4GVBB

Crystal structure of the virally encoded antifungal protein, kp6, heterodimer
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
74
Chain Sequence
b'PRPVMCQCVDTTNGGVRLDAVTRAACSIDGYYTEKDGFCRAKYSWDLFTSGQFYQACLRYSHAGTNCQPDPQYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KP6 killer toxin subunit alpha
publication title The Atomic Structure of the Virally Encoded Antifungal Protein, KP6.
pubmed doi rcsb
molecule tags Toxin
total genus 16
structure length 74
sequence length 78
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.440 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Killer toxin KP6 alpha-subunit 4gvbB00
4GVBB 1KP6A 4GVBA
chains in the Genus database with same CATH superfamily
2E5GA 3GQCA 1GX6A 3UN5A 3W2WA 1WTBA 2JFKA 4NE9C 2F3JA 1WC1A 7FDRA 4OMFG 3CO0P 3QBCA 4IH7A 3M8WA 2CWKA 1K73T 5DGBA 1GH8A 3MOZA 1IUJA 1EP4A 4KB7A 5ITHA 1M5OC 6FDRA 3MAAB 2DXDA 3N6MA 4CT9A 1N34F 2JVRA 4BC7A 2C28A 3ZNUA 4R5PB 4ZVUB 5GAHI 4HKQA 4H4OB 4OI0A 2AD9A 2M0GB 2YNFB 3JSBA 2FTRA 4AE5A 4Y00A 2CJ9A 2G0CA 4HL9A 1U09A 4H4MB 1FEEA 1S57A 3KUGA 4KTQA 2LLZA 1RT5B 3ISNC 2UVUA 1R6VA 1VR6A 1VQLS 4CH1A 1SI9A 4NA3A 2D9PA 1RCXB 4RW9B 5LSRA 5ETSA 4Q8FA 4RNNA 3N5BA 1NH7A 4WFNQ 3PYEA 2JVOA 2FLNA 1QUPA 2K1RA 2HG4A 2PD1A 5L9XA 4PWDA 1WUUA 2IM2A 3IRWP 1UZHA 4TKTA 3GP9A 1DHMA 3IAM9 4Y3CA 3QGGA 1WSRA 1G6BA 2HNDA 4FN5A 1T05B 2AKWB 2IHR1 3OJUA 3MM9A 1RHKB 3D1HA 4FS2A 5LMUF 3O2IA 4B9MA 3EXCX 3A3PB 2L9NA 4DFKA 3KLEA 3GFZA 4L72B 1WEXA 3I0SA 1WG5A 2YWGA 4MKBA 5I3PA 4QCLA 2C2NA 2V4JA 4GRSA 1ULRA 4USMA 2Z57B 5ETKA 5EWEA 2DCLA 4IOAQ 3GPAA 3LGMA 4HDGA 4RL1A 1WOSA 5GAEI 1L3UA 2EG2A 2OH2A 2V9WA 1Y4ZB 5LT5A 3DYAA 1SL0A 1NSQA 3DU5A 1IM4A 4YB6A 3HT3A 2IA6A 1NJXA 3GCXP 3QLHA 4NLGA 4IRCA 2R7XA 3RAQA 4B3MF 4NCGA 1RWOB 5BJRA 5DG8A 3NNAA 3MTJA 4Y2MA 5G4DA 3DDIA 3TNVA 2DTJA 1NUEA 3HFVA 2XI2A 2B8PA 3OSNA 4EZ9A 1XNRF 2DNOA 1ZA1B 5C42B 3UN2A 3C66A 1PYSB 3MMCB 1Q0NA 4W92B 3T5KA 4B3RJ 1EZZB 3KNAA 2PEBA 4WTOB 1U1MA 2KZZA 2PA8D 1FO1A 4DQSA 5A6PA 1FWKA 5JUMA 3IG1A 4X4PA 2BXJA 2F1FA 2AV5A 5D3GB 5KFUA 4AUKA 3BO2A 1XIQA 2DYAA 1TV6B 1REGX 3LP0B 4ZPAA 3EXYA 3P5TL 5DS7A 2PC6A 3KLVA 3CDWA 3GR1A 3BBFA 3EJMA 4CH7A 3CCLS 1QUVA 3VF0B 4C48A 5IT9Y 1ZOTA 2YQ0A 4ZA1A 3H4BA 3BDEA 1F60B 5F8LA 3G82A 3ZTSA 1SL1A 5KFIA 2E66A 1QY7A 4RBUA 3HZEA 4IQXA 1WG4A 2HS3A 2JJ4D 3TAMA 5KT3A 4LRDA 1RT4A 3M8RA 4LF7J 2V8HA 2IA0A 3UNYA 2IM0A 1F5CA 3IWNC 4WK1A 4I56A 1R8AA 3K0JA 4P72A 3ET6A 5K14A 3KTQA 4LIWA 4WF9Q 2N3OA 1Y00A 3H20A 3HDSA 1MMLA 1TKXA 4O23A 5AXMA 2W24A 5J1NA 4HTJA 1MWZA 1QE1B 1XNQJ 1Z4UA 2BA9A 3C8YA 1CJTB 2E44A 2W1BA 1N33J 5G0RB 4KT0C 4BHQA 1KC8T 4I7FB 3VVTA 3N79A 4MIAA 3CO9A 4QIGA 5KFLA 1EARA 4ZVFA 1VRQC 5JJBA 1RQ0A 4QIVA 1RTJA 1KQGB 3JQKA 4CLLA 3T19A 1RBOB 2H9ZA 2XHCA 2IRUA 3PCOB 1SIWB 4DR2J 1NPRA 2DY1A 1X5OA 2VKZG 1JLQB 1T9YA 1SJ4P 2L48A 5HQLA 3I31A 4RW4A 1JLAA 3NY0A 1URNA 1TAUA 1QAIA 3E8OA 3A3NB 3IC1A 4OZ0A 2XULA 4O0IA 2R2SA 3G71S 4MYUA 4NPOA 1UVIA 1FD2A 5KFFA 2R7TA 1GXTA 4H54A 4X4OA 4UOHA 3NNHA 2W2NP 3HT0A 4J9NA 4J37A 1FRMA 4DFMA 2BANB 3BR9A 2KG1A 1RLCL 2Y1RI 1DTTA 2H4YB 2F9DA 3MOJB 3TX0A 1TQLA 3BGRA 4PXDA 2XYHB 3PHEA 3R5JB 7FD1A 1WI6A 5F8IA 1UA1A 3THVA 3K5PA 2GQCA 3TEHB 1TP7A 1HARA 2ZITA 4RUHA 2UUBF 1AFIA 5KFDA 2HRUA 4OHYA 5GADI 2AMCB 4IR9A 2BE7D 5ETQA 3QGPA 4B3RF 1XK8A 4ZVPB 4WU2A 4J91A 3QRRA 1WNEA 4HI1A 5HLFB 3TRGA 3DOLB 4FYVB 2DD8S 2YWKA 1C0UA 1S6PA 2LCWA 3W9HA 4IFVB 3HJVA 3M6WA 1RCOB 4OJHA 5M2PA 1S97A 1SJ3P 3BJYA 5DRKA 1NH8A 4JP8A 2F63A 2HHHJ 4CO2A 2A18A 4DWIA 1YI2S 3BQ2A 3C3LA 3GIKA 1I6JA 5EX0A 3K8WA 3QT7A 3BGFA 1C4AA 2QG9B 4Q43A 2M8DB 4MT1A 3GONA 3IWLA 3MCMA 4B9NA 2GIRA 1Q1KA 1S10A 2Q79A 4IH6A 1N52B 2XEXA 5LMNF 1UWBA 2DR9A 3RRKA 2ZE2B 3EGWB 3NMAA 4ECTA 2KFZA 2A1BA 4KGKA 4DV7J 2SXLA 3KDNA 2VUGA 1U48A 2POKA 4J5OA 2J6SA 4LSLB 3CCTA 1FXLA 1T9WA 4DV5J 3KMSA 1IKWA 4KPYA 1RAHB 4DLGA 3P3DA 1H2VZ 1D9AA 3CCVS 1S7IA 3TZZA 4EMDA 1JLEA 4DF4A 4KV8B 3HFZB 1KQFB 3RB6A 2EI5A 2VFRA 3LP1A 3I5CA 3QIPA 4Q44A 4C8OA 3BEGB 3KK2A 2AZ1A 2YKOA 4OHZA 3DLGB 2CNOB 1X4BA 4DR2F 2CJKA 3R1HA 4WU3A 1RI7A 1WHWA 2HHUA 3UCZP 4EZ6A 2HLTA 2E1MC 3W60A 2MLZA 2HIYA 4K4TA 1C1CB 5FDLB 4ETZA 1IR2A 4C3MA 2VICA 3RRHA 1HNWF 3HD2A 2VPYB 3M30B 1EKSA 4X62J 3TZWA 3I32A 1X31C 3C15A 2UV8A 1URRA 4DPUA 1YJNS 1WWHA 1QDUB 4TYBA 4EEYA 1UTAA 2QA4G 2GW8A 2QIFA 2AX0A 1SVDA 1RJJA 2GVZA 4L6V3 3M1VB 3W63A 1RYSA 2WBRA 1LWCA 3FEYB 1PGZA 2RVJA 3HP6A 4ZHRB 2UUCJ 3TA0A 1JJCB 2EXUA 3Q2SC 2RH3A 2WW4A 2B43A 3PYGA 2CG4A 3FJ2A 1RYRA 1ELOA 4CNYA 1RU2A 3MWBA 1XMQJ 1KS2A 3CD7A 2WZ1A 1B0PA 4CRJA 1M90T 1VOMA 2C2RA 3UPFA 2XC9A 1K8AT 1O6XA 4IG3B 3POTB 3R1LA 4OX7A 3OR2A 2QLJB 4GVLA 4JI7J 3EGNA 4LBPA 1SBRA 3NAHA 4FF1A 4O4RA 4QYZJ 2OTLS 2BMBA 1C1BB 4YMEA 2DNKA 3TQEA 3HZGA 2MPUA 2FLPA 4I0WA 2QRRA 2DJWA 1HBMA 3D68A 1HWKA 4U9RA 4B9VA 2HPUA 2KVIA 1J5EJ 2KU7A 2Q1LA 5A8RA 4BWJA 3B4MA 3GLJA 4ZCMA 4PQUA 4FP9A 4RWWA 1FJGF 2EKNA 1NK0A 3VAJA 4K4VA 4KY3A 1FVQA 2B3TB 3O3LA 2XS5A 4LJMA 2HWIA 1WC3A 1HQEB 1U1RA 4M1KA 1S0NA 2QO3A 2NCKL 4LUBA 1YG0A 3A8IA 4UY85 4ED0A 2DGUA 4WFXA 3T5LA 2HMIA 4DPTA 5T7LB 4N8NA 2N82B 5F8NA 1EETB 3G87A 4NLOA 3MMBA 2DITA 1NBEB 3IA0A 3JAMY 3TYTA 3BB5A 5A8KB 1WEZA 1UJ5A 1TL1A 3MMAB 5IT9U 4A8MP 1H2UX 5CYJA 4YDXA 1TMJA 2QL5B 1GT8A 4WIIA 4YN3B 1J5OA 1C0TA 1SC3B 2CYYA 3G6XA 2BE9B 3MUMP 3DRRA 4KKOA 3BZQA 3G9CA 1GMWA 5J2MB 3B8HA 3CB4A 3JXOA 3KHRA 4PUOA 4C8ZA 3FBBA 3MPVA 1FDAA 2LFVA 2XYGB 5CYMA 1QSLA 4K7QA 3SQGB 3DLJA 3HHLD 1VK8A 4DS4A 3H59A 2QV6A 1BD6A 3R5BA 2ACYA 1GAOA 3SFUA 1TK0A 2H5JB 4NLQA 1EHWA 3T5HA 4U7UD 3FC9A 2UP1A 3OW2R 5GMDA 2RRAA 4DR7J 3G6VA 4ECZA 1JQGA 1BWVA 3OFEA 1SB6A 2HGMA 1KRPA 1HPZB 2W7OA 1NB7A 5IZHA 3MAAA 1RAGB 1B64A 3N6LA 1UP1A 2O5DA 2N3LA 4XK8C 3FQKA 3RBDA 4YQWA 4ES1A 5IV4A 4F26A 1N5TA 2F9JA 3D6HB 1UETA 2QMUB 5HMWA 3HSDA 4R5PA 3IP0A 2Y8WA 3DXSX 5K8NA 4H4OA 2F7VA 2ZBCA 3VR1A 4AL5A 1ZYQA 2YNFA 5KFBA 2Z56B 5DQGA 4USVA 3NCPA 4O3QA 4ZP8A 2CPDA 4H4MA 3RYLA 4LF6J 4LFAJ 4KGVB 1XTZA 4DQQA 2HHXA 1M5PC 3MPYA 1DTQB 3CC7S 2RKIB 2HQFA 3AOAA 4USIA 5BXIA 2B9WA 1L3SA 3CMQA 4RW9A 4OX8A 3BGUA 2I38A 1CS4B 4JI2J 3MFIA 3ENVA 1TR0A 2PMHA 3NGUA 1B99A 1F5AA 1X7VA 2KXNB 3MZIA 1X9SA 3M2RB 2VOPA 4P74A 5IM0B 5AXLA 4DQIA 4A8SA 5D0EA 4IOCQ 4J9PA 4CZCA 3TEGA 2V2KA 4Q0BB 4N5SA 5DQHA 1S6UA 3BV8A 4HLBA 1KFSA 4AYBD 1T05A 2CQGA 2NLWA 2RRBA 3W9JA 5KFXA 2IAJB 3X3UA 4KFBB 2VG6B 2IMWP 2HHWA 1DY3A 2RJZA 3U02A 1OQ6A 2HFSA 4I2QB 2PDAA 3W64A 1UVLA 3MPDA 2R4FA 4C8NA 3OFHA 2K2PA 1GXUA 2DRBA 2JHEA 4YY3J 1JIHA 1S99A 3TANA 2XZWA 5D6GA 1P8GA 4FXDA 5E3CA 1X4HA 4Y28C 4ANCA 4FYXB 1RDRA 1UFKA 3M2UB 1PO6A 3AY0A 2DNRA 4F0HA 4LFCF 2MQ8A 1C2PA 2COLA 1U4BA 1LW0B 2DGOA 3RZAA 1VISA 3K57A 4V19J 2HHVA 4K2JA 5CXTA 2MKJA 4X4QA 4F36A 3DLKB 1PKUA 2Y0SD 4LSZB 3RR8A 5BYSA 3NCRA 3EE3A 5C42A 1RAFB 1SC6A 1NK5A 4UUWA 1D8ZA 3BQ0A 1U24A 2JX2A 2JEIA 1CJKB 3S01A 3X1LB 4ENOA 1N0VC 4B3SF 3PJWA 2A6OA 4B3TF 4ELUA 2ZBQA 3R6GB 1U8WA 1UL3A 2W7PA 2PI4A 1N36J 3AJDA 1MNEA 2N4DA 5D3GA 3LF0A 5D4LA 1HNIB 2AP6A 1LK5A 3R6LB 1TV6A 3VQSA 3R2CJ 1KKHA 2E5LJ 1DFDA 4NEYA 3LP0A 4DR7F 4WYWA 3IGVA 3CCZA 5GAGI 4I69A 3A3OB 2JC0A 3HHLC 4X4VA 2G1DA 4JB8B 2AU0A 1FRXA 5A2QY 5M2RA 2Z2MA 1IBCB 3P45B 1NXIA 3GFHA 1VC0A 4DJBA 2RMLA 2RS8A 1YJUA 3QQCD 1KOOA 1RHJB 4DSJA 3G86A 4OQJA 3ZZRA 5LL6d 2OJ3A 2ZKTA 2HVDA 4CH0S 2HK3A 3GV7B 2ZBPA 5CYQB 2Q6CA 4NOHA 2LMIA 5CHCB 4OZJA 4ED6A 1U1KA 3EUNA 1YITS 3LAMA 1RZMA 4ZKAA 4AFFA 1QE1A 5CZXA 1CJTA 2B51A 2XNRA 5G0RA 1UEUA 2ZHOA 4I7FA 3O1LA 2KH9A 1FCAA 2AZ3A 3IN5A 3J7Z5 2BQRA 2EBGA 3DN9A 4JI2F 1WC4A 4J9OA 2CVIA 3JSMB 2FC8A 1S9EB 1X5PA 3VAFA 2DGWA 5L39A 2AYMA 3IGNA 2GGPB 2CZ9A 1JLQA 5C2CA 1RACB 1FHTA 3BDPA 1P9YA 5DDQC 2FY8A 3T1YF 1KSPA 1S0MA 5C7PA 2QL7B 2RDIA 4Y2KA 1UA0A 4OI1A 4PQAA 3OL6A 1NJIT 4J9VA 1VI7A 3GMGA 1B0VA 4A46A 3D9BA 3OXFA 3NL0A 4ZPWR 4CP5A 2OLWA 4MIBA 2G2OA 1HNXJ 3Q86A 1OY8A 2RAQA 4F4AA 1TTHB 3KDOA 3I6PA 3D7SB 1DLOB 3E2EA 3LWMA 2BANA 4W98A 2R8GA 5HMXA 4DL6A 1Y11A 2DNLA 1RAAB 3JSYA 5J2NB 1LK7A 1OMSA 6AT1B 4ZVTB 3T6BA 5AT1B 4OZLA 5D4NA 4EYHB 3KKFA 2W01A 4E8UA 4HYKA 3V81B 1ZBTA 4DV2J 2V4QA 1NJZA 2MZ1A 1YIJS 2LP4A 1G3OA 4HHJA 4EFAC 2VA3A 2EFNA 1HWUA 1BUXA 1NKEA 4KAIA 4F2SA 4OZ3A 1Z1ZA 3UW1A 4ZVOB 2JZ5A 1XMOF 1YRXA 3DLBA 1W7WA 3QJJA 2NPIA 4DCOB 2YY3A 3I55S 1RWXB 5B0CA 4QWCA 3FCHA 4OV6A 2XLJA 5E0OA 3QT6A 3HX9A 1YLXA 4Q8EA 2LDIA 3QSIA 1EJ7L 1RSCA 1IXKA 2RQMA 4PXBA 4O3OA 4ZPCA 1GFWB 1D9FA 4JI3J 5HLFA 1FEHA 4DBQA 5T14A 3DOLA 3QAEA 2FJXA 4EO6A 4UW2A 3VGUA 4IFVA 1FFSB 4F8RA 2MXYA 4P6QA 1VQ7S 1Q86T 3E01B 3H2LA 4ED7A 4UOFA 3HHLB 1B0TA 1IQTA 1FERA 2DHXA 2ATCB 2R8KA 3ZTQA 4WZQA 2DR7A 1HBOB 2C3MA 1FKAF 1IR1A 4JV0A 2BBEA 3V6KA 4TLRA 3M8QB 3V5RA 2DK2A 2ILYA 4NMLA 5B0DA 4ZIWA 4N76A 4X65J 1Q7YT 2KVQE 2DNNA 3SCLE 1YJTA 5EGYA 1ITPA 3DRXA 4F3QA 4M5HA 2X1AA 2EKYA 2ZE2A 4JI5J 5KG5A 2I0XA 2DEIA 4FDFA 2MGZB 2LEBA 3D4JA 3EZ5A 3GWCA 1KHWA 1YK9A 3C16B 4HVZA 3CXCR 5J2PB 2XGQA 2V8PA 2VDHA 2IVYA 2L41A 4LSLA 2C2EA 4HACB 2W2PP 2IPOB 2CVEA 4U8VA 3G4SS 1V9OA 4CYUB 1U7LA 2EWHA 1F9HA 2FZKB 1OQ3A 4KV8A 4ECQA 4XTTA 1SIZA 5ETOA 3KMQA 4DDFA 3TJ8A 3H5XA 2MZJA 4DXLA 4P2XA 4ILLA 2EFGA 1XR6A 3DLGA 2AJ2A 3B4DA 1FI4A 5HMYA 3FVYA 1OS5A 3MEDB 1WTFA 1N0UA 2OUGA 2LQ8A 4JI8J 3F73A 5EX3A 1CG2A 4C0BA 1WELA 4BS2A 1C1CA 5FDLA 4FF3A 5AXNA 1S1VB 2CQ1A 1JLCB 4P71A 1QTNB 3M30A 2G2ZA 1XJWB 3TUZC 3IRXB 3TVKA 2WSFC 5D8HB 3L7UA 5DDPC 4HH0A 1HNXF 2H51B 3BGOP 1RT2B 1VRTB 3M1VA 1E6YA 4ZVSB 2YNGA 5L46A 1JLGB 5GVQA 4N56A 2MSTA 3BYRA 4RNOA 2V63A 4ZHRA 2LYVA 4X64J 1RT3B 2KRBA 4Y65A 4LRAA 5J1EB 2R8JA 2V9KA 1EB0A 2ZJQQ 4UOCA 3EYZA 4KO0B 4HEA9 3MDFA 2Z2YB 2M3DA 2E29A 2LEPA 3H5SA 2QLWA 2VD3A 3CC2S 4ZLNA 2ZOGA 2RQ4A 4IG3A 2OELA 3JS9A 5L1IA 5GMEA 3CULA 4K59A 1WOOA 1OYEA 1C1BA 1XMBA 4FF4A 1HI8A 3CVKA 4K4SA 4C11B 2CJBA 2XG8A 4NLPA 4IO9Q 4ED1A 5AXKA 5L1JA 3BSNA 1FVSA 4O3PA 3HMJG 1KBRA 2IC3B 2V8DA 2AJQA 1Y5LB 4WYLA 5E3AA 1T0TV 4W90B 2KT2A 1DRZA 5AE3A 4PR6A 2PMZD 4F7VA 3OXGA 3PRDA 2AYBA 1WF2A 2IDLA 