4GUCA

1.4 angstrom resolution crystal structure of uncharacterized protein ba_2500 from bacillus anthracis str. ames
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
RFLDTWRWQNYFLLHHNADFIEELAVGDLKHGDTFDVTIYTGGKDTGIVKIYQLSGNENDEINLHRYKTIYDSGLKHNYGRFVTPITKAYNPGTYVAVMKLGENYYYGGSFKISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.4 Angstrom resolution crystal structure of uncharacterized protein BA_2500 from Bacillus anthracis str. Ames
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
molecule keywords Protein BA_2500
total genus 27
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gucA00
4GUCA
chains in the Genus database with same CATH superfamily
2BNRD 1KCBA 4JB9H 2CIKA 4ZQKA 1X44A 1UACH 1K2DA 3PGCA 3Q1SL 4YS4A 4L4JA 3TU6A 5SV3A 2YGQA 3OKEB 3LRHA 4HSCX 1RUQH 3FYIB 1IC0A 2OCCB 1R17A 4B0MM 3K2UL 5ETUA 3NIGE 5F9OL 2HB0A 5IFHL 4GG6E 2CO6A 7FABL 5LXGH 1JNNL 3LIUA 4Z0BL 1KXVC 3CE1A 3IJ9A 2NYYD 1FFPB 5DJDA 1Q9LB 2VDPB 1IC7L 2FX9L 2EDHA 1G5GA 2EQDA 4NQSA 1OAXH 1OSZA 3T65B 5I16A 5KTEL 4KKAC 4MHHG 3AT0A 1A4JA 5DLLA 4PVNA 1WIUA 5IJBC 4KU1A 1HHGB 4S1QH 5GZNA 4ZI8A 1EJOH 2DJ4A 3QJHA 4EF3A 1I7RA 3FFDB 1BVLB 3PV7A 1MJ7L 2VOTA 1ZVHA 3NCYP 1DQDH 1QFWL 4W9IC 3MJ9A 1ZT7A 2EJ1A 2ERJB 2P4AB 4X7SL 3V8OA 1B3JA 3BKMH 4X6FA 5CEZL 1KCWA 2X4OA 3WFCH 3QEQD 2IDSA 4IKJA 5CS7A 8PAZA 2RMNA 2WIIB 4KO5A 1R46A 2BX5A 1COBA 4FCHA 1U8MB 3M7FB 3HZVB 1KB9J 1PS3A 3FRPB 1PLBA 3D0LB 4DWHA 3CX5K 3VXSB 4L18A 2OP4H 3L1EA 5TH2B 3IDIB 3OB0K 2YQGA 4LFHD 1TTFA 4TUKL 4UQEA 4M7KL 3ILPB 3RWDA 2BP0A 3O3EB 2XPGA 5FUZL 5I0VA 2XJKA 2IQAB 3ILEA 1JPSL 1W0VA 4H0GA 4R5TA 5DZPA 3W2DL 3VU2A 4Z7WF 2HFFB 4Y9CA 5C0BD 2CLVB 4KKAD 4LQFL 4YZFE 4JFEE 1SYSB 2C26A 1J0YA 1A7RL 4P07A 1R3JB 1SJHA 1JERA 1WFUA 1IEHA 1BXXA 4A7TA 2BVUA 4P2RA 3QYCA 4K9EL 5I71C 4NHUA 1AOHA 4BZ1L 2A73A 3AROA 4U05A 1PLGL 1U33A 1F58L 3A6CH 4JM2A 3SBQA 4JRFA 3W57A 1MJ8H 2YSTA 2FBRA 4UOW1 5GGTL 3ZDYE 4IRSD 5LGJB 2PPEA 1EO8H 1RU9L 1U8PA 2CO4A 4XC3H 4B7LA 4OH2A 2XLLA 5B8CC 3NIGF 3RWCB 3WKMH 2VO5A 1Q72L 4NB7A 5BO1L 1K6QH 1E0OB 2X9WA 1SGKA 5E56A 4FMKA 2ZP9A 4Q7DA 1YEJL 3VG0H 3QJUB 2XU9A 2ATPB 3TV8A 4F2MB 1OHQA 2OW6A 3VD2A 4MLSA 4EXKA 2YMOA 4HJEA 2ZG1A 3FSZA 3SJVE 4HIJB 1FZKB 3KWUA 5KVDE 3PHOA 3HG4A 1IM9B 3C75A 1S3KL 4M1GL 4YH6A 3P3RA 5C97A 3BCFA 1FYHB 2J4WH 5E2WH 4DSYA 1XX9C 3QEUB 2QBWA 5I66A 2L0DA 1P2CB 2D7OA 4X5XB 3TJEL 2GSGA 5DT1H 5HGGS 3SGJC 1XTLA 1PAZA 5D1QB 4ICWA 4QHLA 1CFVL 4N86A 1B0GA 2JSFA 4JVPA 5FAAA 2Z65C 1NKOA 5LO7A 2BSED 4Q2ZB 1V7ML 5B8CB 5IMMA 3HI6L 2R69L 1G7HB 3NIFB 4LCWD 1AZUA 2CCLA 2DZEA 4HMEA 3I9PA 3INUL 2ZG2A 5LBGA 3EH5B 3LQAL 4A68A 3UYPA 4YSQA 3NFNB 4U6VH 5F9JB 1TTUA 2AC0A 4JQIH 4B27A 4YAQB 3GSRB 3GHBL 3HFFA 3QFDB 5T1KD 5EIIA 3MNVA 3GMMB 3VFMA 2X4QB 3NK3A 3L3JA 3IMTA 3TVMB 1NEPA 3P9LA 5GRJL 1NLBH 4LGSB 1G9NH 3VI4F 3VDAA 3B9KD 3DIFB 3LS4H 4AGLA 4HUNB 1EFXA 2EXTA 4PJAE 5AD0B 4U6XA 5EBWB 1A3QA 3AS3A 4EO5A 4X83A 1T2XA 3G04A 5EBMA 4N4YB 4QRUB 5SWZA 4TTGA 3LSOA 5LCVL 1RZGB 2D7TH 3KHQA 3FH8A 5K9JL 4NOFA 4MHHI 3ZE2E 1N26A 3OF6D 3RNQA 4UUJA 4ZYKA 5CP7A 5B3JF 2MIZA 5IT2L 2WWNA 1AMYA 4Q4IA 3EDFA 4HQQH 3W82A 4G8GA 3GJEB 2YEVB 1KN2L 1HDMA 4PTTA 2WZPD 4F5CA 5MERB 3L3JB 2H3KA 2OZ4L 2ZWZA 5IFAH 2O6PA 1I31A 4WWNA 4WY7H 2A6KA 4L5FH 3V0VA 1QLRB 2C7UB 4GAYB 3IFOB 4MNQD 4PS7A 2FYVA 5C0AA 1F41A 5DQJA 4HCGA 3RVTD 4UILL 5AENA 1D5IH 3B8SA 3QDMA 4LESA 1JYVA 4GKNB 4QWWC 5IJVB 2YKKA 1S7UA 5F9OH 1CE6A 1J9RA 5C0AD 5INDA 4OT1H 2UXFA 3QXDB 3KYMB 1EZLA 2ZCLH 1N2RA 4MA1C 4OCRH 2V9TA 1CFSB 4IKKA 5I1HL 4KRLB 1J7VR 1G0DA 3K1KC 1AQ8A 4FQJH 2E7LC 1RAMA 5AVUB 2WVVA 2CUIA 5TDPB 1HU8A 1H3TA 2V2XB 4LP5A 2Z8RA 4MD4B 3VACA 4EVNB 1VEOA 4MQXC 4Z95L 5DVLA 4J3SA 4G7RB 4ERSH 3I6KA 5HDOA 4G1EB 4HF5H 2ITDA 43CAB 1UEMA 2OP4L 5DZLA 3A4FA 4ZZKA 2GC7C 3C5ZA 2EVGA 1YMMB 2UXTA 4PP2B 2MOGA 2EVHA 1F4YL 5I71B 1NCJA 4KJPD 1O7DE 5CFHA 5CEZD 3E6FA 5IB3A 3NSCA 1CB4A 4JFDA 1CXFA 1JGDA 3FUIA 2ODIA 5F1KC 5EPMA 5E8EB 2ENJA 1SEBB 2Y1ZA 3FT1A 5D1ZD 3CDFA 2G60H 4Z3IA 3JWDH 5E2TL 3TCTA 2R59A 2FQDA 4PGBA 4XTRD 1CFTA 5D1ZA 3H42H 3GBML 2OCJA 4QHMB 5DEJA 1ZK9A 3BGMB 3EF4A 4YSOA 3ZHFA 1QTSA 2EKJA 1JXFA 4OLYH 3KZ8A 1KN4L 5C07A 3OXSA 4K5NA 1XFPA 4X9BA 3TWCH 2E7DA 3M45A 5C6TH 1U2YA 3CFJB 5AFAA 2MNJB 4H5SA 1L0PA 1LVEA 2Q8BH 3PXLA 5FCSH 3UGEA 4KDTC 3ZE1E 1P4BH 4JFFD 3D3VA 2AJXL 2YBRB 2C9PA 3W39A 1A4KA 1DSWA 2D8KA 2R51A 2YUZA 4R0LC 3C5SB 5D6CB 1GAFL 4IBQA 1FZJA 1K3IA 1XCQB 4H0HB 2V0AA 1OD9A 3N0AA 2P28B 4EAEA 1JZIA 2AF2A 3FF8A 4NC1E 5IBTH 4OJAA 3T3PE 2J4WL 4HALA 1PYWB 3HCVB 4HIHA 3SEPA 4ZW6A 3U4EA 5LLIC 3DX9A 1QUNB 3GSNB 2R1XA 5CILH 2D2OA 4TVUA 2VLRE 1A1OB 2W80C 4QIRA 4KXCA 4AEFA 5AVVB 5JUEH 3ZDZE 4FN0A 4HS3A 25C8L 2D0FA 5DVOA 4KZEL 3LKNB 4PHXA 2HH0H 2VLMD 5DS2A 3OLIA 4E9YA 3FBQA 3EH4B 1UEYA 4ZD3L 1JK9A 1S7VB 5JYLA 2EKSA 2Y06L 5GGVH 3T2LA 2DM7A 5EU5B 4CNIA 2Z31A 3QSKB 1CIUA 1G9NC 3D25B 5IVZA 3OC8A 1E9OB 1C5BH 2ITCB 4TVSa 3UBFA 3UBXB 4FXGA 4XCYA 3HZ3A 4U1LB 4OTXH 3EBAA 1J1XH 1THCA 3PUCA 4KMLB 2UX7A 3GSXB 5L4JA 2XACC 1WC7A 3RFZB 4Y89A 3WFEH 5FYKU 3S6CA 2EDDA 4DP6X 5IBUB 5ABDE 1HL5A 1TZHA 5F7DA 