4GV6A

Structures of lassa and tacaribe viral nucleoproteins with or without 5 triphosphate dsrna substrate reveal a unique 3 -5 exoribonuclease mechanism to suppress type i interferon production
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
214
structure length
207
Chain Sequence
GAMDHVEFGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRTSPRVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA (5'-R(*(GTP)P*GP*GP*C)-3')
publication title Structures of Arenaviral Nucleoproteins with Triphosphate dsRNA Reveal a Unique Mechanism of Immune Suppression.
pubmed doi rcsb
source organism Lassa virus
molecule tags Rna binding protein/rna
total genus 58
structure length 207
sequence length 214
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.410 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4gv6A01
3MX2A 4GV3A 4GV6A 3Q7CA 3MX5A 4FVUA 4GVEA 3Q7BA 4G9ZA 3MWTA 4GV9A 3MWPA 3R3LA
chains in the Genus database with same CATH superfamily
1IG8A 4M3XA 2P9KA 2NZTA 3NGIA 1RT3A 4BGAA 4FWRA 2VQFK 3QEWA 1Q9YA 2V7ZA 3SAFA 1VSEA 3D2FA 4PWDA 4JD2B 1ZBIA 1XHZA 4BROA 5DMRA 3O08A 4FOEA 4LFBK 1U04A 1OVYA 3HVRA 3CPEA 3QNNA 5FPEA 2OTLN 1S3XA 1BGXT 4FZZA 4O0IA 3R8EA 1RT5A 3A8YA 3TANA 4FZXC 1Q8IA 1KC8O 1VSHA 1IBKK 2V51B 3EZ5A 2BH1A 5I9EB 5AFUH 3L2UA 3MCPA 2YCHA 1G15A 1NU0A 3L2QA 3AO5A 1JLCA 3MN9A 3MWTA 1YVUA 4CVNE 1WUAA 1J53A 3MCAB 1NK8A 1N32K 2GEMA 3KK3A 3B6OA 4ID5A 1RDWX 1NK5A 3SPYA 1NJXA 1ZC6A 1SZ2A 3PX6A 1C1AA 3SAHA 3OTOK 2ATQA 4BRMA 3U4LA 1RBTA 3R3LA 4JKGA 3K0SA 1RTIA 5AQKA 3V1RA 4FLVA 2Q31A 3IDHA 2J4RA 1RDBA 5KQDA 5FLXO 1QTMA 1MDUB 3CJBA 3F5TA 4X64K 1IV0A 3KLHA 4W5OA 3DLGA 2ZM6K 1QQOA 3LP3A 1KTQA 2O8FB 4IWVA 4CK3A 3C6AA 3KK2A 4QAGA 1XMOK 1GLBG 4O55A 5J2MA 4DV5K 4Y0WA 3SBGA 4GMJB 5EOYA 4CJ5A 3L4QA 4JKHA 4XH1A 1HNXK 4DQSA 3CETA 3AVBA 3DXKA 4ISFA 5AQLA 3QDKA 3DOLA 1Y64A 2HNYA 1I3AA 1RCHA 4LH4A 3BP8A 3DLEA 1XHXA 5HOOA 3IAYA 4L3QA 3VQAA 3HOSA 2OZSA 3OBWA 4CD1A 4JI2K 1KXPA 1J54A 3O1WA 3SJHA 3V9WA 2HSTA 4LF7K 5KRTA 2WFBA 5C42A 4CK2A 1REVA 4EP5A 3G6EN 4JI6K 3OJUA 3RSEA 4CF2A 3CF5L 4DF4A 3D2EB 2NLXA 1Y97A 4DS5A 4CIGA 1ZBLA 1G99A 4DV2K 1QS4A 5ADXA 4C23A 4DLGA 4CZMA 2RHKA 4I6MA 5GAHP 1TUYA 4A2BA 5KPZA 3DLHA 4FWPA 3OYFA 2NRRA 5BPMA 3R6MA 1Q18A 2B5JA 1U6ZA 3DXMB 3UKRA 3KLFA 5HRRA 1DTTA 4NYFA 4KV8A 1T8EA 1C0GA 4LH5A 3ZSVA 4FJHA 1VSDA 4NCBA 3RTVA 4DQIA 4B1ZA 3WEEB 1LAVA 2RN2A 1HNZK 2YHBA 1WSJA 4MDBA 2RF2A 4G1QA 4BACA 3HYFA 4DTSA 3LPTA 3AO4A 3C7NB 3K5OA 2IVOA 3L2WA 1IH7A 3FZLA 1DEJA 5AQTA 3LP1A 4FLUA 4CGGA 4NCGA 3ULEB 3VGMA 4FWOA 3VENA 3THXA 3FR0A 5EXWA 3PY8A 3QICA 4DS4A 2EWSA 2KZMA 1HKGA 1U48A 4IJNA 1Z25A 3MDQA 5F1XA 4BDZA 1KFSA 5HP1A 4BRIA 3TSQA 4OGCA 3RVCA 3HP9A 4F2SA 4C1NI 4DKWA 1NJWA 3SLCA 1ILYA 3LM2A 4BC3A 3PX4A 4CCHA 5CR4A 2JLEA 2CH6A 4OPAA 3V4IA 4E0DA 5M1KA 3NF9A 3SNNA 2KFZA 3LM9A 4U67L 4DFMA 3HSTB 2FBYA 3A5LC 3V9SA 3S41A 5FPDA 5C0YA 1RT6A 3ZT0A 3ZYYX 1L5UA 1I39A 1Q9XA 2G8KA 1YITN 1RT4A 1LWEA 2HNZA 5DM7L 4M63C 4M45A 2OCEA 3O4QA 4CEZA 4OPKA 1RTDA 1JCGA 2JWLA 1SL2A 3MXJA 1X3NA 1T7PA 4B9SA 1MWKA 4DTXA 3TAMA 2DY4A 4JHDB 4M3RA 3OYKA 2W41A 5C2FA 3VQEA 1VQNN 4KBOA 1U2VB 2LSNA 3E9OA 1DGKN 5H1SQ 1HPMA 2E1ZA 1N36K 2P9PA 3WQUA 5CZ2A 4J2AA 2IGIA 2O8CB 2O8BB 1B9DA 4FPBA 2VQEK 3CYMA 2I5JA 2UYTA 5EU7A 1S5JA 3CD6N 4JKAA 5E26A 1JLGA 1EQYA 3C0BA 4HUEA 1Q82O 1NLVA 4IEEA 5I3UA 1K8KA 2UUCK 3ZCMA 1Z26A 1TAUA 3FE1A 4KO0A 4OX9K 3U6FA 4CERA 3NH0A 1QZ6A 5AZIA 4M3TA 2FBVA 2QTDA 3KLEA 4C1NK 5AQIA 2OPRA 4BY9C 1NGJA 4RW4A 1LOTB 4CBWA 3VF2A 4DMNA 1LV5A 2G8VA 4Z4GA 2E2QA 4BR0A 3AO3A 4F9OA 3KTQA 3AA4A 3GBTA 4CHZA 2E6MA 3Q7BA 2O8EB 2X6NA 3OY9A 3QEPA 2HB5A 3GDQA 3VEXA 3O3GA 3CJCA 1L3VA 2HVIA 4DTMA 3CJAA 2P1JA 3UKUA 4BRHA 3ZSWA 2P9IB 3QLHA 4X62K 4W5RA 2OTJN 4F4KA 4CJ3A 1WN7A 4M41A 3NDKA 4YDUC 3KZBA 1S1TA 1IBMK 3LAMA 1BI4B 3VQPA 1RBRA 2QWOA 3AA2A 3J7ZO 4Z4CA 3VGLA 3DM2A 3QBWA 5SWMA 4KREA 1LAWA 1WNSA 1HNIA 2Q1NA 3LDSA 4KHWA 4AH9A 2E5LK 1ZBFA 4CJRA 4J8FA 3DRSA 1RDCA 5M1OA 3ZEUB 3O80A 4FW1A 4KFBA 1S6QA 3CPWM 4FJNA 4C8NA 4BWJA 4IG3A 4X66K 3O4NA 4CZJA 3CCJN 3TABA 2FBTA 2W6LA 4E3SA 4KB1A 3DJCA 2NRZA 3TTDA 5LMUK 1DKGD 3FZFA 2P9KB 3HSCA 2HHUA 2P9UA 4KHUA 2ASMA 1TAQA 1KVAA 4EZ9A 4DU4A 1SUQA 3D2FB 3L0QA 3G4SN 4DV4K 5IT9O 3VQ7A 1W7AA 2H3GX 4FLWA 4FJ8A 4I9LA 4AHSA 4B9QA 3NF8A 5KRSA 1MWMA 4HHTA 3DLRA 1TKZA 4HWIA 2IC3A 1CXUA 4IBNA 4FK4A 4V19S 5C2DA 4YOTA 4CK1A 4IDKA 3VEOA 1WSHA 4IKFA 2ZGYA 3THYA 3ITHA 1OH7A 1TVRA 2UXCK 3J7YP 3TU5A 2CH5A 3WNEA 3A0IX 1FXXA 1EX4A 2YKNA 2HW3A 5D3GA 3F9KA 3U9ZA 2ZJRL 5AQNA 2G8WA 4CF9A 4K25A 3K2PA 4DSJA 3NFAA 3VQ4A 2NRHA 1BUPA 1C6VA 3KIOA 5GINA 5CYMA 4BRFA 3PSFA 4BRKA 3TAQA 4FYDA 4F3OA 1A5WA 3ASMA 2P9SB 5KTQA 1UWBA 3T19A 1ZBUA 4JKGB 4DUYK 3ALYA 2XY8A 4Z4HA 4AHTA 2DFHA 5AQZA 4AHCA 3P38A 1BWFO 5JVGL 4DR1K 4OLAA 3C6HA 5AR0A 5JLHA 3GE1A 1O13A 4H0PA 4FLXA 3P1GA 4DCHA 4BR9A 3M3ZA 5C24A 3QEIA 2HHQA 2OPQA 4CGIA 3EY1A 2P5OA 1E3MA 2B4JA 4JV5K 1S9EA 3CCRN 5JICA 4DR6K 3VQCA 1NK4A 1YVNA 4IFEA 3CFPA 4C8LA 4ISGA 4IOAL 1S1XA 1EO1A 4E7KA 1NK7A 1ITGA 3DXKB 3CCVN 1NGCA 4CZHA 4A2AA 1IKXA 4FWLA 5KGWA 2UU9K 2XY5A 1RDUA 3M5RA 2QWMA 4E7HA 2F9TA 1BL3A 1LWCA 4E1NA 5AQMA 4NLCA 1N33K 3PO5A 1NMDA 4DV3K 5AQOA 3S3MA 2F96A 3QIOA 4OGEA 4N56A 1VK0A 1NBWA 2QWPA 3EYZA 4ISEA 3CCUN 5TKWA 2HHWA 3RSEB 2F8TA 1NGGA 1NJIO 1NKBA 3SK3A 3M8RA 2YHWA 1E4FT 5M1PA 3UIQA 4FJMA 3U3YA 3DLBA 4BR2A 3P31A 4BGBA 4KKOA 1HNWK 1W0HA 3SZ2A 4J2BA 4JI5K 2QKBA 1TL3A 2FSJA 3VN5A 3QFUA 4CJ4A 4CEBA 4YOXA 5LJVA 3I8DA 4GKKK 5J2PA 4CGHA 4GY2B 3NF6A 4I6MB 4MDAA 4O4GA 3PO4A 4FWQA 5CZ1A 3KLGA 1TUUA 3QEXA 4ELVA 2OANA 3RRGA 3UKRB 1NJZA 2B6AA 4JKFA 4QS8A 3H46O 4OPJA 2V52B 3LWLA 1KVCA 3KWGA 1WBBA 1GLAG 4CF8A 3O9SA 4IZ9A 4WFBL 4CEAA 2YKMA 4CI6A 3SV3A 4B9VA 3THWA 3VQQA 3HL8A 3TI0A 2ZE2A 5KPTA 3CMEN 3Q7CA 3QBXA 4WQ4A 4FL9A 4JRQA 1J9AA 4BC2A 3S9HA 4JK9A 2PZSA 4GVMA 3VF4A 3NH2A 2ETJA 3OYEA 5E41A 3THXB 3CERA 3HOTA 1C0MA 1S9GA 3THVA 3DLLL 2GV9A 1BQNA 5AQQA 3HPOA 3CFOA 5EX5A 1QE1A 1GLCG 4B1XB 2A1SA 3A5MC 1VSMA 1BIZA 4CHOA 4ILHA 4KTWA 4DV1K 5M1QA 4DTOA 4AM7A 4RW6A 4IXCA 1NG9A 2Z1GA 1TGOA 3J81O 4JN4A 3QB0A 1ZBSA 3NVKA 4WCEL 5BREA 3WT0A 2NRWA 2UUBK 1VQ8N 2WOMA 3TAGA 1KLMA 4C8KA 1UAXA 1YT3A 3PIPL 3HPHA 4IO9L 3KK7A 4HTLA 3VETA 1HR0K 3NCIA 4JRPA 3KWIA 3BDPA 4Q0BA 3VEZA 1FKOA 4FWSA 3QESA 5HRSA 1HQEA 3CCLN 3CC2N 4CJTA 5ADXH 2NRTA 4H5NA 3U9DA 4I2PA 3O9TA 1R59O 4A5AA 4JI8K 1GOCA 4JK7A 4AF1A 4BE0A 2AJQA 4RWTA 4LF4K 1W2BM 2EHGA 3TWHA 4QS9A 1QQMA 1UA1A 5FPMA 3S3NA 