4BLWA 2BGRA 2SNIE 5CRIA 5FB3A 3TTWA 1JYSA 2VJMB 5KYXA 4G5RA 3G8AA 3QVGA 4W4UA 2C4VA 3VR2A 1TNDA 3HJBA 4G4SP 1ZZEA 4OJNA 4P35A 4DV7B 4JVSB 1JQAA 3I2KA 3HUTA 4A82A 3N2GA 1FNBA 1YOVA 4R6WA 3LX4A 2AFIE 3TBHA 3IPLA 2AFHE 1DC4A 2I3GA 4B4OA 3FJ1A 1UBTS 2N47A 1E2FA 2WU3A 1TRKA 3OETA 1DUVG 1T0HB 2XEXA 2IS2A 2VYVD 3PD1A 4JU9A 3T3IA 1YA8A 2AI1A 2AR9A 3EA4A 4ZDWA 2CCGA 4CGYA 4J0GA 2DZZA 1H05A 4H7HA 5CB6A 1NC3A 4B87A 1U7HA 3ONWA 1A95A 1GU7A 2ECFA 3GDOA 3AYXB 2J5KA 4F45A 1IZ8A 4G84A 1NNLA 2OR3A 2Q4OA 1QUFA 3A7EA 3EXIB 4IG4A 4L0CA 1U7DA 4Q1DA 1QV6A 5JECA 4QDUA 5J3JA 1KDTA 1YUBA 3N70A 3ZU2A 2BN4A 2FEMA 4AUEA 5HQTA 5GJBA 3DL7A 1MORA 3EGIA 3K15A 4M0MA 2PUDA 1K7YA 4QQ8A 1VOTA 1Z13A 4O02B 3RBZA 4ZJPA 4MMXB 5FWAA 1V37A 3WO1A 1YCDA 3OFNA 4CCYB 4BN4A 3HN2A 4UU8A 2A7QA 3NTUA 3OQHA 1GCOA 3F75A 3FNGA 4DMUB 1QCYA 3O93A 1KH2A 4W8HA 4WKCA 3ZUPA 2OOKA 4OI0A 3C3DA 4W99A 3O1GA 5C8DA 1E77A 2GARA 2K2QB 3Q41A 1RJEA 3ROZA 4FYPA 4QTUB 4KW7A 1RWBA 3H3XA 4RTSA 3R9WA 1LI7A 2BEUB 5IARA 2NZYA 3SR3A 4ZUXU 2JHFA 1Q83A 3OT1A 3KKKA 3KHSA 3ZDDA 3V3KA 1XCPA 2BJHA 3FYCA 4GBMA 1UM8A 4IDAA 4LSWA 4AIRA 4PN3A 1T4DA 2EIXA 3AFGA 1RPNA 1V6CA 3DDHA 3AVVA 1EFVB 1CE8A 3EXG2 3WMXA 2FFQA 1VP9A 1CEQA 2PPLA 4GM0A 4ZEVA 1LPSA 1JTVA 1P9RA 4R0MA 4WQMA 4LMRA 1U2GA 1Z2OX 5MN5A 3VZRA 2IYAA 4NE2A 1RRMA 1XHEA 2NNLD 2OBXA 4QJ4A 4CEJA 3PFNA 4B3IA 3E3MA 4BXOB 1JAZA 1CHDA 4UNQA 5B5SA 2ZIXB 1CVLA 5KNDH 4OKIA 4QXMA 1WVMA 2R87A 2XZDA 5L3RA 3VOAA 1VCNA 2SBTA 1FUYB 3DA8A 4M1WA 3AESB 4CMGA 2BF4A 2XUIA 5L95A 3F73A 3HA7A 3ZTWA 5D6OA 1P8JA 3RCBA 1C1HA 1J1UA 5DLPA 3DPIA 3FA2A 3H9UA 1IMOA 4ALKA 2VHFA 3VVLA 3CV3A 1T2VA 2R4UA 4R51A 1VCMA 4N47A 3RVRA 3VPAA 2P9GA 2PZ8A 4M87A 1N0WA 4DREA 1HV8A 3EZ2A 2WMDA 4MQLA 3S5JA 5JJCA 1OU0A 1L5HA 2ODEA 4ITRC 1VMAA 4ARCA 3WKAA 3RS0A 3WR5A 4AN4A 5GINE 2N1BA 1L5WA 1W85A 3DKIA 1Z29A 3LFTA 2C7RA 1BHQ1 4UHKA 1NJ2A 5BN5B 2NYVA 1YB2A 4MVJG 4RZ3A 3P2KA 2X5JO 1XNHA 4ITVA 5HM8A 4AMUA 2YWCA 3E7XA 3FI0A 3LLCA 4JYAB 4YJHA 1GCAA 4KAXA 4DSOA 2PX5A 3IEMA 1YRWA 3PWKA 1Z2AA 2YJ5A 1CJTC 3AH8A 5DM4A 4TLAA 1UQTA 3E3OA 1QYIA 3RARA 3RS3A 3H9JA 3WLAA 3ZG6A 2QTVB 4G6ZA 4OIMA 2E4YA 3FOFC 3LOQA 4P53A 4DLRA 3WL4A 3HVHA 5HOLA 2HCRA 1H93A 2O3JA 1G21A 4HAYA 4GM1A 4TZTA 4Y6SA 3SSAA 3TLBA 4CM4B 1SURA 5ALIA 4WLOA 1AK2A 1M5UA 4PXSA 3UTDA 3KQNA 2OBLA 2WIBA 2QYOA 3CUTA 4NJEB 1CDOA 3DQPA 4B7XA 3KE9A 5AM3A 3PNLA 4RD4A 1KBOA 1GZ3A 4LX0A 4ZO8A 3LF1A 4RAQA 3WJAA 2QN9A 3WYDA 1OF1A 1N75A 2O2ZA 2VDJA 2TMDA 3CWZA 3BFKA 1WQ4A 4ZY1A 3G1UA 1MQSA 2I8LA 3C14C 3Q7EA 4FFNA 2ZJBA 4MAMA 1BGWA 1SHLA 5DYIA 1O95D 5DXAA 5EWLB 3KBOA 1F8GA 2IYOA 3FMFA 1MOSA 2GOYA 4BY9E 1QXPA 2CJWA 4NBTA 5C3UA 3W6ZA 5LBTA 5AUOB 4HQFA 2Z58A 4RF3A 3RWOA 3SAJA 3LRPA 1K66A 1Z7BA 1KQFA 4UXJA 3X1MA 1HSZA 1R74A 7AT1A 1VHDA 3BGVA 4HBGA 1GRVA 2PMCA 3JQGA 1RWXA 4NFSA 4QEKA 4QEZA 5D3QA 2X9QA 2Q29A 3AEKB 5FPKA 1FSZA 1K8XB 3RHFA 1JRLA 1KQPA 3GGGA 2VT2A 1MHWA 2ZI4A 3G9QA 4RIEA 5CFRA 4R8VA 2VHCA 1YR3A 1ITZA 2X4LA 2D2IA 3OPQA 1XNJA 3OOJA 5D7BA 1GECE 5K1ZA 2X0DA 1HKHA 5DRTA 4KO3S 1JHPA 4JYBA 5HE8A 4B7CA 3FMPB 2NMVA 1TD9A 2RGNC 3OEEA 1PD0A 1ADJA 1OZAA 2AG5A 3Q7PA 3F98A 5GV8A 1EUCB 3OZAA 4OXXA 4BATA 3FPCA 3QVWA 4ZCQA 5ICCA 4OQ4A 2VTBA 1YQWA 2J85A 4HZGA 1LPAB 4JK3A 4QXOA 4XD2A 3WMGA 4BV2A 5BSGA 4GKKB 1T9DA 1B0UA 2Q9UA 1I01A 2W2TA 4MIYA 4TMXA 1GEGA 1H1TA 1XRQA 1X6VA 4I1SA 5GZ6A 2Q50A 3V4ZA 4DJJA 1TL9A 4JOBA 4IJWA 5U4QA 3R4CA 3IERA 2P8SA 3BE4A 1IEWA 4WCFC 1L8LA 3OTWA 1GTVA 5DHQA 1Z7GA 3F4BA 4Z3DA 4PNHA 5KYYA 1BW9A 1VCIA 2Y66A 4DM3A 4F8YA 4PT5A 1A3CA 1NVGA 1O96A 1QTRA 2UZ3A 3Q9SA 4WFQA 4MW1A 4ND8B 4H31A 1Q7TA 3K6SB 2GXAA 3VR6D 5LBUA 2Z84A 2XCOA 1LQUA 3D3WA 4PZCA 5KO2A 4TX1A 2PBLA 2QU7A 1X80B 5FWYB 1OXXK 2I7XA 4NXMB 1PJAA 1TU3A 3BAZA 1AXRA 4EW2A 4UD6A 5LB2A 3B53X 5GZ1A 2J5XA 3UAYA 2WFLB 4GYWA 3RYFA 1ZLXA 3EQ2A 1ONPA 2ZRAA 1U7TA 3B6EA 1V3QE 4GMFA 4KLCA 3FCUB 4WUTA 1XLUA 5AK5A 1C5KA 1M9NA 1VSUA 4RK7A 3K09C 4JA2A 3UGTA 4CKYA 2Q4TA 3EISA 3HWNA 4P8RA 2QIOA 5G0TA 