4GVBB

Crystal structure of the virally encoded antifungal protein, kp6, heterodimer
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
74
Chain Sequence
PRPVMCQCVDTTNGGVRLDAVTRAACSIDGYYTEKDGFCRAKYSWDLFTSGQFYQACLRYSHAGTNCQPDPQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KP6 killer toxin subunit alpha
publication title The Atomic Structure of the Virally Encoded Antifungal Protein, KP6.
pubmed doi rcsb
molecule tags Toxin
total genus 16
structure length 74
sequence length 78
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.440 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Killer toxin KP6 alpha-subunit 4gvbB00
1KP6A 4GVBA 4GVBB
chains in the Genus database with same CATH superfamily
4U96A 4K4UA 2VFUA 4MKBA 2K1RA 2MB0B 1RDRA 4RO0A 3HPOA 3HF5A 4YQWA 4QWCA 3ZTPA 4WFNQ 4KO0B 2VIHA 4YR3A 2HRYA 2AYBA 1LWXA 3TANA 3GYNA 5C25B 1SB6A 3BSCA 2FHJA 4LF8J 4KYZA 4C3KA 3JAMU 4QWEA 3SEOA 1FRHA 3IAM9 4Q8FA 4KHRA 4CYUB 3DLKA 2Y1IA 4KY3A 5HL7Q 5F9LA 1U6BA 3G6YA 3D1OA 3G71S 3EUNA 3Q8VA 3I0SA 2GO8A 2W9BA 1Q7YT 3C6TA 1HARA 2DEJA 4OYXA 2ZBRA 2JL9A 4MKVA 3O8WA 1ZZFA 4RW8B 1D3WA 3PYEA 3OHAA 5JVGQ 3DLHA 3IS9B 5BR8J 2NREA 1Q1KA 1VQ8S 3CWJA 5EWGA 2NSBA 1U1KA 2ATLA 1UJ5A 5HQLA 3TOQA 1SQFA 2UXBF 3BH6B 1UA1A 3N9UC 2V2KA 1M5PC 1NB2A 4G1QB 1ACMB 3ITHB 4YHHF 2I6WA 4USKA 1K0TA 4DUZF 5CHCB 1YZ6A 3R5CA 3MTKA 4YS2A 4DFJA 3N4WA 4AT1B 1S1WA 3R5DA 5F8MA 1N5VA 1B0PA 4JV5J 2Z8QA 4X66J 2ZC4A 2D1CA 2HS4A 3EM1A 3CIZA 3MM8B 3G96A 5KFKA 2GFFA 2OSRA 3VHQA 3A12A 3KNAA 1Z4UA 5KFDA 1VC0A 2GAHC 1JIHA 1JLGB 1WKLA 4ITSA 1RU1A 1OPZA 2P8IA 4NLGA 4YFUA 2RF2B 2ZWOA 5K20B 2YNFA 4NXMJ 2EPIA 3PTWA 3PZPA 5F8IA 3ILJA 2Q6CA 2XYPB 1UVLA 2EW9A 1QLNA 5IT9U 3VCDA 3BGRB 1ZA1B 2HG4A 2ZFHA 4GKKF 2MZSA 4GO5X 2R7WA 2HQCA 3CEDA 1AW0A 4DR3F 2FVCA 1OQ3A 4PG6A 3KLEB 2CQ3A 3MAAA 2FJEB 3DC2A 2MQPA 2QLBB 3DRRB 3BM7A 3O44A 3ZZRA 3G8TA 4QIWD 3D68A 1EAYC 2MZQA 1RT7A 1TELA 2WHOA 3PKYA 1FERA 3GMGA 2H54B 2D3O1 4TY8A 1T3NA 2O66A 2E44A 4NCGA 4ECZA 1IBMJ 4DR2J 1R6YA 1JXVA 3CF5Q 2MY8A 2DXEA 5A8KA 4ED5A 2FYXA 4F0HA 4OZNA 4KPYA 2LXUA 3EGNA 2QA4S 3OSNA 3CT9A 3OBIA 2ATCB 2MMYA 1HKAA 2G0CA 4LJMA 4RBUA 1DTTA 3DLBA 4YP3A 2Z2YB 3M1VB 4B3MF 3SQGB 1VS3A 2OIHA 2LQJA 4K5RA 2VDHA 2B6AB 2HBRB 4IOAQ 1KQKA 2BJ7A 3T19A 1KR4A 2CNLB 1XR5A 1FDDA 4IDKA 3VAJA 2B5JA 1S0OA 1MROB 2EG2A 1G4CA 5A8RB 3NKYA 3GJSB 3FCWA 3CJ0A 1SQEA 3C14B 5FDLB 3S6EA 1T02A 2KKHA 4P75A 1TU0B 1XIQA 1L3TA 4K4WA 2AW0A 2EWHA 4R5PB 3RB6A 1QUVA 1BY9A 4DR6F 2GGPA 3D6HB 4LIWA 4GO7X 3PR5B 1HPZB 3DOMB 5IM0A 4X62F 1X4HA 2DH8A 2AHOB 1R8PA 4I1TA 1C4AA 3HT3A 3R5JB 3OUYA 2F63A 5K5MA 2RJZA 3OFHA 3MXHP 5KG3A 2Z2MA 4O3RA 2IY5B 3FDSA 3UNGC 2CPHA 4WFBQ 1SC6A 2E1PA 2F65A 2IPOB 1X9MA 1F2GA 2GVZA 5KG7A 3M8QB 3R7SB 4UOHA 3I5BA 4DHVA 1Y11A 1G6BA 4CO0A 4FF4A 4TY9A 4KPCA 1HQ2A 3QWPA 2DEIA 3KOAA 3UD5A 2AJ2A 2MLZA 2ZOMA 3QSYB 1BE4A 2COLA 4WU3A 1AFJA 3UI3A 2MQMA 5B7WA 3J80Y 1DQAA 3Q86A 3MPDA 2C22A 2K3KA 4MIBA 5HROB 2PO4A 3TAMA 2YNGB 1XR6A 2J7KA 3N0VA 4IFVB 4DUYF 2KL8A 1FXDA 1HYSA 1S6UA 1FDBA 1X60A 4O3SA 2E29A 2JEFA 4PABA 5DM6Q 1X4GA 2V67A 4JI3J 1G3OA 7FD1A 5EHHA 4FS2A 2D9OA 5BYSA 1ZAVA 1TKZA 1JNZB 3JB9k 1FO1A 2FVSA 3HX9A 1I51B 3OTOF 2FHOB 2NPIA 3G9CA 1S1TA 1KP6A 2BRKA 5T7LB 3JSBA 1T05B 4JI1J 4QBUA 5A0YA 4J9RA 1RTHB 3QRQA 3FVYA 1NHUA 1YDLA 3ZTQA 3G6VA 2IFXA 4QZVB 2OMOA 2FY8A 2U1AA 3IRWP 2VUGA 4LIRA 4FNIA 1GT8A 4WFZA 3CULA 1HNXJ 4A4JA 1IWAA 1N6QA 5AXLA 3K5NA 3FNNA 1CBKA 4AXJA 5F41A 1S1UA 4DDFA 3BSAA 4HDHA 2VPWB 2XB2D 3F73A 4A8SA 2O5DA 1RKJA 3R5AA 3UQSA 1FD8A 5KFTA 2DBBA 1F9EB 2FVPA 2DHXA 2XEXA 4LRFA 5FJ4A 1JK9B 3PKMA 4K2JA 2ADBA 1SH0A 2H5EA 3S1TA 4ZJQA 1JLCB 2WSFC 2ASDA 3KLHA 3HHLD 2J8AA 2MZTA 4TU7A 4ECWA 4I7FA 4ZCIA 2FJWA 5BR8F 1RP5A 4ZPVR 2O1PA 3RU0A 4C8ZA 1WKKA 4Y0FA 1C1CB 2OTLS 2N7CA 4WF9Q 2W1BA 3KHGA 1U4BA 4DR7F 1TL7A 2Y8YA 1CS4B 2FVQA 4N47A 3DHWC 3ENAA 1NSAA 5A8WB 4M94A 2KFYA 3RAQA 1FT8A 4LUBA 3CCVS 4ID5A 1R0AB 5HMWA 1VQPS 1QE1A 3AAWB 3TUPA 3CDEA 4CM2A 1DHMA 1NNDA 2UZAA 2ACYA 1Z2LA 1S0NA 2EI5A 1YJRA 2NQPA 2B43A 3DRPA 5HMYA 4NLWA 3K2YA 5ETQA 2HQ3A 5B0EA 5HJYA 4ZA1A 2CDQA 4DI6A 1U02A 3FEYB 3QO9B 2VA3A 1FCAA 2HQFA 3AD8C 1SC4B 4X4VA 3RGIA 3KJFB 2QO3A 2FD2A 3A3PB 3D5MA 2C2EA 4IFYA 2QZ8A 2BZ2A 2WONB 3IR7B 1FA0A 2MTLA 4F4YA 2JC0A 4EK2A 5JMNA 5LJ3Y 2FPHX 3NOGA 2WVFA 3OTCA 3PJXA 4Z2XA 1UA0A 2JFDA 2J9CA 3KUEA 4J7CA 1TL1B 4RW7A 5D0HA 4E8UA 3QJJA 4DF4A 5AXMA 1S6PB 4ZKAA 2MXYA 1LK7A 1WF2A 1SL0A 1F5BA 2RRAA 5BJRA 5HANA 1U48A 1NJWA 3SI8A 3W9IA 3OJUA 4ZVPB 3GIKA 5DM7Q 1U2RA 3IG1B 5JJBA 4K50A 4LRBA 3GP9A 4X4NA 5GAEI 4FZVA 4L76A 2DR6A 1RAIB 1HNVB 2XMJA 4UZBA 2CQGA 1C0UB 2W2MP 5E0OA 2VASA 2V34A 3C16B 4UY8T 3TA0A 1WF1A 3M2RB 3ISNC 4EZ6A 1LWFB 1ZS6A 3G6ES 4DX6A 2QEXS 2KM8C 3EPIA 3L4BC 1S1VA 4OHVA 3TZZA 4DL6A 2BQ3A 4NXNF 4CWBA 4E2FB 3TX8A 1FFGB 5CA5A 1RKIA 4KHPJ 1NH7A 5I3UB 2LU1A 1X4FA 3RRHA 1WORA 2QG9B 1U26A 2C2KB 3NAIA 3UCUP 2HVDA 3TAQA 2R8JA 2FB0A 1OY8A 1HMVA 3E01B 4XPEA 1UWAA 1UAWA 2QJ3A 