3MK6A 3ZT1A 2F4VK 3UE5A 3ZX0A 2A5XA 1XNRK 4BRDA 4M42A 4C8OA 3HP6A 2P9PB 3AO1A 4DLEA 3CC7N 3QERA 4DSEA 3OYJA 4K8XA 3C65A 3IG1A 2NRVA 2W42A 4LF9K 4CJ7A 2FSKA 3QNOA 4DB3A 1GLJO 3H1VX 4B3TK 1K8KB 2PYJA 5FDLA 4DG1A 2ZJQL 4JS4A 4FVUA 1X1PA 2EX3A 3D7EO 1QHTA 1E4GT 4E7IA 4ZTJA 1KFDA 5AZIB 4EHUA 4XEIA 1C0FA 4JKDA 3EZWA 3PSIA 3PV8A 2W6KA 1X9MA 4HUFA 1W9HA 1KAZA 4YNQA 3E9LA 4IJAA 3EO3A 3K9JA 4BRQA 4ELTA 1WAJA 2P9NA 4IG0A 2ZF5O 4CF0A 4A59A 5KI6A 4B9MA 2DPNA 4K41A 5AQXA 1HLUA 2PFUA 4KHQA 3WNFA 3OYAA 4H0OA 1B9FA 1D9DA 3L3UA 2VWBA 4JKEA 3KLIA 5FROA 3SUOA 4YY3K 3UKUB 4GW6A 1XC3A 5BPLA 1HUXA 3S3OA 3AVAA 4K42A 2FXUA 1R0AA 4EIAA 3WNGA 1LCUA 1D5AA 1BA1A 2V7YA 4MO4A 5JVHL 4WFAL 3NBPA 4DUZK 3P83D 3WXMB 4KI6A 4E1JA 2DFFA 3O8MA 4CHNA 3OYBA 1BQMA 2WUSA 3QETA 3AGRA 1YUWA 3AAPA 3C6TA 4WE1A 2E1YA 2YHAA 4OO1J 1ASUA 4CJPA 5HBMA 3BZCA 4I9QA 1EKEA 4O0JA 2D0CA 1QZ5A 3RMAA 1QHAA 4ID1A 3CCMN 1GLFO 1X3MA 3V1QA 2D0BA 4RW9A 4F3TA 5E84A 1U45A 3GL1A 1WLJA 4FWNA 4DR2K 5AQWA 2UUAK 2FBXA 4CBXA 1ATNA 3CQYA 1CXQA 4CJWA 3BF1A 1EWQA 1KAXA 1RDAA 3CFRA 1XC9A 2QWNA 4DF8A 1WSFA 2P9UB 1Q7YO 3FFIA 3J7AP 1JL1A 1GLLO 4DWIA 1Q86O 4CFAA 3MEEA 1N34K 3LP0A 5KPRA 4BG8A 1NKCA 5SZTA 3R1XA 1VRUA 4BR7A 4YOWA 2Q0UA 1KAYA 2E8AA 4LSLA 3F2KA 4FJKA 2E4LA 2QM1A 3SI6A 1RGIA 2Q3SA 4CIFA 4BRGA 4DSFA 4LSNA 3FFKB 2RKIA 3LAKA 2R7YA 1B92A 4FLYA 1BU6O 1HYZA 3THYB 3MX5A 2XRIA 3AO2A 2VWKA 4B9TA 4ILGB 5HROA 3G0ZA 4BDPA 1D4XA 2VG6A 4CJQA 1YXQA 4CJVA 4CZFA 4E19A 3PLAA 1XI1A 4I2QA 2XO7A 1TYQA 3HZ6A 4BREA 1WSEA 2P51A 4UQGA 4A61A 1T05A 1CZBA 3LALA 3F73A 4DR4K 4BE1A 4NCAA 4R79A 2OPSA 4QS7A 3IRXA 4BRCA 4LC9B 2O4IA 4DQ8A 1VQ5N 4UY8O 5LJWA 1YAGA 5DM6L 4MFBA 4HVJA 3E01A 1GLEG 3HM9A 2E88A 4QOZB 2HBMA 5C10A 3LDOA 3EKUA 5ELZA 4DSKA 4BRAA 1HYSA 1TKTA 2E2PA 2GUIA 1T03A 4CZIA 1ZBHA 4IFYA 4ZTFA 3RWUA 4CESA 3VOVA 4CFBA 1RFQA 4GV3A 2E6LA 4KHNA 3L6QA 3O1BA 3V81A 3OYHA 1ZYQA 3AV9A 3KKRA 4JEPA 5HRPA 3CM6A 3J8AA 3LDPA 1HQUA 4AHRA 3CJ1A 1JJ2M 3EE9A 2YNGA 3DI6A 2WONA 4CZEA 2P5GA 5GIOA 3O9QA 1YHQN 3MX2A 3D6RA 4H0TB 4JI3K 4CZGA 5AQJA 3DLKA 2D0OA 1ATRA 4M3YA 2IIRA 4KB0A 3NMUA 4BWMA 5C12A 2KTQA 1NKEA 3OYDA 3SMPA 5CY4A 2CGJA 4HTUA 3ZSRA 4JNEA 4OJRA 4FCYA 3OS1A 3ZSOA 1KRPA 3SBTA 4FJXA 3GG4A 4FJIA 5TKYA 1SKWA 3ZX2A 2PY5A 2Z1IA 2AA4A 3DRRA 4B3MK 4JLHA 3MN6A 3O4WA 2W40A 3H1QA 5F0XA 1P90A 4M3UA 3JSMA 1S22A 4JI7K 4B3SK 4PKHA 2YNHA 1BG3A 3IS9A 3LZIA 3TARA 2HOEA 4NXNK 4DR7K 4KPYA 2KQ2A 4B1YB 4PL8A 2ITGA 1MU2A 4IFVA 3MEGA 4DSLA 1BCMA 4ZHRA 3NF7A 3WQTA 1VQ7N 3ZT3A 1T44A 4CJFA 3V6DA 1NK0A 3H08A 1S72N 3THWB 4PA1A 1BDGA 1S1VA 4IOXA 3I0RA 2GBZA 2BTFA 2A40A 3AVHA 2A41A 2E20A 4B1WB 4A57A 4H5VA 1HNVA 2Q97A 3CCQN 1VQON 4RTFD 4B9NA 4RW7A 2VYPA 2QWRA 3ZX3A 5LL6Z 3TAEA 3IMXA 4CEFA 1NK9A 3OYCA 4F8RA 1VHXA 3LDNA 3QEVA 1YF5L 1JLFA 1NGIA 4CJKA 2O8DA 1U49A 1RT1A 3CJ7A 1L3TA 2I7PA 4JK8A 3L2VA 4CBUA 3P5JA 4EAHD 3LWMA 4DR3K 4CF1A 2ZGZA 4FWMA 1J5EK 2IVPA 4NYNA 4KHPK 3E66A 4DFPA 2X6SA 3AAQA 4N76A 1V4SA 2WBNA 1NGDA 4MLEA 1CZAN 3ENOA 4LFAK 1OKJA 3U3GA 2QI2A 4N41A 3WNHA 4RG8A 4ELUA 1SAZA 3VQBA 4IO8A 4FZYA 3CCSN 4JKBA 1GOAA 1JLBA 5BRHA 1NWKA 4DV7K 1LW0A 1YJNN 4BE2A 4FLZA 3RMBA 1IKVA 1NM1A 3LDQA 3K5NA 3K5MA 3HK2A 1LWFA 1ZXOA 4A62A 3M8SA 4AM6A 3C6UA 4O8UA 3O5BA 3A5OC 4CHYA 4LF6K 2A42A 3C94A 1SS6A 4E7JA 1VQPN 1T6CA 4DV0K 5AQYA 3VEVA 1VSIA 3ZETA 4NO7A 5AZJA 4OLBA 3NGZA 3LP2A 3P39A 4FLTA 2OYQA 4B9LA 2ZWHA 4I7FA 1FKPA 3NHGA 1VSKA 1CLQA 1L3UA 3W3DA 1SL1A 3TSPA 3V1OA 3JYTA 1SL0A 4W5TA 3DWLA 4O5FA 4WQ4C 3EEQA 4WF9L 3OYIA 4KH4A 2YJEA 4CJUA 2O4GA 4IDHA 2QA4N 1OVQA 4ICLA 5AQGA 2P9NB 1Z05A 1RT2A 4RCHA 3MXMA 1TV6A 5AQRA 2QWQA 1K8AO 4FJ9A 3AVNA 2HMPA 2DFEA 3OHRA 2XY6A 1KLNA 2VG5A 4DTNA 3BUZB 2KW4A 2Q0RA 3E9PA 2F7TA 4W5NA 3OYLA 1JXEA 3WUHA 4M7XA 4CEQA 3OS0A 3ZT2A 1TKXA 2G8UA 2VCPA 3SPZA 1EP4A 3CQ8A 1YJWN 2HHXA 4U7BA 3HT3A 4FWKA 1XWLA 4PL7A 2YX6A 3HVTA 4CEDA 1NGBA 5AQSA 4CFDA 4G9ZA 3OBYA 4CHPA 1IBLK 4WQ5A 3K59A 1WBDA 2QKKA 3L2RA 1VQLN 3SQ2A 1QSLA 2Z1JA 3M6GA 4CZLA 4FM1A 4KAZA 4B1VA 3J80O 3LPUA 2BE2A 2BUPA 2YV0X 5GIPA 2FC0A 3TTCA 1JKHA 1RTJA 4JI4K 2ITMA 4BR5A 5KQ8A 4NLBA 4BDYA 3ATUA 4H5TA 1SKSA 1WSIA 3DOKA 4O8KA 2Q2RA 1X9WA 5HRNA 5FPNA 3TR8A 1FK9A 3VTHA 4FJ5A 5EVZA 1VQ6N 2X74A 1XNQK 3SAGA 3KD5E 5BR8K 2X78A 4F2RA 1YJ9N 2UXDK 1JLAA 4OVLA 2QXLA 2HBKA 3IUCA 3JS6A 1I94K 3CI5A 5GAEP 1M90O 3SV4A 4JI0K 5J2QA 3G71N 5GAGP 3SCXA 3QO9A 4IEIA 4QCLA 2JWKA 1RNHA 5IWAK 4Z94A 4YOUA 1DT9A 2IVNA 3CQXA 4CIEA 5LY3A 4B08A 1NK6A 1FW6A 2P9SA 3M1FA 1O1WA 4FXDA 3I8BA 5AQPA 4CJLA 1GLDG 4B9UA 3K58A 4CE9A 3MXIA 5I42A 3VQ6A 2OPPA 3AARA 4CHQA 3O9UA 2YI1A 4DTJA 3AA5X 4Z4EA 4H0YB 1KSPA 3KD1E 1TK0A 1EXQA 1A5XA 1TYQB 2OZMA 5AFUA 3M8PA 3AVKA 4FK2A 4GKJK 1KCFA 1FJGK 2D5RA 2FLOA 3T1HK 3K9KA 3HM8A 2YHXA 3G10A 3ZT4A 1NJYA 1NNEA 3TPQA 4Y1CA 4DTPA 3O6WA 4KTQA 4IOCL 3AVFA 4AHVA 4H4OA 1QSSA 2IAJA 4DQPA 1OH5A 4CEOA 4E7LA 1N6QA 5BN9A 3N4PA 1N5YA 2Y1JA 1M1KO 3C95A 1XQSC 5AQFA 1BA0A 3CCEN 5KGXA 4HUGA 4YORA 4CJEA 4PHTX 1TKDA 4BVPA 2VWJA 5JS2A 4XH4A 4BC5A 5J2NA 2G8IA 1J6ZA 3IFRA 2D0AA 1VQ4N 4HCCA 3HI0A 4E1MA 2VGNA 3T7ZA 1BCOA 3MECA 3DYAA 2CGKA 3TAPA 2P9LA 3A2FA 2BDPA 1X9JA 5FRNA 2GUPA 4B3RK 2QK9A 1XMQK 3O3HA 4YOYA 4DU3A 1OH8A 3HBTA 3AGKA 4YFUA 4KHSA 1YTAA 3H3OB 4GVEA 3AVJA 2HMIA 4CZKA 3H45C 1RBVA 3HXMA 1ESVA 4PQUA 4J2DA 1BISA 3DRPA 3NAEA 3PX0A 4BRLA 3RR7A 1WAFA 1C0UA 4Z4IA 3OW2M 3ZSZA 4JD2A 2XY7A 1JXBA 3ZSQA 1RT7A 5AQVA 1IKYA 4DFJA 3AVLA 4BG9A 3HTVA 3JAMO 2KFNA 3R9PA 1BHLA 4DTUA 4FSVA 2NNWA 3CG7A 1WSGA 3O9RA 4NB4A 4LD0A 2ASOA 4Z0UA 5A2QO 5C15A 3KJVA 1VSLA 3T69A 4X65K 1QSYA 1F21A 4XIUA 1BO5O 3TSUA 3I33A 3L4IA 4DQRA 3MEDA 1JL2A 3AY9A 2D4WA 3QMLA 2HF4A 1HYVA 4DV6K 1C0TA 1Z6RA 1RDDA 5T7BA 4BQLA 4LF8K 1P8ZA 2QWLA 4MLHA 3EN9A 4O5BA 1DLOA 4B1UB 3AVCA 1YIJN 3ID6A 4H5WA 3OA9A 3OS2A 4M3ZA 3H3NO 1S1WA 4L8RB 1ASVA 3T1YK 3SMSA 4BR4A 1LW2A 4CD3A 2A3ZA 4EHTA 4FVMA 2QW9A 4M7YA 3BEXA 4H0VB 3QIPA 5BRDA 4FK0A 3ZSXA 1OH6A 1K9MO 2O8DB 5HLFA 5F2RA 1RBSA 4JYAK 2ZD1A 2O8FA 3D45A 4YOVA 1HKCA 1NGEA 4AILC 3BY5A 1BOTO 3G25A 3NH1A 1T6DA 1CZ9A 4DR5K 3ENBA 3ENHA 4DU1A 4ILJA 3SJJA 3AA3A 3ID8A 2IDOA 3QFPA 1TK8A 4JI1K 1X9SA 2IS3A 3I55N 4Z4FA 2PYLA 4DTRA 5BPNA 4DHYA 5CE3A 3VQ9A 4WFNL 3O3FA 2GX9A 4JS5A 4OKJA 1RTHA 2ZJPL 2NUBA 5HL7L 4PKIA 1KQSM 4GV6A 2HHVA 1VAZA 3T3FA 2HNDA 3D2EA 3L3VA 4FM0A 1C1CA 3A5NC 4DFKA 4CGDA 2A1RA 4C8MA 5AQHA 2GWJA 1K73O 1XUPO 3HJFA 5AQUA 4PY5A 3CC4N 3VTIA 2HHSA 3VEYA 1H1VA 1L3SA 4MQ3A 4KTZA 4Q5VA 2WC9A 3EE8A 3B8AX 4MO5A 3VQ5A 5CHIA 3FZHA 4AQYK 4DQQA 3VEWA 