3QT5A 1DJ0A 3KYLA 2XGPA 1WC0A 4ZJOA 3N28A 4DG1A 1BQXA 1HQEA 5B08A 3MEKA 1FK9B 3ENWA 2IYIA 3NWRA 5KFMA 4F2RA 5T7LA 3N4WA 3WC0A 2RNEA 4DSFA 1EETA 1Y3KA 4PRFA 3BKTA 5KFYA 5DLFA 3FRZA 2I6WA 4M5LA 2ASJA 2HKEA 5A8KA 4F0MA 2WSEC 3PZPA 5A2QU 3MMAA 1TUVA 3D6FB 1Q53A 4U96A 2DISA 3OPKA 3AAWB 4URGA 2HVEA 2J5AA 1VHFA 1CLFA 3GG1A 4DV4J 3SV3A 1SKWA 4JI6F 5CA5A 1DZ5A 4N41A 1P27B 4G1IA 1VC5A 5J2MA 1AYEA 3RGIA 5I42B 2ASLA 1ZM4A 3CJTA 2PFFB 3GV8B 5E2QA 1TKDA 4Q5VA 1FNXH 1G7CB 3SQGA 3AXKA 3TUPA 5KFAA 4DPXA 2OP5A 2CNKB 3VAMA 4NA1A 4DR1J 2ZH7A 2I9SA 2K7KA 3T1HF 2GHPA 2GJFA 1IBKJ 3SFGA 2OMLA 1PAEX 3DGPB 5E3QA 2B9YA 5KFVA 3CD5A 1K1QA 1GTEA 1N6QB 4ZMMA 1HPZA 5JMNA 4JV2A 3IS9B 2MQQA 4JI1F 3ZZPA 1JJ4A 3C6TB 5D15A 3D6TB 2CJQA 1JXEA 4KGXB 5KFZA 1WC5A 4X4RA 4ZP7A 1XN9A 3M05A 2YH0A 3V4IB 2FIUA 1RTZA 2XLKA 3PW4A 4ER8A 1IWAA 2B4OA 4F50A 4OX9F 2DKOB 5KT7A 2EEYA 3EGZA 5F0WA 3LQVA 1YGYA 3GU0A 1SJFA 5C2GA 1JXLA 4Q45A 1N5SA 2MHEA 2AWZA 4WJBA 1KLNA 2ZNZA 4FKYA 1DTQA 2E9TA 2RKIA 3AHPA 2BVZA 3I9ZA 2B7BB 3PR4A 3AOBA 3I0RB 1CS4A 4QYRA 1RABB 2R7UA 3TUIC 3CC4S 3PG9A 1RA7A 2BDPA 2HEKA 2R7OA 3M2RA 1H7XA 2HBYB 1FNOA 1UVMA 3R2DJ 2WOMB 4IRKA 1N5VA 4A8QA 4Q0BA 4FVMA 2OD6A 5L1LA 3C2PA 3J81j 4ZP6A 1RA6A 3GG0A 1XR5A 2OAUA 1RWNB 2XY5A 4K4XA 4KFBA 2VG6A 1K9MT 1D09B 1BQNB 4NCAA 3D0IE 3NS5A 1Q16B 1MLAA 1T9UA 4OJ3A 2ZJPQ 3A8JA 1RTIB 5HI7A 2K7JA 4I2QA 4AQYF 1RADB 2JOQA 2BJDA 3BF4A 1L5UA 4NLTA 1OIAA 4A4JA 4DV3J 4KHRA 3D1OA 4ED5A 1Q8KA 2LEAA 4DR3J 1FF2A 2AEFA 3J7YI 1HBUB 3DLEB 4G1QB 1NK7A 1ZZNA 4ED3A 3MHYA 1RAOA 1WG1A 1V3SA 4YFUA 1T8EA 1TK8A 2XZDB 1Y10A 5HMZA 3MM6B 3M2UA 3GR0A 4MKAA 2DH9A 1CPZA 4DR6J 5M2UA 2KKHA 2FVSA 2IM3A 1NDLA 3BYPA 5HVFA 2CKWA 4HT5A 1FTRA 1NM2A 3F44A 1LW0A 1TUWA 1FT8A 4L3NA 3VWSA 4NI2B 2NYHA 2B8QA 4R0JA 2D3OR 4CO3A 1QJHA 3VCDA 4UT4A 5GAHU 3THTA 1CJVB 4DV1F 4K2XA 4HT7A 3DLKA 3OVSA 1RT1B 2GMHA 3D6MB 5ETPA 2OMOA 1U49A 3IBWA 1IBLJ 1I1GA 5J2QB 3CCSS 3AODA 4S0MA 3CCWA 1GTHA 2FPHX 3M6XA 1CC7A 3UDVA 4TU7A 3AD8C 2E1CA 1YHQS 3MEGB 4LF8F 1P6TA 2Z2ZA 2K3IA 4F4ZA 1KQKA 2BJ7A 2WVBA 2NSBA 2FVPA 1HNIA 2CNLB 2OFHX 2BQUA 3PFEA 3OUYB 2XS7A 2ZUGA 4DR1F 1T11A 3OTEA 1DQ8A 3PRBA 2ZKUA 2XB2D 3SYZA 3BN4A 4J9UE 2HWHA 2H1YA 3VAHA 3W2VB 2VJUA 2EVZA 1S77D 4ECUA 2J7WA 3CD0A 1FFGB 1S0VA 3GILA 3Q8QB 3SMZA 3U27A 1N34J 3FRYA 1U6BA 2FGCA 2RUGA 1S5ZA 4YEAA 3PW2A 1NSAA 2P6TA 3WHIA 4J9RA 5KFTA 4MFBB 4OZ5A 5CYQA 3HCXA 1PJ5A 3PO5A 2FGOA 3DKDA 2OEKA 2HVZA 1DURA 2LA6A 3THPA 2WAQD 5ADZA 3UVJB 4ETXA 4R0EA 2CPIA 3VV2B 2OO4A 4ZP9A 3BBBA 2GA7A 3TZYA 2M88A 4CLSA 3PW7A 2UXBF 4FXWA 3J7AN 2QYCA 2RUSA 4WP9A 2IRXA 2MEWA 5GAEU 4RBTA 1HKAA 1FFWB 3K5OA 1U45A 3H42A 1D8YA 1TKZB 1IJEB 5CAAA 2HZCA 5IC4B 2OPPB 2MY7A 2UXDF 4CO0A 3KNGA 2DNZA 4QWAA 4I6YA 4UZCA 2KRRA 3ELHA 3JSMA 1S9EA 2ZH4A 3IMQJ 4QW8A 2R3VA 4USHA 2MZSA 2CA9A 2YNIB 4CWBA 4DPYA 2GGPA 2CG8A 4ANDA 3W66A 3AB4B 1RE1B 2XMKA 5B0GA 5DETA 1HA1A 1BHNA 4EYIB 5KG2A 2P5VA 1JNZB 2VFVA 5KT5A 3UE2A 3NMRA 4P75A 3MD1A 5HP1B 1ZPWX 4CTAB 3H0PA 1D9DA 4ED8A 3DHWC 5LMUJ 1JXVA 1S6OA 2ROEA 1RKJA 4XPCA 1H2TZ 3TAQA 4DSIA 3I5AA 5C24B 3H8YA 1CEZA 1YJ9S 1DLOA 1K47A 1FXDA 3N0VA 3AQPA 1UKUA 3HSJA 1F2GA 4QR1A 2P9CA 2VBYA 4USWA 5J2NA 4X4SA 4K4ZA 4P7VA 3M32B 4K50A 4ZN1A 2R2UA 2OSRA 2F40A 3F56A 5DDOC 3V81A 5F3TA 2W9CB 3UD4P 4ZCKA 4PAAA 1X4CA 1PJ6A 3KJFB 4QIEA 3PEHA 2GX8A 2BACA 3T1AA 4I64A 1M1HA 3OL9A 4NRUA 1REVB 4RW8B 1L3VA 4IH5A 4PYAA 2J0QD 2A6MA 3CCUS 3SZ2A 1R8CA 2UVWA 1SQFA 1VQPS 1XNRJ 3QGHA 5I4MA 1A9NB 1S0OA 1N5YB 1IBLF 2GQ2A 2A0FB 4DX5A 2GIFA 5E41A 4UF4A 1CVJA 4CLFA 3OJSA 2YKAA 4RR5A 1YKWA 2DY9A 5F41A 2HZAA 3EX7B 4OHVA 2ZH2A 1DARA 4ECRA 3M6UA 5ETNA 3E01A 3K2YA 5DGAA 3HKWA 4ANEA 2BYCA 1M1GA 4U6PA 3HHLA 2LECA 1FE4A 2RQKA 2JEJA 3DFEA 3CEDA 1YVFA 3LA0A 1HBOA 2BW7A 2DNHA 2J76E 4MMOA 4YUDA 4N77A 3NBPB 2AIRB 3PNIA 5IT0A 3M8QA 2KL8A 4JBCA 1AA1B 3M2VB 2MKCA 3NP5A 2D9OA 4C3KA 2B4VA 2GVDB 4CI0B 3W65A 1RTHB 1YJ7A 2NR0A 4LREA 2HAFA 4RUCA 2MGZA 2FQQB 1T9VA 2FUG9 3C16A 3H4DA 1HHQA 2IJNA 1AFJA 3L4BC 3M8PB 5MAOA 5J2PA 2RDJA 2HVHA 4DSLA 4JV5F 2HQCA 2AGPA 4HACA 4AXIA 3DXBA 3UN3A 3Q8VA 2ZDOA 3QGIA 4CYUA 1K1SA 1HNVB 2ZUAA 3MR5A 2CDRB 3B6BA 3FGVA 1NAQA 4ZVHA 3Q83A 5HVHA 4KSEB 1OPIA 2Z0GA 1R6YA 4IO1A 1U25A 4USTA 4ELVA 3FZ2A 4PG5A 4HI2A 4CLPA 2IIHA 2IBOA 2PSZA 2LA4A 2ILZA 3KG1A 2CRLA 3CMES 3E51A 3MEDA 4P52A 2FHJD 4P7TA 2EFQA 4KE5A 3GJTB 2NZ4A 4F25A 2E1PA 3UCGA 3PX6A 2M8HA 1U47A 2YNHB 1I51B 5GADU 1S1VA 2C2ZB 1JLCA 4NYOA 1GX5A 4NZ6A 2XSFA 2EFPA 3IRXA 2VHGA 4WIQA 4LMZA 1SH3A 3CJ2A 1GXLA 4HHUA 1LWEB 2HFUA 3HD1A 4OI6A 3BS9A 3G8TA 2Z8QA 4DZDA 1RT2A 1VRTA 4NXNF 3SI8A 1JLGA 2BR0A 1X60A 1NHVA 3K89A 4NWBA 3DMJB 1RT3A 4N47A 5J1EA 3I0SB 3LPYA 2AGOA 4WK3A 1HR0F 4OYBA 4CO4A 2R8IA 1RB0A 1JMTA 4KO0A 4PG7A 1GEHA 4HHHA 1EX8A 2C3UA 2XWYA 5B0EA 4TQSA 2W9BB 1NDKA 4UQTA 2CQ4A 1KOHA 1S79A 4Y2CA 4F4YA 1IR0A 4MH8A 3UI3A 2O67A 2MDAA 1I3OB 3AJ1A 1RWUA 1ZETA 2PEHA 2UUBJ 2BM0A 4C11A 1T3NA 2VH7A 3KK3B 1IM6A 2ZBRA 1OSDA 4NCGB 2GNKA 2MKYA 3JTPA 1AZSB 2IC3A 5HN0A 3ULHA 2IMOA 1V5IB 3HVWA 4DI6A 4FNHA 2XMMA 3C6UB 3WX8A 4G65A 5L1KA 3L7OA 2V67A 2XLIA 2HNZB 2KFNA 3PYFA 4EBEA 1N48A 4TU9A 2DIVA 4JYAF 3L09A 4ZJLA 2WTFA 2W8LA 1VQ6S 2E5IA 1WKJA 3HFKA 2XY7A 3CIZA 3FCVA 2VC0A 2NS1B 2V8GA 3S8SA 5L38A 4QW9A 2YKQA 2IVFB 4Z7YA 3QSYB 1ZTTA 1V5VA 4A47A 2UU9J 3SEOA 4KH1B 1RAIB 3DLLQ 2AJ0A 2BRKA 2YKNB 3KUHA 3PW5A 1LKZA 1O51A 5LMNJ 5EWFA 4URSA 4ZPVR 3DDNA 1JJ2R 2KB2A 1O8BA 4ID5B 4O4GB 2L08A 1VCTA 3L7PA 5KOXA 3OTDA 3TOQA 3RB4A 4PABA 3TO8A 5IQQA 5I42A 1WHVA 5HATA 3QT8A 3QJPA 3UD5A 2OKQA 5K14B 1RWWB 4C0HA 1TFYA 3TW0A 2GJ2A 1JNRB 3GIJA 3PACA 3D0GE 2F8MA 3MM5A 1X8DA 1QAJA 4WCEQ 3DHXA 4D3HA 3CWJA 5HQ8A 1VDHA 4RU2A 1MSWD 2BE2B 3DDKA 1U2CA 2MQOA 1B7FA 2ASYA 3DGPA 2AW0A 4C0OC 2ZZNA 5FLXU 3WZ0A 1N6QA 4NZ7A 2MSSA 4A8FA 2XBPA 3IS9A 1HNWJ 1N88A 3C6TA 2IM1A 1R8PA 5DLGA 3AA8A 4ZJQA 1HYSB 4B08A 4OYIA 2AEJA 5H9FK 4TQRA 4YR2A 1OY6A 4H4KC 3V4IA 3NCQA 4USKA 1HNZF 1M5KC 1UEVA 5MLCV 2BX6A 4WXOA 2VKRA 1Y9OA 1N32F 1YBUA 2DGVA 2BOPA 4IDKB 3I96A 2BM1A 1U2FA 1H98A 3S6EA 3RW7A 4MYTA 4KHPF 5CZVA 4EBCA 4C97A 4OL8A 3SSQA 4EBDA 5RUBA 5B0BA 4RPFA 2LXFA 2LQ9A 3U1MA 4LQ9A 5GMKa 3ILJA 3I0RA 2HFVA 5ETLA 4P10A 2DHGA 2A10A 3W7BA 1HW9A 2WOMA 1YTYA 1VJQA 5CQGA 1VHIA 3IM8A 2VFTA 4ED4A 2YXLA 3K8VA 3UD3P 3OHBA 1TKTB 5EUHA 3CJQA 2CJAA 1QVFR 3NKYA 1S1WB 4GKJF 4ZS6A 1BQNA 4BLGA 4TY9A 4ID8A 3HSGA 1RAJA 1RTIA 3Q8SB 1FJGJ 5FJ4A 4OZNA 5DG9A 1XBWA 4QWEA 1FKOA 4Q2LA 5KG6A 1WSVA 2M52A 3DOKB 1FESA 2BRLA 4RLEA 1C0UB 3MPWA 3TARA 1S6PB 2CPEA 1NNDA 4GC6A 1HBUA 3DLEA 4G1QA 2GC8A 2NPFA 5IWAF 5KFPA 2UU9F 1U6ZA 4DV0J 2ERRA 3NGTA 2B9EA 2ALYB 1RBLA 3MM6A 2NSCA 4AL7A 1QSYA 3LGNA 1TVRB 4M5GA 2JRSA 5F8GA 4MIWA 1MN7A 3KWMA 2KHCA 4MK9A 4QBUA 4GKKF 5HSPA 1B4SA 5BYQA 4B9UA 1R0BG 1N4LA 3CJ0A 3OTOJ 1CSJA 1TL5A 4NI2A 1QAXA 4IRDA 4NLYA 1CJVA 1RT7B 2DRAA 2DT9A 4O3NA 5BR8F 3ZTPA 3VALA 3KXDA 5J2QA 2KXFA 4A48A 1H74A 3OL8A 4P2FA 5A76A 2VQFF 5H9EJ 2C1EB 4LRFA 3DRYA 5K8MA 4LF5F 5DDRC 1NHUA 1Y3JA 3MEGA 3QIDA 3U7JA 2WK4A 2GJIA 5KFNA 3I5BA 1YDLA 8ATCB 1PILA 3OUYA 1V3RA 4WE1B 3VZHA 3ZZOA 2RB7A 2UXCJ 4V1Ak 5D0GA 4I67A 2ADBA 3W2VA 4J9KA 1F1BB 4OI3A 3GFYA 3FBEA 4JI0F 4WFBQ 4OYOA 2MZQA 2ZNYA 1VBXA 2DH7A 1PC4A 3KHHA 4G1PA 4L74A 2QT7A 5EDWA 4CT8A 4DL3A 2YWHA 2XCPA 4MFBA 4PPDA 1OO0B 4B9TA 2MKKA 3R97A 4IKAA 2H54B 2KI2A 1NPKA 3UVJA 4NRTA 1BMQB 2KT5A 1VYAA 3CJ4A 1A7GE 4PYDA 3BR8A 5K8OA 2A2DA 1DBDA 4NEZA 4DU8A 3W3SA 4O3SA 1AW0A 1TKZA 2ZVIA 1EQMA 2P9EA 4J9MA 2DNQA 3NAIA 2ZZMA 2OPPA 3ZTRA 1IBMF 2VJVA 2PA3A 1KEKA 4LRBA 3FBFA 1K0TA 2YNIA 3LGHA 3TP2A 2MJUA 1BQMB 4A8KA 4TLQA 2ZM6F 4G6VB 3CD6S 2VQEF 2C3YA 2V5HG 2RU3A 2Q66A 1BE4A 4C9DA 4KJIA 1FXRA 1RWMB 1JLFB 2OEMA 4PG4A 2HIQA 5HP1A 1HBMB 2PN6A 4CTAA 5F8MA 2D74B 4WPAA 1T3OA 2QMXA 4K8RA 3PJ9A 3HHKA 2FJEB 9RUBA 1VRUB 3QYYA 1X4DA 4QJVA 3D3BJ 4LR9A 1NU4A 1KVKA 3HHDA 4TXSA 3JQJA 2UV8G 1I5OB 1FTCA 1S1TB 2H5EA 1NZAA 2PGCA 2LVWA 1QAYA 1IKXB 1NJWA 5CD4A 2NQPA 4DCPB 2J7UA 3LAKA 3M32A 3BBCA 2Y0BB 1F2HA 3EVMA 1YJVA 2YPZA 2PE8A 3CJKB 5GAGU 1VQ8S 2X7IA 4DV0F 3TVZA 3JYTB 3KLFB 3OFFA 3CW2C 1F3FA 2HK2A 2W2MP 3K5LA 2W9CA 1LFWA 3MEEB 1VJWA 4RZRA 4LFCJ 4YS2A 2GO9A 2JEGA 2E9RX 4URQU 3OTOF 1SCJB 3GJRB 4ECSA 3MFHA 3NRBA 2WW8A 3Q8YA 3AJ2A 4LVOP 2NXNA 1REVA 4DPWA 2E1RA 4RW8A 2EK1A 2AEMA 2V34A 1RHMB 4ED2A 3RG6A 2VB6A 9ATCB 3UR3C 3D0HE 2BQ3A 3RTVA 2RF2B 4I2PB 4U67Q 5ETRA 3FEXB 3T6JA 1N5YA 1RWPB 1S9FA 2CUYA 2KJWA 4WTYA 3GV5B 1IKVB 4RW6B 2VG7A 4B3SJ 1NJYA 1QVGR 4B3TJ 2HHSA 2ZH3A 1LXJA 3Q22A 2LU1A 2WHOA 4OI2A 4RWXA 2B7CB 3IBFB 4PXCA 1CULA 2FVCA 2UVRA 3ZO7A 4QU6A 2U1AA 3MM7B 4PCQA 1R43A 3TAPA 1R8BA 4UZBA 1MWQA 2IJFA 1AT1B 4OX6A 1WDTA 5KFCA 2YX1A 4LQ3A 3R3TA 4K0KF 3AT1B 2UXCF 1NK9A 5HBMB 1ZS6A 2KT3A 3AB2B 1RU1A 2OPRB 3PX0A 4ZVQB 4PKDB 3IFEA 5AE1A 1UW4A 3NBPA 2PMWA 2W25A 1CJUB 1XWLA 4QIWD 3AFGA 1RUSA 3M2VA 2J8AA 3C46A 3BKUA 1MW7A 5F0UA 1BGXT 2GVDA 4E2FB 2Q43A 2F4VF 3P4UB 4O44B 1LNQA 3MGJA 1RTHA 2J6TA 2EC0A 2ROPA 4NXMJ 4NLSA 3M8PA 3FNNA 2XTJP 2QFJA 3W5XA 3QZ7A 1NKCA 4K5SA 4YHHF 2HFNA 1U1LA 5JXSA 4DU7A 1RT5A 2O01C 3OR1B 1WACA 3G8SA 1HNVA 1Q8LA 4RW7B 3VAGA 4JUZA 3DM2B 2M7SA 2YX4A 4FPIA 3JQMA 4FNIA 5HK4A 2KM8B 2P6SA 3UWTA 1QM9A 1HFEL 1S4EA 2VZ9A 3PRVA 1RT6B 2LKZA 2EW9A 4RUAA 3QO9B 4LF9F 2VPWB 1SV5B 3OLAA 1I94F 3DLHA 2VBWA 2FDNA 1U0SA 1Z2ZA 1ZZFA 2L3MA 3J80Y 3MUVP 1TK5A 4DUYF 4X84A 3T9NA 4WFAQ 3RRGA 4WP8A 1R0AB 1HW8A 2J0WA 3T1YJ 2YNHA 1VQNS 1U6FA 1CC8A 1RGVA 4O3RA 5E3PA 3ETMA 1KLMB 2K8GA 3BM7A 4ZPTR 3MM8B 1ZPVA 1R89A 1VGYA 1U02A 2N7YA 3VQTA 1VLOA 2A3JA 2FVQA 2VBZA 1GMVA 1LWEA 4X4TA 5K8PA 4LFBF 2LQ5A 2V50A 5KFRA 6FD1A 2UUAF 4IUFA 1PC5A 4BWMA 2F8HA 5B7WA 3DI6B 1D1UA 3HJFA 1IKYB 3DMJA 4KYZA 3I87A 2KHDA 3IR7B 1U8SA 1WDDA 3ZC4A 4NL5A 3MR6A 2DGQA 2P9GA 2F5GA 4P73A 3C14B 3R7NB 1FX4A 1YBAA 2W9BA 2HURA 4OZ2A 2XS2A 3HULA 2AT1B 1N8RT 1FA0A 4ZLLA 2HLUA 2HZVA 1LWFB 2VBXA 1X9MA 4XPEA 2E7VA 5A0YB 1YX2A 1ZAVA 1XMOJ 2V69A 2I5JB 4O0NA 4X66F 2WONB 2WB1D 3GB0A 1S7HA 3GYGA 4D3GA 4DR5F 3HSZA 