3FGNA 1SB9A 3Q7QA 1KWKA 2OVFA 3EWRA 3QBVA 4F4JA 2ZKLA 5DHFA 1GILA 5L3SA 4MVCA 2PWBA 1I6KA 3QYAA 4FI3F 4OFWA 4V39A 5MF6A 1PIPA 3CM0A 3WLEA 1U2TA 1CEEA 1JFRA 4RK0A 3KJZA 2YC4C 3WGQA 3A1NA 3KELA 2W00A 2XF2A 4RLQA 4YJ2B 3K16A 1JBQA 5KKCA 5K0EA 2VNJA 5ECWA 1UJ6A 1G8SA 3O2NA 2EBFX 2B4QA 2PA0A 4AUNA 2V55B 3C6YA 2Q9CA 3AETB 2PUWA 2W90A 3PC4A 1U2RA 3C5HA 1R16A 3AUKA 2ZPAA 2H1IA 2C3YA 5LWQA 2WWGA 3GI1A 2I71A 4QYWA 1L7PA 4TKZA 3GNTA 1F0PA 2CVQA 2DEUA 5CVOB 3PPYA 4XQ0A 4BGUA 5KTYA 3DF0A 1KSFX 2X8BA 3HJRA 2DY0A 1OAOC 1FFSA 1SU6A 3JAKA 2NIPA 4C5AA 2ID7A 4GZLA 3IUNA 1Q1AA 3WP0A 4IJ6A 3GLVA 1M7GA 5J1SB 2REBA 2Z95A 3S28A 5EHQA 5EESA 2XGOA 4DA6A 1HT1E 1O94A 1UP7A 2JGEA 4OVKA 1E7YA 1GUAA 3CVWA 1FEZA 2C03A 5AHRA 2CL5A 2WNSA 2F1GA 1HC7A 2WTNA 1Z47A 4JVNA 4CI0B 4TKLA 1NR7A 2QTFA 2XMZA 1FJ2A 3E58A 1JU3A 5BW5A 2Q28A 3A9CA 1EJ6A 1FDTA 4QSHA 1W1IA 2Z43A 1RWWA 4H3KB 4B80A 3V97A 5HTKA 2ATEA 2AMLA 3P45A 4M88A 4MHTA 1KYVA 5DW3A 1MFZA 1LD3A 1XTZA 4R3WA 5DWVA 8ABPA 2OXFA 5JH7B 1RRCA 4DPMA 4Q0MA 5F4ZA 2AJBA 4XIGS 1YDMA 3EPRA 2UYCA 2JGLA 1BROA 1AGXA 1ZL2A 2VJOA 4LJRA 2HK9A 2AQKA 2IPAB 2VT7A 3THXB 3UB3A 1XZQA 2RKWA 4M0FA 3DL0A 3QEOA 3M7IA 2JBAB 3M6LA 3OC6A 3WQRA 2E0IA 3IT2A 3EGCA 1LPPA 2FW7A 2ZE8A 3M5CA 2IEGA 4G0ZA 3IVAA 2ETXA 2Q7XA 2P27A 2Y77A 4O4IF 1N2CE 3SBXA 4K9MA 3SIHA 4R8MA 1GOTA 2V45A 2ZTSA 4YY3B 1H23A 4K3NA 1AKQA 1HTTA 1Z37A 1JN0A 2MSWA 2IEBA 2GN9A 2ZTLA 3BDAA 1SBHA 4J1TC 5BW6B 1DJPA 1KEEB 5D86A 1U8AA 3SF8A 2Q6KA 1RPZA 2A1IA 1TC2A 3BPFA 3N2NA 1EM8A 2PJDA 1Z0IA 4YS6A 4B74A 1LW7A 2VWQA 3EZ9A 4XLTA 4IJUA 4LDQA 4BMZA 4H77A 1FXWF 1M2OB 1P2TA 1PJTA 3D43A 3LDGA 1RYZA 2B4AA 4UVGA 5GAJA 3NBMA 5ABPA 4PFKA 3P7MA 2J0QA 5D84A 2GO7A 1YASA 1TJ4A 3W9YA 2A9QA 2DQKA 4P0PB 2P91A 3KL4A 2OAGA 2IT1A 4INOA 3N3BC 2OO5A 4HOYA 1MOPA 1QIMA 1XVIA 3AV3A 5D3MB 2I62A 1DLJA 2C7GA 1BXGA 3EGWA 4JY7A 4P5EA 3RWMB 2CCJA 3HHAA 4AJOA 3WL7A 4PANA 2F3UA 3LA6A 3QSYA 1F4PA 5ERXA 1T9CA 1LWNA 5DEIA 3WFJA 2VXBA 2GUGA 1U0TA 4DCSA 3QV2A 5A4FS 4IHQA 4WSOA 1AQJA 3ZWNA 3SC2A 3I8SA 5IT0A 1I80A 3RQIA 1AC5A 3IQGX 1A9XB 1CBUA 3ZEIA 1OXBB 1O6ZA 4EG7A 2KLBA 1CR0A 2X76A 5EZ5A 4B4VA 4IL5A 4BKRA 3I30X 1EWLA 3LE8A 3PE3A 1NA5A 1NWHA 3E8XA 2EFHB 4LZPA 1J8VA 4P4SB 4QUKA 4RL4A 3V9PA 5EPEA 1U2DA 4GC5A 2GJAA 2HJ9A 2M6SA 3GB9A 3NRBA 1FS6A 3HXTA 5BNWA 4EQZA 1PDOA 1U3FA 3B8EA 3WRXA 3ZE6A 5EJ5A 3U5TA 1UOPA 2PU5A 2J09A 5I8ZA 5AI9A 4OQYA 2XGJA 4ND3A 2FWNA 5GWXA 1D2NA 2N46A 3AXTA 3ONNA 3LXXA 3V1TC 2XADA 4XJXA 5AILA 1FJHA 1R15A 3M5DA 3FWPA 3QVMA 4F5ZA 1OI4A 1OROA 1Q84A 4PRKA 5CCEA 1QWSA 3GU3A 3WLMA 3MAAC 4PIVA 2H18A 2I34A 5GONB 3K35A 1FY2A 2RHOA 2ZW9A 1YKFA 3PDHA 1M1ZA 2BGJA 4XDZA 4XWTA 2VSXA 1WEHA 1JDBB 4HD8A 1A9TA 1BFKA 1W48A 4D3SA 3ESYA 3O9ZA 1BS1A 2E49A 2GNAA 3IVXA 4UC0A 3PNQA 3UWOA 2C5SA 5FTWA 4DHEA 1UMCB 3EZNA 3GELA 3WLFA 5KYTA 2NO6A 5KWIA 3K0FA 4GMGA 3WMWA 1AO0A 1W1WA 3I0MA 3W1WA 2DECA 2GEKA 4DLVA 3QLVA 2ZRIA 1VCOA 2ZYSA 3L0BA 4Q21A 4JI0B 3H99A 5HZHA 5KSYA 4W8OA 4I7EA 4RC9A 4BHTA 1PFWA 4QKQA 3W5CA 3OPXA 4X91A 2IDJA 3R6TA 4HB4A 2CFCA 5FL3A 4AG6A 1CDEA 1YC2A 2FK8A 2QVLA 3VGPA 5FLXA 1Y5NA 1SA0A 2GYYA 2G88A 3FTQA 3MS4A 4O2AB 5EXSA 1QRRA 1F48A 4IWYA 3B1XA 4IGFA 2C77A 2B21A 2GAIA 2PZLA 2VPTA 3HBMA 4Q15A 4BZQA 4FB5A 2JD2A 5F7XA 1VTKA 3A36A 4ABLA 1SCIA 3ZWQA 2OAQ1 5KTTA 3KWZA 2C5BA 4QQNA 1L4NA 5FBWB 3DL4A 1VMEA 4K1XA 4PYQA 5FWDA 1EM6A 2FZGA 1QGYA 4YDRA 3U7RA 3LSYA 1WF3A 5A0TA 1YFZA 2QN8A 2R00C 3HCPA 1OTHA 3AMVA 4M0LA 3MD0A 5LDDC 5JXIA 3Q6ZA 2HO5A 2QPTA 2QX6A 1Q12A 1EP1B 2W6CX 2CYCA 4TM8A 3GMTA 5FT9A 1HFEL 2PCLA 4KH1A 5F3DA 2FG7C 2HFKA 3L40A 4PQYA 4DBZA 3ZNQA 3HGTA 3MMNA 4YRMA 2I7CA 2YFQA 3ERVA 2GCOB 1V25A 1J09A 2MMGA 2NZUG 3K9MA 2Q07A 4DY6A 4MGIR 1N5KA 3T9EA 1QRAA 4L27A 1NI4B 1TPZA 4K28A 2FSVA 4PHFA 2Z6VA 3ODGA 4EMUA 1N7HA 2CFTA 5KDLA 2Z3ZA 4TUYB 5JYCA 3KETA 5JAQA 1VKHA 4XE5A 4DL9A 3VR4H 4ZU6X 3MCTA 2REXB 1YJAA 2XODA 5CUQA 4FQ7A 3SEAA 3G59A 1ZUNB 3KFVA 3K96A 4JGIA 4KVGA 3RYIB 3T5GA 2MYNA 4YVAA 2PUJA 1J24A 