4GUCA

1.4 angstrom resolution crystal structure of uncharacterized protein ba_2500 from bacillus anthracis str. ames
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
115
structure length
115
Chain Sequence
RFLDTWRWQNYFLLHHNADFIEELAVGDLKHGDTFDVTIYTGGKDTGIVKIYQLSGNENDEINLHRYKTIYDSGLKHNYGRFVTPITKAYNPGTYVAVMKLGENYYYGGSFKISK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein BA_2500
publication title 1.4 Angstrom resolution crystal structure of uncharacterized protein BA_2500 from Bacillus anthracis str. Ames
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
total genus 27
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gucA00
4GUCA
chains in the Genus database with same CATH superfamily
2Z31B 4ZOEA 3QCTH 4ZS7H 1CTMA 3NCBB 4OLUH 5DO2C 4MJ4A 2ZOTA 4JDTH 2NYZA 3IPEA 4AGLA 3H9YA 1KYOJ 4QHLA 3Q1SH 1T20A 1C5CL 3QUZC 2WSDA 1RHHB 3GSNA 3FT4B 3ZKXB 5IEKB 3APCA 4ELDA 3BEVA 3IAGC 2LHAA 4JN1L 3BGMB 3QIUB 2IWEA 5FK9B 1EXUA 2EC8A 4F8LA 3R4RA 1JGVH 2OR9H 4PJXA 3VFSB 5E9DE 3P9MA 3FCSA 2J5LC 2B2XH 1BM7A 4X7TA 3V4VA 2X6VA 4P0DA 1TCMA 1G7JA 4K3JL 5ACZA 1L7IH 1WYJA 1UH3A 4OM0H 3EOTH 3H9ZA 5FPIA 4NO5B 5D1XD 4P59L 1N0LB 3WKNA 4NBXB 1TSHA 5CJBA 1WAAE 4X6CF 1HWWA 2C1PA 4G3YL 2AJVH 4XAKD 4JLRB 2FB4H 4DK3A 1T7ZA 3UFIA 4XPAH 1I8IB 4GO9A 3IKCA 3O6LL 4K23H 2JNZA 3DA0A 3ULUF 1PY4A 1T0MA 1FLTX 5IW6B 3BP4B 4L8SC 4UV4H 2H3NA 1AHKA 3ZKND 3Q6FA 4X4XA 4KHTL 3WMSA 1OGAD 1UH4A 1DQDH 3L54A 4DPCX 2ZUTA 5IJKC 1FFRA 1FO0H 1Q94B 1OTUD 3NAAH 2PETA 3X12B 2ZX8A 1CE1H 3LNEA 3RVWD 3PWUA 5EO9A 4V1DD 5D71L 5D1ZI 2Z1KA 4I77H 3WOVA 4NKIL 2G75A 4FQ1L 4JG9A 2V2TB 3I6GB 4JFPA 3JTBA 4Z76B 2F8VA 4PJDB 5E94A 1YPZE 3DHPA 4XMKL 3T71A 5C3IA 4FYSA 5DJXB 1SYVB 2X4PA 2BVOB 5JPMB 2J5WA 3ZZQA 2JI2A 2XV2A 5DURD 4JDZA 3US0A 4GYBA 4POUB 4HIEB 2L7UA 2QV2A 1TETL 1ZHLB 2VMJA 3QC6X 3RDTC 1J18A 4YUEH 6FABL 4ZO7A 4AW4A 1ZT1B 1MNUL 3OF6A 3MLUH 4XN9A 5E7FA 2G3NA 3AQZA 2VYRE 4PWHA 1N3NA 1P5UB 1A7QH 1P6AB 3ZIYA 3MRFB 3PWNA 1JVOA 5H4ZA 1U8PA 1AI1H 4EUPA 1EHXA 3GZQA 1A1MB 4X8JA 2O5YH 4EUPG 2J72A 4NP4L 4XMXA 1IRAY 3D39B 3HBGA 3QRBA 4A68A 1LDPH 1UA6H 3UTPD 2CMRH 2D7MA 2FO1A 4JR9H 4YEFA 5D93C 3NRFA 1HSAB 2AEPL 2XACC 3NIDF 3QNXB 1A4KB 2KQMA 3ARDB 3TLRA 4DGYH 5FOBA 4FFWC 3BGFC 1JVLA 3H3PH 4MKTA 4KY2A 4P2RB 3N91A 4H88H 2AGJL 1A6VH 3CX5K 4AV0A 4U1HA 3GMLA 3OZKA 3BFOA 2NTSP 3BH4A 3BRFA 2D7QA 4APQC 1PKQE 4YHPA 3DX8A 3T3PE 3PL6C 1CE6A 5DJ2A 2OTPA 1TZGH 5J4MA 4R2GC 4PCTA 1EANA 5FYJL 3NQKA 5I75C 3IJ9A 3OXSA 4J3XA 4LOFA 4L37B 3NESA 1UVQB 1P0SE 3FFCE 2FWOA 3IVKB 2Y7MA 2Y36H 3S3SA 1M42A 2D3LA 3RB7A 4WUKH 4PLNC 5F1OB 2HLAB 1PG7W 4HXBL 5AAMC 2QBWA 3HB3C 1AFVH 4Z7IA 4R97B 1OK8A 3L3GA 5SWZE 4TF4A 5CWSB 5F44A 4ZFFA 1CIDA 1YQ2A 3DIDA 4X0KA 1NH6A 2ALAA 1BX2A 1RZKL 2ICWI 4I7ZC 4FQ2H 4R96A 4F7TA 1T3FB 1F8TH 4W6XB 2QHRL 1FZOA 1RIUH 3GXUB 3V8CA 2MCG1 1LMIA 2M8XA 1UFUA 4X80H 1BOYA 3L5XL 1HJBC 2R59A 3QAQA 4CVWA 4G6MH 4JRYE 1IQDA 4GAJH 5EUKB 4LVNC 3D85A 5AVYB 5IVOA 4LVEA 4KMTH 4M8UA 2F08A 4R83A 4KJYA 3T2PA 1JZ3A 4I4WB 3WBDA 1CMOA 2KZBA 1AYRA 3EOBB 4A2HA 3CXFA 2XFXB 1SN2A 1KIPA 4Z7UB 2GI0A 2APTA 4OCNC 1AOHA 1FVCB 1ZLDA 4QD2E 2VRKA 5EORL 3BDYL 1ZLUK 3FU7A 3HPJB 2C8NA 3D50A 4FZEL 4I0PC 2ARJB 1EEZA 1V5JA 4YSSA 3U30C 2A9CA 4S1RL 4X6DA 1ULVA 3SE4C 1SFDA 5ITBL 5F93C 2NXYC 4YBLB 3VSQA 1A4CA 2WIIB 4TUJA 5BVPL 1RURH 4HUWA 1I1FB 5AZEH 3WIFB 4ZNEA 2AXFA 1F3RB 5EBLA 1PIFA 3KCPB 3G08B 1DVQA 4WU5B 5CJ8A 3CZFB 1I85A 1JYVA 4ZAKA 1T0NA 3VXME 3TA3A 3BMWA 3WEBA 4AVJA 3MNZA 4HOZA 4D9RE 1R3LB 2FJFA 2IV8A 5L8LB 5E6IC 1ET7A 1RUKH 1SHXA 1E4KA 2CKBH 4MNQB 5J06A 3AU1A 4KKBD 3AG3B 4UQDA 1TYRA 5B4MC 3VXSA 1W80A 3HS8A 4MDIA 2WXLA 1SY6H 2B5IB 1PFOA 1WFNA 3FTZA 2XQYG 4P3DA 3DECA 5CBAB 4F37F 1Q0XH 4AKPA 2X4RA 5AWNL 1W91A 2X09A 3S97C 3CN0A 2PO6A 4GXVH 4LRIC 4OZGF 5EBMB 4GW1A 4N4YB 2H6PA 1JK9A 4RGOH 4N1HB 2IBZX 2QVTA 4XI5D 4W9CC 4IRSA 1NMAH 4MNGA 4Q2ZB 3ZL1A 3HZYB 2ZWNA 3OR7A 4ALAL 2XHNA 4MZRA 4BK4A 4PBWD 2GG1A 5DHDA 5AZUA 5JZ7D 4YDLB 2CGZA 3KPOA 4GW4B 1WZ1H 4OF6A 1BFOA 4PJ8D 1LLAA 1AZNA 4R7NA 2FR4B 5KAQF 3S3DB 4EUPH 4RGMB 3OLDA 4F9PA 4IU3A 4HD5A 1ZGLA 1YG9A 2N0KA 3BHBB 3NJMA 1E0OB 4W6WB 1IFRA 3MUHL 3P3YA 1KJ2L 1KXTA 2A74C 3JWNC 1OTTD 4X6BB 5F89B 4XB8A 2Y7QA 5F9AC 4XPFH 4L4JA 3GDCA 1J7VR 4J3TA 1AGDA 5I2IA 5L9DH 2KZKA 3U4AA 3DO4A 4AMWA 5B21A 1BLNB 1FZMB 1XL6A 4X6FA 4BHUI 1M7IA 3KXFA 1ZLWH 1QSZA 2BPBA 3PAZA 5IFAL 3O41B 4OV5A 4MMXB 2PLTA 4YJZL 3UTSE 3JV4A 3BKJH 4N0YL 4ODBD 4FNLL 5TJWK 3FO0H 3GHBH 4M5ZL 3OAZK 4AQ1C 3QORA 3K72A 1NDMB 4HHAA 4N0RA 1D7DA 3OKYA 3QZLA 4L4TA 5H35A 1BVNT 1NAMH 1OW0A 4OW6A 2B20A 4P2OA 4Y4FB 4M48H 2OV0A 4U33A 4GS7B 3SCMC 2DBLH 3SDYH 4LCWA 4JQVC 2DL2A 4XZ4A 5D93B 1O6VA 3U9PH 3FUIA 2NSMA 1QPKA 3LKSB 5SX5K 4OQTA 3MRMA 1BPVA 4KROD 2GQHA 3CK0L 3FYIB 1K9TA 4TVPL 2IDUA 2O5XH 5EF2A 4A7QA 5HHNB 3OC5A 1HHJA 2X05A 4A6YA 4NNYB 3EGXA 3RWEA 3WFEL 2QPSA 4KRPC 4ONFH 4J3OG 2HN7A 2YA0A 3SOBH 4AYEC 3TBSB 4F58L 1NFDF 3EJZC 4MD5B 5I75B 1ILUA 3IGFA 4ZUTB 3QP3A 1QSEB 1CGTA 3LCYA 4GAAA 4LK4A 1F5WA 3OMIB 4WK4B 3UAJA 1CDYA 1J1PL 1ZXQA 4FMKA 1IGTA 3BKYH 1ZA3A 3M1OA 4NC1E 5F1NA 5IVNA 