1NMNA 2HF3A 3MN7A 4HCBA 5C25A 1HJRA 4KRFA 2BANA 2GTDA 2ZQBA 3V9UA 1IJJA 1D9FA 3DXMA 4RW8A 3ZETB 4H03B 4JKCA 5AZJB 3WXLA 4A5BA 1S6PA 2HBJA 1T3VA 3MAQA 4KHYA 4PUOA 3B6PA 4BVOA 3WEEA 3SUPA 4FM2A 3CMAN 3MWPA 2VGMA 2G8HA 5B8HA 4H8KA 1VQKN 1BIUA 2G8FA 3V9ZA 3ZLJA 4H0XB 1A5VA 1NGFA 3T1AA 4N47A 5AJ3K 1C1BA 3C7NA 2BGGA 4R5PA 3AVIA 3EKSA 4CGJA 3F9MA 3WXKA 2XHBA 1SV5A 3OYGA 3BZKA 3IKMA 3ULEA 3LL3A 3NE6A 4CEEA 1HX1A 1WB9A 3M8QA 1KVBA 2VG7A 1D8YA 2Q36A 1EWRA 3NVMA 1W97L 1VRTA 4FJLA 4KH6A 3SYZA 3TAFA 3KVGA 5BR9A 3JXUA 4EFHA 2YHYA 4N5SA 1YTUA 5JLFA 3PIOL 4K43A 2HHTA 5JS1A 2RPIA 4FJGA 3U8XA 3VMFB 4YDUA 4LF5K 3RR8A 3D0PA 4BQZA 3SQ4A 1J5OA 4BRPA 1VQ9N 4EZ6A 3V9XA 3P4IA 3PUFA 2KKZA 5DK5A 1V4TA 3TTFA 3HRGA 4OKEA 3SUNA 5M1NA 3VERA 1GOBA 1QVGM 1U47A 3AVMA 2AP1A 4CW7B 3OVNA 3MN5A 3HPGA 4Y1DA 2I7NA 1HJOA 3N4QA 4BRNA 3SQ1A 1NGAA 1RBUA 1IG9A 3WXIA 2UXBK 2PAVA 3RRHA 3ATVA 4M3WA 2JGUA 2PBDA 4KI4A 1VQMN 4JAXA 1MA9B 1HRHA 1N8RO 3FZKA 4JHDA 3AVGA 3QINA 2YJFA 2CGLA 3UB5A 4CFCA 1U2VA 2FF3B 3ISNC 3LZJA 1HPZA 3RMCA 2Z1HA 4FJJA 3BF3A 1TK5A 4FJ7A 2O8BA 2O8CA 3L8BA 3E1YA 3EL2A 1U4BA 1NOZA 5J1EA 1YI2N 1SKRA 2KZZA 2A6AA 5BN8A 3FGUA 4FW2A 4BC4A 3OJSA 5GADP 3LANA 3VA3A 1S1UA 3WXJA 4TSXA 1EETA 1VSFA 3VGKA 3MMVA 4NXMK 1RILA 4E89A 3ZSYA 2Y1IA 3SUQA 5FRMA 4K8ZA 3HO1A 1QVFM 3CJ9A 3SQ0A 2FSNA 2FF6A 2HVHA 5K14A 3DMJA 3FLCO 1HKBA 3VPZA 3OYNA 2NRXA 4J2EA 1JCEA 3CM5A 3I56N 1QQNA 2GWKA 3OYMA 2KLAA 4FOIA 2ASPA 4H4MA 1IO2A 5JMVA 1Q81O 2O8EA 3BGRA 3KKSA 4GNIA 3VA0A 4OPHA 1UA0A 2RE2A 4CGFA 2YNIA 1HMVA 3RMDA 2YNFA 1IKWA 3K57A 4CECA 2E2NA 2HBLA 3CIPA 1K6YA 1SQKA 2P9IA 3KHYA 1NOYA 3CHWA 2F9WA 4FO0A 3ULDA 3VQDA 1UOCA 3NGYA 2DTUA 3GOIA 1JCFA 3LDLA 4XH5A 2E2OA 5BRFA 5EY4A 1BI4A 4WQ5C 4GV9A 1TL1A 4OKKA 3VF6A 1NGHA 2QXFA 4H5RA 5CYQA 2IOCA 2QEXN 3K5LA 2D0PA 3CXCM 4YHHK 1JLQA 4PKGA 5LMNK 4KH5A 4CJSA 5MLCQ 3ZEUA 1ASWA 2HHHK 4B8AB 5M1FA 3KK1A 3H6EA 2OA8A 4LFCK 2F8SA 3VQ8A 2KHOA 1QQCA 4LY7A 1VSJA 4B3OA 3VESA 2P9LB 3W0LA 3I0SA 4B8CA 2GELA 4K0KK 1DTQA 3FZMA 1WOQA 1ATSA 4EP4A 1JLEA 4W5QA 4O44A 2WTUA 1KD1O 3DAWA 4DSIA 4FPAA 4WYBA 4AHUA 2D1KA
chains in the Genus database with same CATH topology
4YOTA 1IG8A 3VEOA 2P9KA 4BVPA 2NZTA 4R79A 4QS7A 4XH4A 4BC5A 1J6ZA 4BRCA 4LC9B 4BGAA 4DQ8A 2ZGYA 4FWRA 3IFRA 1VQ5N 4UY8O 5LJWA 1YAGA 2V7ZA 3SAFA 5DM6L 1VQ4N 3HI0A 3D2FA 2VGNA 3TU5A 4JD2B 2CH5A 3T7ZA 1GLEG 4BROA 3A0IX 2E88A 2HBMA 3O08A 4FOEA 5C10A 2CGKA 3LDOA 3EKUA 2P9LA 5ELZA 1OVYA 1X9JA 3CPEA 4BRAA 5FPEA 3U9ZA 2OTLN 1S3XA 2GUPA 2ZJRL 2E2PA 5AQNA 4YOYA 3R8EA 4K25A 3A8YA 4CZIA 2NRHA 1BUPA 3HBTA 3AGKA 1KC8O 3VOVA 5GINA 1RFQA 4GV3A 4BRFA 3H3OB 4BRKA 4GVEA 3L6QA 3O1BA 4CZKA 3H45C 2P9SB 2V51B 1ESVA 4JEPA 2BH1A 5I9EB 4JKGB 5AFUH 4PHTX 3MCPA 2YCHA 4BRLA 3J8AA 3LDPA 3CJ1A 1JJ2M 3EE9A 5AQZA 3OW2M 4JD2A 3MN9A 3MWTA 3P38A 4CZEA 1BWFO 5JVGL 3C6HA 5GIOA 1WUAA 3O9QA 5AR0A 3MX2A 3D6RA 4H0TB 3MCAB 5JLHA 1YHQN 2GEMA 3GE1A 1O13A 4H0PA 1RDWX 5AQJA 5AQVA 4CZGA 2D0OA 1ATRA 4DCHA 4BR9A 3M3ZA 1ZC6A 1SZ2A 2IIRA 3NMUA 4BG9A 3HTVA 3SAHA 3R9PA 3CCRN 5JICA 4FSVA 4BRMA 2NNWA 5C12A 3U4LA 1YVNA 3O9RA 4NB4A 4IFEA 3SMPA 3R3LA 4JKGA 2CGJA 2ASOA 4ISGA 5AQKA 2Q31A 4IOAL 3IDHA 4JNEA 5C15A 1EO1A 3DXKB 3T69A 3SBTA 2J4RA 1BO5O 3GG4A 3TSUA 5TKYA 1NGCA 4CZHA 1MDUB 5KQDA 3CJBA 3ZX2A 3I33A 3CCVN 3L4IA 3F5TA 4A2AA 4FWLA 3AY9A 2D4WA 3QMLA 2AA4A 2HF4A 1RDUA 3MN6A 3O4WA 2W40A 3H1QA 3M5RA 1Z6RA 1QQOA 2QWMA 2F9TA 5AQMA 4NLCA 4BQLA 1P90A 5F0XA 1P8ZA 1NMDA 1S22A 2QWLA 4IWVA 4PKHA 5AQOA 4MLHA 1BG3A 3EN9A 4B1UB 1YIJN 3ID6A 1NBWA 3C6AA 2QWPA 4H5WA 4ISEA 3OA9A 3CCUN 5TKWA 1GLBG 3RSEB 2HOEA 3H3NO 1NGGA 4Y0WA 1NJIO 3SBGA 3SK3A 5EOYA 2YHWA 1E4FT 3L4QA 4JKHA 4XH1A 5M1PA 3SMSA 4B1YB 4BR4A 4PL8A 4CD3A 3CETA 2A3ZA 3P31A 4BGBA 4BR2A 4ISFA 3DXKA 4EHTA 2QW9A 5AQLA 2FSJA 4M7YA 3BEXA 3QDKA 3QFUA 4H0VB 5BRDA 1Y64A 3WQTA 4YOXA 5LJVA 1VQ7N 1T44A 4GY2B 1K9MO 3BP8A 4I6MB 5HOOA 1S72N 4MDAA 4L3QA 1BDGA 3HOSA 5F2RA 4IOXA 3OBWA 4CD1A 1KXPA 3O1WA 3SJHA 2BTFA 4FWQA 2HSTA 4YOVA 1HKCA 2A40A 1NGEA 1TUUA 2A41A 2E20A 2WFBA 4A57A 4B1WB 1BOTO 3G25A 1T6DA 2OANA 4H5VA 3UKRB 3ENBA 2Q97A 3G6EN 3RSEA 3CF5L 3ENHA 3CCQN 4ILJA 4JKFA 3D2EB 3ID8A 4QS8A 1VQON 2NLXA 3H46O 4RTFD 2VYPA 2V52B 3QFPA 2QWRA 1G99A 3ZX3A 3KWGA 3IMXA 1GLAG 3I55N 3O9SA 4IZ9A 4WFBL 5ADXA 4C23A 4CI6A 3LDNA 4CZMA 1YF5L 2RHKA 4I6MA 5GAHP 1NGIA 5BPNA 4DHYA 1TUYA 5CE3A 3CJ7A 4A2BA 4WFNL 2I7PA 5KPZA 4FWPA 4JK8A 5KPTA 3CMEN 3Q7CA 2NRRA 3QBXA 2GX9A 4WQ4A 4FL9A 5BPMA 3R6MA 1Q18A 4CBUA 1U6ZA 3DXMB 4BC2A 4EAHD 2ZJPL 3UKRA 4JK9A 5HL7L 4PKIA 1KQSM 4GV6A 1VAZA 3VF4A 2ZGZA 4FWMA 1C0GA 2IVPA 3D2EA 3A5NC 3CERA 5AQHA 3HOTA 2GWJA 3E66A 1K73O 1XUPO 4B1ZA 3WEEB 3AAQA 3DLLL 5AQQA 1V4SA 2WBNA 5EX5A 5AQUA 1NGDA 4MLEA 3CC4N 3VTIA 1GLCG 3VEYA 4B1XB 1CZAN 1H1VA 3ENOA 3A5MC 1OKJA 2QI2A 2WC9A 3EE8A 3B8AX 4MDBA 4MO5A 5CHIA 3FZHA 4ILHA 3VEWA 2HF3A 1SAZA 5M1QA 3MN7A 4AM7A 4IO8A 3C7NB 4IXCA 2IVOA 3FZLA 3CCSN 2GTDA 4JKBA 1DEJA 1IJJA 3DXMA 5AQTA 5BRHA 1NWKA 3ZETB 4JN4A 1YJNN 3QB0A 1ZBSA 4H03B 4JKCA 5AZJB 3ULEB 3VGMA 4FWOA 3WXLA 4A5BA 3VENA 2HBJA 3NVKA 1T3VA 4WCEL 5BREA 3FR0A 1NM1A 3LDQA 4BVOA 5EXWA 3WEEA 2NRWA 3WT0A 1VQ8N 1ZXOA 3CMAN 3MWPA 3PIPL 3QICA 2EWSA 4A62A 3KK7A 4IO9L 1HKGA 4HTLA 2VGMA 4IJNA 3VETA 4AM6A 3MDQA 5B8HA 5F1XA 1VQKN 4O8UA 3KWIA 3O5BA 3A5OC 4H0XB 3TSQA 4BRIA 2A42A 3VEZA 1NGFA 4FWSA 3RVCA 3CCLN 1SS6A 3C7NA 3CC2N 4C1NI 1VQPN 4DKWA 3EKSA 5ADXH 1T6CA 2NRTA 3F9MA 4H5NA 5AQYA 3U9DA 3VEVA 3WXKA 3SLCA 3O9TA 1R59O 1ILYA 3LM2A 3ZETA 4A5AA 4BC3A 3IKMA 4JK7A 4NO7A 3LL3A 3ULEA 4AF1A 5CR4A 5AZJA 4RWTA 1W2BM 2CH6A 4OPAA 1HX1A 3P39A 4QS9A 5M1KA 1QQMA 2Q36A 2ZWHA 5FPMA 3MK6A 3LM9A 4U67L 3UE5A 3ZX0A 3NVMA 1W97L 2A5XA 4KH6A 3A5LC 3W3DA 4BRDA 3KVGA 5BR9A 3S41A 3JXUA 5FPDA 5C0YA 4EFHA 3TSPA 2P9PB 2YHYA 3ZYYX 5JLFA 3PIOL 3DWLA 4K43A 4O5FA 4WQ4C 3CC7N 1YITN 5DM7L 3C65A 4M63C 4WF9L 3U8XA 4KH4A 3VMFB 2NRVA 2YJEA 4YDUA 4CJ7A 4IDHA 2FSKA 1JCGA 2JWLA 1GLJO 4DB3A 2QA4N 3H1VX 5AQGA 4BQZA 2P9NB 1Z05A 1K8KB 1X3NA 4RCHA 1MWKA 2ZJQL 4FVUA 5AQRA 2QWQA 4BRPA 1K8AO 3D7EO 1VQ9N 2HMPA 3P4IA 3OHRA 1E4GT 3BUZB 2KKZA 2Q0RA 1V4TA 3E9PA 2F7TA 4JHDB 5AZIB 3TTFA 3HRGA 4EHUA 2W41A 3WUHA 5C2FA 4XEIA 1C0FA 4JKDA 4M7XA 4KBOA 1U2VB 5M1NA 3E9OA 1DGKN 3EZWA 3VERA 1HPMA 2E1ZA 5H1SQ 1QVGM 2P9PA 2VCPA 2AP1A 3WQUA 1KAZA 4FPBA 3E9LA 3MN5A 4BRNA 1YJWN 2I7NA 1HJOA 3N4QA 1NGAA 4U7BA 3WXIA 2UYTA 4IJAA 2PAVA 3EO3A 4FWKA 3CD6N 4JKAA 5E26A 3K9JA 4PL7A 1EQYA 2YX6A 3C0BA 3ATVA 1Q82O 4BRQA 1NLVA 4IEEA 2P9NA 1NGBA 2ZF5O 1K8KA 