1I3GL 1LO3L 3UACA 3S0PA 1QW8A 4XI5D 1Y6MR 3QCVH 4WQOA 3VI3E 1JZ4A 5B38A 3EXJA 2FQFA 4JFSA 4IIZA 3KJ6L 4C4KO 3WAJA 1DQLH 3GBLA 1U4EA 3I02B 2OSXA 3G6JB 1MHHA 3D39A 3PJNA 1P9MA 1HXKA 2VRQA 4MXWL 4PJ7A 5KJRL 3O6FD 3LN4B 3ZW3A 4MXVE 1AS7A 2OMVA 2CLRA 3J2PA 5HDBE 2JB5H 5C7ZA 3TPUB 3WBDA 2WNWA 2EKSB 3ZYJA 5GS2H 2Q10A 3H42L 2XETA 4Y1SA 2CIIB 3L3HA 4MCZB 3VVWA 2ZXQA 3WSQL 4POZC 2W9DH 1PJ9A 1X5XA 5HDBF 3TFKC 1M7DB 4QXGH 1CFQA 2VDLL 3LRSA 1SY6A 4D9QE 3TURA 5T5FH 3EF7A 4KZCA 1KCRL 4RGNB 4QOKD 2CH8A 3PXJA 2EEXA 1GGCH 1Q9OB 1TVBB 5A6LA 2XVBA 5CMAB 4AMKH 2X1QA 3TF4A 4JK0D 3TBTB 4POZD 1M6OB 3V55A 5E9DE 1E4XI 4F7KA 3LPWA 3U1QA 2EIZA 2GIMA 5KAQG 3S96A 3MACH 2Z35A 1A0QL 1YY8A 4M7ZB 2QR0A 3KLHC 5AKRA 2DLFH 2VAAB 3H2PA 3F2LA 3HNTL 4YBLB 4FTDA 3C87A 2ZWLT 2EEFA 5IJDC 2XA8L 3DMMA 5T3XE 1E28A 1B2WH 5J1AB 3IN0A 4KTDL 2GJ6A 2WWOA 1IBBA 1OAXL 3EDDA 3GRWH 3F5WB 4FQJL 4TULH 4UQBA 5KJ7E 4WWOA 4Y2DB 1I8LC 1MQKL 4NM4H 3C60D 2WUCL 2GEQA 2NXZD 2R15A 3KLHD 4PS4H 1TSHA 3UG3A 5K1JA 3ZTJH 5JLZB 4MKTA 1BZ7A 3V4VL 4NWUH 5KS9B 4XMXA 2XX1A 1VEPA 4OJEH 2OW7A 3CN4A 4BCZA 4TSAH 4KH2A 4IRZA 1JRHL 2WVSA 1D6EA 3T0WA 1GGBL 5DJ0A 1RZKL 2XSKA 3CN0A 1WWWX 3MRQA 4PJBA 5JW4M 4GBXC 3T2OA 2MTAA 3VXPA 5HHVL 2NPLX 3QUZB 4PRHE 3ARXA 4QRBA 1J87A 2PYEB 1TJIH 1E3FA 4Z7UF 3UTSE 1YA5A 2K6ZA 5AZUA 5AAMC 2GTQA 2WTRA 2DQIL 4Z7WB 4XNYH 1L7TL 1R4XA 4NCC2 4CU6A 4YSPA 5FB8A 4U7MA 3GPEA 2C9RA 1WD8A 5JDSA 4C4KT 5LCVH 3MRIB 5GGQL 4PJFB 4U6YA 2PYEE 3T4AC 4JFHD 1GZQB 4LARH 4HKJA 1A1NA 1SOQA 4XCEA 4LPUA 2F7QA 4E41D 3JTTA 1HEJC 3QNYA 3SQBB 4GKSA 1IGYA 1F6FB 3MJGX 3JUYA 5D2NE 4ENEC 1MRCL 1NCWL 3VFTA 4QXGL 1WIOA 3FFCD 1HSBA 1JF1B 1UT2A 2ZOKA 4FG2A 4UQ2B 1ASPA 4P05A 5DUPL 4PJGB 4AZ8A 2WOYA 4WFFE 2NY0D 3E6HA 2WXPA 2C1PB 4U1SB 4XZ4A 1L0XA 3RYMA 3D7PA 1DQIA 2DF3A 4KJWC 4LSRH 4OM1L 3WHE1 3W3BA 1SXSA 1QP1A 2IOOA 3T71A 3WI9A 1QLEL 3S7GA 4OCXH 3VGBA 2R0ZL 5AOJA 3RHWF 5CD3B 1G7PB 1TQSA 5IQ9A 4MCNA 4XVTL 2EVIA 4JRXB 2CBMA 3ZQXA 3CQPA 3TCLB 4J3XA 4YSEA 4YGVA 2HT3D 2GHZA 4A55A 4XR8C 3OKOA 2VM4A 4GUOA 2RQ8A 3B2PA 2JIXB 2HMID 4JGNA 3NABL 1TQCC 3MNZA 3SYQA 1VDGA 1E27B 1IFGA 3L7EB 3PV6A 4G8AC 3H3PL 3F6LA 4UZSA 4YDLC 1PZBA 5IW1A 3DUSB 1KIPB 1DQMH 2QZ5A 4N8VA 2DYPA 3MREA 1JZJA 3RWJA 2R4RL 1LO4L 3DRTB 3K1DA 1CFVH 1FH2A 5DRXA 3WMPA 3IETB 3WJJA 3RWHB 4ZG1A 1DO5A 4G9FB 25C8H 5C3IA 2I07B 4LOFA 4KZEH 4N6RA 2XX0A 3DTXA 3V4PA 1J1OL 3NIDF 3LH2L 5AZEL 5A2BA 4CILA 3BSZH 3BAEL 3VQ2C 1AXSA 1YECH 3A4DA 3AWEA 1P7KB 2BVPB 2I24N 3G08A 4O5LH 2ZX6A 5B39G 3MLYL 4D9QD 5L2JA 1JGVL 3BWAB 4QTIH 4CDHA 5HVHB 5JHLH 2EIJB 4HJIA 5E51A 1OGAE 2EYRB 4X0NA 3N0PB 3ILQD 5AW6B 2IH8A 3MRBB 1WBZB 4CU8A 5I1IL 3M07A 2FIKA 1KTJA 1MHCA 1FQ9C 3BKJL 3D1MC 1ED3B 3TYGL 1L7IL 1UB6A 5D1QE 4NWTL 4AMXA 1UWFA 1HHJB 4QXWA 4UDTB 2BSRA 2P5ED 4LCCA 4GG6B 3LAFA 1ZJBA 5DQDL 1AI1H 5DTFA 3SDDD 1AC6A 4N2OA 2O72A 2OAAA 5JQIB 3BDYL 3IJYA 4PRBB 4TNGA 4UTCA 5C0NC 3AU1B 5FA4A 3W9EA 4L23A 3L3KB 2OS7A 5I16B 4IM8A 3UJJH 2L3BA 2IBZY 4GKZB 4HLZH 5I76A 1EXUB 1E5CA 5EFIB 4Y9BA 1BYOA 2ZG3A 3AXLB 3UX9B 5I1LB 5E0FA 1GZPB 1WBXB 3B9AA 4PWIA 2NDFA 4PJBB 2W0FB 3WS3A 3DKHA 1V10A 2DQCL 2ED8A 3DPDA 1U91A 4WO4B 3BKML 5KBLA 3P0YL 2FATH 5DZNA 3RZCD 2YN3A 4LASH 4RA0C 3G5VA 4YNYB 3QEGL 4KX7A 4PRHD 3TPKA 1CE1L 2JQZA 2P80A 4NS0A 2YAHA 4U1GC 4XH2A 4DGIH 5I19L 4LVNC 1ZLSL 3FB6A 3MA9H 4PGCB 2FEDC 2C4FU 3RZCA 2A74B 4J6RH 2DQHH 5JW4Q 2CUHA 3TP4A 3FTGB 3BQUD 3MV9D 5I1EH 4RGOH 3C5SA 3DMMD 1BFVL 1DJZA 3BE1H 1CS6A 3ZTEA 4FQHB 4KI5E 4QT5A 4QXVA 3ZT7A 3RIFF 1IGFH 4KV5E 4Y5VA 5SX5H 4J3WA 3MNWA 5IGXH 5K59F 3QNYB 1PZCA 5I6MA 5C9KA 3OR7B 4LDOB 4N9GA 2HJFA 1G7MA 3IKKA 2E27H 1L9NA 3Q8AA 1ZK5A 3HE7A 3RGVA 2KQMA 4FQCL 1DANU 1OAZH 5C09A 1QPXA 4Q0XH 3EJYC 4CDGC 4K94C 3CVHB 3ZVVA 5C0FB 1UZGA 4TQIA 3GLAA 3MFGB 4IDJL 2IC2A 4LVHB 2PP7A 2A73B 4MAYD 1I9IL 5GGTH 4OZHB 3HBGA 3DURB 4AJYV 5KYYB 3ROOA 2E9BA 4YHIB 4HSQA 3UCQA 1H8LA 1LDPH 3KPSB 4M3KB 2OYPA 1MCIA 1Q72H 1RJZB 5E94B 5CGBA 2N7SA 2XVKA 1OF0A 1AZNA 4I8DA 2Z92B 4HG4J 1JNNH 4LLWB 1WT5C 3ECVA 4MWFB 4QOKA 4DKFH 4JDTL 1G9EA 3CLFL 2WD0A 4IEFA 3HC4H 4NZRL 2H0PA 4KBPA 3LIZA 2HYMA 5T1MB 4Y16A 4AQ8A 2FK9A 1EHKB 1XEDA 1IQDB 3HFMH 3KW7A 4G9DA 2P47B 4GMSL 3VW3H 5CBEB 4Z7AA 3FN3A 4LLDA 3MGTA 3GO1L 1T5WB 3P4NA 4RMRA 3ULUL 1X6LA 3BVXA 3EJZC 4K94L 3LV3B 4ODXB 3RB5A 1QW9A 3GIVB 3NFPA 5FA3A 3HEIB 3QJOA 5CZXC 4BFIB 1U3HB 3QG6B 1CFNB 1MQ8A 4FJ6A 4KHTH 5EDXA 3LX9A 3QA3A 4LOUD 4YPJA 3O3AA 1RUPL 1AIZA 1LNUB 1U6AH 3FU6A 3UC0H 3M1BB 4EI5D 4WWKB 3I9IA 4XCCH 4PJHF 1QO3A 1UQSB 2HFEB 2VJXA 1QRND 1TZIA 2VXTL 5DK0B 4JQXC 2DMGA 5IUCA 4J3VA 4WEEA 3MRBA 2J8OA 3OKLB 4DKDC 4JQIL 4H25B 4PJ8C 2E6PA 2GBTA 3D2UB 2BZCA 4KNSA 2ICEB 3F85A 5B3JE 4UT9L 3SDAC 3NK4A 3BVTA 4Q6KA 1JV2B 3GT6A 4ZO6A 4H8PA 3ZOAA 3VXTB 1PAMA 4A2GA 2ESVD 2Z35B 1JWMB 1MCJA 3F00A 1J12A 3QUKB 4GEIA 5E4IA 2NY6B 2VM9A 3R7QA 3D18A 4NP4H 4JFDE 3IFOA 3K2KA 2BXYA 5C6PB 2BHUA 2VWEE 2VABA 1MFEL 1D5MA 4J7RA 1P4LB 1S5IL 3KGTA 3M7OA 4JZOB 4NZJA 3STBA 5JW5A 4ODHH 3DETD 4QCIB 3IDIA 4PRPA 4ZXBC 4NO2B 1R5VA 4GXVL 3PHQA 4WWID 3VE0A 4Z3GA 5EFIA 3IWUA 4M7ZC 1W80A 2DI7A 2VMJA 4QRUA 5F1IA 