5F0LB 3Q6GL 4C4KT 1CN4A 3PHSA 2GIMA 1KIRB 3GD1C 3QCUL 4RX4A 1WZAA 4Z7VF 3B7YA 4NN6C 4QYOB 2BY2A 5C07D 5BJTA 3BUYB 3S6CA 4Y4HD 1IC7H 3KPPB 1CZ8H 1FNLA 2AVGA 3LKRA 5MERB 2EVHA 2MCMA 1CFNB 3NRQA 4IMLB 4AH2B 5IOPB 2QHLA 4AEEA 5EU6E 1TVBA 1A3LL 2QGEA 4MLIA 4HLEA 2X2YA 5FO8A 1WF5A 1KOAA 3HFFA 1D5ZB 1FZKA 1RK7A 2G30A 3CDGB 3MREA 1DLHA 4GBXD 2EEBA 2VL5A 4HJSA 4P99A 4DKAA 4JPWH 1DBKL 1IE4A 4MQ7B 3KPSD 4DVRH 5FYLE 2XTJB 2P5WA 3RX5A 2K8MA 1Q9WB 2CJUL 3RUGA 5GS1A 2R7EB 3EFOB 4JM0A 1XMEB 4P5MA 4ZMXA 3T8VA 2I5YH 1MJJA 1CPUA 4KPHH 3BESR 4KGLA 4GO6B 1A5FL 3RJDA 1YMME 1MCEA 1V7NL 2DMGA 3FUNA 1FDLH 2WYZA 1IKFH 3H4HA 3CUPA 4JJOA 5DEFB 1JPSH 2R1WB 5D2LF 4PH8A 4H26A 4U1MB 2NY6C 4JAMB 3LB6C 2DEXX 4LHJB 4N5ED 5DHVH 2F58L 2NXYB 3BPNB 1O9ZA 2CZNA 4P9HC 4KFMA 4DW2H 2WLYA 4WHDA 1O7DE 3VXUE 4NQCE 3STZB 4RIRA 2GTZA 3W39A 5C92A 4JDEA 2VLJA 5EA0L 2VXTL 2IAND 4ZW8A 4KUZL 4K3EH 3VRJA 1ESOA 5FO2A 32C2B 2DEYX 5GRJL 2LOEA 1J1OH 3TURA 4MJIA 1FA4A 4EQ2A 4UANA 4BBWA 1H5BA 3ZBMA 3ZE1E 2J21A 1I7TA 4FI6A 4X7EC 4BK5A 1QUNB 1FF5A 3D0LB 4X4KA 2H2SC 1W6WA 2WZ0A 3GB7A 3U7AA 4S1DC 1MWAB 2YHGA 4K5OA 2EVIA 5CFAA 3QYMA 2BINA 2MQ0A 4EI5D 5SX4I 4JO4L 4PG9B 5EU7C 2NY3B 3B6SA 4XVSL 1AY1L 4MA7H 3PXJA 2Y6SC 3BZ4B 2A73A 4QF1B 1I9JH 4IRZL 3SHSA 3T3ME 1HCVA 3OHMB 2YEZB 1CT8B 1W72A 4K94C 5C09B 3U6XS 1OPOA 4BDVB 5CEXA 4GG6A 2EABA 4IMKA 1TJGH 3CZUB 2Y06H 5E7BA 3LRGA 3N44F 1EJ8A 5IEHB 4NPYB 2AQ3A 2EJ1A 3LS5H 3C9NB 3CCHA 2DDQH 3IXAA 1EZVY 1ONQA 3UPAA 4W4NA 5JOEA 2AJZB 3ESUF 1U8CA 4Y19B 3GSNL 3MLTA 2JVUA 5M94B 1LO5A 3WFHB 3INUH 3DXAE 1H3WM 3EYSL 2F9BT 2J2ZA 1QFHA 3RTLA 1AO7A 4GMSL 4A7UA 3VXPB 4UDUB 2BFVL 2YOAA 5CHNA 1KXQE 5FYKU 3MBXL 5ANME 3LXBA 4KV5F 1X9QA 1L0PA 3V4VL 4QAWA 3C5ZA 3DX9B 3E3QE 1A7RL 1X5XA 1OK0A 1ZKAA 1UT1A 4XCEA 1YEHH 2RA1A 2YFNA 3HAEB 2W5PA 3UTTB 3FDWA 2WCSA 3QEHA 3N06B 5EWIL 3V4UL 4ACPA 1QYGL 5E6SB 4ZMWA 4N20A 4U1SB 2DIAA 3SN6N 3CVHH 3FYEB 1TNMA 2VLKB 3BAEL 4FKHA 3LH8A 3MTRA 4TSBL 2Y2WA 4XWOD 5I1HL 1NL0H 4ZXBD 1VESA 2VR4A 4JO2H 2W9DH 4WWKC 3TBBA 2XN9E 2J8UE 3LS4H 2R1YA 3A5VA 1E3FA 1G7LB 5F97E 2EIJB 1S9YB 1G9MH 4G7SB 1FYTA 3NJFA 2WK2A 3GSWA 5DFWH 1CIUA 3D07A 4PJFE 3SCMB 2YXWA 2W07A 4GAGL 3PLYA 2A5UA 1LK2B 3SDXA 3TBWA 3QEQB 5D6DC 5J6SA 2MPAH 1I3GH 1VF5C 2V9TA 5BV7C 1K72A 5D7JA 4TSCH 3B9KC 4M3JA 5BRZE 1FL5A 4XRCA 1VPOH 2WNWA 4KWUA 4MS8C 2E59A 2JELL 4QPEA 1P7QB 2AQTA 4G9DA 2OK0H 5I73C 1BJMA 1MCQA 2FSEA 4LAQL 3L8QA 2OCFD 4KRPB 4ZG1A 4YSOA 5C0NC 3I3BA 3AREC 1IKNA 2K78A 1CDBA 3VDBA 4A7VA 1BQRA 1Z2KA 2XVBA 5DFVC 5I6LA 2F74A 4PJ7E 2JKNA 2CO4A 3K0WA 4JPIB 4PMFA 2QKIA 3O8XA 3L3OC 4B96A 2EH7H 4NKMB 4KTEL 3UTQB 4FLOA 2MMXA 1GZQA 3AB0C 4JGUA 1OAQH 3O3BA 1REIA 1ETZA 1E6JH 2HT4C 4OV6F 5MENB 1IX2A 3L4ZA 3WELA 1OL0A 3LKNB 3W11C 4FABL 2I26N 4HEPG 4ICWA 5SWZD 3MRLB 5DRNA 2XLLA 1CBJA 1KB5A 4LEXL 1MCBA 3KYKH 1T0PB 3OZ9H 2WSPA 1GW0A 4N8VG 4QHPA 1AZZC 1EDQA 4PGDB 2NW2B 3DX2A 2ZP0T 4XCCL 3CLFL 5FV1L 3SPIA 3WEMA 1TCRA 3AUWB 1KEMH 2HFGL 4PJ9D 3UZQB 1W0YT 3AT0A 4DPBX 1COBA 1XGYH 1MJUL 4CN4A 1NJ9B 1QASA 2V8MA 5D1XB 5EZLB 3QWQB 2F7RA 5CJQH 5FGRA 4DP7X 2RTTA 3ARGA 3G3LA 1GAFH 1QUPA 3T6ZA 1XEUA 4Z7WA 5LQBH 2D03L 3G6AB 2OL3A 3GRBA 2OXGB 2R4SH 2ZNXA 4IDJL 3RQ3A 3IDMA 4FCAA 4JY4B 3GPEA 4F2MA 2GHWB 2PN5A 5BRQA 2BS8A 2QELA 4LIQE 2XICA 5CSGA 4PQXA 5IMMB 2OJ1A 3L7EA 3SKOA 1OIOA 3ML8A 1KPRA 5HYSB 5D1QA 1BVLA 3MBWA 3ZDWA 2EDKA 4JPVL 4PJCB 3VG0H 3V5DA 1W0VB 2W1NA 1N67A 1I4FA 4IHOA 3MJ9A 4GMTH 4P05A 2G9HA 4OGZA 4UU9A 4BWUA 3MCKA 5A40E 5HGDB 2IDSA 1CGSL 5BW7C 4P4KB 3VO0A 1U8HA 4FQLL 3CFUA 2YPVA 5ILTH 2YXMA 5B22A 1DZ0A 2OMTB 4TYUA 3CC1A 1HNFA 4OGAC 1IM3D 4OZFA 4I3RH 4L4VB 4OZFG 1WZKA 1CICA 4HGWB 1QBAA 5KYWA 3RGVC 3L5WA 5DURB 5F96L 3L6FA 5CD3A 3BPCA 1A7NL 1C12A 4UAOB 4J6RH 5T1DH 4YX2H 3IJSA 5CBEB 3P30H 3DGGB 2IO5A 4Q0XL 4JFYB 2OTUB 3U79A 1FUNA 4LGSB 3P2DA 3ZHLA 3BPOB 5EFIB 1BHGA 4NN5B 2X2HA 2KBGA 3HNTL 3FCGA 5JW3L 2AS5M 3FT3B 3A21A 4QRUB 1A02N 1ACYH 1EMTL 2PW2B 3CPLB 4QXGH 4CSTA 4P3CL 3WJLC 3LEVH 4OJFL 2YUXA 2EIZA 2KI6A 3GLEA 1KV7A 2DM2A 3D48R 3GUFA 5JQIB 5E1GA 3BZEB 3F7YA 4GT7A 4X5WA 3TASA 3TYFB 5IB1B 3RWDB 4NZRH 3PPSA 1VADA 4JG1L 4Y16D 3WAJA 5DLLA 1PZ5A 3NYKA 2J4WH 1MW3A 4ORGA 3VFTA 3ZL2A 4G9FD 1F11B 2CO3A 5AL8A 5ERWA 4PRBA 1BVOA 5E2TH 1P6WA 4PJIE 5GGQH 4XOCA 1YNKL 2DD8L 3BO8B 3ZY7A 4PJ6A 5FWQA 1Z3RA 4MA8H 5GGTH 3QQ3A 3NACH 4FLRA 4G7QB 4PP1D 5HVFB 1WT5A 4F57L 3E9TA 4JFFE 1PY0A 1Y18B 2Q86B 5FC9A 5CCJA 4DUWA 1NLBL 1GGBH 2JQZA 4JFVA 2BM3A 2HCZX 3M1BA 2DQGL 2UZXB 4UIMA 3F64A 4NN7B 3VFOB 3K4AA 2A6KB 5FYLH 1QRNB 4NX0A 1R3HA 4QTHB 2NX5B 4ZDHB 5LGYA 5I6PA 3OKLB 3DVIA 3BVNA 1HWHB 4R26L 3QO1B 4J6IA 4WJKB 1D6VH 1K4DB 5EUOB 4ZUUB 1EK3A 1LNUB 5T3ZE 1PGRB 5DCCA 1EUUA 3QULB 2LV4A 3FHQA 3FSWA 4MYWB 5ALCH 2PPAA 3D52A 1ACZA 3D4CA 3EJRA 3MMEB 1UFGA 3NSDA 3RKDD 3MV9A 1UWFA 2JIXA 3H3BC 1OEZW 1D7BA 4HQQL 4WLCA 2EP6A 3QPQC 1TZAA 3BVUA 1YEEH 2ED7A 3BLBA 4NUJA 3CU7A 5L4JA 3QIWC 1GGIL 2X4QA 2QJDA 2CAKA 1NINA 3V0JA 4FQXB 3R0MA 4J8RA 4FQQA 1WP6A 1U8OB 3VW3L 1NEUA 2V7NA 4NAMA 5B7MA 4G70B 1RUPL 4PV8B 3PJLA 2VLLA 4PY8I 2XWBA 2HRGA 3VRLE 1U95A 1M2VB 2PF6A 2Z8VC 4B95C 