2RQCA 2QE5A 3KK3A 3SIPB 3JB9k 1RWKB 4BBYA 3R9LA 2JC1A 1GMUA 4CQ1A 4CIOA 1AZSA 3AA9A 3MMCA 3W61A 4NCBA 3BSAA 5LJ5Y 2OD4A 5DM6Q 3C6UA 2HNZA 1Q82T 4EU0A 2B9XA 3KJNB 5LSLA 2CJXB 3ZZ0A 2D41A 2CPFA 1M1KT 1SL2A 2YTCA 1T95A 3PYDA 4DHVA 2DGTA 2CQPA 3G96A 2YWEA 3DRSB 3W8PA 4B9SA 3OSPA 1WC6A 4U8YA 1S72S 2WBMA 3IAS9 3CPWR 1LXNA 2R7SA 4NLRA 3RAXA 3R5GA 4JI4F 1LOUA 1A6LA 1JLBB 3FSYA 4ILRA 4DF8A 4K5RA 3NXZA 1NK4A 3R27A 3LH2S 4ITSA 2R8HA 2YKNA 2I8EA 4R8UB 2CQDA 1GK8A 3OL7A 4K4YA 5DO2A 4ID5A 1FJ7A 1X4FA 1HMVB 4O4GA 3TI0A 1X0PA 2P2CB 5D78A 3P49B 3E3XA 4NXMF 4YB1P 1X0FA 3Q23A 4M94A 2O1PA 3M6VA 5KG3A 1VQ5S 5KG7A 4KC5A 2F65A 3ZZYA 4GC7A 1KQSR 1M0SA 4LIRA 2DO4A 3MCNA 1HQ2A 4LSNB 3SSRA 5SUHA 3AXMA 1R8HA 3I9V9 3Q89A 1RK8A 4ZOSA 1M5HA 1HD1A 3PIOQ 1SC1B 2BE2A 3IR5B 2ZEJA 3HHEA 4OYZA 4PZVA 3ADAC 4LRCA 3TJAA 2JFDA 4RNMA 2R7VA 1T94A 2DNMA 2KXHA 3L9ZA 3T5JA 4WXWA 1PYOB 2VC1A 4OYAA 4IYQA 2V68A 4PG8A 2AYEA 3K5MA 1SH2A 3ZXWA 1HYSA 2KG0A 3IBCB 2RDDA 2DR6A 2HHQA 2LU2A 2XI3A 3SCJE 2OIHA 4FYDA 1Y5NB 1JX4A 2XZTB 2GAHC 2KYZA 2IY5B 4GVBB 1FRKA 2XMUA 5C25B 2YWFA 4IDKA 1UFLA 3GJSB 5HROB 5E7OB 3FBCA 1U1NA 3ZTOA 3T41A 4XDDA 5HANA 4FPRA 3IXQA 2AQ4A 3P96A 5A8WB 2MY8A 4PWUA 3PKMA 4E98A 2CQ0A 2BJ9A 2W4CA 3QNWB 2HGLA 2ZHBA 2F8EX 1S76D 1NSKL 2HGNA 3GYXB 5F9NA 1RWVB 5LJ3Y 2PIIA 4IR1A 4A8YA 3MECB 3TQ1A 3BH6B 4HR2A 2CJYB 4DFPA 3OD2A 1TKTA 2XNQA 3ITHB 2XMAA 1X4GA 3GZ7A 2IRYA 1S1WA 3NWGA 1FDDA 3V2UC 5HJXA 4ZCIA 1GQEA 4DOZA 4WFZA 4DX8H 4ALZA 4OYMA 2ZHAA 1V3ZA 1YZ7A 3BSOA 4J90A 3HHNB 2CQ2A 2HAIA 3RUBL 3SQOP 2LXIA 2MZTA 3CIMA 1O5JA 5A6WA 3DOKA 2W8KA 1VK3A 1H7WA 3O5TB 4OIXA 2Q6BA 4B3OB 3UCUP 4IG0B 4KH0B 4KBIA 4TU8A 2FZGB 3RB3A 3AQOA 2B4UA 4TVAB 1VFJA 5H9FJ 2Q3PA 2J0XA 1U26A 3S7RA 2BZ2A 5D77A 2UZAA 1VIOA 3CDEA 1JB0C 1PJ7A 3GYNA 4DV6J 3QPIA 1MMDA 1TVRA 4ZPBA 3TR5A 1KR4A 1HQUB 4MJKA 2KTQA 2D69A 3M9OB 3RBXA 3H2VE 2D7SA 1Z2LA 4RU9A 4CLYA 2NUHA 2JEFA 3AH6A 4JOUA 4JI6J 1D0EA 1RT7A 3VHQA 5KT6A 4V19X 1TL7B 4OHWA 4LF7F 2WVDA 5D4PA 3CDUA 5JVGQ 3I4PA 2XYPB 4K4WA 1R0CB 2FY1A 1UZDA 4ELTA 1IWGA 4ERDA 1T9XA 1B3TA 5FD1A 2BJEA 1HIYA 3EGVA 3LTOA 1SKUB 3EDQB 1U0HB 5KFEA 3DRPB 3OV7A 3OT9A 3UNGC 2GO8A 3HLUA 2HHPA 1JJHA 1XNQF 4I6WA 3MCOA 5LM7E 4OHXA 3FUYA 1N33F 4DPOA 3TA2A 4WE1A 3OVAA 4OYPA 5T41A 3T1HJ 2HNYB 1KWMA 4OFZA 2AYGA 2XWXA 4OJ1A 1WOPA 2AF6A 2ADCA 1KVIA 3J80U 4F0KA 4M95A 2HFZA 3WQPA 2ZH1A 2GV1A 5DG7A 3PO4A 3I82A 2FHJA 2MQLA 1P1TA 4DX7A 3VVUA 1TL3B 4JI1J 4RNFA 3KK1B 3Q0AA 3ONQA 3GIIA 4H4KA 2R9LA 4MKVA 1WHXA 2R7RA 3H40A 1VBZA 3D28A 2QA2A 5H1SV 2FLOA 3OQ2A 3SXLA 4J9SA 3ETOA 3WX4A 4KR0B 4OX9J 2ZJRQ 3DOMB 1U1OA 1F3VA 1RLDA 4DSKA 4NLDA 3A8EA 3RW6A 1PAUB 3FMBA 3FQLA 4QR0A 3D54A 2O66A 1OWXA 2NXCA 5I3UB 4CLWA 1E6YB 3J7YU 2XMJA 2YNGB 2ZBIA 2C2OB 3G8QA 3ISZA 3GE9A 1RP5A 2DO0A 2E7WA 3R8YA 2IBKA 4QWDA 2AX1A 1G2EA 4DSEA 1IN0A 3SSSA 2W2QP 3POTA 1HI1A 2NZCA 2JWNA 1MMNA 1HL6A 1K0VA 2CFXA 4UUXA 1BQMA 4OYWA 2Y1LB 2DXEA 5AE2A 1YRTA 4M5IA 5IFMA 1UW9A 4ZVGA 3BGLA 1W2IA 3VAIA 1JLFA 1B7YB 5IOLA 2APOA 2XO7A 3OLBA 3KJVB 1T03B 2C3PA 2FHOB 2ZH5A 2C2MB 4NLWA 1ZM2A 2B6AB 1BC6A 1M5SA 1MU2B 2DHHA 1VRUA 1Y5IB 1NKBA 3PTWA 4Q7AA 4AL6A 3OXLA 4AQYJ 4WZMA 4A8OA 2HRTA 3O44A 2FJVA 5CCMA 2IJRA 1RBAA 1S49A 1HWIA 4I6AA 1S1TA 3R5CA 3N6NA 1FRIA 3LANA 3VTIA 1IKXA 3KLIB 2YKPA 2IVMA 3Q8UA 4ZVRB 1LV5A 1YWXA 2MB0B 4UQGA 3CJKA 2BV3A 4CLTA 4DG1B 3ICLA 2A2CA 2YWWA 1KVJA 3JYTA 3KLFA 3CJ8A 4DV6F 2HHHF 2AHOB 3MEEA 1Q78A 4A8WA 3PJXA 1D3WA 2DCUB 4I4BA 1SJRA 2HRYA 2ZOFA 2R7QA 4HTIA 1LWXA 2QMWA 1MROB 3W62A 4ZN3A 2MQMA 2XY6A 2BABA 3QWUA 8RUCA 2HSEB 4UY8T 4MK7A 2ZVSA 3OHAA 1EKRA 3CCMS 4DV1J 3PHTA 3W5YA 2RF2A 4I2PA 2XMVA 5CABA 3UDCA 3PR5B 1C4CA 2D1CA 4DV7F 1IKVA 2XSJB 4RW6A 1QSSA 1NRKA 5L8RC 2Y9HA 1FDNA 4TYAA 2Z2LA 3A1YG 1HHSA 5CD4H 1PG5B 3CJ3A 2C42A 5BYRA 4DV5F 4LF8J 3PM9A 2J8SA 2CQIA 3NG8A 2HBQB 3EPGA 3MM7A 4KPCA 3NS6A 5KAKA 3IO1A 1VQMS 2ZFHA 1WD6A 4X2BA 4DUZJ 2QN6B 1NB2A 1XERA 4NZ0A 2W2OP 2QLXA 5F8JA 2CPZA 3FDSA 5HBMA 3KLGB 2OPRA 1S48A 1X4EA 1KP6A 3EMTA 3AOCA 3DGVA 3FFIB 1CJUA 4JV1A 2NXEA 2FYXA 2UVVA 4KQZA 2RD5C 4RO0A 4XDCA 2NYIA 2OGUA 4DN0A 3HM9A 3HVAA 3DNCA 4O44A 1H38A 4FKXA 4DL2A 2M70A 2NREA 4NLXA 1UEKA 2V94A 3KHLA 2FHMA 4X62F 4ECVA 4K4UA 4CM0A 2X1BA 1DAXA 5C5JA 2YKMB 3I56S 3PY8A 1R27B 1HD0A 2MZRA 2F4FA 3CDAA 2I2YA 3EVOA 1YZ6A 4CLKA 3QMQA 2RHQB 3QAUA 2UXBJ 2XM3A 1S12A 2KO1A 3OR1A 1XEZA 5EWGA 2RSQA 4RW7A 1CQMA 1NSPA 3DM2A 2XCAA 2UUCF 4KIAA 4RNHA 5K20B 3QJLA 2D3ZA 2ZC4A 1G1XA 4KHMA 1S6QB 4L3KA 1UFWA 4M5DB 2UXDJ 4OV1A 1RT6A 4OI4A 3K7RA 3QFHA 4NYPA 3QO9A 1XMQF 2KDOA 3NGRA 1FD8A 3CJSA 1F6TA 3D1QA 1SV5A 4RJVA 5DZ6A 1HWJA 2G4BA 5IM0A 2J9DA 2BKNA 3Q8RB 2EC2A 2FD2A 3VGSA 1R0AA 1O0PA 4C6AA 2DIUA 1HBNB 1AXQA 1L3TA 4JI7F 2DGXA 4X4NA 4DN9A 4BDPA 1HLWA 4CLZA 2IAJA 4P2MA 3ZZZA 3QWPA 1KLMA 1EIYB 1J27A 1PIEA 1GNKA 3T3FA 3MM8A 4RBVA 4WKYA 3D5MA 3MAHA 1IVZA 1H3DA 1J5EF 5E5NA 3KHGA 3AD7C 1QLNA 3MUTP 4XIUA 1UAWA 1Q7LB 3H98A 2B4PA 3SDEB 2VU5A 2C2KB 5CH7B 4IFYB 3DI6A 4OLPA 1IKYA 4J7CA 4WP3A 3HVRA 3MAQA 5ETTA 3LWLA 2MKIA 2PI5A 5F9LA 2J0SD 1FKPB 2E5JA 4ZLPA 4FYWB 2X3DA 1NEEA 2Z30B 4P9SA 3C14A 3MCSA 1W26A 2DGSA 1T02A 2HBZB 2V0NA 1SKRA 1TFWA 2QFIA 1ROFA 2Y3YA 2LQBA 1Q4RA 2YQ1A 4USUA 4QOTA 1NZ8A 4MK8A 2QSFA 1OJ4A 2R2RA 3R5DA 1LWFA 2AGQA 2JH3A 3FEZA 5A0YA 2I5JA 2BUNA 2WONA 3GCWP 3QRPA 4F02A 1FJEB 1RTDB 2J9EA 1G4CA 1ZM9A 3N9UC 1H6KX 5IS2A 1UVKA 1YRUA 2CQBA 3W9IA 3SCIE 2YVSA 2B56A 1CJKA 1SUQB 5IQ6A 1F0XA 4PPZA 2BJ3A 1UJ6A 3CMAS 3FZBA 4ZIVA 5FIIA 4ZVEA 2WVCA 3UFCX 3CUNA 1R31A 2EBEA 1RKIA 3NS7B 1BXNA 2GQQA 2DHSA 3DRSA 4ZCLA 2OPSB 3EICA 2BJ8A 4AD6A 4DUZF 4PG6A 1TU0B 1E6VB 4LR8A 1JWWA 4EK2A 2QSWA 3BSCA 3EVWA 5D0RA 2CNNB 1RXOB 3CCJS 5IXUA 1JLBA 2JLEA 4B17A 4YDDB 4DR4J 1OY9A 2NUUG 2QEXS 5EHHA 3G2XA 3WC2A 1PBAA 3BO3A 4A8XA 1OPZA 2B5JB 4MKYA 1LW2B 1WF0A 2G0JA 3HO1A 2CIMA 5KFWA 4MAKA 3B54A 2IYGA 1BWEA 2BJ1A 2Y1IA 1ZA2B 4AT1B 4LF1A 4DL0C 2FHKA 3EWGA 2RS2A 4R8UA 1PSDA 1ZM3A 4LF4J 1QD1A 2R2TA 5CCLA 2QA1A 2ZC3A 4J9LA 1SXLA 1HMVA 1Q79A 3US5A 1HWLA 4EO8A 2ZZTA 1HHTP 5THWA 1VQOS 4JV5J 3TA1A 2DH8A 3NGDA 5HJYA 3MR7A 1S1XB 1S59A 4DL5A 2EPIA 1VQKS 3BPDA 2YQ3A 1KDNA 2YBVA 4I1TA 2EFVA 1AB8A 4BC9A 2GMLA 5KFHA 4LF6F 4LSNA 2FJBB 2QJ3A 3M9MB 4LFAF 3P8BB 4TY8B 4PEOA 1S9GB 1PYTA 2VPXB 1NMEB 1EAYC 3QZ8A 1WJ9A 3PXGa 1MG7A 1FWPA 3HVTB 5FLXY 4TNOA 2MJNA 4N7TA 4FZVA 5ETMA 1JKHB 1ZH5A 3CCES 4L76A 4P2SA 2HQDA 3J7ZT 5B0AA 3BO4A 1FWLA 1TZ0A 1AUSL 1DQAA 4Y2AA 3RJMB 4F67A 2MYFA 2W4PA 2AJFE 5B09A 4DZ6A 3MXHP 1S1UB 1FE0A 5E33A 2YX7A 2BW2A 4NXNJ 3O6QA 4G3IA 4RKUC 1NLKL 3J7A1 4ICLB 4GVBA 2LQJA 5C25A 3KJQB 2OI2A 5HROA 4NASA 2DEJA 2G9OA 4M5MA 1HR0J 2EFOA 4CDIA 2DB1A 4F4XA 3D2WA 2FJAB 2R7WA 4HH1A 4YY3F 4ES2A 5A8WA 3V6HA 2VONA 1ZAWA 2K06A 2ZD1B 3CNQP 4DS5A 3VAKA 2V8VA 2Z58B 1W2BR 2PFDA 3LP2B 3N01A 2K3KA 2FZCB 3LALA 1N5QA 3JAMU 4LVNP 4Y34A 2M2BA 5IC6B 3MECA 4C7QA 4WFYA 1QTMA 4QU7A 3BQ1A 1TELA 3ITHA 4GO5X 2Y8YA 2VG5B 1EQ0A 3HF5A 3S1TA 3K5NA 1RHUB 2QYGA 1KNZA 3CGIA 3V6DB 5DZ7A 4CCHA 5DQIA 1LEOA 4JYAJ 1L3KA 2W7AA 2X51A 3P5BP 2C3OA 1Q5VA 2CZVC 3MPUB 3FK4A 3GSDA 2G1HA 1FRJA 2GHVC 4XAKA 3W8GA 1YSJA 3OFGA 1SJQA 2OPQB 2ALZA 4B3OA 2DNPA 4IG0A 4IQMA 1N36F 1NO8A 1NDPA 2ZDPA 5EN1A 2DR8A 3Q24A 4DR4F 3KLHB 2HS4A 2B0GA 3DCAA 3JSRA 2E5LF 1S4FA 2H65B 3W2WB 4FF2A 1PCAA 4EWTA 1HQUA 1H72C 2WRMA 4DQPA 3UO0A 3ILOA 1YJWS 3D66A 2VA2A 1K44A 3H5YA 1EP4B 4LF4F 2BEFA 3BN7A 2OHDA 4MTPA 4FBTA 2KYXA 4M5JA 1VLYA 3MD3A 2M5YA 5K9FA 5LSOA 1SJ1A 3Q2TC 2YPYA 1R3NA 5KG1A 3TJ9A 2E5HA 1FNMA 1TL7A 4WWSA 4NMXA 3M7VA 2ZOMA 4DL7A 5KFSA 3OVBA 4ZITA 4AXJA 1SQEA 1U0HA 3PFOA 3DRPA 1T7PA 1RHRB 4NX9A 3IR6B 3PIPQ 4XO0A 5E3RA 1IJFB 3M8YA 5KOWA 1BLUA 3HPOA 4U95A 3MTKA 4YR0A 1J2VA 3H25A 2HNYA 3CCRS 5SZTA 2PT0A 2K1RB 3GIRA 2QC3A 4U7CA 3B82A 2RIJA 2VOOA 4PWDB 5AJ3J 2MLYA 2X3GA 1TL3A 4USJC 5KT2A 2DHAA 3KK1A 2ATLA 3QATA 2HNDB 3R7BB 1TL4A 4LBHA 3A4TA 1Q81T 1FRHA 3RU0A 1VQ4S 1BY9A 3HI9A 5F8HA 4U7UK 2ZH8A 8AT1B 1HNZJ 3MM9B 2WVEA 3FSXA 3DOMA 2GMJA 2CADA 4QQBA 4B9LA 2QZ8A 2CPJA 2H4WB 2BKPA 1N32J 3VGVA 3TVYA 3KLEB 3N5FA 4C8KA 2ZWOA 4ECWA 3NNCA 4KHPJ 1UWAA 5I3UA 2DPJA 2AJ4A 4HDHA 4F4KA 1VQSA 2IDEA 4L75A 2V4JB 4KGMA 3JTNA 4LR7A 1WF1A 5KFGA 1UVJA 4UTGA 3H90A 3D67A 4QWBA 3OTBA 1WEYA 5D4OA 3DYAB 3EZOA 1Q5YA 4DV2F 1UPMB 1SPBP 4LF2A 4CM2A 4DCJB 2PO4A 2RE1A 3SBMA 1VQ9S 3QLHB 2V2ZA 3ZZUA 1A0OB 3KJVA 1SC4B 1T03A 2V4RA 1PBUA 2CQ3A 2B6AA 5KFOA 4GKJJ 2DNGA 2DR5A 2V6AA 3PKYA 1B70B 3K59A 1MU2A 3G6ES 4FS1A 2CAJA 3M9NB 3J81Y 2V2QA 1U1QA 4JI3F 3PVXA 2UUWA 4YB7A 1Q95G 2KN4A 1XC9A 2O3DA 3IG1B 1Y0HA 3KLIA 3TX8A 2ZWPA 1MWYA 1FK9A 2XMTA 4F3OA 1X4AA 3BH7B 4EUVA 5IWAJ 2H48B 2VIHA 3ENQA 2KJVA 5KT4A 3K58A 2YH1A 3RB0A 1ICEB 3L3CA 2UUTA 3W5ZA 3D3CJ 2HQ3A 2CWXA 4OYXA 3TZXA 1VIXA 3F0NA 4DX6A 4GKKJ 2AJ1A 3WBZA 5J1PA 4YB5A 1KN6A 4OJGA 3C19A 1MROA 2GCFA 1APSA 3RBEA 4EGLA 1V6HA 2J6UA 3G82B 2ZH6A 1KFDA 3VGTA 2HWTA 3R5AA 4X65F 2IFXA 1VS3A 3TAMB 2G2YA 2ROGA 2FLLA 5LOQA 1RT4B 1GMWD 4C98A 3U1LA 5BR8J 4JI5F 4M5KA 3M4XA 2VL1A 2RRNA 1ZTWA 5KFJA 2VDIA 2XSJA 3ET6B 1VC6A 3OTCA 4DQRA 1Q8BA 3QFWA 3A8KA 4C8YA 2VQFJ 3H7HB 2OTJS 1P9QC 3JTOA 1TKXB 2J9CA 4DLEA 4LF5J 3LOUA 4ZK7M 1AROP 3W1YC 3HK2A 5HL7Q 1NK8A 2E7XA 1F9FA 1KTVA 3L95X 4BCAA 2D3O1 2WVFA 4ATNA 4M63A 4OZ1A 2GHWA 2HYIB 3LPEA 4F3MA 3MM5B 4NA2A 2CPYA 1RTJB 1YQHA 3KLGA 2DRDA 3NGSA 4DEZA 2MMYA 1NK6A 3DU6A 5L9NA 3FFIA 4C8MA 3IWXA 2QGFB 7AT1B 4I68A 5AJ3F 2DNYA 1VBYA 4JI0J 4JI8F 4RW4B 3CT9A 1JLAB 1TUGB 3MR2A 2D3UA 2BOAA 2HS0A 4QIFA 2H3EB 4IOBA 2FJDB 2FVRA 2VF3A 1NHKL 2QX0A 2QTWA 2YKMA 2JL9A 4QPTA 2WSCC 3SCKE 3UR0A 4ECYA 4F04B 3ENAA 2GFFA 4DMZA 1N54B 1UPPA 5JVHQ 1DQ9A 4DL4A 3I4HX 3TUJC 3ZNJ1 4X64F 1TAQA 1P1LA 1DTTB 3CJRA 1KONA 3NOCA 1S6QA 4M5DA 3LO3A 1TMMA 3AD9C 3NLCA 3GFXA 2RT3A 1IBMJ 3GTYX 4QPXA 1U1PA 1RHQB 1UVNA 4N8OA 2OSQA 4B02A 3BGRB 4YP3A 3O8WA 3UDLA 5U47A 4YR3A 2N4CA 3KOAA 3M8SA 4FVCA 3KUEA 2ZM6J 2VQEJ 3A13A 3A12A 5KTQA 2MHNA 2NXJA 2VFUA 1MN9A 1WKLA 3BKFA 3MI7X 1HBNA 3H2UB 1UMJA 5H9EK 4ZLJA 5K5MA 