4GUIA

1.78 angstrom crystal structure of the salmonella enterica 3-dehydroquinate dehydratase (arod) in complex with quinate
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
251
structure length
251
Chain Sequence
KTVTVRDLVVGEGAPKIIVSLMGKTITDVKSEALAYREADFDILEWRVDHFANVTTAESVLEAAGAIREIITDKPLLFTFRSAKEGGEQALTTGQYIDLNRAAVDSGLVDMIDLELFTGDDEVKATVGYAHQHNVAVIMSNHDFHKTPAAEEIVQRLRKMQELGADIPKIAVMPQTKADVLTLLTATVEMQERYADRPIITMSMSKTGVISRLAGEVFGSAATFGAVKKASAPGQISVADLRTVLTILHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-dehydroquinate dehydratase
publication title Crystal structures of type I dehydroquinate dehydratase in complex with quinate and shikimate suggest a novel mechanism of schiff base formation.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 96
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01487 DHquinase_I Type I 3-dehydroquinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4guiA00
3P5ZA 4O19A 4RKAA 1W56A 3GZ3A 4KKXA 3S6DA 3W1AA 5FI8A 1NSJA 1W8SA 3FKRA 3PG8A 4MPQA 5TBOA 1BWLA 1XL9A 3INPA 2ZYFA 1TO3A 3NPXA 3SFKA 5LHFA 3A5VA 4JDBA 4CNOA 3W7NA 2EF9A 3QZEA 5EKYA 5AHEA 5K4ZA 3KRUA 3DFQA 3OVRA 1GEQA 3T4CA 2ZFAA 3QEZA 3QMSA 4UTWC 3S1VA 3N3MA 4GUIA 4WJEA 2GVGA 5LNSA 3BG9A 2QUTA 1ZHAA 4O14A 2A21A 4FNTA 1JUBA 2FJKA 5CZTA 2ZA2A 3W72A 1JCYA 3KX6A 1VJIA 2Z6JA 1R30A 4Y96A 1YTDA 3M0ZA 4M7TA 5G4EA 5DBUA 5U7SA 2B4GA 3W1XA 3TV8A 3G1DA 3OHIA 1Q45A 3MHFA 1DJQA 4MYXA 3TSBA 1KTBA 1QOQA 4ALDA 1GVFA 1UUOA 2VXNA 3BK0A 2V5BA 4JY9A 5BMXA 3R2GA 4O18A 1M7PA 2FTPA 3ZS4A 4LVDA 2PRMA 4ORIA 3RLUA 1TRIA 1WYIA 3MP3A 5LNWA 3UPBA 3GK0A 1G69A 4JX5A 1ICQA 3RNDA 5TIMA 1G7UA 3OIXA 3DH7A 1VZWA 2ISSA 2ZTKA 4E0CA 3TUUA 1O5XA 3MP4A 2E77A 3NNTA 3FIGA 5AHMA 1FY6A 1VCVA 4DF0A 2V30A 3M43A 5D2XA 4WZHA 1Q6RA 1KW1A 3L65A 4M19A 2NV1A 2Y61A 3C4UA 1C8VA 1UUMA 5FEPA 3CHVA 3STEA 2RDTA 2QAPA 5K9CA 4GNJA 1TPB1 1IXNA 3CTLA 3LTYA 2NXHA 1NF7A 3UYCA 4FHAA 3WJWA 2EGZA 4ZZ9A 3MO7A 1A5AA 5C5YA 1LROA 4RR4A 1NFBA 4LY8A 1PIIA 1H1ZA 1Q6OA 3H53A 1KLZA 3E0IA 5HWJA 3EXSA 3IIVA 3TXVA 5AN7A 3GVGA 1TPFA 5D02A 4JS3A 3YPIA 3JR2A 1FCUA 4DELA 3BLIA 2GPTA 4H4IA 2ZZ4A 2B7QA 1PHQA 3FOKA 1Q3NA 2G97A 4UNLA 1H50A 2RHGA 5F2GA 4NT0A 4TMCA 1MEWA 3W7JA 1GVSA 4O54A 4EF9A 3KVMA 3W7RA 4AF0A 5G1TA 3TFXA 4RZ4A 3KVLA 1C29A 4MVAA 3WJXA 1QMLA 2CZFA 3U8GA 1HO1A 3NQGA 4O52A 4GFSA 2GOUA 4FIRA 4FEZA 2J9YA 2O7SA 4A3UA 2YFNA 3UWWA 3EEGA 3W2MA 5FF0A 3P5YA 3L2IA 5HR6A 4Y9AA 1XXXA 1PE1A 2OX1A 4EVZA 1RD5A 3LTSA 1W54A 1M6JA 2JGQA 4GUJA 4CQAA 1R2TA 1R2SA 4C1KA 3W7QA 3QJAA 4E2BA 4JTHA 3ZWSA 5DCDA 3GXPA 3R5EA 3SJ3A 5G1YA 4MFEA 1MZHA 3W1UA 3L66A 3LERA 3SSJA 3DFSA 1O4UA 4ML9A 3W7KA 4FB7A 4N4QA 4EF8A 3A9IA 4C1LA 3LCHA 1SR9A 4K8EA 4O4WA 2ZA1A 3A23A 3W1PA 1F2JA 1VCFA 2OZ0A 3MHUA 3W2NA 4AXKA 5L9FA 3TNOA 3LTPA 3W7HA 4JYFA 3G8EA 2Y7GA 4X2RA 3IEBA 4K39A 4UNKA 1F76A 4QNEA 3NDOA 1TTJA 5D04C 4PCFA 3GAKA 4NXSA 4O28A 2AAMA 4MY1A 3M5YA 4OV9A 4ADTA 3VE9A 3UZ5A 4O12A 1CW2A 1T0OA 3IVTA 2Q8LA 3M41A 3FYPA 2YFOA 1UJPA 2JKEA 2P0OA 1FUYA 3LLDA 3PBUA 3N9SA 4WD0A 5I3HA 3UWYA 3BG5A 4TMBA 1W5MA 1ME9A 3UWVA 3WK0A 1WXJA 5K4XA 1SW3A 1AL8A 1N8FA 1PVNA 2NLIA 2E6FA 3BW4A 3GLCA 3PBYA 3EX3A 2YX0A 3B05A 3TW7A 1TTQA 3DGRA 2CFFA 5G5IA 3LHTA 2ISVA 4GUGA 3D0CA 2FQIA 1THFD 4DXVA 5EMUA 1JCNA 4UTIA 4DO5A 5D2TA 4PL1A 3HPXA 3P61A 4AEOA 3QPYA 4JYEA 2X1RA 3S5NA 3KAOA 3PULA 4OU1A 4HNVA 4ZQNA 3ABSA 5L6UA 3RLVA 2EPHA 3BARA 3IVSA 3UPWA 1J4EA 4D2JA 3O1NA 4NUWA 2GQ9A 5DLCA 4HSOA 1VCGA 3RFAA 4ZQRA 4HNNA 3FLUA 1WBJA 2FPVA 1J5TA 4LS0A 4LNYA 2W0UA 1J2WA 1WAUA 2ZRYA 5IBXA 4QAIA 3DI0A 5GVJA 3L0GA 2XN0A 8TIMA 3TR2A 1LZOA 1YLVA 4A2SA 4DQWA 1JCLA 1BEUA 1GYNA 4XTDA 3STGA 2PE4A 1H7WA 2QJGA 3KRSA 3KXQA 4MJZA 4R53A 2GQAA 3L0NA 1ZAJA 3HPZA 3N9RA 5FF7A 2IQTA 4CLMA 3ELFA 1ZCOA 3N73A 1I8JA 5HUOA 3G18A 2E6DA 2CZ5A 3G3MA 3LCLA 2V2CA 1LBMA 3PAJA 5AC7A 4DF2A 3EWWA 3KVKA 4O1CA 2JKAA 4JTGA 2C3ZA 4LRSA 2TSYA 1Z41A 3A22A 2YZRA 3M9YA 4R7JA 3E9AA 3C2RA 1L2UA 2I1OA 5F2MA 1JQXA 4MIMA 2VFIA 1VLWA 3NM1A 4GXMA 5FEXA 1X8FA 4BWLA 4WX2A 2W6RA 2NXIA 5F1UA 1OHLA 1BKSA 1X6UA 2QEZA 4O13A 1MO0A 4O53A 1G67A 1QO5A 3KVJA 4GBUA 3GDRA 3OEXA 1SSDA 1K8YA 4XBSA 5D30A 3T55A 4DBEA 4RK8A 2JBMA 3QW4B 5FEZA 3LX9A 4U28A 4HT3A 2PCQA 4N4PA 5FF2A 4IJBA 4FIQA 3S42A 3IV3A 5D33A 5LGZA 1T8XA 1GYLA 4JTFA 3W1RA 3L67A 4LRTA 2B7OA 1RVGA 4JTEA 3W1QA 3CM4A 3IGXA 3GDKA 4BR1A 1MXSA 4WY0B 5BMWA 4OV4A 5I3GA 3NZ1A 4MZ8A 4MJMA 3QQ0A 1KLYA 4DBDA 2EAWA 3MJYA 4JR5A 4UCGA 2AGKA 1YADA 3S9YA 2BX7A 1SZGA 4EOUA 4HIBA 4FNRA 4QISA 1UCWA 1KV8A 1L6WA 2GJNA 1KM5A 3C2OA 3FS2A 1F73A 1K7EA 5DY2A 4JNMA 1GPWA 3I7RA 3MW7A 2CLEA 4O1DA 2ZRWA 2TPSA 3GNDA 3LV6A 4CNNA 4NNCA 1Z44A 4H6KA 4L4MA 4FX8A 5FF4A 4TX9A 3MMTA 1VHNA 1W0MA 2Y6ZA 3LRKA 5E0KA 3NOEA 1WBHA 4FO4A 4JEQA 1K8ZA 3NL2A 2QCDA 2R14A 1I2PA 1L6SA 4FNPA 2VFGA 5KTLA 3NG3A 3ZFHA 4GE8A 5D32A 4MYAA 1HFBA 3BW3A 3PB0A 2ZRVA 3W6YA 4UTTA 2NUYA 1K3UA 1GVOA 1YXDA 2X16A 2ZZ7A 3NQ7A 7TIMA 3AJXA 1QAPA 2QCCA 2Y7DA 3NQEA 4EWND 4BI6A 4CCDA 3LRLA 1P0KA 1DQWA 4NJHA 3DHDA 3BO9A 3M16A 4YCPA 4ZQPA 3MYOA 3PF3A 1YXYA 3NQDA 4QSHA 3V1PA 3GDTA 5EA9A 1A53A 3BLFA 1OVDA 5CGQA 