3ASNB 4I1PA 4AE1A 5D8JL 3ZE2B 4UTAA 2QR0B 3MYJB 1RK0A 3MLRH 5K1NA 2GK0B 4KMQA 3VXRE 3L13A 4PRHA 1D5BA 3LIZA 1EZLA 4H5SB 5GRUL 1U8MA 3LRHA 5E8OB 4NKDB 4YFDB 1EO8H 4ZMAT 2V6HA 4KNTA 2XV0A 3S3CB 3KLHC 3MGTB 1RFDH 2R56L 2E46A 3CXHK 1PYWA 1HHIA 3GHEH 3U0TA 3LZLA 1X5FA 2H7WA 4TPRL 1E5AA 2YUZA 1G94A 1OB1B 2UVFA 4OLXH 4Z3IA 3EO0B 3MRIB 5H4YA 2OZ4H 2VWEE 2PWHA 4N3UA 3US1A 3Q3GA 3T65A 4U1LB 2LAAA 3ISYA 3PFUA 1BFVH 1YN6B 4L8SA 1FJ1B 1AGCA 4L3EE 3ZYJA 1GOHA 5DUMH 2ZX7A 4OQTL 3FSAA 3NFPA 3UBFA 1JWUB 3WAKA 3MLYL 3NSXA 4AEFA 3K91A 3PFQA 5JHDA 3QG7L 3DI2B 3EJJX 3N1QC 3C87A 1FG2A 3LRSB 1ZCRA 4HLZH 1UYWL 2B39A 4A6YL 1UC6A 1ZK9A 2VO5A 3GKZA 1FH5L 4D0BB 1M7UA 4KVNH 2DWEA 5J1TC 4M93B 1RUML 3C09B 1I1AC 3FB6A 5I1GH 2NYKA 3V0GA 4DF9A 3ESMA 4JHWL 4OCLC 3QA3B 4BSWA 3W2DH 2A9NL 2XKNB 1W0WA 2MHAB 2VLMD 4JVWA 1T2QH 1ZD6A 3HE6C 3MQIA 3OD3A 5C0BB 3OG6B 1U93A 3L1EA 1BEYL 4O2FB 3VFMA 3NIFB 3QPKA 1ZAGA 4MQXD 1NGWB 3RDTA 1ODAA 1OAYL 1J5DA 5E8NB 2ZUVA 4FI7A 4NFBA 1YA5A 5JIKA 4QIRA 5H94B 4ZMQA 1QEWB 1KC5H 1FC1A 1UKSA 2FZ3B 3IK2A 2N59A 4PGZA 5DS2A 3WFZA 4JO3H 5D7IF 1G7MB 2MKWA 3Q13A 4OJYA 5F9JB 5FGCE 3KDMA 5DK0A 2Z4QA 2NR6C 3GYRA 1J8SA 3I6KA 3TH2T 2E9JA 3E2HB 3MRJA 1XH3A 4BH7B 2D7PA 4G8GA 2CO7B 5F7FA 5F7HA 4MAYD 3ULUC 4A7SA 4DSYA 2J57A 4WUUE 4G7VH 5CR8A 4FA7B 4LGRB 1RZ8A 5HY9A 2CA3A 3T0BA 5KBMA 3V0EA 1IBFA 3AGVA 1UKQA 4E9RA 2ZOUA 5HJBA 3ZDYB 4F33A 1LQBC 3MV7D 4PVMA 2EDWA 4YAQA 1HKLL 3SZKC 4NJ9H 4N25A 1AGBB 2UY7B 3KGUA 4HWBA 1SJXA 3PWLA 4HJGA 1JGUL 2NY1C 4YXHL 2PYED 1U8QB 3QHZL 3Q43A 5KOMC 4KVPA 4G43B 5EU4B 4APQA 3QW9A 4R0LC 4X9IA 5E2VL 5DQ9A 3PL6A 2I24N 2NZ9D 3L9EA 4R90L 3S3JA 3QJXA 4OJAA 5EC2B 4CMHC 1NAKL 1N64H 4PRPD 4ZMOA 4GKNA 4UOZA 2Y07H 3SDCC 2YGOA 4PJGE 1OSEA 4ISVB 4N0CC 2CKBB 4KROB 4PJBE 5PCYA 1HYRC 4N6RA 1URIA 1CTOA 2J56A 3IKKA 1DSFH 4MCYA 2I9TA 3SGEH 4ZSOA 5B7FA 2DWSA 1DUYA 1KBVA 3TIDB 1NBZB 3BP7A 4U6HA 3CFDB 3S36L 1IIIA 1JERA 5GZNC 3QHFH 1LWJA 4HUCA 2IPUK 4FXLA 3C08H 2LLNA 4NKOB 4X9FA 4Y2DD 2HKFL 2NW3A 4BFJA 2UXGA 2Y7NA 5DK2B 2C3VB 2BP8A 1CXIA 1XO8A 1UXSB 2LTQC 3PHOB 1OARH 4M7LH 4NKQB 4P5TB 2IMMA 5D7LD 2XWCA 4AL8C 4I0KA 4LSTL 1RVFL 4B27A 1E9OB 5L4FA 3WGUB 1DQLL 5FUZL 1EHLH 4LSSL 4DKEL 1RU9H 5TFSH 3B2MA 3DV6B 1TTRA 4LIQH 1G7HB 3GRWH 4M8QB 2R4RH 4B3EA 1W72L 4NO0A 1WA2X 4KO9A 4Y4HB 1UCTA 1VACA 4OVVA 3V6ZB 3X14B 2QT6A 2BP0B 2IOIA 4WI7A 1OSPL 3FMGH 4WNQA 5T1KB 1S9VB 2NQCA 1P6FA 2QLYA 3H6JA 1A7PH 25C8L 3R18A 4C56E 3IDGA 4XPBH 4PRAB 1H8OA 3HZMA 1CK0L 1UASA 4OR1A 4UOW1 1F1DA 2E7MA 4I3GA 3DGDA 4L8DA 3I6LE 3QDMD 1U3JA 1JUFA 4RMRA 4I0PA 3KPSB 4JFTA 1YEJH 2NXZB 3RFRA 3UYOD 1A7BA 4QCIA 1NSNH 3MUY1 3SE4A 5IQ7H 2DEWX 1Y7VA 4PJ5A 4KI5F 2WLIB 1TDQA 3HUJB 4W9LC 3DUUB 3QS3A 1C8QA 4PGCB 4QNPF 5DD0H 5D5MF 3HG0A 4A2FA 1XR9A 3BUPA 2AKRB 2X0WA 5KSBF 3FQXA 3OKDA 4W93A 2WLMA 3ZHDA 5HPMB 2OW7A 4KJPD 4YHLL 1P4LB 3IPFA 1R3IL 3VFWA 5D4IA 2E8ZA 3QUMH 4YHML 2W9EH 3EGSA 3P4MB 5E23A 2H8PB 3F6IA 4PW3A 5E6IA 3TH3T 4LSUL 3HCVA 4Z23A 4PIBA 3BAKA 5MHSE 4GXFA 4FFVD 4OF0A 3A4AA 2D73A 1HE7A 3PQYA 3ESNA 4E0RB 1U2HA 5CCKL 1I7RB 1MI5D 1KGUA 3QDGE 4ETQA 3TT3H 4MMZB 4DGWC 1HQ4B 1WAPA 3FT2A 2RAMA 3MOAL 3OPUA 3MR9B 1P7KB 2IANB 4DN3H 3TCLA 5I1IH 5E9DB 2GJ6E 5EBGA 2VM9A 3AUVA 3OR6B 2ZF8A 5BRPA 4LRIA 3UH8A 5JIIA 1NC4B 2WN2A 5EU5A 3RE0A 4KI5E 3HS9A 3J8F7 3RZCD 3VXTA 4EKXA 4YBHA 5L88H 3F65A 2A7BA 1MWOA 5D5ME 4ODUB 1RPQA 1ET8A 3OJVC 1YY9C 4MS6A 2ENQA 4B60A 4PLJC 1QLFA 2E6PA 2J1WA 4LEOA 5F7NC 3VWJC 5B8CA 4DP9X 5IV2A 2DAVA 4X8GA 3LV3A 5KSBE 2ZXBA 3OX8A 3AC0A 3F6LA 3H8NA 4LSVH 4WO4C 5CIPH 5T1MA 3WNIA 4EI5B 4FHJA 3AS0A 3BQUD 3FUEA 3BIAX 1ZSDA 4DGIH 3D69B 2O26U 4N2OA 3MTXA 3SDDC 3FOMB 3W0WD 2A1WH 1KJ3H 1MFCH 3M7FB 5JR1H 2A74A 4YHZL 2FX7L 2J8HA 3HG1A 2DBJA 2WXPA 4ZPVB 1OM3H 4N2AA 5T3ZH 3UBGA 3NGBB 3AWEA 3FXIC 5E4IA 4DP4X 1MHCA 5D4QA 3VYPA 1NMCC 2ADFH 4F3FA 3X1GA 4QI3A 1KB5L 3UEZA 5HGAA 4IIQC 1I7ZB 4Q56A 5DJ8B 4BA8A 2ATAA 1YPZB 2HLFD 5DJCB 3JT0A 5K39B 4L0ZA 2YSSB 3SDAB 5FO9A 3CNKA 4AQ1A 4N8CH 5CAYB 2I60L 4H4NA 2YGPA 2MSPA 2BW4A 1NCGA 1GOFA 1MJ8H 4LPTA 4HPHA 2BSEA 1I9RL 2GUYA 4JFQA 1KCRL 3D0VB 3KG5A 3QEGL 5KBLA 4TQ8A 5I19H 3T0XA 4A67A 3HKFA 4JQVA 4LLYA 3B3IA 3L08A 1CI5A 1X7QB 3GNML 2OL3L 4N2MA 3VFNA 1F1AA 3GSUB 2IGFL 1OQOA 1SEQH 3CDZB 3UP1A 3IFLL 1ZT4B 5CJXC 1XF2B 4JM2D 4FHBD 2AI0L 3TZVB 5SWSE 4HUMB 2FUTA 1J05A 1CLOL 4PV9B 2X88A 3J7HA 4EKJA 1NUNB 3NP4A 4YDIL 3GSRB 5I16B 2WIMA 4U7SA 2GI7A 1MG3C 3MJ9L 1SLWA 5IT2L 4EOWH 1FGVH 1EEUA 5GRWA 3BWUF 2Q8AL 4NQTA 1BZ7B 5DA4A 5DWPA 5I5JA 5K9OA 2WZPD 2YPVL 3DX4A 4L2YA 3CLEL 2G4EA 4U1KA 3L4TA 4OFYA 1UUNA 1XXFC 2VDMH 2EEAA 3QNYA 5T5FL 5I24A 3U1SL 1PKQB 3BRGC 3T3PB 2OYKA 1DO5A 3UTOA 5HDQL 5DJ6B 4MMYA 4RRPA 3ECVA 3FF8A 3R1GH 3UG3A 3KPRA 2JKJA 3A6OA 3BISA 5KJRH 2FIKB 2C34A 2D7NA 5FECB 2WBXA 3D5OF 3LDBC 1DQVA 1B0GB 3WN5B 3HNSH 3W9DB 2BOCA 2BSTB 2VDLL 3P3SA 1SDDB 4FL4B 3D2UD 4OLZH 4O02H 1NBYB 4H40A 4MWFA 2JJUA 5SWZB 1OB0A 3MUGB 4BFIA 2FCBA 4P07A 3FQWA 4TN9A 1P2CB 1W8EA 4OLYL 1DCLA 1NLDH 1A6AA 1O5DT 5DFTA 2WKOF 1U21A 5DVMA 5LGHL 4H2AA 2J6EA 3K8KA 2F8XC 1IAIL 1P5VB 4FQJH 3S88L 4TUKL 1JL8A 1DBMH 3L4WA 4YHKL 