2J9DE 3NGKA 4M8LA 3H5UA 4NYZA 2RILA 1H0HB 1Q8IA 2VASA 2JLGA 1KHVA 3WIVA 5KG0A 4ILMA 3KFWX 2CQCA 3VZIA 4C8LA 3SDEA 1OSCA 4IFYA 1XR7A 4ZDNA 3UDEA 1FDBA 3PW0A 4LBIA 2L9WA 2M4MA 1NCLA 2E9ZA 4NLVA 2RU9A 3IM9A 2XO6A 1FKOB 4Q2MA 1FKPA 5LXRA 1OYDA 2MQPA 1ZAXA 1VMBA 1WORA 2EG1A 4X4UA 4M5NA 2C2DA 1WI8A 3FMWA 3WIUA 1KD1T 2HVIA 3V4MA 2QA4S 1H73A 2FJWA 2GIQA 4C2MA 2U2FA 1FRLA 1R7IA 1UWBB 1RTDA 3MR3A 2HQGA 1RT1A 5IT4A 4Y0FA 3CDBA 2I1RA 1HI0P 4Y6IA 2V2VA 3SV4A 3WDOA 4DV4F 1SUQA 3LW5C 3R7SB 2HW3A 2LXUA 2DBBA 2MTLA 2DXFA 2BKOA 4QYZK 4L73A 1IKWB 2LDYA 1F5BA 2GZOA 4ES3A 5KFQA 2OPSA 1JLEB 4CO1A 1SH0A 1E6VA 4K0KJ 1SKSA 3BPSP 1FJCA 3T9ZA 1WKKA 3LP1B 3QIPB 4KRWA 2W9AA 2MQNA 2KFYA 4Z37A 3KK2B 5I3QA 3CE8A 4C4WA 4QR2A 5DJBA 1AUDA 3EM1A 2HBRB 3UQSA 2E1AA 1IBKF 2B5JA 2JLFA 3LUYA 1LW2A 2JSXA 2F4VJ 5F3ZA 1VQYA 2CXEA 4WKRA 2Y1JA 2X1GA 2VPZB 4Z2XA 1RISA 3C15B 2GS8A 5B0FA 5HQMA 3PEJA 2FC9A 4Y2IA 3CCQS 3CJ5A 4PXEA 3ISND 4C3LA 3MMJA 4WBFA 4E0DA 4YHHJ 2G0IA 4LT6A 2GVZB 4QZVB 1S1XA 3F41A 1T9TA 4F4WA 1LWCB 3RR7A 1CQNA 1W25A 1U2RA 2XMWA 2NXUA 3Q8PB 3ZZTA 4CLUA 1NPPA 2ZH9A 4TY8A 1S9GA 2XHWA 4LF9J 5LXYA 2VODA 2KM8C 1NDCA 2CPHA 3GSIA 3GIMA 1I94J 5KFKA 5HAOA 3M8ZA 3HVTA 4DUYJ 4FBUA 1FX2A 2X1FA 2JDJA 1YBTA 3PV8A 1JK9B 1JKHA 2KZMA 3OR2B 2GAGC 3PDNA 3U1NA 3MURP 3HKZD 2CZ4A 5KG4A 3FKBA 2VV5A 5DM7Q 4UOGA 3B78A 4TN2A 3RBZA 4CNZA 4YOEA 3ILIA 4DUTA 3EDRB 1XQIA 2CDQA 1SQGA 4RX6A 1IQZA 2OFGX 2MKHA 3CF5Q 1S1UA 2HHTA 3CTRA 5C24A 5A8RB 4LFBJ 3P6YC 2DPIA 1CBKA 4CO5A 2UUAJ 2EK6A 3CSKA 2L9DA 3J81U 4ICLA 4PQUB 4GMKA 2RHSB 1LFPA 5D0HA 2WCXA 4RUBA 2Z4PA 1KTQA 3G6YA 4DV3F 3DC2A 2HQIA 3K17A 5IV3A 2CPXA 3ZFVA 2J7KA 2H5IB 4DFJA 4DR3F 1UCNA 2HMIB 3GJQB 2ZD1A 4PWWA 3ILLA 1F9EB 1ACMB 3OBIA 2JNJA 3MMBB 1N56A 3LP2A 3EPIA 2M9KA 4FXVA 3V6JA 4DR6F 2WB4A 4J9QA 2R42A 4ECXA 3RAMA 4KGZB 4X66J 1TL1B 2OEJA 2ACMA 2P8IA 4DR5J 4B3MJ 1YJRA 2MLXA 1M5VC 2QLBB 3NOGA 3FCWA 2DVIA 1J5OB 1VBKA 3TWZA 1C0TB 2QLFB 3NEKA 4R25A 2VG5A 4FYYB 3QRQA 5HO4A 2G13A 4W4MA 4NLUA 4ZPDA 3DRRB 4KKOB 2CQHA 3V6DA 1RAEB 4EI2A 2VFSA 1X5TA 2ABYA 5ETVA 4OLOA 4PUOB 1X5SA 1LQ9A 1WHYA 2VG7B 4Z7CA 3KG0A 3FSIA 5CYMB 3HXMA 1UJ4A 2FB0A 3KG4A 2OPQA 3MF5A 2HFOA 3EZUA 1X9WA 3PX4A 2C22A 2ASDA 1Y7PA 2MKSA 4JI4J 3BREA 1CULB 2W4DA 5HVGA 2XQCA 4GO7X 2QL9B 2N7CA 3KLHA
chains in the Genus database with same CATH topology
4GVBB 1KP6A 4GVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GVB B;  1KP6 A;  4GVB A; 
#chains in the Genus database with same CATH topology
 2E5G A;  3GQC A;  1GX6 A;  3UN5 A;  3W2W A;  1WTB A;  2JFK A;  4NE9 C;  2F3J A;  1WC1 A;  7FDR A;  4OMF G;  3CO0 P;  3QBC A;  4IH7 A;  3M8W A;  2CWK A;  1K73 T;  5DGB A;  1GH8 A;  3MOZ A;  1IUJ A;  1EP4 A;  4KB7 A;  5ITH A;  1M5O C;  6FDR A;  3MAA B;  2DXD A;  3N6M A;  4CT9 A;  1N34 F;  2JVR A;  4BC7 A;  2C28 A;  3ZNU A;  4R5P B;  4ZVU B;  5GAH I;  4HKQ A;  4H4O B;  4OI0 A;  2AD9 A;  2M0G B;  2YNF B;  3JSB A;  2FTR A;  4AE5 A;  4Y00 A;  2CJ9 A;  2G0C A;  4HL9 A;  1U09 A;  4H4M B;  1FEE A;  1S57 A;  3KUG A;  4KTQ A;  2LLZ A;  1RT5 B;  3ISN C;  2UVU A;  1R6V A;  1VR6 A;  1VQL S;  4CH1 A;  1SI9 A;  4NA3 A;  2D9P A;  1RCX B;  4RW9 B;  5LSR A;  5ETS A;  4Q8F A;  4RNN A;  3N5B A;  1NH7 A;  4WFN Q;  3PYE A;  2JVO A;  2FLN A;  1QUP A;  2K1R A;  2HG4 A;  2PD1 A;  5L9X A;  4PWD A;  1WUU A;  2IM2 A;  3IRW P;  1UZH A;  4TKT A;  3GP9 A;  1DHM A;  3IAM 9;  4Y3C A;  3QGG A;  1WSR A;  1G6B A;  2HND A;  4FN5 A;  1T05 B;  2AKW B;  2IHR 1;  3OJU A;  3MM9 A;  1RHK B;  3D1H A;  4FS2 A;  5LMU F;  3O2I A;  4B9M A;  3EXC X;  3A3P B;  2L9N A;  4DFK A;  3KLE A;  3GFZ A;  4L72 B;  1WEX A;  3I0S A;  1WG5 A;  2YWG A;  4MKB A;  5I3P A;  4QCL A;  2C2N A;  2V4J A;  4GRS A;  1ULR A;  4USM A;  2Z57 B;  5ETK A;  5EWE A;  2DCL A;  4IOA Q;  3GPA A;  3LGM A;  4HDG A;  4RL1 A;  1WOS A;  5GAE I;  1L3U A;  2EG2 A;  2OH2 A;  2V9W A;  1Y4Z B;  5LT5 A;  3DYA A;  1SL0 A;  1NSQ A;  3DU5 A;  1IM4 A;  4YB6 A;  3HT3 A;  2IA6 A;  1NJX A;  3GCX P;  3QLH A;  4NLG A;  4IRC A;  2R7X A;  3RAQ A;  4B3M F;  4NCG A;  1RWO B;  5BJR A;  5DG8 A;  3NNA A;  3MTJ A;  4Y2M A;  5G4D A;  3DDI A;  3TNV A;  2DTJ A;  1NUE A;  3HFV A;  2XI2 A;  2B8P A;  3OSN A;  4EZ9 A;  1XNR F;  2DNO A;  1ZA1 B;  5C42 B;  3UN2 A;  3C66 A;  1PYS B;  3MMC B;  1Q0N A;  4W92 B;  3T5K A;  4B3R J;  1EZZ B;  3KNA A;  2PEB A;  4WTO B;  1U1M A;  2KZZ A;  2PA8 D;  1FO1 A;  4DQS A;  5A6P A;  1FWK A;  5JUM A;  3IG1 A;  4X4P A;  2BXJ A;  2F1F A;  2AV5 A;  5D3G B;  5KFU A;  4AUK A;  3BO2 A;  1XIQ A;  2DYA A;  1TV6 B;  1REG X;  3LP0 B;  4ZPA A;  3EXY A;  3P5T L;  5DS7 A;  2PC6 A;  3KLV A;  3CDW A;  3GR1 A;  3BBF A;  3EJM A;  4CH7 A;  3CCL S;  1QUV A;  3VF0 B;  4C48 A;  5IT9 Y;  1ZOT A;  2YQ0 A;  4ZA1 A;  3H4B A;  3BDE A;  1F60 B;  5F8L A;  3G82 A;  3ZTS A;  1SL1 A;  5KFI A;  2E66 A;  1QY7 A;  4RBU A;  3HZE A;  4IQX A;  1WG4 A;  2HS3 A;  2JJ4 D;  3TAM A;  5KT3 A;  4LRD A;  1RT4 A;  3M8R A;  4LF7 J;  2V8H A;  2IA0 A;  3UNY A;  2IM0 A;  1F5C A;  3IWN C;  4WK1 A;  4I56 A;  1R8A A;  3K0J A;  4P72 A;  3ET6 A;  5K14 A;  3KTQ A;  4LIW A;  4WF9 Q;  2N3O A;  1Y00 A;  3H20 A;  3HDS A;  1MML A;  1TKX A;  4O23 A;  5AXM A;  2W24 A;  5J1N A;  4HTJ A;  1MWZ A;  1QE1 B;  1XNQ J;  1Z4U A;  2BA9 A;  3C8Y A;  1CJT B;  2E44 A;  2W1B A;  1N33 J;  5G0R B;  4KT0 C;  4BHQ A;  1KC8 T;  4I7F B;  3VVT A;  3N79 A;  4MIA A;  3CO9 A;  4QIG A;  5KFL A;  1EAR A;  4ZVF A;  1VRQ C;  5JJB A;  1RQ0 A;  4QIV A;  1RTJ A;  1KQG B;  3JQK A;  4CLL A;  3T19 A;  1RBO B;  2H9Z A;  2XHC A;  2IRU A;  3PCO B;  1SIW B;  4DR2 J;  1NPR A;  2DY1 A;  1X5O A;  2VKZ G;  1JLQ B;  1T9Y A;  1SJ4 P;  2L48 A;  5HQL A;  3I31 A;  4RW4 A;  1JLA A;  3NY0 A;  1URN A;  1TAU A;  1QAI A;  3E8O A;  3A3N B;  3IC1 A;  4OZ0 A;  2XUL A;  4O0I A;  2R2S A;  3G71 S;  4MYU A;  4NPO A;  1UVI A;  1FD2 A;  5KFF A;  2R7T A;  1GXT A;  4H54 A;  4X4O A;  4UOH A;  3NNH A;  2W2N P;  3HT0 A;  4J9N A;  4J37 A;  1FRM A;  4DFM A;  2BAN B;  3BR9 A;  2KG1 A;  1RLC L;  2Y1R I;  1DTT A;  2H4Y B;  2F9D A;  3MOJ B;  3TX0 A;  1TQL A;  3BGR A;  4PXD A;  2XYH B;  3PHE A;  3R5J B;  7FD1 A;  1WI6 A;  5F8I A;  1UA1 A;  3THV A;  3K5P A;  2GQC A;  3TEH B;  1TP7 A;  1HAR A;  2ZIT A;  4RUH A;  2UUB F;  1AFI A;  5KFD A;  2HRU A;  4OHY A;  5GAD I;  2AMC B;  4IR9 A;  2BE7 D;  5ETQ A;  3QGP A;  4B3R F;  1XK8 A;  4ZVP B;  4WU2 A;  4J91 A;  3QRR A;  1WNE A;  4HI1 A;  5HLF B;  3TRG A;  3DOL B;  4FYV B;  2DD8 S;  2YWK A;  1C0U A;  1S6P A;  2LCW A;  3W9H A;  4IFV B;  3HJV A;  3M6W A;  1RCO B;  4OJH A;  5M2P A;  1S97 A;  1SJ3 P;  3BJY A;  5DRK A;  1NH8 A;  4JP8 A;  2F63 A;  2HHH J;  4CO2 A;  2A18 A;  4DWI A;  1YI2 S;  3BQ2 A;  3C3L A;  3GIK A;  1I6J A;  5EX0 A;  3K8W A;  3QT7 A;  3BGF A;  1C4A A;  2QG9 B;  4Q43 A;  2M8D B;  4MT1 A;  3GON A;  3IWL A;  3MCM A;  4B9N A;  2GIR A;  1Q1K A;  1S10 A;  2Q79 A;  4IH6 A;  1N52 B;  2XEX A;  5LMN F;  1UWB A;  2DR9 A;  3RRK A;  2ZE2 B;  3EGW B;  3NMA A;  4ECT A;  2KFZ A;  2A1B A;  4KGK A;  4DV7 J;  2SXL A;  3KDN A;  2VUG A;  1U48 A;  2POK A;  4J5O A;  2J6S A;  4LSL B;  3CCT A;  1FXL A;  1T9W A;  4DV5 J;  3KMS A;  1IKW A;  4KPY A;  1RAH B;  4DLG A;  3P3D A;  1H2V Z;  1D9A A;  3CCV S;  1S7I A;  3TZZ A;  4EMD A;  1JLE A;  4DF4 A;  4KV8 B;  3HFZ B;  1KQF B;  3RB6 A;  2EI5 A;  2VFR A;  3LP1 A;  3I5C A;  3QIP A;  4Q44 A;  4C8O A;  3BEG B;  3KK2 A;  2AZ1 A;  2YKO A;  4OHZ A;  3DLG B;  2CNO B;  1X4B A;  4DR2 F;  2CJK A;  3R1H A;  4WU3 A;  1RI7 A;  1WHW A;  2HHU A;  3UCZ P;  4EZ6 A;  2HLT A;  2E1M C;  3W60 A;  2MLZ A;  2HIY A;  4K4T A;  1C1C B;  5FDL B;  4ETZ A;  1IR2 A;  4C3M A;  2VIC A;  3RRH A;  1HNW F;  3HD2 A;  2VPY B;  3M30 B;  1EKS A;  4X62 J;  3TZW A;  3I32 A;  1X31 C;  3C15 A;  2UV8 A;  1URR A;  4DPU A;  1YJN S;  1WWH A;  1QDU B;  4TYB A;  4EEY A;  1UTA A;  2QA4 G;  2GW8 A;  2QIF A;  2AX0 A;  1SVD A;  1RJJ A;  2GVZ A;  4L6V 3;  3M1V B;  3W63 A;  1RYS A;  2WBR A;  1LWC A;  3FEY B;  1PGZ A;  2RVJ A;  3HP6 A;  4ZHR B;  2UUC J;  3TA0 A;  1JJC B;  2EXU A;  3Q2S C;  2RH3 A;  2WW4 A;  2B43 A;  3PYG A;  2CG4 A;  3FJ2 A;  1RYR A;  1ELO A;  4CNY A;  1RU2 A;  3MWB A;  1XMQ J;  1KS2 A;  3CD7 A;  2WZ1 A;  1B0P A;  4CRJ A;  1M90 T;  1VOM A;  2C2R A;  3UPF A;  2XC9 A;  1K8A T;  1O6X A;  4IG3 B;  3POT B;  3R1L A;  4OX7 A;  3OR2 A;  2QLJ B;  4GVL A;  4JI7 J;  3EGN A;  4LBP A;  1SBR A;  3NAH A;  4FF1 A;  4O4R A;  4QYZ J;  2OTL S;  2BMB A;  1C1B B;  4YME A;  2DNK A;  3TQE A;  3HZG A;  2MPU A;  2FLP A;  4I0W A;  2QRR A;  2DJW A;  1HBM A;  3D68 A;  1HWK A;  4U9R A;  4B9V A;  2HPU A;  2KVI A;  1J5E J;  2KU7 A;  2Q1L A;  5A8R A;  4BWJ A;  3B4M A;  3GLJ A;  4ZCM A;  4PQU A;  4FP9 A;  4RWW A;  1FJG F;  2EKN A;  1NK0 A;  3VAJ A;  4K4V A;  4KY3 A;  1FVQ A;  2B3T B;  3O3L A;  2XS5 A;  4LJM A;  2HWI A;  1WC3 A;  1HQE B;  1U1R A;  4M1K A;  1S0N A;  2QO3 A;  2NCK L;  4LUB A;  1YG0 A;  3A8I A;  4UY8 5;  4ED0 A;  2DGU A;  4WFX A;  3T5L A;  2HMI A;  4DPT A;  5T7L B;  4N8N A;  2N82 B;  5F8N A;  1EET B;  3G87 A;  4NLO A;  3MMB A;  2DIT A;  1NBE B;  3IA0 A;  3JAM Y;  3TYT A;  3BB5 A;  5A8K B;  1WEZ A;  1UJ5 A;  1TL1 A;  3MMA B;  5IT9 U;  4A8M P;  1H2U X;  5CYJ A;  4YDX A;  1TMJ A;  2QL5 B;  1GT8 A;  4WII A;  4YN3 B;  1J5O A;  1C0T A;  1SC3 B;  2CYY A;  3G6X A;  2BE9 B;  3MUM P;  3DRR A;  4KKO A;  3BZQ A;  3G9C A;  1GMW A;  5J2M B;  3B8H A;  3CB4 A;  3JXO A;  3KHR A;  4PUO A;  4C8Z A;  3FBB A;  3MPV A;  1FDA A;  2LFV A;  2XYG B;  5CYM A;  1QSL A;  4K7Q A;  3SQG B;  3DLJ A;  3HHL D;  1VK8 A;  4DS4 A;  3H59 A;  2QV6 A;  1BD6 A;  3R5B A;  2ACY A;  1GAO A;  3SFU A;  1TK0 A;  2H5J B;  4NLQ A;  1EHW A;  3T5H A;  4U7U D;  3FC9 A;  2UP1 A;  3OW2 R;  5GMD A;  2RRA A;  4DR7 J;  3G6V A;  4ECZ A;  1JQG A;  1BWV A;  3OFE A;  1SB6 A;  2HGM A;  1KRP A;  1HPZ B;  2W7O A;  1NB7 A;  5IZH A;  3MAA A;  1RAG B;  1B64 A;  3N6L A;  