1EBBA 2E89A 5JYDA 4IDEA 5F9HA 2WYWA 3WWZA 1MDWA 2AVNA 4XH9B 1ZJ6A 3GT0A 3ZQKA 4BMVA 1BC5A 3EPPA 1L5KA 2PJRA 2WM9B 3K70B 3FVVA 1MC5A 2XOXA 2O52A 2P77A 4QREA 3RJTA 3ZE9A 1BU8A 4CETA 1Y3IA 1RMYA 5CAEB 2HLDD 2BHLA 1GM5A 5LDGA 3LFUA 4CM6A 4EJMA 2PSFA 3GVHA 4BFWA 2FK7A 4YP7A 4ZI2A 2DFNA 1MFPA 2ZUCA 4QQKA 3AUFA 4KODA 4D8VA 2JGKA 2AXNA 2DFKB 1ZUD1 1WMAA 1JBEA 1NN5A 4J4HA 5T4HA 1FU4A 4J90A 3RAGA 1W4AA 3BIFA 4AS3A 4EJSB 2PH7A 3OQOA 1H9AA 4M7RA 4MI7A 1ZA2A 5JADA 2WZCA 1O9HA 1BDIA 3SX4A 3SX0A 2E00A 2V7UA 3KAPA 3NBUA 1RWPA 3EAGA 2E6UX 3GD7A 5ALEA 5TQJA 3RVSA 2PXHA 4QGFA 4MP6A 4RS4A 3T1QA 4CL2A 5HJ7A 2BGUA 3K4PA 5KC8A 4LRWA 2R47A 5HIKA 2P7HA 2R6FA 2CXPA 4KXWA 3G0GA 1HEIA 1K97A 1E9EA 4URFA 4BLOA 4DABA 2O3RA 5WRFA 2GSDA 4LCEA 4REQA 4PLWA 1QRTA 3LGXA 4KVFA 2GR9A 4OUKX 5CT8A 1ELOA 1C7QA 2ICAA 3Q72A 4IZIA 4MRPA 5DVZA 2GDZA 1E9BA 4HLDA 2VAWA 1BO6A 1HYEA 2ZIUB 3A2KA 2I1LA 3STHA 5EUBA 3SQLA 4YBZA 1H8HD 1LV8A 3BZWA 2GJ8A 3BCRA 1C1DA 4DJFC 4BPBA 2DXIA 3KDAA 2EL9A 3QEBZ 3JU3A 1TXZA 3SLKA 2JVKA 1Y9EA 2NPOA 1EUYA 3B78A 3VSEA 4M0DA 5G3ZA 1JHQA 4X94A 5CYOA 4D4GA 4E7OA 3B1WA 3IAEA 2VLIA 3MRVA 2H54A 1JE1A 1O0SA 2QSUA 4CEHA 4OXIA 2XITA 3VC2A 1O0BA 2WPNA 2C5HA 4PE5B 4D9JA 3WFIA 3R74A 4DE5A 3UB4A 3GPGA 4BP9A 3MSCA 1ADFA 4MROA 2AG0A 3FWZA 4ETKA 4EEKA 4GX0A 1KKLA 3INGA 4KNWA 4V38A 4B6SA 2GSWA 3I4CA 4PIPA 4O4LA 4WW0A 3MHTA 1K7EB 1DIAA 2EJWA 2WB4A 2VEOA 1R8XA 3F5SA 1P3Y1 3HPRA 4HI0E 4L78A 4XQEA 4J07A 2GD2A 4Z4HA 4CT4B 1Q0TA 4BBJA 3TIXB 3EZYA 3QF7A 5ANRB 1U28C 1X8XA 3AVPA 4C0BA 3GPQA 1NY6A 3C7TA 4KXMA 2G70A 4TYNA 3GJYA 4YLGA 4E33A 3F0TA 4MQMA 1F8FA 2D0IA 3ZHUA 3ZVRA 4DLBA 3U16A 2OYSA 1W29A 4ZOAA 2A0XA 3WHKA 1M74A 1BA2A 1UKCA 3LYUA 5I7VA 1E3SA 3JR7A 4BFCA 1P6UA 1CJLA 4TLMB 3O90A 2CDCA 4IVQA 3P9CA 2HBQA 2CK3A 1CX9B 4J0KA 1QHYA 2Z1NA 3IO5A 2AH5A 1UXKA 3HBAA 3KD3A 4XEHA 5D00A 3K9LA 3B5IA 2ST1A 1LBEA 4N0DA 5IN4A 1W47A 4OAQA 1RQPA 4HDRB 2G8LA 4RXTA 3E3AA 5KX5B 4ZZ0A 3E2IA 3NR2A 3ZNPA 1U1IA 2ZR9A 3BICA 1C1XA 3DB2A 3HP7A 1OGIA 3PVSA 4L50A 4NONA 2PUHA 1TA4A 1W49A 1JA0A 3KQVA 4KACA 2ZBFA 3QPVA 4GO1A 1D4FA 1L5FA 1B41A 5FIUA 2F67A 3ZK7A 4NULA 4YRTA 4RPIA 1X1EA 1PZHA 2QGZA 3DNFA 4NE9A 4QGAA 5E7MA 3HUUA 2F8LA 2I2BA 4EG4A 3R5HA 5A7GA 4C04A 5A3SA 4GSLA 4O59O 1KZ9A 1TVEA 1RXIA 2J0UA 5C37A 4CM3A 5IJWA 1APBA 4OHPA 2Z0MA 4YN3A 5HCNA 4ZZ2A 4ESOA 3NOXA 3UFBA 4LSGA 3NHUA 2CVOA 2A88A 5HBRA 3MMZA 3BWVA 3V00A 3X1DA 1NQXA 8AT1A 3JATA 3WWYA 3O65A 1NNSA 2DBZA 2CHGA 4QYIA 1OFGA 4IVRA 1R2QA 5C81A 1HE8B 1F5SA 1KGDA 4UXHA 1G16A 3N3KA 2PDAA 3IV6A 1PFYA 5IDWA 3UJAA 1V7ZA 1DG3A 2K5UA 4LJ7A 3SHQA 2B35A 2PLNA 2YUIA 2IF0A 3P94A 2PKYX 4E12A 3IURA 4IRMA 5EUCA 4TVOA 4G4IA 1WKBA 4B71A 5J94A 1NRXA 1R3DA 1WVGA 2Y1KA 1DPGA 4U9UA 5C31A 2NO7A 1WUTA 3KZWA 1S01A 4IH1A 2JF0A 1NVBA 1K9VF 3NKFA 5KMGA 2ADOA 1VHQA 2AQ8A 1AZWA 1D7OA 3INRA 3SOPA 5FWNA 5IYZB 4TKUB 3IDAA 5BQXA 3CQ9A 4KWTA 1G4UR 1PJZA 4WN3A 3QA9A 3GGJA 3VPDA 1NPYA 4BNNA 3KP1A 3QSDA 1MW8X 1RJ9A 1OU4A 4J03A 1Z8NA 1CUYA 3DOFA 3OHPA 4RFSA 5K3CA 1ME4A 2BFNA 2QTTA 3PFFA 1UJMA 4EI2A 3BWCA 4F4DA 1KEWA 1RHRA 1IDN1 2EX0A 4NV3A 2IBTA 4LA4A 3EWAA 2JZOA 2ECPA 4E3WA 3ZWCA 2BTWB 2PS3A 4H7PA 1THGA 4QVKA 1OLOA 1NF9A 3RVMA 3SKYA 5T7BA 3UN1A 1N25A 3CH4B 3K30A 4E4TA 3O4GA 3C6KA 4D0NA 1UM9B 7REQB 4L6IA 1SHZA 4DB4A 2QE7A 5K7SA 3TQOA 2PEZA 5E0KB 4DUZB 1YACA 1E6UA 4XGIA 2ZTMA 6YASA 1NUAA 3P5VA 5FOSA 5C8YF 1T4CA 4X1KB 3DZGA 2NYRA 2GA9A 1RYDA 1DAGA 2WVAA 2ZXEA 3QMWA 4LQ4A 2EIHA 1ZINA 2EZ9A 3W2TA 4CHGA 1CQJB 4I4NA 4C4TA 5A71A 4RJIA 5DTMA 1V95A 1RM3A 4JI2B 5TDHA 4E5YA 1PEAA 4GHWA 4UMLA 2Z57A 1Z17A 2DX7A 4P36A 4Y2GA 1B6GA 1NBMA 4F91B 1LCIA 3MA0A 1CXZA 3KSDO 4BX8A 2NU6B 4DIMA 3PEEA 4AO7A 3THYB 4QOGA 4FDTA 4MWBA 1XL0A 4MLPA 3S1AA 4P1ZA 2ZU6A 3Q9LA 2X9NA 2AN3A 3WQQA 3O9MA 3MWEA 1M2HA 1U5IA 1LDBA 3QMMA 4B5KA 2FMHA 4OH1A 2JCBA 3PPWA 4AYWA 2XTMA 3W5IA 4FJCA 1U8FO 2GYVA 5EY5B 1GZ7A 4V2UA 2XMRA 1L7RA 5DBFA 4AY3A 1TMKA 4B3MB 2YUTA 4ZMSA 3UKOA 1J0XO 4MGEA 5KNCA 4YV8A 5THQA 1DO8A 