4GUAA

Alphavirus p23pro-zbd
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
662
structure length
662
Chain Sequence
NPFSCKTNVCWAKALEPILATAGIVLTGCQWSELFPQFADDKPHSAIYALDVICIKFFGMDLTSGLFSKQSIPLTYHPADSARPVAHWDNSPGTRKYGYDHAIAAELSRRFPVFQLAGKGTQLDLQTGRTRVISAQHNLVPVNRNLPHALVPEYKEKQPGPVKKFLNQFKHHSVLVVSEEKIEAPRKRIEWIAPIGIAGADKNYNLAFGFPPQARYDLVFINIGTKYRNHHFQQCEDHAATLKTLSRSALNCLNPGGTLVVKSYGYADRNSEDVVTALARKFVRVSAARPDCVSSNTEMYLIFRQLDNSRTRQFTPHHLNCVISSVYEGTRDGVGAAPSYRTKRENIADCQEEAVVNAANPLGRPGEGVCRAIYKRWPTSFTDSATETGTARMTVCLGKKVIHAVGPDFRKHPEAEALKLLQNAYHAVADLVNEHNIKSVAIPLLSTGIYAAGKDRLEVSLNCLTTALDRTDADVTIYCLDKKWKERIDAALQLKESVTELKDEDMEIDDELVWIHPDSCLKGRKGFSTTKGKLYSYFEGTKFHQAAKDMAEIKVLFPNDQESNEQLCAYILGETMEAIREKCPVDHNPSSSPPKTLPCLCMYAMTPERVHRLRSNNVKEVTVCSSTPLPKHKIKNVQKVQCTKVVLFNPHTPAFVPARKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional insights into alphavirus polyprotein processing and pathogenesis.
pubmed doi rcsb
source organism Sindbis virus
molecule tags Hydrolase
molecule keywords Non-structural polyprotein
total genus 200
structure length 662
sequence length 662
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4guaA02
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4guaA03
3.90.70.110 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cathepsin B; Chain A 4guaA01
4E2ZA 2OZVA 5E8JA 5KQRA 3GPGA 5T67A 4RV9A 1VE3A 3GRZA 3ORHA 4RWZA 3EKEA 3A26A 2BM9A 3PB3A 5DM1A 4AUKA 4JCAA 3CBGA 3SXJA 4ZX9A 5HOLA 3T7RA 4J4ZA 2KW5A 4GC9A 2IIPA 2NYUA 3LPMA 3ANXA 2G71A 3P71T 4HGZA 4WXHA 4XCXA 4ABKA 3EEYA 5GIPE 3V45A 1YD9A 2O07A 1ZKDA 2OPBA 4ZX8A 2HNKA 2HTEA 4P7FA 2PXCA 2ONZA 3GCZA 3RW9A 4YUYA 5M5BA 3KQXA 1XTPA 2A14A 4MQ4A 3KPVA 5GINE 4FZVA 1G60A 3FPEA 4GOOD 4M7RA 3T0IA 1KYWA 3GXOA 3O4FA 2BFRA 3DMHA 3AWIA 5K0FA 1P39A 3A25A 4F84A 3EVAA 4ESSA 4X1OA 3UJ8A 1VIDA 5FA8A 1VP9A 2IPXA 3LDFA 2PWPA 1DL5A 5D1HA 3LX6A 4DA4A 3FUTA 3PLAE 3C6KA 1Y8CA 5HILA 5FSYA 1D2GA 2PX4A 3G8BA 4QQNA 2I9KA 3HTXA 5EHIA 3KPWA 4RYLA 5DLYA 3HCDA 1JQEA 3REOA 3DMGA 1P1CA 5EEGA 2Q41A 4J5QA 2B25A 1XCLA 2ZBRA 3HA5A 4M36A 4XUEA 2QRVA 2NNWB 2AVNA 5CMSA 1RJEA 3HEMA 4R6XA 2I6GA 3I58A 3THRA 1VPTA 1ZGJA 3LBFA 3FPGA 4C4AA 3LCUA 1YB2A 4DCGA 5FSVA 5KS2A 4ZY2A 3HVKA 2R3SA 2WA2A 2XYQA 5K05A 2P3LA 5GM2A 3R6TA 4GBED 2ZWAA 1BPMA 3PX2A 2ONYA 1FP2A 4PCLA 4QQKA 3KQYA 5EIWA 4AX8A 1BLLE 2DPMA 3LGAA 5CVUA 4EVIA 3C0KA 1NW7A 1AF7A 2O05A 4C05A 2OXTA 2BR5A 5F2NA 4QDJA 4RTOA 3KKZA 2EEEA 3A7EA 3GDHA 3I53A 4YUZA 1NW6A 3IV6A 2YUIA 5E9JA 5FULA 5BXYA 1XVAA 4OBXA 3GRRA 3RODA 3O7WA 3BWYA 4NECA 4PYIA 3TR6A 2IBSA 1ZR5A 3H8GA 1FBNA 5E1DA 5C9ZA 5FUBA 2AN5A 5BW5A 2GS9A 2PVCA 2Y1XA 4M38A 1XXLA 3L8DA 5LQJA 2FHPA 3SM3A 4ER6A 3GQEA 3EPPA 2OO3A 2XVAA 1QAOA 3AY0A 3DLIA 4PGHA 2BR4A 1TW3A 2PXAA 1EAMA 3KPYA 5ICGA 3DMFA 3C6MA 1BHJA 3P9KA 2IFTA 4E2YA 5DSTA 2H1RA 4EKIA 4ZY1A 3NDJA 3NJRA 2L8RA 2JH8A 4KIGA 1ZQ9A 2JHPA 2PJDA 5GIOE 3PX3A 2EJUA 3M33A 3EEOA 1O9GA 3EVDA 2OB1A 3ELYA 5CM2Z 4GVWA 2P1DA 2PBFA 2VDWA 1XCJA 1SVUA 1VQ1A 4MHTA 1SUSA 4A6DA 5K09A 2J9AA 4EK9A 4GVVA 4KWCA 3P2KA 2ZSUA 4BLUA 4E2WA 4RTRA 1NV9A 5DX8A 3B3GA 5FQNA 3EMDA 4PINA 3TOSA 4JLLA 1JSXA 2G70A 5HIIA 5AILA 2CL5A 3KR2A 3R3HA 2H11A 5FQOA 5E2AA 3BGVA 3B3JA 2GB4A 1TPYA 3JWIA 3RIEA 5D8NA 2IH4A 3UJDA 1JG4A 2O06A 4RTKA 1B42A 1D2CA 1L1EA 3BGDA 4RTLA 4RVGA 4UOEA 4R76A 3HA7A 1O54A 3TKAA 2FXKA 3FPJA 2AR0A 3B5IA 3JWHA 3PT9A 3UFBA 1RI1A 2P3OA 3V97A 4YMHA 5KVAA 1P1BA 2N47A 4RTJA 5DPMA 4OA8A 3MQ2A 3LDUA 1D2HA 3G2PA 3DH0A 1EG2A 2GLUA 3EVBA 1XJ5A 5DRTA 5DX0A 2BR3A 5FADA 5B1SA 3GRVA 4FGZA 5C1IA 3SMQA 4RTMA 1Q0TA 1IM8A 5EPEA 4YV0A 1WXXA 5EGSA 5EMLA 1ORHA 4IV0A 3HM2A 4PYNA 3UJ9A 1VBFA 1JSZA 5E8RA 2XYVA 5EZQA 1OR8A 2NXJA 5E2BA 3CC8A 5E9QA 4P7JA 1ZR3A 4K3NA 1ZGAA 4H0NA 2IDKA 5D1NA 4P7GA 2G1PA 3DUWA 2HV9A 3Q87B 4PYLA 1N7JA 3CJQA 5U4XA 3UZUA 2XD7A 3EWQA 3LKDA 3P97A 2BM8A 2FG1A 3FPFA 4GUAA 1LAMA 2XVMA 2BZGA 4ER0A 3TM5A 3KPUA 4QVGA 1AQJA 1SUIA 1F38A 2G8NA 3P9NA 1ZHFA 3MTEA 2ERCA 4PWYA 4KIFA 4CTKA 3FUVA 4IKPA 3M6XA 2PWYA 1NW5A 4KRGA 3IHTA 3E23A 1UIRA 4JXJA 1X1CA 5HFJA 3TQSA 3X0DA 3GQOA 4PNEA 1EIZA 2EFJA 2HWKA 2FCAA 4GQBA 3NVMB 1PJZA 2NP6A 3NDIA 4BLVA 1FJXA 3GU3A 3M6UA 3FUWA 4TU0A 2AOUA 1H1DA 3BKWA 3KR9A 3P9IA 3SIJA 5ERGB 3JRUA 5EVJA 2FYTA 5EC8A 4PYQA 5CVVA 3G7UA 3UJCA 3C3YA 3HCFA 1KPHA 4PIMA 5DXJA 5FWDA 5JUWA 2JJQA 4R7MA 1LCPA 3KR5A 3CJRA 2B2CA 2GAFA 5FA5A 3ME5A 1INLA 5HIMA 3IJ3A 2IP2A 5CIYA 3KQQA 2ZULA 4GF5A 5DM2A 5H02A 3FPHA 4ETJA 5EZSA 4E2XA 2ESRA 2VS1A 1RI2A 2GH1A 1JQ3A 2AZTA 1NT2A 2VP3A 4OQDA 4QPNA 3CKKA 4BP1A 2Z6UA 5CBMA 3DULA 5HEKA 1G6Q1 3EVEA 1DUSA 2Z6QA 1I9GA 2UYQA 3DLCA 4AZVA 4LWPA 5LQNA 1R8XA 3BUSA 5HOQA 1YF3A 1AV6A 4JVVA 2P7IA 1BOOA 2FAVA 3T8WA 3H2BA 2EJTA 1HMYA 5CB3A 4RTQA 2NXEA 3QV2A 3LCVB 1JG1A 2PX5A 3S68A 4J5SA 3SIHA 7MHTA 3H8FA 3B7PA 1R74A 3OE4A 3T7SA 4RVHA 3THSA 1JTFA 5K01A 5K0BA 4V0RA 4OX9Y 4BY9E 4KSIA 1KIAA 2VDUE 5EIFA 5FHRA 5LQUA 3JZTA 3SSNA 1PRYA 2O0LA 4HC4A 1BPNA 3ELUA 4FSXA 4HG2A 4LWOA 10MHA 5T6BA 2C7QA 2YQZA 5E3BA 3SX0A 3PTAA 1Q0SA 3DP7A 4C04A 4POOA 2BH2A 3MAGA 4ETKA 4GOMD 2FRXA 5GOZA 4E70A 2ZBPA 4A6EA 5HZMA 1KXZA 1NW3A 4CKCA 2ACFA 1KYZA 3LBYA 1KPGA 4KVZA 2UZ4A 