4P2AA 4PJCF 3VI4E 5L0QB 4UV7H 3VCLB 5I6XC 5GGRY 3EIFA 4XX1E 3D12B 1HWHB 4XRCA 4MNHA 5D7LB 4HWUA 3DX0A 1WYJA 1U8NB 3SY0A 3E38A 3TVMD 4AYID 4QRFA 1FC1A 4WTWA 3VXTA 3FOMA 2ZE0A 2KHAA 4HLZG 3IMUA 1C12B 2NX5B 5E2UH 2QPEB 5E8OB 5JHLL 5E6IB 5DMYA 1S7SB 4U0QB 3CFCH 4P5KA 4RBPH 2HKFL 3GTNA 2DJSA 3L3OB 1F11A 1DQKA 4G6JL 3FTGA 4YSRA 5D4IA 3U2JA 1AGBA 1UYWL 5HHPB 1QAWA 3C2AL 3UCRA 5DS8A 2Z31C 1A1MA 3GHEL 3Q6GL 3QNXB 3QQDA 2XVGA 5DO2D 3UTTD 1UFGA 5FM5O 5F7FA 2E8YA 2B59B 2E8ZA 3HLAB 2ED9A 1Q90A 1F56A 2FGWH 4FQ1H 5JZ7C 4B53A 4QRPB 1S6NA 4BUQA 1I1FA 4NM8L 4O4YL 5D1XA 5M7QA 1OOAA 5AALA 1N3NA 1A1NB 4XCEB 2AXHA 4IBVA 1LILA 2I5YH 2YMXH 1ACCA 3NDZE 3R1GH 3GZPA 5H94B 2ZUVA 2WQVA 4K7PL 2V9RA 3ASNB 3RWFA 2ATKB 5LXVA 1S5HB 3CSFA 1EX0A 1U8QA 3A67L 3SJVD 2DYPD 1C16B 1E5AA 2X3BA 4FXLA 3GSQA 2A6DA 3H6JA 1UOLA 4PJIA 3FB8A 4XO5A 4NCDA 3SPIA 2Z6FA 5CUSH 4C56A 1IJ9A 3GSWB 3RURA 4GW5B 1UXLA 3QJTB 2F53E 4PRHA 3HG1A 1MFDL 5DXWA 3VMPA 4XC1H 4EPSA 1KIQA 4Z5RA 4N2NA 3K2IA 1GJUA 5DFAA 2CGRL 4L3EA 1S3RA 1MEXL 5CD3A 1I7UA 3Q6FA 1T83A 4UI2A 5IMLA 3BQUA 4BFJA 1DEEA 5HI5C 2P1YA 2Q0ZX 1ODUA 1U8CA 3L9BA 3QUYD 4D9RE 3L9RA 3ILPA 4P2RE 4OIIH 5F6IC 2GUOA 4Y4HC 4NUJB 2G3NA 1ZLVK 5ID1A 3BESR 3CHQA 1NGWA 3T4AA 3VXRD 5IQOA 1BFOA 5I8CB 3BP4B 3W81A 4GAAA 5F21B 5IM7B 3GXMA 2WBWB 3BZ4A 1J1PL 1TQVA 1OF2B 4PLKC 3FNKA 1L7TH 2J2ZA 4Z7VA 1NCHA 3N85H 1EAJA 2ZD0A 4ZUWA 3FK3A 3MCLH 6FABL 5J13C 1JNJA 4G80B 2FECI 5HI4C 4HOXA 2UXVA 5HHQB 3VXMD 2YD2A 4GSUA 5I1IH 1I85C 3K4ZA 5CP7B 3MUGB 3V8CA 2DRUA 4W4NA 1OD7A 5EEXA 3VWJD 3QQNA 4ZO7A 2JI1A 4YWGH 1UG9A 5JIQA 4FERA 1E65A 1BVLA 5EZPA 5I23A 1MNUL 4WW2B 1K8IB 1D5MB 4PWJA 5C0AB 2XFXB 3JVFC 4HAGA 4XMKL 3CK0L 1Q1JL 1RURH 4K9EH 4Q4EA 5AVWB 2F8IA 5HYQB 6PCYA 1KPVB 1J18A 4L1BA 1AGFB 2A4CA 2OJ1A 3F8UB 3HKZA 2X41A 3DGGB 3UJIL 1UM4H 1H5BB 4FFYH 3SKNA 4XCNA 4FFYA 4TLKA 3CFIC 3QR2A 4J2XA 3X3GH 5HYFA 4ONFH 4LLUB 4P9HC 5I5JA 4AQ1C 5CLZA 4LL1A 4N26A 1HE8A 3BFQG 3HUJB 3D9AL 4XOAA 3MUY1 1KV3A 1FZKA 3ZMRA 5FOBA 4LE8A 4ZFFA 3IDNB 4OUUB 2BIIA 1P7QA 2CPUA 4XNXH 4XVJH 3X1BA 1MHHB 3TIDA 2NY2D 2O5XL 1NLBL 5AQ0A 1DVYA 1T5XA 1TJXA 3G6DH 2F68X 2W9DL 1EEZB 3HHMA 4K23H 4MX7B 3W11C 2FT6A 4KK9C 2F7IA 2RALA 2O5YH 2R2BA 3F04A 2J43A 4CADA 1X9LA 3AREC 4H1LA 4QR7A 4B9KC 1JZ5A 3E2HC 5CFAA 4EQ2A 2FCBA 3QJFA 3G04B 4PRDB 4E2OA 2IADA 3CHXA 1BVKA 3IDXL 1BHGA 3SYOA 5FKAB 4Q9CA 4KNQA 4PCYA 2BVQB 2ARWA 3U0WL 1EAOA 3FQNB 3AAZA 3VXUB 3GGWA 5HHOD 3I6GB 32C2B 1QQDB 4OSUH 4PRNB 1TQTA 3O6FB 2N0MA 4MD5B 4FG6C 3FUNA 3V6ZB 4HUVA 4TVPL 2H0EA 2YAFA 3VMOA 2X38A 2CBQA 5A43C 3VXPB 4G7VH 1EVUA 2EEAA 3UTPE 2A77H 3S36L 4E68A 3VFSB 3F7LA 4ZUVB 1PU0A 2IFFH 4CN1A 2ZF8A 1ZA3A 3WJJC 1XGQA 3HOGA 2BZDA 4PP1D 1BIIA 5D96C 4Y0GA 1WGVA 2F53D 2OMZB 1KSRA 1YEKL 3ARDB 1LM8V 3Q1EA 4QOKB 1XCQA 3WE6A 2EYSB 2ICCA 4KQ3H 3P2TA 1N70A 1U8JA 4LCIL 5B8CA 4NCC1 1FVCB 2H32H 3MRKA 3A6BL 1SZNA 5JLZA 5J6HB 3ZRSA 4UTAH 5IB4B 3VM7A 5GSVA 3WTTA 3IAQA 4BFNA 4JHWH 2B4CC 4F8PA 4X5QA 4XNMA 3QYMA 1XEUA 1P4BL 3BO8A 4HKBB 2XN9A 3B3IB 3CDGA 4KH9A 5AOZA 1B4LA 4L8CB 2J21A 3O45A 3SJVA 4W9CC 3C6SA 1N18A 2AV7B 2EDLA 5D1QC 3KYKH 3VFOB 5MEND 3OHXB 3QW9A 5FO9A 3V4UL 2QKIA 1CL7I 3I3EA 1A6AA 2AEOA 1V8HA 3OAUL 1S9WA 3SQOH 4WI7A 3CSYB 1FGVL 3MLZL 4M9OA 5HPMA 2XFGB 4QLRA 3IGKA 2CDEA 1FAIL 1Z2KA 2MPVA 4G6KH 4XBPA 3H53A 5CCHE 2DQJL 2RR3A 3GSUB 2MOQA 4K2UL 5J11C 1NAMH 2GBAA 1PCXA 4NOBA 1X5HA 3F7RA 4PRIE 4CU7A 5B3NA 5BV7L 3CFDB 3U83A 4KRPB 1OP9A 3P11L 4JW3A 2CHZA 4XOEA 4L9LC 4NZDA 4L8DB 3GXIA 1QNIA 2WHVA 3LPOA 2NR6D 3B2XA 3MN8A 4K3HA 3EOBB 4WVRA 5EIQA 4JKKA 5KN5A 4QMEA 4S10A 4RAHA 1QOKA 4PGEA 1UD4A 1OB0A 1FRGH 2AMGA 3LN4A 4G1EA 1KJ2L 4HIPA 1XR8A 2OMUB 2A9ML 1EANA 1AY1L 2RHEA 2CHWA 4RMVA 4PJGA 5ADPH 15C8H 4JZOA 5JW5B 4X6EA 3MGAA 1WG3A 4OQ1A 1F4XH 1KJVA 1NCUA 5LKNA 4Y5YA 1E8WA 3QJRB 1H15B 4UZUA 5HY9A 5CR8A 3T6QC 1JFQH 4M1CD 3OKMA 4JKMA 5KYNA 4N2GA 1FHGA 4MXVF 3ZKND 4ZX3A 2OR8A 1BZDA 1X5IA 5GXBB 5AB2A 3JXAA 4IKLA 3VW3L 4B9YA 3PQYB 1HWGB 1TVHB 1OAKH 5EN2B 1SN0A 2NX5D 3EJYD 4NZFA 3FFCB 4X8JA 3CX5J 1OM9A 3MO1A 4A1RA 4XN9A 2DDQH 5CINH 4ONGL 4PJ5E 1KELL 4J4PA 4EJ1C 3ARFB 2QVKA 4LPTA 5E5UB 1BF5A 2NNAA 4Y19D 7FABH 4AQZA 4C56D 3D30A 2NNCA 1OV8A 1HHJA 1KG0A 2R83A 2QADB 2ZX9A 2PCPA 3TN0A 2L7JA 3FHEA 1KJVB 2EAEA 2Y1VA 2OX5A 5F1OB 2YAPA 2YK1H 1IEAB 1OSPL 1P6WA 2VLLA 1CD1B 4IRJA 4JRXD 1WT5A 4LCUA 2XXFA 4LDEB 4LSQL 3QUML 4QRPA 5DRWA 5F72S 2F54D 1DEDA 1T22A 1X5MA 1B9ZA 3VXUE 2JIXD 2WNGA 4JM4H 3TOPA 4JO4L 4NKDB 4HVBA 4I2XE 4IS6B 4G8FB 5FS5A 5F7BA 5FF6B 1CCZA 4LFHG 3KEHA 1E7UA 4GBXA 5BW7C 3GWJA 3BW9A 4OFKA 3VFSA 5IVOA 1G4RA 1C7SA 1Q1PA 4R2GB 4M8QB 3RA7L 2ICES 2NNFA 3NJJA 4GAJL 4H5SB 1NUFA 3Q2LA 1P7QD 2VR4A 2VTFA 5EU5A 5F7UA 5BS0E 1OAQH 1T80A 1D9KC 1FVDA 3F65A 4BWTA 1RZJL 3PL6D 5EZJB 4ZSOE 4ZMVA 4HBQA 4PJGF 5DDHA 3TF7C 4M4RA 1OIOA 1ZVNA 2BH0A 4N3TA 1IAII 4UCFA 1CGUA 1DUZA 3VFUB 3MLZH 5EF2A 3CNKA 5T1LB 4F93B 4D8PB 4BQ6A 5EULV 2FD6H 4OD3L 4WENB 4PWKA 4ZUTA 3FT3A 2V3EA 4OQTL 4JAMA 3KPRE 3QR1A 3GMPB 4GQRA 2E0PA 1JF1A 3L7FB 3NP3A 3QFJE 2FUTA 4APXB 2K6YA 1I9RL 2AGJH 4G6FD 1IC5L 3GSNH 3LN5A 3D09A 3NJIA 3SCMB 1TQWA 