2CE2X 3N87A 3TQQA 1RE1A 3U4CA 2GERA 3PSEA 3FMIA 3JV7A 1IWPB 1CCWA 4RE6A 5JEEA 1ECPA 2GVDC 2IGTA 4B46A 1FFGA 1UCFA 2G80A 4A8JA 1KDYA 3BB4A 4LMAA 4EKDA 3EYAA 5D2CA 3V1YA 3VX4A 2NUBA 1PU2A 2QR5A 5FUVA 5LQSA 1Y3CE 2I1VB 2HF2A 2N42A 4EHIA 4MEBA 2XD4A 2I5PO 4EGFA 1V1JA 2VNSA 4FGUA 2P2GA 5FO0A 5FPPA 1AT1A 1GUFA 2X23A 5JVDA 3DW3X 5IULC 4P80A 2RC6A 4PG5A 2CHUA 3MLAA 1NTRA 1YB1A 3COVA 2QNBA 3GPIA 3T9FA 3JVEA 4G4GA 4U39A 3ULKA 5L51A 3A1EA 4JGKA 5FSXA 2FPPA 3BHMA 4ZCLA 1CDZA 1F4VA 3D3NA 5CVNB 4YMWA 1FUIA 2ZB8A 3BWMA 1SJ9A 4V3BA 2I7VA 4MVJE 5ELMA 1XTQA 3PX3A 3KR2A 5A2GA 2QVGA 3RU9A 1US8A 4JS0A 1TVKA 4Q4AA 3EUWA 9ATCA 3KLMX 4RJJA 3PTZA 3UENA 1GNVA 4WXPA 1DKPA 3JWEA 4P84A 2P90A 5I3CA 3O8DA 5K4HA 3KEQA 1Z25A 1X8LA 1PV2A 3FCAA 4F97A 3ZDBA 2F48A 2W6QA 5CDUA 3QH4A 1OBOA 1AU0A 3QPAA 1C3JA 1LPBB 4QRHA 2H52A 2AN9A 2ILVA 4AFNA 2G5TA 1T5DX 1E63A 3B6ZA 3BN3A 3JQ6A 2QN7A 3NCHA 4II7A 4G5XA 4UUMA 1Y4UA 5J63A 1RTKA 4PLYA 4B4UA 2BSQA 2JIBA 1LF0A 2MINB 4YYSA 2D4AA 1AYVA 3M6FA 4J49A 3SYNA 1COWD 2IL1A 3ZW7A 3C87A 4ZHSA 5JAPA 1XNGA 1R10A 3H1TA 3KZMA 2JH9A 3MGCA 3VC3A 5JQWA 2B61A 5LU8A 4CDCB 5CK5A 5I7OA 2P6MA 3W31A 3KR9A 1F2VA 2PBHA 3MT7A 2MR5A 2GPNA 1SKYE 1USWA 2Q2NA 4FDAA 4IGAA 1KDZA 2O05A 5TEVA 5G0SA 1ZH6A 1ICFA 3ID6C 5E7QA 4AJIA 2X0EA 4QDKA 4MOWA 3ADPA 2XRFA 4A6XA 4QBBA 1T9KA 2JEZA 2CYBA 4IXDA 4M0CA 2C3MA 1TZMA 4G85A 1RVV1 4TSRA 3EWNA 3H84A 4YYWA 2AJTA 2JFNA 1HBJA 1EGAA 4UNSA 2XYGA 4LDJA 4PPNA 3DM9B 1E7SA 2J30A 2PUFA 1JR3A 1PFUA 2VH1A 5I9MA 3HVJA 3RSHA 1DLIA 2IVFA 4H7EA 2ORYA 1CU1A 3CVXA 4DQLA 4F4HA 2WMYA 1J70A 5DRYA 4EG6A 1VMKA 1QYDA 4WNIA 2Q5IA 3TTVA 4AXMA 2ZCVA 2RH4A 4Q8GA 5FBKA 5K3AA 5CMSA 1OHHD 5LYJA 2G0NA 1W9MA 4CNBA 4DBVO 1QBKC 4GW3A 3Q6IA 4E03A 4ZHQB 5HRCA 4Q9KA 1RP7A 4EHHA 5EJ9A 4B31A 5J4VA 3EXFB 2DETA 2N75A 1NPDA 2Q3HA 4LK2A 3STYA 2WILA 2ACWA 4COKA 4BDSA 2DC6A 1U3CA 5I9IA 2QMQA 1UEXC 4UQOA 4WH0A 3BKXA 3QEMB 4KR0A 2DUJA 1Y4DE 1QTQA 2FEXA 4ME6A 4PYOA 4A0QA 3R7AA 4J75A 1YIDA 2R6ZA 4U2BA 1JI3A 4WOPA 4C6TB 1HDXA 4TTTS 3IBGA 5TE9A 4M1SA 2JVJA 4WFJA 1E9FA 4DFDA 1NBEA 2YW2A 4YUAA 1G60A 2J9XB 3K9GA 4WLEA 5ALNA 1SELA 5EMHA 5LBIA 3QENA 5BN4B 1FS4A 2ZSEA 4EKNB 4EZEA 2ZDHA 4IDHA 2WM2A 4NP6A 4CCYA 1AHPA 4MAAA 2I4RA 1KVTA 1JMYA 1XQXA 2H1HA 3NB0A 1GUBA 1EAMA 4P4UA 2AVWA 1FCJA 1RI2A 2QK4A 5KVQA 1KE1A 5KWEA 4MK4A 2GPWA 3OM9A 1NJSA 5FF9A 1JEJA 1BTOA 1ONOA 1XQ1A 3SC3A 3HDJA 2QX4A 1WMFA 3UYLA 2NUPB 5HS6A 3MCAA 4GR5A 4DIDA 5DBEX 3KJFA 4JLOA 4ZCTA 1EWYA 3F8SA 2G04A 1MRZA 4MUNA 5EIHA 4PZ0A 4DIFA 1UK8A 4D3DA 3ZX5A 4D3FA 2AYOA 1YVBA 1PQ4A 2LNDA 2B1GA 2RGUA 4J9VA 2J9AA 1I14A 4UOEA 1Z18A 1Y4HA 5CBMA 1F2UA 2IHYA 2JIMA 2YHAA 3BS4A 3UWSA 1WOMA 3QKWA 1MMFB 3Q8LA 1XEFA 1VBFA 1P7VA 3LRXA 1E69A 3UBTA 3V7NA 2YJNA 3HG7A 3PJRA 1QP7A 1QE5A 3PKJA 4P6EA 3I9OA 3RG2A 4OI2A 3O8LA 3WOVA 2VP2A 1TVCA 2B6NA 3GWZA 1QOQB 2HIGA 6REQA 1KYXA 1R9NA 1N9KA 2R44A 1SEVA 3S70A 1Y8ZA 3G13A 3FHCB 3OZFA 3E7PA 3AESA 1W25A 1U8TA 5EJ8A 4JC4A 3F9RA 3A0RB 2FUDA 5CGZA 2WY2D 1JJFA 1XKXA 4U7JA 1N6IA 3NZEA 3TR0A 1KVRA 3EC7A 1R9GA 2FDXA 2IY7A 3HYLA 4PZEA 4S0XA 1WZIA 1CW2B 2BGLA 3DMHA 3QPDA 3AUYA 4HLCA 4I8XA 1JB1A 1JSXA 4LJLA 4N7BA 4RV5A 3NIGB 1GSHA 2BFDA 4N6NA 1KARA 1R88A 5IF3A 3PGJA 4FTWA 4C6SA 1UXHA 1ZIDA 4KYVA 2B9EA 4FCTA 4H4CA 2ZAOA 5BT8A 1MJHA 3ROQA 4FOOA 2FQXA 2PUCA 1QIKA 3IEVA 5F1KA 1LSSA 3N2EA 4NRDA 4R71A 5ICEA 2IV3A 1BVRA 1LW6E 3NHMA 1FK8A 2YKGA 4LBWA 4MS3A 4X6JA 3KOWA 4U7TB 5KNCH 2DHDA 1R50A 2HQBA 3EVAA 3QEJA 4QLOA 3RSLA 4CUKA 2IZ6A 4FQ5A 3CLUC 4D8YA 3U5ZB 1FDOA 1U8CB 2VJCA 1JAIA 3WB0A 4BYMA 1CB7A 1MOZA 3DGFC 4B6FA 1C4XA 3ZK9A 5LVAA 1TM4E 1ZDMA 1OKKA 1CY2A 1QE0A 1SWVA 2PU7A 2QTVA 5CX4A 5KTKA 3E03A 4O3FA 4Q01A 2V7GA 1P3DA 1UBJS 1Z82A 2FZ5A 4M1TA 3RHSA 2PADA 3OQPA 4PLZA 3NYQA 3T7EA 3O4HA 2VPIA 2LRHA 1AURA 5CX1B 1SRQA 2E01A 3NH6A 4RVCA 5H59A 4BZZA 4Z4QA 2R6NA 3IXLA 4RSMA 2V65A 4OQEA 4B8ZA 1EEXB 4EY8A 3UJ9A 4ZYTA 1LAMA 3KD2A 5HWSA 4X93A 1YJQA 3B8HA 4DCOA 1P4HA 1Z3IX 3GZJA 3A05A 4K9SA 3CX7A 