1G8SA 3EWOA 4QTUB 1WS6A 2ZCJA 1R18A 3GJYA 2LGRA 3EJFA 4Z2YA 2P7HA 2FPOA 4LECA 5DRYA 5FWAA 4ER7A 1I4WA 2B3TA 4MTLA 3LDGA 3TLJA 2OKCA 3TPZA 1DCTA 3BWBA 3MHTA 4YV1A 3KQWA 4RTPA 3VFQA 2HR1A 4X63A 4PYMA 5DTMA 3A27A 3OZRA 5T64A 4FSDA 4YMGA 4PYKA 2WK1A 3G2MA 1G55A 3FYDA 2EX4A 3JWJA 2BFQA 3CCFA 3GRUA 3G2QA 2XYRA 3KQTA 4QTTB 1TXZA 5DTRA 5F2OA 3K0BA 3EGEA 4GOND 5CB5A 1NE2A 2G72A 3SIGA 1KP9A 2FK7A 2QE6A 4DKJA 3GPQA 3BGIA 2K4MA 5K0LA 1VP3A 3OZTA 4CTJA 4ATNA 4ZY0A 4RTNA 1Z3CA 3E7PA 5HIHA 1WG8A 2EG5A 2B78A 2P41A 3NW9A 1RI5A 4IV8A 4YUWA 2QY6A 1L3IA 2R6ZA 3HVHA 1LANA 2V7EA 1FPQA 2FK8A 2PLWA 2X47A 1VHUA 3UA4A 4OA5A 3I9FA 2OB2A 3CVOA 1IY9A 3HCCA 2GPYA 4HTFB 2JH9A 5E1BA 2CMHA 2YTZA 2OY0A 4L7VA 3Q71A 3FRHA 1G8AA 5HIKA 5CCBA 3UJAA 1L3BA 2PT9A 1NJRA 1G38A 2CMGA 5HIJA 4O29A 4G56A 1P91A 3LECA 4OBWA 1XDUA 5IH3A 2HMYB 1TW2A 3QOXA 5C0OE 3R24A 4Y30A 3E05A 2AS0A 1TY8A 5P8WA 3FRIA 3ER9A 3UJ7A 3KU1A 4E32A 5EMJA 4K6MA 5CVDA 5EQJB 3P8ZA 4C07A 4CKEA 4ZYQA 3MGGA 3M4XA 3MERA 1UFKA 5LQCA 4ER3A 4X60A 1RJGA 4HTFA 3O31A 1JTEA 3OFKA 4PYOA 1XDSA 3SVZA 3TFWA 3KQOA 3ELDA 4FT2A 2PT6A 3LCCA 1YUBA 4ER5A 4R8RA 3KR4A 4HGYA 3EMBA 9MHTA 4KDRA 2IBTA 5EG5A 1MJFA 4X61A 5EKUA 5FTWA 2YXEA 3EGVA 3GRYA 3I64A 1AQIA 3TM4A 3KQZA 3HNRA 2ORED 1X1DA 3UJBA 3VC2A 4DM3A 2P3QA 1JG2A 3P9CA 2YR0A 1F3LA 5EEHA 2DX6A 1HNNA 3EVFA 4IWNA 3ER8A 3FTCA 1JQDA 1X1AA 1NKVA 4EKGA 2WA1A 2GA9A 3P2EA 5FSUA 5BW4A 2EWBA 3KHKA 3FUXA 3MCZA 3PFHA 5EMMA 3KPJA 2PSSA 3EVGA 1VL5A 4V0QA 5F2KA 4CKBA 5G02A 4KYBA 2IH5A 3ETIA 1XDZA 5KQSA 3HVIA 2F8LA 2YX1A 3G5TA 2JHCA 1EJ6A 1QYRA 3G8AA 3I5UA 3OE5A 1YFJA 2AOVA 4RX1A 3M70A 1QAQA 5IKMA 2ZBQA 5EMKA 2I7CA 2ZW9A 3FZGA 3OZSA 1NV8A 3EVZA 5K0JA 4HSGA 1NBIA 3DTNA 2Y1WA 4MIKA 5BP7A 3U81A 2AOTB 3HCEA 3OFJA 4QPPA 1N2XA 3B3FA 3AJDA 2ZZNA 5DX1A 3VYWA 4DQ0A 3OU7A 3UJ6A 2ZIFA 5EKXA 3Q7EA 4E30A 2JHAA 2QYOA 4E33A 3EWPA 5FSZA 5FHQA 4DMGA 4R05A 3SR4A 3FTEA 3V2BA 4ZI6A 1M6EX 4BLWA 3Q6ZA 4LG1A 1O9HA 2CKDA 5GM1A 4AZTA 1GYTA 1N7IA 1RI4A 3GWZA 3MCTA 3MB5A 1I1NA 3BXOA 4DF3A 2AOTA 2Z6AA 2AOUB 1SKMA 2E5WA 3ELWA 2V74B 2DULA 3HCAA 2I62A 2ZIEA 4X41A 3PFGA 5E9WA 1KHHA 2AN4A 3HCBA 2IGTA 2PXXA 4R8SA 1R6AA 3UBTA 3B89A 1M0EA 3GIWA 4UMLA 1NBHA 3BWCA 4GEKA 2UYHA 2QRVB 1QAMA 3CJTA 3PVCA 5ICCA 3NMUF 4DCMA 3KR0A 4ISCA 4F86A 4HH4A 1YZ3A 3D2LA 4HRAA 3BKXA 3IYLW 5GP1A 3SSMA 3KQSA 2PY6A 5K8VA 2UYOA 5LQAA 2CWWA 3FYCA 3G89A 3HVJA 5MHTA 3R9XB 1KPIA 2YXDA 4D86A 2IH2A 5KYGA 3ERCA 4KDCA 1SQFA 5LQRA 3OU6A 5K03A 4XUCA 3EWRA 5DM4A 2OYRA 3EW5A 2B9EA 1VLMA 5LR6A 3PEIA 3KQVA 3VSEA 5DUSA 3TMAA 2PGXA 4R6WA 5DTQA 3LKZA 2P35A 4DZRA 1MHTA 3LL7A 1R8YA 1RJDA 2QM3A 4C03A 4K0CA 2ZWVA 5CUQA 1YZHA 4B17A 3GPOA 3TKYA 1M6YA 2YXLA 5DWQA 5FSXA 2AVDA 4FS8A 2ADMA 4FT4A 4QDKA 3UA3A 5E1OA 4F85A 3LSTA 5CCXA 3EJGA 2C7PA 1T43A 3EGIA 3DXZA 3KQMA 1SPVA 2PKWA 4GC5A 3P2IA 3NVKI 2ZFUA 4AZSA 3NTVA 3NWBA 3DOUA 2AOXA 3FTFA 2ZZMA 3G88A 2PX8A 1RJFA 1QANA 1ORIA 3MTIA 3PS9A 1L9KA 1SG9A 3WSTA 3DXXA 5LSAA 3G5LA 3BWMA 3KZWA 2ZTHA 4J5RA 3G2OA 3M6WA 4PGGA 3JWGA 3SSOA 2PX2A 1ZG3A 3VC1A 1JG3A 5LQKA 4YUVA 3AXTA 4P58A 3CGGA 4QVKA 4U7TB 4Y2HA 5DT2A 3IIFA 1QZZA 2P8JA 3LHDA 2UYCA 1KR5A 2JG3A 3BT7A 5CVJA 5EOVA 2NXNA 2VZ9A 4EMSA 4OQEA 1BKYA 1V39A 3DXYA 5K0CA 5JR3A 3TRKA 3FTDA 3T7TA 3OPNA 2C7RA 4RTSA 1U2ZA 4ZTBA 1RI3A 5ICFA 5CVEA 3HP7A 3SGLA 1SQGA 2O57A 1EQAA 3E8SA 4RVFA 4RVDA 4YV2A 3UWPA 2ZLBA 5DSXA 5ICEA 1LAPA 2P40A 1BC5A 2IDJA 2OBFA 3HA3A 3KQPA 5CD1A 2AOWA 4GOLD 2YVLA 3AXSA 4M37A 4P7KA 1WZNA 4U7PB 5DM0A 3BZBA 4FP9A 2ZZKA 4R6TA 3F4KA 3ID6C 3GNLA 5E1MA 4CXMA 1WXWA 3K6RA 1UWVA 5EHGA 3KR1A 3C3PA 3QOWA 1X19A 2AN3A 3GO4A 3OU2A 1IXKA 4PCAA 3V8VA 5FCDA 4C06A 3FUUA 2XBMA 2ZVJA 1EJ0A 1L3CA 1NW8A 2NXCA 3IEIA 3OCJA 4RSRA 5K0EA 4X2TA 4JGKA 4IQYA 1JR4A 1HJZA 2PV0A 4XUDA 8MHTA 4C08A 3A7DA 4MWZA 1X1BA 2LD4A 5DXAA 5GWXA 4E31A 3GGDA 4PYJA 4YUXA 4PIPA 4BP3A 4CWAA 4EQZA 2NP7A 4PONA 1FP1D 4WVLA 3EVCA 3NWEA 4FR0A 1WY7A 3DR5A 2ZIGA 1YFLA 3R0QA 5K0GA 3M6VA 4KW7A 2H00A 3H8EA 2C7OA 2VDVE 4AZWA 5K0NA 2AFCA 4ABLA 2VRIA 3SIIA 3IIDA 1R00A 3A4TA
chains in the Genus database with same CATH superfamily
1RYMA 5E8JA 1D9ZA 1YDMA 2GXUA 2LKDA 3ORHA 2GZAA 3IO5A 3MWGA 3GJZA 4RWZA 1WUTA 1EBBA 1WIWA 3JRXA 5HRAA 4RCVA 4RLQA 4ALLA 3R8FA 2XVZA 1TYDE 3D6VA 3FKSD 5JBQA 4LBWA 1XHLA 5LA6B 3IJRA 3RG2A 2A0YA 2LXNA 5ITVA 3K94A 1EUYA 3VJMA 2I6QA 1TFUA 5L6MB 1FNSA 1ZUWA 1JEOA 2A1UB 2P79A 4YRDA 3DKVA 2Z5LA 5IJZA 2B35A 1ULSA 4FEYA 2JGEA 3NFRA 3DDCA 1UEXC 4LQLA 4BNUA 4DDUA 2AHRA 4FHGA 3JCZA 4B3XA 2E82A 2DFTA 3UY4A 3VBEA 1DIRA 2FAXA 4LDNA 4MQEA 3U09A 1XTVA 2J3KA 3LGXA 3ZHOA 3ZHVA 1VIDA 4BGDA 4OMCA 1JQBA 2MR5A 4OLHA 3ZIUA 4H0CA 1XD2B 2OM2A 1BNCA 5IAJA 4D46A 3ZE8A 1F6BA 4CQNA 2XQJA 1Y7IA 1ZSYA 3HGQA 5EHIA 1TZJA 2QDKA 4BVLA 4DLLA 4P2BA 4ZOLA 1VB5A 1Z5ZA 2XX3A 4PZYA 3V4RA 1O57A 3STYA 2UXBB 1FMFA 1T4CA 2HDNB 3HXQA 3H87A 3EIWA 2FGKA 1QFZA 2QG9A 1X9GA 2FSSA 3DMGA 4WUVA 3VISA 3U9TA 5K4HA 3QU2A 1XYVA 1N2OA 3LIIA 1R12A 1BIFA 4GKAA 3KT3A 1FFEA 2F3RA 1H65A 3M1IA 3MJCA 3IXMA 3AETB 4DG9A 1QHHB 3LCUA 4CKXA 1KEWA 3O90A 1N2EA 1PFWA 2ZRCA 3COZA 4OU5A 4UNNA 4R4JA 5FR2A 1UP4A 4J3NA 1Y82A 1IXYA 2X8AA 4PCLA 1XPRA 3DT9A 3V4PB 3IP7A 1S2GA 2DPMA 5JG7A 3MTBA 