1KXQA 1IC7H 2C1PA 2X09A 4U1SA 3S3BB 3V79C 3KYOA 2J2ZB 1NJ9B 3P4OB 2B1AL 1KJ3L 4K15A 2R2EA 4B9JA 3CZUB 5J12C 3Q3GB 4Z3FA 3AY4A 3L2NA 3VXMB 4FFWD 5JOFA 4JKWA 1OAYH 3CFBB 1BJ1J 4PJDF 5D7JC 3F05A 3QUMA 4NO0B 1BJ1H 4OM0H 3CDZB 1RFDL 5CXPA 5J06A 4NM4L 3B7UX 2KL6A 1JDAA 4L1DA 3MRJB 1BVOA 2PXYA 1JCVA 3RILA 3ARSA 4AYEC 3RKDC 4Y9EA 1GW0A 2O61B 3E1ZA 1JRHH 3F7VB 2N1KA 3MGOA 4NPKA 3MBWA 1BCIA 4R96A 4B3EA 4JZJA 3K6IA 2UUDH 3BJ91 3IAPA 5E8DL 2G5RA 1J05A 5DD3H 5FYKD 3TO2A 1TJGH 3MV9B 1NJ9A 2VIRB 2M26A 4WFED 2ADFH 4G6MH 5TGBA 4LVOB 2NY1B 3OJ2C 4GRWB 2CDFA 2A1WL 4PG2A 2K70A 4YX2H 1GGIH 1YUKB 3NG5A 4J27A 4JRYB 4KGLA 1H3VA 3WEBA 4ZUSB 3DVNB 4GRLB 1WICA 4DHLA 3B2DC 3TEUA 3U7YH 2EH8H 2HJKA 2OLDA 3IFLL 5HHNA 3T6VA 3TBWA 4Z8FH 1JF6A 3IXAA 5IF0B 4BQ8A 1CGSL 3FTWA 2YSSB 3L4XA 1BZ7B 1IT9H 1GA2A 4GIPD 1KJ2H 4QY8A 2EUZA 1N12A 2BHZA 2OZNA 4LHUD 4YBLC 1NOLA 5FYJL 3WNKA 4MXQD 1TITA 5IROD 1JPGB 2VERN 1J8HD 2D03H 3TZVA 3W2DH 4DEPB 2GK0B 3FQWB 4J4PC 3LZFH 1FN4A 4JQXA 4LDCA 4TVPH 1RVFL 4PN6A 1AZVA 3JWNE 5FLVA 4Q74A 3MOQA 5E1GA 2YC1A 3EJQA 3LMJH 3LIZL 1GMEA 3QXAA 4WI6A 3UYRL 4L8BA 2J8UB 3K5SA 2NUTB 3DGCR 1J0JA 3R19A 2VXQA 4M9PA 3QEGH 3M1OA 1QX1A 2R9HC 1BQRA 4GKNA 4OFVA 1U8HB 2QDWA 1EXUA 1OP4A 1KTBA 3S37H 4XAKE 3MOAH 1I1AD 1M7IB 1AQKH 5J0BA 3FB7B 3CFUA 3O2VH 1AYOA 2H0FA 4PGZA 4TQ8A 4JFXB 1AO7A 2HT4D 3X1GA 3UL4A 4P46A 1U92A 2D7MA 4JG0H 1WV7T 2Q86B 4FCAA 4KPHH 4JG9A 1NIEA 3VGHA 1AACA 1KTCA 3TZVB 3KPOB 4ALAL 3Q9QA 3HG1E 5JW3H 3B9DA 4I1RA 1A6TA 4HH9B 1MVFA 2VC2L 3LKQB 1MY7A 1MCWW 5ICXA 2BMKB 3QPQD 3CZJA 4NHCL 3PNWB 5IW1B 2CA3A 1BJ8A 1LWJA 4L5FE 1DBMH 1DVQA 3CVHL 5KSAB 4ONFL 4BDVA 5F3HB 1ZLUK 1BOGB 1BAFL 3DXAE 2WGXA 4JN1L 1NIDA 2WPGA 3L3DB 3JYCA 4E36A 2NY2C 3OMNB 3V4PB 4MKMA 2XTJB 2BCKB 1JRHI 3K72B 5L0QC 4NNXA 1F3JB 1OTSD 2D73A 4H44C 4DZ8B 2DM3A 4TNWK 1L9TA 1ZVSA 2VDPH 3BHBB 4BK5C 2IQAA 5J6SA 3ECQA 1ZAGA 1BD2D 2YKLL 5HGAB 3ETBJ 4H8HA 1WHOA 3S35H 3CZGA 4BUGA 2OTPA 1QI3A 4URTB 5TE6L 2FIKB 1SOSA 1T66D 4ZFGH 4OZIB 4F37F 5JOPE 4R84A 4UIMA 1BG9A 1NLDL 1HNYA 5A6MA 5C0CD 4M8RA 4N0YL 3TXAA 3SO3B 2FAUA 4GG6A 5DK2B 1SLWA 4MTMA 4A7GF 1UH2A 4PLJC 3MKGA 5I26A 4WEBL 4FLRA 3V9FA 3L17A 1TETH 1CBJA 4N0CC 5HI3C 2OMXB 4B60A 3FKUS 1U3HD 1S7QA 1WEJL 4ZFOL 1KCLA 4GKZA 4B50A 4S1SL 3D6GA 4GEJA 1U3HA 3Q44A 3C6LC 4HIEA 1KDJA 2C9SA 2W60A 3MOAL 4F7PB 2A6DB 4KUZL 4GKOA 4BFBD 4N0FA 1EMTH 5IV2A 2NY3C 5DTFB 5GGTA 3L2MA 4TUJB 3WAKA 4WFEE 1M53A 2D0HA 4BQ9A 3RDTA 2F58L 2DIEA 4O02L 3D34A 2YD9A 2BVOA 1UVQA 3F3HA 4QRRD 5CCJA 5IHLB 5DUJA 3HPLA 1ND0B 3OKLA 2HFFA 4G7YL 2A0LC 4N90D 5GGVL 3RDTD 2AEPH 3UGUA 1OCCB 5C09E 1BMZA 4POYA 4UNVA 2VZTA 1JBJA 1NEZA 3FC8A 3C2AH 1SJVA 1F4HA 4P2RB 3SODB 3MBEC 5FW8A 5F7EH 4AYMC 3IDYC 2M83A 2NXZB 4AKPA 2AK1H 1UB6B 1LO0L 3DIDA 3DK0A 1JD7A 2ESVE 2J8UE 3BT2H 1U30A 2IH9A 1RZKC 1TVDA 1ZANL 3O3DB 4XPFL 5E6ZA 3HFML 1T03L 3CSTA 4PRPB 1GXEA 1M2VA 1E5ZA 3SDYH 2YMXL 2IAMD 3FO0L 5D7LD 3POCA 1IGCL 4OTXL 3ES6B 4K73A 4GQPH 4QF1A 3R4RA 3QEQA 5DHYA 2DTMH 1S7TB 2LGNA 2IXQB 1SQMA 2WCPA 1A7OH 5IQLA 2LU4A 5JIMA 5IVNA 2WQAA 5DGRA 4BFEA 4BSJA 3UYOD 2ZKYA 3CPUA 4JN1H 3TESA 3VSQA 3ZKMC 4KKPA 4ETQA 3KDMB 4FG0A 4N2DA 3SDCC 4FX5A 3K8KA 5CKGA 3OQ3B 4FNPA 5F6IB 2EIZB 3MR9A 5ALCH 5FDWB 4N3UA 1WAAE 3JWDC 3MFFA 1T5XB 3FCUB 4UT9H 3FU3A 4AQAB 3FQYA 3TBSA 1B0GB 2X4QA 2EEBA 5F6HJ 3WNLA 1PZ5A 1MOEA 3KCPB 3LDBC 4EDXB 1RSYA 1AG0A 5HVWA 3U1SL 2BINA 3IRZA 4O2EB 2KLRA 4A7VA 1LK2A 2WLZA 3E9TA 1QTPA 5EN3A 1D2PA 2A2QT 3QJZA 2YQ2A 4I89A 3VXOB 3WXWH 4JFQA 2CMRH 3LQAC 5LUMA 3MV7E 2ENPA 1N10A 5DRNB 5EBMB 5CBEA 2CBPA 2YD1A 3MRHA 4FQXC 4ERSL 4DQOL 4R4BA 4PJ7F 5H8DA 3B1TA 3HZMB 3P9LB 5TE7H 3T0EB 2ZXEB 3V6ZA 4CVZB 1MPAL 3EBGA 3LN5B 1OB1B 3VWJC 3EDKA 3W37A 3CBKB 3PE9A 5JPNB 5D7IE 3RWGB 3QG6A 4PWGA 2X70A 2CU9A 3KPSD 2J56A 1R0AL 1C5CH 5CGMA 3SE6A 3FT4B 2VQ1B 3HS0A 3G5XA 1CL7H 2QMJA 4FZ8H 3KCPA 4KDTA 5IBUG 4YHZL 4HDIB 1RZFH 2ZJSH 4JHVA 1TZIB 1GJIA 2EUWA 1TJIL 2OULB 2TAAA 4ZFZA 1O5PA 1YEFL 2VE6B 5E1QA 1ERNA 3BVWA 4KMTL 2DAVA 4HCRL 4UBDD 3MRIA 1QSEE 2QVFB 1OARH 2DICA 1ZDQA 1GZHC 1Q1JH 1FF5A 1BVKB 3HMWH 4IOIB 1T0PB 1KNOB 3T0EA 4G7QB 4BWUA 1HZHL 4JUTA 1S9YB 4NIKB 3O11B 5EU7C 1QLFB 2E5EA 4ADGA 1CFNA 5DEGB 5D2LB 3VFRA 4M5TA 3EGDB 2UY7B 3MQIA 2D9CA 4HEME 3ZE0B 2YD6A 2GYSA 4DCQB 1TO5A 3U79A 1M4KA 2ITDB 1BBJB 4GSDL 2I27N 5C8JA 3HZKB 3NCJH 3NCCB 3ML9A 1J9QA 4BH7A 2F5BH 2FQGA 3QQXA 5F9WC 2YBRA 1PLGH 3ZKXC 4OKDA 4BELD 5CILL 4XPTH 3NJGA 5L6YH 3D50A 1A6ZA 2R0ZH 1X5KA 4AYSA 4W70A 5AAWA 4F7MA 1DBKH 1RU9H 2BWIA 2JWYA 4GRLC 4QRAA 3WTWA 4HKXA 1XZWA 5I5IA 4P4RA 5FECB 3O11A 1I7ZA 1KENH 2YEZB 4X7TB 2R8SH 3N41B 3NZHL 2R0KL 2KDGA 4XX5A 4JMXA 2LLNA 3US1A 1AGBB 1INDL 1W15A 4G7YH 4B97A 3LXBA 1J8KA 2G4GA 3JV6B 2EC8A 1S9XB 1L9RA 1RUKH 5AW5B 2JB6B 2JJUA 2FNBA 2QKIB 3SKJL 2OMNA 2P5PA 3HJEA 4OM0L 4M29A 4DEWA 5CU5A 4BQCA 5DA0B 1JPFA 5FW6A 1OPGL 4HIIB 2WTPA 1KPUB 1IARB 1KIQB 1MAJA 2AJ3A 3DHUA 4YDIH 4DP0X 5C9JB 4KY1L 5KBKA 3KXFA 1RD6A 2BS8A 5HGHA 4LKXB 1R6VA 1VPOH 2CGYA 2G3XA 1QNZL 2X4UB 1SDAB 1GY1A 4WNQB 1BD2A 3RIFK 2JI2A 3NGBC 5DQ9B 1U8QB 1ZEAL 3IPEA 4YBQD 2PW1B 3PS6A 4DO6A 4Y8AA 