5AQSA 4G9ZA 4A59A 2PBDA 3OBYA 2DPNA 4K41A 5AQXA 4WQ5A 1HLUA 2PFUA 3FE1A 1VQMN 4JAXA 1MA9B 4H0OA 1N8RO 3FZKA 1VQLN 2VWBA 1QZ6A 4JKEA 4JHDA 5AZIA 3M6GA 4CZLA 2QTDA 4B1VA 2YJFA 2CGLA 3UB5A 3UKUB 1U2VA 2FF3B 2BUPA 1XC3A 4C1NK 5GIPA 5BPLA 1HUXA 4K42A 5AQIA 2FXUA 4BY9C 3BF3A 4EIAA 1NGJA 1LCUA 3TTCA 1LOTB 1BA1A 2V7YA 3VF2A 4CBWA 4MO4A 5JVHL 2ITMA 4BR5A 5KQ8A 4NLBA 4WFAL 2E2QA 3ATUA 3E1YA 3EL2A 4H5TA 3WXMB 4BR0A 4O8KA 1YI2N 4E1JA 2Q2RA 3O8MA 4F9OA 2A6AA 5BN8A 3FGUA 2WUSA 3GBTA 5FPNA 3VTHA 4BC4A 5EVZA 3Q7BA 3AGRA 5GADP 1VQ6N 3GDQA 1YUWA 3VEXA 3WXJA 3AAPA 3CJCA 2E1YA 3SAGA 3VGKA 3MMVA 4OO1J 3CJAA 3UKUA 4BRHA 1YJ9N 2P9IB 1QVFM 2QXLA 3CJ9A 2OTJN 2FSNA 2FF6A 1QZ5A 1QHAA 4YDUC 2HBKA 3FLCO 3KZBA 3IUCA 1GLFO 3JS6A 3CCMN 1HKBA 1X3MA 3CI5A 5GAEP 1M90O 3VPZA 2NRXA 3G71N 5GAGP 4IEIA 1JCEA 3I56N 1QQNA 5E84A 2GWKA 2JWKA 2KLAA 4FOIA 3GL1A 4FWNA 2ASPA 5AQWA 2QWOA 4YOUA 1DT9A 2IVNA 3CQXA 4Z94A 4CBXA 5JMVA 5LY3A 3J7ZO 1ATNA 3VGLA 2P9SA 3QBWA 1Q81O 3M1FA 3CQYA 4GNIA 3BF1A 2Q1NA 3I8BA 1KAXA 4OPHA 5AQPA 2RE2A 2QWNA 1GLDG 2P9UB 4J8FA 2E2NA 2HBLA 3CIPA 1Q7YO 1SQKA 2P9IA 3KHYA 1GLLO 3CHWA 2F9WA 4FO0A 5M1OA 3O80A 3ZEUB 1Q86O 3AARA 5KPRA 4BG8A 3O9UA 3R1XA 4BR7A 2YI1A 3CPWM 4YOWA 2Q0UA 1KAYA 3GOIA 1JCFA 4H0YB 2E8AA 3LDLA 3F2KA 4CZJA 4XH5A 2E2OA 5BRFA 5EY4A 3CCJN 1TYQB 4WQ5C 2QM1A 4GV9A 3VF6A 5AFUA 1RGIA 1NGHA 3DJCA 2NRZA 4H5RA 3TTDA 4BRGA 1DKGD 2FLOA 2QEXN 2D0PA 3FZFA 3HM8A 3K9KA 2P9KB 2YHXA 3FFKB 3HSCA 2P9UA 3CXCM 2ASMA 4PKGA 1BU6O 4KH5A 3TPQA 5MLCQ 3MX5A 3ZEUA 1VQNN 3O6WA 3G4SN 3D2FB 3L0QA 4IOCL 4ILGB 5M1FA 3H6EA 1D4XA 1YXQA 2H3GX 4CZFA 2KHOA 3PLAA 3VESA 2P9LB 5BN9A 3N4PA 4B9QA 1M1KO 1TYQA 3W0LA 1XQSC 1MWMA 3HZ6A 5AQFA 2GELA 4BREA 1BA0A 4HWIA 3CCEN 3FZMA 1WOQA 1ATSA 4A61A 4YORA 1KD1O 3DAWA 4FPAA 4WYBA 5C2DA 2D1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MX2 A;  4GV3 A;  4GV6 A;  3Q7C A;  3MX5 A;  4FVU A;  4GVE A;  3Q7B A;  4G9Z A;  3MWT A;  4GV9 A;  3MWP A;  3R3L A; 
#chains in the Genus database with same CATH topology
 1IG8 A;  4M3X A;  2P9K A;  2NZT A;  3NGI A;  1RT3 A;  4BGA A;  4FWR A;  2VQF K;  3QEW A;  1Q9Y A;  2V7Z A;  3SAF A;  1VSE A;  3D2F A;  4PWD A;  4JD2 B;  1ZBI A;  1XHZ A;  4BRO A;  5DMR A;  3O08 A;  4FOE A;  4LFB K;  1U04 A;  1OVY A;  3HVR A;  3CPE A;  3QNN A;  5FPE A;  2OTL N;  1S3X A;  1BGX T;  4FZZ A;  4O0I A;  3R8E A;  1RT5 A;  3A8Y A;  3TAN A;  4FZX C;  1Q8I A;  1KC8 O;  1VSH A;  1IBK K;  2V51 B;  3EZ5 A;  2BH1 A;  5I9E B;  5AFU H;  3L2U A;  3MCP A;  2YCH A;  1G15 A;  1NU0 A;  3L2Q A;  3AO5 A;  1JLC A;  3MN9 A;  3MWT A;  1YVU A;  4CVN E;  1WUA A;  1J53 A;  3MCA B;  1NK8 A;  1N32 K;  2GEM A;  3KK3 A;  3B6O A;  4ID5 A;  1RDW X;  1NK5 A;  3SPY A;  1NJX A;  1ZC6 A;  1SZ2 A;  3PX6 A;  1C1A A;  3SAH A;  3OTO K;  2ATQ A;  4BRM A;  3U4L A;  1RBT A;  3R3L A;  4JKG A;  3K0S A;  1RTI A;  5AQK A;  3V1R A;  4FLV A;  2Q31 A;  3IDH A;  2J4R A;  1RDB A;  5KQD A;  5FLX O;  1QTM A;  1MDU B;  3CJB A;  3F5T A;  4X64 K;  1IV0 A;  3KLH A;  4W5O A;  3DLG A;  2ZM6 K;  1QQO A;  3LP3 A;  1KTQ A;  2O8F B;  4IWV A;  4CK3 A;  3C6A A;  3KK2 A;  4QAG A;  1XMO K;  1GLB G;  4O55 A;  5J2M A;  4DV5 K;  4Y0W A;  3SBG A;  4GMJ B;  5EOY A;  4CJ5 A;  3L4Q A;  4JKH A;  4XH1 A;  1HNX K;  4DQS A;  3CET A;  3AVB A;  3DXK A;  4ISF A;  5AQL A;  3QDK A;  3DOL A;  1Y64 A;  2HNY A;  1I3A A;  1RCH A;  4LH4 A;  3BP8 A;  3DLE A;  1XHX A;  5HOO A;  3IAY A;  4L3Q A;  3VQA A;  3HOS A;  2OZS A;  3OBW A;  4CD1 A;  4JI2 K;  1KXP A;  1J54 A;  3O1W A;  3SJH A;  3V9W A;  2HST A;  4LF7 K;  5KRT A;  2WFB A;  5C42 A;  4CK2 A;  1REV A;  4EP5 A;  3G6E N;  4JI6 K;  3OJU A;  3RSE A;  4CF2 A;  3CF5 L;  4DF4 A;  3D2E B;  2NLX A;  1Y97 A;  4DS5 A;  4CIG A;  1ZBL A;  1G99 A;  4DV2 K;  1QS4 A;  5ADX A;  4C23 A;  4DLG A;  4CZM A;  2RHK A;  4I6M A;  5GAH P;  1TUY A;  4A2B A;  5KPZ A;  3DLH A;  4FWP A;  3OYF A;  2NRR A;  5BPM A;  3R6M A;  1Q18 A;  2B5J A;  1U6Z A;  3DXM B;  3UKR A;  3KLF A;  5HRR A;  1DTT A;  4NYF A;  4KV8 A;  1T8E A;  1C0G A;  4LH5 A;  3ZSV A;  4FJH A;  1VSD A;  4NCB A;  3RTV A;  4DQI A;  4B1Z A;  3WEE B;  1LAV A;  2RN2 A;  1HNZ K;  2YHB A;  1WSJ A;  4MDB A;  2RF2 A;  4G1Q A;  4BAC A;  3HYF A;  4DTS A;  3LPT A;  3AO4 A;  3C7N B;  3K5O A;  2IVO A;  3L2W A;  1IH7 A;  3FZL A;  1DEJ A;  5AQT A;  3LP1 A;  4FLU A;  4CGG A;  4NCG A;  3ULE B;  3VGM A;  4FWO A;  3VEN A;  3THX A;  3FR0 A;  5EXW A;  3PY8 A;  3QIC A;  4DS4 A;  2EWS A;  2KZM A;  1HKG A;  1U48 A;  4IJN A;  1Z25 A;  3MDQ A;  5F1X A;  4BDZ A;  1KFS A;  5HP1 A;  4BRI A;  3TSQ A;  4OGC A;  3RVC A;  3HP9 A;  4F2S A;  4C1N I;  4DKW A;  1NJW A;  3SLC A;  1ILY A;  3LM2 A;  4BC3 A;  3PX4 A;  4CCH A;  5CR4 A;  2JLE A;  2CH6 A;  4OPA A;  3V4I A;  4E0D A;  5M1K A;  3NF9 A;  3SNN A;  2KFZ A;  3LM9 A;  4U67 L;  4DFM A;  3HST B;  2FBY A;  3A5L C;  3V9S A;  3S41 A;  5FPD A;  5C0Y A;  1RT6 A;  3ZT0 A;  3ZYY X;  1L5U A;  1I39 A;  1Q9X A;  2G8K A;  1YIT N;  1RT4 A;  1LWE A;  2HNZ A;  5DM7 L;  4M63 C;  4M45 A;  2OCE A;  3O4Q A;  4CEZ A;  4OPK A;  1RTD A;  1JCG A;  2JWL A;  1SL2 A;  3MXJ A;  1X3N A;  1T7P A;  4B9S A;  1MWK A;  4DTX A;  3TAM A;  2DY4 A;  4JHD B;  4M3R A;  3OYK A;  2W41 A;  5C2F A;  3VQE A;  1VQN N;  4KBO A;  1U2V B;  2LSN A;  3E9O A;  1DGK N;  5H1S Q;  1HPM A;  2E1Z A;  1N36 K;  2P9P A;  3WQU A;  5CZ2 A;  4J2A A;  2IGI A;  2O8C B;  2O8B B;  1B9D A;  4FPB A;  2VQE K;  3CYM A;  2I5J A;  2UYT A;  5EU7 A;  1S5J A;  3CD6 N;  4JKA A;  5E26 A;  1JLG A;  1EQY A;  3C0B A;  4HUE A;  1Q82 O;  1NLV A;  4IEE A;  5I3U A;  1K8K A;  2UUC K;  3ZCM A;  1Z26 A;  1TAU A;  3FE1 A;  4KO0 A;  4OX9 K;  3U6F A;  4CER A;  3NH0 A;  1QZ6 A;  5AZI A;  4M3T A;  2FBV A;  2QTD A;  3KLE A;  4C1N K;  5AQI A;  2OPR A;  4BY9 C;  1NGJ A;  4RW4 A;  1LOT B;  4CBW A;  3VF2 A;  4DMN A;  1LV5 A;  2G8V A;  4Z4G A;  2E2Q A;  4BR0 A;  3AO3 A;  4F9O A;  3KTQ A;  3AA4 A;  3GBT A;  4CHZ A;  2E6M A;  3Q7B A;  2O8E B;  2X6N A;  3OY9 A;  3QEP A;  2HB5 A;  3GDQ A;  3VEX A;  3O3G A;  3CJC A;  1L3V A;  2HVI A;  4DTM A;  3CJA A;  2P1J A;  3UKU A;  4BRH A;  3ZSW A;  2P9I B;  3QLH A;  4X62 K;  4W5R A;  2OTJ N;  4F4K A;  4CJ3 A;  1WN7 A;  4M41 A;  3NDK A;  4YDU C;  3KZB A;  1S1T A;  1IBM K;  3LAM A;  1BI4 B;  3VQP A;  1RBR A;  2QWO A;  3AA2 A;  3J7Z O;  4Z4C A;  3VGL A;  3DM2 A;  3QBW A;  5SWM A;  4KRE A;  1LAW A;  1WNS A;  1HNI A;  2Q1N A;  3LDS A;  4KHW A;  4AH9 A;  2E5L K;  1ZBF A;  4CJR A;  4J8F A;  