3PUDA 2WNNA 3LB0A 1FWWA 3OG3A 5AYYA 4POCA 3G0XA 2JGYA 1DKWA 4LT9A 4FNUA 3NPVA 1OX4A 2CLKA 1XKYA 1ALDA 2V9DA 2YDAA 1FWTA 1KM3A 3GXTA 2Q8ZA 3B8DA 3O16A 2VKZG 3LM7A 4UFIA 1DHPA 1TJRA 3N34A 1PL9A 1SZEA 2E1DA 4BI5A 5KSWA 1OX5A 4XKYA 4M6QA 2J27A 4JIPA 2QJIA 5HNRA 2CZEA 3LXAA 1JCMP 1LCOA 1RR2A 1EUNA 3EWYA 1HO4A 3TU9A 2ZQ0A 2ZDRA 3LRMA 4IX2A 3THAA 3LCFA 1EP2A 1B4KA 4IWWA 1XBXA 3WJYA 4O4VA 3ABOA 5CZ0A 1GG1A 3N2MA 3LCIA 1LLWA 3ABRA 4MZ1A 4UUIA 1HTIA 1FBAA 1VH7A 3LXBA 1OABA 1YPFA 3HJZA 1ICPA 5D03A 1VQTA 3QC3A 4M7SA 1NF0A 4IPIA 4JICA 5TQLA 1JRCA 4Z0SA 3GNNA 2A6NA 1OG0A 2FB2A 1A50A 1VPXA 4JIQA 4BF9A 3HGOA 3P74A 4X22A 1KM1A 2FPTA 1B57A 4I7UA 4PH6A 3HMJG 3VNDA 1GVQA 2FB3A 4YLWA 3QMTA 4LVAA 3F1QA 1OFOA 4O1BA 1FWNA 2NWSA 3PVFA 3NQMA 3G1VA 1TQJA 2RH9A 4Z0JA 4UTMA 2ZZ2A 4JY8A 3O6DA 4P61A 3W2UA 1I2RA 2BWGA 1KM2A 1G4PA 3QMRA 3PBVA 3QM3A 5A8GA 2QJHA 2PC4A 5CSSA 2DZXA 3LHZA 4K7YA 4R33A 1GOXA 3FFSA 5F2IA 1AMKA 3FJLA 3W1NA 3GDLA 2NZLA 2CW6A 3W83A 4RLIA 2VFDA 1X1OA 1QFEA 2C15A 3MBFA 1A5BA 4JTIA 4OHQA 4AF0B 1PHWA 3NPUA 4Z1AA 1KFCA 4A29A 2H8ZA 1OYAA 4CCCA 1WA3A 3I65A 3CC1A 4JTSA 4O0ZA 3QW3A 3W7IA 2Z0IA 3GAYA 3FYOA 3GIYA 1GQNA 3GXNA 5CKSA 5FF3A 5KMYA 3P67A 3F4NA 4JTJA 5U4NA 1YTEA 1WX0A 2V0TA 1TRDA 3F03K 3MWAA 3W23A 4P2VA 4NX0A 1F6PA 3M7WA 5E93A 1QCWA 4JYDA 4N9EA 5AHNA 3NPWA 4IMFA 2WNQA 1XI3A 4XWUA 2KZHA 3KHJA 4O15A 4O16A 2Y70A 4NNAA 4UTWA 2HMCA 3VE7A 1V7YA 3LGEA 3NQ2A 2A0NA 5FEWA 3DFOA 3HPSA 2P10A 3O6CA 3L5LA 3JRKA 3UWUA 2Z2UA 2E09A 3N14A 1D9EA 3IIZA 1H7NA 4ZMGA 2VELA 2V2DA 4AH7A 3B0UX 4UXDA 5D2VA 3SI9A 4TR9A 5HR7A 1TCDA 1VR6A 3EXRA 1SU5A 2BSLA 5C55A 3TKFA 3T40A 1OK4A 2WKJA 4Q4KA 5D05A 3EWBX 2ABAA 1OFQA 3C6CA 1UBSA 5A5WA 1QPOA 3NQ8A 1FDZA 1SO4A 1P4CA 1LRTA 1Z48A 3GB6A 3TE9A 1FXPA 2B7PA 3THQA 4WY0F 2AQWA 3NQ6A 3O8AA 1EUAA 2Q3OA 4TU1A 3SECA 1HUVA 1W1ZA 3M5XA 4Q33A 2RFGA 5BOOA 3O15A 4K38A 1KTNA 3HGSA 5AHIA 3ZWTA 2C16A 1GT8A 1OFRA 2Z1BA 3USBA 4UMAA 3LI0A 1VYSX 3LBCA 3SY5A 3QFEA 2EHHA 4KFNA 4QNWA 4XQ6A 1MEIA 2DORA 3QQ1A 1PS9A 1QR7A 1WOAA 3PS7A 3W74A 1OFPA 1TV5A 4UTLA 3LHUA 4NX5A 3NVTA 5KZDA 1G7VA 1W3TA 2WV8A 1H63A 3C2EA 2H90A 2Z6IA 2ZZ3A 1EX5A 5LNRA 5DELA 1XDMA 2I14A 3MI3A 1E51A 3AO0A 4RXGA 3P81A 1XDLA 1W5OA 3I7QA 3FJ6A 3W7MA 1H7OA 3H55A 1EPXA 3ATYA 2V5LA 1G4TA 5CPLA 2NUWA 5LNUA 2E6AA 2CU0A 2ISWA 1SFJA 2BLEA 1NAL1 1C9DA 4EIVA 4NZFA 1JUEA 1H7RA 4K7VA 3W1MA 3S8HA 4NU7A 1EB3A 1SQ7A 1YDOA 3I68A 2QCLA 2VFEA 3LHVA 4LVBA 3CB8A 5SWUA 1QWGA 4ZQOA 4JTKA 3G1SA 3PUEA 3TQVA 1NEYA 2VEKA 3TQKA 5H2ZA 3G22A 5AYZA 3C3NA 4OT7A 1F05A 1U83A 3DKJA 4ICNA 1JULA 1VYRA 2R94A 1FX6A 5LHEA 1W5NA 1SUXA 5D38A 3W7OA 3O07A 3CT7A 4JX6A 4L4LA 4LV9A 2R91A 4ADUA 3P84A 2OT1A 5K9DA 3MBDA 3N2XA 1LBLA 3GX9A 3PY2A 4ZVJA 1LDCA 4HNTA 1OK6A 1QO2A 2WNZA 1ZAHA 2DZUA 5CPOA 5HWNA 4WUIA 3IIXA 4NJGA 3HF3A 1F74A 1YPIA 1D3GA 5DXXA 5I3JA 1BWKA 3LDVA 3DENA 3T78A 5CG7A 3TROA 3GKAA 1V5XA 2RDWA 4K8HA 1SO5A 2C6QA 3DI1A 3G1AA 4Q32A 3VKJA 1LOSA 1VHCA 4LS1A 1I4NA 1P5BA 3TXZA 3TDFA 1OF6A 1G4SA 2NWRA 3GR7A 4UFLA 4WXZA 3MI2A 1PV8A 1DORA 1DV7A 3PWAA 1FWSA 4A21A 1OJXA 4A22A 3A21A 4AHOA 1SW7A 2XFWA 1IXPA 2QUUA 5BW6A 3EB2A 1DOSA 4GJ1A 4TO8A 2J9XA 2ZZ6A 3W75A 3P7YA 3R8RA 1TMHA 3EX1A 1Y0EA 3NQCA 3O06A 5DBTA 3UXDA 2WSRA 2ZRZA 4Y8FA 1RQBA 5G2WA 2QCHA 4KFOA 2UV8G 3R13A 2Y7FA 1W37A 2VFHA 4NJKA 3NM3A 4FX6M 4DPPA 1AW2A 5AHLA 1GTEA 3NL5A 5FESA 2QCDB 3W2KA 4XTIA 3FEMA 4UIOA 2ZBTA 2GVJA 3TCEA 3G3DA 4IMCA 3C2FA 2FIQA 4FNSA 1WV2A 3NGJA 4HPJA 1RZMA 4AHQA 3EKZA 5DY3A 3IGSA 2WSQA 1EP1A 4IXHA 3LCXA 5F4SA 1W31A 1EWEA 1SZFA 3E02A 5D2YA 1B9BA 1A5SA 2FDSA 1HG3A 4IMEA 4J9JA 3T7VA 2H3DA 3HG4A 3NR0A 1F7BA 2CWNA 2QCEA 1RV8A 1XC4A 4LUIA 1P1XA 2H3BA 2V2HA 5D2WA 1JJKA 4PTNA 4M5PA 2B0MA 2GQ8A 1X1ZA 4CQ8A 1P0NA 2OT0A 4FXSA 2CLIA 3K30A 2YR1A 5HINA 1LLZA 5H91A 1JUKA 2YSWA 3UXAA 2X30A 1H61A 4K37A 3P62A 1AW1A 2WQPA 5J5DA 4JX4A 4ZL1A 3S0CA 2VEPA 3VCRA 1KTCA 2DJLA 1L6YA 4WQ6A 2C19A 2CLLA 3PSWA 3EX4A 2ZZ5A 3WJZA 1QNVA 4R34A 3QSRA 1OFBA 2ABBA 1AG1O 2TRSA 2VENA 3O63A 4NZJA 4HNUA 4M6PA 4XKYB 2WSYA 1D3HA 3G0UA 1W5QA 4KWWA 3W87A 1O95A 2A7PA 3W70A 3G0SA 5E1QA 4JXCA 4RZ6A 4E2DA 3BV4A 3NXFA 3W88A 1H60A 2G96A 1FDJA 2Y63A 1ZNNA 3R12A 4OQVA 1SSGA 3LCWA 1W3IA 2W79A 3LI1A 3LLFA 1VYPX 3A5FA 3DU0A 3Q37A 1OFDA 2YYTA 5C2XA 2HS6A 3C61A 1XUZA 1EEPA 1KM4A 1SPQA 3PB2A 3LCGA 1H1YA 3G8RA 4HKPA 1FWRA 4M6VA 4NJIA 4O17A 5BRBA 1UASA 3SR7A 5F4XA 3TX9A 4XUGA 1XBZA 2GUUA 2X2GA 3Q58A 3QRHA 3UZJA 2WPBA 4N9CA 4UTKA 2ZRXA 2GVLA 4ONVA 3C8FA 2H8XA 3FA5A 4MFDA 2YYUA 1YTKA 4S1FA 4GUHA 2NX1A 2TMDA 3QH2A 4PFMA 5HQEA 3TJXA 3O6YX 4QM1A 4NNBA 5MHBA 4JTUA 3BLEA 2XN1A 2BXVA 4LWWA 4JD4A 3WFAA 2G5WA 2WOQA 2NXGA 1R46A 3DFPA 4FF7A 2XN2A 3M1ZA 3P80A 2DZWA 4YMZA 5BNKA 1LTDA 1KV5A 5KZEA 4GUFA 1TREA 3IRDA 4O0KA 4PA8A 3SIZA 5I3IA 5K2ZA 3IIOA 1LM1A 2CLMA 3TC7A 1QPQA 3UWQA 1TIMA 5CSRA 5D09A 3CIWA 3HO8A 3HBLA 2A7RA 4UTJA 3CU2A 3M6YA 3L9CA 2YW4A 2WJZA 1Q6QA 2J9ZA 1GWJA 3IGUA 3TMLA 2LLEA 5HULA 4UFMA 1LORA 5AC6A 1IGSA 3B04A 1X7FA 1TB3A 3W2JA 2X1SA 3NQFA 1ZALA 2C14A 2Q3RA 3C56A 3L68A 4O11A 2WO5A 5K9XA 5EL1A 3R89A 1LOQA 5LNVA 1R2RA 4PODA 4X3ZA 4UTHA 5AB3A 4Z1CA 1FQ0A 