4O2BA 2WDZA 4JP1A 5CDYA 2HV8A 4F2GA 3FCUB 5HHTA 1MG5A 1Q0QA 1ZMXA 3L93A 4RE6A 1O5OA 1CVLA 2J3HA 2J7PA 1NC3A 3BCSA 4HVCA 2DX7A 2QUIA 3RS0A 1IN5A 1ST2A 3SM9A 4N7MA 3U3ZA 3VV3A 1JLMA 1PJTA 1ZZGA 1TJ5A 3FYUC 3PE4A 4R69A 3U1VA 4DQUA 4X6HA 4KQEA 3CUVA 2WWHA 4Z1OA 3KDPA 4NNPA 4UNIA 2PVPA 2BFEB 1QPBA 2ZRHA 4Q1BA 3RVPA 3Q8MA 1J90A 3R5HA 4IF4A 3EISA 4BEBA 4UHCA 1UJ6A 3O0UA 2VJQA 3GQEA 1V5EA 2DWOA 1N1MA 1JYSA 2EX0A 2Q2NA 4K88A 3W8DA 2Q4TA 3KPYA 1RHUA 5FLEX 4B6JA 2RGDA 4L22A 2HZ7A 4ND7A 4H4DA 2IFTA 1P4SA 4BDTA 4E2YA 5DSTA 2ZUEA 5KQGA 2L8RA 5L95A 4QJ5A 4P81A 1GA1A 2B8EA 4A7PA 5GIOE 1GYRA 4J9VA 5CGQB 2DR2A 3BK1A 4BX9A 5JC8A 3K0FA 5CVNB 2W6ID 2J3QA 4QYMA 1KEEA 5IKXA 1YH3A 5EGNA 4A2QA 2ZJ2A 3CRRA 1LW6E 1OI3A 3IKLA 1WJGA 4NYMQ 3SF0A 3WICA 2AK2A 2JFZA 3T7AA 3Q3GE 5KYVA 1AA9A 5FUMA 4N8WA 4C4ZA 1SVIA 3ZCUA 1L1RA 3LMKA 1A8HA 2G70A 3O91A 4YUAA 1ENOA 1ZSVA 5KZMB 2CL5A 1OVGA 1PJSA 1UF9A 2HRQA 1H0HA 4GOKA 1MFZA 2ERYA 5JTTA 2CVHA 2J6HA 3PWTA 1ZHOA 3BGVA 1E0KA 3ZD6A 4MARA 3HO8A 1ATIA 3LH5A 3SYRA 5JY1A 3K8UA 3H0CA 4KLRA 3MQ4A 2CWDA 2NPIA 3LF2A 2FXKA 4X2TA 3FPJA 3BT7A 1C30A 3AH8A 3HS3A 3RVOA 3SQLA 1YKGA 3U19A 2XEDA 1AKRA 4O4HA 3UW1A 4U7WA 5TQVA 3LF1A 3N07A 2I22A 4P3KA 2BJHA 2QZ4A 4QT0A 1S8AA 3OCYA 2CHVA 2Q3MA 5JQGF 521PA 4MQUA 4FGZA 4QYIB 4ED9A 4I19A 2WTMA 1YALA 3L1IA 4HI0E 4AN1A 3LC0A 4C0AC 4MYHA 4D97A 1A9ZA 4LGYA 3HHIA 4GO1A 3JQ7B 4WLUA 2XDYA 1UWLA 5LKRA 4XDYA 1WLSA 3GV0A 4XARA 2XNDD 4JLAA 5KQMA 2VUIB 2RH5A 3IPXA 3CEMA 1FNNA 5AOBA 4GXTA 4D3DA 3ANTA 4FI3F 2B8TA 2R7KA 3BQ9A 3BC1A 2OFOA 2GESA 3K72B 1BFKA 3H89A 1F4LA 3CH5A 3VA7A 5KDDA 2L82A 4FI3C 4NDNE 1Y98A 1EPUA 4NHOA 1NVGA 3QMMA 1AHNA 1O6ZA 4GL4A 4KSBA 4Q4HA 4XSHA 4OYYA 5E2IA 3MTEA 9LDBA 2WAAA 5KQPA 4EYOA 1M67A 3EMVA 3FR7A 2PA0A 3LUFA 4KRGA 3RS9A 4AN0A 5A4KA 1KJ9A 2V4MA 3DOHA 5BV1A 5JS6A 4UCXA 5G1OA 4BYGA 1QF6A 1IZ9A 5LKAA 2YXBA 3NVMB 1GKKA 3EXHB 3H4MA 5JS2A 4Y2GA 1ZJJA 3STUA 4G41A 3DW3X 3PK0A 3SIJA 2AV6A 2VXOA 4HZUB 3CVXA 2ZUCA 1H2BA 3KVYA 1U90A 3C3YA 3NONA 1YR1A 4FC7A 4PIMA 5FI3A 4R7MA 4RIIA 3WLAA 4FQ8A 4G1VA 1VJ0A 3M81A 4WNAA 1W85B 2PL9A 3NHEA 1E69A 2QTTA 4MW1A 3TD2A 3KHTA 1Q6YA 2IP2A 1OIXA 2JIRA 3RH0A 2A84A 1SBIA 1VCHA 2MYPA 3VSCA 3AI1A 2CFTA 4ARIA 1HFWA 2VP3A 4KYVA 4QPNA 4LSMA 1S9DA 5CT9A 3RC9A 2NVBA 1C1DA 3DULA 3K2EA 2QR2A 3EQ6A 4NJMB 2B2XA 4NY1A 1AZWA 3ZCPA 3I8SA 1MTOA 4D4JA 4I1OA 1XVTA 2F7SA 3FNQA 4MW4A 5K4AA 1EA7A 4Q00A 3QYAA 1P31A 1XN1A 1XRPA 2G1AA 2Y0PA 1GUZA 3LFTA 5CW2A 2JRIA 3BCNA 4JMLA 1J8YF 4KXUA 3IODA 3SQNA 1I2ZA 2C78A 4BE9A 5K0BA 5ECDA 3THSA 3D4BA 3DQZA 4DSNA 1L5MA 3OLVA 3T1QA 4V0RA 1VYVA 4EEKA 1BS2A 4DDTA 4ZHSA 3BFVA 4WFQA 3AUAA 2EVWX 2UUPA 5JZVA 1PVJA 3RSHA 3IA2A 2VTKA 4BMCA 2ZIAA 2FN7A 2OV6A 1B0AA 2MIIA 5JPCA 4K6HA 2R9MA 3I4FA 2OCKA 2YZMA 2XDQB 4B8YA 5CB6A 3GUYA 2V6MA 2ZBPA 4I50F 4R0VA 1KOLA 4CKCA 4U7JA 2PCLA 3KYDB 3WK7A 5MN4A 4HEJA 2UYYA 1GFIA 4KPUB 2IKSA 2ODEA 1WW2A 1SXIA 2D1QA 3QI7A 1Y80A 5JCOA 1GMYA 1PFGA 3WIVA 1BDHA 5COBA 1SUAA 2XKBA 3BMCB 2WICA 3QE3A 3VFQA 2I99A 3TE7A 4DDVA 5KWSA 1TD9A 1U28C 1VJGA 2QV7A 4ZCIA 5LMZA 1HFKA 3AVVA 3OJWA 1QYIA 2NM0A 4HWRA 2HSEA 4BLRA 1M1YE 3ZWVA 2MSNA 3FDXA 3RC7A 3T5DA 4YDQA 3TYXA 4ZO9A 1CUUA 5CB4B 2NZXA 2OOSA 3AT1A 3E6AA 3HY3A 4MZXA 4XYLA 4A82A 4FFVA 1SKAA 1TXGA 4UBOA 3BGIA 2VO1A 1Y5RA 1VP3A 2V7VA 3ND9A 4CMKA 2L2QA 4WY2A 2BCGY 3WDSA 3SLGA 1H2EA 3X2SA 1JV2B 3A6FA 2FXIA 4WKNA 4QGFA 5FPQA 3LYAA 1SU7A 4IV8A 5HWSA 1JFTA 2WKSA 2F1RA 1TA4A 4N82A 4OHVA 2KS6A 4GUDA 3UA4A 4YDSA 5JSHA 4BPVA 2Y1FA 4FUQA 2NPOA 1SELA 4QEKA 4AM8A 1SHLA 2BE9A 2V7QD 4A0FA 1LI5A 4KPFC 3KZXA 1P4GA 4LV5B 4QPZA 3GARA 5TNXA 3UYLA 4PLTA 1W88A 2YRWA 5BQ5A 5J94A 1N9GA 1J00A 1ID1A 2XZPA 5K9ZA 4B84A 3NLLA 1L3BA 1N32B 1SHZA 4OQZA 1DU4A 2OG2A 1RWNA 2WM2A 3U39A 4Z49A 1XDUA 5LOVF 1COZA 1EH5A 2D62A 1Q44A 3B9QA 3R24A 4WZAE 4CQMB 1XMXA 1NDQA 2RGRA 1HI9A 2AFIE 3DV2A 5FTJA 3N2ZB 4MV1A 1GPH1 1XVUA 4W7HA 4MQ5A 5JMOA 2VLBA 1PCIA 1UPFA 1JQAA 1LJUA 3RRYA 1E59A 4UAJA 4S1OA 3TFWA 4DEXA 3CVWA 4DYHA 4BQIA 4GICA 4JENA 1SP4B 3B52X 3EAFA 2VHTA 3ZUPA 4D81A 2ZE5A 2QTVA 1GXSA 4GPD1 5AHOA 5TF0A 5T4HA 3A1VA 2GCNA 1BCRB 1SXJC 2HK9A 4OJYA 2JL1A 4M89A 3WLRA 3N70A 1F3LA 4EVQA 5I7EA 3H99A 4C1NA 1JX6A 5TT1A 2H17A 2PZLA 3W6OA 2SECE 1GG9A 1SR8A 2QSZA 3OQMA 3P2JA 1HEYA 1OKKA 1UT8A 4EY3A 1K7XB 2VK4A 2EQBA 1NT4A 2Z0MA 1F20A 2IHTA 2PZGA 2GN8A 2GSDA 4MI9A 4KH0A 3DO8A 5HKBA 1G3UA 1VBNA 3CO5A 4XVCA 4U8HA 4G3XA 1FFWA 1ZH8A 1WKCA 1AUQA 1NATA 4LOKA 2Z5FA 2V7QA 4XJVA 2Z1MA 4WXPA 3M89A 2C29D 1W4CA 1XKGA 3OX4A 3K0EA 3UJ6A 2ZIFA 3W31A 1J2EA 1X6VA 2FPIA 3D7SA 5FHQA 4ARZB 4ZI6A 4EDFA 3C3WA 3QUAA 5IVDA 4MS3A 2H5LA 2ZRKA 2ZROA 3H2HA 3EOBI 3VTFA 1JR2A 4CDMA 2XWBF 4BCBA 5IT0A 4KUGA 3Q2OA 3WA7A 1P1FA 2OBBA 1GAQA 4MUXA 1U9IA 1IPHA 2Q6VA 3H8JA 1RZRA 2JIDA 4WOJA 3KCQA 1N0IA 1N2ZA 2VHUA 5JARA 7MHTA 5BMVB 4H16A 1CQIB 3RYHB 5CFQA 4Z9FA 2AN4A 3HCBA 4TGLA 1NBWB 2QX7A 4R1OA 2ZUSA 2F8TA 1UK9A 4WZ6A 1WZIA 2P9BA 2O0MA 3LUBA 2CNKA 3SQWA 1WU8A 1N2SA 2IHBA 1LTQA 221PA 4MRNA 4LRWA 4NJMA 1RP7A 1L7MA 1QIGA 3SSMA 4DAEA 3AP2A 3EQ2A 5JLAA 5BWNA 3K5PA 3BH0A 4PLCA 5DVZA 1SD2A 3O26A 1U3UA 1C0PA 2OEPA 5KYGA 3PKIA 4U2FA 2VAXA 4Z0TA 1WR8A 1Y9AA 5TPWB 2D0OB 1FZTA 5JAZA 