5D3GA 4C8NA 4CO5A 4JB8B 4L75A 1QSSA 2CPJA 3I31A 2E1CA 5GAHU 3B4DA 1KOHA 3N6NA 2J0SD 4AFFA 4FBTA 5U47A 3RUBL 2M3DA 3ELHA 5J1PA 5JVHQ 3TUIC 3MCOA 3DRSB 3BGLA 4KC5A 4Y00A 5AXKA 3MFIA 2HPUA 2ILZA 4ZCKA 4BC7A 1VQ9S 5C42B 4AQYF 2E1AA 1X0PA 2DRDA 4PG7A 5E2QA 2YBVA 2OO4A 3EMTA 3EZ5A 3JYTB 2ZH7A 4O3QA 5J1NA 4CLYA 3OR1A 3LA0A 1N5QA 5EUHA 4HYKA 4C11A 3ADAC 3KMSA 1JLEA 5I42B 1VIOA 4NLQA 3OT9A 1UFKA 2BM1A 3LGHA 1KQFB 5D4OA 5M2UA 4A8XA 2IBKA 2XMTA 4KTQA 1HQEB 1O6XA 4DL3A 1OYEA 3W5ZA 2DB1A 1LWEA 3GG0A 2EC0A 2F4FA 4KIAA 2YNIB 2IVYA 4QIFA 4QYRA 3GSIA 2MEWA 3BS9A 1CQMA 1K8AT 3BH7B 3POTA 3RW6A 3DRXA 3GE9A 1S48A 2YKMA 4OYZA 4URGA 1R8BA 1DRZA 4DZDA 1SV5A 3KWMA 2XM3A 1RU2A 1J5OA 4PG4A 2VF3A 3J7YU 2RB7A 3GPAA 2QLFB 3M32A 3TEGA 5D8HB 1V3SA 3C2PA 4L74A 3CDAA 1TKXB 2JSXA 4S0MA 2CQ0A 4USMA 4PXEA 3L09A 1XMQJ 2EEYA 1NB7A 1IBLJ 2VA2A 5LXYA 4O0IA 5C2CA 2WBMA 3VQTA 4HEA9 4FS1A 4DPTA 2AQ4A 2R8HA 3KNGA 3QAEA 3ONQA 1ITPA 4NYOA 3W9JA 1EJ7L 1LWCB 2NSCA 1VCTA 5LMNJ 3QLHB 2JVRA 3OTBA 4DL7A 4CH1A 2WAQD 3GR0A 4X65J 1ICEB 2RD5C 2L9NA 4OYMA 1IBCB 2ROEA 2BM0A 3MMJA 3MD3A 4RW9A 3T1YJ 3GZ7A 2VV5A 3FSXA 3I6PA 2RQKA 4V1Ak 2BRLA 3OJSA 2GVDA 3TP2A 4G6VB 1RA6A 3CW2C 2VFRA 4H4OB 4YDXA 4U95A 1RTIA 2FJDB 1WC1A 3R7NB 3FQKA 2RDJA 1FRKA 4LBIA 3O1LA 2W4CA 3EXYA 2M9KA 4PCQA 3HJVA 2HHTA 4CO4A 2HHQA 1HBOA 3UNYA 4TN2A 1VQNS 4F67A 3OLBA 3VAIA 4ZJOA 1LK5A 1QTMA 2H5JB 2JOQA 2CNKB 1S7IA 2QX0A 2OPPB 2C3OA 3FZBA 4TLQA 1QAXA 2PE8A 4A47A 4QJVA 3TJ9A 4KJIA 1Y3KA 5IOLA 1Q7LB 1R8HA 1SUQB 5IFMA 1BQNB 1N36J 4FVMA 3D3CJ 1DLOB 3DMJB 4OX9J 3LQVA 2W4PA 4FKXA 2DD8S 2MQQA 4O44A 2LXFA 2PMWA 2MKCA 1CULA 3JTNA 2OFGX 4WE1B 2Z4PA 4O3OA 1TK5A 2DKOB 2YQ0A 1B3TA 3MGJA 3IA0A 4C6AA 1RT3B 5AXNA 1D0EA 1B0VA 4QCLA 3V81B 5IV3A 3OTDA 2CKWA 1HNZJ 4X4TA 3R27A 2OAUA 2HNDB 3BZQA 1TQLA 4DCOB 4QWBA 5M2PA 4RUBA 1YLXA 3MOZA 1ZYQA 2DNLA 2XNQA 1N56A 3MCMA 2BW2A 5KTQA 2B56A 3V4IA 1S9FA 1JMTA 1GMWD 1S7HA 1H98A 4IQMA 4LRAA 4LQ9A 2J0QD 3UN3A 3D1HA 4USHA 2QA2A 1AUDA 4ECTA 2KZMA 2A6MA 1YJUA 1SQGA 1Q78A 3HLUA 5A76A 3TZYA 1EKRA 4YB7A 2MQ8A 4UQGA 2LDIA 1PC5A 5IC6B 3PW5A 2HBQB 2Z57B 1EKSA 1PSDA 3CJQA 4OX8A 4KR0B 1GAOA 2XSJA 1UL3A 2DCUB 2JLGA 3DYAA 1DQ8A 1HW8A 4F0KA 3IP0A 1YKWA 1N5YB 1C4CA 4P52A 4RNMA 5J2MA 3G8QA 3UD4P 1UW9A 2KT5A 2KRRA 3MWBA 1RISA 1WTBA 2VG6B 2LEAA 2YX7A 2BVZA 4N5SA 3W1YC 3AJ1A 4ZP6A 1HBMB 1NK9A 2KFZA 4KHPF 3L9ZA 3HFZB 2G2OA 1AT1B 4KFBB 3W2VA 1HHSA 1Q5YA 2HWHA 4RNFA 2WVEA 1ZTTA 1UWBB 1BWVA 1ZBTA 2UV8A 3M4XA 3G82A 3HSZA 1RHRB 3PEJA 1IR2A 1X5PA 3X3UA 2Y1JA 2F3JA 3L7OA 3AOBA 4NMXA 5JXSA 1S0MA 4NLDA 4CO3A 5C5JA 3HZGA 1DBDA 4IOCQ 4RNHA 3GFXA 1Q4RA 4ZHRA 1XK8A 3B54A 4RZRA 3HXMA 4ED8A 1QD1A 3R9LA 1WG1A 4CH0S 1HR0J 3A4TA 4WP3A 1T94A 1VK8A 4FF3A 1FNMA 3AH6A 5F8JA 1RTDB 3DGPA 4ELUA 2BKPA 3MUMP 1UMJA 3CSKA 4HH0A 2ZJPQ 5HJXA 3DLGA 4WP8A 2Q6BA 2V50A 3KK2A 1ZM2A 6FDRA 2AGPA 2EFGA 4ICLB 1WNEA 2KVQE 1HIYA 4K4SA 4KHMA 2YKNB 1B7FA 3C15B 1EQMA 2KB2A 3NAHA 2XMUA 3M8PB 3S01A 4NZ6A 4UOCA 3ZTSA 4TXSA 1NCLA 2UP1A 3GU0A 5ETOA 4V19J 4O3NA 3KK3A 4A8YA 2DH9A 1NH8A 1MWZA 4M5MA 1ELOA 3CUNA 1S49A 5CYQB 2ZUAA 1NKCA 5K8PA 4BBYA 2MLXA 2J6UA 1UEVA 4ECXA 1N4LA 1FKOA 5HBMA 2D7SA 2I9SA 2FZGB 1SJ3P 2BDPA 4NLUA 1CJVB 1URNA 3IN5A 5EWFA 2A2DA 4P71A 1HD1A 4LF6J 4JV2A 2RS2A 1Q79A 4ZPWR 4UUWA 2YKQA 2VPYB 1CSJA 1NSQA 4UW2A 1K73T 5LMUJ 1H0HB 3OSPA 1UZDA 3DOLB 2X7IA 1XMQF 2AZ3A 3LP1A 3D3BJ 1IBLF 3UR0A 1KSPA 2RQ4A 3FJ2A 2DNZA 5HP1A 4RW4B 4DV2F 3K5MA 3GIMA 2E66A 2OJ3A 2BJ9A 4TNOA 1KC8T 4NI2B 4B3RJ 3JXOA 3TA1A 3FBEA 1F9HA 3CD0A 5LMNF 5DRKA 3GFZA 4ZLPA 4LR8A 1S4FA 1RBAA 4DSJA 3MF5A 2J6SA 3Q2SC 5DZ6A 3UN2A 2BABA 1FRMA 1ROFA 5IV4A 2KHCA 1U25A 2OSQA 1S72S 4IUFA 5GAGI 2VG5A 4U6PA 2GCFA 3OPKA 2RNEA 2XSFA 2ADCA 1ZM9A 4RWWA 2PIIA 5C24B 3DXBA 2H5IB 1HHTP 2WTFA 1VRUA 4ED7A 1FNOA 3KG4A 2MZRA 4P9SA 2YKAA 2JDJA 1FX2A 4OYOA 4OI4A 4FXWA 2ZNZA 2GQ2A 1J5EF 3KMQA 4DFMA 4P72A 3W5XA 4Y65A 4PWDB 1N36F 2DVIA 5KFRA 1RBOB 3V6DA 1DTQA 3GV5B 2C2RA 2GA7A 3AB2B 2I0XA 4W92B 1T3OA 1EETB 2AX0A 1C1BB 2DNRA 1PAEX 1WHVA 4LQ3A 4JV1A 2QSFA 2BANB 1WI8A 2R7UA 1MWQA 4UF4A 3IM9A 4KGZB 3M2VB 2LYVA 2FGCA 2B7BB 2KDOA 4C0HA 2KI2A 4B17A 4DQPA 1CJKA 4ANDA 2OPRB 1U0HA 1TAUA 4OIXA 4PG5A 2MY7A 4DV5F 4WYWA 3NBPA 2HQDA 3CJRA 3PY8A 3CD6S 5GAHI 1Q8BA 2EK6A 4IG3B 2RSQA 1UJ6A 3GILA 2JFKA 3MCSA 3MAQA 1BWEA 4MKAA 4LSNB 5IQQA 3M8SA 2F4VJ 2EFNA 5KFXA 3D7SB 5SZTA 3PDNA 2EXUA 1UW4A 3HHLC 3PIPQ 2D3OR 2A1BA 2LMIA 3QT5A 3DI6A 4J9UE 2FHJD 3MUTP 2HEKA 2QSWA 4ZVUB 4DQRA 4ZVSB 4IH7A 2PGCA 1NKEA 3H7HB 5IWAJ 4XPCA 3TWZA 3QATA 1U1LA 3MMCB 3LTOA 1NHVA 3C6UA 3A8EA 5DDRC 2MQLA 4ZVFA 2ZH9A 3T5KA 3RBZA 1XQIA 2VPZB 4KV8B 2DR7A 5B0FA 2PN6A 1MU2A 4GC7A 4CLPA 3MR5A 1WC5A 1RZMA 4EBEA 1RE1B 4ZP9A 3DLEA 3QT6A 4Q2LA 1F6TA 3HI9A 3RB4A 2JLFA 4LRDA 1IJEB 5ETTA 2Z0GA 2QE5A 5G0RA 5LOQA 2K06A 3MM9A 2DHAA 4QU7A 3UVJB 2CNNB 1U1MA 1QY7A 4B08A 2J8SA 4R8UA 3D54A 3FZ2A 8AT1B 2RKIA 3EDRB 4C3MA 2QFIA 1RGVA 2OHDA 3MM6B 4ZLLA 2M70A 3J7YI 3MMBA 2CPZA 1S1XA 1RT6A 3EPGA 4CP5A 3M05A 