1UB3A 1AK5A 3DBPA 3CEUA 2CLFA 3UQNA 2PURA 2DZTA 3W7EA 1LBFA 1XBVA 3F4WA 3P8IA 4GRSA 3UY7A 3E12A 3CLMA 1F6KA 1T99A 2V8ZA 1IF2A 3MP5A 3ZR4A 1PCWA 6ALDA 2X1UA 4H3DA 1KFJA 1MSSA 3EWZA 1DBTA 5EYWA 3EWXA 4HHPA 3S1UA 5DCEA 4LVGA 2C1HA 2DZVA 2E68A 1H62A 1TPVA 1WOBA 3HG5A 3G1FA 4WXYA 5F4WA 4UR8A 1K03A 4NVTA 4I7VA 3S1WA 5HWMA 3TH6A 3FKKA 3W7GA 3TFCA 1TPWA 2D73A 4AWUA 4RZ5A 1ZFJA 4RJEA 2ATSA 1VS1A 4O57A 1XBYA 4LVFA 1KBJA 4AHPA 3DZ1A 3UY8A 4UFJA 3DFTA 3A24A 4IPJA 4BFAA 1S5VA 4JTTA 5LZLA 1QDSA 3DKLA 3L5AA 5LKYA 2YXGA 3VFLA 1O5KA 1JCJA 3LHYA 1M5WA 1ZAIA 3HQ1A 3P60A 3UD6A 1EIXA 3B06A 1B3OA 2OCZA 4IQLA 2DP3A 3GDMA 4IOTA 2F7FA 4HPXA 2HTMA 3LOTA 1A5CA 1DJNA 5EY5A 1ONRA 2DJXA 2ZTJA 3WK2A 4N6FA 3W9ZA 4N2YA 1TTPA 3UWZA 3SW6A 3U6WA 3RMJA 1IIHA 4NQ1A 3M47A 2Y89A 5AC8A 3W07A 3H54A 4OBTA 3W22A 2JK2A 3DFNA 4TIMA 3U2OA 3V75A 4GWEA 3HIJA 1GTHA 5IM51 4LOCA 3RU6A 5LGXA 1LYXA 2QAFA 1K7XA 3HGJA 4MUZA 1RQHA 4IUOA 1TSIA 1W5PA 1ADOA 4I7WA 3G1YA 2H6RA 1TJPA 4MY8A 3HB9A 2CLHA 3S5OA 3EKLA 5LSMA 4B5NA 2A2IA 1TQXA 4LC6A 3W76A 1MEHA 1FCQA 2CZDA 2RKXA 2NX3A 2E6YA 1N7KA 4Z1DA 3ABQA 1TYGA 2PRLA 3P82A 3PM6A 1I2NA 2A5HA 1YYAA 1YDVA 3CPRA 1PCKA 1VRDA 4ADSA 1S5TA 3GR8A 2YW3A 2E5BA 4AB4A 3L0KA 5K3VA 3RF9A 3L5MA 1TPDA 3PUOA 3B0VC 3S5YA 5AFDA 5KZMA 3C0JA 2YGYA 5EBUA 3O05A 3VI2A 5I3FA 3G1HA 5KITA 4BK9A 1ICSA 3W73A 3NL6A 5ABTA 1QOPA 3W7CA 1XM3A 3SGUA 4S2BA 3PC0A 2F84A 4JN6A 3M5ZA 2JKPA 2QCNA 4JGDA 4O1AA 1JVNA 4PL2A 3T44A 2PRHA 1TV7A 4IMDA 4KFPA 1LOLA 3W84A 2QUVA 3BVJA 1K02A 4QQ3A 1IIGA 1AW5A 4RXFA 2YCEA 3DAQA 3TC6A 1SFLA 1T96A 3EX6A 5IBXC 4RCXA 1JCXA 3ANYA 4IX0A 4IMGA 1G6CA 2VFFA 5F2LA 3W2LA 5AYXA 1GG0A 1NVMA 1KM6A 5CZSA 1EWDA 4PEKA 1XCFA 2RDUA 5CPNA 1CI1A 1O60A 1YXCA 4N02A 4QJ1A 2OMAA 3W1LA 3W3OA 2HSAA 3QYQA 5T26A 2FLIA 3TK7A 4UTUA 1H7PA 4AWSA 1VC4A 2E5DA 4CCEA 2A85A 3TW6A 5J5RA 3NA8A 1XFBA 3LBMA 3JS3A 1ZY9A 4N9DA 3NYZA 4GC4A 5HJLA 1WQ5A 5G2IA 3WK3A 1GVRA 2A1YA 3OA3A 4MLJA 1SO3A 1EA0A 1FDYA 3G1XA 1S5WA 4BWLC 3HOJA 1TPC1 4UFHA 3HG3A 3Q2DA 1N55A 4IGHA 4O50A 4LV4A 3DHFA 4JDYA 4AAJA 1TPEA 4KWVA 6TIMA 3MI6A 2J6XA 4RV8A 4N9BA 4Z08A 3TAOA 3KFTA 5KINA 4UMBA 4MLRA 5C6MA 1IXOA 3CQ0A 2ALDA 4AWTA 2HS8A 4O8RA 5HUPA 2NV2A 3OVPA 4AMAA 2FPYA 1IXQA 3PR2A 2G95A 4CQ9A 4WOZA 3W7LA 3NQAA 3TJLA 4DO4A 3M44A 5CPMA 4X9SA 5I3KA 3NEVA 3KRZA 3Q94A 1SO6A 1KBIA 4XZ9A 3QF0A 4G1KA 5D37A 4YXGA 3LXCA 2A7NA 3DXIA 4K6AA 2V81A 3W71A 4OWGA 3M5VA 4DO6A 4LU0A 2Y85A 2QCMA 1GJPA 4FXRA 2ZRUA 2QKFA 1GZGA 3IIPA 1VLIA 2YPIA 3E49A 1TPUA 1L9WA 3TAKA 2VOMA 2C0AA 4MZYA 1QPNA 3RK8A 4JTLA 1U5JA 4YWIA 1DL3A 1RPXA 3EWUA 1JR1A 2BZNA 4CNPA 1M7OA 3KOFA 4N6EA 1LRQA 2B7NA 1EP3A 3HGRA 2Y88A 1ZENA 2QDHA 4HN4A 4ORMA 1F5ZA 2DZPA 1FCBA 3B03A 4FNQA 4ZQCA 3NAVA 1WDWA 3TQ0A 1KM0A 3W86A 2VC6A 3G24A 1K8XA 2A4AA 4UTTC 3WJSA 2A6LA 5DXYA 2NX9A 2Y7EA 2V82A 2ZCGA 1RQEA 2QCFA 4A2RA 1ML1A 3HG2A 4NXKA 3CIXA 2TYSA 1Z42A 3GKFA 4YL2A 2J88A 4XBKA 4LTSA 4S2CA 3LV5A 4WOQA 1ZJIA 3B0PA 4IXXA 3SZ8A 3W7DA 3L21A 3C52A 4LW7A 4DPQA 2CLOA 4UFKA 3UNDA 1H7XA 4MOZA 2P1FA 1XUUA 2QDGA 1B4EA 1JRBA 3S5ZA 3OBKA 1OYCA 4QIUA 2ZZ1A 3LHWA 1ME7A 1LRNA 1LP6A 4DF1A 4W9TA 4DEFA 3EX2A 1KFLA 1OX6A 2NUXA 1I45A 1YDNA 4UMCA 3W1TA 4ZQMA 3MHGA 4OE7A 4I9AA 5DCBA 3I7SA 4OGZA 4YCOA 3PG9A 2OJPA 3P8JA 4MKNA 1S3HA 3TSDA 3IVUA 1KA9F 5AOUA 5G4WA 3STCA 3BG3A 3EXTA 3WK1A 1OFAA 4Y90A 4Z1BA 3CEPA 3N19B 1H5YA 1O94A 1OX4B 2DU2A 1G4EA 5F1VA 3E96A 1VGAA 1HL2A 3PSVA 3SGZA 1SZNA 3W7PA 1K7FA 5AHFA 3MYPA 2I9EA 1W3NA 3CWNA 5EPDA 3BW2A 2QF7A 2C18A 3BGGA 2J24A 4PC8A 4LUJA 3GYEA 1I2QA 1Q6LA 3B4UA 1KFBA 3ATZA 3S1XA 2R8WA 5C54A 2X1TA 4HSNA 2QCGA 1OYBA 5HMSA 1DVJA 3STFA 2FFCA 5CZJA 4UC5A 3TMQA 4BI7A 3I6RA 1OFEA 2BTMA 2C13A 4NJJA 4Y6GA 1QPRA 3BGJA 3C2VA 3NZRA 2DZSA 2GJLA 2VEIA 3NO5A 3W85A 1OF8A 4MY9A 3BPWA 4K36A 3CWOX 2EKCA 1TTIA 1AL7A 4RX0A 1TV8A 4WY0A 4E38A 5DN1A 1KFKA 1FXQA 3NL3A 3MUXA 2ATMA 3PBWA 3QSTA 3TIMA 3QPZA 4FX7A 1JQVA 3OVQA 2E5CA 4LS2A 1SW0A 1BTMA 2Y62A 1TPH1 4LC8A 5G2HA 5K7JA 1CX9A 1I2OA 3TSMA 1H51A 1KFEA 3NQVA 4O10A 4U4MA 2O7QA 4QITA 1R47A 4UR7A 2VEMA 4AVFA 1DQXA 1ME8A 2QR6A 1FCVA 2ZA3A 3TA6A
chains in the Genus database with same CATH superfamily
4GZIA 3OO2A 4KKXA 1Y5WA 3PG8A 3VFCA 1BWLA 4V27A 4BEQA 3SFKA 1BF2A 5LHFA 2NT1A 3WQWA 3VK5A 4HCDA 3OGSA 3OYZA 3WH5A 2DVUA 1BG4A 3QZEA 1GOWA 3JVAA 1KXHA 5CBBA 4H8VA 4QJ4B 7REQA 4QP0A 3E1F1 2X42A 1MFUA 2ZFAA 5I77A 2PTWA 3QMSA 4UTWC 5DT7A 4D1IA 3V0TA 1OT1A 3BG9A 3CK5A 5LNSA 1FOBA 3GUWA 1ZBCA 2VNCA 1HT6A 3W72A 1JCYA 3WH8A 2YA2A 4JIIX 1B31A 1R30A 3UCQA 2CKRA 2BY1A 1VFLA 5G4EA 3S6TA 1MWOA 3G1DA 3PNUA 3WF2A 3R11A 2ESCA 4L1XA 1DJQA 1CLXA 1XLBA 3TSBA 4AIOA 4C91A 3BK0A 4O18A 1M7PA 3VIKA 3RLUA 5LNWA 1WYIA 3GK0A 2QJJA 4H01A 3WD3A 4BHYA 1EBHA 4ATWA 5FOOA 4PUMA 4H9UA 1AH4A 3GTNA 1WNOA 3MP4A 1PZ2A 4ZOCA 1EJUC 1T8QA 2XIMA 3AXHA 1J0HA 2X05A 1VCVA 1JZ3A 4DF0A 2V30A 2W62A 4WZHA 4G8TA 3IAQA 5XIMA 3EPMA 4XO6A 3H2CA 4PUWA 1PXGA 3T0TA 4IFKB 3GD6A 2NV1A 1UUMA 5FEPA 2E9BA 4GXWA 4F0RA 4GZEA 1IXNA 3M46A 3LTYA 2VR5A 3B8TA 4FHAA 2D2OA 3EPOA 1FWDC 1XD0A 3ARUA 1A5AA 2PDWA 4Y9MA 1NFBA 1A47A 3SGGA 3THCA 1RP8A 4UQ9A 3EXSA 3RDKA 4D6JA 4AD2A 