5F9WB 3Q2NA 3TVMD 1AP2A 4PJ9B 4U4BA 1KFAL 3UYRH 2OR7A 1SXAA 1KN4L 2IAMA 4P48A 4JY6A 1JK8B 4TNGA 5KG9A 3V4PH 4RMUA 1C08B 4JRYB 4HZLA 1S9XA 3ZZLA 4XE5B 1J88A 5I9QC 1NCWL 1XVSA 4RQQA 3HG4A 4HALA 4RAUA 1SN5A 4JFZL 5DQDH 2FJGA 1ORSB 4KMLB 5FO7A 3K6SB 3RBGA 4HG4K 2QFPA 1MCPH 4WWNA 3FCUB 2DQCH 4HUVB 1E9QB 4QOKE 2F54A 4G72B 4LBEB 4N2NA 2HWZL 2Y22A 4FTVA 4AM0B 3QH3A 3V7AG 5J9PB 8FABA 3BSHA 4U1IA 4EDWH 4E5XB 3DX6A 3EH2A 3WD5L 1KXVA 2V5TA 1GOGA 4XHJC 3P4NA 4R8WH 4P2QA 1NFAA 1AXSA 3M1CA 3K4DA 4AIZA 3W5MA 3KR3H 3MRBB 5TQ2L 4CU8A 5GGUB 2GKIA 3HE7B 1LMKA 1UHVA 4YDKL 3VX1A 5DMJB 5C8JB 3H1ZA 3THMH 1X5ZA 3SIKA 3ZTNH 3LN5A 2CPCA 1TMQA 1HINL 5CMAB 2B0SH 5EIIG 4EPSA 3MRNB 2YPKB 3FRPB 3GUTB 4J4PC 1IM3B 4QRSA 5IG7B 5I1JH 3NZHH 5HYJA 2EZ0D 3VFUB 1KYDA 3V5KA 4YHIA 3SYOA 3FT9A 1UD8A 4H8QA 1QQDA 2PP7A 1R5IA 5F9OL 1CD1A 1U3HD 4RFOL 4F7CA 1ZHNB 4HS8L 1K8DB 3ALXA 3IAPA 4K3DH 3VWJB 7PCYA 3EO9L 3GM8A 4TNEA 1NEZB 3IMTA 4HS6B 4GOSA 3OSVA 5TF1L 1KLFB 3T6VA 2XC8A 2VLRA 4UTAL 3F3HA 2BNRA 1G43A 2DQDH 2IXQB 3F58H 3EJTA 4AC2A 5BOPA 2EDXA 3LIZL 4OUOA 2PCFA 3GBDA 2Z9TA 1E28B 2BOBB 3UG5A 3L5IA 3ZTDC 2GFBA 4LLDA 4KAQL 4KO5A 5KANG 3WNLA 4IBUA 5ENWB 3JTSB 2PTTA 5EOTB 3DTDA 3V0VA 3H42H 2O4EA 3HHSA 2VDRH 1HT6A 1M7DB 1GKEA 2IQAA 1GY1A 1PJ9A 2VN7A 4X99B 5MI0B 3P4OB 1D5MB 3MFFA 3FUJA 1BG9A 3VJ6B 4AQ8C 5C6PB 2P80D 2ADGB 2WBJD 3MJGX 4WDIB 4U6YB 1VJSA 3K8MA 3LZOA 1MAKA 3EOAB 1HZLA 3JVGC 3IYLW 4WWKA 4OCMC 3RPIA 2XIIA 4Q9QH 3QS2A 3E3QC 2VISA 4MTMA 3ULVD 3STLA 3DIFB 1DANU 5F8QC 3LY6A 3R0NA 1B0RB 3NFSH 4XP4L 1YQVH 4TTGA 2R8SL 3CLWA 2OMBA 2RR3A 1ZS2A 4YSQA 1IGJA 2FYVA 5D6DA 3ZR5A 3RWJB 3L4XA 2C4FT 3UTSB 4WW2F 5GGVL 1TSRA 4Q97A 5C0JA 3AAZA 4PFEA 2F8IA 2UWEE 3B9KA 2W81C 2BZDA 3H2PA 1EHKB 1C5CH 4D9LH 3UYPA 3WXWL 4UQBA 2I7OA 3FU9A 3NJHA 5D1ZD 1Z9LA 1ZGLM 3JT2A 4N6QA 4X2UA 3X3GL 1TVDA 2D0HA 2DN7A 1PW3A 5I71B 4LPYA 5TDPB 5B38A 1IAII 4KI1A 5FFOA 3ECBA 4NENB 1DCEA 4ELKB 2NYYC 1D9KC 1JDAA 4DP2X 4UINL 2ZUUA 4NRXB 4NQSB 4BGLA 4K3JH 4TULL 4AT6B 1DBBL 2X7LA 3MJ7B 4KJQD 4UM9D 2EUZA 3GDBA 3L3OA 3U0PA 1GYWA 4Z5RA 4P59H 4ZFQA 2ZUSA 1HI6B 3MODL 2UYLA 3LKPA 4L05A 3R8QA 1QATA 4G3YH 4FS0A 2WXQA 3BP6A 4KXZI 1CFTA 1AS8A 4OGXL 3PWPE 1F4WL 4WNSA 1EFXA 3DO3A 4Y1TA 5AW7B 5GS2H 5KSAA 4IQHA 2HFEA 2C7UB 1F4YH 3MOBL 2PXYC 2ZXWB 2YC1B 3ABLB 4KHTH 5AKRA 1U33A 3TEYA 2GB2A 4A63A 1RL1A 2DQFA 3J07A 3O9WC 4GXUM 2GT9A 2WQAA 5EN2A 1NM9A 3CXHJ 1WBYA 3EYOB 2EDEA 5L2KD 1JZEA 1DE4A 3NEXA 3QIBC 4S10A 5D71H 3KM2A 1WC7A 4BQBA 1HH6B 1NGQL 4YK4C 5I1KH 3VXOA 4WTXA 4NKIH 2YWYA 1QNZL 4XPHL 5CN3A 4FQ1H 4HWBL 1HDMB 2VQUA 4IEFB 5MHSD 2ZWKA 4PRNA 4UDTB 1XGUA 1J1XL 5EU6B 4XMKH 2AQNA 4DZBA 3QWRD 1L9OA 3IM1A 1A9BA 5F3FA 2J25A 4WKXA 1RZJH 1SEBB 3CFJB 2NY0C 2NY7H 5GISL 1OQXA 3EYFA 5DF0A 4DO4A 5ID0A 5JXAH 5E1HB 3V79C 4WEUD 1CYXA 1MNUH 1ACCA 3DX7A 3TV8A 3AXLB 4UNUA 5J12C 2DH3A 4JB9L 2Q7YA 3SPJA 2V37A 4BRVA 4DEPB 2VZVA 4GP8B 5BW7A 2QTVA 3N41F 5IHLB 3W5NA 1YMMB 3OGCB 5EBWA 1I1YA 2M1KA 2CM5A 4NP4H 3TO2A 4LPCA 3FFDA 3I2CL 2SEBA 4PB9H 4HKXB 5CS7A 4D3CL 3S98A 3RGVA 3SJVE 1OSZB 4Z7QE 3RIAF 2IFGA 5HGHA 4FOMA 3WE6B 1E5CA 2WM0A 2AEPH 4QRTB 4Y1AE 3TT1L 5E6YA 1PX4A 3IETA 4NQCB 4WSKA 1JF6A 2ZD0A 3GMQB 4N9OB 1E40A 1NC2D 1T0OA 2GJZA 3HMXA 2H3XC 1VKXA 1LD9B 4X4ME 2AGJH 3QFJD 2ATPA 4PJXF 4RZCB 4IBLT 2FL5A 1F42A 1KN2L 3IFNL 2EAEA 5KS9F 4I18C 4MKMA 5IBUB 2V7HB 3WJLA 1T66C 2DYRB 3VI4A 2IADA 1IAMA 5T3XD 2JB5H 3ZE1B 1HILB 4ONGL 4YGVA 3K8LA 4PJAA 2BSRB 1TVHA 1AHWC 2LQRA 4MA1B 1CU4L 5FA3A 1DVFB 3IFPB 4QRAA 3EJCA 3UPCA 5CLWA 2APSA 4IOIB 4LBAA 1NDGB 3KVQA 4JANA 1MH5B 4E9QA 2CDFA 4NQED 1XXDC 4LDEB 1F4XL 5TGBA 5DQJA 1ZHKB 3RLSA 1FYHB 2GCYB 3A3YB 3FQNA 4HXBH 4JREB 2A38A 1X4XA 4JZJA 4NZFA 2O6DA 5F7MC 5BZWA 5IB2B 5DUJA 4HWZA 3T3MB 3VNYA 2JB6A 4OZHF 1KGCE 3QJVB 5KYXA 4J12A 5J13B 4PU2A 3BAXA 4XVOA 5AKVA 1RZKH 3A67L 3L9RA 2PYEB 5H2BB 3LTVA 3EF7A 1FVEB 2EILB 1X5JA 3FNKA 4LLAA 2HT2C 2FQFA 1JWMB 1NBVL 2JJWA 2JSFA 4L9DA 1G7IB 4PJXE 4YBQD 2QHRH 4BZ1H 2E8YA 3ETTA 4I9WE 3A6CL 4G6AC 2DYPB 1VCBC 1YEFL 3DXAB 3RTQC 4HPYH 3DROA 2EVJA 3DTXA 4HYTB 2GBUA 3L5XH 4EDXB 5LBSA 1I8KB 3NCYP 2HP4A 4MHHI 5C7ZA 4OKVB 2K7PA 3W37A 3QJHB 4KK9D 5ANMB 1IQWL 5LKNA 5F7EH 3H9SD 4BEIA 4JZOB 4U1JB 1OTSC 2WWKO 4XPTL 1WA1X 4P06A 3EDDA 4G6JL 4Y2DB 2APXA 2EE6A 3G5YB 4WFHD 4KKRA 5EORH 3CFKB 3OB0H 3IWVA 4X50A 2MEJB 2X6CA 4GQPH 2QZ5A 5D7LB 3LPPA 3N40P 3REWA 4FZEH 1RZPA 2JXMB 1UOLA 1Z1WA 3DETD 1N68A 2GSIB 2WYTA 2V2XA 3QIWA 3TNNB 1YVLA 4P04A 5I18H 2UV3A 5DC0A 1C16B 1O7SA 5ITBH 1SOQA 5BVPH 4YDJB 1SVCP 4DVBB 2R0ZL 2XN9B 2J8UB 1BQKA 5TE4L 4WGWB 4XE0A 2ICCA 1F13A 1R17A 4Y2OA 3UC2A 3GJFA 1SXBA 3E0GA 1INEL 2WQUA 4PJFB 3U1QA 4CN6A 3VD0A 3RAJL 1VIWA 3B9DA 4C83B 5HXMA 4NQDA 4LVOC 4PWKA 5A2IH 2XWTB 3PDGA 2A0LC 2OTWB 3QDMB 5BRZB 1TLKA 2KZWA 5FYJD 1R5WA 2B4CC 1NAMA 3BWZA 1EJOH 5DWUL 2VXSL 1AS7A 4X5QA 4DT2A 2N7BA 2Z91B 5A2BA 4JM4L 1F02I 1OE2A 5L8KB 1Q1JL 2DZEA 5AW6B 5GSVB 3IS1X 3W9EB 4ES8A 5T1LA 1LILA 1PLCA 4F1ZA 5FKAA 2BRQA 3JWDH 3ZN6A 5AWNH 1CC3A 4ZUSB 4G6FD 3VI3A 3GEWB 4PJ7B 5I15H 3POHA 5LLIC 1RZGB 4NXSA 4PREB 5HHQB 2BH0A 4MRBA 5EZIL 2X4TA 1YEGL 3SY0A 