1M2OB 3PP8A 3RGGA 4F2PA 1E0SA 5DLQC 2PRYA 1Q0LA 1S4QA 3PEIA 2W11A 1Z75A 4ZIRB 4FW9A 4ASUD 1ULBA 1BGOA 3MK31 5KI6A 1UKVY 4MGZR 3N75A 3HDGA 1D5CA 4PV7A 2PVSA 3JZDA 3DAOA 3LX8A 2ZWVA 1NQXA 1W2GA 1YZHA 2G5TA 5TXGA 3ZVRA 1EVJA 3ZDAA 2W6MA 3DG9A 1ADYA 4J7AA 4KG7A 3I2JA 3QSGA 2O8EB 5FSXA 3IOMA 3VPCA 4DRYA 3OCVA 1FDUA 1TAHA 1E3JA 4AROA 1T43A 1SPVA 1DUVG 4YREA 2O2HA 3WE7A 1QIMA 2PADA 2CYCA 3NVKI 2ZFUA 3E0QA 4IAOA 3T54A 4KXVA 4ZRMA 3STWA 4DLVA 2GJ4A 5KJEA 3KETA 2NV6A 1RHKA 4MJLA 1ORIA 2EEZA 2ZCVA 4PU0A 3H1BA 3LO8A 5FNVB 2QTZA 5JCZA 3RWOA 4PFJA 1Q92A 4GVLA 3ZHQA 2AG1A 4L9RA 2WR8A 3RAEC 4GU5A 2WJWA 4IY1A 1M5RA 4X7RA 3WMGA 1IN1A 1JG3A 1ZW1A 2Z56A 1A3CA 5DT2A 3DPIA 3IHKA 4DCJA 2WMYA 2ZRPA 1CUIA 3GFSA 4NJOA 4QXRA 4CNQA 2NZWA 3CRZA 2P86A 2B98A 1GKLA 3FDFA 4MPPA 4EB0A 1IBLB 2DCDA 1YAHA 4JXZA 1QGUB 2J0UB 3O75A 3O9ZA 3EF1A 1OH7A 1O5IA 1FDSA 4JB2A 4LZAA 1O8BA 1R10A 3MGAA 3HY6A 4JEUA 3SMVA 1G6KA 1BRMA 1JZTA 1VMKA 2PGIA 3WWOA 4UQLA 3CPEA 4IPTA 4CKZA 1O97C 2ONKA 5K51A 3CLRD 2Z4SA 1EFAA 1JHRA 2RFLA 2VAWA 3AEKA 2OXIA 5JNSA 3OECA 4LRUA 4RANA 1NZJA 3RF7A 4DNXA 1PEKE 2VEDA 2KYRA 1MAAA 3CUSA 2AN3A 3GBPA 2YHUA 4K05A 4LHSA 3RVSA 5DASA 5L53A 4YCNA 3KSAC 2OP3A 3I4LA 1IB6A 4HLNA 1EJ0A 4AMZA 5B64A 1TMOA 1DFGA 4H7IA 2DC8A 2Q7OE 4C08A 1XR3A 4EKDA 1JA1A 4XA8A 4YBRA 5LP6B 3TOZA 2JDID 3NTXA 3W34A 1CQZA 5AW8A 3E3OA 2ODNA 1Y8RA 2IW1A 4HH1A 1WY7A 4QGGA 2BH9A 1E58A 2I2XB 4MVJM 4UMFA 4UVDA 3WLQA 2XYPA 2W6JA 5IT9A 2JCGA 4JL5A 4Q3EA 3RYIA 5CLIA 3NBQA 1IZYA 1R6BX 4GR4A 4YCCA 1Z18A 2WFLB 2CBGA 4R16A 4GX2A 5JAOA 2WUWE 1OWOA 3LC7O 1QVVA 5HS6A 3TPCA 1BXRA 1IONA 4ZV7A 1L5HB 4UE2A 3K73O 2BM9A 3WWPA 4XQ9A 4AUKA 2BDEA 1Q57A 3ETGA 1RCFA 4BJ3A 2PFSA 4CLOB 3GP8A 1GGKA 3QWHA 4Q21A 2HF8A 3FHCB 2DCCA 2NWQA 3MFQA 3GRFA 4YMWA 2WC1A 2XXAB 4OQNA 2BBSA 4UNQA 2DEUA 4RF2A 2O07A 2OCLA 4KQMA 4E4YA 2HNKA 3HJAA 3PQ7A 3OJEA 4ZJZA 4JVOA 1I2MA 1Z0FA 4AC9A 3B12A 1CR1A 2VEOA 3NPAA 1VJ1A 1WPXA 4MZDA 3B7GA 1ZWLA 1BU5A 4GOOD 4QPJC 4U2KA 3OJCA 1BMQA 1R6XA 2OR3A 3FDIA 3GCWA 5CITA 2QLJA 4UE3S 5EVCA 4FR5A 2KE5A 3GL9A 4US2R 2YBEA 1J42A 4TLDA 4K6KA 3SYMA 1FLNA 4X1OA 3W9YA 2IPXA 1VM6A 5F4ZA 1NZDA 1OE0A 1UR5A 4RXTA 4BO0A 4COOA 4H27A 3UMRA 3G8BA 4BLTA 1J9GA 1TEXA 1VJTA 4Z4GA 1XRMA 4F4UA 1L5OA 1YRHA 2VKQA 3I01A 4K8RB 4D44A 8OHMA 3L07A 3O4IA 3RVNA 4C0WA 1C3OA 4BASA 1V1RB 1P1CA 4M98A 3W6NA 2XD4A 1JBQA 3M3PA 3W9SA 1RTTA 2RH9B 4OIMA 1XCLA 4UUBA 1B8OA 5IZCA 3I05A 1FX0B 2EP7A 4J1NA 5AVKA 4AY5A 2WU1A 1T15A 1SK9A 1TT5A 1DT3A 2W6QA 4ZODA 1Y1QA 2IUUA 2BGGA 3SQOA 2VP9A 3O4VA 3QU5A 2DU8A 1VRVA 4AX8A 5EIWA 4QOGA 2JLBA 1DX9A 3PDJA 4RY2A 5H82A 4EG5A 5BV8A 1G19A 3SEAA 5CVUA 3I04M 5DYNA 4IXNA 1AF7A 4XDGA 1OXUA 1D2AA 3IIJA 3O3NB 4HYEA 4DLBA 3G49A 1MB0A 1ECGA 2IODA 1PT9A 2HK7A 4H1UA 4JU8A 5HUHA 3P4YA 4WACA 3KK0A 3DTTA 1PJAA 2GASA 4NYJQ 4OHCA 2XJ9A 5G41A 1CDEA 4IKEA 5L7TA 3BYZA 4RWEA 1G38A 4HN9A 2VSFA 3H8EA 3DLIA 4FFDA 2PE5A 4BS6A 5I8PA 2D59A 2VDLB 4I07A 5JD4A 3R6GA 2P9QA 4G0UA 4DLYA 1ZA2A 3HB5X 3UM9A 2E1PA 1E18A 4IHJF 1VSBA 2FEXA 5FPHA 2XXBA 4IMPA 5JISA 5AI0A 1CY0A 2ATEA 8PCHA 4JSYA 3WR5A 1IM2A 3IMEA 1M0WA 3OD5A 5DCYA 2ZJZA 3V2UA 2A1IA 1E2PA 1TQ8A 2IKQA 4I1SA 4XR9A 1YVUA 1SVUA 3GLHB 4E1AA 1V25A 5DDIP 3H11B 3CU5A 1WPQA 1MX9A 2Q4EA 3K32A 4HNAB 2HQOA 1NXVA 4BLUA 5CG2A 5C4MA 4NSNA 1QYWA 2CUTA 1PPDA 4WLVA 1RD4A 3UB3A 6REQB 1Q22A 1V0JA 3C45A 3L7LA 4MGIR 5E4TA 5FOXA 2BMJA 4HAVA 4ZDIA 5JANA 5KOYA 3GPCA 2JQFR 2YIVX 5JAPA 3Q7IA 2B0CA 4RFVA 3RS4A 2WIKA 1EDZA 3K6JA 2PS1A 3IVCA 3RAGA 5IK2A 3S29A 3WJ2A 1GQOA 2O06A 5AQ1A 2HD5A 1HY3A 2GK4A 1CT9A 3IMCA 4PO9A 3NM4A 5IYZA 2C4UA 2PSFA 1DJNA 3X3HA 1GIAA 1RE1A 3R41A 4I4IA 5KINB 3KB2A 2VXYA 1JEQA 4X00A 3VTAA 2I2DA 5DO9A 2JRCA 4U5XA 2XMZA 5AK3A 1E5DA 5B1SA 4YJGB 1ATKA 4M0FA 4Q0MA 4OREX 3ASUA 4BOYA 4D5GA 1JJBA 3WRYC 4MV5A 1KQOA 5EUCA 1EFUA 5CEEA 1JDTA 1P2TA 3JQAA 2AEEA 1E1DA 3BRWD 4R41A 1VLHA 2WDPA 4LIPD 2AH5A 3IS3A 3BGOS 1SC9A 5B3JC 4CEJA 2VF8A 4RA6A 3T35A 3OLXA 1G291 2AW5A 1G8HA 1R4ZA 2AT1A 4BLSA 3V9PA 2FUG6 2DWQA 1T26A 1WF3A 2DKOA 1WE2A 3O6VA 2B9VA 3QZUA 1SD1A 4KGDA 3WMFA 3EWQA 1Z2CA 2IYWA 3IDFA 4HQNA 4LGMA 3LFYA 1MMFB 3CEAA 2FB9A 2GX6A 2VRBA 1EUDB 4RDCA 4JLMA 3DE6X 2CLCX 1HT0A 1XV5A 1K9VF 1EM8B 1LAMA 1ND6A 1N5LA 4Q4LA 2WJGA 4QVGA 4UD2A 4Q47A 5K99A 2IXBA 2VHCA 4K86A 3GJ8A 4M1ZA 2JKVA 3MN1A 1E1MA 5CDHA 2CXSA 1V96A 4BVEA 2HJRA 4WFJA 2HH9A 2HH5A 3OJLA 4JK3A 4MQMA 4EELA 1PBHA 1SCUA 1PGPA 1LS6A 4J7UA 3N5KA 4J90A 1J8DA 4O4HF 1RAGA 4C4XA 2P6PA 3M3HA 4KN5A 3TOVA 3GVPA 1FJXA 1E92A 5DBIA 3GEMA 3OLQA 5ERGB 4QWWA 2PQ0A 3V4SA 2OC4A 1V95A 4O6VA 2C4NA 4W5HA 4RTPA 2GF0A 3IKMB 4I2VA 4BX2A 2A57A 2ECKA 1P6UA 2ZE8A 1M5TA 3CJRA 3PQ5A 1LW7A 4UEOA 3WLFA 1TZ2A 3M2TA 2QVXX 2TMYA 3NIFB 3JATA 3EDQA 3FZEA 4UD6A 3SIXA 1PFVA 4IQ4A 1G9SA 4XGRA 1FTSA 2P3SA 4XLLA 5JROA 4H6XA 4O0LA 4FMCB 4RAQA 1QIKA 2ZB2A 1ZH4A 1ZOIA 3S8EA 4N48A 3N39C 1ISMA 1Q3KA 1OILA 1T8SA 3PXCX 4I1VA 1CF4A 1MB3A 4O8ZA 4G0NA 4HQOA 1X70A 3U0BA 3QRWA 3ZXXA 4TKUB 5CJ2A 4G0WA 3H2BA 2EJTA 1ZGGA 4JWTA 4GMXA 2B34A 5LLSA 4KO8A 3G3EA 1U2QA 1PVDA 1SZDA 2PX5A 2PZJA 3C3JA 2WF8A 3OIUA 1YHNA 3NIGB 3E27A 4RVUA 4BE4A 4XOIA 5K01A 3AL3A 3ZLBA 2QLBA 4GMHA 4F8EA 4DKXA 1A9PA 3H6SA 2AE1A 