4PMQA 4GH1A 5D02A 4JS3A 4AZ5A 2XG9A 3BLIA 3T05A 2GPTA 4H4IA 4V15A 5IDIA 5HBFA 4LNCA 2B7QA 3UVIA 4AYSA 2G97A 3PWIA 3BSMA 5F2GA 4NT0A 4TMCA 1MEWA 4O54A 3IJ8A 1E5NA 1XIGA 3W7RA 5G1TA 3DN5A 1V79A 3KVLA 2BGNE 3WJXA 4W8BA 3QTPA 4E3TA 2CZFA 2DDXA 1HO1A 3NQGA 1E1CB 4WRHA 3VDGA 1FP9A 2J9YA 4R3UA 3W2MA 4Y7EA 4AY8A 3ZT7A 3UPMA 2PWGA 1QXLA 2PDQA 3AMLA 1PE1A 3JZUA 5DMLA 5A8MA 1W1A1 1KCKA 1UW9A 1W54A 4YVVA 2JGQA 3KBNA 1R9YA 4PULA 1QVBA 4JTHA 4J40A 3GXPA 4MFEA 3CQHA 1MZHA 3LERA 2J77A 1JFHA 3VKDA 4GQBA 4AD1A 1F4HA 2XVPA 4K8EA 4W84A 1F2JA 4C1NB 3C0QA 4PCNA 1VFUA 4YTTA 1Q66A 3G8EA 2Y7GA 4CN6A 5JU6A 3OOQA 3SCVA 3VIJA 2IPWA 4UQCA 4NZ5A 3ZLFA 4QNEA 3NDOA 4ZOAA 1TTJA 1E1FA 1W6TA 3WMCA 4GJIA 4R85A 3AHZA 4MWAC 3NIYA 4HPHA 3WQPA 5I78A 3UZ5A 1JAEA 1T0OA 2W61A 1O1HA 3IVTA 2Q8LA 3M41A 2VX7A 5REQA 2JKEA 4YIWA 5K4XA 1WXJA 3BCFA 1G9HA 4REQA 3GWQA 3B40A 3EPNA 3GLCA 3PBYA 3W01A 3DGRA 5G5IA 2ONEA 1C8YA 3D0CA 2DFAA 1BWVA 4TXEA 1UWSA 1PTAA 1KQYA 3WH7A 1QI5A 4PBEA 3HPXA 3P61A 4BCEA 2PSNA 2XFRA 2X1RA 3E5PA 3NUKA 3S5NA 5I09A 4OU1A 3V5CA 1JNDA 1RBOB 3UGVA 3ABSA 4DJED 2OSWA 1C91A 5E0CA 5LIKX 1JZ7A 1Y8BA 4ACZB 3UPWA 4D2JA 2QGYA 5DLCA 3RAOA 4EK7A 3BGAA 3RFAA 2Z1WA 1JZ4A 1M1BA 2UBPC 4LS0A 4LNYA 4I6VA 2J74A 2W0UA 5A6JA 1WAUA 4QAIA 3KBJA 2PS2A 4M3PA 3TR2A 8XIMA 4A8IA 1YLVA 4QG9A 1B3YA 4KIRA 3PZGA 3MUY1 2OYLA 3R7MA 4MJZA 1DHKA 1FKXA 2NLYA 4UBPC 1ZAJA 4G1NA 3EB3A 4QEEA 3AMGA 3GIQA 3N73A 3LCLA 2V2CA 1BQGA 3U7VA 3PAJA 1Q6FA 5CGMA 3EWWA 3KVKA 1WE5A 3H6OA 3CQIA 2TSYA 4UQEA 2O9RA 3L4VA 3M9YA 1E6SM 1EJ7L 1TVNA 3WYZA 5F2MA 1QHOA 4PYSA 1VBJA 1TUFA 1UIOA 3NM1A 5FEXA 1XC6A 1X8FA 1TA3A 4DYEA 1BKSA 1X6UA 2QEZA 4DUVA 4O53A 4GBUA 1LWJA 4AWEA 4DJFD 1TZZA 3QR1A 3WQVA 2RUSA 2J79A 1JPHA 1K8YA 2XYLA 4M29A 4RK8A 1EOKA 1OZQA 1UMYA 4MNLA 2PCQA 2GWGA 4US6A 1C90A 3IV3A 2YB1A 1RVGA 4PSPA 2XJ7A 1TG7A 1PX8A 3ITOA 4WGXA 5I3GA 4MZ8A 1E4NA 1DYSA 1I9CB 4JR5A 4UCGA 5FAGA 3UW6A 2AGKA 4QRNA 4Q8TA 2BX7A 1SZGA 3MVTA 2OGJA 1JAKA 1ZUAX 4QFUA 1KV8A 4E8GA 3K5XA 4F2BA 3E5BA 4B5VA 2PF0A 4AG0A 3F5LA 1VFOA 2GJRA 3WH6A 2ALRA 3R0DA 3GNDA 1XLCA 3NDZA 2PDMA 4OVXA 4AZ6A 3WNKA 4H9ZA 1HVQA 4IIBA 3MMTA 1J9YA 2Y6ZA 2INZA 1XWYA 3NL2A 2WVSA 4ECLA 2D24A 3AS2A 1S5NA 5BWFA 1W9PA 1XQLA 2V3GA 1OSEA 1XGEA 4JHZA 2ZC8A 3CZLA 4DWSD 3W6YA 1JI1A 4CEXC 2J7BA 3CO4A 4U5KA 1K3UA 1KR0A 2PDGA 3VM5A 3NQ7A 2FDMA 4A3HA 3AJXA 4QEHA 2VX6A 2QCCA 1MFVA 3LQLA 3BMVA 4TVDA 1R38A 3ONBA 1DQWA 3DHDA 4L65A 4ZQPA 3TOPA 1DJGA 4L61A 3GG0A 1GEHA 1N82A 4AZBA 5LXXA 1UZDA 3AC0A 5DMYA 2OKOA 4FPSA 3PUDA 3WNPA 4QE5A 1FWWA 4POCA 1W3JA 1R9ZA 4LT9A 3WUFA 3CQJA 1OX4A 1V0LA 4ACYA 3PZMA 2QXWA 3H26A 3B8DA 3LY0A 3O16A 4JFUA 3GVQA 2EPLX 3V0UA 3N34A 2WZEA 4IL0A 1IT7A 3RX4A 2QJIA 1R7AA 1UPMB 5HNRA 2Z25A 3RUBL 3IUHA 3H12A 1LCOA 3EWYA 3AXIA 4KBXA 3DG6A 3WMBA 3LCFA 4GI6A 1PX3A 3WJYA 4O4VA 3ABOA 3LCIA 1JXKA 3LXBA 5A6SA 4IFRA 4XVEA 1O66A 1YPFA 4S3AA 3V5FA 1VQTA 2PDCA 1EZWA 3GE7A 4OTKA 2F6UA 5TQLA 4GYPA 1A50A 4JIQA 4BF9A 3WD0A 4DAFA 3P6LA 4N0RA 4RDYA 3ABZA 3AISA 3RJXA 1B57A 1V4YA 4PH6A 5AZ0A 2FB3A 4AIBA 2IQ0A 4Q6XA 3F1QA 4JN7A 5J04A 1W32A 3G1VA 1TQJA 1N2VA 4MWAE 3O6DA 3W2UA 4LEQA 1I2RA 1W1PA 3PBVA 2WANA 1UC5A 5BWAA 1CGYA 2H9AB 1GOXA 3FFSA 4ZR8A 1A0DA 3GDLA 4MPKA 2GFTA 1A80A 2VFDA 4DZ5A 1A5BA 4EE9A 1PHWA 3SRHA 4QDPA 3NCOA 2XFFA 1KFCA 1TMLA 4A29A 1OYAA 5A6BD 3GTFA 3PFRA 3CHFA 4TVUA 5CC3A 1GQNA 3VIFA 3RXZA 4OIFA 4JTJA 1S1RA 4GINA 1WXYA 3AIQA 2V0TA 3BCDA 4YTUA 4WKHA 1F6PA 4F66A 2VHLA 3GHTA 4N9EA 5AHNA 3NPWA 1CNVA 3VGGA 1XI3A 3S2NA 1R3RA 1REQB 4GY1A 2RGLA 1JPMA 2XSBA 3AYSA 4IM4A 3EOSA 3NQ2A 4YN5A 2A0NA 3DFOA 2P10A 3EOLA 3NGFA 3ZT6A 2HEJA 3UZZA 2E09A 3NWRA 4ZMGA 4W7UA 1A4LA 4DUWA 1UP3A 5I79A 1LT7A 1TCDA 4LAOA 1SU5A 2YDQA 4I3GA 4FP1A 5C55A 1Q13A 2MANA 1D8CA 5D05A 4OBSA 2OEJA 1AH3A 3RRXA 1E6QM 4ZTXA 3URBA 3TZFA 3WUBA 1SO4A 3NQ6A 4HNOA 5IFPA 1B1YA 1EUAA 1S2WA 3K8LA 1XRSA 3LSBA 1W1YA 4Q33A 2RFGA 4Z1YA 1IGWA 5BOOA 1NY1A 4CCZA 3CZ8A 1NOWA 4R9XA 1VF8A 3EAUA 2Z1BA 1GQJA 3KTXA 4P7OA 3WFZA 5I3DA 3QFEA 3W28A 2ZXDA 4KFNA 4QNWA 3QGVA 4PN2A 4B3ZA 1JXJA 2DORA 3QQ1A 3HQOA 1DWIM 1WOAA 3W74A 3SRFA 4FSAA 4NX5A 1G7VA 3VO0A 3T2QA 1H63A 3C2EA 4C6CA 3IUIA 3OU8A 2H90A 2Z6IA 3V0SA 1MDLA 2I5IA 1XLFA 4M6UA 1J11A 5DELA 2ZUMA 3MUCA 3DG3A 2O55A 3POHA 2ANUA 2PBGA 1DJZA 2Z7GA 3WBYA 3ATYA 2QV4A 2V5LA 1G4TA 4F2TA 5LNUA 2XVNA 3EYPA 3VDCA 4WDWA 1SFJA 1C9DA 3E0WA 4FI4A 2ZVIA 1H7RA 4K7VA 3URAA 1EB3A 3V5OA 4LGXA 2D22A 3AIRA 1RK6A 1LUCA 3GSMA 2QUNA 1PWLA 5SWUA 4M1RA 3GY1A 2VCAA 3G1SA 3WQCA 1NEYA 1XICA 3TLQA 2GZXA 4HMEA 2X40A 4GNKB 1F05A 1U83A 3CLWA 2YCKX 1ISVA 3F4CA 2DUXA 3TP4A 4FF5A 1PB0A 3CZEA 1W5NA 3CT7A 1Q8JA 1VJSA 4LAMA 1UOZA 4AZ7A 1XLGA 2OT1A 5K9DA 5FL0A 1LBLA 4DWDA 5C7HA 2FTYA 2JQXA 2F38A 1OK6A 4QXIA 1QO2A 2WNZA 4RW5A 4NAFB 2DZUA 4OJYA 5CPOA 4WUIA 4PUJA 3VINA 4NJGA 1J0IA 2KAUC 3TWBA 3JZEA 1F74A 3EA1A 3LDVA 1XLIA 4PZVA 3QV6A 3T78A 5CG7A 3V4BA 3ECQA 4K8HA 1SO5A 5C0QA 5CC7A 1NQKA 1I4NA 1A0CA 4G7EA 1OF6A 4WXZA 3GR7A 5DO8A 3V7PA 4PTVA 1XH1A 1OJXA 3IV8A 4LY4A 4Y8EA 1EJRC 4R7WA 2G3IA 2J9XA 5EMLA 3HTWA 3W75A 4JFWA 3EX1A 4W7WA 3O06A 2VOTA 5TAOA 1PBGA 3KDNA 4Y8FA 1RQBA 5G2WA 4GQRA 