2VR9A 3ZYOA 1BG1A 2OULB 4ALAH 5ISZD 5E2WL 2WAHA 3QFDA 4J23A 4Z77B 5GZOD 1AJ7H 2IH3B 1G5GA 1X44A 2NCMA 4O58L 1MI5B 1X5AA 4G1EB 5F7DB 4Q6IC 1HHKB 2QGBA 3V52H 2AV7B 2AC0A 1S9WB 3RB5A 2VWEC 1V54B 4Y9FA 1KJ2H 4EMZA 4R7LA 3O2WL 2WYHA 4OF8A 4NFDA 1FNSH 1KDJA 5KSVA 1CG9B 4MB3A 3NCJH 4N2IA 2F53A 1JYXA 3QHTC 3POCA 4OM1H 4N90E 1WTLA 2XOTA 3HE6A 5FLUA 2YJQA 1E43A 1MCLA 3NEEA 1YSOA 2X4UA 2X2UA 4ZFOA 3RVWC 2ED9A 3BYTA 3FH7A 3MNMA 3P69A 3T9WA 5F0MB 5SX4H 4PY7A 1WWWX 2A99A 2H6UA 3L1GA 4M5ZH 1FV1A 5AOMA 5CGMA 1QFWL 2H9GA 1AD0B 4PVLA 5AW1B 3S5LA 1I3RA 5HDBF 1TTUA 2PPDA 5H37G 3KJ6L 3C6SB 2W38A 1BF5A 1WUNT 4WW1B 1TUPA 5GJTL 4X6CA 5G55A 4UMSA 2ZCKL 4NNXA 5C0IB 5BS0D 1ACXA 5TTRA 2NR6A 2O6EA 1S3KL 3QXAA 4WJ5A 1N4XL 1X5YA 3N42F 4WI8A 1LO4L 3WFBL 2HTKC 5I76B 1M05A 1JXFA 4OTXL 4IK6A 3IGLA 3TTSA 1YUHA 3CK0H 5E08L 5AYQA 5JOFA 3WEAA 4HPOL 4A7GF 2J6EL 3FO1B 2BVQA 5DHVA 4CN1A 5IREA 3D30A 1VFAB 4U31A 1H15B 4AUJA 1OSYA 2OMZB 5JIHA 5KVDL 3SE3C 2BZCA 5BZDB 2MWCA 3ARFC 2R29A 4GRMB 3JTTA 3S4SA 4O00A 4Q52A 3LMJL 4DZ8A 4F58H 4R3SB 1B9ZA 1D6EA 4WF7A 2LT9A 1KTCA 3NT0A 2VDKL 1H9VA 4JFOA 4JN2A 1NGXB 4WTWA 4R0LA 1WTGT 1FVDA 5F1IA 2VIRB 2X4NA 3Q9PA 4M7ZB 3CC5A 4P9HL 1VFBA 4ZMNA 4N85A 3QYNA 3QUMB 4IOSD 2H0PA 3SDCA 5DMIL 1S7VA 1JZGA 3F7RA 3HNVL 3Q6GH 4LCVA 4X6DE 4GSQA 3QCUH 4WI0B 3GXPA 4ZTPL 1F00I 1ED3B 1ZHBA 2EIDA 1K4CA 4ZNEE 5LAXB 1AZBA 4XBPA 4Z6AT 4ZO8A 1U8IB 1QVOA 5GZNA 3QYCA 1S7UA 1FE8L 1A3LH 3AM8C 4I8DA 5DJZA 4Y2LA 3RIFK 4F8QA 4PJIB 1O9VA 5AG9A 2ICEA 4JG5A 5IW1B 2DQHL 1MHHB 4W9DC 3HLAB 4ZMLA 2R0LH 1DBKH 3DURB 3QAZB 3B2XA 2VDPB 5E4OA 5ACMA 5FOJA 4JFFB 3VXSE 1FN4A 2CJUH 2WNXA 1ZY9A 3ZYZA 4Y4KB 3D18B 2EO9A 3RL1B 4KRMB 1M71A 3DVNB 3BLPX 4K94L 1U8KA 3ARSA 5TH2B 1A5FH 2VAAB 2EYRA 3O3EB 3L3IB 4Z7OE 5DC4B 1KCBA 1V7NH 3VQMA 2VQTA 3QJZA 3IU3B 2RFXA 3QJTB 3K6NA 3QUXB 5IMLB 3MLPA 4ZX4A 1KTKE 1OCZB 2Q8BH 3WDHA 1IAIM 2IJ0C 4JFHD 1JGVL 4MNGE 5IKCB 1WCBA 4PJEF 2F58H 2G5RA 3UEQA 1BP3B 2B2XL 4NQVA 4IS6B 4O5LH 3WL9A 3K1KC 1L7IL 2YD4A 4NSKB 2Y5TB 1T22B 3O3DA 2YMXL 2DMKA 2FO4A 2OM5A 4XMTA 1N18A 2BCKB 3ES6B 3IDNA 5FUOL 2Q10A 1JZ8A 5EA0H 1MVYA 4TVPD 1KTJA 2YAEA 2FB4L 2VXTH 1IILE 1JNHA 2DQMA 1ZWIB 3RRQA 3CVHA 1BA9A 4E9YA 4KXAA 5IF0B 1KPVB 1WBXB 5AVQB 1AZCA 2ZUYA 3E80A 5GRJH 3TVMB 3BGMA 1HZKA 1T5WB 3PJNA 2VXUH 3QISA 4FYQA 1UB5B 3SQBB 3TONA 1YUKB 2IBGA 5INDB 4W9EC 3B1TA 2W65A 1XSJA 1FO0L 5K59F 4PD4K 1MFBL 3KXFE 4OIFA 4J3OF 1GCYA 1C8PA 2A83B 3D06A 3EH3B 3N6YA 4JO4H 4HG4J 2HAZA 5L0QC 4LLQA 2LFGA 1PKOA 5FA4B 4XVSH 1AY1H 3ARRA 1U30A 5LGKA 1E4WL 1QFWI 4IRZH 1A8ZA 3N3EA 3VXRB 3VSTA 1NIDA 3BLKA 3ZMRA 5J6HA 2DLTA 3BXNB 3QO0A 4QJ4B 1A6TA 4IBSA 4L4TE 4MFHA 2OYPA 4IHBA 4EZLA 1E2WA 5BV7L 2OQJB 5F6IB 1VEPA 3C60B 4LCWE 4IYKA 5B1KA 3NFNB 12E8H 3V7MA 2C1OA 3ECWA 2VE6B 4UT6H 4LVHC 2E5EA 3CVIH 3EYSH 3SE8H 1WBZA 3BDXA 1XF3A 4WO4A 3LXUX 4WV1C 4QRQB 4X4YA 2BFVH 3QZMA 3MBXH 4XNBA 5E1QA 5K59E 4AW7A 2MQ3A 4L3EB 3V4VH 1NWPA 4D0DB 2LW3A 3TCXA 1KEGL 1AI1L 4KI5C 2WWMD 2FX9L 3VE0A 1K8IB 3NZ8B 3QI9D 4E41D 3ME0B 4N26A 3MROB 3BPLB 1QW9A 4WCYL 5EWIH 1YYML 5DTFA 3V4UH 1UA6L 4YO0A 4LLMA 2CMRL 1L3NA 4GLRI 4JM2F 3E6HA 1U42A 5FW7A 4HIEA 4JZNB 3FKUS 4JUTA 5JZ7C 4FJZA 4NM8H 3BAEH 1ZHLA 5I1HH 4PJ8C 2VERN 3NN8B 4PRIA 4TSBH 5F6HJ 3VRIB 4AVKA 2FD6L 1FFPB 2GJJA 2Y3NA 2YD5A 2KDGA 4IIQA 2NY4B 2CDEB 3I9PA 1ZXKA 3H3PL 3IGAB 4MYPA 3IF1B 1P5UA 3VM5A 3G9AB 5D7SL 2Y6TE 3D08A 4Z1PA 4UILH 1OLZA 4UQ2B 4PR5B 2VR7A 3E6FA 4U3SB 5DUBA 4GAGH 1A1MA 3TXAA 3UOAB 4GG8B 3WLWD 3BDBA 1BQHB 1FNGB 5FDWB 4DN4L 4Y1AD 1WJ3A 2VQ1B 1TZGL 1QA9A 1S7QB 1RZJC 4H8VA 1IGFL 5IMOB 1ZVSB 4OZGA 1MCFA 3MRDB 1G7QB 3GTNA 1CL7L 5CKAA 3WTSA 2JELH 4LDCA 2X9YA 1SNRA 1J87A 3IMBA 4HHGA 3V4PB 4LHUD 2P5WE 1Q9OA 5CJXA 2J12B 2X4OB 5IWLC 3IE4A 2VJ8A 4ZOCA 2NNAB 4DO5A 4EQ3A 5K9KB 1ZA6B 2ITFA 2X0VA 3DRQB 4QRRD 3KW8A 4TSAH 3NCYS 2B7DT 3FONA 1ZTXL 5B1JC 3T6WA 1Q72L 2EYSA 1NZRA 4KTEH 2QQKL 1EZVX 3CH1B 2IH8A 3V5HB 3O4LA 2B14A 4NQXB 4TLUA 4F8PA 4F7KA 2Z6FA 1RIUL 5HHOA 1OALA 1UGNA 3LZNA 5HI5D 1HZHH 1TTBA 1S78D 4FXKB 2G5BA 2OXHA 2YD9A 1BAFH 3K3QA 4LP4A 4OAWB 1F18A 4OIBA 2J1KA 5D1ZB 5E4AA 2VNCA 4LEXH 2XZAL 4LL9A 2HLAA 3UC0L 1Z0MA 2VLJE 2BO0A 1F1GA 2ZG2A 5IM7B 2Z93B 4P2YA 4XCCH 1TITA 3CLFH 5FCSH 4ENZA 5E51A 1MSPA 5IR1B 7PAZA 3L5JA 5A3ID 4PJGB 4Y2NA 4UM9B 5IUSA 4MJIE 1MJUH 2YBRA 4PJBB 5GGRY 3HMXL 4PI0A 1T3FA 3T77B 1KSRA 4Z0XB 1BBJB 4JMXA 4TNWF 2D03H 4YR6B 5JLZB 4PTUA 5CD5D 3U48A 4HCGA 3TGXA 2WZ6A 5CSBA 1D7CA 3C6LC 4XNMA 2XKSA 2X70A 4LSPL 1ZLWK 4FC3E 3DVGA 2R69A 5CEZL 4GG6E 1MOEA 3KYMB 3WS3B 5L8JB 2PR4L 3DLQR 4UOJA 4ENEC 2R1XA 2P8MA 35C8L 5HI3D 4GBXC 3NIGB 2BWIA 1L5GA 3C8KA 1SF5A 4Y9BA 2VDRB 1NFDA 2AXHA 3RY6C 3WN6A 1U3ZA 4ZFZA 4P5RA 5BPPA 2G2PA 4JRXA 4FQLH 1SY6L 4DOHE 3P3RA 1F45A 1NIEA 4W81A 3BWUC 3TO4B 1TG8A 4WI5A 4PHZA 1AO7E 2WIIA 3BAYA 5FGBC 1T7YA 4HV8B 3D6GA 4YPGA 1Q0XL 3OQRA 3I50L 3L3HB 3LKQB 1J8HD 4HIJA 2OMWA 4C56B 5DEZA 2B15A 5F96H 3KCPA 4IDLA 1A7NH 2EEDA 3D3VD 1CUOA 4Z7VA 5EZPA 3CZKA 3M45A 5LBSL 3QZWB 1NMAL 3T8XB 1PFCA 4N5EC 2ITEA 3MGOA 3HNTH 4O2EA 3WHXB 4PJHB 3MV8D 5JW3H 1ZGLP 4Z18A 1NFIA 5C0GB 2P5EA 4ZO9A 3PWVB 