4Q66C 3BWXA 2I8CA 4UTOA 5EWLA 2PUVA 4L8WB 3UICA 1PS0A 5KU7A 2HT1A 1YD9A 1A1SA 1VHUA 2VK8A 2BONA 1VI5A 2OV8A 4OJTA 3R7WB 1ZK1A 5C4GB 1Y4ZA 3C3XA 1IULA 3HXPA 1DIRA 2ZS9A 4E22A 5F12A 1K4YA 2AYYA 4A0GA 4JKOA 4Q48A 4ZVOA 4A2QA 1SUAA 4FD2A 5JDIA 2R9MA 3C3EA 4RKYA 5CHVA 3R0ZA 4L8YA 2Q45A 4GI5A 5AOVA 3ZZMA 1D6SA 2JAPA 2YMMA 2N1MA 4C87A 2NP6A 4NCNA 1R6AA 2YXEA 5H68A 5BYJA 5IG2A 3P2IA 2FGJA 3T1VA 4U4AA 4C29A 2IA5A 4LZNA 2DB3A 4L85A 2QGFA 5KTSA 3IE2A 3FJOA 2CLMB 2R6JA 3FXAA 4B48A 4CJXA 2DFDA 4JP1A 4TKVB 1PJ2A 5AJVB 3RUEA 2AXPA 2A0YA 1TM7E 1WZUA 1EUCA 1RQ7A 2DOKA 2EFGA 2A86A 1ULUA 2NN3C 2Z5VA 4M9CA 3SDBA 3H5OA 4E1AA 4OU5A 1SFRA 1C1YA 1BRTA 4BYGA 2NVUB 1YU6A 1E2UA 3M1YA 3EWOA 2BKEA 2P2SA 1C3EA 2HM7A 3G82C 3OPYB 2I7DA 2IYFA 1X15A 1LLFA 3NHPA 5DV9A 2FFJA 1I30A 4RXUA 3TGWA 4NFYA 4OLJA 3AW8A 4PZLA 3NHYA 4AJKA 2PRZA 3ACBA 3LWZA 5EG5A 2JKVA 2WCTA 2A57A 3DLPX 3IFSA 1Y1KE 2DTEA 2XZTA 4LKOA 5TGZA 1V11B 3PGXA 1NJFA 1VBMA 2JK0A 3JTMA 3M0EA 2C5EA 4RTQA 9LDBA 3Q88A 4ZDKA 3FLEA 4WT7A 5HOQA 3K6SA 2C61A 3QW2A 1PT8A 4Z9AA 4X7RA 1A9QA 3U7IA 2R65A 3KSMA 4CDRA 4QU8A 3TCKA 2HYDA 3Q98A 4BX0A 1X80A 3AHGA 1E18A 1NFFA 4FHCA 5IFKA 3BSWA 5JQGA 2XE7A 3UUGA 3CPSA 2JAUA 1XQWA 4RU1A 2JIOA 4YACA 4J3NA 2OHVA 2FX3A 2PKXA 1NYTA 3PNVA 4PC6A 1Y4SA 3TSAA 3U3RA 2BUCA 2GAJA 4JT4A 3NNNA 2C9YA 4OP2A 3GDGA 2X14A 3NPAA 2FWMX 2POCA 2WJAA 3UT6A 1YBHA 3MUFA 1SUEA 1VGQA 2ZSBA 3K94A 3X44A 5C5DA 3Q71A 1ZGBA 5DM0A 5LQMA 1YE5A 2I6FA 2IYYA 3K4HA 4HDOB 4BJHB 3GZNA 1GU0A 1S6YA 2H48A 3L7JA 2XE8A 1YA6A 1R0CA 3G2LA 4MS1B 1AY0A 2C42A 4IJVA 1QHHB 5IM4F 2FW1A 2AFRA 1GNRA 4F85A 2PMWB 2PR7A 4FFVA 4ZOLA 1V0JA 3AB3A 3CRVA 3K4QA 3LL4A 4MSUA 4ALMA 1SXQA 2OP3A 5TT0A 4KDCA 3AETA 3M89A 1TQ2A 2YWFA 2R7KA 4J2HA 2NW6A 3V4LA 1Z6YA 1Y7LA 3FGOA 4LF4B 1LTKA 2XAUA 3FUXA 2WBFX 2QJRA 4IH9A 4IIGA 4K6MA 4M9XA 3MTJA 4RNAA 1L7VC 2AFIB 5A62A 2AFHB 4KR3A 3EAFA 5EQJB 5BY2A 4BAUA 1QKKA 3QLTA 1XU4A 1AKRA 4YDSA 5DYNA 5LCXA 3GP3A 5NULA 4KWIA 3U1BA 2XU4A 3OLYA 1GSOA 3Q3CA 4IV8A 1G20A 1WTAA 5A0FA 5KDOA 4ZAGA 3R3UA 2COKA 2V9PA 4XVCA 3M3HA 3W8NA 3TDMA 5HVNA 3GH3A 5LLSA 1QF7A 2RIPA 1N3LA 1O5TA 1O7JA 1U3DA 2FWPA 3NLLA 3P97A 5EZQA 3OG9A 2V6MA 1ABBA 1B43A 2D00A 3GJ5A 4L4ZA 4ZT3A 3ZWOA 3MNFA 4NOMA 4K9NA 2QV7A 5CEFA 3E2MA 2ZUVA 3H7AA 3O1LA 3QZUA 3B52X 4NY1A 1JUDA 3B6IA 3NHFA 4MWZA 2QL9A 5HMMA 3ENNA 1VJ0A 3OQVA 4HMOA 1IK6A 1GADO 2FZKA 1N2OA 2B5VA 3QWBA 4TQAA 2X58A 4ND1A 3K20A 2HA4A 4FS3A 4ICIA 2ET6A 5ES3A 4MR7B 3DULA 1HZJA 3ELBA 2QORA 3IOCA 4G5SA 5I7WA 1SBZA 2QP4A 3ANXA 3BJEA 4W1SA 1F9AA 3B7PA 3VSAA 3WQHA 1K5HA 3TMPA 5BWLA 1RBQA 2IZOA 4JKYA 3O8QB 5FTKA 2JBAA 1Z5ZA 1DEKA 2QM7A 1YS7A 4GOMD 2VK1A 1JHUA 4TQ9A 1KE2A 4ZCIA 4IUMA 4I6GA 2J3HA 2BH2A 3OT4A 3GGPA 2ZWMA 3IKVA 4EY5A 3IXQA 3MD9A 4MO2A 4RJTA 2QI9C 1E32A 2P3SA 3AFIA 3OOEA 1G4AE 4TVKA 3FH0A 1XC7A 2PWPA 2O7QA 4J7UA 3MJFA 1YDGA 4GIBA 4X6HA 1SCJA 2ZUSA 4O4HF 2BH9A 3FKSD 2HZ7A 1TIKA 1D03A 1JSRA 2XV1A 2ZT7A 1XCLA 4C3VA 3RAPR 4C78A 5JCZA 3MJVA 1IXYA 1EHCA 3B3QA 2QAGB 3CZMA 1M2OA 4O2BF 4UM7A 1G66A 5E9WA 3TFWA 3W34A 3KKNA 2A9OA 5DYWA 2BEWA 3PGVA 3R75A 5DHUA 1QVZA 3SIXA 1SC6A 4PC1A 5CMLA 3BH7A 5KNBA 1U6JA 2H8GA 4JLAA 5D3MA 5IAJA 5CH5A 1UBSB 4HAZA 4X44A 1NQTA 5EVCA 3IAS1 3ZU6A 3HXQA 4Y8VA 4B6QA 4YYQA 3H1FA 4I4CA 3U7HB 3SHOA 2A6PA 4EYKA 3HFJA 2WUWE 3R0QA 1E62A 2JI6A 4KIJA 4FE7A 3UOAB 5AW8A 3PUZA 3CXUA 2WPDA 2QMYA 4XM0A 4EK9A 3S29A 4OHOA 4RX1A 2WHYA 3FNQA 4I50A 1ZYUA 2J3LA 4R9VA 3S40A 4AP6A 5HYVA 4DV4B 3GIDA 1LZKA 4R2JA 1XZEA 2XE6A 1NJGA 2YMLA 1A9XA 3ANYB 4KN5A 5ALGA 3FVTA 4RKRA 3ZHYA 1JDJA 4PY2A 4BNFA 3SN6A 4MZDA 2QLJA 4FDLA 2RONA 2CVZA 2BR5A 4U6SA 3T9AA 3VR5H 4DCPA 4PFSA 1T0PA 3MC1A 4NWIA 1S02A 1MO5A 4R84A 4MDFA 3A11A 3JARA 3M1IA 3V8MA 3ETEA 3HBNA 4QFDA 4MMZB 2CBXA 4RE5A 1BFUA 3TGLA 5A6SA 1TJPB 2ZGVA 2F59A 5JHGB 3AM5A 4JELA 1YBAA 3BH6A 3O8OB 3VYVA 1Q50A 3QM1A 4XD7A 5TMEA 4D82A 2WKSA 3UB2A 4PFJA 1ND5A 2FX5A 4R98A 5C0OE 1GNQA 3BA6A 3C5EA 1NX6A 3NV9A 1GSIA 3OPMA 1PHRA 1QMYA 4NZPA 