3DRS A;  1RDC A;  5M1O A;  3ZEU B;  3O80 A;  4FW1 A;  4KFB A;  1S6Q A;  3CPW M;  4FJN A;  4C8N A;  4BWJ A;  4IG3 A;  4X66 K;  3O4N A;  4CZJ A;  3CCJ N;  3TAB A;  2FBT A;  2W6L A;  4E3S A;  4KB1 A;  3DJC A;  2NRZ A;  3TTD A;  5LMU K;  1DKG D;  3FZF A;  2P9K B;  3HSC A;  2HHU A;  2P9U A;  4KHU A;  2ASM A;  1TAQ A;  1KVA A;  4EZ9 A;  4DU4 A;  1SUQ A;  3D2F B;  3L0Q A;  3G4S N;  4DV4 K;  5IT9 O;  3VQ7 A;  1W7A A;  2H3G X;  4FLW A;  4FJ8 A;  4I9L A;  4AHS A;  4B9Q A;  3NF8 A;  5KRS A;  1MWM A;  4HHT A;  3DLR A;  1TKZ A;  4HWI A;  2IC3 A;  1CXU A;  4IBN A;  4FK4 A;  4V19 S;  5C2D A;  4YOT A;  4CK1 A;  4IDK A;  3VEO A;  1WSH A;  4IKF A;  2ZGY A;  3THY A;  3ITH A;  1OH7 A;  1TVR A;  2UXC K;  3J7Y P;  3TU5 A;  2CH5 A;  3WNE A;  3A0I X;  1FXX A;  1EX4 A;  2YKN A;  2HW3 A;  5D3G A;  3F9K A;  3U9Z A;  2ZJR L;  5AQN A;  2G8W A;  4CF9 A;  4K25 A;  3K2P A;  4DSJ A;  3NFA A;  3VQ4 A;  2NRH A;  1BUP A;  1C6V A;  3KIO A;  5GIN A;  5CYM A;  4BRF A;  3PSF A;  4BRK A;  3TAQ A;  4FYD A;  4F3O A;  1A5W A;  3ASM A;  2P9S B;  5KTQ A;  1UWB A;  3T19 A;  1ZBU A;  4JKG B;  4DUY K;  3ALY A;  2XY8 A;  4Z4H A;  4AHT A;  2DFH A;  5AQZ A;  4AHC A;  3P38 A;  1BWF O;  5JVG L;  4DR1 K;  4OLA A;  3C6H A;  5AR0 A;  5JLH A;  3GE1 A;  1O13 A;  4H0P A;  4FLX A;  3P1G A;  4DCH A;  4BR9 A;  3M3Z A;  5C24 A;  3QEI A;  2HHQ A;  2OPQ A;  4CGI A;  3EY1 A;  2P5O A;  1E3M A;  2B4J A;  4JV5 K;  1S9E A;  3CCR N;  5JIC A;  4DR6 K;  3VQC A;  1NK4 A;  1YVN A;  4IFE A;  3CFP A;  4C8L A;  4ISG A;  4IOA L;  1S1X A;  1EO1 A;  4E7K A;  1NK7 A;  1ITG A;  3DXK B;  3CCV N;  1NGC A;  4CZH A;  4A2A A;  1IKX A;  4FWL A;  5KGW A;  2UU9 K;  2XY5 A;  1RDU A;  3M5R A;  2QWM A;  4E7H A;  2F9T A;  1BL3 A;  1LWC A;  4E1N A;  5AQM A;  4NLC A;  1N33 K;  3PO5 A;  1NMD A;  4DV3 K;  5AQO A;  3S3M A;  2F96 A;  3QIO A;  4OGE A;  4N56 A;  1VK0 A;  1NBW A;  2QWP A;  3EYZ A;  4ISE A;  3CCU N;  5TKW A;  2HHW A;  3RSE B;  2F8T A;  1NGG A;  1NJI O;  1NKB A;  3SK3 A;  3M8R A;  2YHW A;  1E4F T;  5M1P A;  3UIQ A;  4FJM A;  3U3Y A;  3DLB A;  4BR2 A;  3P31 A;  4BGB A;  4KKO A;  1HNW K;  1W0H A;  3SZ2 A;  4J2B A;  4JI5 K;  2QKB A;  1TL3 A;  2FSJ A;  3VN5 A;  3QFU A;  4CJ4 A;  4CEB A;  4YOX A;  5LJV A;  3I8D A;  4GKK K;  5J2P A;  4CGH A;  4GY2 B;  3NF6 A;  4I6M B;  4MDA A;  4O4G A;  3PO4 A;  4FWQ A;  5CZ1 A;  3KLG A;  1TUU A;  3QEX A;  4ELV A;  2OAN A;  3RRG A;  3UKR B;  1NJZ A;  2B6A A;  4JKF A;  4QS8 A;  3H46 O;  4OPJ A;  2V52 B;  3LWL A;  1KVC A;  3KWG A;  1WBB A;  1GLA G;  4CF8 A;  3O9S A;  4IZ9 A;  4WFB L;  4CEA A;  2YKM A;  4CI6 A;  3SV3 A;  4B9V A;  3THW A;  3VQQ A;  3HL8 A;  3TI0 A;  2ZE2 A;  5KPT A;  3CME N;  3Q7C A;  3QBX A;  4WQ4 A;  4FL9 A;  4JRQ A;  1J9A A;  4BC2 A;  3S9H A;  4JK9 A;  2PZS A;  4GVM A;  3VF4 A;  3NH2 A;  2ETJ A;  3OYE A;  5E41 A;  3THX B;  3CER A;  3HOT A;  1C0M A;  1S9G A;  3THV A;  3DLL L;  2GV9 A;  1BQN A;  5AQQ A;  3HPO A;  3CFO A;  5EX5 A;  1QE1 A;  1GLC G;  4B1X B;  2A1S A;  3A5M C;  1VSM A;  1BIZ A;  4CHO A;  4ILH A;  4KTW A;  4DV1 K;  5M1Q A;  4DTO A;  4AM7 A;  4RW6 A;  4IXC A;  1NG9 A;  2Z1G A;  1TGO A;  3J81 O;  4JN4 A;  3QB0 A;  1ZBS A;  3NVK A;  4WCE L;  5BRE A;  3WT0 A;  2NRW A;  2UUB K;  1VQ8 N;  2WOM A;  3TAG A;  1KLM A;  4C8K A;  1UAX A;  1YT3 A;  3PIP L;  3HPH A;  4IO9 L;  3KK7 A;  4HTL A;  3VET A;  1HR0 K;  3NCI A;  4JRP A;  3KWI A;  3BDP A;  4Q0B A;  3VEZ A;  1FKO A;  4FWS A;  3QES A;  5HRS A;  1HQE A;  3CCL N;  3CC2 N;  4CJT A;  5ADX H;  2NRT A;  4H5N A;  3U9D A;  4I2P A;  3O9T A;  1R59 O;  4A5A A;  4JI8 K;  1GOC A;  4JK7 A;  4AF1 A;  4BE0 A;  2AJQ A;  4RWT A;  4LF4 K;  1W2B M;  2EHG A;  3TWH A;  4QS9 A;  1QQM A;  1UA1 A;  5FPM A;  3S3N A;  3MK6 A;  3ZT1 A;  2F4V K;  3UE5 A;  3ZX0 A;  2A5X A;  1XNR K;  4BRD A;  4M42 A;  4C8O A;  3HP6 A;  2P9P B;  3AO1 A;  4DLE A;  3CC7 N;  3QER A;  4DSE A;  3OYJ A;  4K8X A;  3C65 A;  3IG1 A;  2NRV A;  2W42 A;  4LF9 K;  4CJ7 A;  2FSK A;  3QNO A;  4DB3 A;  1GLJ O;  3H1V X;  4B3T K;  1K8K B;  2PYJ A;  5FDL A;  4DG1 A;  2ZJQ L;  4JS4 A;  4FVU A;  1X1P A;  2EX3 A;  3D7E O;  1QHT A;  1E4G T;  4E7I A;  4ZTJ A;  1KFD A;  5AZI B;  4EHU A;  4XEI A;  1C0F A;  4JKD A;  3EZW A;  3PSI A;  3PV8 A;  2W6K A;  1X9M A;  4HUF A;  1W9H A;  1KAZ A;  4YNQ A;  3E9L A;  4IJA A;  3EO3 A;  3K9J A;  4BRQ A;  4ELT A;  1WAJ A;  2P9N A;  4IG0 A;  2ZF5 O;  4CF0 A;  4A59 A;  5KI6 A;  4B9M A;  2DPN A;  4K41 A;  5AQX A;  1HLU A;  2PFU A;  4KHQ A;  3WNF A;  3OYA A;  4H0O A;  1B9F A;  1D9D A;  3L3U A;  2VWB A;  4JKE A;  3KLI A;  5FRO A;  3SUO A;  4YY3 K;  3UKU B;  4GW6 A;  1XC3 A;  5BPL A;  1HUX A;  3S3O A;  3AVA A;  4K42 A;  2FXU A;  1R0A A;  4EIA A;  3WNG A;  1LCU A;  1D5A A;  1BA1 A;  2V7Y A;  4MO4 A;  5JVH L;  4WFA L;  3NBP A;  4DUZ K;  3P83 D;  3WXM B;  4KI6 A;  4E1J A;  2DFF A;  3O8M A;  4CHN A;  3OYB A;  1BQM A;  2WUS A;  3QET A;  3AGR A;  1YUW A;  3AAP A;  3C6T A;  4WE1 A;  2E1Y A;  2YHA A;  4OO1 J;  1ASU A;  4CJP A;  5HBM A;  3BZC A;  4I9Q A;  1EKE A;  4O0J A;  2D0C A;  1QZ5 A;  3RMA A;  1QHA A;  4ID1 A;  3CCM N;  1GLF O;  1X3M A;  3V1Q A;  2D0B A;  4RW9 A;  4F3T A;  5E84 A;  1U45 A;  3GL1 A;  1WLJ A;  4FWN A;  4DR2 K;  5AQW A;  2UUA K;  2FBX A;  4CBX A;  1ATN A;  3CQY A;  1CXQ A;  4CJW A;  3BF1 A;  1EWQ A;  1KAX A;  1RDA A;  3CFR A;  1XC9 A;  2QWN A;  4DF8 A;  1WSF A;  2P9U B;  1Q7Y O;  3FFI A;  3J7A P;  1JL1 A;  1GLL O;  4DWI A;  1Q86 O;  4CFA A;  3MEE A;  1N34 K;  3LP0 A;  5KPR A;  4BG8 A;  1NKC A;  5SZT A;  3R1X A;  1VRU A;  4BR7 A;  4YOW A;  2Q0U A;  1KAY A;  2E8A A;  4LSL A;  3F2K A;  4FJK A;  2E4L A;  2QM1 A;  3SI6 A;  1RGI A;  2Q3S A;  4CIF A;  4BRG A;  4DSF A;  4LSN A;  3FFK B;  2RKI A;  3LAK A;  2R7Y A;  1B92 A;  4FLY A;  1BU6 O;  1HYZ A;  3THY B;  3MX5 A;  2XRI A;  3AO2 A;  2VWK A;  4B9T A;  4ILG B;  5HRO A;  3G0Z A;  4BDP A;  1D4X A;  2VG6 A;  4CJQ A;  1YXQ A;  4CJV A;  4CZF A;  4E19 A;  3PLA A;  1XI1 A;  4I2Q A;  2XO7 A;  1TYQ A;  3HZ6 A;  4BRE A;  1WSE A;  2P51 A;  4UQG A;  4A61 A;  1T05 A;  1CZB A;  3LAL A;  3F73 A;  4DR4 K;  4BE1 A;  4NCA A;  4R79 A;  2OPS A;  4QS7 A;  3IRX A;  4BRC A;  4LC9 B;  2O4I A;  4DQ8 A;  1VQ5 N;  4UY8 O;  5LJW A;  1YAG A;  5DM6 L;  4MFB A;  4HVJ A;  3E01 A;  1GLE G;  3HM9 A;  2E88 A;  4QOZ B;  2HBM A;  5C10 A;  3LDO A;  3EKU A;  5ELZ A;  4DSK A;  4BRA A;  1HYS A;  1TKT A;  2E2P A;  2GUI A;  1T03 A;  4CZI A;  1ZBH A;  4IFY A;  4ZTF