4P3CH 3RNKB 3UMTA 4OJFH 2Z34A 3H9HB 4I48A 4NUGL 4XCFH 4J4PA 1ETJA 3KL5A 1JPFB 1X4ZA 2VZSA 5EOQL 4ZRGA 2JMRA 5FB8B 4AY0A 4AK2A 3PIQB 2ICWB 1THAA 2R2EA 3G5ZB 2WC7A 1JGIA 4UQIM 3QQNA 3AG1B 1N6UA 1HXKA 3SDXE 2DD8H 3QWOA 3TPKA 4CVZB 2NUTB 4FA6A 1ODUA 3B2VH 4ANWA 5L9DL 3UAEA 2CLZA 3QDGB 1T4WA 1CL7I 2AV1A 3Q8EA 5C08A 4AQEA 1M2OA 5SWQB 2CNZA 5D2LA 2J3SA 5I8KH 3UP6A 1UJ3B 3MRCB 4LOEA 3RWCB 1NLBH 5F9DC 5KEZA 3G6DL 5JPNC 2FR4A 3BKJL 4NHUB 1RIHL 5BQ7A 1YNLL 1MCOH 5A2LH 5BMFL 3BN3B 4TRPL 2HX8A 2WQVA 3FN0H 3BN9C 5HP5A 5E2UH 1NIBA 1PZAA 2HVKA 3MRPA 3OKMB 5I17A 3JWDC 1CDJA 3B83A 4AJWA 1NAML 4L3CA 2DQUL 2NSXA 4M48L 2YPLA 5GRYA 5KSBB 1NCUA 2A3TA 4KKCD 3U6RA 1K5NA 3GF8A 4IKNA 3SDYL 3NK4A 4S1QL 4UNVA 4QXTB 4BCYA 3PWJA 3FOLA 2E86A 3C5SB 5DS1A 1FORL 2WINA 5JMOC 4BQCA 1U3YA 2COVD 2NUPB 2R39A 4CMMB 5DJDB 1E2ZA 3BD4A 2PYFB 4NO2A 1RZFH 1CQKA 1MY5A 1DQML 1KXQA 3KH3A 2E4FA 1XB8A 1A1NA 1WFTA 1YEKH 2BIQA 1WISA 4G8AC 4XNZB 4YIQA 5CINL 3L3JA 3JVGA 4GH7B 1EEYA 3BAIA 4LEEA 4HQQH 2P7TA 4UOW0 3KPMA 1TNNA 3DJZA 1J8RA 3SOBL 1GGIH 2YXFA 5DEGB 5AD0A 3P2TA 2H2PD 5FYKD 4N0FB 4MD4A 4TUOB 5JUEL 3VW3H 3ALPA 4HDIB 3TV3H 1AGFB 3GTTA 4GRWF 4XWOC 3W38A 1EGJA 4Z7WE 3HZKB 1F41A 4ZXBC 2HPOA 2IBBA 2W9LA 2VUKA 2XU9A 3H9SB 2ESVA 5D8JH 3VCLB 3KGSA 2L4OA 4F15C 2JKIS 3FBQA 5CGYD 5LCVH 3OAYH 4MCZB 5CZKA 1IC7L 3T2OA 5ITFB 4JFDA 5JORB 1U2YA 2CK0L 5JTWA 4WEMB 2X87A 5KSUA 1D9KA 4JQIA 1XF4B 1VB9A 3O4OC 4KOBA 4PP2B 5EC1B 2D7TL 5D1QE 4AXWA 4IBZA 4ZFOL 2X9WA 4G80A 4HOWA 4YSDA 2X41A 2I07B 1SXCA 2R56H 1PG7H 1V55B 4JGMA 4GY4A 3I75B 4OZ4A 3KWWB 4TPRH 4ZPTB 1MRDL 4KKPA 5SWSB 4BUHA 5DJYB 3CSYB 1NCDH 3PJSA 3FSVA 1SM3H 2JKLA 3IRZA 4JFEA 4P2AA 2UX7A 4JRWA 1OF2B 1YNTB 4KPHL 1MCHA 1ZLSH 2APBA 43C9A 3GBEA 3TIEB 5FW8A 4HVBA 3KPPA 1CVRA 4GRWE 4KHXL 2PXYA 1UXLA 4Q6KA 4OQTH 3ULUL 1N6QH 1VZIA 2CCWA 1AKJA 5GHWL 3MLYH 3O9WA 1VAHA 4ZOAA 3L1OL 5J1SC 2R0KH 3EYVB 3QG7H 1XR8A 1TZ8A 4OSUL 5EZOL 2GY7B 4HIIA 3ULSA 1SJEB 1UYWH 2DI8A 1M1XA 3QIBA 4A6YH 1FH5H 4J3OH 3VVVA 3WSQL 4KBPA 5ADOL 5AAPA 5IIEB 1R0AH 3IJHA 4B0MM 4A2MA 2R29L 1KCUH 3C6LB 3EHBB 1ZS8A 1RUMH 3KS0J 4WW2C 2BIIA 3BE1L 3CHPA 4QT5A 3WUWB 3DJRA 1RZIB 4JHWH 2VR6A 1L6XA 5KJ4A 2B8OT 3VTAA 1BQSA 2A6IA 3F85A 4Y5VB 2C3GA 3UIZA 2A9NH 3WLBA 5IFJB 1Z9PA 4M6NL 5ESQA 1BEYH 3K6IA 5EPMA 5C0CD 2O93L 5DEFA 2R1WA 2K4WA 1BYPA 1MF2L 1P1ZA 2ERJC 5G4OA 4NM4H 4G8EA 1OAYH 3AGWA 1DFBH 1FIEA 5SV4A 4D0CA 2BX5A 4JVUA 3FQ1A 5DS8A 2X12A 2C9XA 1A0QL 1GPOL 4OI9A 4G5ZL 1EBAA 1R3JB 2QKSA 3IFOA 2ZOLB 4UYPA 1ANUA 5CSZB 2J44A 3DPDA 1QFWM 1TZIA 1MCCA 1YO4A 3HLKA 4IRJB 3U9UB 1W6LA 3K71B 4MSWB 1XIWD 4AL8L 2XJKA 3Q48A 3FTXA 2JJSC 4QRPD 2WWOA 2DM4A 1TJGL 2XSKA 3SKMA 2Q3ZA 1JN6A 3KXFD 3BKML 3HN3A 2ZOOA 2MOQA 2W0KA 3V0WL 2FVNA 3IJ7A 4GRLB 5E4EB 4FNTA 1PS3A 5FKPB 1TF4A 3FB7B 3AROA 4QOKB 1HKLH 4H0LC 3Q44A 1F3JA 4P4RA 5G5DA 2CHNA 1JGUH 1U2CA 1XCQA 2FQEA 3GXNA 1LP9B 4L4TD 1LGVA 3A4EA 4I18A 1HQRA 4YXHH 2M2DA 3BZ4A 2VSMB 4I5BB 4QF1A 4AEHH 4WTZG 5E2VH 1CT8A 2GAZB 4R90H 2CO6B 7CGTA 1XB3A 4LCWD 1NAKH 2EE2A 4PW9A 3HR5A 1MFEL 3HC3L 1AHWA 4OCYH 5F3HB 4MA3A 3W82A 1LE5B 2GUOA 1A9VA 2C9RA 3TBVA 1DQJB 1FC2D 3OPZL 3CFIC 2XV6B 4YLQT 4WFEE 1BOGA 2A6JB 2GABA 3CVHL 3MLZL 4J7RA 3JV6B 4Y19A 5JXEA 5AVSB 3WFHA 3E1F1 2J7LA 1NL0L 2JKXA 4DFIA 4LSRL 4BIKA 4JO2L 4FNPA 3VXPA 2J1YA 2HKFH 1HSBB 1QKZH 3K2UL 4AYFB 1PAMA 2B59B 4DIXA 1A1OA 4PRHE 4Y16C 5C0AA 3T4YB 1Q0YL 2VC2L 4LSTH 1RVFH 2HG5B 1L9MA 2PWFA 3TYGH 3GMOB 1DQLH 3DMMC 3LN4B 2WMPA 5FUZH 3BUQA 4LSSH 3U4KA 4AV5A 4JCMA 3HAEG 1I3GL 3EYQD 3RTQA 2TSBA 3MXWL 2RACA 1FZJB 5DSCB 1VPOL 1W72H 3CN4A 4JK0D 1XGZA 1I8UA 4YC2B 5AALA 3IGKA 2VLKA 2OK0L 3KHQA 4OJCA 1OSPH 4QHKI 5CIPA 2GTWB 4OBRA 1O7VA 1B88A 1KJ2B 1JZ7A 3DOIA 4GI9A 4B6ZA 3UAAA 4FQIH 1DSYA 1T21B 1CK0H 4BFFA 2VW6A 5C9JB 2VDNH 2F5AH 4E9TA 1L6ZA 3O3AB 4KKQA 4DWHA 2AZAA 3QEQA 5JHDE 4FXGB 2PR9A 3GJEA 5I6MA 3O6FB 4U0QB 1E6JL 1A4AA 3EH4B 3RVXD 5MEPA 4YHYC 5I1LA 4MASA 1S46A 1JS4A 2H47C 1JI2A 1RZQA 3AJ7A 1Q9LA 5IK3B 4AYGA 1CB4A 4OH2A 3QDJE 4JFSA 4KKZA 3T0EA 3RKDC 1C1EH 3OZ9L 5AW2B 1Y1DA 4N2EA 4YHLH 2RQ8A 3ABKB 5CZRA 4AMKL 4P23C 4YGAB 5I1AA 2J20A 4LSUH 2DQJL 2UWEB 4C59B 2CLVA 3DBXA 4QYAA 4WU7A 4DQOL 5FW6A 1JSYA 3PNWA 1ZV9A 5CCKH 1NBQA 2BIOA 4X7SL 3HC0B 5CJQL 3GSQA 3MN8A 1GAFL 4DKDC 1DQQA 2VLJD 3U7WH 5AENA 1IC5L 5EV7A 3LKNA 3Q0HA 2R4SL 1QR1B 4PIRF 5JW4M 3PPEA 2YBGA 3ARWA 3CSGA 4QWWD 1TQBC 4IGBB 1NCBL 3NSYA 1RP9A 5FCUL 4APXA 3L3DA 4PGDA 2ITDA 1AYOA 4G8GE 3CGTA 2EYTA 3K6FA 3P77B 4A39A 2QADD 4R84A 1SJMA 3QJQB 3FU5A 2DJMA 3X1FA 2WBKA 3OHXB 4GMTL 4QY8B 3EH5B 4LL1A 4QTIH 4ZQKA 4Q6IA 4XOEA 1IO4C 1UWEH 2D3VA 2PTUA 2AK4D 1U4EA 2OXGA 1FL3A 4M61B 1YDPA 1LQSR 1AXTL 4YHZH 2FX7H 4PTTB 5HHXH 5EZJB 1U8NB 4ODVH 4UB0H 4FFTA 3C75A 3F12A 3VFPB 4BE5A 4DETA 1MY7A 2XYBA 4E9XA 3T08A 5D96B 4C55A 2KLSA 2VDQH 2CIIB 2YA1A 2LU3A 2VR5A 1OGAA 1DBJH 4J6RL 1E30A 2KC0A 5E8EA 4MQSB 3EOYG 5T1DL 4YX2L 5HYSA 5HYSG 3IRPX 4OFQA 3U4EA 4MX7A 1KB5H 2OSYA 3DRTA 3TN0C 1T1ZA 4K7PX 3HVNA 1Z32X 3GMNB 4V1DA 1T5KA 1IEAB 3VD2A 4BK8A 4ZSOE 2Q76B 3AFLA 2RHEA 5J7CC 1AIFB 1JCKA 3ZDXF 1RKRA 1E3XA 1RK1A 4PRDA 3PDDA 4E41B 