3CC4S 4OZJA 4ECYA 4ANEA 4HT7A 5A2QU 3N79A 3U1NA 4F2SA 4ECVA 3H90A 4KO0A 1KQSR 3MPUB 3M2UB 2XHCA 5C25A 1TFWA 2HZAA 5CH7B 1EX8A 2QFJA 1K44A 1Z2ZA 3T9ZA 1HR0F 1JLAB 2CQ4A 2ZOGA 1Q0NA 1SL2A 4MT1A 1UVJA 5JUMA 5F3TA 4CYUA 2QC3A 5D0EA 1M1HA 4PUOB 1VQKS 1TKDA 1F3FA 4GKJJ 5DGBA 2OGUA 3SXLA 2UUAJ 1T9UA 5EDWA 2YX1A 4M5HA 2ZH4A 3W8PA 3IBCB 3RJMB 3MEKA 1RK8A 2C3MA 2I38A 4BHQA 2JEJA 4YDDB 2G4BA 2CJKA 3CNQP 3IS9A 3PV8A 1TL3B 5B09A 3I0SB 4ZLNA 2B9WA 4U8VA 4DV0J 3WQPA 2V8GA 3MECB 4ZPBA 3UCGA 5CYJA 4C48A 3PX4A 1RBLA 1PAUB 1M5KC 3I87A 3T6JA 2VG7B 4G1QA 3ITHA 2ASJA 1VHIA 1S6OA 3PJ9A 4JI2J 2L48A 1WC3A 1NPRA 3CE8A 2AJ1A 4LR9A 2XTJP 2G1HA 2G9OA 2IMWP 4DR1J 2E9RX 2YWKA 3MM8A 1KHWA 5KFQA 2PFDA 3MM5B 2DRAA 3MAHA 1IKVB 1B64A 1RJJA 4ZMMA 1FE0A 3VGUA 1X4AA 4QW8A 1JLGA 2RU9A 1VJQA 2RF2A 2CWXA 3QGGA 1MMNA 1UEKA 3LGMA 2UUCF 4UOGA 3BGRA 2CRLA 1VRTA 1DARA 3DU5A 1YJ9S 4XO0A 2GJIA 3MMAA 4YB1P 3RYLA 1KS2A 4RUAA 2J7WA 3KLEA 1FF2A 3HHEA 1IM4A 3DRRA 3VVUA 5FD1A 2DTJA 3HD2A 1S0VA 1FKAF 2RU3A 2XI3A 1Q82T 3D0GE 4WK3A 4CO2A 2VH7A 3Q22A 4O4GB 2MZJA 3D4JA 1S76D 3KJNB 1HNIB 3A13A 3GFHA 4ETZA 3GV8B 2ILYA 3GB0A 2MKJA 2BUNA 1OO0B 1F5CA 2X1AA 4EUVA 3CDUA 3NGSA 4DV1F 3OFFA 4QYZJ 3H4DA 4Q5VA 3HO1A 3PNIA 3TZWA 4LFCJ 2R3VA 2CQDA 3NNHA 4ED4A 4AXIA 4E98A 1IR1A 4YN3B 1FESA 2ZH3A 3M1VA 3SQGA 2IRUA 2ZZNA 2B6AA 5H9FK 2ABYA 3GIRA 5ETLA 2HLTA 1F2HA 1RA7A 3OTEA 5CD4H 2DNYA 2HS3A 5F9NA 5LM7E 1MROA 1OY9A 5A8RA 2A2CA 2WSEC 3VZHA 3UDEA 5LL6d 1H2UX 3MEDB 2ZH8A 3C14A 4EO8A 5FDLA 1RADB 4EO6A 2XGPA 1Y10A 2C3YA 3PO5A 2J6TA 4F4WA 1U1PA 5J2PB 5KFYA 4R5PA 2NXJA 5BXIA 3DKDA 1VC6A 1P1LA 1HPZA 3DOMA 5D77A 2XS7A 5A6WA 2C2ZB 2I5JB 2CQBA 4USTA 4P7TA 2HFVA 4PYDA 3KDOA 2VBXA 3MR3A 2QN6B 2R2UA 4ZVRB 4Q8EA 3PACA 2F4VF 5KFLA 3M8QA 4PRFA 2KT2A 1NK5A 2NUHA 2MHNA 1YJ7A 4LFBJ 3IWXA 3H59A 1DZ5A 2CVIA 3D6TB 1MG7A 1SIZA 1NDLA 2KJVA 2HBZB 2PC6A 4C97A 1OY6A 1O8BA 2GVZB 5IWAF 1LOUA 5HROA 5MLCV 4DU8A 3R6LB 2OELA 2BA9A 5AE2A 1GMUA 2YNGA 2I1RA 3US5A 4DUZJ 3ILLA 4FVCA 4IFVA 1UKUA 3V4MA 1TUWA 5L39A 1IKXB 2V9KA 4J9QA 4HTIA 3CC7S 1RAAB 2HVEA 2HMIB 2BJ8A 2YQ3A 3ZZZA 4CH7A 2AU0A 4RNOA 3T1AA 2ZWPA 1FKPB 4ZIVA 3CJ8A 4USIA 1XMBA 5DQHA 5KT4A 5T7LA 4HACB 1T05A 1QSLA 2GC8A 1RAEB 2Q1LA 4LF5J 2BE7D 3UW1A 4R0EA 1RTHA 2DYAA 2RHQB 3L7UA 1B99A 1XNQF 5B0DA 2J9DA 3KG1A 1N0UA 4DFKA 3MEGB 1DURA 2DH7A 4EMDA 1FWPA 4XK8C 3BYPA 4F3MA 5A0YB 4M8LA 4OZ5A 4KB7A 3W64A 1ZOTA 3ZZTA 2DIUA 1D09B 2M7SA 2HIQA 2R4FA 3EGWB 5KG1A 4OYWA 2GIQA 1RACB 1RHMB 3W5YA 2HHUA 2HHPA 4KH0B 5H9EJ 4F36A 2J9DE 4I2QB 1KTVA 2FVRA 4DN9A 1YX2A 3H8YA 3KUGA 1P9YA 3NCRA 1RHJB 3ZO7A 1TV6B 2UVWA 2YVSA 3LUYA 4I67A 1UTAA 4TYAA 1HI8A 1WG5A 1FJGF 1UETA 3PM9A 2CPDA 1JLCA 3KKFA 2GIRA 3OVAA 2ZHOA 3QNWB 2XWYA 3CXCR 1U8WA 3HD1A 4DPOA 1AROP 4JI5F 4DV0F 5D4LA 4NLPA 3IWLA 4IRKA 4YUDA 4B3MJ 4OLPA 3OVBA 4OJGA 4RBTA 2HFNA 3FRZA 3KUHA 1RWUA 3F0NA 4F4ZA 3VWSA 2RUSA 2VC0A 1S12A 1VLYA 1CS4A 3ZZ0A 1U2CA 4DQQA 5A8WA 2V6AA 4ZDNA 2DNOA 2HK2A 2RH3A 1R0AA 1NLKL 1VQYA 1WWHA 5L1LA 4ZP8A 2BR0A 3R6GB 4K4VA 4DR1F 2QYGA 4CO1A 2V69A 2FC8A 4GMKA 3ZZYA 1S4EA 4DR6J 3G4SS 2EFOA 3GYGA 4X62J 2LEBA 3QO9A 1FTRA 3DHXA 3GCWP 4X64F 3PW2A 1WEYA 2RMLA 2L3MA 2AX1A 4ED1A 1JWWA 3R2DJ 4IG0B 2HRTA 3SMZA 2ZKUA 1R6VA 2KYXA 2WONA 2ERRA 3QIPB 2Z58B 3SV4A 2DGVA 4RKUC 4CNYA 2YNHB 2AV5A 1VDHA 1VK3A 2GZOA 1TL1A 1YITS 2NXEA 3W2WB 1Q53A 4B9MA 2APOA 1H6KX 3HJFA 1FE4A 1S6PA 1S57A 2PDAA 2YWGA 3G86A 2VJVA 1RYSA 4ZVTB 3P3DA 2PFFB 4JUZA 5DDPC 3L3CA 1VBXA 3RAMA 1GTEA 3EWGA 1XMOJ 2VD3A 1SC3B 3I5CA 3IG1A 2XO6A 2DK2A 4IH6A 1HNVA 2L9DA 2ZH5A 4C8MA 3C16A 1Y5NB 2YH0A 2K7KA 4EEYA 3M2RA 1AB8A 1UP1A 1LWFA 3GFYA 1VIXA 1HI1A 3HDSA 4Y2MA 1KD1T 2YH1A 3ICLA 1JLQA 4CQ1A 4L72B 2VODA 2OMLA 2NXUA 2XZTB 4LFCF 1VQMS 4LSLB 2MKKA 5I3UA 1UVKA 4ZJLA 3KLIB 4DV7F 3P49B 4YR0A 1VBYA 2XNRA 1LV5A 2W9AA 5E41A 3TAPA 4W4MA 3T9NA 3UE2A 4DWIA 3M8ZA 5F3ZA 3E01A 3OL6A 3FFIB 3ETOA 1SXLA 2HHVA 1HQUB 5J2QB 3A3OB 3FC9A 2DXFA 4K4TA 1X5TA 2Y1RI 3GQCA 2CADA 1HMVB 2LLZA 5DGAA 5SUHA 3DRSA 2DIVA 4FXDA 5IC4B 2XC9A 4U7UD 1CC8A 2BXJA 3NS5A 4WKYA 4DV3F 3HULA 3TARA 3MURP 4AE5A 1Q81T 1HNWF 1PJ5A 2J7UA 5C42A 2D3UA 4CLSA 3AOAA 1F3VA 3JYTA 1V5IB 3ET6B 1X7VA 2N3OA 2F8EX 1REVB 4OLOA 1T95A 4FN5A 4DR4J 4KKOB 5I42A 3MOJB 4WFAQ 1N8RT 3ZTRA 4I56A 2OEJA 3G8SA 2HYIB 2GHVC 5L9XA 2VFSA 2FHKA 1HQEA 3OVSA 1UPMB 1V3RA 5LXRA 3NNCA 3WX8A 2FY1A 3NXZA 4PWWA 2B51A 3AA8A 2UUWA 3CCUS 4LFBF 1M90T 4ELTA 2BQRA 1R3NA 2YNIA 3VAKA 1N52B 2YWWA 2NZ4A 4ED6A 1U1NA 1IQTA 4HH1A 2B9EA 4FBUA 1LFPA 1RCXB 2EBEA 2DR9A 4URQU 1M5VC 5L46A 3DFEA 4DR7J 4NCBA 4D3GA 4ED0A 4EYIB 4L73A 2KVIA 1CC7A 4UY85 4FNHA 1VR6A 4UOFA 4J9OA 4BDPA 1FX4A 1G2EA 4ERDA 4DN0A 4OHWA 1CJTB 5E7OB 4XDDA 2FIUA 2R2SA 1VQOS 2W8KA 1R43A 1N5SA 1SJQA 2NCKL 3M9NB 1TKXA 4BCAA 4PZVA 1E6YB 3R1LA 2XMAA 5CYMB 3Q8RB 4RR5A 1T9XA 2VZ9A 4RW6B 1JKHB 2IJRA 3CCSS 4CRJA 4NLYA 2DGTA 2VQFF 4DSIA 4LF1A 2CJ9A 4LF5F 1RTZA 4DS4A 2JRSA 3U1MA 3O2IA 2ZZTA 5K8OA 5IT4A 1NUEA 3I56S 5B0GA 4PQUB 3P4UB 2LKZA 1LWCA 