1UP1 A;  2O5D A;  2N3L A;  4XK8 C;  3FQK A;  3RBD A;  4YQW A;  4ES1 A;  5IV4 A;  4F26 A;  1N5T A;  2F9J A;  3D6H B;  1UET A;  2QMU B;  5HMW A;  3HSD A;  4R5P A;  3IP0 A;  2Y8W A;  3DXS X;  5K8N A;  4H4O A;  2F7V A;  2ZBC A;  3VR1 A;  4AL5 A;  1ZYQ A;  2YNF A;  5KFB A;  2Z56 B;  5DQG A;  4USV A;  3NCP A;  4O3Q A;  4ZP8 A;  2CPD A;  4H4M A;  3RYL A;  4LF6 J;  4LFA J;  4KGV B;  1XTZ A;  4DQQ A;  2HHX A;  1M5P C;  3MPY A;  1DTQ B;  3CC7 S;  2RKI B;  2HQF A;  3AOA A;  4USI A;  5BXI A;  2B9W A;  1L3S A;  3CMQ A;  4RW9 A;  4OX8 A;  3BGU A;  2I38 A;  1CS4 B;  4JI2 J;  3MFI A;  3ENV A;  1TR0 A;  2PMH A;  3NGU A;  1B99 A;  1F5A A;  1X7V A;  2KXN B;  3MZI A;  1X9S A;  3M2R B;  2VOP A;  4P74 A;  5IM0 B;  5AXL A;  4DQI A;  4A8S A;  5D0E A;  4IOC Q;  4J9P A;  4CZC A;  3TEG A;  2V2K A;  4Q0B B;  4N5S A;  5DQH A;  1S6U A;  3BV8 A;  4HLB A;  1KFS A;  4AYB D;  1T05 A;  2CQG A;  2NLW A;  2RRB A;  3W9J A;  5KFX A;  2IAJ B;  3X3U A;  4KFB B;  2VG6 B;  2IMW P;  2HHW A;  1DY3 A;  2RJZ A;  3U02 A;  1OQ6 A;  2HFS A;  4I2Q B;  2PDA A;  3W64 A;  1UVL A;  3MPD A;  2R4F A;  4C8N A;  3OFH A;  2K2P A;  1GXU A;  2DRB A;  2JHE A;  4YY3 J;  1JIH A;  1S99 A;  3TAN A;  2XZW A;  5D6G A;  1P8G A;  4FXD A;  5E3C A;  1X4H A;  4Y28 C;  4ANC A;  4FYX B;  1RDR A;  1UFK A;  3M2U B;  1PO6 A;  3AY0 A;  2DNR A;  4F0H A;  4LFC F;  2MQ8 A;  1C2P A;  2COL A;  1U4B A;  1LW0 B;  2DGO A;  3RZA A;  1VIS A;  3K57 A;  4V19 J;  2HHV A;  4K2J A;  5CXT A;  2MKJ A;  4X4Q A;  4F36 A;  3DLK B;  1PKU A;  2Y0S D;  4LSZ B;  3RR8 A;  5BYS A;  3NCR A;  3EE3 A;  5C42 A;  1RAF B;  1SC6 A;  1NK5 A;  4UUW A;  1D8Z A;  3BQ0 A;  1U24 A;  2JX2 A;  2JEI A;  1CJK B;  3S01 A;  3X1L B;  4ENO A;  1N0V C;  4B3S F;  3PJW A;  2A6O A;  4B3T F;  4ELU A;  2ZBQ A;  3R6G B;  1U8W A;  1UL3 A;  2W7P A;  2PI4 A;  1N36 J;  3AJD A;  1MNE A;  2N4D A;  5D3G A;  3LF0 A;  5D4L A;  1HNI B;  2AP6 A;  1LK5 A;  3R6L B;  1TV6 A;  3VQS A;  3R2C J;  1KKH A;  2E5L J;  1DFD A;  4NEY A;  3LP0 A;  4DR7 F;  4WYW A;  3IGV A;  3CCZ A;  5GAG I;  4I69 A;  3A3O B;  2JC0 A;  3HHL C;  4X4V A;  2G1D A;  4JB8 B;  2AU0 A;  1FRX A;  5A2Q Y;  5M2R A;  2Z2M A;  1IBC B;  3P45 B;  1NXI A;  3GFH A;  1VC0 A;  4DJB A;  2RML A;  2RS8 A;  1YJU A;  3QQC D;  1KOO A;  1RHJ B;  4DSJ A;  3G86 A;  4OQJ A;  3ZZR A;  5LL6 d;  2OJ3 A;  2ZKT A;  2HVD A;  4CH0 S;  2HK3 A;  3GV7 B;  2ZBP A;  5CYQ B;  2Q6C A;  4NOH A;  2LMI A;  5CHC B;  4OZJ A;  4ED6 A;  1U1K A;  3EUN A;  1YIT S;  3LAM A;  1RZM A;  4ZKA A;  4AFF A;  1QE1 A;  5CZX A;  1CJT A;  2B51 A;  2XNR A;  5G0R A;  1UEU A;  2ZHO A;  4I7F A;  3O1L A;  2KH9 A;  1FCA A;  2AZ3 A;  3IN5 A;  3J7Z 5;  2BQR A;  2EBG A;  3DN9 A;  4JI2 F;  1WC4 A;  4J9O A;  2CVI A;  3JSM B;  2FC8 A;  1S9E B;  1X5P A;  3VAF A;  2DGW A;  5L39 A;  2AYM A;  3IGN A;  2GGP B;  2CZ9 A;  1JLQ A;  5C2C A;  1RAC B;  1FHT A;  3BDP A;  1P9Y A;  5DDQ C;  2FY8 A;  3T1Y F;  1KSP A;  1S0M A;  5C7P A;  2QL7 B;  2RDI A;  4Y2K A;  1UA0 A;  4OI1 A;  4PQA A;  3OL6 A;  1NJI T;  4J9V A;  1VI7 A;  3GMG A;  1B0V A;  4A46 A;  3D9B A;  3OXF A;  3NL0 A;  4ZPW R;  4CP5 A;  2OLW A;  4MIB A;  2G2O A;  1HNX J;  3Q86 A;  1OY8 A;  2RAQ A;  4F4A A;  1TTH B;  3KDO A;  3I6P A;  3D7S B;  1DLO B;  3E2E A;  3LWM A;  2BAN A;  4W98 A;  2R8G A;  5HMX A;  4DL6 A;  1Y11 A;  2DNL A;  1RAA B;  3JSY A;  5J2N B;  1LK7 A;  1OMS A;  6AT1 B;  4ZVT B;  3T6B A;  5AT1 B;  4OZL A;  5D4N A;  4EYH B;  3KKF A;  2W01 A;  4E8U A;  4HYK A;  3V81 B;  1ZBT A;  4DV2 J;  2V4Q A;  1NJZ A;  2MZ1 A;  1YIJ S;  2LP4 A;  1G3O A;  4HHJ A;  4EFA C;  2VA3 A;  2EFN A;  1HWU A;  1BUX A;  1NKE A;  4KAI A;  4F2S A;  4OZ3 A;  1Z1Z A;  3UW1 A;  4ZVO B;  2JZ5 A;  1XMO F;  1YRX A;  3DLB A;  1W7W A;  3QJJ A;  2NPI A;  4DCO B;  2YY3 A;  3I55 S;  1RWX B;  5B0C A;  4QWC A;  3FCH A;  4OV6 A;  2XLJ A;  5E0O A;  3QT6 A;  3HX9 A;  1YLX A;  4Q8E A;  2LDI A;  3QSI A;  1EJ7 L;  1RSC A;  1IXK A;  2RQM A;  4PXB A;  4O3O A;  4ZPC A;  1GFW B;  1D9F A;  4JI3 J;  5HLF A;  1FEH A;  4DBQ A;  5T14 A;  3DOL A;  3QAE A;  2FJX A;  4EO6 A;  4UW2 A;  3VGU A;  4IFV A;  1FFS B;  4F8R A;  2MXY A;  4P6Q A;  1VQ7 S;  1Q86 T;  3E01 B;  3H2L A;  4ED7 A;  4UOF A;  3HHL B;  1B0T A;  1IQT A;  1FER A;  2DHX A;  2ATC B;  2R8K A;  3ZTQ A;  4WZQ A;  2DR7 A;  1HBO B;  2C3M A;  1FKA F;  1IR1 A;  4JV0 A;  2BBE A;  3V6K A;  4TLR A;  3M8Q B;  3V5R A;  2DK2 A;  2ILY A;  4NML A;  5B0D A;  4ZIW A;  4N76 A;  4X65 J;  1Q7Y T;  2KVQ E;  2DNN A;  3SCL E;  1YJT A;  5EGY A;  1ITP A;  3DRX A;  4F3Q A;  4M5H A;  2X1A A;  2EKY A;  2ZE2 A;  4JI5 J;  5KG5 A;  2I0X A;  2DEI A;  4FDF A;  2MGZ B;  2LEB A;  3D4J A;  3EZ5 A;  3GWC A;  1KHW A;  1YK9 A;  3C16 B;  4HVZ A;  3CXC R;  5J2P B;  2XGQ A;  2V8P A;  2VDH A;  2IVY A;  2L41 A;  4LSL A;  2C2E A;  4HAC B;  2W2P P;  2IPO B;  2CVE A;  4U8V A;  3G4S S;  1V9O A;  4CYU B;  1U7L A;  2EWH A;  1F9H A;  2FZK B;  1OQ3 A;  4KV8 A;  4ECQ A;  4XTT A;  1SIZ A;  5ETO A;  3KMQ A;  4DDF A;  3TJ8 A;  3H5X A;  2MZJ A;  4DXL A;  4P2X A;  4ILL A;  2EFG A;  1XR6 A;  3DLG A;  2AJ2 A;  3B4D A;  1FI4 A;  5HMY A;  3FVY A;  1OS5 A;  3MED B;  1WTF A;  1N0U A;  2OUG A;  2LQ8 A;  4JI8 J;  3F73 A;  5EX3 A;  1CG2 A;  4C0B A;  1WEL A;  4BS2 A;  1C1C A;  5FDL A;  4FF3 A;  5AXN A;  1S1V B;  2CQ1 A;  1JLC B;  4P71 A;  1QTN B;  3M30 A;  2G2Z A;  1XJW B;  3TUZ C;  3IRX B;  3TVK A;  2WSF C;  5D8H B;  3L7U A;  5DDP C;  4HH0 A;  1HNX F;  2H51 B;  3BGO P;  1RT2 B;  1VRT B;  3M1V A;  1E6Y A;  4ZVS B;  2YNG A;  5L46 A;  1JLG B;  5GVQ A;  4N56 A;  2MST A;  3BYR A;  4RNO A;  2V63 A;  4ZHR A;  2LYV A;  4X64 J;  1RT3 B;  2KRB A;  4Y65 A;  4LRA A;  5J1E B;  2R8J A;  2V9K A;  1EB0 A;  2ZJQ Q;  4UOC A;  3EYZ A;  4KO0 B;  4HEA 9;  3MDF A;  2Z2Y B;  2M3D A;  2E29 A;  2LEP A;  3H5S A;  2QLW A;  2VD3 A;  3CC2 S;  4ZLN A;  2ZOG A;  2RQ4 A;  4IG3 A;  2OEL A;  3JS9 A;  5L1I A;  5GME A;  3CUL A;  4K59 A;  1WOO A;  1OYE A;  1C1B A;  1XMB A;  4FF4 A;  1HI8 A;  3CVK A;  4K4S A;  4C11 B;  2CJB A;  2XG8 A;  4NLP A;  4IO9 Q;  4ED1 A;  5AXK A;  5L1J A;  3BSN A;  1FVS A;  4O3P A;  3HMJ G;  1KBR A;  2IC3 B;  2V8D A;  2AJQ A;  1Y5L B;  4WYL A;  5E3A A;  1T0T V;  4W90 B;  2KT2 A;  1DRZ A;  5AE3 A;  4PR6 A;  2PMZ D;  4F7V A;  3OXG A;  3PRD A;  2AYB A;  1WF2 A;  2IDL A;  3QT5 A;  1DJ0 A;  3KYL A;  2XGP A;  1WC0 A;  4ZJO A;  3N28 A;  4DG1 A;  1BQX A;  1HQE A;  5B08 A;  3MEK A;  1FK9 B;  3ENW A;  2IYI A;  3NWR A;  5KFM A;  4F2R A;  5T7L A;  3N4W A;  3WC0 A;  2RNE A;  4DSF A;  1EET A;  1Y3K A;  4PRF A;  3BKT A;  5KFY A;  5DLF A;  3FRZ A;  2I6W A;  4M5L A;  2ASJ A;  2HKE A;  5A8K A;  4F0M A;  2WSE C;  3PZP A;  5A2Q U;  3MMA A;  1TUV A;  3D6F B;  1Q53 A;  4U96 A;  2DIS A;  3OPK A;  3AAW B;  4URG A;  2HVE A;  2J5A A;  1VHF A;  1CLF A;  3GG1 A;  4DV4 J;  3SV3 A;  1SKW A;  4JI6 F;  5CA5 A;  1DZ5 A;  4N41 A;  1P27 B;  4G1I A;  1VC5 A;  5J2M A;  1AYE A;  3RGI A;  5I42 B;  2ASL A;  1ZM4 A;  3CJT A;  2PFF B;  3GV8 B;  5E2Q A;  1TKD A;  4Q5V A;  1FNX H;  1G7C B;  3SQG A;  3AXK A;  3TUP A;  5KFA A;  4DPX A;  2OP5 A;  2CNK B;  3VAM A;  4NA1 A;  4DR1 J;  2ZH7 A;  2I9S A;  2K7K A;  3T1H F;  2GHP A;  2GJF A;  1IBK J;  3SFG A;  2OML A;  1PAE X;  3DGP B;  5E3Q A;  2B9Y A;  5KFV A;  3CD5 A;  1K1Q A;  1GTE A;  1N6Q B;  4ZMM A;  1HPZ A;  5JMN A;  4JV2 A;  3IS9 B;  2MQQ A;  4JI1 F;  3ZZP A;  1JJ4 A;  3C6T B;  5D15 A;  3D6T B;  2CJQ A;  1JXE A;  4KGX B;  5KFZ A;  1WC5 A;  4X4R A;  4ZP7 A;  1XN9 A;  3M05 A;  2YH0 A;  3V4I B;  2FIU A;  1RTZ A;  2XLK A;  3PW4 A;  4ER8 A;  1IWA A;  2B4O A;  4F50 A;  4OX9 F;  2DKO B;  5KT7 A;  2EEY A;  3EGZ A;  5F0W A;  3LQV A;  1YGY A;  3GU0 A;  1SJF A;  5C2G A;  1JXL A;  4Q45 A;  1N5S A;  2MHE A;  2AWZ A;  4WJB A;  1KLN A;  2ZNZ A;  4FKY A;  1DTQ A;  2E9T A;  2RKI A;  3AHP A;  2BVZ A;  3I9Z A;  2B7B B;  3PR4 A;  3AOB A;  3I0R B;  1CS4 A;  4QYR A;  1RAB B;  2R7U A;  3TUI C;  3CC4 S;  3PG9 A;  1RA7 A;  2BDP A;  2HEK A;  2R7O A;  3M2R A;  1H7X A;  2HBY B;  1FNO A;  1UVM A;  3R2D J;  2WOM B;  4IRK A;  1N5V A;  4A8Q A;  4Q0B A;  4FVM A;  2OD6 A;  5L1L A;  3C2P A;  3J81 j;  4ZP6 A;  1RA6 A;  3GG0 A;  1XR5 A;  2OAU A;  1RWN B;  2XY5 A;  4K4X A;  4KFB A;  2VG6 A;  1K9M T;  1D09 B;  1BQN B;  4NCA A;  3D0I E;  3NS5 A;  1Q16 B;  1MLA A;  1T9U A;  4OJ3 A;  2ZJP Q;  3A8J A;  1RTI B;  5HI7 A;  2K7J A;  4I2Q A;  4AQY F;  1RAD B;  2JOQ A;  2BJD A;  3BF4 A;  1L5U A;  4NLT A;  1OIA A;  4A4J A;  4DV3 J;  4KHR A;  3D1O A;  4ED5 A;  1Q8K A;  2LEA A;  4DR3 J;  1FF2 A;  2AEF A;  3J7Y I;  1HBU B;  3DLE B;  4G1Q B;  1NK7 A;  1ZZN A;  4ED3 A;  3MHY A;  1RAO A;  1WG1 A;  1V3S A;  4YFU A;  1T8E A;  1TK8 A;  2XZD B;  1Y10 A;  5HMZ A;  3MM6 B;  3M2U A;  3GR0 A;  4MKA A;  2DH9 A;  1CPZ A;  4DR6 J;  5M2U A;  2KKH A;  2FVS A;  2IM3 A;  1NDL A;  3BYP A;  5HVF A;  2CKW A;  4HT5 A;  1FTR A;  1NM2 A;  3F44 A;  1LW0 A;  1TUW A;  1FT8 A;  4L3N A;  3VWS A;  4NI2 B;  2NYH A;  2B8Q A;  4R0J A;  2D3O R;  4CO3 A;  1QJH A;  3VCD A;  4UT4 A;  5GAH U;  3THT A;  1CJV B;  4DV1 F;  4K2X A;  4HT7 A;  3DLK A;  3OVS A;  1RT1 B;  2GMH A;  3D6M B;  5ETP A;  2OMO A;  1U49 A;  3IBW A;  1IBL J;  1I1G A;  5J2Q B;  3CCS S;  3AOD A;  4S0M A;  3CCW A;  1GTH A;  2FPH X;  3M6X A;  1CC7 A;  3UDV A;  4TU7 A;  3AD8 C;  2E1C A;  1YHQ S;  3MEG B;  4LF8 F;  1P6T A;  2Z2Z A;  2K3I A;  4F4Z A;  1KQK A;  2BJ7 A;  2WVB A;  2NSB A;  2FVP A;  1HNI A;  2CNL B;  2OFH X;  2BQU A;  3PFE A;  3OUY B;  2XS7 A;  2ZUG A;  4DR1 F;  1T11 A;  3OTE A;  1DQ8 A;  3PRB A;  2ZKU A;  2XB2 D;  3SYZ A;  3BN4 A;  4J9U E;  2HWH A;  2H1Y A;  3VAH A;  3W2V B;  2VJU A;  2EVZ A;  1S77 D;  4ECU A;  2J7W A;  3CD0 A;  1FFG B;  1S0V A;  3GIL A;  3Q8Q B;  3SMZ A;  3U27 A;  1N34 J;  3FRY A;  1U6B A;  2FGC A;  2RUG A;  1S5Z A;  4YEA A;  3PW2 A;  1NSA A;  2P6T A;  3WHI A;  4J9R A;  5KFT A;  4MFB B;  4OZ5 A;  