5DC0A 4W68A 4WI4A 5C07B 2JB5L 4AQAA 5CU9A 3P3TA 1L9MA 5HJBA 3NRFA 1LO5A 3QC5X 1SHMA 3GMOA 4PWFA 3V4VA 3GQFA 1QUPA 2Q8AH 3ZMNA 5HHPA 3WGUB 4GW4A 1AHWC 1SVBA 4FFWC 1YUHB 2MH4A 2FX8H 3M8OL 4KK5D 3NCWA 3QUXA 4RIRA 2CRYA 2FX7H 2NZIA 3C5JA 3D3VB 5E2WL 8FABB 4XN2A 2JFCA 5C0IB 3DMMC 3HE6C 3GI8L 5C08A 4L3EB 3B5HA 3ARZA 2COQA 5LNDA 4UT7H 2VN3A 3QUXD 3GZQA 4A38A 3IGLA 4N6QA 1NKRA 5E23A 5EIIG 2ZNXA 1ITCA 4YHLL 2DWSA 4N2EA 2F5AH 3HR5A 4FQLH 1A5FH 1E9OA 2ITCA 1J88A 4Z7UA 3BAWA 3BWZA 4DGUA 1HINL 4R97C 4U1LA 3UBGA 3AXIA 1KXQE 1KTDA 5JPNA 3FO1B 4WWKC 3QS2A 1KELH 4ODUB 3F58L 3O4LD 1D9KB 4IU3A 4LSDA 3LKNA 4XPAL 5KVFE 1CDBA 3A4AA 5EIVA 2EO1A 2WZAA 3BQUC 5CBAA 4FFTA 3V95A 4ZAKA 4JRYE 4N5EC 4WW2A 4OIFA 1VCAA 4G72B 3QH3A 4HUXA 4RAUB 4X2UA 1I8MB 4ZAKD 4B9PA 3T0BA 4CC1A 4F80A 5DK2A 4GINA 3KJ4B 1IEAA 2B5IC 4ZOBA 2NW3B 3IJ8A 4A63A 4JFYA 2V8MA 1ZLSH 1QR1B 3V0JA 1FVEA 3HI1B 3RJDA 2XY1A 3RL1A 4DZBA 1H5BA 1WZAA 1VF5C 3JWOL 4OM1H 3GXTA 5AYUH 1TZHB 4MAYC 5F7DB 3IKCB 5I28A 2PCXA 2VC2B 4I77L 3BD5A 4O02B 3NCYS 3CXDL 2UZPA 1DJSA 3B5TA 3DIFA 4G9FE 1D5XA 4Y9FA 3ZE0E 1QZ1A 2G60L 2IANB 4ALAC 2F58H 3MRDA 1QPPA 1TU2A 4Q97A 1L6ZA 3P3YA 4BK5A 1O9VA 2FB4H 1KENL 1LL1A 1J10A 2FYYA 3WJLA 5IIEB 1JUFA 1LXMA 4QAMB 1AZCA 4RGOL 1LP9E 1JMXA 2FUQA 5DYOA 1AANA 2Y3AA 3V6BR 5DLML 4JMNA 3AW5A 5DFVC 1DJGA 5IW3A 4DVBA 1D5ZA 3ZUNC 4HF5L 3LRSB 1A6ZB 1J9SA 1MIEH 3KLQA 1XR9B 5GQBA 1ZLWK 1YEGH 3EYVB 3TYGH 4X7EC 4HUWA 3ARGB 4PJ6A 4PGEB 5C0JA 1J5DA 3ARBA 3GNML 1WQVT 4P06A 4WCYL 3RKPA 5DQDH 3BT0A 3KPRB 3N1PC 1HK6A 1SBSH 4RAVA 3MGTB 3ETBF 3IK2A 2V6HA 3C08L 4YE0A 2YEQA 2Q7YB 4L8SC 3L16A 2F1AA 1KCUH 4LHUG 4U3SB 4E5XG 4CJ1A 2WVTA 2IAMB 2F8OA 3Q5YA 3DTDA 4MD5A 2LU7A 5IBLD 3WN5C 3PWUB 2F5BL 1THAA 2YQBA 3P3SA 4PTUA 3UJTL 1UYWH 2P8PA 3UDWC 3GRBA 2BM3A 1KPUA 1S46A 3KBHE 4X6BB 3KL0A 1G6RB 3DVNA 2MEJB 2WLMA 3NA9L 1MJUL 4BHUI 5JNYB 3ABGA 2CDGA 3WKYA 5AW8B 2R2HA 3FCSB 3V4UH 3A6BH 1A9EB 2FLRT 3NSJA 4JBSA 3ZQ9A 1PG7L 4N1CA 1GPOL 4AJ0A 3ZDYB 1GHFH 3B2VL 4JQIA 3CVIH 2X88A 2XOTA 3PJLA 2WLYA 4XOBA 1OO2A 4LRIC 3RTQA 1JYWA 3VJ6A 3S8WA 4UILH 2XTSA 1A02N 4QRTB 4ZMZA 4AL8H 4EE2A 1KXHA 3L48A 1YNKH 2DQEH 4U33A 4XVTH 1QSFB 2HLEB 2V8LA 2YLHA 3J27A 1F1DA 4U4IA 2WP3T 2YC1B 4M02A 2Z34A 2RD0A 4NKOB 4HS6B 3P73A 3UPCA 4R26L 3UROR 3B2UC 4P46C 5LGHL 1GVIA 4QAWA 1WK0A 1Z9LA 3SKOB 5BVPH 2W65A 1AY1H 2AXJA 1PY0A 2ZUSA 1FNAA 1OAZL 4NUMA 4F7TA 4ABWA 1WH0A 4G8EA 2MPAL 5FPIA 4KMTH 3FSOA 5DRNA 1AIFB 1JHTA 2F54E 2PPFA 2MCPL 5F70A 4C55A 1NINA 1LE5A 1IV8A 3C60A 3CFEA 4JO2H 5FGCB 1ES0A 4TF4A 1YZZA 4PPTA 3DARA 4NN7C 1SXBA 3MUHL 5L8LB 2XPYA 2BWDA 2J1YA 3QEHB 2EECA 5F7WC 3RWGA 2FD6L 1QFWM 2BNUA 4AZUA 1IGIH 4RQQA 1QNZH 3UYRH 5CGYC 3QJHB 4JRYD 1BGXL 3HAEA 3T3MB 1DVFB 1BQLL 5FFLA 1XZ0B 2VR9A 4K4KA 5EC1B 1V54B 2VDRL 3PV6B 4J2QA 5GZOD 3LZRA 2VMDA 4JGMA 4L0YA 3B9VA 1KCVL 4WKZB 4EUPH 5AW3B 3JWNH 3EYOA 2EICA 2H8PA 1AIFA 3T3ME 4OGAD 2BY0A 1UJ3C 2R1XB 3SCMD 1XF3B 1BYNA 2B2XH 5KVDH 5IB5B 4JDZA 4WLCA 4UTBA 5I1KH 2XC8A 5L7XH 2ESVB 3GEWB 4TNEA 4F7EA 3QEHA 1IKOP 1NCCH 2HT2C 4RWYH 1L4IA 2FJGA 1AXTH 4M43L 2G9HB 4V33A 1JK9B 2YIHA 1JHKH 2ORBH 3FO9B 1TZGL 2EDKA 3LHPH 1E4WL 3LVEA 2EVJA 4NBXB 4BSVB 4G6JH 1HESA 4U2ZA 3QCVL 1I8IA 1TSRA 3OKYA 3ROLB 3L3IB 3RWJB 4CVWA 1IQWH 3E1F1 5D7IA 5C0GA 5I1AA 5TJWK 3RWIA 1Y0LA 3LNHA 1AMXA 4N6RB 2R1YB 1A4JB 4N2FA 3R06B 1I1CA 4BZYA 4HUWB 3KXFD 3EYOB 1L9OA 2ETWA 3Q6FB 3BZDA 4RZCB 1CQYA 2EC9T 3MYJA 3IDMA 4YDVB 1N5YL 1MVUB 4IJ3C 1RUMH 3WDHA 3SGEI 3AABA 5A7BA 3DJRA 4C83B 2ICWJ 2OSLB 3BWUF 2VMCA 3L6FB 5FO8B 3V4LA 2YAQA 4IGBD 4U6TA 1DE4B 1YPZB 1EUTA 3QZMA 4N20A 4PBWD 2DBLL 2K45A 2H6PB 2HRGA 2NCEA 4LMQI 4OJFL 3UFIA 4DUXA 4N2MA 4BHUA 2IPUK 4ANWA 5EOTA 1MAML 4PCSA 1Q9WB 3LRLA 3I50H 1CL7L 1NDMB 3MV8A 3PJSA 4OZFH 4W9EC 1EXHA 1XSIA 2JCWA 4M8QA 4PB0H 4R3SB 5GRVL 4KXZI 2FX8L 2VNCA 4U1IB 1CD1A 4LCUB 1H6EA 3QJVB 3DWTA 2AGJL 1MEXH 2ARJA 3DSFH 5JMOC 2XY2A 2ZSWA 3O3EA 1HTYA 1MFBH 4LLMA 3QPQC 1WWAX 2XXMB 2JQMA 2BC4B 2NY7H 5I1DA 4DGWC 2Y5QA 3G5YA 5D70L 3WD5L 5D8JL 1A65A 1L6XA 1N8ZB 4S2SB 3BH4A 3S5ZA 1GC1L 3NTCL 4BKTC 3IT8D 1YY8B 2ISDA 1C08B 4J3OC 4N0UA 4QKXB 4AGPA 5HHMD 1CJYA 1QLEH 3ZYIA 4JGUA 4M6AA 4ZFOA 1NAKL 4IKIA 2WBJB 4ZFQA 2IDFA 4ZODA 4UINH 3ULVD 3FT3B 2JF1A 3VGAB 3U36A 1CD0A 1EBAA 4GIOA 5EORL 3GUTB 3IM1A 1NFDA 4KKLD 4DGYL 4AG4H 1HXMA 5EIIB 1G9MH 3UTQA 5BV7B 2Q3AA 2XVLA 4WJKB 1IGIL 2BFVH 5C0FA 3L5JA 4RRPG 5J6GB 2P5EA 4Y5VB 2B4CH 3ROOB 1OZUA 4E42B 4HETA 5GRUH 1K4DB 5JXEA 4QT5B 4L2YA 3LQMA 3EJJX 2V2TB 3K2UH 4FC3E 4FKHA 2C3WA 5D4QA 1R3LB 2RB8A 4NKDA 3JWOH 5DZAA 4YC2C 4S0TD 5C09B 2APTA 4H8VA 3QUMB 4FQ2H 2EDWA 2EH7L 1ZT4A 2OXHB 4R9HA 4NRZB 2CHXA 4P2QA 4PB9L 1WLHA 3L5WA 4WI3A 2F0CA 3VI3F 5LN8A 5FR3A 4PJXA 4PI0A 3BMWA 2I7SA 2YD8A 4D7BA 3NEOA 4ZQTA 2EIDA 3H9SB 1P7QB 2C9QA 2K4WA 4N28A 1PZAA 1ONQB 3WLBB 3C8HA 3DO3A 2G75B 1JZ3A 3N43B 5EO1B 4M03A 3NEXA 4E5XA 3L3DA 3QDHA 2IPTH 4Z76A 3MUJA 1RZKH 4GRMB 3VWJB 4ZUUA 3ZDZB 2VR8A 3BKYH 3DUHA 4LPWA 1NC2B 5T1LA 3SQBA 3QRBA 2AXGA 4MJHA 3A22A 3MSPA 1Z7JA 3DJSA 5DURD 5JW3L 5INDB 5FM4A 5DJ8A 2FO4A 3I6SA 2YPVA 3RUGA 5LN4A 3V5HB 3CSPA 1DVUA 3HRZA 