5GGSB 1I9RH 2CUHA 4NJAL 4JDVB 2X3AA 3FQRB 1PPIA 2QPFA 1DL7L 1KCRH 2DIEA 4A2DA 2VUOA 1CGVA 1IEBB 2J4WL 3L7FA 1O6SA 1E5ZA 3GNMH 3QQ4B 4UT7L 1FBIL 3IFLH 2ZYSA 1SVZA 4KGJA 3WO4B 3CJJA 2AI0H 4XODA 2N0MA 5GGTL 4C8XA 1MUJB 2NY2D 5JOPE 3TFKD 2R69L 4OZIF 1JDCA 3BZFB 4NC0B 1BZ9B 1FYTD 3SJVB 3SE3A 3X11A 4YDIH 1KV3A 1S7SA 2ZT9C 3ARFA 3T1WA 4Z7QB 3MJWA 3ASWA 1J9SA 3VD9A 2EDDA 4K2UL 3LSOB 4XN2A 3O6KL 1TPXC 4Y1AB 5IT2H 4AENA 1JE6A 4E9SA 5E9NA 4HJJL 2BZ7A 5J6GA 3ZDXE 4MAYC 3C6EA 2Q8AH 4YDVB 8PAZA 4HISA 3WTWA 3BW9A 1HXMB 3NK3A 3CLEH 4MXQC 1I8AA 4OZFH 3P73A 3BO8A 2NTFA 1UM6H 3ROLB 5DJAA 3S35X 2OYLA 4OFIA 4GRWH 4PJ5E 3U1SH 3HZVB 2AEOA 4FG2A 3DK2A 5FWRA 5HDQH 4QXUL 5BOJA 2CH8A 5E0FA 3CAFA 4CSZA 1NGYB 1MN4A 1CGYA 3QIUD 4L8BA 3AM8A 3DJ9A 4NUMA 1JV5A 3WMPA 4BM7A 2NZ9C 2QEJA 2A6KA 2WZAA 4KXDA 5D7IA 5D72L 1R19A 1T20B 3SQOH 3CPUA 5I6XB 4JRLA 3PQYE 3FQUA 3GSNB 4KZEL 4TXVB 1NPUA 2AITA 3BEVB 5ESAB 1HFUA 4OLYH 5AKTA 5ALBL 5EUOA 5C0EA 4HHWA 2V5MA 3CFNA 5DLML 3R19A 5LGHH 5I6KA 1KBPA 3QULA 1EXUB 1IAIH 3S88H 1I85C 4TUKH 4YHKH 2VSDA 1IGYA 3FCSB 3H0TA 4ZMVA 3MMEA 1F2QA 2E9GA 1INDH 1G7JB 1BZ8A 5ACZB 1ID2A 1KN4H 1ZANL 1T1WA 1YZZA 1RJLA 5E24E 1EZUA 1NCWH 1P84K 1RFDL 1GYVA 4JFZH 1OAUL 4KXZH 3CHOA 3AG2B 3HI5L 5FV2A 1HEZB 1JZ6A 1T0MB 4KKLD 3OAWA 3LZPA 3IBEA 3L2MA 2HWZH 2DPKA 4X4XB 5IB4A 3OAUL 4L1BA 5HYQA 3JWNE 4X7FC 5F7KC 3HG1E 2YD6A 4R4ND 5IQOA 1FP5A 1A8JH 5I8OL 3JQOB 3PWUB 4X5XB 4KVCL 5EO9B 4YN3A 3WIAA 4G7RB 1N7ML 4NKDA 4GUOA 3DYMA 1X5KA 3F5WA 2OMUA 4ILDA 2B08A 2G75B 2AJXH 4PM1A 4AKQA 5I82A 1KIQA 2CUMA 1Q38A 2EKSA 4JFPB 4B9JA 4KXCA 1UD5A 1WFMA 4BFRA 4I2XA 2X4PB 4UBDD 5DZOA 3MRIA 4L18A 1A3RL 4RFOH 5F9OH 1E7UA 3KLAA 4JDZB 2XX0A 4HS8H 3D39D 5J89A 1FJ1A 3EO9H 3QUKA 4HKJB 1IC4H 5E8PB 3QEUA 1B3JA 2DY2A 3H3KA 3N1FC 4XHQA 2DI9A 3T5WA 4CC1A 5TF1H 1TU2A 1PX3A 1EGJL 1N3NB 4UTAH 3FTUA 4KK5D 2ZPKL 3PWNB 3HN8A 4M6AA 4MVBD 1AC0A 4H13C 2IPKA 1VFOA 3ARDD 1JZ4A 2BHUA 1U8PB 2LVCA 2BVYA 4P2RD 4X8JB 2OLDA 3F00A 1N0XL 5FEBA 1MJ7H 2NLJA 2ZYRA 4JQIL 3OB8A 4KAQH 2AJ3A 2CHWA 1OW0C 1Z5HA 2V2WA 3ZR6A 1FCGA 3RZCC 2XRAL 4MXWL 2WO2B 2YZ8A 3TBCA 5D5MA 1QZ1A 4BKSC 4HH9B 4QTFA 1M4KA 2MNJB 4I0CC 1KIUA 5FOBB 2I7SA 2YAQA 3OG4B 1PZ3A 1DLFL 2R9HD 4PJ8A 3D2TA 3FQ4A 3U6XA 4U1HB 3GMLB 2WLNA 1JGEA 3S36X 3BQUC 1JGLL 1CD0A 3ZE0E 2BXYA 2IG2L 4J3OC 4K71C 4YHPB 4AZ8A 3DX8B 2FZ3A 1CE6B 4MLSA 3TNMA 1PCXA 3RPKA 4E2OA 4XP4H 4CU7A 2R8SH 4XMLL 3L2NA 3OXSB 3B9EA 2DTML 1YEDB 2YWZA 2YKLL 2ZCHL 3BWAA 2FWOB 3RG1C 1I82A 2W91A 1H6UA 4JPKL 2PTVA 2L7EA 3KJ4C 4JMNA 1N64L 1KGJA 2AAAA 1GZPA 3NPZB 1DVSA 1F4AA 3WXWH 5MEQA 4HT1L 4CVUA 2Q2LA 5DD5L 1L9SA 3GSOA 3TH4T 2FATL 3O0RL 3L3GB 5CN1A 3IMVA 2HLFC 1JNNL 5AZ2L 3X3GH 4ZFFB 3MLVL 3EJQA 3MX0A 2DV6A 5IWLA 1BX2B 4OF3A 1BW8A 2OBGA 3MV9D 4XZUA 2BIMA 3FC8A 4F7TB 4UINH 2UY7A 4BH8A 5B1JA 4TULH 1FSKC 4CAGA 5KVDE 4MGXA 1DBBH 4B5ZA 3HJEA 1N10A 3ARBD 3ESPA 2VMDA 4CJ1A 4KTDH 3P54A 4XWGL 3MODH 1A22B 2EDOA 4TM9A 1IQDB 3D85B 1MRCL 2UZYA 5GS1C 1EHLL 4KJYB 4ISVA 3SEPA 4OCXL 5JA9A 1PZUB 5TFSL 43CAB 4JM2C 1F4WH 3QUZD 3GRWL 1DANT 1ZOXA 2YMTA 2R4RL 3LRMA 3QZBA 4K3GA 1KIPB 1OE1A 1YN7A 3LPWA 2WVVA 3TEZA 1NBZA 4F80A 3CFDA 3VFGL 4PGBA 2F54E 2RQEA 4XCYA 3F7VB 3FMGL 4FTVE 3CFCH 1A7PL 1EEZB 1S5IL 3D7PA 4XX1G 4X6DB 1AQHA 1QHQA 1GGUA 5HD8C 3CFTA 5DK2A 1GXEA 4MNQD 5FM4A 2MKLC 4P2QE 1PNCA 3ULAB 4TUJB 3CVBA 3UJTL 2JK5B 4HUWB 3ZPDA 1FQ9C 1QNZH 4XPHH 5EBLB 5ETUA 2FT6A 1Z5LA 4HWBH 3KVPA 5IQ7L 5J1AA 1I31A 4YE4L 1J1XH 3MJ8A 5C07A 4ZAKB 5EU7E 1ZIBA 1MCIA 5HYJE 3OVUB 3TA3B 4Y4HA 1VENA 2ZAHA 3MNZB 4PI2A 1BQ5A 2FJFB 1S7TA 3A0OA 4LE8A 1A21A 5BO1L 3AU1B 1J0YA 2EEFA 4YVNA 2K3HA 2V5YA 1AR1C 4ZUWA 3VXSB 4JHBA 3DPBB 2W9EL 2X1OA 4WHYH 4JB9H 4GBXA 1DDHA 4GQZA 3EG9A 3GHPA 2ADYA 4LP8A 3RY6A 4BZ1A 2VLRE 2X4RB 2BNRE 4Z7OB 2PO6B 5DJ0A 3Q01A 2Z1PA 1E4JA 1HCFX 4GW1B 3KBPA 4BWTA 1K2DB 2H6PB 2OMNA 2WXGA 1GC1C 1FAKT 4D3CH 4IRSB 5I1IL 4MNGB 3OR7B 3OJMB 4GQQA 4O51A 3L3KA 5J3HC 3K5SA 2F1BA 2BSCA 4OFVA 3TT1H 5L88L 1NKGA 3B37A 4UT9A 1F6FB 3KPOB 1P4LA 4YSAA 1BFOB 2H1PH 2Y1VA 3DC0A 3VGAC 4QRFA 2EKJA 4IU3B 2X40A 3QXUA 3VD4A 3KWVA 1ZGLB 3RI5K 2BC4B 1N26A 3SBPA 4F24A 4L9LC 3G7TA 3IFNH 1KXTB 1HHGA 1A47A 3HHMA 3TBYA 3QRGL 4H25A 4ZX5A 2Y7QB 4DGIL 3AXHA 2JCCF 1OP5H 4WFFE 1PU0A 1V3KA 2D4DA 2IANA 2WXFA 4HUXA 1XIWB 4ONGH 1AGDB 3PF2A 4TQIA 1KJ3L 1MFCL 5I2IB 5F8RC 3U36A 1CU4H 4X6FB 4Y4FD 2RBLA 2CR6A 3CZEA 4KKAD 4NLAA 1M7IB 2OMVA 2WKOA 3KXFB 4XOBA 5GSRA 4ZMTA 4OV5B 2EXWC 2CCVA 5DMKA 1F4XH 2W95A 3OXRA 1IFGA 5DHMC 3S9DB 2H0FA 1TTCA 1SLUA 1WGOA 2CGYA 4FFWD 1BD2D 2XPGA 3TFBA 3ZVVA 3QORB 3K72B 4LKXA 1OD7A 4HHAB 5K5YA 4DGVH 2ADJA 3Q8AA 3R7QA 5JPNA 3KLKA 3A67H 4IKLA 4L4TB 5DDHB 2EZ0C 5H35B 2VN4A 3GBNL 4P2OB 1NBVH 4N8CL 1HNGA 4LCWB 1U3HC 3FOMA 2CPUA 3PL6D 1E27A 1MAJA 3U2IA 4R2GD 2B4CL 3A6CH 5KTEL 3VGHA 3ZDZE 2D31A 3MRMB 3RFZC 1Q8MA 3IT8D 4BKLA 4R5VA 4F7EA 1H3TA 1WAEA 3DKHA 4Y5XC 2AJUL 2VM3A 3UZVA 4WI6A 4B9KC 5JHMA 1SEQL 2IQ9L 1IQWH 4H1LA 4A6YB 3H53A 3EGXB 3RWEB 2ZZUT 2E7HA 4H1LG 4YSEA 4XPTH 3DV4A 2XWDA 1I7ZA 2HN7B 4G6JH 5JYMA 1XSIA 5E6UB 3BH8A 4AQOA 3HBZA 5ID1B 1CXHA 3WGVB 2Y1ZA 4XNQA 4Q7DA 4LCUB 