A;  3RWU A;  4CES A;  3VOV A;  4CFB A;  1RFQ A;  4GV3 A;  2E6L A;  4KHN A;  3L6Q A;  3O1B A;  3V81 A;  3OYH A;  1ZYQ A;  3AV9 A;  3KKR A;  4JEP A;  5HRP A;  3CM6 A;  3J8A A;  3LDP A;  1HQU A;  4AHR A;  3CJ1 A;  1JJ2 M;  3EE9 A;  2YNG A;  3DI6 A;  2WON A;  4CZE A;  2P5G A;  5GIO A;  3O9Q A;  1YHQ N;  3MX2 A;  3D6R A;  4H0T B;  4JI3 K;  4CZG A;  5AQJ A;  3DLK A;  2D0O A;  1ATR A;  4M3Y A;  2IIR A;  4KB0 A;  3NMU A;  4BWM A;  5C12 A;  2KTQ A;  1NKE A;  3OYD A;  3SMP A;  5CY4 A;  2CGJ A;  4HTU A;  3ZSR A;  4JNE A;  4OJR A;  4FCY A;  3OS1 A;  3ZSO A;  1KRP A;  3SBT A;  4FJX A;  3GG4 A;  4FJI A;  5TKY A;  1SKW A;  3ZX2 A;  2PY5 A;  2Z1I A;  2AA4 A;  3DRR A;  4B3M K;  4JLH A;  3MN6 A;  3O4W A;  2W40 A;  3H1Q A;  5F0X A;  1P90 A;  4M3U A;  3JSM A;  1S22 A;  4JI7 K;  4B3S K;  4PKH A;  2YNH A;  1BG3 A;  3IS9 A;  3LZI A;  3TAR A;  2HOE A;  4NXN K;  4DR7 K;  4KPY A;  2KQ2 A;  4B1Y B;  4PL8 A;  2ITG A;  1MU2 A;  4IFV A;  3MEG A;  4DSL A;  1BCM A;  4ZHR A;  3NF7 A;  3WQT A;  1VQ7 N;  3ZT3 A;  1T44 A;  4CJF A;  3V6D A;  1NK0 A;  3H08 A;  1S72 N;  3THW B;  4PA1 A;  1BDG A;  1S1V A;  4IOX A;  3I0R A;  2GBZ A;  2BTF A;  2A40 A;  3AVH A;  2A41 A;  2E20 A;  4B1W B;  4A57 A;  4H5V A;  1HNV A;  2Q97 A;  3CCQ N;  1VQO N;  4RTF D;  4B9N A;  4RW7 A;  2VYP A;  2QWR A;  3ZX3 A;  5LL6 Z;  3TAE A;  3IMX A;  4CEF A;  1NK9 A;  3OYC A;  4F8R A;  1VHX A;  3LDN A;  3QEV A;  1YF5 L;  1JLF A;  1NGI A;  4CJK A;  2O8D A;  1U49 A;  1RT1 A;  3CJ7 A;  1L3T A;  2I7P A;  4JK8 A;  3L2V A;  4CBU A;  3P5J A;  4EAH D;  3LWM A;  4DR3 K;  4CF1 A;  2ZGZ A;  4FWM A;  1J5E K;  2IVP A;  4NYN A;  4KHP K;  3E66 A;  4DFP A;  2X6S A;  3AAQ A;  4N76 A;  1V4S A;  2WBN A;  1NGD A;  4MLE A;  1CZA N;  3ENO A;  4LFA K;  1OKJ A;  3U3G A;  2QI2 A;  4N41 A;  3WNH A;  4RG8 A;  4ELU A;  1SAZ A;  3VQB A;  4IO8 A;  4FZY A;  3CCS N;  4JKB A;  1GOA A;  1JLB A;  5BRH A;  1NWK A;  4DV7 K;  1LW0 A;  1YJN N;  4BE2 A;  4FLZ A;  3RMB A;  1IKV A;  1NM1 A;  3LDQ A;  3K5N A;  3K5M A;  3HK2 A;  1LWF A;  1ZXO A;  4A62 A;  3M8S A;  4AM6 A;  3C6U A;  4O8U A;  3O5B A;  3A5O C;  4CHY A;  4LF6 K;  2A42 A;  3C94 A;  1SS6 A;  4E7J A;  1VQP N;  1T6C A;  4DV0 K;  5AQY A;  3VEV A;  1VSI A;  3ZET A;  4NO7 A;  5AZJ A;  4OLB A;  3NGZ A;  3LP2 A;  3P39 A;  4FLT A;  2OYQ A;  4B9L A;  2ZWH A;  4I7F A;  1FKP A;  3NHG A;  1VSK A;  1CLQ A;  1L3U A;  3W3D A;  1SL1 A;  3TSP A;  3V1O A;  3JYT A;  1SL0 A;  4W5T A;  3DWL A;  4O5F A;  4WQ4 C;  3EEQ A;  4WF9 L;  3OYI A;  4KH4 A;  2YJE A;  4CJU A;  2O4G A;  4IDH A;  2QA4 N;  1OVQ A;  4ICL A;  5AQG A;  2P9N B;  1Z05 A;  1RT2 A;  4RCH A;  3MXM A;  1TV6 A;  5AQR A;  2QWQ A;  1K8A O;  4FJ9 A;  3AVN A;  2HMP A;  2DFE A;  3OHR A;  2XY6 A;  1KLN A;  2VG5 A;  4DTN A;  3BUZ B;  2KW4 A;  2Q0R A;  3E9P A;  2F7T A;  4W5N A;  3OYL A;  1JXE A;  3WUH A;  4M7X A;  4CEQ A;  3OS0 A;  3ZT2 A;  1TKX A;  2G8U A;  2VCP A;  3SPZ A;  1EP4 A;  3CQ8 A;  1YJW N;  2HHX A;  4U7B A;  3HT3 A;  4FWK A;  1XWL A;  4PL7 A;  2YX6 A;  3HVT A;  4CED A;  1NGB A;  5AQS A;  4CFD A;  4G9Z A;  3OBY A;  4CHP A;  1IBL K;  4WQ5 A;  3K59 A;  1WBD A;  2QKK A;  3L2R A;  1VQL N;  3SQ2 A;  1QSL A;  2Z1J A;  3M6G A;  4CZL A;  4FM1 A;  4KAZ A;  4B1V A;  3J80 O;  3LPU A;  2BE2 A;  2BUP A;  2YV0 X;  5GIP A;  2FC0 A;  3TTC A;  1JKH A;  1RTJ A;  4JI4 K;  2ITM A;  4BR5 A;  5KQ8 A;  4NLB A;  4BDY A;  3ATU A;  4H5T A;  1SKS A;  1WSI A;  3DOK A;  4O8K A;  2Q2R A;  1X9W A;  5HRN A;  5FPN A;  3TR8 A;  1FK9 A;  3VTH A;  4FJ5 A;  5EVZ A;  1VQ6 N;  2X74 A;  1XNQ K;  3SAG A;  3KD5 E;  5BR8 K;  2X78 A;  4F2R A;  1YJ9 N;  2UXD K;  1JLA A;  4OVL A;  2QXL A;  2HBK A;  3IUC A;  3JS6 A;  1I94 K;  3CI5 A;  5GAE P;  1M90 O;  3SV4 A;  4JI0 K;  5J2Q A;  3G71 N;  5GAG P;  3SCX A;  3QO9 A;  4IEI A;  4QCL A;  2JWK A;  1RNH A;  5IWA K;  4Z94 A;  4YOU A;  1DT9 A;  2IVN A;  3CQX A;  4CIE A;  5LY3 A;  4B08 A;  1NK6 A;  1FW6 A;  2P9S A;  3M1F A;  1O1W A;  4FXD A;  3I8B A;  5AQP A;  4CJL A;  1GLD G;  4B9U A;  3K58 A;  4CE9 A;  3MXI A;  5I42 A;  3VQ6 A;  2OPP A;  3AAR A;  4CHQ A;  3O9U A;  2YI1 A;  4DTJ A;  3AA5 X;  4Z4E A;  4H0Y B;  1KSP A;  3KD1 E;  1TK0 A;  1EXQ A;  1A5X A;  1TYQ B;  2OZM A;  5AFU A;  3M8P A;  3AVK A;  4FK2 A;  4GKJ K;  1KCF A;  1FJG K;  2D5R A;  2FLO A;  3T1H K;  3K9K A;  3HM8 A;  2YHX A;  3G10 A;  3ZT4 A;  1NJY A;  1NNE A;  3TPQ A;  4Y1C A;  4DTP A;  3O6W A;  4KTQ A;  4IOC L;  3AVF A;  4AHV A;  4H4O A;  1QSS A;  2IAJ A;  4DQP A;  1OH5 A;  4CEO A;  4E7L A;  1N6Q A;  5BN9 A;  3N4P A;  1N5Y A;  2Y1J A;  1M1K O;  3C95 A;  1XQS C;  5AQF A;  1BA0 A;  3CCE N;  5KGX A;  4HUG A;  4YOR A;  4CJE A;  4PHT X;  1TKD A;  4BVP A;  2VWJ A;  5JS2 A;  4XH4 A;  4BC5 A;  5J2N A;  2G8I A;  1J6Z A;  3IFR A;  2D0A A;  1VQ4 N;  4HCC A;  3HI0 A;  4E1M A;  2VGN A;  3T7Z A;  1BCO A;  3MEC A;  3DYA A;  2CGK A;  3TAP A;  2P9L A;  3A2F A;  2BDP A;  1X9J A;  5FRN A;  2GUP A;  4B3R K;  2QK9 A;  1XMQ K;  3O3H A;  4YOY A;  4DU3 A;  1OH8 A;  3HBT A;  3AGK A;  4YFU A;  4KHS A;  1YTA A;  3H3O B;  4GVE A;  3AVJ A;  2HMI A;  4CZK A;  3H45 C;  1RBV A;  3HXM A;  1ESV A;  4PQU A;  4J2D A;  1BIS A;  3DRP A;  3NAE A;  3PX0 A;  4BRL A;  3RR7 A;  1WAF A;  1C0U A;  4Z4I A;  3OW2 M;  3ZSZ A;  4JD2 A;  2XY7 A;  1JXB A;  3ZSQ A;  1RT7 A;  5AQV A;  1IKY A;  4DFJ A;  3AVL A;  4BG9 A;  3HTV A;  3JAM O;  2KFN A;  3R9P A;  1BHL A;  4DTU A;  4FSV A;  2NNW A;  3CG7 A;  1WSG A;  3O9R A;  4NB4 A;  4LD0 A;  2ASO A;  4Z0U A;  5A2Q O;  5C15 A;  3KJV A;  1VSL A;  3T69 A;  4X65 K;  1QSY A;  1F21 A;  4XIU A;  1BO5 O;  3TSU A;  3I33 A;  3L4I A;  4DQR A;  3MED A;  1JL2 A;  3AY9 A;  2D4W A;  3QML A;  2HF4 A;  1HYV A;  4DV6 K;  1C0T A;  1Z6R A;  1RDD A;  5T7B A;  4BQL A;  4LF8 K;  1P8Z A;  2QWL A;  4MLH A;  3EN9 A;  4O5B A;  1DLO A;  4B1U B;  3AVC A;  1YIJ N;  3ID6 A;  4H5W A;  3OA9 A;  3OS2 A;  4M3Z A;  3H3N O;  1S1W A;  4L8R B;  1ASV A;  3T1Y K;  3SMS A;  4BR4 A;  1LW2 A;  4CD3 A;  2A3Z A;  4EHT A;  4FVM A;  2QW9 A;  4M7Y A;  3BEX A;  4H0V B;  3QIP A;  5BRD A;  4FK0 A;  3ZSX A;  1OH6 A;  1K9M O;  2O8D B;  5HLF A;  5F2R A;  1RBS A;  4JYA K;  2ZD1 A;  2O8F A;  3D45 A;  4YOV A;  1HKC A;  1NGE A;  4AIL C;  3BY5 A;  1BOT O;  3G25 A;  3NH1 A;  1T6D A;  1CZ9 A;  4DR5 K;  3ENB A;  3ENH A;  4DU1 A;  4ILJ A;  3SJJ A;  3AA3 A;  3ID8 A;  2IDO A;  3QFP A;  1TK8 A;  4JI1 K;  1X9S A;  2IS3 A;  3I55 N;  4Z4F A;  2PYL A;  4DTR A;  5BPN A;  