3UGXA 2YXMA 1DBAH 3O6FA 1YDPA 4WWKA 5G5DA 1Y0LB 2W94A 4L3CA 5BZDA 3FU9A 1KY6A 15C8L 1Q8MA 4WF7A 5DZ9A 4I3SL 3SE9L 2ZX5A 4M4PA 2ZOLA 2DD8L 1I3UA 1JF5A 1QR4A 1FH5L 5E2TH 3VWJA 2GFBB 4G1MB 4CRPA 3FOLB 4W9GC 2WUBL 4A2FA 4B41A 1AQKL 1Z5HA 1JVKA 4JJHA 4HX1A 2C3GA 2BSSB 2D31B 5IMKA 4OLYL 3TNMB 2H3NA 4A37A 4AVJA 3EGSA 4PLJD 5EOTB 3NZ8A 4AV5A 2IQ9H 2Y22A 3OSKA 1RPQA 2IDCA 2YPVH 5DD1L 4NQEE 2ZZUT 4A7GA 3IETA 1CR9H 2FO8A 3QWOA 4U1KB 5DD5H 3SDCA 5F1SA 4IRSB 1TG8A 3VX0A 4EOWL 1VLXA 3RDTB 3X3GL 3QXVA 1J5OL 5IB1B 3HBZA 2DMBA 1SF3A 2HVKB 3DXAA 1CD9B 3OPZL 3OXSB 1Y6NR 4S1DD 1PIGA 1RP8A 1ZIBA 3ATFA 1HYSC 3S4SB 2X4RB 3LYRA 3CH1A 5DUBB 3OWEA 4JX0A 3H9ZA 2ZYHA 4MMYB 5EUOE 5HHMB 2JKSA 4QNPF 5CN1A 3QO1B 5D55A 3OMZA 2OMYB 2Y7LA 1NCOA 1SF5A 2FJUB 1LJMA 3ML8A 4PMFA 2AV1A 5I18H 3ZHNA 4GAFB 2VDKL 5BZWB 4HJGB 3MROB 4JO4H 5GSRB 2E7MA 4J1UB 5A2AA 2ICWI 2K9UA 2NSMA 1F1GA 1BREA 3I6KB 4LGPB 4P4RB 5FECA 1EO5A 3VQLA 5HHME 3BMVA 2GK0A 1YN7A 2YWZA 3E3QE 3FQWA 4BV1A 1S7RA 4PB9H 4D0CA 4HJTA 4PP2A 2Y06H 1NGWB 3T4AB 1ZHKA 3P73B 5FYKL 5JZ7D 4V1DA 3NCBB 3OAZH 2VL5B 5CHNB 4GMTH 2E7LA 3H3KA 3RZCC 1UOKA 2V2TA 3PU7A 5TE4L 3PYCA 1R5IB 5AEAA 3HLAA 5K9QI 1BBJA 1ACZA 1XXDC 1MCCA 2APFA 3KM2A 3JVGC 3ZKMD 4JGJA 3WNOA 3BAYA 3QO1A 4JN2A 4Y16D 1G9NL 1KZYA 3EJZD 2V17H 4BCYA 1OZTG 2VB5A 4Z5RB 3X12A 1WUNT 2IANE 5EORH 1SN2A 3M88A 2O5NA 4QXUH 5K93A 2B9AA 2E75C 4JPSA 4IHOA 4HKXB 1K5WA 4YHZH 5G4OA 1I1YA 1G7LB 1KCUL 4NZ8A 4Q6IA 4BINA 1PIFA 2NYYC 4OZIA 3MFFB 3L9EA 4E41A 2WNXA 2R69H 1IC5H 3PAUA 4YHPB 3FS9A 4NT6B 4ZSOA 3ASWA 4DKEL 1KTRL 1N59A 4JM0A 3VD5A 3LEYH 3MRRB 1HOCA 3D08A 3RWEA 5C0RL 4OLUH 5IMLB 5ITFB 2HLAB 4LBEB 2Z8VC 3VXOA 1N6UA 1PDKA 2AEQL 2XTJC 3IJSA 5AYTA 4QTFA 1CDYA 1AR1B 3IDJB 1MRCH 5JIHA 2ZSVA 3HC3L 4ZX6A 5AVZB 3X3FL 2VDML 4LCYB 1FI8C 5D8JH 2X4PA 4FKKA 1XT5A 2QZQA 3ARBC 1BFOB 5I8CA 1KB5A 5IGXL 4HKZB 4Z7OB 4LZKA 3V7AG 1NEZB 1DUYB 5EMYA 2A74C 3DX2A 3HE6D 3LQAH 3TEXA 1K85A 4LPXA 5HDBB 1HS6A 3MV8D 3FO2B 2Y72A 2CO7B 4L4VE 3RNKB 2X1PA 2DQTL 5C0CB 1V3KA 2C7UA 3PDDA 1GS8A 2IG2L 1MFCH 2HA1A 2W38A 1HNFA 5E2JA 1OP5H 4OD1L 3C6LD 3ATDA 4F33B 3EJRA 5ACMA 4JFYB 2WXQA 1KYFA 3UMNA 1RJLB 1AH1A 1KLFA 2QLYA 5IHWA 2HKFH 4MX7A 3WUWA 4HPHA 1Z5LB 4C57C 4KJQD 4JDVA 1S7TA 4TNVF 3QK0A 1C1EH 1PL3A 1UD3A 4NC2B 4HC1A 1ICTA 4ANKA 1DQML 1ZWIA 1AGCB 2OPCA 1XSJA 1KN2H 5JHDE 3QUYA 1ZHBA 3QNFA 5KYUA 4MBRA 5D5MF 4FADA 1NEUA 2B15A 2ZWSA 2EIKB 3A3YB 2WN3A 2VZUA 5FYJD 3ZL4L 3TPUA 1QI5A 5MEPB 3KJ4C 2IGLA 4G42A 4KJYB 4AGMA 5KSBF 2K1MA 4J6RL 2H7WA 3UO1L 3AG2B 2AQTA 3E9UA 5HVGB 1KCVH 4Y4HB 4OFYA 3VGAC 4KI5F 1QMUA 1S5IH 1J5CA 5KZCB 4FQXD 2AXFB 4FXKA 3TWCL 3D2UA 4S1RL 2E9GA 1I7TA 3FONA 3HI5H 2KS0A 1T04B 1UOWA 3BPCA 2HUEA 1UZ8A 3KPLA 3X13A 5EU3A 3QQ4B 3HTLX 2JMRA 3J7HA 4ACPA 4PBDA 4Q9QL 2PXYB 4PSRA 3UPRA 1NBYB 3KDMA 3D85D 4HXAL 3UAEA 3CFKA 4NO5B 1FYTB 1GKEA 1KEGH 3B8YA 2VW6A 4HISA 5A16A 3BPOB 1MPAH 3A6OA 3INUH 1XBDA 3PGDA 3EO1A 4FQQB 4Z1PA 4AUUA 1H0DA 5E6RB 1GH7A 4Z7WE 5E8NB 2WB7A 1IM9A 1R0AH 5FO2A 4I18B 2VDMH 2EUXA 3ARVA 3SDXA 4F3FA 5DD1H 3CDGB 4ZX4A 1RMFL 1LP9B 3GC3A 1CLZH 4MJ6B 4Y4FA 4CVUA 1JV5B 3ZZLA 3MLXL 3A67H 3SQRA 2P80D 3QDGA 2K0RA 3K4DA 1V05A 2OSYA 1GYCA 4QHLB 1X9QA 4EI6B 4IRJD 2EDBA 3BKYL 4EN3D 1TKWB 4P04A 3RUGF 1WHPA 2IAND 5GGSY 4WK4B 5A1AA 4GI9A 3EG9A 3MRNB 3V0WL 3RQ3A 4QRTA 1TJMA 3LEVH 3SE4A 3WIFB 2Y7NA 1TOXA 1O7DC 5IUSA 1XGQB 2LVCA 5IK3B 4XXDA 3MRRA 3EOBA 1N5AA 1FLTX 3CG8A 2MCG1 6CGTA 1NEZG 4FHJA 2A1WH 2DMCA 3SDXB 5KVFL 4DVRH 5LGKA 4PJBF 4JO3H 1QYGL 1L3WA 4PJ8A 2J8UA 1I1FB 2YUXA 1BEYL 3DI2B 3MRKB 5E99H 4KFMA 1BZOA 4ODSH 1N0LA 1JPST 1E4KC 1S7XA 3QQ3A 5DURB 4WGKA 3DK2A 3T77B 3B9KC 1SHSA 3FTYA 3IFPA 1HE7A 2XPGB 1S9WB 4X8GA 4TXVB 2ZOTA 1MUJA 2B77A 4NRXB 5AB0A 2X7LB 1EHAA 4ISVB 2RH0A 5D2NC 4F2ME 4H8WH 3VUAA 3D4YA 1XF2A 3QZPA 3WTXA 1AGDB 4L8CA 4ZAKB 3CLEH 1RZIB 4YVUA 4GLRI 2WXGA 4TSCH 2MNWA 4XVSH 2F6AA 4AG4L 3I3BA 2EYRA 1I8MA 5J4MA 4PCKA 4ZNEE 4YHMH 1YEGL 3NJHA 4EBQH 1EDYA 1N0XL 2CD0A 3MRMA 2HG5A 1UT9A 4EDWL 1NFIB 3D8MA 2HRPH 2HVJB 3TYFA 1Y7VA 4HXBH 3WN5A 1FZJB 4XN4A 4CA4A 5E1HB 4ZFZB 3MOBL 3IE9A 1OALA 1L9SA 1OPGH 2Y07L 4QTHA 4PRBA 1GCFA 2XG4B 2EINB 1ZLDA 5DD5L 5I6KA 1A3RL 1N68A 3TBTA 2XKNA 5EBGA 1AE6L 3DLQR 1MCEA 1MI5D 2GJRA 5BMFL 4Q9QH 1E9PB 2BHYA 1L9PA 1WITA 5KUMA 5EBLB 3AXLA 2OQJA 2ENQA 2XWDA 3AQZA 1NGPL 3EO9H 4HCIA 3LVTA 1AKJA 1FLRH 4NPYB 4TOYH 2E7HA 4L4TE 3X2QB 2Z3FA 5DHVH 2ZNWA 5CEZH 3WHXA 5T33L 1BZQK 1I7TB 3FONB 4ZMWA 1UHVA 5MEQA 2HT2D 1JPFB 2VLRD 4P9MH 3IB4A 4FQIH 2DEYX 4F27A 2PP8A 1WGOA 1TUPA 1FBIL 2LVEA 3RY6A 1FFNB 3NIFE 2GITA 4JCMA 4X8XA 5E2VL 4P8QA 1FNHA 5DRWB 3WJMA 1MW0A 4R7LA 4FFZL 1WAPA 5B38B 2EH8L 2AK4D 4NQUA 2IPKB 2YUVA 5A2LH 3FUJA 2ALAA 2ED7A 3CPLB 2YOAA 4HK0B 1F3DJ 3F58H 3S35L 4AYDC 4ZW5A 4CC4C 1KG0B 4JB9L 4YGAB 2WBXA 4MQTB 3TGXA 1LEKB 2XRAH 2NNAB 3CIQA 4WW1B 4X50A 4F3FB 1PMYA 1WBYB 4XMPL 1XH3A 1T83C 4Z7IA 2B9BA 4BKSC 5GRVK 1PY9A 2IBBA 1ETA1 1MJ8L 4U6HA 2DWDB 1HEZA 4OZGF 3RG1C 3WY2A 2JKNA 2BY3A 1MFUA 1GY2A 5E6IC 1CGYA 2PR9A 4NEHB 5BXFB 4DNLA 5I1LA 3ZTJG 5CJXA 3WYRA 1EEYA 1ZOXA 5I74C 1URIA 3S5LG 3CWGA 3HE6A 4GP8B 