5ULLA 4S05A 1AVTA 2G67A 2Y92A 3DNMA 2IP2A 4II3A 2H2WA 3CB2A 4FIZA 4D9KA 4KAFA 2O2JA 3HCFA 3W4KA 1UWCA 3BJMA 3CUSA 2PN1A 1FFDA 2YQ4A 3DZBA 1GTMA 1AQUA 2IHKA 5AXDA 5CB8A 4KAAA 3W5BA 2CNKA 4WVLA 2WE7A 4AXBA 1YDHA 3Q6NA 2VZEA 3LQ2A 3IEKA 5KIAA 4I81A 4MB6A 4ID9A 3OO1A 4Y9UA 2B94A 2CXUA 5CH3A 4I1PA 4ZQBA 1QAOA 4O2AA 1T0UA 1C3OB 4NJOA 3OD5A 1NPTO 3KXKA 1DC5A 3IP8A 3MQ4A 2JDIA 4A73A 2JFGA 2IYNA 3KLNA 3AI1A 4UQPA 2CL6X 4C7MA 4BGDA 5KVAA 1VE9A 4JQSA 4LTNA 4BX3A 1DUIA 1E6CA 2E55A 3KOYA 2UUCB 2DQSA 4HG2A 1QV9A 1VG0B 2V7TA 3DKKA 3GEIA 3H6HA 1XD8A 1ABFA 2QTRA 3CYFA 3LV8A 2QNIA 2CBGA 4R68A 4XOUA 3WK8A 4CKEB 4CDGA 1ZGCA 2XTNA 1Q1EA 1VGVA 4X3PA 1JFSA 1ISHA 1K7CA 3R44A 5ALZA 2W93A 3WE7A 1LBTA 5THKA 1AMUA 1WXWA 3Q3JB 2MWMA 4OOEA 3A3PA 3GAFA 1T0BA 1Z2CA 2P9QA 1RYYA 3FSEA 4OHBA 4XB1A 3VPBA 4IBOA 3QXJA 3OMXA 4JJFA 3MMPA 4GBJA 4N4ZA 3S2SA 4ABYA 1DXYA 3KQMA 1U6KA 3UAOA 3ZIAA 4H4EA 4ZZIA 1K8RA 3Q1LA 4E51A 1B7GO 1R00A 3FUCA 3HJTA 2G63A 5ER6A 4A1OA 2A33A 3I53A 1E3EA 4AB1A 4MUEA 3TLYA 3KYBA 2ONKA 5JS8A 2KBFA 2OO3A 1KVUA 1NQWA 3ZE7A 4QQRA 3K8YA 1ZUNA 2AOUA 3B9QA 1SU4A 1D5CA 2ILTA 1GDTA 1FX0B 3GN2A 3M6MD 1LZLA 4TV8A 3O0TA 2W70A 3IBYA 4D3XA 4FUTA 4XQ9A 5HIAA 2VJLA 5FV7A 1CF9A 4ZXPA 1JG7A 1QTNA 5LP6C 5AICA 3LY9A 5L53A 2QZPA 4FE4A 2QUKA 1XAGA 3DB1A 2G08A 2OECA 3GGDA 4YUZA 5LDHA 3OTHA 5CNKA 1EFLA 4OX9B 4HF7A 2IQ5A 1CR1A 2IXFA 1QYRA 4U00A 1F6WA 2ZYWX 1PG2A 2CZGA 4QTXA 5FR2A 1JSCA 4GVPA 1U8YA 3IUTA 1OIVA 4UBKA 4Z0HO 5DX8A 1DFIA 1GZSA 1D3AA 1RXSA 4YRFA 3Q3EA 2ZUDA 3VU1A 4EH1A 3H4IA 2ZR7A 1E3LA 2ZSAA 4M9ZA 3EXEB 5CP8A 4EQ6A 5HF6A 3WL6A 5A9SB 4KPGA 4Q16A 2ZXUA 3AF5A 2FN3A 1W73A 1KI9A 3BFJA 3Q9NA 2CFRA 1U0FA 1CTEA 1SQGA 4H3HB 1J6UA 3RUAA 2NZWA 4DUGA 1JA9A 2HSDA 2R8RA 4QELA 3PB3A 3WYNA 2P2ZA 4Z7JA 1HURA 5FQNA 4QFCA 1XTTA 1IG0A 2GESA 3A10A 3TVDA 1YE8A 2ZJ7A 2E4VA 3H1EA 4GYJA 3OJFA 4KIWA 4MWGA 4Y67A 3GVCA 3H16A 4DV5B 4AJHA 1IEXA 5GGXA 5G3YA 3Q7SA 3RIXA 2V7EA 1C8LA 4BCBA 3GLHA 4J5SA 1JWAB 1T0IA 1ZH8A 3I52A 2I55A 4NYJQ 4HVLA 3NQ41 5E6RA 3Q7RA 1JHMA 3NETA 5EGSA 9ABPA 3AEUA 1RJGA 1N32B 3L0IB 5EE5B 4DSTA 4AK9A 1VP3A 1Z6GA 3MPUA 3F5DA 1FP4B 3KIPA 5HGJA 1DQSA 1X8KA 1XG5A 1XZLA 3WFZA 4C7KA 1QG0A 2B37A 2QG9A 5BSEA 2NU9A 4BTLA 3W90A 3O92A 1USIA 4BMXA 1DB3A 1TQDA 9LDTA 5K8CA 3AVXA 4MYDA 3TTTA 2GEUA 2O7SA 4P3YA 3VO1A 1SVOA 2O2SA 3LUPA 1AV6A 5EP2A 4Q7JB 1PR9A 1H3FA 1B73A 3LDFA 4HMQA 5K0JA 1VXRA 3BQNB 4REMA 1RM0A 3RK1A 4G0NA 3LT4A 1OFUX 4BWGA 1G3IA 4B6RA 4LVCA 4BRUA 4FFOA 1ODCA 4UCQA 5FA5A 3RIMA 3ZHXA 4LYHA 4BGIA 2PZJA 1PJCA 3DEJA 2IX3A 1K2VN 1REQB 4JFAA 4JD5A 4BJ1A 3C0RA 4S1TA 5EZYB 2HDOA 1W9HA 5AJWA 2DUWA 1GPYA 3HJAA 3MJDA 5AESA 4D96A 3M1LA 5FBRB 2ZJOA 3CCFA 1ZRNA 3T7SA 1VE6A 3ZHSA 4BAZA 4UBMA 1N2CB 4E4RA 1EUZA 1V41E 1X9GA 5KOJA 3BE8A 3WS7A 2QTZA 4LDPA 4DKJA 4HQKA 4IEIA 3DVLA 3ES9A 1U99A 2ZDQA 1QCZA 3C7DB 3VPGA 5C52B 2QJWA 3TXAA 3DKVA 4GZ3A 3JQAB 3IPAA 4AAYA 2IFTA 1X1AA 3EVDA 1V47A 2XXAB 1BKSB 3KOOA 4NBUA 3V1KA 2VDWB 3QF4A 3WNDA 3WXGA 5IH3A 1NOIA 4QRDA 4FYXA 4A8TA 3NHLA 1I5OA 3DLTA 3FFBA 1WXDA 2HQOA 3BZBA 2R5NA 3NYIA 4XVQA 4TROA 2VDQB 4XGQA 2BGGA 3C6BA 1YRAA 2PS9A 3IUQA 2R1VB 3UXHA 1ZGZA 3U4GA 3QUCA 4KR9A 1KSHA 4PEVA 3OZVA 4XWWA 2I87A 4IY1A 4BWFB 4EGAA 5C53B 3HR4A 3TFQA 3DFMA 2FLKA 3QPUA 3O0DA 4IOKA 5E7IA 2R6HA 1DIBA 1CQXA 3PV0A 4JDPA 5AKZA 4DRXB 4KR7A 4U5XA 2FO5A 1BWPA 2JLSA 2O6XA 5LXTB 2AEMA 2JCYA 1KJNA 5JWRA 2W11A 1C9KA 1UT5A 3Q6MA 3WZLA 1DTWB 4ZN6A 4QBIA 2ZJ2A 1ODIA 2PWYA 2A1UA 3HEAA 2X5XA 4TXNA 5ARBA 5ES4B 4Y7CA 2FPLA 2Y1OA 5KB3A 1C9YA 1IATA 2JIDA 4YAEA 4AS1A 3SIWA 4I07A 3BMOB 3CC8A 4JP2A 1L7AA 1LUAA 2OHOA 5D7NA 5FD8A 5CB5A 2UZ1A 2IH4A 2HH5A 3KX1A 4TSFD 2ZYIA 3THRA 2F9FA 3KR4A 3JQ8B 5ADVA 5EJMA 3V45A 2JIZD 1AF7A 3B82A 1UWLA 3G2MA 2D5IA 3JXEA 3TYXA 3T95A 1IQRA 1DCTA 2UDPA 1ZI8A 3RRZA 2R2AA 4G24A 1ZN8A 2GZ3A 4DPKA 4Q4JB 1VFNA 3OQBA 4L4YA 2RGRA 2VJAA 3TLMA 3TXXA 4CT0A 5CYPA 1KSJA 2VKTA 4D81A 4OK6A 2DU8A 5IYZA 2Q0XA 2XQIA 4ZALA 5FPYA 1P4JA 2E5FA 4BO3A 2H1WA 