4DHY A;  5CE3 A;  3VQ9 A;  4WFN L;  3O3F A;  2GX9 A;  4JS5 A;  4OKJ A;  1RTH A;  2ZJP L;  2NUB A;  5HL7 L;  4PKI A;  1KQS M;  4GV6 A;  2HHV A;  1VAZ A;  3T3F A;  2HND A;  3D2E A;  3L3V A;  4FM0 A;  1C1C A;  3A5N C;  4DFK A;  4CGD A;  2A1R A;  4C8M A;  5AQH A;  2GWJ A;  1K73 O;  1XUP O;  3HJF A;  5AQU A;  4PY5 A;  3CC4 N;  3VTI A;  2HHS A;  3VEY A;  1H1V A;  1L3S A;  4MQ3 A;  4KTZ A;  4Q5V A;  2WC9 A;  3EE8 A;  3B8A X;  4MO5 A;  3VQ5 A;  5CHI A;  3FZH A;  4AQY K;  4DQQ A;  3VEW A;  1NMN A;  2HF3 A;  3MN7 A;  4HCB A;  5C25 A;  1HJR A;  4KRF A;  2BAN A;  2GTD A;  2ZQB A;  3V9U A;  1IJJ A;  1D9F A;  3DXM A;  4RW8 A;  3ZET B;  4H03 B;  4JKC A;  5AZJ B;  3WXL A;  4A5B A;  1S6P A;  2HBJ A;  1T3V A;  3MAQ A;  4KHY A;  4PUO A;  3B6P A;  4BVO A;  3WEE A;  3SUP A;  4FM2 A;  3CMA N;  3MWP A;  2VGM A;  2G8H A;  5B8H A;  4H8K A;  1VQK N;  1BIU A;  2G8F A;  3V9Z A;  3ZLJ A;  4H0X B;  1A5V A;  1NGF A;  3T1A A;  4N47 A;  5AJ3 K;  1C1B A;  3C7N A;  2BGG A;  4R5P A;  3AVI A;  3EKS A;  4CGJ A;  3F9M A;  3WXK A;  2XHB A;  1SV5 A;  3OYG A;  3BZK A;  3IKM A;  3ULE A;  3LL3 A;  3NE6 A;  4CEE A;  1HX1 A;  1WB9 A;  3M8Q A;  1KVB A;  2VG7 A;  1D8Y A;  2Q36 A;  1EWR A;  3NVM A;  1W97 L;  1VRT A;  4FJL A;  4KH6 A;  3SYZ A;  3TAF A;  3KVG A;  5BR9 A;  3JXU A;  4EFH A;  2YHY A;  4N5S A;  1YTU A;  5JLF A;  3PIO L;  4K43 A;  2HHT A;  5JS1 A;  2RPI A;  4FJG A;  3U8X A;  3VMF B;  4YDU A;  4LF5 K;  3RR8 A;  3D0P A;  4BQZ A;  3SQ4 A;  1J5O A;  4BRP A;  1VQ9 N;  4EZ6 A;  3V9X A;  3P4I A;  3PUF A;  2KKZ A;  5DK5 A;  1V4T A;  3TTF A;  3HRG A;  4OKE A;  3SUN A;  5M1N A;  3VER A;  1GOB A;  1QVG M;  1U47 A;  3AVM A;  2AP1 A;  4CW7 B;  3OVN A;  3MN5 A;  3HPG A;  4Y1D A;  2I7N A;  1HJO A;  3N4Q A;  4BRN A;  3SQ1 A;  1NGA A;  1RBU A;  1IG9 A;  3WXI A;  2UXB K;  2PAV A;  3RRH A;  3ATV A;  4M3W A;  2JGU A;  2PBD A;  4KI4 A;  1VQM N;  4JAX A;  1MA9 B;  1HRH A;  1N8R O;  3FZK A;  4JHD A;  3AVG A;  3QIN A;  2YJF A;  2CGL A;  3UB5 A;  4CFC A;  1U2V A;  2FF3 B;  3ISN C;  3LZJ A;  1HPZ A;  3RMC A;  2Z1H A;  4FJJ A;  3BF3 A;  1TK5 A;  4FJ7 A;  2O8B A;  2O8C A;  3L8B A;  3E1Y A;  3EL2 A;  1U4B A;  1NOZ A;  5J1E A;  1YI2 N;  1SKR A;  2KZZ A;  2A6A A;  5BN8 A;  3FGU A;  4FW2 A;  4BC4 A;  3OJS A;  5GAD P;  3LAN A;  3VA3 A;  1S1U A;  3WXJ A;  4TSX A;  1EET A;  1VSF A;  3VGK A;  3MMV A;  4NXM K;  1RIL A;  4E89 A;  3ZSY A;  2Y1I A;  3SUQ A;  5FRM A;  4K8Z A;  3HO1 A;  1QVF M;  3CJ9 A;  3SQ0 A;  2FSN A;  2FF6 A;  2HVH A;  5K14 A;  3DMJ A;  3FLC O;  1HKB A;  3VPZ A;  3OYN A;  2NRX A;  4J2E A;  1JCE A;  3CM5 A;  3I56 N;  1QQN A;  2GWK A;  3OYM A;  2KLA A;  4FOI A;  2ASP A;  4H4M A;  1IO2 A;  5JMV A;  1Q81 O;  2O8E A;  3BGR A;  3KKS A;  4GNI A;  3VA0 A;  4OPH A;  1UA0 A;  2RE2 A;  4CGF A;  2YNI A;  1HMV A;  3RMD A;  2YNF A;  1IKW A;  3K57 A;  4CEC A;  2E2N A;  2HBL A;  3CIP A;  1K6Y A;  1SQK A;  2P9I A;  3KHY A;  1NOY A;  3CHW A;  2F9W A;  4FO0 A;  3ULD A;  3VQD A;  1UOC A;  3NGY A;  2DTU A;  3GOI A;  1JCF A;  3LDL A;  4XH5 A;  2E2O A;  5BRF A;  5EY4 A;  1BI4 A;  4WQ5 C;  4GV9 A;  1TL1 A;  4OKK A;  3VF6 A;  1NGH A;  2QXF A;  4H5R A;  5CYQ A;  2IOC A;  2QEX N;  3K5L A;  2D0P A;  3CXC M;  4YHH K;  1JLQ A;  4PKG A;  5LMN K;  4KH5 A;  4CJS A;  5MLC Q;  3ZEU A;  1ASW A;  2HHH K;  4B8A B;  5M1F A;  3KK1 A;  3H6E A;  2OA8 A;  4LFC K;  2F8S A;  3VQ8 A;  2KHO A;  1QQC A;  4LY7 A;  1VSJ A;  4B3O A;  3VES A;  2P9L B;  3W0L A;  3I0S A;  4B8C A;  2GEL A;  4K0K K;  1DTQ A;  3FZM A;  1WOQ A;  1ATS A;  4EP4 A;  1JLE A;  4W5Q A;  4O44 A;  2WTU A;  1KD1 O;  3DAW A;  4DSI A;  4FPA A;  4WYB A;  4AHU A;  2D1K A; 
#chains in the Genus database with same CATH homology
 4YOT A;  1IG8 A;  3VEO A;  2P9K A;  4BVP A;  2NZT A;  4R79 A;  4QS7 A;  4XH4 A;  4BC5 A;  1J6Z A;  4BRC A;  4LC9 B;  4BGA A;  4DQ8 A;  2ZGY A;  4FWR A;  3IFR A;  1VQ5 N;  4UY8 O;  5LJW A;  1YAG A;  2V7Z A;  3SAF A;  5DM6 L;  1VQ4 N;  3HI0 A;  3D2F A;  2VGN A;  3TU5 A;  4JD2 B;  2CH5 A;  3T7Z A;  1GLE G;  4BRO A;  3A0I X;  2E88 A;  2HBM A;  3O08 A;  4FOE A;  5C10 A;  2CGK A;  3LDO A;  3EKU A;  2P9L A;  5ELZ A;  1OVY A;  1X9J A;  3CPE A;  4BRA A;  5FPE A;  3U9Z A;  2OTL N;  1S3X A;  2GUP A;  2ZJR L;  2E2P A;  5AQN A;  4YOY A;  3R8E A;  4K25 A;  3A8Y A;  4CZI A;  2NRH A;  1BUP A;  3HBT A;  3AGK A;  1KC8 O;  3VOV A;  5GIN A;  1RFQ A;  4GV3 A;  4BRF A;  3H3O B;  4BRK A;  4GVE A;  3L6Q A;  3O1B A;  4CZK A;  3H45 C;  2P9S B;  2V51 B;  1ESV A;  4JEP A;  2BH1 A;  5I9E B;  4JKG B;  5AFU H;  4PHT X;  3MCP A;  2YCH A;  4BRL A;  3J8A A;  3LDP A;  3CJ1 A;  1JJ2 M;  3EE9 A;  5AQZ A;  3OW2 M;  4JD2 A;  3MN9 A;  3MWT A;  3P38 A;  4CZE A;  1BWF O;  5JVG L;  3C6H A;  5GIO A;  1WUA A;  3O9Q A;  5AR0 A;  3MX2 A;  3D6R A;  4H0T B;  3MCA B;  5JLH A;  1YHQ N;  2GEM A;  3GE1 A;  1O13 A;  4H0P A;  1RDW X;  5AQJ A;  5AQV A;  4CZG A;  2D0O A;  1ATR A;  4DCH A;  4BR9 A;  3M3Z A;  1ZC6 A;  1SZ2 A;  2IIR A;  3NMU A;  4BG9 A;  3HTV A;  3SAH A;  3R9P A;  3CCR N;  5JIC A;  4FSV A;  4BRM A;  2NNW A;  5C12 A;  3U4L A;  1YVN A;  3O9R A;  4NB4 A;  4IFE A;  3SMP A;  3R3L A;  4JKG A;  2CGJ A;  2ASO A;  4ISG A;  5AQK A;  2Q31 A;  4IOA L;  3IDH A;  4JNE A;  5C15 A;  1EO1 A;  3DXK B;  3T69 A;  3SBT A;  2J4R A;  1BO5 O;  3GG4 A;  3TSU A;  5TKY A;  1NGC A;  4CZH A;  1MDU B;  5KQD A;  3CJB A;  3ZX2 A;  3I33 A;  3CCV N;  3L4I A;  3F5T A;  4A2A A;  4FWL A;  3AY9 A;  2D4W A;  3QML A;  2AA4 A;  2HF4 A;  1RDU A;  3MN6 A;  3O4W A;  2W40 A;  3H1Q A;  3M5R A;  1Z6R A;  1QQO A;  2QWM A;  2F9T A;  5AQM A;  4NLC A;  4BQL A;  1P90 A;  5F0X A;  1P8Z A;  1NMD A;  1S22 A;  2QWL A;  4IWV A;  4PKH A;  5AQO A;  4MLH A;  1BG3 A;  3EN9 A;  4B1U B;  1YIJ N;  3ID6 A;  1NBW A;  3C6A A;  2QWP A;  4H5W A;  4ISE A;  3OA9 A;  3CCU N;  5TKW A;  1GLB G;  3RSE B;  2HOE A;  3H3N O;  1NGG A;  4Y0W A;  1NJI O;  3SBG A;  3SK3 A;  5EOY A;  2YHW A;  1E4F T;  3L4Q A;  4JKH A;  4XH1 A;  5M1P A;  3SMS A;  4B1Y B;  4BR4 A;  4PL8 A;  4CD3 A;  3CET A;  2A3Z A;  3P31 A;  4BGB A;  4BR2 A;  4ISF A;  3DXK A;  4EHT A;  2QW9 A;  5AQL A;  2FSJ A;  4M7Y A;  3BEX A;  3QDK A;  3QFU A;  4H0V B;  5BRD A;  1Y64 A;  3WQT A;  4YOX A;  5LJV A;  1VQ7 N;  1T44 A;  4GY2 B;  1K9M O;  3BP8 A;  4I6M B;  5HOO A;  1S72 N;  4MDA A;  4L3Q A;  1BDG A;  3HOS A;  5F2R A;  4IOX A;  3OBW A;  4CD1 A;  1KXP A;  3O1W A;  3SJH A;  2BTF A;  4FWQ A;  2HST A;  4YOV A;  1HKC A;  