5LQUA 3GLGB 1PK9A 3A9VA 3SSNA 2RGBA 4YRGA 1KJ8A 1XZLA 2V0GA 1P29A 3CKMA 1F4PA 4EUKA 2ECOA 2YQZA 3AFNA 1Q0SA 1PUIA 1UBTS 3OQNA 5CT8A 1DKQA 3CZ4A 2FRXA 2N9UA 1QDLB 5AHXA 1QUEA 2XZDA 4KPEC 3P0EA 5J63A 1NLUA 2N75A 1KYZA 1SUEA 5CT6A 1A8QA 4QARA 1N4AA 3VX3A 3K0AA 3QX8A 4H08A 1NB3A 3R4VA 1AMNA 3NALA 3STXA 3OMXA 4G0PA 4K6GA 4YQZA 3DQQA 4ZKEA 1KXRA 2GEBA 3ZWYA 5DM60 1K63A 1E6CA 3L84A 3ASZA 4K1LA 1J2UA 4BNKA 3OZRA 1E4VA 1N3BA 4ZT2A 2QGZA 2V7UA 3FTQA 4PYKA 4C4RA 4MHOA 4EF4A 5LL6P 3HJRA 4ALIA 4P1ZA 2QYTA 3C9EA 2BTOA 4R0NA 2QMZA 4QM7A 1KU0A 2Z3WA 2E03A 4EUFA 5KCMA 4WBXC 2H08A 3OOHA 3OO0A 4M1SA 3DXFA 4M6WB 4AS2A 1JH8A 1H6AA 2BHSA 3H65A 3JYPA 3OEEA 5CB5A 3SP1A 3FGOA 2Z2JA 5I8ZA 1E2FA 3WOHA 4FZ5A 2BCEA 4XQCA 3DLAA 3BC3A 4RHEA 3WJAA 2CXTA 4XD7D 4NENA 2G5PA 4L4SA 4RFSB 2V3CC 2EF1A 4UHJA 9ATCA 3VU0A 2JLRA 1Q0UA 4TVKA 3BY4A 2GF9A 4RZUA 3QA3E 2VUSA 3NCHA 3NIWA 3AEQB 4X20B 3N2LA 3J7TA 3KAKA 1TM2A 4JLNA 4XJXA 4JJIA 4EFLA 5IJ0A 1BJKA 3MHHA 2YTZA 4ZTZB 3STTA 1U3FA 1WL8A 3IAFA 4Q16A 1RADA 4WAUA 4R84A 4CV1A 1G8AA 4EW3A 2L69A 1BH2A 2E0IA 2H4HA 3RYFA 5FDFA 2I4MA 5FTMA 1M7GA 2VNKA 1P4RA 2W2PA 1AKEA 3QQ5A 2CFCA 2G1UA 2HBZA 4RGVA 5BSRA 2IEDA 3FLEA 1M34A 3A2KA 5T7BA 4QZVA 4U6NA 4V0NA 1U4SA 3O8NA 4AT1A 4Y6SA 2FSUA 3SFZA 1LDGA 3BCRA 4C9BA 4CI0B 5BORA 1YZFA 5HSGA 1UFKA 1M2KA 4AKIA 1K5HA 1E2DA 1PG0A 2OLEA 4MUIA 5AKYA 1KFXL 3WZ2A 3W5IA 1XDSA 3OKFA 2PUCA 3E7WA 3P9PA 3S55A 3VDXA 3RRBA 1RQLA 1N3LA 3TTXA 4B9AA 5KVVA 1TPZA 2G4LA 3AERB 1PT8A 5JJBA 3DPUA 4ND1A 5DNDA 3ZCQA 3SI7A 2LIVA 4I81A 4EPYA 1KNQA 4FYJA 3TLKA 2EG9A 3ZWQA 2CD7A 1JYFA 2C2GA 3WMRA 4GW3A 3QLUA 4P22A 2P3QA 1PI3A 2BTQA 4HHEA 1SG0A 1T3SA 1C3VA 1FRZA 1GPBA 1C7JA 2VBCA 1QH9A 4G23A 4JITA 5DHUA 1U8ZA 5AQEA 4I3HA 4CKWB 4RF5A 2DH6A 4DARA 1EFKA 3EWIA 4MW9A 1VCOA 4JLVA 2G7YA 4V0QA 4JMPA 4F60A 2ZYSA 3HSSA 2INGX 3OIDA 2ZPUA 4BHTA 2G4CA 2DKFA 2FP4A 2HSGA 4V0ME 2XA2A 3EY9A 5AKXA 1UBLS 3WRXC 3T9AA 3D4NA 4H4EA 1PEDA 4NKRA 4IQFA 2ES4A 2BDTA 5JIBA 2ZW9A 1OT3A 3COYA 3NKLA 2HM7A 1GGNA 3GQBB 4ONEA 1QTRA 4W5CA 1T9CA 2LDXA 5BUQA 3B3FA 4HDMB 2ZZNA 1ZRSA 4X24A 4F0JA 6PADA 4DNOA 3VOTA 3VR4H 1EJBA 2FEOA 1AMUA 4FWTA 3EQ8A 4BLWA 4BWGA 1JAZA 2O8BB 4IFTA 5NULA 1K08A 1XSEA 2H4WA 2FWMX 3W5JA 2KM1A 4G5FA 5TSDA 5I3ZA 3AI7A 4JJZA 4AICA 4BPBA 1U9XA 2ARYA 2QX8A 4L3WA 1E60A 1R4MB 1A2QA 4IIDA 4FFMA 5FEUA 4OMDA 3TJZA 4DJDC 2WPDA 1XMIA 1EGHA 2B99A 1GNTA 2OGWA 121PA 1VIAA 1RMYA 4MIEA 4PRKA 1ZCMA 1PUXA 3W1EA 3JYNA 2Y5BA 1ZX1A 4ZDWA 3U56A 3R77A 1PQWA 1MO6A 1LLCA 1SXJD 1QAMA 1D2NA 1SH7A 4FONA 3U4QB 4OQPA 4RK0A 4FNOA 1H4QA 4XQEA 4N8DA 1FPMA 2Q2VA 5AKZA 2JQGR 4C7XA 5BWBA 3LPLA 1B4DA 1U0SY 2HF2A 4DZTA 5MHTA 2BUBA 3ZCSA 4Q66C 4TS1A 1IXRC 4WXYB 4NBLA 3P32A 3W05A 2R6DA 3R5FA 1AS2A 3ERCA 2IP1A 2QIPA 3BB4A 1RFLA 2ZI9A 5A5FA 5SYMA 1YBFA 3JALA 4MVJH 4Y1RB 5LR6A 5JSQA 1AD2A 3MLAA 4KP7A 2DPHA 5J5AA 3G0BA 5JNLA 4YROA 4AS1A 1R8YA 3KJEA 1W1WA 1YGYA 2NT4A 1F60A 2I6TA 1UMCA 3V00A 1DWQA 5DWQA 5B7QA 2JC3A 1UPUA 2WJ4A 3IP1A 1I5OA 1VG9B 2ZWPA 2R8RA 3PJRA 2QZ9A 1ILEA 2JCYA 2XTMA 2JEOA 3WKDA 1C1HA 4KACA 4ZANA 4AY3A 3NWBA 3UO8B 4E3WA 1K27A 4EGJA 5I48A 3B8HA 1OXKB 2I4OA 1SCJA 2YW9A 1KKUA 3IQGX 3P2OA 4LI3X 1RRCA 3CMMA 2CHFA 4ZC1A 4KO2S 4J5RA 3KO8A 1N0VC 4P0QB 4LJYA 2IUSA 1M6NA 4MP3A 1ZG3A 3ITEA 3VC1A 1VCIA 4Y2HA 4U7TB 5HP4A 1F2TB 2D6FA 1J0CA 3F9IA 3LHDA 5D2CA 3B6EA 3RC1A 4PN7A 3DF9A 4B48A 3UMCA 1D0IA 2Q07A 3FOZA 1WXGA 3AB8A 3GLSA 3P5SA 4MVJF 2BZ1A 3IO3A 1KMMA 1ZL0A 2E48A 5CVEA 1HKUA 4CF6A 3EUAA 4DJAA 3V1UA 3BZUA 1FFXA 3IUYA 2GT1A 3SZOA 2M1XA 2JLVA 3VZRA 3OT5A 1LLDA 4CCSA 1WXEA 4FMDB 4M37A 4EAAA 4OB6A 3ISJA 3GNLA 2BOVA 4ZOEA 4BQFA 1WM1A 4KXMA 4YRNA 1IH8A 3ZE7A 4FFBA 3TVTA 4DLKA 4O4JF 2P91A 4LVOA 1I0IA 1LWNA 1EBFA 3K5IA 3GI1A 6GPBA 2P4EA 2NXCA 2WJAA 1FOEB 3FHJA 4HUQB 1KJWA 3EMKA 3F8TA 3I9MA 2A0XA 1ZINA 4XEUA 1ISSA 2LD4A 4HXFB 4NNOA 5HVNA 4LSZA 3IPCA 4RDIA 1YRAA 1WB9A 4XVHA 4ZYTA 4G9GA 1EFRD 2F1IA 3WLSA 3D0RA 4D4MA 5FAKA 1V6AA 4L4RA 4UJ5A 5KDOA 1AKUA 3ADKA 2L19A 1CXZA 1HF3A 4F2DA 3OUZA 3VKWA 3DF0A 4WZBA 2AUMA 3GJ5A 2CCGA 2W43A 4Y6PA 2D8AA 4J16C 4LXHA 2GHQA 3R6WA 4C88A 3ED1A 4UHEA 1QGOA 3A8TA 1AU3A 3TZ6A 4LAFA 3PD0A 1QNFA 4OAPA 1QHYA 3S2ZA 5IHPA 1O6GA 1PL8A 1UQRA 5IVHA 4JCAA 5HOLA 4K9SA 4Y6QA 3AC0A 1IEWA 1YQDA 1O96B 3IESA 3NX4A 4B3BA 5ALHA 1KYYA 5JRDS 1VYTA 1XNRB 5CFRA 1W9MA 3P27A 4MP6A 1CQPA 4I9HA 1GZ7A 4ND5A 1FLDA 4QDZA 4KAAA 5EP1A 3EX7C 3ZU3A 1OSNA 2XMCA 3VR6D 2PXCA 3E8MA 4RIEA 3O4GA 2H1FA 4J1TC 2YRFA 1QBGA 3WQQA 4C0JA 1IY2A 1JN0A 1XTPA 5L3ZA 4IVPA 2HCRA 1K89A 3GXOA 2EJCA 1F0NA 4JHLA 1SOWA 3LQ1A 5IFLA 2ZS9A 2A0KA 3IDAA 5JW6A 3PHXA 1XZAA 2XHZA 3F7TA 5CFMA 1CZLA 2Z83A 4U7FA 4KBGA 4NZMA 3NXSA 4I1RA 3FBTA 4CDRA 3P0RA 5H4HA 1T4BA 3ZBUA 3FE2A 3DNPA 1QWSA 3L7YA 1AKNA 1Y1LA 1SJ9A 2VK8A 3W8EA 2I9KA 4C4TA 2YJTD 4LPKA 1LDEA 3VDQA 3WXMA 4WCVA 1L4YA 1NXOA 2GZRA 2OVBA 4HGPA 5DLYA 4M9XA 1ZN2A 4A6PA 1UBKS 1GEGA 1JQPA 1ZVVA 3DZCA 2O1SA 2RHLA 3AGQA 3GG9A 8ADHA 4Y2XA 5DEOA 1ZIOA 4EYGA 2FHSA 4FNMA 4CGYA 2E4VA 2O7QA 4XUEA 3G23A 5BMVF 1E6UA 1MHWA 5BRAA 3PUKA 1MJNA 3FFWA 3L92A 2I6GA 2VDNB 4E22A 4FFLA 4BN0A 4W9RA 1TCVA 4GP7A 2UVPB 4DLZA 4OH7A 4ALMA 3KOUA 3OZUA 4FCTA 3OZIA 2VAVA 4MWDA 4N8SA 2WE7A 