3S37L 2JK5A 2YZ8A 1ZGLP 4P9HL 1JZEA 1MIEL 4MCMA 5DRZA 3NQKA 4XN5A 3TFBA 1AZRA 4MZ2A 1UUNA 1W72L 3P2BA 3S8FB 3ISYA 1IQDA 3SD2A 3ULVF 3FB6B 1A47A 1BPLB 2MTPA 5CIPB 1IVLA 1NGXB 1BF2A 2JJTC 3D05A 3FH5A 3GMPA 4GJTB 4WK2B 5HYJB 4L3ED 4GAGL 3QHTC 1JCKA 3PFQA 1HC1A 2IBGA 5TD4A 2HRLA 2JKJA 3CX2A 3PWPA 4QPEA 1SDYA 4FZ8L 3NP4A 3LCYA 4WIQA 4XNZB 2QHRL 3ATAA 5DD6A 2ZXGA 3P4OA 3RL1B 4DZBB 3KYMA 3REVB 1ZSDA 1L0QA 4MB1A 1QQDA 4PRNA 5BRQA 4HCRA 3QE5A 3FRPG 3CAFA 3MBEB 2BNRB 1D5BB 4HKZA 4XPHH 3SOBH 3ABMB 5DU7A 4APXA 3O4LB 5T3XD 3HE6B 4APQD 4LKCA 1INQA 2MQ3A 2JXMA 2VDNB 1C08A 2C3HA 4UAHA 2FJHB 1Z9PA 2IANA 4FTVA 2WK2A 5CUSL 1UXSA 5SWSD 1FNSL 5TTRA 5D7EA 2R0WL 2B5IB 4HT1L 4QNPE 3QI9B 2CM6A 2QPFA 4PYGA 3BPLB 3LZQA 2O6FA 3VH8B 1YMME 2VJ0A 1N5YH 5JPMC 3CFBA 2EE9A 5T5FA 2VQTA 4W6XB 1JGIA 1KDIA 2OR9L 3T5WA 3BP7B 2J5LC 4DP2X 3E6FB 4PGDA 3PWNB 4I48B 4PV1C 2XUWA 3BKJH 4X9IA 5IB4A 5TK4A 5KS9E 3L5HA 3L3HB 2ERJC 4O2EA 2D3LA 1SEBA 3O6FC 1X5FA 1XF1A 5HDLA 1A7BA 1QKZH 1KEML 1AXSB 2HSIA 3BPLC 1HCVA 5FKPB 2LTQB 4OZGE 5ADOH 3BX7C 2XN9B 3B3IA 5ESQB 4WW2F 3VFTB 4P2OA 5BVPL 4CUCA 4LSQH 3WEOA 3ZYZA 1OTUD 1FO0A 3VA2C 1BVNT 4ANXA 2VM3A 3P54A 5GJSH 3ROLA 5B4MD 2AAVA 4RESB 1PX3A 3WV0A 4AE1A 4Q8BA 1IM9D 2Q86A 5FYLL 4JFFB 2VLKD 4FI6A 4PJCB 1FNGB 5LAXB 2BOLA 5TQ0L 3SO3C 3WS6A 5DFWH 2H1LM 1XL6A 2XNAA 3GK8L 5MEQB 3ILDA 3BPNC 4DVRL 4PV9A 4HZLB 4LQ1A 4TSBL 2N7BA 1OAUL 2ADGB 4ESKA 1UXWA 3MJ8B 2Y4SA 2F54A 1IO4C 2A77L 3QZNA 4E5XB 2X89D 3IJYB 3TCLA 3MVSA 3NPSB 2VE6A 1OP3H 4HAFA 1YNLH 4N2IA 3IF1A 3TT3H 4MQXD 2EUVA 1R3HA 1XGTB 2WLKA 4ZNCD 4HK0A 1VSCA 4NDMB 4GBXD 4NAQA 4DIXA 1G43A 2NT1A 1CICC 1G9ML 2XBDA 3L7EA 3BQVA 2DIBA 1Y07A 2HP4A 3TV3L 1E8ZA 4WRLA 5FXCH 5I82A 3T0VA 4QI3A 3L95B 3UAJA 4KJPC 4X0KB 3ZE2B 1TYJA 4BH8B 1F4WH 3MODH 4G6AD 1WZMA 1Q94B 5D4JA 3FTVA 3PHAA 4CVXB 4E9QA 1PZ2A 2UY7A 1MFAL 1F4YH 1M7IA 5E7FA 2J71A 4FA7B 4XP6L 2MHAB 1A7NH 2RA1A 3FN0H 2PYFA 3LKQA 3VCLA 1U0QA 4LSTL 1ECZA 3DHMA 3ARFD 2RBLA 2CDGB 5DVNA 1WC7B 5HHOA 1SXNA 4CSTA 2DIAA 3H7BA 2C9VA 4YDMA 2WTOA 2EXWC 5TDOA 3VI4A 1F1AA 3G5ZA 2XN1A 2GHWB 3S36X 4XPTL 3GXPA 1AS6A 1DEEB 4X6CB 3WENA 1H8OA 1W0WB 4Z0BH 3W56A 3JTTB 5GISH 2AANA 2WXJA 4TQEL 1OWWA 3DO7A 3B3BA 3MRPB 4OF8A 4ANUA 1U8IA 1JPTH 3ULVE 3RHWK 3ATEA 4H1LG 3WDJA 3QUHA 1I8AA 4OZHA 5DFTA 2DQFB 4ONHB 1PZ3A 1ASOA 1GJWA 4X4YB 1D9KD 3ZO0A 1J86A 4MB5A 2GJZA 4X80H 2FH6A 5JO5A 1IRAY 3BVNA 3LKRA 2N59A 2BS9A 4PJEE 3P0VL 3ARRA 4XMTA 5I1AB 3SPJA 5CGTA 1A7PL 3RGHA 4HMCA 4I0PB 4YN3A 3KS0J 1UZ6F 5H94A 1MNUH 2ZYRA 3MLTA 1USQA 5EV7A 4OKVB 5JA8B 1XF2B 4B5ZA 1GGUA 3CZFA 4PYHA 5J8OA 4XXWA 2WWKO 2KMWA 2P8LA 4KDWA 3U2SA 3NPZB 1W0WA 3GM8A 2FRGP 3ZDZF 4PVBA 4X4XA 4O2CA 4NNPL 3FB8B 3R4DA 3H3PH 2OSLA 3A5VA 2QQQA 1K2DB 4ZOEA 2D7NA 4K7FB 1TIUA 3PLYA 1OQXA 4ELMB 3GTVA 2R4RH 1OM3H 4M6ML 1QVOB 1XB3A 4X6FB 5GJTH 2QVTA 3AACA 3VTTA 1DLHB 1NICA 2R0LL 4CKQA 1LO0H 4G6FB 5HYQA 4DP5X 4LIQE 3BD4A 3GBDA 4U1IA 4DP7X 5DK0A 1WDAA 2BVOB 1ET5A 5T3ZH 2AK4A 4HGWA 5DR5L 2A6JA 3W9DB 3VQ1C 3II2A 4OKVA 1KTLA 3KNBB 3DROB 4HLEA 4YXKH 1A7NL 1NFDE 2WP3O 5I6LA 4NO0D 4G8GB 1N8ZA 3AT8A 4S2SA 2VXTH 4HIEB 1CDIA 4OLWL 1WF5A 3N1QC 4OY9A 2J1XA 3O2VL 2VR6A 3F7YA 3QUZA 1ETZB 2VLKE 2P5EE 4PAZA 2O1AA 5C0RH 3RRQA 2ZXCA 5FOBB 5C0GB 3MODL 4MAZA 1SDDA 3HB3C 2MRYA 3OLEA 3KPRD 2NNXA 4GAGH 1QASA 1HH9A 4AM0Q 4N22A 2WXMA 3FOLA 3OJDA 1YMHB 1NFDB 4QCIA 1UH4A 3O8XB 4RDQF 2N56A 4F7CA 4MS8D 2NW3A 2WIIA 2NY5H 1MG2C 4M7JH 1FG2A 5LNGA 2BRQA 2H9GA 4JFEA 5HHXL 3WJMB 2CNYA 3AU0A 4Z8FL 2HJLA 1LP9F 3NZ8B 1S2EA 3WDIA 1GZHA 1R34A 1ZWIB 5AW2B 4P57B 1DQJA 4F8QA 3KS0H 3PF2A 4JM2C 5CLWA 3ZL1A 3SKJH 3FQUA 1F02I 4WHTB 4XT1C 5F8RC 3K80A 1C12A 2NX5A 4DUWA 2C9XA 3VD0A 3N44B 1K8DA 1U91B 4HU2A 3W11D 2H2SC 1HXMB 1FIEA 2QFPA 1C9SA 4TTDC 2EDNA 1DSFL 3MLSH 3LKSB 5DD0L 5E7BA 4R3SA 4CJ0A 5D1ZC 2F1EA 1D6VH 3N1FC 3QDJB 1SJMA 4MA1B 2R8SL 1QA9A 4PW3A 1KBGL 2R27A 2Z93B 1XF5A 3G6JE 1E7VA 1J8HB 4F7CB 4OGQC 3TBSB 3U1PA 1DN2A 4HWEL 3AQXA 3OZ9L 5BNXD 3CU1A 3X13B 1O6VA 1CK0L 2IWKA 4JRXA 4TLSA 1HXYA 5HDRA 3VG9B 1MHPH 2K8MA 4ZFFB 1IFHH 1AGCA 2WBJD 3JZYA 2DW5A 2VZ3A 4Q0XL 4RGNE 4KPHL 1M1SA 2XIDA 4ZMXA 3GD1C 2IMMA 5CIPA 2R23B 4MVBC 1O5DT 1N6VA 3D2TA 3GSQB 3GMMA 4IMLA 3PHOB 1MAKA 2TSAA 4CW1A 2QL1A 1F4WL 1V5JA 5D7JB 1T7YA 2OR9H 3QAZB 4UOJA 5DD6B 4E42A 5C3LD 1ASQA 1NAML 2BERA 2V5MA 4JFOA 5F93C 4X6BA 1EFXB 2IWGA 4F2MA 4YSSA 5CSGA 3BVVA 3BD3A 5FO9B 4WDIB 3BXNA 1E4HA 4NKQB 4JFDD 4LSPH 2R2HB 4LSSH 3QI9C 3TNNA 3RU8H 4YJZL 4Y7OC 4PWHA 1INQB 3B6SA 4YEEA 4JZNB 3L5WB 1HQRB 5GPRA 3GJFH 5ACZB 3QCUH 3EG9B 3MRNA 5KSAD 3DJZA 5CJXC 3QEUA 1TTBA 4H0LC 5LCVA 3G9VA 1IE4A 4MXWH 3VJ6B 1H19A 4FL4C 4JHAH 5CCKH 3B34A 3L3GA 1GS7A 2NY5C 4GUPA 2HPTA 5IOPA 3BYYA 1E4XL 2XTJD 3WELA 4F15C 3MTXA 5GS3A 2CUMA 3K81A 2UWEF 1JG9A 4U1MA 5J7CC 1T1YB 1YO4A 1FCCA 1NIFA 3QORB 4LOEA 5KBMA 5HYIA 4Q2ZA 5IQ7L 2DKMA 1JWUA 4OCYL 4FG6D 4LCCC 3A47A 5FGBC 4DPCX 4ZTEA 5IY5B 3SDAD 2Z1KA 1NBCA 4RNRB 1XTMA 2O6DA 5AL0A 3O0LA 3RWDB 1OKEA 3DROA 4ORGB 1RUKL 3QXDA 3MCG1 5KSVA 3INOA 3PY9A 5CD5D 3VFMB 1NWOA 1RZGA 4BBWA 2PCYA 2FWOB 4R2GC 4MA3B 2NOYA 1EZUA 1BW8A 3CZEA 