5CYQ A;  3HCX A;  1PJ5 A;  3PO5 A;  2FGO A;  3DKD A;  2OEK A;  2HVZ A;  1DUR A;  2LA6 A;  3THP A;  2WAQ D;  5ADZ A;  3UVJ B;  4ETX A;  4R0E A;  2CPI A;  3VV2 B;  2OO4 A;  4ZP9 A;  3BBB A;  2GA7 A;  3TZY A;  2M88 A;  4CLS A;  3PW7 A;  2UXB F;  4FXW A;  3J7A N;  2QYC A;  2RUS A;  4WP9 A;  2IRX A;  2MEW A;  5GAE U;  4RBT A;  1HKA A;  1FFW B;  3K5O A;  1U45 A;  3H42 A;  1D8Y A;  1TKZ B;  1IJE B;  5CAA A;  2HZC A;  5IC4 B;  2OPP B;  2MY7 A;  2UXD F;  4CO0 A;  3KNG A;  2DNZ A;  4QWA A;  4I6Y A;  4UZC A;  2KRR A;  3ELH A;  3JSM A;  1S9E A;  2ZH4 A;  3IMQ J;  4QW8 A;  2R3V A;  4USH A;  2MZS A;  2CA9 A;  2YNI B;  4CWB A;  4DPY A;  2GGP A;  2CG8 A;  4AND A;  3W66 A;  3AB4 B;  1RE1 B;  2XMK A;  5B0G A;  5DET A;  1HA1 A;  1BHN A;  4EYI B;  5KG2 A;  2P5V A;  1JNZ B;  2VFV A;  5KT5 A;  3UE2 A;  3NMR A;  4P75 A;  3MD1 A;  5HP1 B;  1ZPW X;  4CTA B;  3H0P A;  1D9D A;  4ED8 A;  3DHW C;  5LMU J;  1JXV A;  1S6O A;  2ROE A;  1RKJ A;  4XPC A;  1H2T Z;  3TAQ A;  4DSI A;  3I5A A;  5C24 B;  3H8Y A;  1CEZ A;  1YJ9 S;  1DLO A;  1K47 A;  1FXD A;  3N0V A;  3AQP A;  1UKU A;  3HSJ A;  1F2G A;  4QR1 A;  2P9C A;  2VBY A;  4USW A;  5J2N A;  4X4S A;  4K4Z A;  4P7V A;  3M32 B;  4K50 A;  4ZN1 A;  2R2U A;  2OSR A;  2F40 A;  3F56 A;  5DDO C;  3V81 A;  5F3T A;  2W9C B;  3UD4 P;  4ZCK A;  4PAA A;  1X4C A;  1PJ6 A;  3KJF B;  4QIE A;  3PEH A;  2GX8 A;  2BAC A;  3T1A A;  4I64 A;  1M1H A;  3OL9 A;  4NRU A;  1REV B;  4RW8 B;  1L3V A;  4IH5 A;  4PYA A;  2J0Q D;  2A6M A;  3CCU S;  3SZ2 A;  1R8C A;  2UVW A;  1SQF A;  1VQP S;  1XNR J;  3QGH A;  5I4M A;  1A9N B;  1S0O A;  1N5Y B;  1IBL F;  2GQ2 A;  2A0F B;  4DX5 A;  2GIF A;  5E41 A;  4UF4 A;  1CVJ A;  4CLF A;  3OJS A;  2YKA A;  4RR5 A;  1YKW A;  2DY9 A;  5F41 A;  2HZA A;  3EX7 B;  4OHV A;  2ZH2 A;  1DAR A;  4ECR A;  3M6U A;  5ETN A;  3E01 A;  3K2Y A;  5DGA A;  3HKW A;  4ANE A;  2BYC A;  1M1G A;  4U6P A;  3HHL A;  2LEC A;  1FE4 A;  2RQK A;  2JEJ A;  3DFE A;  3CED A;  1YVF A;  3LA0 A;  1HBO A;  2BW7 A;  2DNH A;  2J76 E;  4MMO A;  4YUD A;  4N77 A;  3NBP B;  2AIR B;  3PNI A;  5IT0 A;  3M8Q A;  2KL8 A;  4JBC A;  1AA1 B;  3M2V B;  2MKC A;  3NP5 A;  2D9O A;  4C3K A;  2B4V A;  2GVD B;  4CI0 B;  3W65 A;  1RTH B;  1YJ7 A;  2NR0 A;  4LRE A;  2HAF A;  4RUC A;  2MGZ A;  2FQQ B;  1T9V A;  2FUG 9;  3C16 A;  3H4D A;  1HHQ A;  2IJN A;  1AFJ A;  3L4B C;  3M8P B;  5MAO A;  5J2P A;  2RDJ A;  2HVH A;  4DSL A;  4JV5 F;  2HQC A;  2AGP A;  4HAC A;  4AXI A;  3DXB A;  3UN3 A;  3Q8V A;  2ZDO A;  3QGI A;  4CYU A;  1K1S A;  1HNV B;  2ZUA A;  3MR5 A;  2CDR B;  3B6B A;  3FGV A;  1NAQ A;  4ZVH A;  3Q83 A;  5HVH A;  4KSE B;  1OPI A;  2Z0G A;  1R6Y A;  4IO1 A;  1U25 A;  4UST A;  4ELV A;  3FZ2 A;  4PG5 A;  4HI2 A;  4CLP A;  2IIH A;  2IBO A;  2PSZ A;  2LA4 A;  2ILZ A;  3KG1 A;  2CRL A;  3CME S;  3E51 A;  3MED A;  4P52 A;  2FHJ D;  4P7T A;  2EFQ A;  4KE5 A;  3GJT B;  2NZ4 A;  4F25 A;  2E1P A;  3UCG A;  3PX6 A;  2M8H A;  1U47 A;  2YNH B;  1I51 B;  5GAD U;  1S1V A;  2C2Z B;  1JLC A;  4NYO A;  1GX5 A;  4NZ6 A;  2XSF A;  2EFP A;  3IRX A;  2VHG A;  4WIQ A;  4LMZ A;  1SH3 A;  3CJ2 A;  1GXL A;  4HHU A;  1LWE B;  2HFU A;  3HD1 A;  4OI6 A;  3BS9 A;  3G8T A;  2Z8Q A;  4DZD A;  1RT2 A;  1VRT A;  4NXN F;  3SI8 A;  1JLG A;  2BR0 A;  1X60 A;  1NHV A;  3K89 A;  4NWB A;  3DMJ B;  1RT3 A;  4N47 A;  5J1E A;  3I0S B;  3LPY A;  2AGO A;  4WK3 A;  1HR0 F;  4OYB A;  4CO4 A;  2R8I A;  1RB0 A;  1JMT A;  4KO0 A;  4PG7 A;  1GEH A;  4HHH A;  1EX8 A;  2C3U A;  2XWY A;  5B0E A;  4TQS A;  2W9B B;  1NDK A;  4UQT A;  2CQ4 A;  1KOH A;  1S79 A;  4Y2C A;  4F4Y A;  1IR0 A;  4MH8 A;  3UI3 A;  2O67 A;  2MDA A;  1I3O B;  3AJ1 A;  1RWU A;  1ZET A;  2PEH A;  2UUB J;  2BM0 A;  4C11 A;  1T3N A;  2VH7 A;  3KK3 B;  1IM6 A;  2ZBR A;  1OSD A;  4NCG B;  2GNK A;  2MKY A;  3JTP A;  1AZS B;  2IC3 A;  5HN0 A;  3ULH A;  2IMO A;  1V5I B;  3HVW A;  4DI6 A;  4FNH A;  2XMM A;  3C6U B;  3WX8 A;  4G65 A;  5L1K A;  3L7O A;  2V67 A;  2XLI A;  2HNZ B;  2KFN A;  3PYF A;  4EBE A;  1N48 A;  4TU9 A;  2DIV A;  4JYA F;  3L09 A;  4ZJL A;  2WTF A;  2W8L A;  1VQ6 S;  2E5I A;  1WKJ A;  3HFK A;  2XY7 A;  3CIZ A;  3FCV A;  2VC0 A;  2NS1 B;  2V8G A;  3S8S A;  5L38 A;  4QW9 A;  2YKQ A;  2IVF B;  4Z7Y A;  3QSY B;  1ZTT A;  1V5V A;  4A47 A;  2UU9 J;  3SEO A;  4KH1 B;  1RAI B;  3DLL Q;  2AJ0 A;  2BRK A;  2YKN B;  3KUH A;  3PW5 A;  1LKZ A;  1O51 A;  5LMN J;  5EWF A;  4URS A;  4ZPV R;  3DDN A;  1JJ2 R;  2KB2 A;  1O8B A;  4ID5 B;  4O4G B;  2L08 A;  1VCT A;  3L7P A;  5KOX A;  3OTD A;  3TOQ A;  3RB4 A;  4PAB A;  3TO8 A;  5IQQ A;  5I42 A;  1WHV A;  5HAT A;  3QT8 A;  3QJP A;  3UD5 A;  2OKQ A;  5K14 B;  1RWW B;  4C0H A;  1TFY A;  3TW0 A;  2GJ2 A;  1JNR B;  3GIJ A;  3PAC A;  3D0G E;  2F8M A;  3MM5 A;  1X8D A;  1QAJ A;  4WCE Q;  3DHX A;  4D3H A;  3CWJ A;  5HQ8 A;  1VDH A;  4RU2 A;  1MSW D;  2BE2 B;  3DDK A;  1U2C A;  2MQO A;  1B7F A;  2ASY A;  3DGP A;  2AW0 A;  4C0O C;  2ZZN A;  5FLX U;  3WZ0 A;  1N6Q A;  4NZ7 A;  2MSS A;  4A8F A;  2XBP A;  3IS9 A;  1HNW J;  1N88 A;  3C6T A;  2IM1 A;  1R8P A;  5DLG A;  3AA8 A;  4ZJQ A;  1HYS B;  4B08 A;  4OYI A;  2AEJ A;  5H9F K;  4TQR A;  4YR2 A;  1OY6 A;  4H4K C;  3V4I A;  3NCQ A;  4USK A;  1HNZ F;  1M5K C;  1UEV A;  5MLC V;  2BX6 A;  4WXO A;  2VKR A;  1Y9O A;  1N32 F;  1YBU A;  2DGV A;  2BOP A;  4IDK B;  3I96 A;  2BM1 A;  1U2F A;  1H98 A;  3S6E A;  3RW7 A;  4MYT A;  4KHP F;  5CZV A;  4EBC A;  4C97 A;  4OL8 A;  3SSQ A;  4EBD A;  5RUB A;  5B0B A;  4RPF A;  2LXF A;  2LQ9 A;  3U1M A;  4LQ9 A;  5GMK a;  3ILJ A;  3I0R A;  2HFV A;  5ETL A;  4P10 A;  2DHG A;  2A10 A;  3W7B A;  1HW9 A;  2WOM A;  1YTY A;  1VJQ A;  5CQG A;  1VHI A;  3IM8 A;  2VFT A;  4ED4 A;  2YXL A;  3K8V A;  3UD3 P;  3OHB A;  1TKT B;  5EUH A;  3CJQ A;  2CJA A;  1QVF R;  3NKY A;  1S1W B;  4GKJ F;  4ZS6 A;  1BQN A;  4BLG A;  4TY9 A;  4ID8 A;  3HSG A;  1RAJ A;  1RTI A;  3Q8S B;  1FJG J;  5FJ4 A;  4OZN A;  5DG9 A;  1XBW A;  4QWE A;  1FKO A;  4Q2L A;  5KG6 A;  1WSV A;  2M52 A;  3DOK B;  1FES A;  2BRL A;  4RLE A;  1C0U B;  3MPW A;  3TAR A;  1S6P B;  2CPE A;  1NND A;  4GC6 A;  1HBU A;  3DLE A;  4G1Q A;  2GC8 A;  2NPF A;  5IWA F;  5KFP A;  2UU9 F;  1U6Z A;  4DV0 J;  2ERR A;  3NGT A;  2B9E A;  2ALY B;  1RBL A;  3MM6 A;  2NSC A;  4AL7 A;  1QSY A;  3LGN A;  1TVR B;  4M5G A;  2JRS A;  5F8G A;  4MIW A;  1MN7 A;  3KWM A;  2KHC A;  4MK9 A;  4QBU A;  4GKK F;  5HSP A;  1B4S A;  5BYQ A;  4B9U A;  1R0B G;  1N4L A;  3CJ0 A;  3OTO J;  1CSJ A;  1TL5 A;  4NI2 A;  1QAX A;  4IRD A;  4NLY A;  1CJV A;  1RT7 B;  2DRA A;  2DT9 A;  4O3N A;  5BR8 F;  3ZTP A;  3VAL A;  3KXD A;  5J2Q A;  2KXF A;  4A48 A;  1H74 A;  3OL8 A;  4P2F A;  5A76 A;  2VQF F;  5H9E J;  2C1E B;  4LRF A;  3DRY A;  5K8M A;  4LF5 F;  5DDR C;  1NHU A;  1Y3J A;  3MEG A;  3QID A;  3U7J A;  2WK4 A;  2GJI A;  5KFN A;  3I5B A;  1YDL A;  8ATC B;  1PIL A;  3OUY A;  1V3R A;  4WE1 B;  3VZH A;  3ZZO A;  2RB7 A;  2UXC J;  4V1A k;  5D0G A;  4I67 A;  2ADB A;  3W2V A;  4J9K A;  1F1B B;  4OI3 A;  3GFY A;  3FBE A;  4JI0 F;  4WFB Q;  4OYO A;  2MZQ A;  2ZNY A;  1VBX A;  2DH7 A;  1PC4 A;  3KHH A;  4G1P A;  4L74 A;  2QT7 A;  5EDW A;  4CT8 A;  4DL3 A;  2YWH A;  2XCP A;  4MFB A;  4PPD A;  1OO0 B;  4B9T A;  2MKK A;  3R97 A;  4IKA A;  2H54 B;  2KI2 A;  1NPK A;  3UVJ A;  4NRT A;  1BMQ B;  2KT5 A;  1VYA A;  3CJ4 A;  1A7G E;  4PYD A;  3BR8 A;  5K8O A;  2A2D A;  1DBD A;  4NEZ A;  4DU8 A;  3W3S A;  4O3S A;  1AW0 A;  1TKZ A;  2ZVI A;  1EQM A;  2P9E A;  4J9M A;  2DNQ A;  3NAI A;  2ZZM A;  2OPP A;  3ZTR A;  1IBM F;  2VJV A;  2PA3 A;  1KEK A;  4LRB A;  3FBF A;  1K0T A;  2YNI A;  3LGH A;  3TP2 A;  2MJU A;  1BQM B;  4A8K A;  4TLQ A;  2ZM6 F;  4G6V B;  3CD6 S;  2VQE F;  2C3Y A;  2V5H G;  2RU3 A;  2Q66 A;  1BE4 A;  4C9D A;  4KJI A;  1FXR A;  1RWM B;  1JLF B;  2OEM A;  4PG4 A;  2HIQ A;  5HP1 A;  1HBM B;  2PN6 A;  4CTA A;  5F8M A;  2D74 B;  4WPA A;  1T3O A;  2QMX A;  4K8R A;  3PJ9 A;  3HHK A;  2FJE B;  9RUB A;  1VRU B;  3QYY A;  1X4D A;  4QJV A;  3D3B J;  4LR9 A;  1NU4 A;  1KVK A;  3HHD A;  4TXS A;  3JQJ A;  2UV8 G;  1I5O B;  1FTC A;  1S1T B;  2H5E A;  1NZA A;  2PGC A;  2LVW A;  1QAY A;  1IKX B;  1NJW A;  5CD4 A;  2NQP A;  4DCP B;  2J7U A;  3LAK A;  3M32 A;  3BBC A;  2Y0B B;  1F2H A;  3EVM A;  1YJV A;  2YPZ A;  2PE8 A;  3CJK B;  5GAG U;  1VQ8 S;  2X7I A;  4DV0 F;  3TVZ A;  3JYT B;  3KLF B;  3OFF A;  3CW2 C;  1F3F A;  2HK2 A;  2W2M P;  3K5L A;  2W9C A;  1LFW A;  3MEE B;  1VJW A;  4RZR A;  4LFC J;  4YS2 A;  2GO9 A;  2JEG A;  2E9R X;  4URQ U;  3OTO F;  1SCJ B;  3GJR B;  4ECS A;  3MFH A;  3NRB A;  2WW8 A;  3Q8Y A;  3AJ2 A;  4LVO P;  2NXN A;  1REV A;  4DPW A;  2E1R A;  4RW8 A;  2EK1 A;  2AEM A;  2V34 A;  1RHM B;  4ED2 A;  3RG6 A;  2VB6 A;  9ATC B;  3UR3 C;  3D0H E;  2BQ3 A;  3RTV A;  2RF2 B;  4I2P B;  4U67 Q;  5ETR A;  3FEX B;  3T6J A;  1N5Y A;  1RWP B;  1S9F A;  2CUY A;  2KJW A;  4WTY A;  3GV5 B;  1IKV B;  4RW6 B;  2VG7 A;  4B3S J;  1NJY A;  1QVG R;  4B3T J;  2HHS A;  2ZH3 A;  1LXJ A;  3Q22 A;  2LU1 A;  2WHO A;  4OI2 A;  4RWX A;  2B7C B;  3IBF B;  4PXC A;  1CUL A;  2FVC A;  2UVR A;  3ZO7 A;  4QU6 A;  2U1A A;  3MM7 B;  4PCQ A;  1R43 A;  3TAP A;  1R8B A;  4UZB A;  1MWQ A;  2IJF A;  1AT1 B;  4OX6 A;  1WDT A;  5KFC A;  2YX1 A;  4LQ3 A;  3R3T A;  4K0K F;  3AT1 B;  2UXC F;  1NK9 A;  5HBM B;  1ZS6 A;  2KT3 A;  3AB2 B;  1RU1 A;  2OPR B;  3PX0 A;  4ZVQ B;  4PKD B;  3IFE A;  5AE1 A;  1UW4 A;  3NBP A;  2PMW A;  2W25 A;  1CJU B;  1XWL A;  4QIW D;  3AFG A;  1RUS A;  3M2V A;  2J8A A;  3C46 A;  3BKU A;  1MW7 A;  5F0U A;  1BGX T;  2GVD A;  4E2F B;  2Q43 A;  2F4V F;  3P4U B;  4O44 B;  1LNQ A;  3MGJ A;  1RTH A;  2J6T A;  2EC0 A;  2ROP A;  4NXM J;  4NLS A;  3M8P A;  3FNN A;  2XTJ P;  2QFJ A;  3W5X A;  3QZ7 A;  1NKC A;  4K5S A;  4YHH F;  2HFN A;  1U1L A;  5JXS A;  4DU7 A;  1RT5 A;  2O01 C;  