1FDWA 5D00A 2EL9A 4KSYA 1CR6A 1F2UA 1OBVA 3LYLA 3N8GA 1ESMA 3TOXA 3V5NA 1KERA 3LGAA 3MOGA 2F17A 4YRIA 5JXHA 2I4TA 1ME4A 1EUCB 1E8DA 3LT2A 4I55B 2P1ZA 3IKVA 2YN0A 1HTBA 3EVTA 2EEEA 2BMDA 3IAEA 4ENUA 1U3DA 1QJCA 2VA9A 4TSFD 1CRWG 2XQIA 1KDZA 2NSYA 2JCXA 3HPRA 1RMQA 3AY7A 3BWYA 4I36A 4NECA 2IBSA 1CF9A 2R7LA 1F2BA 4BU1A 5ADVA 1PO7A 1RHMA 1NVMB 3C3MA 1MEOA 1DAEA 3A1CA 6AT1A 1A97A 1DBRA 1OU0A 2QVLA 2Y1XA 4RHYA 4Y67A 1CUWA 4US0R 4WTOA 4ER6A 1Z4QA 2H7JA 4WZAB 4RMNA 2M6LA 2NUPB 1TW3A 1EAMA 5AJYA 2HA7A 3RV3A 4Z51A 1GPLA 4RL4A 1A98A 1N8TA 1QOZA 1UP7A 2QN6A 2IK8A 2WWRA 2Y2UA 4GNRA 4X5OA 5TR9A 4KLZA 4MPTA 3AUKA 1EZZA 1DV1A 4QT4A 5JZMA 1IG0A 2Y0CA 3Q9LA 5K6RA 1PNRA 2QVYX 2EFYA 3RFUA 3ZWPA 4J0JA 1XLVA 2ISSD 3O3OB 2B82A 4GP6A 4MKXA 3N58A 1NVVR 2WWTA 2VDWA 1U7ZA 3OP1A 4E4TA 4GVWA 5HFAA 2HO5A 5CNIA 1PBTA 4TZKA 2CVQA 3QKWA 4JFRA 4MYTA 3VPSA 2WM8A 3CG4A 4AU1A 5C8VA 3O9VA 5HKKA 3E2PA 3IALA 2C97A 3L7AA 3JZMA 1E7MA 1COWD 4GZ3A 1TJNA 2LGJA 3HKDA 4GFDA 1ZMTA 3OPQA 3P96A 3SIHA 3PYXA 1BTOA 3JRWA 3P2MA 3U62A 3WYDA 3OT1B 5FQOA 3U60B 3ZVNA 3THWA 1QMGA 1M0SA 3CR8A 5I8WA 3ET5A 3H6KA 1I0ZA 1V41E 3G6WA 2IIBA 3WLJA 4IIXA 3BGDA 3JWHA 5AW9A 3M6IA 4YMHA 3T38A 4CUZA 1KIMA 4P5EA 1Q2XA 1HTWA 2YL2A 4WKGA 4JC8A 4IDNA 5LN1A 2DC9A 4PPNA 1PX0A 5KHOC 3EVBA 5ENDA 1N1EA 3SMQA 4NG4A 3QH4A 1NONA 1J0AA 3GLTA 3IB3A 3PEVA 4OHFA 2R1UA 4YTEA 1A71A 1IM8A 1EU1A 2BEVB 2G7ZA 1RC0A 4RCYA 5A5GA 5JEDA 4UMDA 2X6QA 2RHBA 3L4BC 1Z74A 1OR8A 3N59A 4JYBA 4M9RA 4YJ3B 5E9QA 3E48A 4NXMB 2WAOA 3BXHA 5KO2A 4DRXA 4GEGA 1PR4A 2RHHA 4B32A 2OO5A 2H2WA 2PUAA 4EGSA 1MC5A 4FZJA 5HRUA 1JDSA 1JHDA 1U3WA 2GNPA 3F3KA 3JPWA 1ZESA 4GVPA 3KBOA 3F6SA 4WK2B 3QKSB 1D6SA 2QPTA 4IOKA 3WMEA 4QUEA 2PQ2A 3NHBA 5TB5A 5G0TA 1YRWA 2P9CA 2UVQA 2XR1A 5FBKA 1AQLA 3KPUA 2WBFX 2QUHA 1EA5A 4B4KA 2MCFA 1DTWB 3UKDA 1ZHFA 3JQDA 3VAYA 4EI8A 1KMHB 1XDBA 3N6XA 1Z13A 1V26A 4MAFA 3R0IA 5AI5A 2DQSA 5AXAA 4LYJA 1KVUA 3D3KA 2HHNA 3Q3VA 4XYBA 4UBJA 3ZNOA 1LFAA 3NDIA 3SIRA 1MH9A 2BFAA 2ZYHA 1KI9A 2ABWA 2ST1A 1EK1A 1JQKA 3HDYA 4DJFC 5CH3A 1NNSA 2JZFA 5F7JA 1JBKA 3TAHA 3UJCA 4AJ2A 2PKRA 2PWBA 1TF5A 2Q1SA 2JJQA 2XIQA 3A1NA 2YZNA 1ZM7A 2H85A 3HYCA 4HD8A 5IYZF 3QLEA 3RUFA 4M3NA 3UF0A 4DSOA 4ETWA 2AJLI 2ODQA 4KFSA 5H02A 3BAZA 4ZOBA 3OE1A 1YF3A 2AS8A 1IRIA 2PBRA 2VS1A 5F9MA 2AZTA 1I3OA 1NT2A 1S01A 3VYSB 3O7MA 4ND6A 4FYXA 5AJXA 1NOKA 3EJ6A 5HEKA 1G3MA 1U0RA 2JBWA 2UYQA 1N3IA 3DT8A 5EERA 3PSHA 1TAGA 5J1SB 1VI6A 3D3JA 3PQ2A 5IDQA 2H3EA 1J70A 1ZRHA 3COJA 3W4KA 2Q6TA 2CIOA 2IEIA 1K86A 2QA5A 2QOEA 4D4KA 1CD5A 1JS1X 2YDXA 2EP5A 4Z3OA 3FR8A 3Q1KA 4RVHA 3PRMA 1G64A 2VP5A 4N7JA 1H22A 3DHYA 3IP9A 1V7QA 2Y68A 2ZSHA 3STHA 3U3DA 4QQ8A 2ORVA 1E79A 3DE0X 5U9CA 3ZIDA 1PRYA 4ZMBA 1BPNA 2QU7A 1TYCA 4YYSA 2IZZA 4HG2A 4WN3A 1PN3A 4ZVNA 4YRJA 3RYTC 4GXRA 1KS2A 4GPZA 4CMEC 3G9TA 3U44B 2G1JA 4D9IA 1QH8B 4XWAA 1PNTA 4UHDA 5CLLA 5T8KA 4YCBA 4FDTA 5J1TB 1E3WB 1YJAA 2RGGA 4H1WA 5SZJA 4MOWA 2WVAA 3NVDA 3PWSA 4LF9B 2J48A 1BW9A 4G8JA 4FE7A 4NCKA 3COPA 2V7BA 3B13B 3EJWA 2HR1A 2FEWB 4YR7A 2H57A 1T9AA 1YMQA 4P4LA 4QOJA 1QRSA 3Q72A 1XCPA 2I33A 3FYDA 4DV3B 1YK8A 2ZTSA 2BFQA 5DTEA 1OI4A 1CJBA 1DXQA 3DZHA 1DCMA 2FW6A 1L5KA 1RHRA 5T57A 1KSFX 3VSAA 5I6DA 4Z4IA 2O2XA 4YYWA 3G0DA 1PLLA 2EW8A 2XYRA 5CX1B 3H97A 2PJUA 4BNXA 4BMNA 1FYDA 4PZLA 5HQTA 1FSFA 2CJFA 2GN6A 4O4LB 2I9PA 1ZCZA 2FQWA 2GILA 4IWXA 3ZHZA 4W5RA 4Q9LA 4RD6A 4JJFA 3W5UA 2X5OA 1RC1A 5ENVA 1WG8A 2P41A 1Z2NX 3PJFA 2CD9A 4HN4B 1RCTE 4TL6A 5M2QA 4X65B 1DKPA 2JZNA 4O3MA 1FPQA 3K6SA 1JQ5A 4XLTA 1AIMA 2Q5OA 4JT8A 4JLPA 4L07A 1VKZA 2I80A 1IY9A 3CG0A 3ZGXA 1FVXA 1XP8A 3G8CA 2CMHA 3UGTA 2WHQA 3RQSA 3U0VA 5CG1A 2P9GA 2IS6A 3W3AH 3MWDA 1XMJA 1I3MA 3CE9A 3UB2A 4AF6A 4I3FA 4L3VA 4PX3A 3U17A 5KSWB 4TQAA 4XGIA 5J3JA 3HDVA 2B1IA 2XMRA 3AR3A 3ICCA 1JTVA 3HKBB 1F9EA 2AYYA 1M33A 1YWGO 3PFFA 4K6MA 4YP1A 5H81A 3W06A 3ADBA 2FUCA 3DQPA 3H04A 4MJ3A 1ST3A 1ZLYA 3ZE9A 1MXFA 3GLKA 1ZGCA 1RKBA 1GG2A 3QNWA 4H7JA 4HTFA 1JTEA 4KFRA 2BHNA 1XEXB 4HCJA 4E7PA 1K5GA 1Y9DA 3KQOA 5F7XA 1DO2A 3LGSA 4LDZA 2QENA 4M0WA 1OYOA 3HJBA 4O1MA 4U9IS 4B83A 3PT5A 3AB3A 4DLRA 5COAA 4QU5A 4C0LA 3C85A 5EKUA 2XYGA 1DEHA 1FRVA 2FW7A 1SRQA 2P4HX 3EGVA 1BHSA 2GEDA 3HYSA 3I1YA 3LHFA 4MWGA 4RJKA 5BUZA 3PUYA 1Z8NA 3VC2A 1W7AA 3EXEB 1S4VA 1QDEA 3C70A 3FTCA 1X1AA 5ALPA 2ID8A 4IQ0A 1NXPA 3ICOA 2BKEA 3SZMA 2LWIA 1KMNA 3EBLA 1JAYA 3FF4A 3NI2A 3PYLA 3S2YA 1MS6A 3G2LA 4ABTA 3VRHA 1NXTA 2PAFA 3ETIA 1KOJA 3WK9A 5AVYA 1QQTA 2OE2A 5KWJA 1JDNA 2F59A 1DTSA 2J30A 2Q4DA 2NUPA 1J23A 4I50A 5AK0A 2A9VA 5BURA 4HZGA 3C7TA 4KAFA 1UJBA 5JI3E 1QAQA 4AWXA 2I7CA 1P2VA 2G6BA 3A11A 3ZE2B 1ZD9A 1SKUA 4JL6A 2I8AA 2AOTB 4NBUA 4XR4A 1L8OA 2O8NA 4M60A 5D5PA 4BQPA 4CM7A 3PQFA 1DLIA 4GR5A 4WX2B 1SCAA 2RI6A 2VT3A 1CQJB 1OZHA 1EEHA 5K2MA 3JATB 4EA6A 4MKGA 3Q6ZA 1MDWA 1L8XA 4LY6A 1O9HA 4TTRA 5EYPB 5IHXA 5EZ6B 5IM4F 3V2HA 1IDN1 3DF7A 2YXNA 3RVRA 5J4HA 3JQ9C 1GNPA 2I5PO 2AOUB 2DM6A 2FSVC 3I45A 5GPBA 3VZBA 4DXDA 4EG3A 4JI8B 1J8VA 3GHHA 4PQFA 4B73A 3IBFA 3FIJA 3K9CA 4K3VA 1LY1A 3MTNA 2Q1XA 3MB8A 4GX0A 4QHTA 4WZZA 1YMVA 3GIWA 5CCDA 3BWCA 3W77A 3TBFA 4EPXA 3B8EA 4IICA 4DVJA 4MRVA 3EXG1 3EEQA 3C6BA 5JCPA 3AOGA 2QTHA 5GP1A 4DUYB 4A36A 