2B8PA 3B8HA 1R0BG 5LSLA 3LP2B 4H4KA 2NYIA 1BUXA 3QLHA 1ZA2B 1N88A 2HURA 4J9MA 3TX0A 4B9UA 1U24A 4NLVA 3I32A 3CCRS 4B9SA 5BYQA 1H2VZ 4QW9A 4P2FA 2G0IA 4B9LA 1LEOA 1MMDA 2XMKA 3HHDA 3W63A 1LW0A 5E3PA 2ZE2B 1F9FA 2X1BA 4H4OA 5ITHA 4X4PA 3DLJA 5CAAA 3ILIA 2ROGA 1FXRA 2Q43A 4U7CA 2WK4A 5HLFB 2HNZA 5F8LA 1PJ6A 4DV6J 5KFOA 4JOUA 4LRCA 2ZKTA 4Y28C 1OWXA 1S77D 2UUBF 6AT1B 1NSPA 2QLXA 2JJ4D 1X4EA 2GX8A 4NXNJ 2OPPA 1Y0HA 4DXLA 4OX6A 1Y00A 2CQHA 2JVOA 3MZIA 3EYZA 5D6GA 2I8EA 2Y1LB 3TQEA 3CJ3A 4OZLA 4QQBA 3U02A 3FEZA 1SKRA 2X1FA 1SUQA 3MM7B 1BQNA 2QIFA 3NOCA 1DLOA 1R8AA 3DMJA 4JI7F 4XTTA 4A8QA 2HGNA 3QQCD 2BYCA 8RUCA 3QZ7A 3LP0B 1UPPA 3QAUA 4Y2AA 4CM0A 2H4YB 2DHHA 2CWKA 1FJCA 4EU0A 1D8YA 1VC5A 2KN4A 1PJ7A 4N56A 4WE1A 1DFDA 4N77A 1XTZA 2B4OA 3KJVB 1RT3A 1T9WA 1CEZA 3IMQJ 3SFGA 1SL1A 3V81A 1KN6A 3HHNB 4MAKA 3B4MA 3OD2A 4AQYJ 4IR1A 2HNDA 5T41A 3E51A 5B08A 4NL5A 3HVTB 3M7VA 3SIPB 5KFPA 1ZPWX 3PYFA 4OZ2A 5L8RC 1VQ7S 5DG8A 1FNXH 2YWHA 3MD1A 4LMZA 4ZVQB 4C4WA 2NXNA 3CO0P 4MIAA 1B70B 1BQXA 4ES3A 4B3OB 3BQ0A 2IYGA 4V19X 3MHYA 3TUZC 1T9YA 4B9VA 3CCWA 1BC6A 4GVBB 1U0SA 1U1RA 4NCAA 1M1KT 4FYXB 3W60A 4EI2A 3NGUA 2CJAA 3K58A 1BGXT 4DMZA 5F0WA 2D74B 2E5IA 2AJ0A 3FBBA 1X9WA 2PEHA 1WKJA 2F8HA 2E7XA 5E3RA 5L1IA 1XMOF 1WOOA 1N5YA 1H3DA 2WB1D 4O4RA 1ZAXA 1RABB 2KG0A 3JSMB 1OPIA 2VG6A 2ALZA 5HQ8A 4FYVB 3R97A 5D78A 4RBVA 9ATCB 3O5TB 1YRTA 2RUGA 1TKTB 1NK4A 2XY6A 3DN9A 1HBMA 3TI0A 1X9SA 4C3LA 1SJFA 3A8IA 1IUJA 4KFBA 1RWVB 3Q24A 1I5OB 2VOOA 4IKAA 3H25A 2B4UA 3BPSP 1CPZA 5LT5A 1WEXA 4IOBA 7AT1B 2ZUGA 4D3HA 1RUSA 5GVQA 2DNNA 1UWBA 3QFWA 2OD4A 4WPAA 1FI4A 2AGOA 4X4SA 3CB4A 4KQZA 4YB5A 4Q0BB 4IH5A 3A3NB 2WW4A 4FKYA 4DSKA 1AFIA 4L3KA 2M4MA 1KFDA 3GR1A 1S5ZA 3KK1B 4RLEA 4FP9A 3GG1A 4WFXA 3K17A 1RAOA 3BPDA 3VR1A 4DPWA 1RTDA 2HHXA 3BB5A 4Q7AA 4F2RA 1P9QC 3FMWA 2JZ5A 3W61A 4DR4F 1VQ6S 2ASLA 1H74A 1RI7A 1V3ZA 4HHHA 4PKDB 3UDCA 2E1RA 1M5SA 4Y2CA 3B82A 1P27B 2IA6A 1FRXA 4DG1B 2HZCA 2YKNA 1HL6A 3C15A 1TFYA 3M8PA 4UUXA 1RWNB 1SH2A 4UTGA 1GTHA 4P6QA 3SCIE 1Q8LA 2GHPA 4J9NA 5G4DA 3WX4A 4PYAA 4ELVA 4ILMA 5CYQA 4HI1A 4K4ZA 4I6AA 1WDTA 1XJWB 1NEEA 4I4BA 4F04B 2IC3B 4IRCA 4ZCLA 1YSJA 2HNYB 2EG1A 2XBPA 3V6KA 1CJVA 2HFUA 2V8VA 2PA8D 3D67A 3OQ2A 2XMMA 1O0PA 1TL4A 3D6FB 3GONA 1S97A 3KXDA 3CGIA 4X2BA 4DR5F 4EWTA 4L6V3 4QWDA 4LF9J 2LQ5A 5E3AA 5FLXY 2ZBQA 1N54B 4HHJA 2H3EB 3DOLA 3QT7A 2E5LF 3J7A1 2XCPA 4RW4A 3BYRA 2J9EA 1OSCA 2PA3A 4TVAB 1W25A 3SQOP 5GAGU 2LQ8A 1GXUA 2V4RA 2D41A 3P5TL 3V6JA 1HW9A 4DSFA 4NI2A 3MPWA 2V2VA 2M88A 1MSWD 3KDNA 1XEZA 3CMAS 4MIWA 1BHNA 2VBYA 3CDBA 4DZ6A 1SJ1A 4ZPAA 3FRYA 2UUTA 1R27B 1C0TB 9RUBA 4A8KA 2QMXA 2UVRA 1UEUA 2XCAA 2VL1A 4G3IA 3PHTA 3M8YA 1TUVA 3RBDA 2O01C 3T3FA 5KFBA 3ENWA 4ALZA 1K9MT 3HHLB 1K1QA 3AY0A 2V8PA 4RPFA 1WOSA 1JJHA 3I4HX 3WBZA 3CC2S 3CIMA 2CZ9A 3TA2A 1LW2A 2XY5A 5C7PA 4DV6F 3CPWR 3PO4A 5C24A 3SZ2A 2P2CB 2IBOA 3I55S 1HWJA 3FUYA 1FD2A 2FZKB 2H48B 1KONA 3OXLA 1FJ7A 2HZVA 3SFUA 2OPQB 4NZ0A 2BKOA 2CG8A 2AYGA 1IJFB 3TQ1A 5E33A 3CJ2A 3NG8A 3DM2B 4MK8A 2XLJA 2AJQA 1JXEA 3FSYA 1TK8A 1T11A 2HRUA 2KFNA 4KSEB 4PWDA 4CTAB 2R7TA 4KGXB 3R2CJ 2XQCA 1GEHA 3PW0A 3O6QA 3HVWA 5GMDA 3NMRA 3CCJS 4OHYA 2G13A 3VZIA 1T0TV 2IRXA 1XR7A 1FWLA 4Y2IA 2MGZB 4MKYA 1WDDA 4HVZA 2HGMA 1C1BA 2L08A 1A9NB 1W2BR 4OZ0A 2BANA 1RWKB 4Y6IA 1PILA 1WG4A 2P9CA 3M2VA 2Y9HA 2WOMB 1N48A 2ZD1B 2CYYA 4NA2A 1YJNS 1NM2A 2IMOA 4EBCA 4ATNA 2EC2A 4USJC 5MAOA 3Q8UA 1WSVA 3BQ1A 1URRA 3JS9A 4J37A 4WIIA 3KLFB 1OSDA 3HKWA 1BXNA 2BJDA 2C2OB 1WTFA 4IG3A 1NO8A 4I2PB 4RU2A 3H5YA 3T5JA 3AXKA 4F50A 4O3PA 1Y5IB 2NLWA 2HK3A 1A0OB 4NASA 2CJBA 3PXGa 3G87A 4LSNA 1B7YB 3ILOA 1U45A 2RQCA 3BGOP 3CCTA 3DLLQ 1MN7A 2DNKA 4H54A 2XMVA 1SPBP 3OR2B 3MPYA 4P7VA 3SV3A 1D9AA 1HBNA 5LJ5Y 4ECUA 4K7QA 2MDAA 1TVRB 4MH8A 1NK8A 2PEBA 2DNMA 4DLGA 3P96A 1HWLA 3N5FA 3BGFA 2M5YA 2GMJA 2ZDPA 4H4MB 5J2NB 3IM8A 3AFGA 3MMCA 1IKYB 5KG5A 4LFAJ 2PSZA 4KV8A 3JSRA 4M1KA 4YR2A 4WP9A 2YXLA 4F02A 5HMZA 2XMWA 2J0XA 4DUTA 3MR2A 5KG0A 1VISA 2W2PP 3FSIA 3PRVA 5HI7A 2LXIA 1H7XA 1E6VB 3VAFA 1N33J 3Q8QB 2IM1A 1JLBB 2VJUA 2PI4A 2CQ2A 2MYFA 3WIUA 2ZH2A 3QGIA 1NK0A 1NDCA 1NXIA 3U7JA 3W66A 4X4OA 4DV2J 3UVJA 2KXFA 5KOXA 2XI2A 2V8HA 4M5GA 3CCZA 2GQQA 3TEHB 5KT5A 5DG9A 1PO6A 5EWEA 2P9GA 2XZWA 3MM6A 1FFWB 3CJKB 4LR7A 5K14B 1PCAA 2AT1B 1SH3A 2R7VA 2ZH1A 4QIVA 5E3CA 2ZVIA 4WJBA 2HVIA 2DGOA 1DQ9A 4J5OA 1ZAWA 3AQPA 5KOWA 1JLFB 5DQIA 2BJ3A 4U8YA 3AQOA 2C2MB 3JQJA 3HSJA 3OW2R 1UVIA 3M2UA 4LF4F 4Q43A 3T1HF 4CNZA 2WCXA 2RE1A 1JLAA 3RBXA 3BN7A 1Q86T 2DXDA 3J7ZT 1FEHA 4IYQA 2CPYA 4PUOA 1GXLA 3ENVA 4DFPA 5CCLA 2ZH6A 3HFKA 3BKUA 2LEPA 2A18A 2E9ZA 2E1MC 4B9TA 4AL6A 2DGUA 3B6BA 2M8HA 4IRDA 3TVZA 2DITA 1TL3A 2ZJQQ 4A8WA 3JQKA 1S9GB 1J5EJ 2ZM6J 3MECA 1FRJA 1RAHB 2V2ZA 1ZM4A 1Z1ZA 1KBRA 5KG2A 3CCES 4LF7F 2B0GA 4OX7A 2DY9A 3G2XA 3NL0A 2IRYA 2VG7A 1ZETA 3MFHA 1T03B 4I64A 2E5JA 3I96A 3IWNC 1QAIA 5L1KA 4NYZA 4I68A 4WIQA 2HWIA 5I3PA 3OFGA 2IJNA 5L38A 4FYDA 1IVZA 2IM2A 3JTPA 4CT9A 4RX6A 4QWAA 