2QCHA 1VD6A 4MSSA 3R13A 3SUUA 2R1KA 2Y2WA 2Z1XA 3NM3A 4DPPA 1AW2A 5AHLA 4GKLA 3NL5A 4CN1A 2R1PA 4XTIA 3FEMA 4UIOA 3UERA 2ZBTA 3B8UA 3GRIA 1JFXA 3M0HA 4U31A 2O56A 3NGJA 4HPJA 1PAMA 4J5NA 3ZM8A 3UR8A 2UZ9A 3LCXA 1Q7QA 2WMIA 1YKWA 4LALA 1EWEA 1SZFA 3ANVA 3AU6A 5D2YA 2J7GA 1B9BA 1KRMA 1HG3A 1KBBA 3T7VA 5JBFA 3E2SA 4HK5A 4WSJA 5C9XA 3KBSA 2HVNA 4H6QA 3MMDA 5CH9A 2BHYA 3U57A 4R5EA 3LA4A 1XC4A 4IUGA 1JJKA 4UNIA 4M5PA 3OLDA 1X1ZA 1LL4A 5A95A 2OT0A 4L6OA 3GXIA 5HINA 3KEHA 3G77A 4DLMA 1XH0A 3P62A 2WQPA 1SJCA 5JIWA 1W2PA 4J35A 3PTDA 4ZODA 3VCRA 3WN6A 4WQ6A 3JW7A 2CLLA 5GJNA 3WJZA 2NVDA 1M65A 3LGGA 2VENA 3O63A 4M6PA 4XKYB 2WSYA 3G0UA 4KWWA 3LPPA 2XPKA 3ARTA 2P0IA 1BVNP 3H2FA 3N2TA 4XK2A 2Q02A 4Q8PA 3BV4A 1YHTA 3NXFA 3W88A 1XGZA 1H60A 3GH5A 1SJAA 4HMDA 4DUOA 1W3IA 3LI1A 1OFDA 1XGDA 3CAQA 3S2LA 3LCGA 4GHRA 3GNRA 2VD9A 1RY8A 4O17A 5BRBA 1UASA 2QYGA 4TTUA 3TX9A 2E3ZA 4HU3A 2YJQA 1BKHA 4L6HA 4BQ3A 2E4TA 1VFSA 3LGDA 3UBPC 3UZJA 3L7RA 5HATA 5A6TC 3NZGA 2EQDA 4ONVA 2V6AA 4UOJA 4AD0A 2ACSA 2X0HA 1JDCA 3E2RA 2TMDA 4PFMA 2HBXA 1CB7B 2J7EA 3USZA 4FK9A 4I6KA 3GTHA 2O92A 4JTUA 4Q3MA 2O9OA 4Z2JA 5FCZA 5CAHA 1WP6A 3HPAA 3M1ZA 4D6DA 3P80A 1IEQA 1LTDA 3TCSA 1NFPA 3P0XA 4PA8A 1E4MM 4XIMA 3SIZA 4AC1X 2VCBA 3IIOA 1QW7A 3UWQA 1QPQA 6TAAA 5D09A 3TR9A 5HNTA 1Q7ZA 4UTJA 4IP7A 3CU2A 1UPPA 9XIMA 1Q6QA 4AEEA 4J3VA 1GWJA 2Q6ZA 4UFMA 1XIFA 1HJQA 2DH2A 2PP1A 4WDTA 1ZALA 2C14A 2WO5A 1PDYA 3FHQA 5K9XA 1JZ2A 4X3ZA 3DBPA 3UQNA 2CLFA 1BVWA 2PZ0A 2PURA 3OTRA 3PZ9A 4YU1A 1LBFA 1XBVA 4AVOA 1ONWA 1QJWA 1F6KA 1IF2A 3ZR4A 4ZXLA 1KRCC 3CZGA 1KFJA 1MSSA 1UP0A 3EWXA 4HHPA 1G0CA 3P2VA 3MVIA 1OQFA 2E9LA 4LVGA 4PRRA 5JMUA 3MDWA 2E68A 1WOBA 3HG5A 4WXYA 1K03A 2DVTA 2PP0A 1CCWB 2NQLA 3SQMA 3REQA 3DFYA 3WH9A 4NAEB 4RZ5A 5GNYA 1DJWA 4O57A 1XBYA 4LVFA 3DZ1A 3DYOA 4UFJA 4ZE5A 3FSUA 4IPJA 5LKYA 3V36A 4LXFA 2YXGA 3VFLA 1L8NA 1AQFA 4Q7NA 4WLCA 3ALGA 2BASA 3B06A 1B3OA 3ARPA 3H7RA 5LA2A 1GOKA 2F7FA 2INEA 3N12A 2HTMA 2J7CA 2X7VA 5HOSA 1UKTA 5HK4A 3OW1A 4D6EA 3N1AA 4CU8A 2DJXA 3DCPA 4QE1A 5CC6A 4Q8WA 1PKNA 4N6FA 3W9ZA 4N2YA 3UWZA 2Y8VA 3RMJA 1M04A 2ZX9A 3M47A 3VMPA 2Y89A 2G4FA 5AC8A 1WKFA 1JPIA 1XYCA 4A8NA 3U2OA 5IM51 5LGXA 1LYXA 4GY7A 3BOXA 4IUOA 1J01A 1ADOA 1TJPA 2PDNA 4B5NA 3ARXA 3W76A 2CZDA 2PPGA 3P82A 5A8OA 3CHDA 4J1OA 1YYAA 2F2HA 1VRDA 2PODA 3GR8A 2YW3A 1V51A 3L0KA 3C0SA 4PRWA 3BLPX 3AXXA 5ABGA 3L5MA 1TPDA 3PUOA 1FHVA 4DZAA 2YGYA 4PMYA 3O05A 1W9VA 2IKIA 3G1HA 1PIGA 3W73A 3NL6A 3VTRA 5ABTA 5AECA 4EPKA 3WELA 3HFYA 5LIYX 4H8NA 1Q85A 4O1AA 1MYRA 2XZ7A 3KL3A 4IMDA 2NVAA 1LOLA 2QUVA 1K02A 3RCMA 4BKNA 1FWBC 4AIEA 3QHOA 3GVRA 3KUMA 2RJGA 5LA1A 2WVVA 2DQXA 1FWJC 3AFBA 1GZ1A 1I1XA 2BV9A 4C60A 2VFFA 2DUAA 3AYRA 4DM1A 4PR4A 1IE7C 2E8ZA 1BAGA 5CPTA 1CXKA 2JEQA 1FWEC 3BQ6A 1LQAA 5CPNA 1O60A 4NI3A 4JIEA 2DIEA 4F79A 1C9WA 1NDVA 1CEOA 1YDYA 1VC4A 3KDOA 4GISA 5J5RA 5JIPA 3Q67A 1T40A 1ZY9A 4IGNA 4GC4A 3PZQA 3WQGA 1FH8A 5G2IA 1EC9A 2R24A 4ZSTA 1GVRA 3OA3A 1SO3A 1PJ9A 1XLKA 2XFYA 1GOMA 1R7OA 2G37A 5E9XA 4J7RA 1T6MA 4H9VA 4O50A 3N25A 1OGBA 4IP5A 4JDYA 4GMEA 2UY4A 3KFTA 4L4PA 1IXOA 3CQ0A 3PPHA 4J3WA 5IHRA 4O8RA 1EYEA 5HUPA 1JYWA 2O4QA 4ZGYA 3OVPA 2O9PA 2I5QA 1CGUA 3PR2A 4RNHA 1POJA 2XIIA 3AZSA 3OPSA 3TJLA 3NEVA 1SO6A 1MQQA 4XZ9A 5D37A 4YXGA 1UH3A 2PUZA 2A7NA 1DXIA 1HXJA 4K6AA 3LS9A 4DO6A 1HIZA 3ARVA 3WF4A 1WKDA 1MXDA 4WHBA 3TZNA 2R9RA 3S9ZA 1BGAA 1ZZMA 2YPIA 1TPUA 2HRWA 2C0AA 3WUGA 3UVAA 4PMVA 1J2BA 1DL3A 1KCZA 1UKSA 4H9YA 1PZ3A 1RCXB 2Y5EA 3KOFA 2VC7A 4N6EA 1GVIA 1ELSA 1ZENA 4HN4A 1F5ZA 1FCBA 2ZE3A 3B03A 4GVIA 4ZQCA 1WDWA 4Q22A 3IJLA 1XRFA 3G24A 4ATLA 3TN4A 2A6LA 2GK1B 3LMYA 4LUTA 3SUTA 1E71M 4HOZA 2D0FA 3HG2A 4NXKA 4A05A 2TYSA 1E6PA 1Z42A 3KTCA 4DO7A 2J88A 4LTSA 2Y24A 4E8DA 2VQTA 4UFKA 2DEPA 4MOZA 2QDGA 1JRBA 1TWWA 2WHMA 2ZZ1A 3LHWA 2X09A 3QV9A 1MI3A 3H22A 4W9TA 3NEHA 1OX6A 3A3XA 3CZKA 2F9RA 3I3BA 3VXGA 1NDYA 4I9AA 1L8PA 1GOOA 2G50A 4OGZA 1ECEA 4YCOA 2OPJA 5BRPA 3P8JA 4JHMA 1KA9F 5AOUA 4XKMA 3DDMA 1YE4A 5HMEA 4CD8A 3ZZ1A 1L6GA 5BYWA 2AQOA 5AVNA 1XQKA 3AIBA 2EPOA 3CEPA 3PSVA 3SGZA 3W7PA 4GK8A 4M24A 1E43A 2DY3A 2FZMA 5AHFA 1KRAC 2VWSA 1W3NA 3L12A 3T81A 3BW2A 1TWDA 2QF7A 2ZWYA 3H2NA 4FR6A 1UD8A 1Q6LA 3B4UA 3G5EA 4KW2A 4KWOA 4QSFA 5BZAA 4UB9A 3ATZA 2A3LA 4P7LA 4DJDD 2XH0A 3DFHA 3PZIA 5AC4A 3ITCA 4GYPC 1WZLA 1XIDA 3SN4A 4BI7A 1QNRA 1TV3A 4Y6GA 1XCXA 2OZTA 1C3FA 4Z2GA 3ZYZA 3PBGA 1VB9A 3K46A 5I0DA 4O8AA 2GJLA 1QATA 1WUEA 3NO5A 1JCTA 4MY9A 4J28A 2XWEA 1TTIA 4DB7A 1AL7A 1IEVA 2IUZA 4OOZA 3C2YA 3WD4A 1FXQA 4C6FA 3QSTA 2HWGA 4LF1A 4MAZA 4FX7A 1JQVA 2CHOA 3EDEA 2FTWA 3OVQA 4QQUA 1A5MC 3NO1A 1DTUA 2FMOA 3WENA 3MKKA 3ZLHA 3ZJ7A 1RPKA 3NQVA 1Y7VA 2PCEA 4O10A 1J93A 4QITA 2VEMA 4D6IA 2WMHA 1H11A 1J5SA 1DQXA 1QOXA 3U4AA 1FWCC 4DN1A 4EAYA 2ZA3A 1TVPA 3P5ZA 4I5UA 2GSHA 3GZ3A 3S6DA 3QOKA 5FI8A 3FKRA 5TBOA 3AI0A 4QDWA 2OQYA 1TO3A 5GPRA 4GX9A 3VD3A 3NPXA 4UQAA 4JDBA 2PTZA 3MPGA 1RJQA 5AHEA 1XIMA 5K4ZA 3BAYA 1FH7A 4BF7A 2Z29A 3KRUA 1GEQA 1GPFA 3S5SA 4CD5A 4JTCA 3S1VA 3N3MA 3WLQA 2QJNA 3GU2A 1UOKA 2GVGA 4HMCA 3WEMA 4R9OA 1A3WA 4Q4OA 1KR1A 2A21A 5CZTA 2ZA2A 1EH9A 4I9TA 4C6NA 1OCJA 