2MYTA 1Y4DE 3I52A 4P92A 2IX3A 1LRKA 2D3WA 3ZHRA 3FJYA 4B31A 2CWWA 3FZNA 1L5ZA 3KU4A 2IVZA 1W8DA 1LWOA 1XTIA 4D3SA 2BELA 2PKYX 1WQ4A 3EGDA 3V8RA 4XFJA 3ILSA 1U0NA 5IXSA 1WKBA 4NZZA 3LV8A 1W73A 4AAYA 4CEJB 1HT2E 1X7GA 4HF7A 2I03A 4JJ8A 1A8UA 1G0NA 1HE4A 4ANFA 1P3JA 1PZEA 2DMRA 2QW8A 2WHPA 3LWBA 3D0KA 4YALA 2P35A 3ED5A 2A86A 3LL7A 4LVUA 1RBYA 3D8BA 5B6JA 3W9BA 1JXQA 5CT5A 1I3CA 3Q9NA 2PYZA 4BU0A 2EBFX 4B17A 4KHPB 2PM8A 1HUCB 5DP2A 2KBFA 5BRJA 1P1HA 4JY7A 1JP7A 3I0ZA 4XTRA 5DWVA 5E1OA 4YP6A 2DQKA 1OFIA 3E70C 4FS3A 3MC1A 1V8DA 5CDTA 1XU7A 2Q6IA 2PZBA 2PN1A 4IJMA 5CMLA 3WQHA 2CVOA 2QQ5A 4M1MA 2PX8A 3RBVA 3UAOA 1M3SA 2JAWA 2QM8A 2ZM6B 1NQAO 3WBJA 1VG0B 4GL2A 1W5TA 2G28A 4UHHA 4P98A 5TQ2A 4WNYA 2VLIA 1V2GA 3AXTA 4M0KA 4PVCA 1QZZA 2MHCA 5AK6A 4ZYXA 2JG3A 2AQKA 2XQKA 1VHWA 4J0GA 3EC7A 1AUPA 1ZOPA 2R47A 3DXYA 3GH3A 4NAHA 2WSIA 3IQIX 3OTQA 4BQNA 4QRVA 3SJAA 2FRVA 2GCGA 5LNK6 1NMSA 5ICFA 3EFOA 2DCAA 1DV2A 4TTTS 4AJ9A 4PNZA 4FHFA 1AMOA 5BV0A 2XB6A 3ADDA 4ZKDA 3DMRA 1EDEA 5EWMA 4JZYA 2C5BA 2GO1A 4N9QA 4CM3A 4UXIA 2CLHB 3EDYA 4KOEC 2DLNA 3W2GA 3I1FA 4R6TA 2Z8YM 3HN2A 3L82B 1UFVA 3M4ZA 1QGDA 3ONNA 1GADO 1ODJA 1YCGA 3PIIA 3ZU2A 5CA0F 2PR7A 1EWTA 4O63O 1QKJA 1MV5A 1NIJA 1UWVA 1ENZA 1Y3FE 2JFUA 2X0RA 3CZAA 3GP3A 1I32A 1XQWA 3PFKA 4KIJA 4M1QA 5FCDA 1M1YA 4EW2A 4Z1MD 3DUFB 3PUHA 3N4CA 4OI4A 1RS0A 2R79A 1DX6A 1I4EB 1BXGA 4YYRA 4YUXA 4M99A 1R9MA 5I47A 3I5AA 1DUIA 4Q7MB 1YR8A 4F3CA 3EVNA 4JB0A 4ZGGA 4MIOA 4LDPA 4Q19A 1LC3A 2FUDA 2O2JA 4PBTA 1ID8A 2Q9AA 5BUSA 5I01A 1KEZA 3FYUB 5AHWA 5K0ZA 1SCBA 2ZE6A 2CLKB 2FKNA 2Z4RA 4L5BA 4Q7JB 2RG1A 1WX1A 5FPPA 3AJAA 4F56A 1TTHA 3EN0A 2FPWA 5BYBA 2ZR0A 1L5WA 4WESA 2AFCA 3VNRA 1N6KA 2QAGB 2ZYTX 3OPYB 4R9VA 4A0SA 5TGDA 5TQ0A 1I13A 1UPBA 1VE3A 1MO3A 2BC9A 1YE3A 4ZK2A 1OASA 3L0SA 4IX9A 4D26A 3AEZA 3PL1A 1HX7A 3JWEA 4YA6A 4MPDA 5C35A 4J4ZA 3OTHA 4GZLA 3QKSA 1ZO8A 1RWQA 2RGCA 2FCRA 5KIAA 2YJ4A 4QBTA 1U0OC 2HFJA 1Y08A 1J7JA 1MPXA 2WUFA 2YUTA 5FV4A 1TM4E 1GRCA 4UQOA 2Z2YA 4DOMA 1FRNA 2ZR7A 2ONZA 3GJRA 1RXEA 4IDAA 2O2GA 1TKRA 5M5BA 2HSJA 4YRMA 3PEYA 1N8SA 2GD1O 2IXGA 3DEKA 3ZWOA 3SSAA 4GPAA 3T0IA 3RT9A 2HTFA 3KTAA 4J94A 1V16A 1SBQA 4BFXA 1P39A 1KYIA 3UUGA 4HQ0A 4JI0B 2AC4A 1VP9A 4EJSC 4BFZA 1UXIA 1V11B 2WFMA 7REQB 2FZEA 3L7MA 3C6KA 5HILA 4PX2A 1NL6A 3IP5A 5IUJC 3FWHA 4Q39A 2GKOA 1EVIA 3EY4A 3AILA 4JGGA 3HCDA 1E3EA 2PZFA 5JH7F 1YVBA 1PR6A 2CYBA 2FOXA 3V8NA 1TLOA 1E9FA 3OG9A 4UDYX 4B4UA 2WUGA 5EJ5A 4J5QA 3GN1A 1FQWA 2XAUA 2B25A 4G1FA 5ISMA 1WDLA 4M36A 1XTSA 1K8RA 2YFYA 2VA8A 5F78A 3TFQA 1Z07A 1P2SA 2EOAA 5DGHA 1NF2A 1YT7A 3NT5A 4C4PA 2B4TO 4TS4A 1VPTA 5MN5A 2AF4C 3RUHA 3HHEA 2A9JA 2GKSA 1BXRB 1ZQ1A 3H16A 4EO7A 4UE6A 4CQLB 3WVNA 2UUCB 4KPGA 1CQDA 4HVAA 4G4SO 5LU9A 3U16A 1YZQA 2WFLA 2EL7A 4RZ2A 1CDOA 3L4EA 4LK3A 1SXJA 3RYIB 1VHDA 4A0QA 5ALEA 1NW7A 3JAWA 1X9YA 4BRUA 3Q11A 4QDJA 2O8BA 1NL3A 1Z5GA 4OW0A 3MHSA 2IE8A 3A7EA 1NY6A 1ETHA 3ZY4A 5G3YA 4FYKA 1Y8RB 1HFJA 2H8KA 2YUIA 5M3BA 4DJEC 3RODA 4WI1A 3I2HA 3AF2A 4LJKA 4JCOA 5LP6A 1YB1A 3BF7A 5L7WA 1FBNA 2NQDB 4LZOA 3OISA 3IKTA 2Z43A 1U9CA 3QY9A 5T3UA 3H5TA 3QV1A 4EYQA 1TUEA 4YRRA 3GGPA 5EWMB 2OO3A 4PGHA 2XNJA 4XVQA 3BSWA 4BVJA 2PYDA 2QV0A 4FKZA 3DO5A 3M9XA 4R7ZA 4TMFA 3G9UA 3JTMA 1KBOA 4TMKA 2ET6A 2XMBA 2DSTA 4TUYA 1VGQA 1KVQA 2COUA 3A1DA 4XCVA 1T10A 5K45A 1YR2A 1Z5WA 2QN3A 3OA2A 4Z4HA 3CONA 3ELYA 3WDKA 2AFVA 3V1NA 1NMQA 2PS0A 4P16A 4Q1DA 2EW2A 1SUSA 5BOSB 3LT1A 4KMMA 1ZEMA 4ACAA 3HBMA 2ZSDA 3H9JA 1NV9A 3U13A 4MS1B 4HMQA 2UVPA 1TM5E 3AFIA 4LYDA 5DE3A 1XJQA 1QQAA 3I06A 4WY5A 1QX3A 1GPYA 5HKAA 4HB0A 4LZPA 1X9HA 4LJ8A 1WWKA 2I3DA 1PW5A 1ICFA 1N5IA 2CMDA 3K35A 4MW7A 1Q20A 3MLEA 4I99A 3AR9A 3T3EA 4NBNA 5LDHA 2WMNB 3MD0A 4N03A 3ZBTA 1O54A 1AO0A 4UAVA 1Y8QB 1CUGA 1UXJA 2H06A 2V3VA 3BIOA 1NAIA 2QG6A 3FAKA 4G09A 4OCZA 4NQZA 4CM8A 1ISIA 1P1BA 5IJ9A 3HO6A 1ECLA 5KKNB 2Q4RA 4JVMA 1DRVA 4HNHA 5BVHA 3RYFB 4V1CA 3FXAA 1AY0A 4NK5A 2P1RA 4W1QA 1UPTA 4YWHA 5FADA 3MSCA 1IY8A 3RUEA 5HUQA 5K3EA 4EF6A 3C15C 2VL7A 1CP2A 4DLXA 4DYDA 1JLLA 2RGNC 3SYNA 2B37A 3M1YA 2B83A 1U2GC 1GZ5A 2CZCA 2QVZX 2ZS8A 3E7FA 4WY8A 5DHTA 5FWXA 5DHSA 2WHEA 1XTQA 1EYZA 3EIOA 3ESBA 4J1SA 1TZMA 4C4YA 4IXWA 3ROMA 3C5WP 3W2EA 4NENB 1G0OA 1UDCA 4F5DA 1G66A 2FMKA 2IHJA 5DH9A 1S89A 1NASA 3ZOKA 5KYTA 2X8JA 5KKAA 2BSQA 3W8RA 3ZH2A 5EXXA 1IJBA 3P97A 1MRNA 5HCNA 2EGGA 1LX6A 3ND8A 2W98A 3OIGA 1BS1A 3E9EA 1Y9JA 1EX6A 4GUAA 4NC9A 4PC3A 4PNPA 3AZQA 3EZ6A 3FNBA 4RD2A 1O95C 3GR6A 5FV7A 2NZJA 3WL8A 2PANA 3A3NA 3LQ4A 2O5CA 5BYAA 5TS2A 1NURA 5BW4A 2EATA 3GPQA 1O94D 4DWJA 3QVVA 2DPLA 1GQRA 2QD5A 4ID9A 4YI3A 2YJCA 1QDUA 4EHFA 3ZV3A 1NBME 5IVIA 4D9EA 1NUTA 3JSXA 2VHXA 3AUSA 3PKZA 4R1NA 4W4TA 4ZVTA 4B40A 4B7AA 4FGJA 1JDJA 2NQGA 3CM0A 4HNGA 5J2TA 3KR9A 4E5MA 5CB8A 2JGLA 2ORIA 1TUBB 4X3PA 4AG6A 4P6EA 1N2JA 3QA9A 5JOQA 2IE0A 2NTNA 2JLXA 3KJZA 2GBFA 4P84A 1GR1A 1JG7A 1KFBB 2ZAIA 4TRJA 3A3PA 1YI0A 4OBBA 3HDQA 3THYA 3AHDA 3FSRA 1LGYA 4I9GA 4I50B 3LK7A 2J6IA 3V7YA 3CH7A 3H17A 3CKKA 2EFEB 1MA3A 4HMOA 4NDAA 4TV8A 4H1HA 1D6MA 1W52X 3FGZA 3N8NA 4OHRA 4DWVA 1TF2A 2F8MA 3X1DA 4CLXA 3UAVA 2WAYA 4IIVA 4OMFG 4TQ9A 3FZQA 1NI4B 4JODA 3EFHA 1JR3D 4HN2A 2WY2D 5A5DA 4DV7B 