1F5AA 3NWRA 4K2XA 4LF9F 1KVKA 3EICA 4MFBB 3FKBA 4P2SA 3MM5A 2FJAB 2XG8A 4MMOA 1IKVA 4DV5J 3NRBA 3TRGA 1CJUB 4DL0C 2ZOFA 1KLMA 1RTJB 2A10A 1S10A 2Q66A 1NMEB 2KT3A 1JXLA 1M5HA 1ZPVA 1I6JA 4CLLA 4DU7A 4Z37A 3R3TA 1PIEA 3NP5A 3PX6A 5HN0A 1C2PA 3Q2TC 4YY3F 1TK0A 4DL2A 2DO0A 1F1BB 5D4NA 3U27A 3UDVA 4EFAC 3VAHA 1L3KA 1VRTB 4QIGA 2BJ1A 1PKUA 3MMAB 3CMQA 1GFWB 4OFZA 3M8WA 4F3OA 4O4GA 2O3DA 4BLGA 1N5TA 2V4JB 1HNIA 4C8LA 1FK9B 3IFEA 1VLOA 2MQNA 2BMBA 1WSRA 3QGPA 3KTQA 5HAOA 2CQPA 3P6YC 2B4PA 2EFPA 2FC9A 3VAGA 2FDNA 5F8NA 4UQTA 2J76E 2JX2A 4FDFA 1RYRA 4DQSA 5EN1A 1EHWA 1QVFR 3BBFA 3GSDA 1JQGA 5DETA 1O5JA 4NZ7A 2OEMA 5DO2A 1FEEA 3BREA 3AD7C 3KLGB 3NS6A 3LALA 1P6TA 2YQ1A 1OIAA 2CJXB 1BQMB 2XS2A 4EBDA 1PC4A 1CVJA 2FJBB 2CAJA 4IQXA 2MPUA 2Z30B 3ISZA 2B7CB 5KFVA 3MEDA 2F7VA 1V9OA 4F0MA 1VQSA 1O51A 4CLZA 4DLEA 4HR2A 5J2PA 1MWYA 1VRQC 3BR9A 3C19A 3VAMA 4KBIA 5KFAA 3MEEB 3LOUA 3OHBA 1KVIA 1AA1B 3BF4A 2P6SA 2OD6A 2ZHAA 3THVA 1NJXA 3GIJA 2I5JA 2XYGB 4HDGA 4N7TA 4TKTA 4F4XA 3LF0A 2W9CB 3MDFA 3V5RA 4A8OA 2ALYB 2XGQA 1GQEA 1IQZA 3PRBA 3SBMA 4N8OA 1FRIA 3M6UA 4P2MA 2LCWA 4FPRA 1W26A 4F7VA 1KFSA 1WHYA 1RB0A 3FK4A 2OI2A 4MJKA 2NPFA 3K8VA 3FBCA 2BACA 3RR7A 1I94J 1U47A 2Y3YA 1RCOB 4ECRA 3LPEA 1NHKL 1EP4B 1F0XA 4PQAA 1ZH5A 2X3GA 2VPXB 1HBUB 5E5NA 1D9FA 2AKWB 4JI0J 3VALA 1N34J 4LFAF 3CVKA 2CJYB 3M30B 2DNGA 3EZOA 5KFZA 2XO7A 3DOKB 2J5AA 1IKXA 5DQGA 1FDNA 2W25A 1X31C 2DNPA 3H2UB 1VGYA 3W9HA 1F60B 4KT0C 4DV4F 3H5XA 2HMIA 2OPSB 5L9NA 2FGOA 1IM6A 1N33F 4I69A 2UXCJ 1VFJA 1RT5B 2FHMA 1FKPA 3AA9A 2EFQA 3THTA 3OLAA 3D0HE 4A8MP 3KYLA 4NPOA 1SCJB 4I6WA 4HACA 5KG4A 1S6QB 3HCXA 3SSRA 1YJWS 5K8NA 3TZXA 1TMJA 1SKWA 2IAJB 1NRKA 2HBYB 3D0IE 4W90B 2UUCJ 3PW4A 3QYYA 3QJPA 3MEGA 2B8QA 2BW7A 1U1OA 1RT4B 3NGTA 3CMES 1LXNA 3EVWA 2YX4A 4WKRA 2HHHF 5M2RA 3BDPA 3OXFA 4FF2A 2AYMA 2A6OA 1FVQA 1QJHA 3GYXB 1JNRB 4BWMA 5GMKa 5IZHA 1MN9A 5KFIA 1RHUB 2QV6A 2G0JA 2FJVA 2BOPA 3Q83A 1FHTA 4RNNA 4LREA 4I2QA 2AYEA 1RWWB 2KH9A 1GX5A 4DPUA 4OI6A 2P9EA 1XERA 2ZVSA 4LF8F 3V6HA 4C8OA 5KFCA 1IKWB 1TV6A 3R5GA 2EFVA 5IS2A 3TJ8A 3PYDA 3BSOA 4G1IA 4P73A 3K8WA 1NU4A 3QMQA 4M5DB 3IRXB 4DV1J 3HT0A 1U6FA 5HVFA 1YK9A 3ENQA 3P45B 3M6XA 4OZ1A 1NPPA 4NLTA 1TMMA 2DGWA 1RT2B 1GK8A 2AEJA 3SDEB 4RJVA 4URSA 3LO3A 5B0AA 1RHKB 4TLRA 4WTYA 1S9EB 2FLNA 3VTIA 4MYUA 2ZM6F 1G7CB 2JLEA 1GXTA 1PYSB 4XIUA 1WEZA 3AHPA 1RXOB 4ZIWA 5ETVA 1YGYA 2W2OP 3EJMA 2V63A 2O67A 1M1GA 1HHQA 3C3LA 3AXMA 1KQGB 5AE3A 2QL9B 3J81j 2VHGA 1X5SA 3FQLA 5CZVA 4ENOA 4K8RA 1V6HA 2CQIA 1JJCB 2M0GB 2DR8A 1UZHA 4EZ9A 5J1EB 4NLSA 3QRRA 3OL9A 3VGVA 3AJ2A 1HWUA 3LAKA 3GWCA 5HQMA 2DCLA 2BE2B 2RILA 4JV5F 5CCMA 4X66F 2GQCA 4F8RA 5ETRA 4NX9A 5I4MA 4IG0A 1AZSA 2QL5B 3I4PA 3JAMY 1EIYB 4PXDA 4OJHA 3QIPA 3QZ8A 4NEYA 2ZITA 1ZZNA 3AB4B 2YNHA 5ETSA 4NXMF 1APSA 2Y0BB 3CCLS 4C2MA 2HFOA 3CD5A 1EARA 1KEKA 2JWNA 4DCJB 1QAYA 5KFWA 3W2WA 2N82B 4Y3CA 4LVNP 1D1UA 2F9DA 2LQ9A 2POKA 4DPYA 3I0RB 1QTNB 3LWLA 4DSEA 2N7YA 2WW8A 4ZCMA 3JTOA 2LP4A 2EVZA 4AD6A 3E8OA 4NEZA 2BX6A 4ETXA 1PYTA 5KFGA 2R7OA 3L95X 4R0JA 1N32J 1WC6A 2VFVA 3AODA 1KRPA 2AJ4A 4IR9A 1RT1B 2LU2A 3QSIA 1IBMF 4DR2F 4LSLA 2DGXA 4ZS6A 3EX7B 2DISA 3QJLA 4PEOA 3KLIA 1VQ4S 2XZDB 3MUVP 2MKSA 1OYDA 1XNQJ 1JLQB 4CLUA 4F3QA 4DF8A 3ZTOA 5HVGA 3FFIA 1JJ4A 3QWUA 3M6WA 3I9ZA 1U8SA 1HQUA 3SSSA 5J2QA 4BWJA 2JH3A 3UN5A 1WC4A 3D66A 2Q3PA 3PR4A 2CQ1A 1L3VA 2BBEA 2VOPA 2IDLA 4JI8J 2J0WA 3PCOB 2EK1A 2K1RB 5IT9Y 1YBTA 3KHHA 3IGVA 3KHRA 2D3ZA 3VVTA 1LFWA 3ZNJ1 3LPYA 3ET6A 3VQSA 3DXSX 1TTHB 4ZOSA 3PFEA 1REVA 4F25A 1Q95G 4KKOA 3LWMA 3KFWX 2RRBA 1FJGJ 3UO0A 3DLKB 4LSZB 1NAQA 5KFNA 1WACA 2GW8A 2BV3A 4RW8A 4JBCA 3UFCX 1LQ9A 3BKTA 4GVLA 4JI5J 2LVWA 4PPZA 3ZXWA 3BDEA 3DDIA 3HSDA 2W9BB 1I94F 2CNOB 3C6TB 1RQ0A 1Y7PA 2VFTA 5F8GA 4Q2MA 3TW0A 2A0FB 5H9FJ 4JI0F 2X3DA 3HFVA 3NGRA 1N34F 4PXBA 2MJUA 4NA3A 3EZUA 1QSYA 5CABA 1P8GA 4NYPA 3ZZUA 2HQGA 3ZFVA 5KFUA 5EX3A 1CJTA 4LBHA 3H5UA 4JI6J 2D9PA 5DG7A 4WFYA 1JJ2R 4ZK7M 1KWMA 4Z7CA 2YWFA 1E6YA 4PR6A 1LNQA 2BEFA 5CYMA 2UXCF 1S1WB 2DR5A 1IXKA 4RW6A 1JKHA 1OJ4A 2PT0A 3A8KA 4X64J 4JI3F 5KFSA 3BBBA 5CQGA 2NS1B 3IC1A 2F9JA 1RLCL 1UFWA 2HKEA 3QBCA 4K5SA 1NSKL 3PVXA 4PQUA 2KO1A 1FDAA 3LP2A 2PD1A 4ILLA 4B02A 3Q23A 2YNFB 4JI1F 2K7JA 4QR2A 3HP6A 5EGYA 2QLWA 2V94A 3W3SA 1YIJS 5DS7A 2UXDJ 1HWKA 1U09A 2LA6A 2ZE2A 4E0DA 2RAQA 1HNXF 3GTYX 3QIDA 5HVHA 4EGLA 2DJWA 1RAFB 4ES1A 2UU9J 3ZZPA 4XDCA 2QTWA 2F1FA 4C0BA 3MAAB 2IJFA 1LW0B 3W65A 5HLFA 3PFOA 1RWXB 2FQQB 1RT7B 4P74A 1LXJA 5HATA 2YY3A 1RSCA 2OP5A 4DL4A 3HHKA 1KKHA 3VGSA 2IHR1 3PJWA 4TY8B 3IGNA 4KGVB 4NCGB 2HNZB 2QRRA 1TR0A 2KHDA 5A8KB 2FZCB 3MR7A 2XWXA 3MR6A 3OL8A 4DV7J 1SKSA 2E7WA 4M5KA 3MM7A 1XWLA 4RUCA 2C42A 2MKHA 1DTTB 2PMHA 3LP0A 4ANCA 4CLWA 3G6XA 2WSCC 4FPIA 1X5OA 1T7PA 1MMLA 3DCAA 1Y5LB 3KJVA 4F4KA 5BYRA 3UDLA 4YMEA 4IDKB 4DV3J 2B5JB 2MSSA 5CZXA 1HNWJ 3GCXP 4N8NA 5ETPA 3UD3P 2JEGA 3M9OB 4M5LA 3LGNA 2F40A 1VQ5S 2K2PA 3SYZA 3HVTA 1TAQA 4O0NA 4Q44A 2MSTA 2IA0A 3SSQA 4B3TJ 