3OR1 B;  1WAC A;  3G8S A;  1HNV A;  1Q8L A;  4RW7 B;  3VAG A;  4JUZ A;  3DM2 B;  2M7S A;  2YX4 A;  4FPI A;  3JQM A;  4FNI A;  5HK4 A;  2KM8 B;  2P6S A;  3UWT A;  1QM9 A;  1HFE L;  1S4E A;  2VZ9 A;  3PRV A;  1RT6 B;  2LKZ A;  2EW9 A;  4RUA A;  3QO9 B;  4LF9 F;  2VPW B;  1SV5 B;  3OLA A;  1I94 F;  3DLH A;  2VBW A;  2FDN A;  1U0S A;  1Z2Z A;  1ZZF A;  2L3M A;  3J80 Y;  3MUV P;  1TK5 A;  4DUY F;  4X84 A;  3T9N A;  4WFA Q;  3RRG A;  4WP8 A;  1R0A B;  1HW8 A;  2J0W A;  3T1Y J;  2YNH A;  1VQN S;  1U6F A;  1CC8 A;  1RGV A;  4O3R A;  5E3P A;  3ETM A;  1KLM B;  2K8G A;  3BM7 A;  4ZPT R;  3MM8 B;  1ZPV A;  1R89 A;  1VGY A;  1U02 A;  2N7Y A;  3VQT A;  1VLO A;  2A3J A;  2FVQ A;  2VBZ A;  1GMV A;  1LWE A;  4X4T A;  5K8P A;  4LFB F;  2LQ5 A;  2V50 A;  5KFR A;  6FD1 A;  2UUA F;  4IUF A;  1PC5 A;  4BWM A;  2F8H A;  5B7W A;  3DI6 B;  1D1U A;  3HJF A;  1IKY B;  3DMJ A;  4KYZ A;  3I87 A;  2KHD A;  3IR7 B;  1U8S A;  1WDD A;  3ZC4 A;  4NL5 A;  3MR6 A;  2DGQ A;  2P9G A;  2F5G A;  4P73 A;  3C14 B;  3R7N B;  1FX4 A;  1YBA A;  2W9B A;  2HUR A;  4OZ2 A;  2XS2 A;  3HUL A;  2AT1 B;  1N8R T;  1FA0 A;  4ZLL A;  2HLU A;  2HZV A;  1LWF B;  2VBX A;  1X9M A;  4XPE A;  2E7V A;  5A0Y B;  1YX2 A;  1ZAV A;  1XMO J;  2V69 A;  2I5J B;  4O0N A;  4X66 F;  2WON B;  2WB1 D;  3GB0 A;  1S7H A;  3GYG A;  4D3G A;  4DR5 F;  3HSZ A;  2RQC A;  2QE5 A;  3KK3 A;  3SIP B;  3JB9 k;  1RWK B;  4BBY A;  3R9L A;  2JC1 A;  1GMU A;  4CQ1 A;  4CIO A;  1AZS A;  3AA9 A;  3MMC A;  3W61 A;  4NCB A;  3BSA A;  5LJ5 Y;  2OD4 A;  5DM6 Q;  3C6U A;  2HNZ A;  1Q82 T;  4EU0 A;  2B9X A;  3KJN B;  5LSL A;  2CJX B;  3ZZ0 A;  2D41 A;  2CPF A;  1M1K T;  1SL2 A;  2YTC A;  1T95 A;  3PYD A;  4DHV A;  2DGT A;  2CQP A;  3G96 A;  2YWE A;  3DRS B;  3W8P A;  4B9S A;  3OSP A;  1WC6 A;  4U8Y A;  1S72 S;  2WBM A;  3IAS 9;  3CPW R;  1LXN A;  2R7S A;  4NLR A;  3RAX A;  3R5G A;  4JI4 F;  1LOU A;  1A6L A;  1JLB B;  3FSY A;  4ILR A;  4DF8 A;  4K5R A;  3NXZ A;  1NK4 A;  3R27 A;  3LH2 S;  4ITS A;  2R8H A;  2YKN A;  2I8E A;  4R8U B;  2CQD A;  1GK8 A;  3OL7 A;  4K4Y A;  5DO2 A;  4ID5 A;  1FJ7 A;  1X4F A;  1HMV B;  4O4G A;  3TI0 A;  1X0P A;  2P2C B;  5D78 A;  3P49 B;  3E3X A;  4NXM F;  4YB1 P;  1X0F A;  3Q23 A;  4M94 A;  2O1P A;  3M6V A;  5KG3 A;  1VQ5 S;  5KG7 A;  4KC5 A;  2F65 A;  3ZZY A;  4GC7 A;  1KQS R;  1M0S A;  4LIR A;  2DO4 A;  3MCN A;  1HQ2 A;  4LSN B;  3SSR A;  5SUH A;  3AXM A;  1R8H A;  3I9V 9;  3Q89 A;  1RK8 A;  4ZOS A;  1M5H A;  1HD1 A;  3PIO Q;  1SC1 B;  2BE2 A;  3IR5 B;  2ZEJ A;  3HHE A;  4OYZ A;  4PZV A;  3ADA C;  4LRC A;  3TJA A;  2JFD A;  4RNM A;  2R7V A;  1T94 A;  2DNM A;  2KXH A;  3L9Z A;  3T5J A;  4WXW A;  1PYO B;  2VC1 A;  4OYA A;  4IYQ A;  2V68 A;  4PG8 A;  2AYE A;  3K5M A;  1SH2 A;  3ZXW A;  1HYS A;  2KG0 A;  3IBC B;  2RDD A;  2DR6 A;  2HHQ A;  2LU2 A;  2XI3 A;  3SCJ E;  2OIH A;  4FYD A;  1Y5N B;  1JX4 A;  2XZT B;  2GAH C;  2KYZ A;  2IY5 B;  4GVB B;  1FRK A;  2XMU A;  5C25 B;  2YWF A;  4IDK A;  1UFL A;  3GJS B;  5HRO B;  5E7O B;  3FBC A;  1U1N A;  3ZTO A;  3T41 A;  4XDD A;  5HAN A;  4FPR A;  3IXQ A;  2AQ4 A;  3P96 A;  5A8W B;  2MY8 A;  4PWU A;  3PKM A;  4E98 A;  2CQ0 A;  2BJ9 A;  2W4C A;  3QNW B;  2HGL A;  2ZHB A;  2F8E X;  1S76 D;  1NSK L;  2HGN A;  3GYX B;  5F9N A;  1RWV B;  5LJ3 Y;  2PII A;  4IR1 A;  4A8Y A;  3MEC B;  3TQ1 A;  3BH6 B;  4HR2 A;  2CJY B;  4DFP A;  3OD2 A;  1TKT A;  2XNQ A;  3ITH B;  2XMA A;  1X4G A;  3GZ7 A;  2IRY A;  1S1W A;  3NWG A;  1FDD A;  3V2U C;  5HJX A;  4ZCI A;  1GQE A;  4DOZ A;  4WFZ A;  4DX8 H;  4ALZ A;  4OYM A;  2ZHA A;  1V3Z A;  1YZ7 A;  3BSO A;  4J90 A;  3HHN B;  2CQ2 A;  2HAI A;  3RUB L;  3SQO P;  2LXI A;  2MZT A;  3CIM A;  1O5J A;  5A6W A;  3DOK A;  2W8K A;  1VK3 A;  1H7W A;  3O5T B;  4OIX A;  2Q6B A;  4B3O B;  3UCU P;  4IG0 B;  4KH0 B;  4KBI A;  4TU8 A;  2FZG B;  3RB3 A;  3AQO A;  2B4U A;  4TVA B;  1VFJ A;  5H9F J;  2Q3P A;  2J0X A;  1U26 A;  3S7R A;  2BZ2 A;  5D77 A;  2UZA A;  1VIO A;  3CDE A;  1JB0 C;  1PJ7 A;  3GYN A;  4DV6 J;  3QPI A;  1MMD A;  1TVR A;  4ZPB A;  3TR5 A;  1KR4 A;  1HQU B;  4MJK A;  2KTQ A;  2D69 A;  3M9O B;  3RBX A;  3H2V E;  2D7S A;  1Z2L A;  4RU9 A;  4CLY A;  2NUH A;  2JEF A;  3AH6 A;  4JOU A;  4JI6 J;  1D0E A;  1RT7 A;  3VHQ A;  5KT6 A;  4V19 X;  1TL7 B;  4OHW A;  4LF7 F;  2WVD A;  5D4P A;  3CDU A;  5JVG Q;  3I4P A;  2XYP B;  4K4W A;  1R0C B;  2FY1 A;  1UZD A;  4ELT A;  1IWG A;  4ERD A;  1T9X A;  1B3T A;  5FD1 A;  2BJE A;  1HIY A;  3EGV A;  3LTO A;  1SKU B;  3EDQ B;  1U0H B;  5KFE A;  3DRP B;  3OV7 A;  3OT9 A;  3UNG C;  2GO8 A;  3HLU A;  2HHP A;  1JJH A;  1XNQ F;  4I6W A;  3MCO A;  5LM7 E;  4OHX A;  3FUY A;  1N33 F;  4DPO A;  3TA2 A;  4WE1 A;  3OVA A;  4OYP A;  5T41 A;  3T1H J;  2HNY B;  1KWM A;  4OFZ A;  2AYG A;  2XWX A;  4OJ1 A;  1WOP A;  2AF6 A;  2ADC A;  1KVI A;  3J80 U;  4F0K A;  4M95 A;  2HFZ A;  3WQP A;  2ZH1 A;  2GV1 A;  5DG7 A;  3PO4 A;  3I82 A;  2FHJ A;  2MQL A;  1P1T A;  4DX7 A;  3VVU A;  1TL3 B;  4JI1 J;  4RNF A;  3KK1 B;  3Q0A A;  3ONQ A;  3GII A;  4H4K A;  2R9L A;  4MKV A;  1WHX A;  2R7R A;  3H40 A;  1VBZ A;  3D28 A;  2QA2 A;  5H1S V;  2FLO A;  3OQ2 A;  3SXL A;  4J9S A;  3ETO A;  3WX4 A;  4KR0 B;  4OX9 J;  2ZJR Q;  3DOM B;  1U1O A;  1F3V A;  1RLD A;  4DSK A;  4NLD A;  3A8E A;  3RW6 A;  1PAU B;  3FMB A;  3FQL A;  4QR0 A;  3D54 A;  2O66 A;  1OWX A;  2NXC A;  5I3U B;  4CLW A;  1E6Y B;  3J7Y U;  2XMJ A;  2YNG B;  2ZBI A;  2C2O B;  3G8Q A;  3ISZ A;  3GE9 A;  1RP5 A;  2DO0 A;  2E7W A;  3R8Y A;  2IBK A;  4QWD A;  2AX1 A;  1G2E A;  4DSE A;  1IN0 A;  3SSS A;  2W2Q P;  3POT A;  1HI1 A;  2NZC A;  2JWN A;  1MMN A;  1HL6 A;  1K0V A;  2CFX A;  4UUX A;  1BQM A;  4OYW A;  2Y1L B;  2DXE A;  5AE2 A;  1YRT A;  4M5I A;  5IFM A;  1UW9 A;  4ZVG A;  3BGL A;  1W2I A;  3VAI A;  1JLF A;  1B7Y B;  5IOL A;  2APO A;  2XO7 A;  3OLB A;  3KJV B;  1T03 B;  2C3P A;  2FHO B;  2ZH5 A;  2C2M B;  4NLW A;  1ZM2 A;  2B6A B;  1BC6 A;  1M5S A;  1MU2 B;  2DHH A;  1VRU A;  1Y5I B;  1NKB A;  3PTW A;  4Q7A A;  4AL6 A;  3OXL A;  4AQY J;  4WZM A;  4A8O A;  2HRT A;  3O44 A;  2FJV A;  5CCM A;  2IJR A;  1RBA A;  1S49 A;  1HWI A;  4I6A A;  1S1T A;  3R5C A;  3N6N A;  1FRI A;  3LAN A;  3VTI A;  1IKX A;  3KLI B;  2YKP A;  2IVM A;  3Q8U A;  4ZVR B;  1LV5 A;  1YWX A;  2MB0 B;  4UQG A;  3CJK A;  2BV3 A;  4CLT A;  4DG1 B;  3ICL A;  2A2C A;  2YWW A;  1KVJ A;  3JYT A;  3KLF A;  3CJ8 A;  4DV6 F;  2HHH F;  2AHO B;  3MEE A;  1Q78 A;  4A8W A;  3PJX A;  1D3W A;  2DCU B;  4I4B A;  1SJR A;  2HRY A;  2ZOF A;  2R7Q A;  4HTI A;  1LWX A;  2QMW A;  1MRO B;  3W62 A;  4ZN3 A;  2MQM A;  2XY6 A;  2BAB A;  3QWU A;  8RUC A;  2HSE B;  4UY8 T;  4MK7 A;  2ZVS A;  3OHA A;  1EKR A;  3CCM S;  4DV1 J;  3PHT A;  3W5Y A;  2RF2 A;  4I2P A;  2XMV A;  5CAB A;  3UDC A;  3PR5 B;  1C4C A;  2D1C A;  4DV7 F;  1IKV A;  2XSJ B;  4RW6 A;  1QSS A;  1NRK A;  5L8R C;  2Y9H A;  1FDN A;  4TYA A;  2Z2L A;  3A1Y G;  1HHS A;  5CD4 H;  1PG5 B;  3CJ3 A;  2C42 A;  5BYR A;  4DV5 F;  4LF8 J;  3PM9 A;  2J8S A;  2CQI A;  3NG8 A;  2HBQ B;  3EPG A;  3MM7 A;  4KPC A;  3NS6 A;  5KAK A;  3IO1 A;  1VQM S;  2ZFH A;  1WD6 A;  4X2B A;  4DUZ J;  2QN6 B;  1NB2 A;  1XER A;  4NZ0 A;  2W2O P;  2QLX A;  5F8J A;  2CPZ A;  3FDS A;  5HBM A;  3KLG B;  2OPR A;  1S48 A;  1X4E A;  1KP6 A;  3EMT A;  3AOC A;  3DGV A;  3FFI B;  1CJU A;  4JV1 A;  2NXE A;  2FYX A;  2UVV A;  4KQZ A;  2RD5 C;  4RO0 A;  4XDC A;  2NYI A;  2OGU A;  4DN0 A;  3HM9 A;  3HVA A;  3DNC A;  4O44 A;  1H38 A;  4FKX A;  4DL2 A;  2M70 A;  2NRE A;  4NLX A;  1UEK A;  2V94 A;  3KHL A;  2FHM A;  4X62 F;  4ECV A;  4K4U A;  4CM0 A;  2X1B A;  1DAX A;  5C5J A;  2YKM B;  3I56 S;  3PY8 A;  1R27 B;  1HD0 A;  2MZR A;  2F4F A;  3CDA A;  2I2Y A;  3EVO A;  1YZ6 A;  4CLK A;  3QMQ A;  2RHQ B;  3QAU A;  2UXB J;  2XM3 A;  1S12 A;  2KO1 A;  3OR1 A;  1XEZ A;  5EWG A;  2RSQ A;  4RW7 A;  1CQM A;  1NSP A;  3DM2 A;  2XCA A;  2UUC F;  4KIA A;  4RNH A;  5K20 B;  3QJL A;  2D3Z A;  2ZC4 A;  1G1X A;  4KHM A;  1S6Q B;  4L3K A;  1UFW A;  4M5D B;  2UXD J;  4OV1 A;  1RT6 A;  4OI4 A;  3K7R A;  3QFH A;  4NYP A;  3QO9 A;  1XMQ F;  2KDO A;  3NGR A;  1FD8 A;  3CJS A;  1F6T A;  3D1Q A;  1SV5 A;  4RJV A;  5DZ6 A;  1HWJ A;  2G4B A;  5IM0 A;  2J9D A;  2BKN A;  3Q8R B;  2EC2 A;  2FD2 A;  3VGS A;  1R0A A;  1O0P A;  4C6A A;  2DIU A;  1HBN B;  1AXQ A;  1L3T A;  4JI7 F;  2DGX A;  4X4N A;  4DN9 A;  4BDP A;  1HLW A;  4CLZ A;  2IAJ A;  4P2M A;  3ZZZ A;  3QWP A;  1KLM A;  1EIY B;  1J27 A;  1PIE A;  1GNK A;  3T3F A;  3MM8 A;  4RBV A;  4WKY A;  3D5M A;  3MAH A;  1IVZ A;  1H3D A;  1J5E F;  5E5N A;  3KHG A;  3AD7 C;  1QLN A;  3MUT P;  4XIU A;  1UAW A;  1Q7L B;  3H98 A;  2B4P A;  3SDE B;  2VU5 A;  2C2K B;  5CH7 B;  4IFY B;  3DI6 A;  4OLP A;  1IKY A;  4J7C A;  4WP3 A;  3HVR A;  3MAQ A;  5ETT A;  3LWL A;  2MKI A;  2PI5 A;  5F9L A;  2J0S D;  1FKP B;  2E5J A;  4ZLP A;  4FYW B;  2X3D A;  1NEE A;  2Z30 B;  4P9S A;  3C14 A;  3MCS A;  1W26 A;  2DGS A;  1T02 A;  2HBZ B;  2V0N A;  1SKR A;  1TFW A;  2QFI A;  1ROF A;  2Y3Y A;  2LQB A;  1Q4R A;  2YQ1 A;  4USU A;  4QOT A;  1NZ8 A;  4MK8 A;  2QSF A;  1OJ4 A;  2R2R A;  3R5D A;  1LWF A;  2AGQ A;  2JH3 A;  3FEZ A;  5A0Y A;  2I5J A;  2BUN A;  2WON A;  3GCW P;  3QRP A;  4F02 A;  1FJE B;  1RTD B;  2J9E A;  1G4C A;  1ZM9 A;  3N9U C;  1H6K X;  5IS2 A;  1UVK A;  1YRU A;  2CQB A;  3W9I A;  3SCI E;  2YVS A;  2B56 A;  1CJK A;  1SUQ B;  5IQ6 A;  1F0X A;  4PPZ A;  2BJ3 A;  1UJ6 A;  3CMA S;  3FZB A;  4ZIV A;  5FII A;  4ZVE A;  2WVC A;  3UFC X;  3CUN A;  1R31 A;  2EBE A;  1RKI A;  3NS7 B;  1BXN A;  2GQQ A;  2DHS A;  3DRS A;  4ZCL A;  2OPS B;  3EIC A;  2BJ8 A;  4AD6 A;  4DUZ F;  4PG6 A;  1TU0 B;  1E6V B;  4LR8 A;  1JWW A;  4EK2 A;  2QSW A;  3BSC A;  3EVW A;  5D0R A;  2CNN B;  1RXO B;  3CCJ S;  5IXU A;  1JLB A;  2JLE A;  4B17 A;  4YDD B;  4DR4 J;  