3K70B 2AZMA 1OROA 2RAUA 5IN4A 3PQ8A 4AF8A 1REQA 4QIHA 1W5FA 4RTQA 3LCVB 3S68A 4DCVA 4LNAA 4C7BA 1PFKA 3OZEA 5F98A 3GJ7A 4LWZA 5AICA 4B1FA 4E5KA 1BCSA 2CLDX 4WK4B 3RGWS 1UBUS 3VO9A 2FMFA 3QX3A 4EITA 1CZUA 2L0XA 1W25A 1RWKA 2FUKA 3UAYA 1YB5A 3OQVA 2I2WA 4KQXA 2XJ4A 5GAJA 4HWSA 3SZ3A 3AFGA 5E3BA 3BXZA 1TMKA 1UMDB 3HRKA 5F5XA 4JV5B 4M49A 3PFCA 3L04A 3GP5A 2RGNA 2QTVB 4UDXX 1YDWA 3K05A 1E2IA 2UZ4A 5GZ6A 3HKBA 5H59A 3GJ3A 4KUHA 3QG1A 4N0QA 1GFZA 4X8OA 2AA3A 3S7ZA 3HBNA 3TW4A 3HR7A 1P1KA 4LQDA 4RK5A 1NF3A 1UAGA 3CUKA 2BFWA 3ROFA 1BRTA 1JXMA 2XXJA 4XM0A 1D2MA 1QG2A 2CL6X 3WO1A 2WU0A 4L6IA 5TX7A 4EMTA 1G55A 4Z54A 3LI2A 3EF0A 1YUNA 3UXHA 1DAOA 3QXJA 3O2JA 2BMEA 4PC7A 3ZQUA 1YQGA 2EIHA 4IUBS 4C29A 4DQLA 1X1SA 4NV0A 4A2WA 1E1NA 1W94A 1EFDN 4BBZA 4ZHQB 1BFDA 2GWRA 4IHJA 3IILA 3ELBA 1QOPB 1U8CB 4RFLA 5FO0A 5CA0B 3G9ZA 3IAHA 5JQGB 5A5EA 5JAHA 2VQFB 2EG5A 3K9MA 3KYCA 4JJGA 1E1QA 1JHAA 2WJHA 1BVYF 3S1LA 4QXQA 3FCYA 1MU0A 4R54A 1CQXA 3H1EA 4L51A 5IBRA 3REFA 3H9EO 4KWHA 2G1KA 4CL3A 5KKCA 4RH1A 5LYJB 4JYZA 2HCBA 1EFVB 3JD3A 3WTCA 4Y7CA 4OI0A 1W48A 1K2VN 2CDNA 4KEAA 1M10A 1UK7A 3PVSA 2X7JA 6PFKA 5LXTA 3GPLA 5C0OE 3ENWA 4FTWA 4H6WA 4E32A 1UBOS 2QTFA 1H2ZA 4OYRA 4ZAVA 1LPPA 4MRSA 3G59A 1HLDA 1Z15A 1C7RA 3PNMA 4EEZA 4Q3LA 3VC3A 2O2IA 4BNJA 3KR4A 4OL9A 1E3LA 3AEUA 3DE5X 3G0OA 1EQ2A 1IATA 1Z5NA 4KDRA 3G8DA 1JVNA 1T6ZA 3PVZA 1I36A 2PT5A 3K9HA 2D0PB 3GRYA 4EUNA 1QHIA 3DBRA 3HNRA 4MUKA 2V7GA 4DG5A 1JPVA 2CHUA 2I7TA 3CLUD 3P9CA 4AJ1A 2V6IA 3E9RA 1Z0ZA 2IX9A 2NYAA 2ECPA 1ONNA 1YIDA 2FPSA 1LX7A 3P2EA 4NULA 4RVOA 4XH9B 2EWBA 1KTVA 2F7DA 3PFHA 4GYYA 1WKVA 3HNOA 1KY3A 5GV8A 4RGBA 5EP2A 5G02A 4EFDA 3QFTA 1IAQA 2NACA 3EZ7A 1ARZA 1SHJA 1QFJA 4IP3A 2C8LA 1VA5A 4UQPA 2TRSB 3B1XA 4HVTA 4DFDA 1XALA 1ZIDA 1YS7A 3P5WA 1MO2A 1A7JA 2W2NA 2YHAA 4BFUA 2RI0A 1Q1BA 4PAOA 3U81A 1M2EA 4JI1B 4UEJA 4Q8GA 5ALGA 2KQVA 1MVLA 2YJBA 4MWBA 1OAOA 3LOUA 1SBCA 3LQFA 3Q7EA 2QYOA 4B80A 1KI1A 5JHGB 1QBKC 2J87A 2Q2QA 2V5AA 4O08A 1TL7C 2C57A 2VHQA 3FTEA 3ENKA 4KLCA 3K0KA 4F9FA 3OQHA 2HQRA 5IT4A 1OFUX 5T4BA 1O77A 3B60A 3AF1A 4O1HA 1CNEA 4X6UA 3UJ3X 4BGVA 3R5SA 1LBHA 3MFYA 1AHPA 1IHUA 2ZUDA 3ETEA 2IZ1A 3D1JA 3H5AA 3HACA 4MTCA 5BW6B 1Z2EA 5ITZA 3RNVA 1TCUA 2ZYDA 5JVDF 2NLOA 2IOQA 1TT5B 4NE7A 3I01M 3O38A 4UMLA 2QRPA 2ZYGA 1KF0A 1NBHA 3OF3A 2D2FA 3TIVA 5EIBD 1IBRA 4V0MA 4LV8B 4LFAB 3DMYA 3IUJA 2DBRA 1A5ZA 1A82A 3BE8A 2RIPA 2B8NA 1I3LA 3AEQA 1C5KA 1G4AE 1FVFA 4WK0B 3IDZA 4X20A 4D6XA 4DJJA 2XA9A 3RYCA 2FSIA 5LQAA 3R7LA 1Y6QA 4LE1A 1B3RA 4BKRA 1WNFA 1M2JA 4G81A 3H9CA 3F3MA 1T0IA 5G40A 1PEAA 1XXHB 4A1FA 1JT9A 3ZUAA 1DJOA 4X6YA 2F4NA 3ZK8A 2OCIA 2F4VB 3N2KA 4J2OA 4EQ6B 1VLMA 5AVXA 1HE1C 1V37A 1DHTA 4PO1A 4YJFA 5KAMA 1EP2B 2XU3A 4YECA 5COQA 3IOCA 2XVXA 3JQBA 3M83A 2ENUA 3NWJA 1OAOC 2WKPA 4BMVA 3CB4A 5JDIC 3A9TA 2BHLA 3QVSA 3RTDA 4PLZA 4RELA 1LSUA 4LRXA 4QYIA 4ZXPA 2YXLA 3GZNA 1ZD8A 1Z6ZA 3O0DA 3Q3JB 3UV3A 5J2TB 3UA3A 1FW8A 1MJ5A 4R5HA 4CLRB 1XNHA 2QZSA 4G5SA 2HJGA 1GTVA 2PMWB 4B2IA 2RIRA 5CLFA 4RY8A 4RS4A 2FPPB 3GFGA 2FMHA 3QNMA 2PLRA 5CU7A 2HXSA 3HKDB 4HNQA 2OO7A 4PBRA 5FI1B 3JAKA 1K3FA 4F9GA 1DEUA 2WJYA 1NG9A 1P0PA 3HP1A 4ZEVA 5LQKA 1AECA 4QVKA 1H6DA 1ECPA 1OXTA 2GBGA 2YWHA 4Q1EA 2WD7B 4CIVA 1OV4A 3OMWA 3K0SA 4R2IA 4HGNA 2NU6A 1WBBA 1BKYA 2G76A 3FPAA 3U3RA 1YNOA 1DG1G 5JSYA 3UFXB 3VKVA 3OQPA 1XA3A 3K5HA 4TWZA 1ZK3A 2A30A 2IYYA 1KEEB 3FWPA 1IUNA 4WCDA 4F3NA 3WGKA 1BQIA 3CNQS 4E5PA 2WJ3A 1XGKA 2HDHA 4CL8A 4IRUB 3PLNA 3SC2B 3ZPXA 3I2YX 5AVTA 3DGEC 1O0CA 1M8JA 3PBKA 2G9RA 4Q01A 3FRJA 2BU3A 4PP1A 4RNAA 3MYRA 3MJDA 3IV7A 4A73A 3ID6C 5E1MA 3LG2A 2BKUA 3KR1A 2JLQA 2FMXA 5DGTA 2M6SA 4M8LA 3DCYA 3TB6A 3OCJA 1NSYA 3F7NA 5K0EA 4FEAA 4Z7JA 2CY0A 3F1KA 4OLJA 1D6JA 1N5DA 2NUTB 4CDCB 4Q9IA 5HX7A 4CWAA 4UC0A 1TKAA 2R00A 4EQZA 2YYSA 4X9XA 3KT8A 3IHLA 1SUCA 4GZMA 5CXXA 1PPOA 3L9XA 5IWAB 3DR5A 1JQLB 3U7EB 4FLFA 3R0QA 1JMVA 4MUGA 3KSDO 3IBGA 4KW7A 5EF4A 1HDRA 4MR9A 1QG6A 5HCIA 3IOYA 1Y4SA 2RJ3A 4O2BB 4EG8A 2C7OA 2VDVE 3BMNA 4EHHA 1RQNA 2YIJA 2FJPA 1Y3IA 4J4HA 5JCJA 3SC6A 4BTLA 4QKQA 2IWHA 2NO9A 1X7WB 4OBEA 2GM5A 4W4UA 2W70A 3HSYA 3NOOA 4EJ2A 1P61B 1OPRA 1HQCA 3L7CA 1Z45A 2X0NA 3V4FA 1VMAA 4H77A 4TUYB 4YJHA 1B0UA 4MRPA 3UUEA 4UPVA 2FR0A 3DM9B 3GRPA 1P44A 1DVRA 3TQFA 2D0DA 3A6DA 2A92A 4I9UA 4UZEA 2HHAA 4MVCA 2HLNA 3AOEA 2X0DA 1K88A 4P6GA 1YC5A 1KY2A 4A8PA 3JV7A 2X5XA 5CLGA 4JYPA 4DTIA 4JBNA 4FM9A 1J20A 2Z08A 4MRMA 2AXNA 1Z4LA 2E18A 4FZVA 3CNLA 2NAFA 2YY6A 4LOLA 3B2EA 1Q1NA 1MD9A 2ZB3A 3LZCA 4E2FA 4HKTA 4M4SA 1GCOA 1R6DA 3ENZA 1FUUA 4R3NA 4A8JB 4ESSA 4FGWA 1I2AA 1UZNA 2XQVA 4RUKA 2CCKA 2E9SA 4K7JA 4ESVA 2IY8A 3IUMA 3L77A 1B6TA 3JQRA 1PP4A 3U9SA 1HZJA 5C5IA 5HZHA 3PLAE 1SHUX 1FUIA 1TC1A 1CUAA 1JHVA 1ZITA 2WD7A 3FLMA 3GZ4A 3GZTB 3I09A 3NYQA 4QQNA 3K0HA 2W71A 1K5PA 1YB4A 5B37A 2WWVD 1WDKA 4ZRNA 2Q3EA 2C77A 3LJKA 3QJYA 3MP2A 1JQJC 4KODA 4QU8A 3TPFA 5EE1A 1WMDA 3ESDA 3GEEA 4UM9D 2GTIA 4A10A 1GRQA 1PKEA 2PT7A 2ZBRA 4YMIA 4RVSA 1KQNA 5DISB 1XRLA 3MRTA 3UIEA 1WQ3A 4N0MA 3UK6A 4UTOA 4PXAA 3UATA 2HA2A 2WWGA 3C1AA 3OEED 4BNWA 4KGZA 2FO5A 4Q9NA 3UMMA 2R9CA 2BEJA 4GMDA 5FP0A 4YQEA 3NAQA 4CMHA 5IANA 1ISGA 4V0LA 5IT5A 3TRHA 4JKYA 4EGQ<