3TVKA 3Q89A 2H9ZA 2GGPB 4KGMA 5IM0B 3H0PA 2GNKA 4J9VA 2R8KA 3CDWA 2RHSB 1VMBA 4M95A 4C8KA 4WCEQ 4B3OA 4GRSA 3OUYB 1U6ZA 2XLKA 2YTCA 4FXVA 4WZQA 4GVBA 2XHWA 2RDDA 2IVMA 2WVDA 2H4WB 2HFSA 3N6LA 1WF0A 3W62A 3NCPA 4EYHB 3Q8YA 4HTJA 4JI4J 4NRTA 4DS5A 3RW7A 4ZN3A 2XY7A 1KDNA 3CJ5A 3BN4A 3BO3A 1EQ0A 3WDOA 4KGKA 2GJFA 4OL8A 4NRUA 4OJ1A 5K8MA 2HGLA 2R8GA 2W2QP 1YVFA 4USVA 3TJAA 4DOZA 2MKYA 2MKIA 5KT3A 3TAMB 2HWTA 2QYCA 3N5BA 1YG0A 3JSMA 4NOHA 4OYBA 2HFZA 4X4UA 2L9WA 5D0RA 1NPKA 4IO1A 3F41A 1Q5VA 4Q45A 4NLRA 3BGUA 3FMBA 1N32F 1TKTA 2W24A 1HYSB 3EVOA 3WC2A 3DGVA 4OYIA 3WHIA 4ZVHA 4QPXA 2FLOA 4WXWA 2VQFJ 2VQEJ 2KXHA 1FTCA 1OQ6A 2CZVC 1XC9A 4ED2A 4DPXA 2DPJA 3FGVA 1TKZB 2BOAA 4CLTA 4J9KA 3EVMA 2W7OA 3IBFB 5E3QA 3PHEA 2HAIA 5DJBA 1S1TB 2V9WA 2BJEA 2VONA 1D9DA 3ZNUA 2R9LA 3A8JA 4MK9A 4Q0BA 3CCMS 2CZ4A 4ES2A 3P5BP 4TQSA 4CT8A 2AP6A 2VICA 3W8GA 1HI0P 1MLAA 3UPFA 4G65A 4JI8F 4I0WA 3KK1A 3RB0A 3T6BA 2DGSA 2EKYA 1R0CB 2CXEA 3H2VE 1N6QB 2Y8WA 2FUG9 4BC9A 2OEKA 2H65B 2VBWA 2CIMA 5HMXA 1WJ9A 1K47A 1S1UB 2MLYA 1U49A 1NBEB 2B9YA 4M5IA 1VI7A 3C8YA 4JP8A 1YTYA 2KG1A 3IXQA 3EXCX 2UUBJ 2XLIA 5DZ7A 1KNZA 1PBUA 4DG1A 2DPIA 2H51B 4CCHA 2FJXA 2ZZMA 2ZHBA 3TO8A 2HQIA 5THWA 3MPVA 3D6MB 5KFEA 2W4DA 4ZLJA 1HA1A 4NMLA 3KLHB 1C1CA 3BO2A 4I7FB 2GO9A 5KT2A 3EE3A 1R7IA 4QR0A 4CDIA 5IT0A 1X8DA 2G2ZA 2NUUG 1VHFA 4JI7J 1KVJA 2IC3A 1SVDA 2BQUA 1QVGR 2HNYA 2OKQA 1FRLA 4CI0B 3D9BA 3NCQA 3NGDA 1GMVA 3HZEA 2GAGC 2MZ1A 1T8EA 2D69A 4J9PA 4ER8A 1TL7B 1HWIA 1FJEB 2W8LA 2GV1A 2GJ2A 4JI6F 1PGZA 4ECQA 4LT6A 5DLGA 3K89A 3Q8SB 4LBPA 1DJ0A 1SBRA 4ID5B 4NA1A 5D0GA 2R42A 5GADU 1QE1B 1NKBA 4USUA 3Q0AA 3NS7B 5DDQC 2AEFA 3THPA 3DRPB 5H1SV 4O23A 2YKOA 4HL9A 4X4RA 2RQMA 3VV2B 3LW5C 3GJQB 1Q16B 3M6VA 2ZC3A 3FCHA 1RAGB 3T5LA 3RR8A 2HAFA 1SIWB 5T14A 4RWXA 2ZNYA 4IFYB 3R8YA 1K1SA 5B0CA 5L1JA 3SCJE 2QMWA 4J9LA 2C3PA 1C0TA 3HSGA 1ZTWA 4OI0A 4C8YA 2UXDF 4F4AA 2HSEB 3K5LA 3OFEA 2I2YA 3P8BB 2E9TA 2W2NP 3HHLA 2UU9F 4RW7B 4X65F 3BBCA 2WVCA 3KG0A 5D15A 1W7WA 2M8DB 3MTJA 3T1YF 2V2QA 2IVFB 1S59A 4ZPCA 3KJQB 2N3LA 4YOEA 1C0UA 4A46A 3BJYA 2P5VA 4Y2KA 4MYTA 4CLKA 4KE5A 1EZZB 3RG6A 1AYEA 2OPQA 1LW2B 1L3UA 1AUSL 4CLFA 3DRYA 3DM2A 4B9NA 1VJWA 4HI2A 3JQMA 4YB6A 4DX5A 1S1VB 4CTAA 4DJBA 2RS8A 4WWSA 5CD4A 3RAXA 2ZDOA 5ADZA 4U9RA 2RDIA 1RWMB 2MGZA 5ETMA 2ACMA 4Y34A 1Y9OA 4OX9F 5D3GB 5FLXU 1NK6A 3CD7A 2JHEA 1I3OB 5KFMA 1NJIT 2WOMA 2LDYA 3DDKA 3UR3C 2ZD1A 4WYLA 2WBRA 3J7AN 1VQLS 3H4BA 4OMFG 3QFHA 1NJZA 1SI9A 2XS5A 4PAAA 1HNZF 4B3TF 2Z2ZA 3BEGB 2PMZD 3KLFA 3HM9A 1G1XA 3OR1B 5F0UA 4I2PA 4C11B 1JLEB 1Q8IA 4XAKA 3FEXB 1XNRJ 5HSPA 2MQOA 5I3QA 4TYBA 1JB0C 2E5GA 2BE9B 2VKRA 1TP7A 3OR2A 3W7BA 2KJWA 3J81U 1TVRA 4UZCA 4JI4F 3M9MB 4BS2A 5F8HA 3WZ0A 5IXUA 1Y4ZB 2MJNA 2LECA 2DT9A 4HKQA 1LWEB 3IR6B 2UVVA 1H72C 2YPZA 4H4MA 5J2NA 3R7BB 1TZ0A 2CJQA 1IKYA 4DL5A 3EGZA 1HBNB 3AT1B 4GC6A 1N0VC 4TQRA 4OI2A 1PG5B 3POTB 4JYAJ 3QPIA 4USWA 4F26A 3D1QA 2QA1A 2YKMB 2AF6A 5HK4A 2NR0A 1CLFA 3TYTA 4DR5J 3RZAA 2GHWA 2OTJS 7FDRA 1SV5B 2KU7A 3JSYA 1E6VA 4RU9A 1J5OB 2YWEA 1GNKA 1U7LA 1JLBA 3M32B 2IIHA 2R7RA 1B0TA 1XN9A 2E5LJ 2U2FA 1PYOB 1AXQA 3OXGA 2VQEF 1YZ7A 5LSOA 1FFSB 1UVMA 3QT8A 4ZN1A 4ZPTR 2VBZA 4CIOA 1VYAA 2UV8G 2OUGA 1WC0A 3CJKA 5K14A 2AMCB 5ETNA 2C3UA 3UWTA 4WXOA 1J2VA 3NMAA 1JLFA 1A7GE 2AD9A 1UJ4A 3M8RA 4ID8A 3I5AA 4U67Q 1X4BA 2G1DA 3KHLA 3Q8PB 3DNCA 1OS5A 1NJYA 1QM9A 1A6LA 5KFJA 4RW9B 4RUHA 3A1YG 3OL7A 3LANA 3TUJC 5AJ3J 2GVDB 2OFHX 3ZZOA 2EBGA 1RTIB 3LAMA 1H38A 3K5OA 2V0NA 1R89A 2IM0A 1EB0A 3PG9A 3R5BA 3BKFA 3IBWA 1HBOB 3H20A 4HLBA 5DLFA 2ZEJA 3K57A 4AYBD 3RBEA 1R31A 2ZJRQ 1S9GA 3D2WA 2DHSA 2P6TA 3ULHA 3BV8A 1R8CA 4OJ3A 1RAJA 2HS0A 2ZBCA 2DRBA 4PG8A 1NZ8A 2HHSA 2QLJB 1T03A 4DBQA 5AT1B 3V2UC 4U7UK 1GH8A 4B3SJ 3S8SA 2YKPA 1T9TA 2AGQA 2QMUB 4O44B 3GIIA 3NLCA 1WELA 2CG4A 1DAXA 1FWKA 4DCPB 1CULB 4P10A 2FLLA 2LFVA 1SKUB 2WVBA 4MFBA 4LF6F 4Z7YA 1IWGA 1I1GA 1UCNA 3IAS9 1YJVA 2M2BA 3H2LA 3DU6A 1CJUA 2DGQA 4ZP7A 5KT6A 5LMUF 3GJRB 1YRXA 4ZVEA 1RTJA 1B4SA 1WD6A 3VF0B 4ED3A 1IN0A 2R7XA 8ATCB 4H4KC 5KAKA 4QOTA 2RIJA 3V4IB 2DO4A 4MK7A 1CQNA 3B78A 2N4DA 4NE9C 5C2GA 4ILRA 4TU9A 1NZAA 1FVSA 2CUYA 1KLMB 3H40A 3PW7A 2HLUA 4B3RF 3FBFA 3FCVA 3J7Z5 1S99A 5KFHA 4KRWA 2C28A 1M0SA 2V68A 1UVNA 4OV6A 2AZ1A 2V5HG 1IR0A 3IR5B 2EKNA 1TL5A 4J90A 2GS8A 4J9SA 2V4JA 1NDPA 2A3JA 1ULRA 1FK9A 4C0OC 2XSJB 2C1EB 4AUKA 1T9VA 3KLVA 3DYAB 4OI1A 1VBZA 1YRUA 3VGTA 4K0KJ 4WZMA 2R7QA 5J2MB 3DDNA 1KLNA 3NWGA 4HT5A 3BO4A 3EDQB 2M52A 4K4XA 4ZVGA 1FXLA 1IBKJ 1ZM3A 3PEHA 3SCKE 5EX0A 1D8ZA 4QU6A 2GMHA 3C66A 2JEIA 2Z2LA 1NDKA 1QAJA 4W98A 3KLGA 4YEAA 1BMQB 2HW3A 1VBKA 3W2VB 3QGHA 1H2TZ 1BQMA 5LSRA 1BD6A 2VC1A 5ETKA 2B9XA 1GX6A 1HLWA 3RRKA 2R7SA 2B3TB 3G82B 3SCLE 2YPYA 1GMWA 4LF4J 4M63A 3T1HJ 3PIOQ 4IO9Q 3AD9C 4PXCA 4DX7A 4NWBA 2ASYA 2SXLA 3WIVA 4N76A 1YHQS 3MEEA 2KXNB 1WI6A 2HIYA 4PPDA 4ZHRB 2W7PA 2VU5A 2QT7A 2R8IA 2UVUA 2AIRB 2XYHB 1QUPA 2LA4A 2W9CA 2BKNA 4L3NA 2VDIA 1L3SA 5KT7A 3DGPB 2K3IA 4ICLA 1MNEA 