2RHLA 5C80A 2A5FA 4RK5A 1F1JA 5FOVA 5ILOA 2YJTD 4BNMA 1MB0A 1N2XA 2W9XA 2Z8XA 1CQIA 3PXUA 1YK0A 2DJ5A 2F17A 1EWVA 4CW7A 3GT4A 4FLMA 1R64A 2YS6A 3QMVA 2WT4A 3EVFA 4FUQA 1P1FA 4BBZA 1BWQA 4AIIA 1XKLA 3DOCA 4YCLA 2UVPA 2PH1A 1JXMA 4ABTA 2PUTA 4IQ4A 1UMBB 1I3MA 4YGYA 4OMDA 5JXWA 1SXJC 1E7RA 2HEGA 3BEDA 3O2SB 3HDTA 2FEPA 3AIIA 4YRJA 5BN3A 4KV9A 7REQA 2JH3A 4CM1A 3ZJ5A 4OW0A 1OT5A 3FHLA 3A7DA 3ZDQA 2WIKA 3JX9A 1WDWB 4U3JB 1PYDA 1D1PA 4ZTBA 2XI4A 3EWSA 3FNBA 1MC4A 1OZFA 2BP7A 2OXEA 1NWCA 3CZRA 3PICA 3SIJA 2P2CA 5CGQB 1CQJA 1IWOA 2Z4RA 1JPJA 1ZXLA 4ZT4A 3K0AB 3BC1A 3RNOA 2IU6A 2QP9X 4HXEB 2ZG6A 2W37A 1CR2A 1Z6PA 3DHYA 1CSBB 2GBLC 2AD5A 4ARIA 4UTXA 5EHGA 1HZZA 1SCAA 1FFCA 1GN9A 2NU6A 1U3UA 1O94C 3L2OB 1XTVA 1X3SA 4EBBA 4EF5A 3ORSA 4MR9A 4KXLA 1NB5A 2ZYTX 5JG7A 5CCDA 5TIIA 4NL4H 4RTNA 2I6TA 3UK0A 1V16B 2E1PA 3BIJA 2D3WA 2CYAA 1CJVC 2GETA 3WLHA 2GN6A 4YH1A 4IUYA 3ACDA 4BKOA 2XEDA 1C50A 2YNMA 3DGEC 4JJ7A 4RK4A 4ZJZA 4GVVA 4ARAA 2YHUA 2JLVA 3BHIA 5BSMA 1EK1A 3OQ1A 4M2LA 3LCCA 2PYZA 1HLDA 3R7NA 1BNCA 4EHDA 5J2TB 3WYGA 1Q74A 2J3DA 1YQUA 4PC3A 1BXRB 3FWYA 3ZD8A 2IZ1A 3DDZX 3U09A 4CMEA 4RA6A 3FPFA 1RLJA 2BBOA 4D4MA 3BF7A 2CLEB 2JFWA 1J2TA 2F3PA 5LKRA 4PO3X 4XIJA 3U56A 3AB7A 5DM70 1UBMS 3ADDA 2YYSA 1M2WA 3DLCA 3JALB 5DPMA 5K5EA 3VA7A 2XSZA 5HKOA 3AI8A 1NDHA 3BTVA 4XLLA 1MLDA 4S2UA 3H8WA 4FFPA 3ENVA 1WY7A 2PO7A 2FZVA 2QTCA 1BQ4A 5JPCA 1P6XA 4C30A 1ZP6A 3B7WA 3QHAA 5IDYA 3EIFA 4FXPA 5FI5A 2G9NA 3TJZA 4GKJB 2ARYA 1VJVA 1LTHR 2XZPA 3A2MA 2WG1A 2QX9A 3LP8A 3LZDA 4FYMA 1QS0B 1E0DA 3BCHA 1K6MA 4J6FA 2FEOA 3F6PA 4YUWA 3UATA 2A9PA 1E3TA 2IX9A 3OI7A 5T67A 2AE1A 1PKXA 4FZ3A 2EKZA 1Z4PX 3KUKA 3AVOA 2XQJA 4KQXA 1H0KA 3UV6A 1XP8A 1RCFA 2G5GX 1KJZA 3TB4A 3M70A 4H6PA 4OM8A 4W63A 5ALVA 1GYQA 3R6DA 4CMIB 5BURA 3W5JA 3FE2A 1L6RA 2YV3A 4LWOA 4QPPA 3RRNA 3DKRA 2X5NA 5KWSA 4JCCA 4BMPB 4EVRA 3PJEA 4BUCA 1P75A 4HGQA 4G5OA 2C00A 5EEHA 4Z0PA 1A77A 2HXYA 4GPBA 4EHBA 2ES4A 1MD9A 1WCWA 3C4VA 9MHTA 3N39C 4LBVA 3ZK8A 3ETCA 1ZJWA 3G0BA 4YMIA 1A9PA 2P0RA 1LLDA 4YP1A 1LPMA 2ORVA 1HE1C 1I36A 2VF5X 1L9KA 4UUPA 5GJWC 2X19A 1KEPA 4OXNA 4ND7A 2Y05A 3OAAA 1NMSA 3T3MB 3MEQA 1XZCA 2NSLA 3VR2D 4EI8A 3O8RA 4JJ6A 2H0RA 4Y2XA 4YJGA 5ALUA 3UKDA 5JS2A 2R9CA 2DC9A 1G5TA 4NCKA 4G1VA 1U2DC 3KW9A 1PO7A 1ZCZA 5L6LB 3RYTC 4F9FA 2R1TB 5LKAA 2OHGA 5H4HA 5B1SA 2BIFA 5CNMA 3WRXC 2DWUA 2BLNA 1RD4A 4ALJA 3L7OA 4BFLA 2J7KA 4H1WA 4MZSA 3REFA 4YVFA 5FWXA 4Y6QA 4HR7A 2MIIA 4FGZA 4LSZA 2YOHA 3SI7A 3TNYA 4ZICA 5FAKA 2IYUA 5AQEA 1K0FA 1P8AA 5JATA 4BFVA 2NX2A 1EJ0A 1GAWA 1UXJA 3S2YA 3HGMA 4RD2A 3B60A 4R83A 3G1TA 4MCJA 2DUNA 2OCXA 1CZNA 4FMDF 3GYBA 1G98A 5CDHA 1SB8A 4LZWA 1G41A 4U7WA 3K1TA 4QWWA 3ZE0B 1I4WA 3OFND 2J3IA 4JB0A 1OH6A 4WFKA 3A4MA 3EQ7A 1TA0A 3IP1A 4H0CA 4L0QA 4CDMA 2V5UA 3MFYA 1E9AA 1M2VA 4GI2A 4QGBA 1KZ4A 3ROMA 3WL5A 3NKVA 4PI3A 1R7RA 4YRDA 2FAXA 3NDIA 3KTOA 3CEJA 1JTEA 1TU4A 3MYRA 3ML1A 4M99A 4CKZA 5J58A 3OKCA 2ZYAA 1IUNA 2UZ0A 4L2IB 5AK0A 1DEAA 1J9GA 3UAXA 5IABA 3GFVA 1HT3A 5B7GA 4N40A 3JD0A 3U7JA 3O21A 4ZPJA 1J56A 3ZE8A 4HLUC 3LTNC 1UDXA 4HAOA 2WYUA 3FYUB 5IVDA 3PT9A 3WWPA 4ZIRA 4KKXB 1QQ6A 1OXMA 3RRFA 3PS9A 1H0RA 5LM3A 4EGQA 1TYZA 2DHCA 5CA1B 4Y2UA 2BC9A 5ADWA 3GYGA 4KDRA 4BOYA 4ZANA 2R8XA 3IAAA 3ECSA 2W4IA 2GWRA 9GPBA 1P60A 1JHXA 1T1SA 3P0FA 1I4TD 4JEHA 4BO7A 1UBGA 2GEFA 2FWRA 4O4IA 2GA8A 3JZAA 2QJTA 3OCXA 4Q4DA 1GLOA 1UXGA 4KQJA 4TPKA 3SJ7A 1ILEA 1EFDN 1TC1A 3VPSA 1NURA 5HQ3B 1LAPA 4ENUA 4E5VA 1BFDA 4DLXA 4E5NA 2XAAA 3FKJA 5BN4A 3MLEA 4EVSA 5JI2E 4MAFA 3AIMA 2TSYB 1IWDA 1VG8A 5LP1A 3F97A 3RSOA 2DHEA 4XR7A 1R12A 3CA8A 3CUUA 4FCWA 2AJ8A 2VRCA 1GHTA 3E6AA 4MRAA 5LD2B 2C2HA 2P9TA 1IQPA 1JEEA 1KMHA 5LZ7A 2IYSA 5ALKA 1KYTA 1FXWA 2NUPA 2OEPA 4N49A 3VNRA 3EPKA 1NXOA 1TM2A 3H2ZA 5FUYA 5KC9A 1RWMA 4KK4A 4OQNA 4TRNA 2VFAA 1GFSA 1UBOS 2QD1A 4HCJA 4BGVA 4BO1A 2UYQA 3LQ4A 1OR8A 3WHLA 2BEVB 3JQCA 4IV5A 1DJNA 4QQFA 4YFYA 4PAGA 4LF8B 4EB8A 3VYWA 1LNQA 1QH8B 4AL4A 4GP6A 1DC7A 1FLNA 5FPSA 1P1IA 