1YE6A 1YTDA 4KF1A 1EL3A 3M0ZA 4M7TA 3VABA 1B9ZA 1FWGC 4GBDA 5DBUA 3W1XA 2XINA 2XH4A 3TV8A 5EFDA 2GOKA 3OHIA 1F61A 1Q45A 2GJPA 3F5JA 1QOQA 3Q45A 4U3AA 1V3JA 3AOFA 4JY9A 1D8WA 4RDWA 2HPMA 3U2CA 3DGBA 4ORIA 3KM8A 1VKFA 4AQLA 4JX5A 3RNDA 1HGWA 1G7UA 1CECA 4INFA 3WD2A 5CBJA 5E09A 1JDDA 4G7FA 2CCRA 3VX0A 4E0CA 3TUUA 2E77A 2WNWA 1PKYA 3NNTA 4IJCA 3UFYA 4EXQA 2ZVRA 3OLGA 1CXLA 5D2XA 5T91A 3UT0A 1A3HA 2IPFA 3LPOA 1TWSA 1GQKA 1JPKA 5EMYA 5IHSA 3KS5A 3CTLA 4GPNA 1NF7A 2J7FA 4H19A 1CGTA 3WCZA 5BCAA 3BLOA 1ITQA 3K1DA 1LROA 5FJPA 4D1JA 1I0DA 3S83A 1PIIA 1Q6OA 2TODA 1KLZA 3S6OA 4IT1A 3TXVA 5AN7A 3T09A 2VURA 3YPIA 3FVDA 3DECA 3EDJA 2ZZ4A 3HM7A 1Q3NA 2Z27A 1XX1A 1C92A 1H50A 2RHGA 1WDRA 4XZIA 5JBEA 1E0VA 2G8ZA 1GVSA 4KEUA 1AFSA 5D9MA 3QPEA 3WFLA 4HGXA 3TNBA 3TN5A 3QVQA 4ML4A 4IIEA 4GABA 3B3DA 1B30A 3B9EA 4O52A 4GVHA 2GOUA 4FIRA 2BS9A 5H8UA 2O7SA 3TOYA 2DQWA 3FAXA 4ZO8A 5D9OA 5C2GA 3P5YA 5HR6A 3WDPP 1XXXA 5A69A 1XRTA 1GW1A 3CIVA 2OX1A 4F48A 1ODZA 4GYJA 1R2TA 4CQAA 3FEQA 4C1KA 2ZXQA 3RX2A 1H5VA 3TW9A 1FWIC 2EJ1A 3OGVA 2QZRA 4E2BA 1AQMA 1U22A 3ZWSA 2D1ZA 2P3EA 3W1UA 1F9CA 4ML9A 1US0A 4FB7A 3VUSA 2A3HA 4BQ4A 4HVXA 2GVYA 3L4XA 3AHTA 2ZX7A 1SR9A 3AICA 3D46A 4O4WA 1LWIA 1VCFA 2HVMA 2OZ0A 3MHUA 1UR9A 4AXKA 2BBFA 2CYGA 3W7HA 4JYFA 3UETA 3UJEA 2W66A 3WNOA 3A64A 3ZVHA 4X2RA 1IEIA 4CN4A 4EAMA 5HDRA 1XDJA 1AQ0A 3GR4A 3VC5A 2BHUA 4HOXA 4PCFA 3OYXA 1G94A 3UA3A 2XDFA 1VIWA 1FHUA 3KCLA 2ISFA 4MY1A 3M5YA 4HHHA 4ADTA 1M9HA 5LA0A 4EXBA 4XAYA 1XS2A 2VGIA 1A5UA 1QASA 4P7NA 4I90A 4JQAA 3FYPA 1FUYA 2J47A 3F2CA 4WD0A 4Z2LA 3HA1A 2QW5A 4TMBA 2EO7A 4AZHA 3UWVA 3N4AA 5CCZA 3LK6A 5AYBA 2IS7A 1GKRA 3DESA 3BW4A 3EX3A 1TTQA 2ISVA 1THFD 3AHVA 2GLKA 3EOOA 1XIIA 3UG3A 5BXRA 3QV8A 1EF3A 3QPYA 4JYEA 3FY1A 4Q4MA 4W86A 5A2AA 3M0YA 1R3QA 4Q7BA 4Q8UA 2YDSA 2QMKA 2DZBA 3BARA 1KC7A 4YHEA 4JFTA 3H21A 2D3NA 1VCGA 1XLJA 4ZQRA 4HNNA 4MG4A 3PAOA 1M03A 1J2WA 4Q7IA 2ZRYA 4GG9A 3DI0A 5GVJA 3L0GA 2XN0A 2PDBA 2FHBA 4ERIA 5CBIA 1LZOA 2PU0A 3QBUA 4H2HA 3P14A 3L4WA 1BEUA 1BF6A 1GYNA 1XD1A 4XTDA 3STGA 2PWHA 2Q71A 1TKKA 5FF7A 2IQTA 3GW3A 4IH3A 4X2PA 4CD7A 2I5GA 3GC5A 5HUOA 3L4TA 2PWEA 3ES8A 4JTGA 2C3ZA 3A22A 1Q2SA 4Q8OA 1ZJAA 4Q4RA 1JQXA 3PPGA 3A9BA 4MIMA 4I9JA 3BZJA 4BWLA 1U30A 3O2LA 2NXIA 4NAFA 5HJXA 2PGRA 1MW3A 2ZUNA 3FW6A 2EXOA 3BE7A 1MO0A 3GG8A 4AZIA 4C90A 2QVHA 3AAMA 4XBSA 5D30A 4DBEA 3EDDA 5FEZA 2E25A 4D8ZA 4U28A 2VUNA 4HT3A 1A5NC 1BFNA 5C9ZA 3S42A 1UG6A 1NM9A 1GYLA 2GWNA 2IKGA 2QJMA 3L67A 4LRTA 4JTEA 4Y9OA 1EDQA 3CM4A 3W1QA 4B9ZA 4IIFA 3GDKA 3CYVA 2DT2A 4UQBA 5BMWA 5MKGB 2OSXA 4I9MA 3MJYA 2ZX5A 1YADA 3N18A 4HSHA 1UHVA 4HIBA 1UCWA 2PGFA 1GQIA 1HKMA 1KM5A 3C2OA 1EBGA 8A3HA 5G1MA 4RNFA 4PMOA 1IT8A 1IV8A 1CGVA 3EB4A 4O1DA 2ZRWA 4GQ0A 4LCRA 2WZHA 1Z44A 3VIGA 3SCNA 1S38A 1W0MA 1ZSXA 2BFGA 1Q4NX 3NOEA 1TV4A 1EO7A 1PYFA 4JN8A 2R14A 1QK2A 1M7XA 3ZFHA 4ZO9A 2CBVA 2WKLA 2YL5A 3ZSSA 4LAUA 4HB7A 2VWTA 2VYOA 2ZRVA 3PB0A 2QPUA 1TJ1A 4PUDA 1FWAC 3NQEA 4XZMX 4EWND 2QDEA 3LRLA 3PZUA 4JZ5A 4YTRA 3M16A 1Z69A 1JZ8A 3PF3A 4FLQA 3VIPA 3ARRA 5EA9A 1A53A 3BLFA 3F4VA 5CGQA 3UU0A 4OECA 3ONCA 4L4OA 3BJSA 3KOZA 2J13A 4HA0A 1V0MA 4FNUA 2J66A 4Y2WA 3NPVA 2CLKA 2OODA 1XKYA 4NHVA 1BSLA 2WM1A 3GXTA 4BS0A 3WF1A 1FTXA 5HQMA 3LM7A 1DHPA 2WVUA 1TJRA 1PL9A 4ZA0A 2E1DA 5KSWA 4XKYA 2YL9A 3VGBA 2JALA 3AWNA 3UCDA 4TV5A 1NOUA 3WZ0E 2CZEA 3DHPA 4JHOA 1RR2A 1XYFA 3BCJA 2ZDRA 2VRQA 2VX5A 3WDIA 1XBXA 1EQCA 1GG1A 3N2MA 1NU5A 1DE5A 1NFGA 3ABRA 2PDXA 1HTIA 3WMLA 5KETA 3CUJA 1BLIA 1CYGA 4HK7A 1LF1A 3DEQA 5E70A 3U5YA 4IPIA 4PMJA 1JRCA 3LNPA 2PWUA 3KS6A 7ODCA 1UWUA 1IEXA 4V33A 2GUYA 2VD8A 1AJZA 1GK8A 3ABXA 4X22A 1KM1A 2FPTA 4FS9A 5HJYA 3HMJG 1IQ8A 1SMAA 4DNHA 1KNWA 1QK0A 1OFOA 4O1BA 1XIHA 3TWAA 3NQMA 3NQBA 3K8MA 2MNRA 2RH9A 3S2JA 3IWPA 4Z0JA 2ZZ2A 4JY8A 1QI4A 3GU1A 2BWGA 1KM2A 1G4PA 3IANA 1OCBA 2PC4A 4S23A 2BVTA 1LWHA 3LMZA 2DZXA 3LHZA 4R7OA 2I56A 5D9PA 4R33A 3TYUA 5AY7A 1E1EA 5F2IA 1U5HA 3A3WA 4LYPA 4L9ZA 4RLIA 3FJNA 3RR1A 1X1OA 3QR0A 1QFEA 3R79A 2NW0A 4Z1AA 2H8ZA 1PEZA 3I65A 2OLAA 4JTSA 3QW3A 1ISYA 1NDWA 3FYOA 4ZOEA 5KMYA 3SJNA 3F4NA 1YTEA 4ZEPA 3A4JA 3KWXA 3F03K 3MWAA 4JFSA 3ME3A 4NX0A 2I16A 5E93A 2HBVA 3QYSA 2Y70A 3AUJA 2HROA 2HMCA 4S38A 3FCPA 4KMQA 5FEWA 2D3LA 3JRKA 1MW2A 2VP8A 2CXGA 5B80A 3N14A 2VELA 2GGHA 2V2DA 3VDAA 3EDKA 4AH7A 5D2VA 4QTGA 3SI9A 4TR9A 4EPEC 3S46A 2FZBA 5KZ6A 4V2XA 2F8QA 1OK4A 4HPGA 2EBNA 3EWBX 3TTYA 3HU7A 1QPOA 4NAEA 1LRTA 1Z48A 3QHNA 1FXPA 2B7PA 2R1NA 4MWAD 3FXYA 1LG1A 1R5YA 2AQWA 2CXEA 4EANA 3U48A 4TU1A 4D6HA 3M5XA 3H8AA 4WEVX 3O15A 4CD4A 2BY3A 1KTNA 2V5CA 1FP8A 3GNPA 1UZ1A 3ZWTA 2C16A 4S39A 3CUIA 4LANA 2JIEA 5TF0A 3SY5A 4I5RA 4E5TA 2C7FA 4XQ6A 2CZVA 5ENLA 3SBFA 1QR7A 4HYRA 3CV7A 3ENLA 1WXZA 3IJIA 3NVTA 3OIHA 5A94A 1I6NA 2WV8A 4JCMA 3R94A 4M0XA 1EGMA 2ZZ3A 1EX5A 1RY0A 3GVVA 2FGBA 2O9TA 2WCAA 5LNRA 2VDHA 3MI3A 1OZMA 4FXFA 3AO0A 1R0MA 1XDLA 2IMRA 4PB4A 3UXIA 4KQNA 3BV7A 3AS3A 3SY8A 1EPXA 4CQDA 1H49A 3CHEA 2P88A 3NSMA 1FWFC 1P6WA 3VD9A 1JGIA 2CU0A 3K1GA 3M0MA 3CZJA 4NZFA 3CMJA 1JUEA 1A49A 5BXPA 3W1MA 3UF9A 1SQ7A 1HQTA 3R58A 1DQUA 3BANA 2VVSA 3MANA 4JTKA 1EX1A 2YZ5A 2GQ3A 