1XNRF 3DLGB 1Y3JA 4OQJA 2R2TA 3KK2B 4R25A 3HMJG 2KZZA 1X4DA 4FF1A 1SJ4P 5KG6A 4DQIA 5HO4A 4ZITA 4M5JA 1RLDA 1EP4A 2AEMA 1RHQB 4LF7J 2B4VA 3HVRA 1HBUA 2NYHA 2H1YA 6FD1A 3KK3B 2MHEA 2VB6A 2ZBPA 2JNJA 3M30A 5IQ6A 2UXBJ 2NZCA 1YWXA 4JYAF 3RTVA 3DOKA 2W01A 1YJTA 1FKOB 3H42A 4C98A 5HBMB 3T41A 3U1LA 3ETMA 3F56A 4J91A 4YHHJ 1KOOA 3X1LB 4ZVOB 2OPSA 3O3LA 4ECSA 2VKZG 1WHXA 2C2DA 3GLJA 2G2YA 3ISND 1RT5A 1PBAA 4P2XA 4ZPDA 1CG2A 4WBFA 4QYZK 2XULA 4X4QA 1DY3A 1S6QA 2IAJA 5A6PA 1M5OC 3LH2S 2Z56B 3LP1B 2NXCA 5KFFA 5HP1B 5CXTA 4M5NA 3PYGA 3HKZD 3E3XA 1RT4A 2E7VA 4OYPA 4YY3J 2HHWA 5GADI 5D4PA 3N28A 5GMEA 1NK7A 4C7QA 3C46A 3J81Y 3BQ2A 1H73A 4GKKJ 2CVEA 2Q79A 4AL5A 3RRGA 2W7AA 1REGX 4DR3J 3H98A 2JC1A 5RUBA 1RWPB 2DHGA 3I9V9 2F8MA 2CFXA 3CTRA 4OYAA 5AJ3F 1IKWA 4G1PA 2AJFE 3TVYA 1VOMA 1WHWA 4QR1A 4DEZA 2V4QA 4A48A 1Q8KA 4M5DA 3IRXA 2VG5B 2Y0SD 1U2FA 2DNHA 4GKJF 4RL1A 1J27A 2V8DA 4LF2A 1RT2A 4K4YA 2FLPA 2UUAF 2WZ1A 3SDEA 3I82A 1VRUB 4OV1A 3NEKA 1XBWA 2CPEA 1W2IA 3TNVA 4OI3A 1S9EA 3L7PA 3CJSA 3OV7A 4K59A 3TR5A 3GJTB 3CJ4A 3NNAA 4WU2A 4JV0A 3N6MA 3S7RA 2DNQA 5DDOC 1YQHA 1LKZA 1EETA 1JX4A 3J80U 4WK1A 4PWUA 2CPXA 4OHXA 2HVHA 4B3SF 4LVOP 3MI7X 2KM8B 1DTQB 3V6DB 3UCZP 1H7WA 4DSLA 3HVAA 2X51A 2LQBA 1UFLA 4UT4A 5J1EA 4C9DA 5K9FA 4JI2F 3CJTA 1QDUB 2OPRA 2GMLA 2KTQA 2IM3A 4KAIA 3H5SA 3MCNA 1BLUA 4QPTA 2BE2A 2ROPA 1WOPA 3WC0A 5A2QY 1X0FA 4A8FA 2WRMA 4QIEA 3NY0A 1KTQA 2ZBIA 1CJKB 1U0HB 1WUUA 1YBUA 3T5HA 3NGKA 2OLWA 3CO9A 3NBPB 4CZCA 1MW7A 3CCQS 3RB3A 4FYWB 2WB4A 1SJRA 1AZSB 1U1QA 3QRPA 4N41A 1S79A 5GAEU 4OZ3A 4MTPA 4WTOB 3K5PA 4NLOA 2X1GA 2L41A 2CA9A 1L5UA 2AWZA 2IYIA 3BSNA 3HK2A 3DI6B 2K8GA 2RVJA 3N01A 2RT3A 2HVZA 3I0RA 2CDRB 2C2NA 2KYZA 1YI2S 3D28A 2FTRA 2RRNA 2CPIA 2QL7B 4AL7A 4TU8A 2E5HA 5H9EK 3C6UB 3R1HA 2QA4G 2CQCA 4X84A 5B0BA 2KRBA 5AE1A 3AJDA 4DV4J 3BR8A 4K0KF 2R2RA 2PI5A 1X4CA 4NLXA 4DUYJ 1MU2B 4OHZA 2F5GA 3PRDA 1RT1A 1IBKF 3DLEB 2CPFA 2QGFB 2GIFA 3GV7B 1OMSA 1SC1B 3IO1A 1HD0A 1V5VA 3OTOJ 5G0RB 1KHVA 3PX0A 5FIIA 3AOCA 3K59A 1K0VA 3EGVA 3ZC4A 3MM9B 4KH1B 3K0JA 2OH2A 1HFEL 4I6YA 4R8UB 2N4CA 2RKIB 2HHHJ 2DY1A 2IDEA 3F44A 1YBAA 1TUGB 3K7RA 3MMBB 1RWOB 4DX8H 1S1XB 1RT6B 3E2EA 4FYYB 4HHUA 1P1TA
chains in the Genus database with same CATH topology
1KP6A 4GVBA 4GVBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KP6 A;  4GVB A;  4GVB B; 
#chains in the Genus database with same CATH topology
 4U96 A;  4K4U A;  2VFU A;  4MKB A;  2K1R A;  2MB0 B;  1RDR A;  4RO0 A;  3HPO A;  3HF5 A;  4YQW A;  4QWC A;  3ZTP A;  4WFN Q;  4KO0 B;  2VIH A;  4YR3 A;  2HRY A;  2AYB A;  1LWX A;  3TAN A;  3GYN A;  5C25 B;  1SB6 A;  3BSC A;  2FHJ A;  4LF8 J;  4KYZ A;  4C3K A;  3JAM U;  4QWE A;  3SEO A;  1FRH A;  3IAM 9;  4Q8F A;  4KHR A;  4CYU B;  3DLK A;  2Y1I A;  4KY3 A;  5HL7 Q;  5F9L A;  1U6B A;  3G6Y A;  3D1O A;  3G71 S;  3EUN A;  3Q8V A;  3I0S A;  2GO8 A;  2W9B A;  1Q7Y T;  3C6T A;  1HAR A;  2DEJ A;  4OYX A;  2ZBR A;  2JL9 A;  4MKV A;  3O8W A;  1ZZF A;  4RW8 B;  1D3W A;  3PYE A;  3OHA A;  5JVG Q;  3DLH A;  3IS9 B;  5BR8 J;  2NRE A;  1Q1K A;  1VQ8 S;  3CWJ A;  5EWG A;  2NSB A;  1U1K A;  2ATL A;  1UJ5 A;  5HQL A;  3TOQ A;  1SQF A;  2UXB F;  3BH6 B;  1UA1 A;  3N9U C;  2V2K A;  1M5P C;  1NB2 A;  4G1Q B;  1ACM B;  3ITH B;  4YHH F;  2I6W A;  4USK A;  1K0T A;  4DUZ F;  5CHC B;  1YZ6 A;  3R5C A;  3MTK A;  4YS2 A;  4DFJ A;  3N4W A;  4AT1 B;  1S1W A;  3R5D A;  5F8M A;  1N5V A;  1B0P A;  4JV5 J;  2Z8Q A;  4X66 J;  2ZC4 A;  2D1C A;  2HS4 A;  3EM1 A;  3CIZ A;  3MM8 B;  3G96 A;  5KFK A;  2GFF A;  2OSR A;  3VHQ A;  3A12 A;  3KNA A;  1Z4U A;  5KFD A;  1VC0 A;  2GAH C;  1JIH A;  1JLG B;  1WKL A;  4ITS A;  1RU1 A;  1OPZ A;  2P8I A;  4NLG A;  4YFU A;  2RF2 B;  2ZWO A;  5K20 B;  2YNF A;  4NXM J;  2EPI A;  3PTW A;  3PZP A;  5F8I A;  3ILJ A;  2Q6C A;  2XYP B;  1UVL A;  2EW9 A;  1QLN A;  5IT9 U;  3VCD A;  3BGR B;  1ZA1 B;  2HG4 A;  2ZFH A;  4GKK F;  2MZS A;  4GO5 X;  2R7W A;  2HQC A;  3CED A;  1AW0 A;  4DR3 F;  2FVC A;  1OQ3 A;  4PG6 A;  3KLE B;  2CQ3 A;  3MAA A;  2FJE B;  3DC2 A;  2MQP A;  2QLB B;  3DRR B;  3BM7 A;  3O44 A;  3ZZR A;  3G8T A;  4QIW D;  3D68 A;  1EAY C;  2MZQ A;  1RT7 A;  1TEL A;  2WHO A;  3PKY A;  1FER A;  3GMG A;  2H54 B;  2D3O 1;  4TY8 A;  1T3N A;  2O66 A;  2E44 A;  4NCG A;  4ECZ A;  1IBM J;  4DR2 J;  1R6Y A;  1JXV A;  3CF5 Q;  2MY8 A;  2DXE A;  5A8K A;  4ED5 A;  2FYX A;  4F0H A;  4OZN A;  4KPY A;  2LXU A;  3EGN A;  2QA4 S;  3OSN A;  3CT9 A;  3OBI A;  2ATC B;  2MMY A;  1HKA A;  2G0C A;  4LJM A;  4RBU A;  1DTT A;  3DLB A;  4YP3 A;  2Z2Y B;  3M1V B;  4B3M F;  3SQG B;  1VS3 A;  2OIH A;  2LQJ A;  4K5R A;  2VDH A;  2B6A B;  2HBR B;  4IOA Q;  1KQK A;  2BJ7 A;  3T19 A;  1KR4 A;  2CNL B;  1XR5 A;  1FDD A;  4IDK A;  3VAJ A;  2B5J A;  1S0O A;  1MRO B;  2EG2 A;  1G4C A;  5A8R B;  3NKY A;  3GJS B;  3FCW A;  3CJ0 A;  1SQE A;  3C14 B;  5FDL B;  3S6E A;  1T02 A;  2KKH A;  4P75 A;  1TU0 B;  1XIQ A;  1L3T