2A40 A;  1NGE A;  1TUU A;  2A41 A;  2E20 A;  2WFB A;  4A57 A;  4B1W B;  1BOT O;  3G25 A;  1T6D A;  2OAN A;  4H5V A;  3UKR B;  3ENB A;  2Q97 A;  3G6E N;  3RSE A;  3CF5 L;  3ENH A;  3CCQ N;  4ILJ A;  4JKF A;  3D2E B;  3ID8 A;  4QS8 A;  1VQO N;  2NLX A;  3H46 O;  4RTF D;  2VYP A;  2V52 B;  3QFP A;  2QWR A;  1G99 A;  3ZX3 A;  3KWG A;  3IMX A;  1GLA G;  3I55 N;  3O9S A;  4IZ9 A;  4WFB L;  5ADX A;  4C23 A;  4CI6 A;  3LDN A;  4CZM A;  1YF5 L;  2RHK A;  4I6M A;  5GAH P;  1NGI A;  5BPN A;  4DHY A;  1TUY A;  5CE3 A;  3CJ7 A;  4A2B A;  4WFN L;  2I7P A;  5KPZ A;  4FWP A;  4JK8 A;  5KPT A;  3CME N;  3Q7C A;  2NRR A;  3QBX A;  2GX9 A;  4WQ4 A;  4FL9 A;  5BPM A;  3R6M A;  1Q18 A;  4CBU A;  1U6Z A;  3DXM B;  4BC2 A;  4EAH D;  2ZJP L;  3UKR A;  4JK9 A;  5HL7 L;  4PKI A;  1KQS M;  4GV6 A;  1VAZ A;  3VF4 A;  2ZGZ A;  4FWM A;  1C0G A;  2IVP A;  3D2E A;  3A5N C;  3CER A;  5AQH A;  3HOT A;  2GWJ A;  3E66 A;  1K73 O;  1XUP O;  4B1Z A;  3WEE B;  3AAQ A;  3DLL L;  5AQQ A;  1V4S A;  2WBN A;  5EX5 A;  5AQU A;  1NGD A;  4MLE A;  3CC4 N;  3VTI A;  1GLC G;  3VEY A;  4B1X B;  1CZA N;  1H1V A;  3ENO A;  3A5M C;  1OKJ A;  2QI2 A;  2WC9 A;  3EE8 A;  3B8A X;  4MDB A;  4MO5 A;  5CHI A;  3FZH A;  4ILH A;  3VEW A;  2HF3 A;  1SAZ A;  5M1Q A;  3MN7 A;  4AM7 A;  4IO8 A;  3C7N B;  4IXC A;  2IVO A;  3FZL A;  3CCS N;  2GTD A;  4JKB A;  1DEJ A;  1IJJ A;  3DXM A;  5AQT A;  5BRH A;  1NWK A;  3ZET B;  4JN4 A;  1YJN N;  3QB0 A;  1ZBS A;  4H03 B;  4JKC A;  5AZJ B;  3ULE B;  3VGM A;  4FWO A;  3WXL A;  4A5B A;  3VEN A;  2HBJ A;  3NVK A;  1T3V A;  4WCE L;  5BRE A;  3FR0 A;  1NM1 A;  3LDQ A;  4BVO A;  5EXW A;  3WEE A;  2NRW A;  3WT0 A;  1VQ8 N;  1ZXO A;  3CMA N;  3MWP A;  3PIP L;  3QIC A;  2EWS A;  4A62 A;  3KK7 A;  4IO9 L;  1HKG A;  4HTL A;  2VGM A;  4IJN A;  3VET A;  4AM6 A;  3MDQ A;  5B8H A;  5F1X A;  1VQK N;  4O8U A;  3KWI A;  3O5B A;  3A5O C;  4H0X B;  3TSQ A;  4BRI A;  2A42 A;  3VEZ A;  1NGF A;  4FWS A;  3RVC A;  3CCL N;  1SS6 A;  3C7N A;  3CC2 N;  4C1N I;  1VQP N;  4DKW A;  3EKS A;  5ADX H;  1T6C A;  2NRT A;  3F9M A;  4H5N A;  5AQY A;  3U9D A;  3VEV A;  3WXK A;  3SLC A;  3O9T A;  1R59 O;  1ILY A;  3LM2 A;  3ZET A;  4A5A A;  4BC3 A;  3IKM A;  4JK7 A;  4NO7 A;  3LL3 A;  3ULE A;  4AF1 A;  5CR4 A;  5AZJ A;  4RWT A;  1W2B M;  2CH6 A;  4OPA A;  1HX1 A;  3P39 A;  4QS9 A;  5M1K A;  1QQM A;  2Q36 A;  2ZWH A;  5FPM A;  3MK6 A;  3LM9 A;  4U67 L;  3UE5 A;  3ZX0 A;  3NVM A;  1W97 L;  2A5X A;  4KH6 A;  3A5L C;  3W3D A;  4BRD A;  3KVG A;  5BR9 A;  3S41 A;  3JXU A;  5FPD A;  5C0Y A;  4EFH A;  3TSP A;  2P9P B;  2YHY A;  3ZYY X;  5JLF A;  3PIO L;  3DWL A;  4K43 A;  4O5F A;  4WQ4 C;  3CC7 N;  1YIT N;  5DM7 L;  3C65 A;  4M63 C;  4WF9 L;  3U8X A;  4KH4 A;  3VMF B;  2NRV A;  2YJE A;  4YDU A;  4CJ7 A;  4IDH A;  2FSK A;  1JCG A;  2JWL A;  1GLJ O;  4DB3 A;  2QA4 N;  3H1V X;  5AQG A;  4BQZ A;  2P9N B;  1Z05 A;  1K8K B;  1X3N A;  4RCH A;  1MWK A;  2ZJQ L;  4FVU A;  5AQR A;  2QWQ A;  4BRP A;  1K8A O;  3D7E O;  1VQ9 N;  2HMP A;  3P4I A;  3OHR A;  1E4G T;  3BUZ B;  2KKZ A;  2Q0R A;  1V4T A;  3E9P A;  2F7T A;  4JHD B;  5AZI B;  3TTF A;  3HRG A;  4EHU A;  2W41 A;  3WUH A;  5C2F A;  4XEI A;  1C0F A;  4JKD A;  4M7X A;  4KBO A;  1U2V B;  5M1N A;  3E9O A;  1DGK N;  3EZW A;  3VER A;  1HPM A;  2E1Z A;  5H1S Q;  1QVG M;  2P9P A;  2VCP A;  2AP1 A;  3WQU A;  1KAZ A;  4FPB A;  3E9L A;  3MN5 A;  4BRN A;  1YJW N;  2I7N A;  1HJO A;  3N4Q A;  1NGA A;  4U7B A;  3WXI A;  2UYT A;  4IJA A;  2PAV A;  3EO3 A;  4FWK A;  3CD6 N;  4JKA A;  5E26 A;  3K9J A;  4PL7 A;  1EQY A;  2YX6 A;  3C0B A;  3ATV A;  1Q82 O;  4BRQ A;  1NLV A;  4IEE A;  2P9N A;  1NGB A;  2ZF5 O;  1K8K A;  5AQS A;  4G9Z A;  4A59 A;  2PBD A;  3OBY A;  2DPN A;  4K41 A;  5AQX A;  4WQ5 A;  1HLU A;  2PFU A;  3FE1 A;  1VQM N;  4JAX A;  1MA9 B;  4H0O A;  1N8R O;  3FZK A;  1VQL N;  2VWB A;  1QZ6 A;  4JKE A;  4JHD A;  5AZI A;  3M6G A;  4CZL A;  2QTD A;  4B1V A;  2YJF A;  2CGL A;  3UB5 A;  3UKU B;  1U2V A;  2FF3 B;  2BUP A;  1XC3 A;  4C1N K;  5GIP A;  5BPL A;  1HUX A;  4K42 A;  5AQI A;  2FXU A;  4BY9 C;  3BF3 A;  4EIA A;  1NGJ A;  1LCU A;  3TTC A;  1LOT B;  1BA1 A;  2V7Y A;  3VF2 A;  4CBW A;  4MO4 A;  5JVH L;  2ITM A;  4BR5 A;  5KQ8 A;  4NLB A;  4WFA L;  2E2Q A;  3ATU A;  3E1Y A;  3EL2 A;  4H5T A;  3WXM B;  4BR0 A;  4O8K A;  1YI2 N;  4E1J A;  2Q2R A;  3O8M A;  4F9O A;  2A6A A;  5BN8 A;  3FGU A;  2WUS A;  3GBT A;  5FPN A;  3VTH A;  4BC4 A;  5EVZ A;  3Q7B A;  3AGR A;  5GAD P;  1VQ6 N;  3GDQ A;  1YUW A;  3VEX A;  3WXJ A;  3AAP A;  3CJC A;  2E1Y A;  3SAG A;  3VGK A;  3MMV A;  4OO1 J;  3CJA A;  3UKU A;  4BRH A;  1YJ9 N;  2P9I B;  1QVF M;  2QXL A;  3CJ9 A;  2OTJ N;  2FSN A;  2FF6 A;  1QZ5 A;  1QHA A;  4YDU C;  2HBK A;  3FLC O;  3KZB A;  3IUC A;  1GLF O;  3JS6 A;  3CCM N;  1HKB A;  1X3M A;  3CI5 A;  5GAE P;  1M90 O;  3VPZ A;  2NRX A;  3G71 N;  5GAG P;  4IEI A;  1JCE A;  3I56 N;  1QQN A;  5E84 A;  2GWK A;  2JWK A;  2KLA A;  4FOI A;  3GL1 A;  4FWN A;  2ASP A;  5AQW A;  2QWO A;  4YOU A;  1DT9 A;  2IVN A;  3CQX A;  4Z94 A;  4CBX A;  5JMV A;  5LY3 A;  3J7Z O;  1ATN A;  3VGL A;  2P9S A;  3QBW A;  1Q81 O;  3M1F A;  3CQY A;  4GNI A;  3BF1 A;  2Q1N A;  3I8B A;  1KAX A;  4OPH A;  5AQP A;  2RE2 A;  2QWN A;  1GLD G;  2P9U B;  4J8F A;  2E2N A;  2HBL A;  3CIP A;  1Q7Y O;  1SQK A;  2P9I A;  3KHY A;  1GLL O;  3CHW A;  2F9W A;  4FO0 A;  5M1O A;  3O80 A;  3ZEU B;  1Q86 O;  3AAR A;  5KPR A;  4BG8 A;  3O9U A;  3R1X A;  4BR7 A;  2YI1 A;  3CPW M;  4YOW A;  2Q0U A;  1KAY A;  3GOI A;  1JCF A;  4H0Y B;  2E8A A;  3LDL A;  3F2K A;  4CZJ A;  4XH5 A;  2E2O A;  5BRF A;  5EY4 A;  3CCJ N;  1TYQ B;  4WQ5 C;  2QM1 A;  4GV9 A;  3VF6 A;  5AFU A;  1RGI A;  1NGH A;  3DJC A;  2NRZ A;  4H5R A;  3TTD A;  4BRG A;  1DKG D;  2FLO A;  2QEX N;  2D0P A;  3FZF A;  3HM8 A;  3K9K A;  2P9K B;  2YHX A;  3FFK B;  3HSC A;  2P9U A;  3CXC M;  2ASM A;  4PKG A;  1BU6 O;  4KH5 A;  3TPQ A;  5MLC Q;  3MX5 A;  3ZEU A;  1VQN N;  3O6W A;  3G4S N;  3D2F B;  3L0Q A;  4IOC L;  4ILG B;  5M1F A;  3H6E A;  1D4X A;  1YXQ A;  2H3G X;  4CZF A;  2KHO A;  3PLA A;  3VES A;  2P9L B;  5BN9 A;  3N4P A;  4B9Q A;  1M1K O;  1TYQ A;  3W0L A;  1XQS C;  1MWM A;  3HZ6 A;  5AQF A;  2GEL A;  4BRE A;  1BA0 A;  4HWI A;  3CCE N;  3FZM A;  1WOQ A;  1ATS A;  4A61 A;  4YOR A;  1KD1 O;  3DAW A;  4FPA A;  4WYB A;  5C2D A;  2D1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...