3II1A 1V0KA 2VEKA 3PJTA 4ZO7A 1JDAA 1K8CA 1RHCA 3D47A 1K9TA 4ICNA 1VYRA 5E5CA 2R94A 5LHEA 3VNJA 3LQGA 4JX6A 1TFVA 1CT5A 4L4LA 4LV9A 2R91A 1GNXA 3S4TA 2WM0A 1LDCA 3KBVA 2D2JA 1SJDA 3UWEA 4HZMA 2AOSA 4LSBA 3F4DA 2F61A 2W4XA 3VGDA 1LQ0A 3M0VA 1BWKA 3DENA 3WUEA 5I00A 3LPFA 4J3SA 1MUCA 2ZX8A 3DI1A 1WZAA 2FZDA 4LS1A 1G4SA 3MI2A 3I3EA 1DORA 3CNYA 1DV7A 3F2BA 4H8UA 4A21A 4A22A 1MNZA 1D7FA 4HMNA 2J7HA 2A3BA 4AHOA 4C5ZA 3EB2A 1DOSA 4KERA 3WQEA 4AZCB 3GC2A 1K77A 4LB4A 5DANA 3P7YA 3W26A 4DBSA 3VDHA 4KFOA 3UNTA 2UV8G 4PTMA 4S3JA 2YL8A 5M03A 3E2VA 1GTEA 1B3VA 3G2GA 1J6OA 3W2KA 1ZJBA 3K13A 2Z24A 2HDJA 4L6DA 3WDQA 2PLJA 3G3DA 4IMCA 2YBVA 3C2FA 3VCCA 1V03A 1WV2A 4CNUA 1Y5VA 1OWQA 5GNZA 3WLLA 5DY3A 1QHPA 1V6TA 3IGSA 3DUGA 3NZPA 5F4SA 2ZICA 4PCPA 1Z8AA 1A5SA 4J9JA 2D2HA 2WJFA 4JTQA 4H1ZA 4W85A 5C8BB 2H3DA 4AMCA 4K1WA 2QHAA 5E6YA 2R1MA 1F7BA 2CWNA 1RV8A 2BY0A 1DP0A 4LUIA 4JIRA 2V2HA 4DXKA 4MB1A 1B3ZA 2IPGA 3UYIA 1P0NA 1G01A 2CLIA 4DXXA 4LFYA 3RHGA 5BXSA 1LLZA 1XIBA 4JNYA 4WKAA 2YSWA 1YBQB 4BY3A 4K37A 1AW1A 3QKZA 4JX4A 1D3CA 1K6WA 2AMXA 1R85A 1TIWA 2C19A 2J75A 2PFHA 2ABBA 1R3YA 3IJ7A 4QLKA 3DBNA 1NJJA 4RNIA 3T9PA 2QT3A 2X7WA 2ZUUA 1W5QA 3W87A 4PUNA 4DY1A 6XIAA 1Q8AA 4RZ6A 2ZOXA 1WKYA 4ZFMA 1H41A 4E4UA 4PE8A 2Y63A 3CTTA 3R12A 2J62A 2VTFA 1VYPX 3A5FA 2YYTA 3AS1A 1Y65A 2QGHA 1SPQA 3PB2A 1IZKA 4IPPA 2QVNA 1XG4A 1FWRA 4M6VA 4NJIA 1N8WA 2VM8A 3MDUA 3SR7A 4KH2A 5F4XA 5I6SA 1IHIA 1XBZA 5RUBA 2X2GA 3PN8A 3ERPA 3B0XA 2WCSA 4UTKA 2ZRXA 4XVDA 2I57A 2ZWZA 2XVGA 3N04A 4US5D 3FA5A 4MFDA 4W8LA 4D6GA 1YTKA 4YWSA 1M68A 2NX1A 2WMFA 4FOUA 3LN3A 4MB3A 4LCQA 4QM1A 2PI6A 4NNBA 4KT2A 5MHBA 4YTSA 5F7UA 3BLEA 3TA9A 2VMFA 4S3DA 3WFAA 4IP4A 2Z2AA 3GFXA 4HA1A 4DYKA 2XN2A 1U1JA 3CYJA 2DZWA 3NTYA 2OOGA 1P6BA 3VZXA 3TC7A 1TIMA 5CSRA 2I9UA 3ZVIA 4D6CA 2WJEA 3M6YA 3CMGA 3L9CA 2WJZA 5DEZA 2J9ZA 3FX4A 5AYIA 3IGUA 1GJWA 3VD4A 5HULA 5BOEA 4MAVA 1LORA 4M80A 3FNDA 5AC6A 2P3ZA 5C9WA 3W2JA 4ZB5A 3C56A 2Q3RA 4O11A 3WO8A 3WD1A 5EL1A 1R2RA 4J2PA 4F3HA 3CEUA 4GIYA 4DWSB 2XIQA 4LYKA 3P8IA 3E12A 1UA7A 4TQTA 3EEZA 2X1UA 1GQLA 3EWZA 1DBTA 5EYWA 2PU1A 3IJDA 3N2OA 3OQEA 3QLDA 2C1HA 2DZVA 5EB8A 3WL0A 3G1FA 5F4WA 2HK0A 3DYMA 1CWYA 2Q01A 3TH6A 1EJTC 3M7SA 2D73A 1X1NA 4AWUA 1Z9AA 2ATSA 3S9IA 1KBJA 3QOMA 1ISWA 4Y9NA 2IQDA 4BFAA 5BOFA 4JQ2A 4JTTA 5JUVA 5LZLA 2C1GA 1R9XA 5FJJA 1JCJA 3MSGA 4L5ZA 1M5WA 3LYEA 3HQ1A 3GFZA 3P60A 1EIXA 4IQLA 4C7DA 3N6QA 3AROA 3OVGA 3B9OA 3VCNA 2GUBA 2ZTJA 1H09A 1IIHA 3UZWA 1K1DA 3BAWA 2E67A 3H54A 1XFCA 3W22A 2JK2A 1JNEA 1M41A 4TIMA 4O1FA 3FDGA 3HIJA 1GTHA 3CL8A 3RU6A 4D8LA 1RQHA 4K3ZA 1X6LA 1W3HA 2VC9A 3ZOAA 1SJBA 1TSIA 2DPEA 2H6RA 4ROQA 3SAZA 3HB9A 3S5OA 4BJHA 4HA3A 3UJSA 2WC7A 4P7RA 1WZMA 3E3HA 4Z1DA 2XIJA 4ERAA 1X97A 1I2NA 4XUYA 4XV0A 2MUCA 4RPQA 4ADSA 3GZAA 5LIXX 1E40A 3GDBA 3S5YA 4A35A 1ZGDA 3B8IA 3VNLA 1MUMA 4DRSA 5I3FA 1KXQA 4BK9A 3EMQA 4H41A 3W7CA 5HMDA 1HZYA 4RUBA 2F84A 3BLDA 3M5ZA 3MT1A 2JKPA 3VC6A 4PL2A 2DIKA 2PRHA 1PYMA 4KFPA 3W84A 3BVJA 4GIRA 1A5KC 3EX6A 4RCXA 1JCXA 4GD0A 3H23A 3N11A 3SO7A 3T0CA 1AH0A 1G6CA 5F2LA 3W2LA 5AYXA 1GG0A 2WC3A 3PK7A 3D3FA 4DIAA 4PEKA 1J12A 4KEVA 2RDUA 1J0YA 3NZQA 3VOHA 1RALA 1V3IA 3W1LA 1CXFA 3S2MA 2HSAA 1HJWA 1RBLA 5T26A 2BVDA 3QN3A 3RJYA 5EBAA 3BL3A 3GYCA 3SB0A 3NA8A 1IYXA 4F2UA 3LBMA 2PDHA 3OLIA 2YA1A 2WMKA 1E72M 3NYZA 1OC5A 3WK3A 2A1YA 4PTXA 1JI2A 2HVOA 4MF4A 3MKCA 4MLJA 1JYVA 1FDYA 1A4MA 3DHUA 1S5WA 3G1XA 3MB9A 1IZCA 3AYVA 4IFOA 4BWLC 5A8QA 3HV9A 4UFHA 1BXBA 3HG3A 3Q2DA 1UH4A 1N55A 5JBDA 4IGHA 1HP4A 3ITGA 4ILSA 4AAJA 4KWVA 4HBKA 6TIMA 5I2UA 3MI6A 2J6XA 2CNCA 2VGGA 1YNQA 3O6AA 2XTKA 2YCIX 4CNSA 1XSJA 4UMBA 5C6MA 4AWTA 1U1HA 2AL2A 1TA3B 1JZ6A 2HXUA 3FAWA 3MA8A 4IIGA 1CDGA 4AMAA 4DAIA 4N42A 4FOKA 4CQ9A 4WOZA 1KRBC 4H00A 3W7LA 4EP8C 2IW0A 1UR2A 2WWDA 5I3KA 3KRZA 3Q94A 1JIBA 1KBIA 2D69A 3DXIA 3FN9A 3BOLA 1VEOA 3IARA 4A3RA 1A5OC 3A6OA 1V6VA 2Y8KA 3M6DA 1B54A 1RXOB 1U1UA 3E49A 1EFZA 4BA0A 1L9WA 3MJMA 4MZYA 3ARWA 3RK8A 4HU4A 4JTLA 2CBIA 1U5JA 1C8XA 1RPXA 3EWUA 3UR7A 4CNPA 3APTA 3M0LA 4ATDA 2VI0A 4ORMA 3I6EA 3TQ0A 1KM0A 4KESA 1UC4A 2SFPA 1PIFA 1K8XA 3GXMA 2YA0A 3WJSA 2NX9A 3L2MA 2V82A 2DVXA 2ZCGA 4XAFA 3SCUA 3FGCB 3N9KA 4L9YA 4A2RA 1HGYA 3SRKA 3GKFA 4YL2A 2AQVA 1PZ0A 3H4WA 3LV5A 4WOQA 1ZJIA 3B0PA 4IXXA 3C52A 4LW7A 1VBUA 4DPQA 1QUMA 3UNDA 3EA2A 3SQSA 3N2BA 3S5ZA 4JL2A 4XD4A 4AD4A 1T5AA 1NTHA 1IT0A 4DEFA 5CJ5A 2NUXA 2XSXA 2VL4A 3W1TA 4RNJA 3M0KA 1RLCL 2XVKA 3K4WA 2OJPA 2WPGA 1WDQA 4Z17A 1S3HA 3TSDA 1JF5A 5CEWA 1BXNA 3GIPA 5JH2A 4Z42C 5G4WA 4H8HA 1M3UA 3WK1A 1DTNA 4L9XA 3B9NA 1H5YA 1OX4B 3E96A 1HL2A 1SZNA 2I9EA 3CWNA 3ZR5A 5T9CE 1XIJA 1UWRA 2J24A 4LBUA 2V63A 4J2MA 2R8WA 3HPFA 4AYGA 4DNMA 2QCGA 3E0VA 3GQYA 4JQ4A 2FFCA 5CZJA 5HAOA 2BTMA 2C13A 3VKAA 1QI0A 9RUBA 1QPRA 1DIKA 3BGJA 3NZRA 4XAGA 2CHNA 4JNZA 2YBTA 1BG9A 3TEVA 4XZWA 3BPWA 4K36A 3W02A 1F3XA 2VDIA 4IHCA 2EKCA 3G6MA 4RX0A 4UCFA 4E38A 1KFKA 2PDJA 1HF6A 1W1IE 2OWXA 3GU9A 2RGMA 3TIMA 1HKJA 2NSOA 5M3WA 1E15A 2E5CA 4LS2A 4B91A 1RH9A 3DG7A 4LC8A 5G2HA 5K7JA 1CX9A 2A3EA 4QLJA 4NSBA 4H04A 2O7QA 1R47A 2OX4A 4UR7A 2AGTA 1ME8A 4W4QA 2QR6A 1FCVA 