4QICA 3LDHA 2IPMA 2VDUE 4LE0A 4MW2A 3KX2A 4PNZA 3RS7A 3BXHA 2C9OA 1TZKA 3SHFA 3N2KB 3K05A 3KUUA 4BVBA 2EDAA 2FPGB 2YV1A 1SHUX 3BQ9A 3NGXA 4NBSA 4MW9A 3RE1A 4F3CA 4YI5A 1LPNA 4EFMA 1R0YA 3TZEA 1F12A 5D1NA 3X1ZA 4JVVA 3BGSA 1N2EA 4I4TB 2ZJZA 1W52X 4CLRA 3PEYA 3HYTA 5HDBB 2ZDGA 1DHRA 4XYBA 1KQGA 2H2DA 2RB5A 4PZDA 2WD7B 4D44A 2CSUA 5B53A 3OU7A 1FLVA 2WNIA 4ENTA 5JJBA 2VHSA 1Z0AA 2I2XB 2FWBA 5GGYA 2Q41A 3CMCO 1UBEA 4Y2SA 3ZQJA 2I22A 5BR4A 3BOSA 2FTKE 4D99A 1UEIA 4EKEA 3IX7A 4P58A 3IA2A 1ICIA 2P5TB 3H97A 2ZZKA 3T0GA 1OB5A 4WLFA 4MEJA 1T1EA 3PEUA 2VBCA 5CB4F 3E5HA 1XPRA 4G5QA 2XUDA 5BOVA 2P3LA 4HDSB 1HUQA 2UAGA 1V7CA 3B6MA 4PQGA 4BP1A 4B0PA 5ITVA 4KR2A 2RI6A 3NWPA 1Y8AA 4KMSA 2ZWOA 4PYKA 1GD1O 3HE3A 1GKLA 2HWYA 3U2QA 3UMYA 2OQVA 1ME3A 4MJXA 3BVPA 4YO7A 4E2FA 1RWNA 2QW8A 1MABB 2WABA 3K73O 4B3JA 3VZQA 2XXJA 4BNUA 1QSGA 1QP4A 1HFWA 2VJYA 1VKOA 2PNFA 2V7BA 1UDRA 3CONA 5B4UA 3VV3A 2FZ4A 5JCXA 1IQUA 3WLRA 1VIMA 2P4QA 4UEQA 4NC9A 4YT4A 4D0GA 3JYPA 3PJGA 5IEJA 1OH5A 3OEED 2DKNA 5P8WA 4EUEA 5A4MS 5KQPA 1PT7A 2LIPA 1KL7A 2HMAA 4M7OA 3G89A 4LXYA 1WR8A 4PZYA 1IAQA 4JVLA 4W7SA 3GUUA 2O8CB 4PGFA 4YEDA 1PWEA 4B3FX 2HOQA 2VA8A 3A9TA 3OZXA 1KI6B 1DMSA 1FDVA 5KTRA 1VFPA 4OLHA 1ENYA 3G2JA 3QOYA 4RORA 1CETA 2PH3A 2PMKA 4RCYA 4KI7A 1PPDA 2Z83A 3HO8A 3REOA 2O2HA 4LC1A 3L79A 4MH0R 2FQ9A 1U0OC 2KW5A 2E7ZA 4L3WA 4BNIA 5CR9A 4J0IA 2GEBA 4U2EA 5LQDA 4JVOA 1DVRA 3IR7A 2ZRJA 2G8JA 5HZKA 3QX9A 4NU6A 3CX4A 1HRDA 1KYZA 1XOIA 3DQZA 4IHAA 2UUPA 4XB2A 5ERYA 3SGLA 2YWJA 5AK3A 2DCDA 4RTLA 1Y8RB 3U1VA 1T5OA 1OMOA 2WTEA 5JMTA 5AKKA 2Q6OA 2X9GA 4KKVA 4CMKA 2W2OA 2IBSA 4DV2B 4ES6A 2PZEA 4UEWA 1TB4A 1U8UA 1G8AA 2H4XA 1NJ1A 2Y0PA 3AHHA 2B7CA 2NO1A 3E70C 2JAOA 2YL2A 5A06A 621PA 3DDNA 4BB9A 1E6EA 4PTZA 4FW8A 2QI9F 4AKGA 3F3SA 2IU4A 3VBCA 5EQDA 5LQCA 4YNBA 3WV4A 3HJNA 1O9GA 3DV0A 3GROA 3I5MA 4R2KA 3OPYA 1EGVB 2G25A 4DNFA 5IMSA 1GTG1 4C89A 1TT5B 2BDZA 1Z74A 4JI1B 3DE7X 4BFZA 1JL3A 1I4EB 2RGWA 1NSTA 3LP6A 3V8NA 1M8GA 1GQRA 4I08A 2VLBA 4FWIB 4O25A 3GPOA 2ZBEA 4JFRA 5FV4A 1V11A 2VHTA 2PKCA 3P52A 3NP7A 3UBMA 3U3MA 4BVHA 2G3YA 3CEAA 3O7MA 2PYDA 3KKPA 1F0KA 3RC8A 2WR8A 2YWRA 4M54A 3H8CA 3I6MA 4Q4HA 4HAWA 4P6VF 4AYXA 1M0WA 1ZUWA 5AUQA 3BWKA 1LRLA 2WB2A 4B7ZA 2H2GA 1MV8A 3QQPA 4LISA 2J31A 3JD4A 4PQRA 1SKYB 4AMGA 4FMCF 1J2JA 4WJZA 3E82A 2ZWVA 4FM9A 1RAAA 3RHZA 2OC4A 2PNJA 2NSDA 5E6JA 4I2NA 3VFDA 1Q0UA 5JCOA 1KI2A 3MCUA 4RPKA 4RH0A 4S1VA 5M7EA 2H5LA 4H1VA 1GPWB 5AK6A 1JQBA 3EJGA 1ZKMA 4UM9D 3WLIA 4LW8A 1PFKA 4TLCA 1UK7A 1U0LA 1YXMA 2C54A 4KHPB 2RHGB 4ED9A 1P4AA 3W1EA 5KS2A 2HADA 2CJPA 1GTRA 4FYWA 1E2BA 3G2PA 1I8TA 2O1WA 4GRIA 2EHJA 3BRSA 4X92A 5C3MA 1WETA 1NXVA 2P9CA 5TR9A 5JTTA 1QHHA 5B58C 2I29A 3JAWB 3D6HA 3L0SA 2OFWA 3W3ZB 4JLWA 1WPXA 4GX5A 4Q18A 2WG0A 1SD2A 3R76A 2B69A 4A10A 1UBUS 4M1KA 5FOQA 5JNLA 1AF4A 5AVSA 3EH1A 3USES 3STWA 3KLOA 3QUTA 1DSSG 4XYEA 3R24A 2FW8A 2FW9A 2JI4A 2NXNA 2DUMA 5KUTA 4GM4A 1GUYA 2P86A 4TYYA 2I03A 2X2FA 3L84A 2H4WA 3KXIA 3EMDA 3WMRA 1XCMA 4AS2A 4OG2A 1RAGA 3AW9A 4L3OA 1Y6FA 2KI5A 2BDTA 3OQJA 2EZUA 2YJCA 1FYEA 2BBSA 2CHEA 2FH5B 2W8BA 2ZJFA 3OX2A 3ZZ1A 4RDIA 1AYUA 5FORA 3WGYA 5JZMA 3C4QA 3Q8KA 3O0UA 3GFGA 5AKEA 4H17A 4NK5A 1ADCA 2NO4A 3GQBA 4FYHA 2OXTA 1DAKA 2WVJA 2WWTA 1FRNA 4QRGA 2QRNA 1QGUB 2Q3BA 5J2UF 1MRNA 1E1LA 1I7PA 2FP4B 4KDEA 3MXOA 4C1NA 5BNIA 4HGZA 4OCZA 3L1JA 4Q9DA 4NU0A 2VNKA 5HJ5A 3M83A 1U8EA 1Q7CA 3SHVA 2XB2A 1PI3A 2C31A 1T8YA 3SQXA 1D2RA 3BJRA 3CZ5A 3LU1A 4GYKA 5F02A 3EQ6A 4FOPA 3BXPA 4ZVMA 3O8QA 2VF7A 1E8MA 1DX6A 1ZNWA 5CVEA 4HDMB 4F21A 2BTOA 1M34E 4YR9A 2ID8A 3IHLA 4ND4A 3UKJA 4XUEA 3M4NA 1BOFA 3DOUA 2ZUEA 5C7LO 4CMBA 1IVSA 5KOHB 1C29B 2GN8A 5K03A 3LPNA 2R7MA 3AJEA 3L8CA 4EJ0A 4XSGA 4Q19A 4U2CA 1EWPA 3HSYA 1JVSA 4J43A 4B6JA 3PRKE 4YAIA 5LU9A 3DO8A 3MJSA 2XJ4A 3DSRA 4GE0A 3RTDA 3ZLTA 3NTOA 4JYZA 2JGFA 1BPNA 5TF4A 3DF9A 4FBMA 3QBTA 2Q62A 3BGOS 3CLHA 3OJXA 1QPGA 2WAXA 3X2SA 3R0XA 5B58T 2W6JA 5AKXA 4QIHA 1OPRA 3EC1A 2J5RA 3OX3A