2GJRA 5EDSA 2LVEA 1DFXA 1DJXA 2VL4A 4XNAA 1QPXA 4WFGE 1IGTB 3CSBA 5F1NB 2FGZA 4B9CA 3HC2A 5IP4A 3TF7C 4U6TA 3KE0A 2R0ZH 4HH8A 4TL4A 2FBOJ 5BJTB 2XTJD 5KZCB 3GSUA 2WBJC 4HUUA 5K9JL 4GP5B 4Q9RL 1INEH 3LKRB 2WP3O 4K15A 4ZXBA 2VDML 1XF2A 4PLKD 3RAJH 1CLVA 1JD7A 1FNFA 3TJHD 1TVBB 4WQOA 1JZ5A 2FH6A 1KBBA 5FO8B 3KYOA 2X6BA 3R1GL 3OJDB 3FO9A 4PV9A 1FZKB 4ZNCD 5KJRL 1QI5A 3MREB 2AQSA 2VL5B 3IN0A 2XPYA 3GSRA 1CYWA 2G60H 1JF5A 1ZTXE 5DWUH 4M1DL 1NCOA 2VXSH 3ZRFC 3F7KA 3WKQA 3QG6B 3RUGB 1CFSB 4JM4H 4XO3A 3ARGC 1Q1JH 2NXYD 4P5MB 2CO1A 4L5FE 4OLZL 2XVLA 1MJJB 4O02L 1J5HA 1MHPH 3RWIA 2HH0L 5HDOA 1OT2A 1OZTG 5J8OA 1ZT7A 1NLDL 4L1HA 1IVLA 3CUPB 1YEGH 4QLWA 1DN0A 1KZQA 3F2LA 4RA3A 2K9FB 2WQXA 4U4IA 4FQJL 5DJ6A 9CGTA 4H26B 5FXCH 1NIAA 4NO3B 4V2CB 4KJQC 3VG9B 1CFQB 4G8FA 1XGRA 3ZRSA 4O58H 2A9ML 2ZE0A 2BSTA 4YNYA 4RMVA 4RIRB 5CR1A 3W39B 2XZQH 5FDYA 4JDEB 4CL7A 2VLJB 4ZS6D 2XTSA 3NTCL 3PWPA 3IDJA 3O2WH 4Q4IA 3Q2CA 4WW2A 1UADC 5DQDL 5JQHC 3LKOB 1CICC 1U58A 3VRJB 1P2CA 3GSVA 2L0DA 1SYSA 3VI4E 2V5RA 3ARVA 4IJ3B 4MJIB 5C09D 1A6ZA 2F15A 3EBIA 2WBWB 1H5BB 5FS5A 2K4AA 3GS0A 1I7TB 3WU1A 2QADB 3ILPA 3GB7B 4YHOL 2P5PA 4PJ9A 5DFAA 5CEZE 2EXSA 2Q3XA 3ZHNA 2W0FA 1QFUH 4H8PA 4RISL 1SHWA 4NOBA 4WWOA 4AYMC 3ATAA 3RURA 5BXFA 1JHKH 3G5XA 3QGVA 1LJMA 3IPBA 4N0UA 1QFWH 2A73B 3ZTNL 4MNHA 2R0WL 5DRWB 3N43B 1W72B 4H8HA 1UEMA 4GG6B 3TS8A 5GJTH 5B39B 4U6VL 4UIKL 2BDNL 4TQPA 1S3KH 5EEUA 4NFCA 4LBEA 2VDOL 3CCHB 3EBAA 4UQEA 3VFVA 4BFNA 5A7EA 1LO4H 3CBRA 1USQA 2JJSA 5DZAA 1ONQB 3WFBH 1H6FA 2F18A 2ZXQA 2Z92A 3MLTB 1LO5B 4DOHB 4E5XG 2WXNA 4HGKC 2NZ1A 2EE0A 3V0IA 3PGFL 1A4JA 1BAWA 1AO7B 1KJMA 3ZLQC 1WT5C 2J6EH 4DUXA 2RIKA 5EEYA 2YAPA 1I3UA 5CHNB 5KVGE 5GGUA 5C0RL 4B9ZA 1PSKL 3EFFA 4G8IA 4XN4A 1WV7T 5KVDH 3LOWA 2E3VA 2BNQD 3C5ZB 1KUMA 1SQMA 3LMJH 3MRNA 1IVTA 1IM3A 3KPTA 4XCEB 2BSED 2VDKH 1UD3A 3QEHB 1GHFH 2G2RA 2OFQA 5LVEA 3SCMD 4GLRH 2WQRA 4AUUA 1J0IA 3BX7C 5DMIH 3CFBA 3HNVH 3NG5A 5E5MA 2OI9C 2X89D 1NEZA 4HS6A 1JG9A 1NEZG 5DHYA 2NY2B 3NCEB 1KLFA 2R1YB 2HLEB 4XNYL 1FYTB 2IXQA 1FE8H 1YAIA 2HJKA 3US9A 4KRPD 5FYJU 1NQBA 2EDLA 2W07B 1FFOB 3K2KA 3ARZA 3SDXB 1E28A 2DQHH 3WKML 2DI7A 4R7VA 4Y16A 5HGBA 1BBDH 4NQDE 5D7JB 3WJJC 1IZJA 1YQVL 4G9FA 2CLRA 3JTSA 1FL5B 4XRCB 4QHMA 1GGCL 5BCAA 3UGXA 3D25A 1QBMH 2C3XA 3DMMA 1YMHA 1W8NA 3G6JF 4R9HA 1D5MA 2FSEB 1NICA 1ZMYA 5MEND 3ILEA 4U0RB 3MNVA 4K94H 4D9LL 5J57B 4HXAL 4MJ5A 4UT6A 1PIGA 2IGLA 3KPRD 3VI3E 1JGDB 5M7QA 2F74B 3LH2L 1XEDA 1RMFL 2QKIB 1RH8A 3O8XB 5D4JA 1AD9A 3MACL 2NY5H 1XZ0A 3DIFA 1E3ZA 1GZQB 4AQZA 5KS9A 1B0RA 4HCIA 3GS4A 3O3BB 4G6KL 5DEJA 3KPNA 3PS6A 2X53A 2YMXH 4KQ4H 4HIHB 3VWKC 4WENB 5FUOH 1KTDA 2Z0BA 3IJYB 5DRNB 4YXLL 2YD0A 3FRUB 1KB5B 2YRLA 1EUTA 4I89A 5HDLA 3AY2A 6TAAA 3SGDH 3B7UX 1UH2A 5I23A 2UY6B 2D9CA 4K7FA 1TCRB 3G6JE 2E27H 1F4YL 3H2WA 4KX7A 3WY2A 2F53E 2R2HA 4OZHA 4XPGL 2DOCA 4P23A 4XBEL 2NY6D 4YLCA 4XXCC 5MP6L 4YE0A 1P84J 1MFDH 5E99L 1MFBH 4XC1L 5JIPA 3S3BB 1X9UA 4P57A 5F72S 4Z7WB 4BZYA 2OL3B 1XGPA 2E75C 3TOPA 5I1KL 1HI6A 4TLTA 3IDMB 1E4WH 4F2MB 4NZUL 4P4KD 5A2FA 4JKWA 4NT6B 4MRCA 2Q6WA 4UTCA 4GT0A 3L7EB 2NT0A 3RWGA 3SKOB 2BSBA 4KK8C 2GY5A 1KPRB 3P3UA 4L4VD 4F93B 4CKQA 5D1QB 1BVLB 3MBWB 3MRGA 2VUYA 5BV7H 3V5DB 1IB5A 4X6CE 3KGRA 1RZJL 1I4FB 2WLHA 4IHOB 1SJHB 2NY7L 4NS0A 4JL1A 4S1SL 3QJFA 1HH9A 3S2AA 2RJMA 5JXAL 3NEOA 4UU9B 3ULUE 2C9QA 5I1EL 2H2SD 3MCKB 1ES0A 1U8HB 2VR3A 3MXVL 2ADIA 1PX8A 3Q1EA 4OZFB 3JV5A 3MV01 1CICB 1XHHA 1Z5YD 2Y6SD 1KEGH 5KYWB 3S0PA 3L5WB 5C2UB 1E4HA 2G3XA 2FX9H 4W9HC 1L0QA 3BPCB 1C12B 5HYFA 4HU8A 3P4LA 4WCYH 3IJSB 3MBEC 1YYMH 4GFTB 4PB9L 4RNRA 4L48A 1ECZA 4NDMA 1GH7A 5DZVA 3CFJA 1NIFA 4OVUA 2FNBA 1JRHL 5GZOC 2PKDA 2VDLB 5I30L 2FD6H 4CBZA 3TN0A 2BSSA 3OB0K 3DYPA 2QGCA 2FGWL 4TOYH 3N9GL 1KBWA 2EIZB 4DUVA 4X5WB 2JJVA 5D7SH 5AQ0A 5CN2A 4Z7NF 1UD2A 1VADB 1VEMA 5J0BA 4Q58C 3VFTB 1NUFA 2DLFL 5ERWB 1UXWA 4PRBB 5IHUL 2KQNA 2MJWA 2KH2B 3DHUA 3MGAA 4B7IA 4DN4H 2CRZA 2JB5L 1TYJA 1H3VA 4M4PA 2IWGA 1QRND 1IGFH 2Q2EB 3EBHA 5K1VA 4OD3L 2E4TA 1CL7H 2NX5D 3QQ3B 3M17A 1JJUA 3IDIA 4PLOB 1TZOA 4RGNC 3ZZ1A 1Y0LA 4CNIA 5AB0A 3SODB 3P3TA 2FWLB 4ANKA 2YRBA 1CDHA 2IVFC 3GLZA 5DD1L 4HIPA 1OGTB 5HHME 4M3HA 3ZRCC 2BNUB 3UJIH 3M1BB 1SQ2N 1LD9A 3D4YA 1NA8A 3IU4L 4X98A 4WI9A 1U91B 3B56A 1ITCA 1ZTXH 3FN3A 3NIDE 1Q72H 2O30A 1WE5A 1FFNA 1R3HB 3AACA 2V7HA 5C3TA 2QQKH 5IBUG 2OCJA 1AQDA 5L7XL 4YDNA 4L5FH 4U1GB 5LO7A 4EZMA 1HILA 4RWYL 4FLHA 4MAYA 4BZ1L 5TDNA 5I66A 1ILSA 1JNJA 2BSRA 1GRWA 1MCDA 4FQXD 2ODIA 3UERA 4HPYL 4MS8D 4FI8A 1KTBA 4LZKA 1P1VA 4NB7A 5I5IA 1UXMA 4KDTC 2XZAH 1T4KB 3H85A 1M9WA 1N12A 3UC0H 4MJHA 2WUBL 3CN3A 4FEMA 3MV9B 2JIXB 3ARED 3MV7A 5F7EL 5KUMA 2CO2A 1U8LB 3GGWA 3QQ9D 1T7VA 2XKUA 1U92B 4NUJB 4UT9L 1J86A 1UOWA 2PPFA 3ARBB 2COQA 4OLEA 3HMXH 4J8RB 1OWRM 3GMMA 1JWMA 4UQ3A 2YEQA 3NCMA 3WTTA 1G6RA 2V7NB 3D4GA 3TM6A 4BE6A 4PRPA 2AK1L 1MLCA 3S8GB 2XWBB 3SKNA 1I53A 5I18L 2HT4D 1U95B 2EINB 3HS0C 3QUZB 5CCGE 3JBG7 4N2LA 4PJDF 3QCVL 1B2WL 2XG4A 3H56A 3Q8FA 4OKVA 5JO5B 4LSPH 2AZUA 2FRGP 4PRHB 2EDFA 1D5BB 1ZVNA 4AC4A 4HLZG 5CEZH 5I1DA 4A7GA 5D7KE 1T1YA 5F0JB