4FZIA 4O19A 1CLKA 3W1AA 1XL9A 1DWFM 1KD0A 1ADDA 2PTYA 5IRPA 3WEZA 4NRRA 2FHFA 4ZE4A 3MCMA 1LQ2A 5ABFA 3GHRA 1VFTA 5EKYA 3I10A 4NZ1A 3T4CA 3U3HA 3KWSA 4W93A 1PX4A 3PJWA 4GUIA 2QUTA 1ZHAA 3R6IA 2IPJA 4GVGA 3SN0A 2FJKA 5I7GA 2NQ9A 5T8GA 1VJIA 3ZLGA 4L7ZA 4Y96A 2B4GA 2RAGA 4A6GA 5GQBA 1W91A 3WQ4A 2VT0A 4TV6A 1V77A 1X6NA 4MYXA 4YYFA 5BXTA 1KTBA 9CGTA 4ALDA 3CL6A 2V5BA 4J3UA 2FTPA 2PRMA 3TJIA 1VP5A 3T2OA 3UPBA 5M17A 1G69A 3FDKA 5TIMA 2FH8A 2HXTA 3OIXA 3DH7A 3FV9A 1UP2A 2ZTKA 2W63A 1XPGA 3TTSA 3WLTA 5JQ9A 1O5XA 4KPLA 3LZ3A 2GDQA 1V3HA 3FIGA 2V3DA 4WVXA 3AIUA 5AHMA 1N8IA 1FY6A 2VZVA 4B92A 4XZBA 3M43A 2WMGA 1FWHC 2WJDA 2ODOA 2PA6A 3VA8A 1TELA 1KW1A 3L65A 4K68A 2DT3A 1UR1A 4M19A 4KGLA 2OEMA 3MY9A 1C8VA 1FH9A 3CHVA 2QAPA 4FOJA 4HYVA 3W27A 1TMQA 4Z2KA 1UD5A 4RPPA 4B3KA 3W37A 5TNVA 3UYCA 4HTBA 3WJWA 5A8PA 2Y5JA 3SCOA 3QGKC 2EGZA 4ZZ9A 3MO7A 4TVCA 5C5YA 1E3XA 1ZU8A 4KGJA 2Z2BA 4XB3A 3TC3A 4Q4PA 1H1ZA 2X2YA 4B2DA 3GXFA 3E0IA 4WDUA 4S3CA 1US3A 1XPYA 2BDQA 4DM2A 1TPFA 3JR2A 2OFJA 1FCUA 4DELA 2V3FA 3VOGA 1PHQA 4C65A 1OG6A 3UJRA 3W7JA 4EF9A 1HW6A 3KVMA 3CPUA 3TFXA 3LPGA 4IF2A 1C29A 3QQWA 1ONEA 5DMNA 2YLAA 3MKVA 3U8GA 4RE2A 1JDFA 3SUSA 2WMJA 4GFSA 3VM7A 2IKHA 4FEZA 3UWWA 3EEGA 5FF0A 1F4AA 4NG3A 4JBRA 4PSRA 3M0XA 4IPNB 4IPLA 1LUCB 1MW0A 3CH9A 3VZZA 4JTRA 4PRTA 4GUJA 1JPDX 1R2SA 4NY2A 4YVXA 3W7QA 4PFHA 3ICJA 4X9YA 4WIWA 1AJ0A 3R5EA 5G1YA 1E5JA 4PBFA 3DFSA 1O4UA 3B97A 1POKA 3H2OA 4N4QA 2XWDA 3U4FA 3A23A 3W1PA 3WQDA 3UESA 4OUEA 2G4JA 5L9FA 4XSMA 3LTPA 3OJGA 3W81A 3BAJA 2Z26A 3F5KA 3IEBA 2QIWA 1T41A 4K39A 1UR4A 3VNMA 2WZIA 4HP5A 4HU8A 3AQUA 4NIRA 3WQFA 4GO9A 1HJVA 1UH2A 4OFCA 4NZCA 2YCJA 5C7VA 4NXSA 2OEKA 4QCFA 2WK2A 4JQ1A 4R88A 5LIWX 3ES7A 3VMOA 3VE9A 1EJWC 3SQLA 5XINA 1W9UA 3BQ5A 2YFOA 3NFUA 3GHSA 4J27A 2F6KA 2P0OA 1MDRA 1PWMA 1PUDA 1LLOA 3LLDA 4CVUA 3PBUA 3BG5A 1YNYA 3QZ6A 1ME9A 4OZOA 3L23A 2HQAA 1AL8A 1N8FA 1SVDA 1LT8A 2NLIA 2YX0A 1RAKA 2RJHA 3DC8A 1UWAA 1BRLA 2FYMA 4G9PA 4GUGA 1UD4A 1UQYA 4KEMA 4HPNA 1JCNA 4UTIA 4DO5A 5D2TA 4HCLA 4AEOA 2ASHA 4MGGA 1XINA 4C6MA 4CVWA 5L6UA 4XD5A 3RLVA 4CEUC 1AA1B 4DI8A 2DT1A 2OWCA 3O1NA 4UOQA 2GQ9A 1EJXC 4HSOA 4MM1A 2C71A 2J8GA 1F8IA 5FACA 1JD9A 5EFFA 3FLUA 1WBJA 2FPVA 3N15A 3KP1A 1AQHA 1OCQA 2YCLB 3H2AA 3K4AA 4A2SA 4TTGA 4KCUA 3KXQA 4TOQA 3THDA 4P8UA 1AD1A 1ISZA 1UD2A 3MQTA 3N9RA 4P8XA 1U2YA 4CLMA 3VDBA 4HZ6A 2PDUA 3KOYA 4HHMA 5AC7A 4DF2A 4O1CA 4C6PA 1ZBKA 4LRSA 2NQ5A 3OB8A 1W9DM 4R7JA 3W6LA 3C2RA 1L2UA 2PD5A 1MUWA 2OU4A 1H3GA 1VLWA 4LQ1A 3GH4A 3WEOA 4WX2A 5KEZA 5F1UA 1V93A 4YHGA 2PB1A 3ZR6A 4O13A 1AD4A 1ZS2A 1G67A 2J7DA 3V18A 1TX0A 3BSGA 1SSDA 1VFFA 5FKYA 3W38A 3NURA 1TR1A 3VGFA 2V69A 1KQZA 4N4PA 4IJBA 4FIQA 1BYAA 4CGTA 5D33A 3ARZA 4YYCA 3W1RA 2B7OA 1OINA 3IGXA 2PC8A 4BR1A 4S3KA 4OV4A 3NZ1A 3QQ0A 5DMMA 2WAGA 1KLYA 4DBDA 2EAWA 4FAMA 3VNIA 4AZCA 1X96A 4FNRA 2E8YA 1KBLA 4QISA 3RPDA 4F9DA 1L6WA 1UD6A 3W29A 2GJNA 4ZSUA 5A6MA 2FHCA 5DY2A 2VX4A 4JNMA 1CPUA 2CLEA 2CLPA 2G0WA 5CAKA 2POZA 4LBRA 1HJSA 2E28A 3LV6A 4NNCA 1XYZA 3M0JA 4L4MA 3MCNA 4QCEA 5FF4A 4TX9A 1VHNA 5E0KA 4JEQA 1JDEA 3VKKA 1PKLA 5A6AA 2WCGA 1UA3A 1I2PA 1RJRA 1L6SA 4NYYA 2VFGA 5KTLA 3TYBA 4GE8A 3NOYA 3BW3A 2OYMA 4UTTA 4ENLA 4DJEA 1GVOA 2P53A 1QAPA 3WBWA 3CAKA 4RE0A 2Y7DA 1P0KA 4NJHA 5H6HA 3BO9A 3MZ2A 4H6RA 4YCPA 3MYOA 4A3YA 4QX4A 1QNSA 3PANA 1YXYA 3NQDA 2DUZA 1OIMA 5HMFA 4QSHA 3M64A 1TV2A 2QPSA 3R8HA 1YBQA 2WNNA 5AYYA 4CU7A 3G0XA 1BPLB 2OVLA 1ALDA 2YDAA 2CHRA 1FWTA 2Q8ZA 1S39A 1PO9A 2VKZG 4GIAA 2REQB 4V28A 1K9FA 1SZEA 4BI5A 1OX5A 1TZ7A 2EPMX 3WLHA 4JIPA 3DERA 3AIWA 3REQB 2BGSA 3TU9A 1DWHM 2ZQ0A 4C6IA 3LRMA 3THAA 1EP2A 1B4KA 4GZJA 4IWWA 1C8QA 3B0YA 2QUMA 3VYLA 1RP9A 1LLWA 4UUIA 3F2DA 1VH7A 1R3TA 1ICPA 5D03A 2AL1A 1NF0A 4DJFA 1WAWA 4LBSA 2BNJA 1HJUA 3GNNA 2FB2A 1VPXA 1VAHA 3HGOA 3P74A 4I7UA 1B90A 1GVQA 4B5XA 3QLLA 4GQQA 2HJPA 4YLWA 1FWNA 3B9DA 3KE0A 2C0HA 1GOIA 2C91A 5DRCA 1GKQA 2BOGX 4P61A 3GFYA 2G41A 3VOIA 4JKKA 3QMRA 3N3TA 1F6YA 1B5TA 3PP7A 5A8GA 2QJHA 5CSSA 3XISA 4PB3A 3ANUA 4K7YA 2HPIA 5AKQA 1Z89A 4D6FA 2TAAA 3RO8A 5C9UA 3FJLA 3W1NA 4KCTA 4MMWA 2NZLA 2CW6A 3W83A 1AUSL 3SDOA 3P0WA 3MBFA 2C15A 4JTIA 4AF0B 3VD5A 4CCCA 3TN6A 3VAVA 2PTXA 4HK6A 4H9TA 2PDPA 4O0ZA 5CJMA 1G5AA 4Q4QA 3CPGA 2YXXA 3W7IA 2Z0IA 3GIYA 5FF3A 5CZKA 1P7TB 3P67A 5CLWA 5U4NA 3S47A 1WX0A 1QHZA 1S3TC 1TRDA 4FMVA 4P2VA 3TJ4A 3R25A 4O1EA 4IMFA 2HE8A 3A12A 2WNQA 5CPSA 4XWUA 2KZHA 3VIOA 4O15A 2OQLA 1B2YA 1O68A 4O16A 4Q8VA 1DWAM 4ZCWA 4DWSA 3KBWA 1R87A 4AY7A 4NNAA 3BXWA 1X38A 1V7YA 2VCCA 2D0HA 3HPSA 2F6XA 2UY2A 1Q2RA 3UJFA 1O1ZA 3U0HA 2WVVB 1K4HA 4PMUA 1D9EA 1A0EA 1GONA 3AXKA 3B8WA 3C5QA 4MB4A 3RX3A 1EHNA 3VIMA 4UXDA 2VZSA 2XM1A 1VR6A 2JFEX 2CETA 2BSLA 3F7JA 3IUDA 3AALA 3T40A 1XLHA 2WKJA 4PEEA 1OFQA 2W3ZA 1UBSA 5A5WA 2IKJA 3FXGA 5AZ1A 2PDLA 5HNUA 3THQA 5FJIA 4WY0F 7XIMA 3VMNA 4LYQA 1GOQA 4XO7A 2OGYA 2Q3OA 1GORA 4IFKA 4F0HA 3S2CA 1DXFA 1UMLA 5TD4A 1NWRA 3SCWA 4CKQA 3WLNA 1GT8A 1OFRA 3ARSA 3USBA 1D7KA 2NQJA 3LI0A 2YKKA 5IDZA 1VYSX 3LBCA 4KEZA 1ISXA 2EHHA 4LB3A 2G3MA 1HVXA 1PS9A 1OFPA 1TV5A 2V3EA 2WZTA 3WY1A 1ZTVA 3AZTA 6A3HA 2A3CA 1SYTA 3WLKX 1E3ZA