3E8UH 2ZP0T 2AV1B 4JL2A 2A4ZA 1UD6A 2JTDA 3KCWA 4JVWA 2NLJB 5I1GL 3TJPA 4U1GB 1A6VH 4WJ5A 2NY3D 4X8JB 4MNQE 4IOSA 1JWMA 4QEGA 1BEYH 2PYED 3OKDA 2OFQA 1RFDH 1NL0L 3HZKA 3NRPA 5E2UL 1BZ9B 3VFVB 4AMKL 1FGNH 5DS1A 3LS5H 5DUBA 2ZWKA 3WY4A 2H9GB 4JFEB 4DK3A 3TA3B 4IU2B 4PY8I 4FQHA 3A6CL 1F58H 3C5JB 1GYWA 4E9RA 1L0YA 3FSAA 4YUEH 5JOPD 3QDMB 3FFCE 4W4OA 1YY9D 4JCLA 5E8PA 1U8LB 1XH1A 5IWLA 5HXMA 2FX7L 4RLDA 1VKXB 5BJTB 4K23L 4R7XA 3FQUB 1ACYH 4WHTA 4A7QA 1FP5A 1Q0XL 1G7IB 2FR4B 1XR8B 2OMUA 2P5WA 3U7WH 2WGNB 4UIKL 3X11A 1BSIA 4G42B 4PJDA 1MFDH 5F88B 4DQAA 5JHDD 1E2VA 4LO9A 4K8RD 2J88H 3H54A 4OGZA 3NSFA 1PQZA 7CGTA 1I1YB 5T5FL 2R4SL 4MDIB 2X05A 1J8HA 5JIKA 4MASA 1IU1A 4Z77A 4M6OL 4ZPTB 1EHLL 3WS6C 1FNEA 2BNRE 3A21A 1KGUA 1X5LA 2VXUL 1JHLL 4XVUC 2DOCA 4LSRL 4AW7A 4AIZA 4QLWA 5M95B 3PPSA 1URLA 3O41A 3QULA 3H2WA 1FPTL 2APSA 2X12A 3VQMA 5IMMB 1B6DA 4PS3A 3LDBB 4HPYL 1IM3D 3LH8A 1AE6H 4L8SB 3EHBC 4HC1H 1FSKC 2AZAA 1BAWA 1JK8A 4LSPL 2Y5TB 1MXGA 4F8NA 4LPVA 4POUB 1GR7A 2MSPA 3KWVA 5D7JD 4OFIA 3TEYA 3TWYA 1HN1A 3LOWA 3HAEH 3ZJAA 1OGAB 3QIBD 2N3JA 2EIMB 2VKXA 3MRQB 2P43B 3GMOB 4BFIA 5KYXA 1N7ML 1VAHA 4NQCA 4AENB 4R0LA 1AP2A 2MPAH 4JFOB 3GLEA 2IXQA 1QRNB 2OMWA 3ARDD 2VSCA 1ET7A 5EA0L 3W0WD 4G83A 1FNEB 3CVBA 2WXRA 3WFBL 4L1TA 2E7BA 4NX0A 3TT3L 4RSYA 3ARDA 3WE6B 4IBZA 5LQBH 2ZQKA 1TKWA 3RVVC 4X5LA 1D6VL 4MAUH 2WAQA 4LCYA 4C54A 2ZCHH 1QPKA 4IW4C 5JOFB 3QXWA 1YEJH 3VG0L 1SN5A 5D7LE 2YD5A 4OLZH 1SMDA 4K7PX 5ISZB 2LOEA 1KB3A 1FFOA 4G71B 3UZQA 3VXRE 1SEQL 1ZIAA 4QHNB 2CCVA 2OL3L 1UADC 2WBJA 1ZT1A 4ZZFA 3WMQA 3U0TB 1JVOA 3SDAB 3DX9B 5IR1A 2B1OA 2WWMD 1MDAA 2AEWA 4IYKA 3F12A 4PJ8B 2XTJE 4B9CA 2UWEE 1DLHA 4IIQB 5CN3A 3B5GA 1N6QL 3VD7A 5IFAL 3OWRA 1RV6X 3FHQA 5E4EC 1SXCA 2BFVL 3T4YB 5HPMB 4RMQA 3IVKA 4DOHB 3SKMA 3V5DA 4KX8A 2AK4B 3W9DA 5K9OA 2FWOA 5IVZB 5DYOB 5BS0A 2FT7A 4FFZA 2NY3B 3NQIA 1W6LA 2N1TE 5SWQA 5KUKA 4A2DA 5K39A 4D0BA 3IDUA 4GG8B 1MRFL 3T2QA 4MD0A 4KVCH 5JQ6H 4P23C 4MS8C 1HKFA 4M6OH 1EHLH 1IAKB 3EYUL 4YIQA 1AFVL 3KYOB 1JFHA 1FL5A 2FJFB 4C4UA 3T0DA 3FQXB 4DGYH 4KY1H 2NDGA 1KMGA 2JJVA 1A3RH 2YPLA 3MV7D 3QDMD 2HWZH 4KHTL 5GS2D 1SLUA 1BXVA 2VXVL 3KHOA 3TC9A 1M2OA 3UG5A 5HYJA 1NCGA 2XXGA 1V27A 1G0YR 2VAAA 3MJ9H 3GS4A 3AT9A 2MCPH 2P46B 3DMMB 1NWPA 1MJ7H 5AG9A 3UTZB 2VDOH 2OKMA 3KPSE 1B0RB 1Z5LA 1D3CA 5D2LF 4OAWB 3RPBA 4PJHE 1IL1B 2G30A 5DHMC 5KTEH 3PQYA 4QJ4B 2BO0A 3VRLF 3BIBX 1E2WA 3T2PA 2JKTM 5IFJA 2GJJA 3MXWH 3DHPA 4EDWH 2VSMB 5L2KD 1KT2B 2D0GA 3SPVA 2OZ4H 4MRCA 4M5SA 3FW6A 4AIXA 4UNIA 3PCYA 4F9LC 2W91A 2DBLH 2X0VA 4R7NB 4TNFA 4PJ7E 4AIZB 3CFNA 5L4IA 1UXWB 3MJ8A 2RQEA 3TT1L 4PFEA 3HS9A 3L1OL 4GIAA 1E8YA 1DP0A 1WWCA 1XIWB 2Y1YA 3HLKA 3G3LA 5F7MC 4CADB 3PNWA 4CSSA 1H8SA 1WS8A 2QQLL 3S3JA 3J8F7 4LVNB 3HZYA 3V6OC 5FUCC 3CPLA 2X6CA 2AAAA 4OZGB 1FL3A 4KQ4L 4RMWA 2BW5A 4RMTA 1T03H 2AP2A 2QR0B 1KFAH 2K3HA 2K8QA 2W0FA 1XF3A 2OBGA 4Q58C 2QSQA 5I1EL 2B1AH 5C0ND 3I6GA 1F3JA 2GUYA 1CBVH 2JLPA 2P5WD 4B7IA 4NJ9H 3FPYA 2R7EA 4TLUA 1A5FL 2EDEA 2VR5A 4NXSA 5JHDA 4M6NL 1HEZB 2ZUYA 2ADJA 3ESMA 5DA4A 5GGSB 5F9WB 2KZ1B 1AHWA 4HU8A 3F01A 1AXTL 4M43H 4DKAA 2ZJSL 1L5GB 2AJ3B 5IT2H 3GEFA 1TXKA 3OAWA 1ZA3B 3VD3A 1ZXQA 1DVXA 4X9HA 3PUUA 4F20A 1QTYT 4NBZB 1XZ0A 2AVGA 2VISB 3VH8G 4FMFA 4ELMF 4UANA 9CGTA 1LD9B 3AJ7A 2QVIA 5GZND 4YHKL 2QHRH 3NH7H 3CCHA 5J3HC 5JDJA 1HL8A 4TN9A 4L0ZA 3CZLA 1ZLUH 3KPOA 3BJLA 1CLCA 3JT0A 3P0GB 3BZEA 1DVZA 3T09A 1A22B 3PGCB 3P0YH 2V5YA 3MLWL 5C0AE 2XYBA 4MRBA 2LV4A 5ILTL 5E1IA 1T2QH 3IGUA 2JELH 2Z31D 5ETUB 1OE1A 1MCKA 5L9DL 2VLLB 5HVHC 3QZWB 3GZOA 4EXPX 1Q9KA 4DP8X 3FO9A 3JTBA 5JW4R 4I77H 3IVKB 4XGZB 1CGSH 1V3MA 4EZMA 1KULA 5DWUH 4AH2B 4XCNB 3U30C 3DRTA 5DRXB 4DJMA 4HBCH 1HHHA 1F2XK 1IC4H 3VD9A 4JDZB 4JNXA 3K91A 5JXEC 4Y19E 3CSYA 1CD8A 1RLBA 4S1DC 4MD0B 2ZCKL 4AEIH 1HIML 1BM7A 2DH2A 3ARBD 3UDWA 2VH5H 4YPGB 1T2JA 4CN6A 1ND0A 4HJ0C 3UC0L 4U2YA 4CMHC 1JI2A 3HUJA 5HGAA 4JFUA 4LVOC 1J1OH 5AZEH 4HEPG 2GT9B 2O61A 2NLJA 3QI9A 2FGZA 3MGOB 1MHEA 4UIKH 4UOZA 4JM2D 3JQOB 2ZX7A 3LB6D 4Y8DC 3GSOB 4JY6A 4WZ9A 3MNZB 3HVDA 2FZ3A 4FABH 2R1WA 3I84A 1ZDSA 3PWNA 2IF7A 3MRMB 3R06A 4I48A 4NQDE 4TPRH 3WKNA 3WNIA 3U36B 2IDTA 3EKCA 4NUQA 3D39D 2GJZB 3D4ZA 3KLSA 7PCYA 4OW6A 5EWIH 5K9QG 2MFNA 4BA8A 3PWLA 4HOZA 4D8PA 2KT6A 4WUKH 2YFOA 2DLFL 5BVJA 3BRGC 2IOIA 2ZUUA 1AO7D 4GS7B 1A6PA 2XV2A 3T0AA 3KWXA 2GTWA 4J6IA 2OSWA 3KEDA 4G3YL 1SOKA 2H6PA 2WBKA 3QUMH 2FSEA 2QKIC 4RETB 4Y16C 4AQ8C 4OGYH 4YHLH 5EZOH 4NSKA 2VC2H 3U2SB 4DH2A 4N1HB 5GS0H 4MBOA 4MYPA 5EBLA 4LSUL 2H47C 2DTSA 3FN9A 2CUAA 5F96L 1KGXA 2Q5BA 1T6WA 2EXSA 3PJSB 2P24B 2JJWA 2GTZB 3LB6C 1ANUA 4HAKA 1VRSA 2J55A 2PCFA 4A7SA 5LGJA 3OGCA 2H1PL 1AJ7L 4UMSA 5IVXE 1J8RA 2PWGA 2BSTB 1RJLA 2KLTA 3VE0B 1IB5A 4D2NA 2VZSA 4JFPA 3P77A 4LU5L 1TYEB 4AL8C 4DK5A 1IGJA 4WV1C 5I0WA 4HUKB 3SPHA 5BPPA 4QYOB 3SBWC 4DPBX 2NY6C 4XPHL 5E1AA 2WANA 3L95A 5IHBA 3Q8EA 4UM9D 1WFOA 4FF9A 4W4OC 5DMIL 5DJAA 1XD0A 1E42A 4AVIA 4J12A 2PO6D 4MCYB 1X7QA 5TE4H 3NESA 5HSFA 2CHDA 3GINA 2PR4H 3WS3B 1XH3B 2KZWA 3BW9B 4OQTH 4N0UE 3RIAF 2CK0H 3STZB 1A4BA 2A9DA 5TQ2L 4YSTA 2D3NA 3SDDB 4DN3H