1OY9 A;  2NUU G;  2QEX S;  5EHH A;  3G2X A;  3WC2 A;  1PBA A;  3BO3 A;  4A8X A;  1OPZ A;  2B5J B;  4MKY A;  1LW2 B;  1WF0 A;  2G0J A;  3HO1 A;  2CIM A;  5KFW A;  4MAK A;  3B54 A;  2IYG A;  1BWE A;  2BJ1 A;  2Y1I A;  1ZA2 B;  4AT1 B;  4LF1 A;  4DL0 C;  2FHK A;  3EWG A;  2RS2 A;  4R8U A;  1PSD A;  1ZM3 A;  4LF4 J;  1QD1 A;  2R2T A;  5CCL A;  2QA1 A;  2ZC3 A;  4J9L A;  1SXL A;  1HMV A;  1Q79 A;  3US5 A;  1HWL A;  4EO8 A;  2ZZT A;  1HHT P;  5THW A;  1VQO S;  4JV5 J;  3TA1 A;  2DH8 A;  3NGD A;  5HJY A;  3MR7 A;  1S1X B;  1S59 A;  4DL5 A;  2EPI A;  1VQK S;  3BPD A;  2YQ3 A;  1KDN A;  2YBV A;  4I1T A;  2EFV A;  1AB8 A;  4BC9 A;  2GML A;  5KFH A;  4LF6 F;  4LSN A;  2FJB B;  2QJ3 A;  3M9M B;  4LFA F;  3P8B B;  4TY8 B;  4PEO A;  1S9G B;  1PYT A;  2VPX B;  1NME B;  1EAY C;  3QZ8 A;  1WJ9 A;  3PXG a;  1MG7 A;  1FWP A;  3HVT B;  5FLX Y;  4TNO A;  2MJN A;  4N7T A;  4FZV A;  5ETM A;  1JKH B;  1ZH5 A;  3CCE S;  4L76 A;  4P2S A;  2HQD A;  3J7Z T;  5B0A A;  3BO4 A;  1FWL A;  1TZ0 A;  1AUS L;  1DQA A;  4Y2A A;  3RJM B;  4F67 A;  2MYF A;  2W4P A;  2AJF E;  5B09 A;  4DZ6 A;  3MXH P;  1S1U B;  1FE0 A;  5E33 A;  2YX7 A;  2BW2 A;  4NXN J;  3O6Q A;  4G3I A;  4RKU C;  1NLK L;  3J7A 1;  4ICL B;  4GVB A;  2LQJ A;  5C25 A;  3KJQ B;  2OI2 A;  5HRO A;  4NAS A;  2DEJ A;  2G9O A;  4M5M A;  1HR0 J;  2EFO A;  4CDI A;  2DB1 A;  4F4X A;  3D2W A;  2FJA B;  2R7W A;  4HH1 A;  4YY3 F;  4ES2 A;  5A8W A;  3V6H A;  2VON A;  1ZAW A;  2K06 A;  2ZD1 B;  3CNQ P;  4DS5 A;  3VAK A;  2V8V A;  2Z58 B;  1W2B R;  2PFD A;  3LP2 B;  3N01 A;  2K3K A;  2FZC B;  3LAL A;  1N5Q A;  3JAM U;  4LVN P;  4Y34 A;  2M2B A;  5IC6 B;  3MEC A;  4C7Q A;  4WFY A;  1QTM A;  4QU7 A;  3BQ1 A;  1TEL A;  3ITH A;  4GO5 X;  2Y8Y A;  2VG5 B;  1EQ0 A;  3HF5 A;  3S1T A;  3K5N A;  1RHU B;  2QYG A;  1KNZ A;  3CGI A;  3V6D B;  5DZ7 A;  4CCH A;  5DQI A;  1LEO A;  4JYA J;  1L3K A;  2W7A A;  2X51 A;  3P5B P;  2C3O A;  1Q5V A;  2CZV C;  3MPU B;  3FK4 A;  3GSD A;  2G1H A;  1FRJ A;  2GHV C;  4XAK A;  3W8G A;  1YSJ A;  3OFG A;  1SJQ A;  2OPQ B;  2ALZ A;  4B3O A;  2DNP A;  4IG0 A;  4IQM A;  1N36 F;  1NO8 A;  1NDP A;  2ZDP A;  5EN1 A;  2DR8 A;  3Q24 A;  4DR4 F;  3KLH B;  2HS4 A;  2B0G A;  3DCA A;  3JSR A;  2E5L F;  1S4F A;  2H65 B;  3W2W B;  4FF2 A;  1PCA A;  4EWT A;  1HQU A;  1H72 C;  2WRM A;  4DQP A;  3UO0 A;  3ILO A;  1YJW S;  3D66 A;  2VA2 A;  1K44 A;  3H5Y A;  1EP4 B;  4LF4 F;  2BEF A;  3BN7 A;  2OHD A;  4MTP A;  4FBT A;  2KYX A;  4M5J A;  1VLY A;  3MD3 A;  2M5Y A;  5K9F A;  5LSO A;  1SJ1 A;  3Q2T C;  2YPY A;  1R3N A;  5KG1 A;  3TJ9 A;  2E5H A;  1FNM A;  1TL7 A;  4WWS A;  4NMX A;  3M7V A;  2ZOM A;  4DL7 A;  5KFS A;  3OVB A;  4ZIT A;  4AXJ A;  1SQE A;  1U0H A;  3PFO A;  3DRP A;  1T7P A;  1RHR B;  4NX9 A;  3IR6 B;  3PIP Q;  4XO0 A;  5E3R A;  1IJF B;  3M8Y A;  5KOW A;  1BLU A;  3HPO A;  4U95 A;  3MTK A;  4YR0 A;  1J2V A;  3H25 A;  2HNY A;  3CCR S;  5SZT A;  2PT0 A;  2K1R B;  3GIR A;  2QC3 A;  4U7C A;  3B82 A;  2RIJ A;  2VOO A;  4PWD B;  5AJ3 J;  2MLY A;  2X3G A;  1TL3 A;  4USJ C;  5KT2 A;  2DHA A;  3KK1 A;  2ATL A;  3QAT A;  2HND B;  3R7B B;  1TL4 A;  4LBH A;  3A4T A;  1Q81 T;  1FRH A;  3RU0 A;  1VQ4 S;  1BY9 A;  3HI9 A;  5F8H A;  4U7U K;  2ZH8 A;  8AT1 B;  1HNZ J;  3MM9 B;  2WVE A;  3FSX A;  3DOM A;  2GMJ A;  2CAD A;  4QQB A;  4B9L A;  2QZ8 A;  2CPJ A;  2H4W B;  2BKP A;  1N32 J;  3VGV A;  3TVY A;  3KLE B;  3N5F A;  4C8K A;  2ZWO A;  4ECW A;  3NNC A;  4KHP J;  1UWA A;  5I3U A;  2DPJ A;  2AJ4 A;  4HDH A;  4F4K A;  1VQS A;  2IDE A;  4L75 A;  2V4J B;  4KGM A;  3JTN A;  4LR7 A;  1WF1 A;  5KFG A;  1UVJ A;  4UTG A;  3H90 A;  3D67 A;  4QWB A;  3OTB A;  1WEY A;  5D4O A;  3DYA B;  3EZO A;  1Q5Y A;  4DV2 F;  1UPM B;  1SPB P;  4LF2 A;  4CM2 A;  4DCJ B;  2PO4 A;  2RE1 A;  3SBM A;  1VQ9 S;  3QLH B;  2V2Z A;  3ZZU A;  1A0O B;  3KJV A;  1SC4 B;  1T03 A;  2V4R A;  1PBU A;  2CQ3 A;  2B6A A;  5KFO A;  4GKJ J;  2DNG A;  2DR5 A;  2V6A A;  3PKY A;  1B70 B;  3K59 A;  1MU2 A;  3G6E S;  4FS1 A;  2CAJ A;  3M9N B;  3J81 Y;  2V2Q A;  1U1Q A;  4JI3 F;  3PVX A;  2UUW A;  4YB7 A;  1Q95 G;  2KN4 A;  1XC9 A;  2O3D A;  3IG1 B;  1Y0H A;  3KLI A;  3TX8 A;  2ZWP A;  1MWY A;  1FK9 A;  2XMT A;  4F3O A;  1X4A A;  3BH7 B;  4EUV A;  5IWA J;  2H48 B;  2VIH A;  3ENQ A;  2KJV A;  5KT4 A;  3K58 A;  2YH1 A;  3RB0 A;  1ICE B;  3L3C A;  2UUT A;  3W5Z A;  3D3C J;  2HQ3 A;  2CWX A;  4OYX A;  3TZX A;  1VIX A;  3F0N A;  4DX6 A;  4GKK J;  2AJ1 A;  3WBZ A;  5J1P A;  4YB5 A;  1KN6 A;  4OJG A;  3C19 A;  1MRO A;  2GCF A;  1APS A;  3RBE A;  4EGL A;  1V6H A;  2J6U A;  3G82 B;  2ZH6 A;  1KFD A;  3VGT A;  2HWT A;  3R5A A;  4X65 F;  2IFX A;  1VS3 A;  3TAM B;  2G2Y A;  2ROG A;  2FLL A;  5LOQ A;  1RT4 B;  1GMW D;  4C98 A;  3U1L A;  5BR8 J;  4JI5 F;  4M5K A;  3M4X A;  2VL1 A;  2RRN A;  1ZTW A;  5KFJ A;  2VDI A;  2XSJ A;  3ET6 B;  1VC6 A;  3OTC A;  4DQR A;  1Q8B A;  3QFW A;  3A8K A;  4C8Y A;  2VQF J;  3H7H B;  2OTJ S;  1P9Q C;  3JTO A;  1TKX B;  2J9C A;  4DLE A;  4LF5 J;  3LOU A;  4ZK7 M;  1ARO P;  3W1Y C;  3HK2 A;  5HL7 Q;  1NK8 A;  2E7X A;  1F9F A;  1KTV A;  3L95 X;  4BCA A;  2D3O 1;  2WVF A;  4ATN A;  4M63 A;  4OZ1 A;  2GHW A;  2HYI B;  3LPE A;  4F3M A;  3MM5 B;  4NA2 A;  2CPY A;  1RTJ B;  1YQH A;  3KLG A;  2DRD A;  3NGS A;  4DEZ A;  2MMY A;  1NK6 A;  3DU6 A;  5L9N A;  3FFI A;  4C8M A;  3IWX A;  2QGF B;  7AT1 B;  4I68 A;  5AJ3 F;  2DNY A;  1VBY A;  4JI0 J;  4JI8 F;  4RW4 B;  3CT9 A;  1JLA B;  1TUG B;  3MR2 A;  2D3U A;  2BOA A;  2HS0 A;  4QIF A;  2H3E B;  4IOB A;  2FJD B;  2FVR A;  2VF3 A;  1NHK L;  2QX0 A;  2QTW A;  2YKM A;  2JL9 A;  4QPT A;  2WSC C;  3SCK E;  3UR0 A;  4ECY A;  4F04 B;  3ENA A;  2GFF A;  4DMZ A;  1N54 B;  1UPP A;  5JVH Q;  1DQ9 A;  4DL4 A;  3I4H X;  3TUJ C;  3ZNJ 1;  4X64 F;  1TAQ A;  1P1L A;  1DTT B;  3CJR A;  1KON A;  3NOC A;  1S6Q A;  4M5D A;  3LO3 A;  1TMM A;  3AD9 C;  3NLC A;  3GFX A;  2RT3 A;  1IBM J;  3GTY X;  4QPX A;  1U1P A;  1RHQ B;  1UVN A;  4N8O A;  2OSQ A;  4B02 A;  3BGR B;  4YP3 A;  3O8W A;  3UDL A;  5U47 A;  4YR3 A;  2N4C A;  3KOA A;  3M8S A;  4FVC A;  3KUE A;  2ZM6 J;  2VQE J;  3A13 A;  3A12 A;  5KTQ A;  2MHN A;  2NXJ A;  2VFU A;  1MN9 A;  1WKL A;  3BKF A;  3MI7 X;  1HBN A;  3H2U B;  1UMJ A;  5H9E K;  4ZLJ A;  5K5M A;  2J9D E;  3NGK A;  4M8L A;  3H5U A;  4NYZ A;  2RIL A;  1H0H B;  1Q8I A;  2VAS A;  2JLG A;  1KHV A;  3WIV A;  5KG0 A;  4ILM A;  3KFW X;  2CQC A;  3VZI A;  4C8L A;  3SDE A;  1OSC A;  4IFY A;  1XR7 A;  4ZDN A;  3UDE A;  1FDB A;  3PW0 A;  4LBI A;  2L9W A;  2M4M A;  1NCL A;  2E9Z A;  4NLV A;  2RU9 A;  3IM9 A;  2XO6 A;  1FKO B;  4Q2M A;  1FKP A;  5LXR A;  1OYD A;  2MQP A;  1ZAX A;  1VMB A;  1WOR A;  2EG1 A;  4X4U A;  4M5N A;  2C2D A;  1WI8 A;  3FMW A;  3WIU A;  1KD1 T;  2HVI A;  3V4M A;  2QA4 S;  1H73 A;  2FJW A;  2GIQ A;  4C2M A;  2U2F A;  1FRL A;  1R7I A;  1UWB B;  1RTD A;  3MR3 A;  2HQG A;  1RT1 A;  5IT4 A;  4Y0F A;  3CDB A;  2I1R A;  1HI0 P;  4Y6I A;  2V2V A;  3SV4 A;  3WDO A;  4DV4 F;  1SUQ A;  3LW5 C;  3R7S B;  2HW3 A;  2LXU A;  2DBB A;  2MTL A;  2DXF A;  2BKO A;  4QYZ K;  4L73 A;  1IKW B;  2LDY A;  1F5B A;  2GZO A;  4ES3 A;  5KFQ A;  2OPS A;  1JLE B;  4CO1 A;  1SH0 A;  1E6V A;  4K0K J;  1SKS A;  3BPS P;  1FJC A;  3T9Z A;  1WKK A;  3LP1 B;  3QIP B;  4KRW A;  2W9A A;  2MQN A;  2KFY A;  4Z37 A;  3KK2 B;  5I3Q A;  3CE8 A;  4C4W A;  4QR2 A;  5DJB A;  1AUD A;  3EM1 A;  2HBR B;  3UQS A;  2E1A A;  1IBK F;  2B5J A;  2JLF A;  3LUY A;  1LW2 A;  2JSX A;  2F4V J;  5F3Z A;  1VQY A;  2CXE A;  4WKR A;  2Y1J A;  2X1G A;  2VPZ B;  4Z2X A;  1RIS A;  3C15 B;  2GS8 A;  5B0F A;  5HQM A;  3PEJ A;  2FC9 A;  4Y2I A;  3CCQ S;  3CJ5 A;  4PXE A;  3ISN D;  4C3L A;  3MMJ A;  4WBF A;  4E0D A;  4YHH J;  2G0I A;  4LT6 A;  2GVZ B;  4QZV B;  1S1X A;  3F41 A;  1T9T A;  4F4W A;  1LWC B;  3RR7 A;  1CQN A;  1W25 A;  1U2R A;  2XMW A;  2NXU A;  3Q8P B;  3ZZT A;  4CLU A;  1NPP A;  2ZH9 A;  4TY8 A;  1S9G A;  2XHW A;  4LF9 J;  5LXY A;  2VOD A;  2KM8 C;  1NDC A;  2CPH A;  3GSI A;  3GIM A;  1I94 J;  5KFK A;  5HAO A;  3M8Z A;  3HVT A;  4DUY J;  4FBU A;  1FX2 A;  2X1F A;  2JDJ A;  1YBT A;  3PV8 A;  1JK9 B;  1JKH A;  2KZM A;  3OR2 B;  2GAG C;  3PDN A;  3U1N A;  3MUR P;  3HKZ D;  2CZ4 A;  5KG4 A;  3FKB A;  2VV5 A;  5DM7 Q;  4UOG A;  3B78 A;  4TN2 A;  3RBZ A;  4CNZ A;  4YOE A;  3ILI A;  4DUT A;  3EDR B;  1XQI A;  2CDQ A;  1SQG A;  4RX6 A;  1IQZ A;  2OFG X;  2MKH A;  3CF5 Q;  1S1U A;  2HHT A;  3CTR A;  5C24 A;  5A8R B;  4LFB J;  3P6Y C;  2DPI A;  1CBK A;  4CO5 A;  2UUA J;  2EK6 A;  3CSK A;  2L9D A;  3J81 U;  4ICL A;  4PQU B;  4GMK A;  2RHS B;  1LFP A;  5D0H A;  2WCX A;  4RUB A;  2Z4P A;  1KTQ A;  3G6Y A;  4DV3 F;  3DC2 A;  2HQI A;  3K17 A;  5IV3 A;  2CPX A;  3ZFV A;  2J7K A;  2H5I B;  4DFJ A;  4DR3 F;  1UCN A;  2HMI B;  3GJQ B;  2ZD1 A;  4PWW A;  3ILL A;  1F9E B;  1ACM B;  3OBI A;  2JNJ A;  3MMB B;  1N56 A;  3LP2 A;  3EPI A;  2M9K A;  4FXV A;  3V6J A;  4DR6 F;  2WB4 A;  4J9Q A;  2R42 A;  4ECX A;  3RAM A;  4KGZ B;  4X66 J;  1TL1 B;  2OEJ A;  2ACM A;  2P8I A;  4DR5 J;  4B3M J;  1YJR A;  2MLX A;  1M5V C;  2QLB B;  3NOG A;  3FCW A;  2DVI A;  1J5O B;  1VBK A;  3TWZ A;  1C0T B;  2QLF B;  3NEK A;  4R25 A;  2VG5 A;  4FYY B;  3QRQ A;  5HO4 A;  2G13 A;  4W4M A;  4NLU A;  4ZPD A;  3DRR B;  4KKO B;  2CQH A;  3V6D A;  1RAE B;  4EI2 A;  2VFS A;  1X5T A;  2ABY A;  5ETV A;  4OLO A;  4PUO B;  1X5S A;  1LQ9 A;  1WHY A;  2VG7 B;  4Z7C A;  3KG0 A;  3FSI A;  5CYM B;  3HXM A;  1UJ4 A;  2FB0 A;  3KG4 A;  2OPQ A;  3MF5 A;  2HFO A;  3EZU A;  1X9W A;  3PX4 A;  2C22 A;  2ASD A;  1Y7P A;  2MKS A;  4JI4 J;  3BRE A;  1CUL B;  2W4D A;  5HVG A;  2XQC A;  4GO7 X;  2QL9 B;  2N7C A;  3KLH A; 
#chains in the Genus database with same CATH homology
 4GVB B;  1KP6 A;  4GVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...