A;  4K4W A;  2AW0 A;  2EWH A;  4R5P B;  3RB6 A;  1QUV A;  1BY9 A;  4DR6 F;  2GGP A;  3D6H B;  4LIW A;  4GO7 X;  3PR5 B;  1HPZ B;  3DOM B;  5IM0 A;  4X62 F;  1X4H A;  2DH8 A;  2AHO B;  1R8P A;  4I1T A;  1C4A A;  3HT3 A;  3R5J B;  3OUY A;  2F63 A;  5K5M A;  2RJZ A;  3OFH A;  3MXH P;  5KG3 A;  2Z2M A;  4O3R A;  2IY5 B;  3FDS A;  3UNG C;  2CPH A;  4WFB Q;  1SC6 A;  2E1P A;  2F65 A;  2IPO B;  1X9M A;  1F2G A;  2GVZ A;  5KG7 A;  3M8Q B;  3R7S B;  4UOH A;  3I5B A;  4DHV A;  1Y11 A;  1G6B A;  4CO0 A;  4FF4 A;  4TY9 A;  4KPC A;  1HQ2 A;  3QWP A;  2DEI A;  3KOA A;  3UD5 A;  2AJ2 A;  2MLZ A;  2ZOM A;  3QSY B;  1BE4 A;  2COL A;  4WU3 A;  1AFJ A;  3UI3 A;  2MQM A;  5B7W A;  3J80 Y;  1DQA A;  3Q86 A;  3MPD A;  2C22 A;  2K3K A;  4MIB A;  5HRO B;  2PO4 A;  3TAM A;  2YNG B;  1XR6 A;  2J7K A;  3N0V A;  4IFV B;  4DUY F;  2KL8 A;  1FXD A;  1HYS A;  1S6U A;  1FDB A;  1X60 A;  4O3S A;  2E29 A;  2JEF A;  4PAB A;  5DM6 Q;  1X4G A;  2V67 A;  4JI3 J;  1G3O A;  7FD1 A;  5EHH A;  4FS2 A;  2D9O A;  5BYS A;  1ZAV A;  1TKZ A;  1JNZ B;  3JB9 k;  1FO1 A;  2FVS A;  3HX9 A;  1I51 B;  3OTO F;  2FHO B;  2NPI A;  3G9C A;  1S1T A;  1KP6 A;  2BRK A;  5T7L B;  3JSB A;  1T05 B;  4JI1 J;  4QBU A;  5A0Y A;  4J9R A;  1RTH B;  3QRQ A;  3FVY A;  1NHU A;  1YDL A;  3ZTQ A;  3G6V A;  2IFX A;  4QZV B;  2OMO A;  2FY8 A;  2U1A A;  3IRW P;  2VUG A;  4LIR A;  4FNI A;  1GT8 A;  4WFZ A;  3CUL A;  1HNX J;  4A4J A;  1IWA A;  1N6Q A;  5AXL A;  3K5N A;  3FNN A;  1CBK A;  4AXJ A;  5F41 A;  1S1U A;  4DDF A;  3BSA A;  4HDH A;  2VPW B;  2XB2 D;  3F73 A;  4A8S A;  2O5D A;  1RKJ A;  3R5A A;  3UQS A;  1FD8 A;  5KFT A;  2DBB A;  1F9E B;  2FVP A;  2DHX A;  2XEX A;  4LRF A;  5FJ4 A;  1JK9 B;  3PKM A;  4K2J A;  2ADB A;  1SH0 A;  2H5E A;  3S1T A;  4ZJQ A;  1JLC B;  2WSF C;  2ASD A;  3KLH A;  3HHL D;  2J8A A;  2MZT A;  4TU7 A;  4ECW A;  4I7F A;  4ZCI A;  2FJW A;  5BR8 F;  1RP5 A;  4ZPV R;  2O1P A;  3RU0 A;  4C8Z A;  1WKK A;  4Y0F A;  1C1C B;  2OTL S;  2N7C A;  4WF9 Q;  2W1B A;  3KHG A;  1U4B A;  4DR7 F;  1TL7 A;  2Y8Y A;  1CS4 B;  2FVQ A;  4N47 A;  3DHW C;  3ENA A;  1NSA A;  5A8W B;  4M94 A;  2KFY A;  3RAQ A;  1FT8 A;  4LUB A;  3CCV S;  4ID5 A;  1R0A B;  5HMW A;  1VQP S;  1QE1 A;  3AAW B;  3TUP A;  3CDE A;  4CM2 A;  1DHM A;  1NND A;  2UZA A;  2ACY A;  1Z2L A;  1S0N A;  2EI5 A;  1YJR A;  2NQP A;  2B43 A;  3DRP A;  5HMY A;  4NLW A;  3K2Y A;  5ETQ A;  2HQ3 A;  5B0E A;  5HJY A;  4ZA1 A;  2CDQ A;  4DI6 A;  1U02 A;  3FEY B;  3QO9 B;  2VA3 A;  1FCA A;  2HQF A;  3AD8 C;  1SC4 B;  4X4V A;  3RGI A;  3KJF B;  2QO3 A;  2FD2 A;  3A3P B;  3D5M A;  2C2E A;  4IFY A;  2QZ8 A;  2BZ2 A;  2WON B;  3IR7 B;  1FA0 A;  2MTL A;  4F4Y A;  2JC0 A;  4EK2 A;  5JMN A;  5LJ3 Y;  2FPH X;  3NOG A;  2WVF A;  3OTC A;  3PJX A;  4Z2X A;  1UA0 A;  2JFD A;  2J9C A;  3KUE A;  4J7C A;  1TL1 B;  4RW7 A;  5D0H A;  4E8U A;  3QJJ A;  4DF4 A;  5AXM A;  1S6P B;  4ZKA A;  2MXY A;  1LK7 A;  1WF2 A;  1SL0 A;  1F5B A;  2RRA A;  5BJR A;  5HAN A;  1U48 A;  1NJW A;  3SI8 A;  3W9I A;  3OJU A;  4ZVP B;  3GIK A;  5DM7 Q;  1U2R A;  3IG1 B;  5JJB A;  4K50 A;  4LRB A;  3GP9 A;  4X4N A;  5GAE I;  4FZV A;  4L76 A;  2DR6 A;  1RAI B;  1HNV B;  2XMJ A;  4UZB A;  2CQG A;  1C0U B;  2W2M P;  5E0O A;  2VAS A;  2V34 A;  3C16 B;  4UY8 T;  3TA0 A;  1WF1 A;  3M2R B;  3ISN C;  4EZ6 A;  1LWF B;  1ZS6 A;  3G6E S;  4DX6 A;  2QEX S;  2KM8 C;  3EPI A;  3L4B C;  1S1V A;  4OHV A;  3TZZ A;  4DL6 A;  2BQ3 A;  4NXN F;  4CWB A;  4E2F B;  3TX8 A;  1FFG B;  5CA5 A;  1RKI A;  4KHP J;  1NH7 A;  5I3U B;  2LU1 A;  1X4F A;  3RRH A;  1WOR A;  2QG9 B;  1U26 A;  2C2K B;  3NAI A;  3UCU P;  2HVD A;  3TAQ A;  2R8J A;  2FB0 A;  1OY8 A;  1HMV A;  3E01 B;  4XPE A;  1UWA A;  1UAW A;  2QJ3 A;  5D3G A;  4C8N A;  4CO5 A;  4JB8 B;  4L75 A;  1QSS A;  2CPJ A;  3I31 A;  2E1C A;  5GAH U;  3B4D A;  1KOH A;  3N6N A;  2J0S D;  4AFF A;  4FBT A;  5U47 A;  3RUB L;  2M3D A;  3ELH A;  5J1P A;  5JVH Q;  3TUI C;  3MCO A;  3DRS B;  3BGL A;  4KC5 A;  4Y00 A;  5AXK A;  3MFI A;  2HPU A;  2ILZ A;  4ZCK A;  4BC7 A;  1VQ9 S;  5C42 B;  4AQY F;  2E1A A;  1X0P A;  2DRD A;  4PG7 A;  5E2Q A;  2YBV A;  2OO4 A;  3EMT A;  3EZ5 A;  3JYT B;  2ZH7 A;  4O3Q A;  5J1N A;  4CLY A;  3OR1 A;  3LA0 A;  1N5Q A;  5EUH A;  4HYK A;  4C11 A;  3ADA C;  3KMS A;  1JLE A;  5I42 B;  1VIO A;  4NLQ A;  3OT9 A;  1UFK A;  2BM1 A;  3LGH A;  1KQF B;  5D4O A;  5M2U A;  4A8X A;  2IBK A;  2XMT A;  4KTQ A;  1HQE B;  1O6X A;  4DL3 A;  1OYE A;  3W5Z A;  2DB1 A;  1LWE A;  3GG0 A;  2EC0 A;  2F4F A;  4KIA A;  2YNI B;  2IVY A;  4QIF A;  4QYR A;  3GSI A;  2MEW A;  3BS9 A;  1CQM A;  1K8A T;  3BH7 B;  3POT A;  3RW6 A;  3DRX A;  3GE9 A;  1S48 A;  2YKM A;  4OYZ A;  4URG A;  1R8B A;  1DRZ A;  4DZD A;  1SV5 A;  3KWM A;  2XM3 A;  1RU2 A;  1J5O A;  4PG4 A;  2VF3 A;  3J7Y U;  2RB7 A;  3GPA A;  2QLF B;  3M32 A;  3TEG A;  5D8H B;  1V3S A;  3C2P A;  4L74 A;  3CDA A;  1TKX B;  2JSX A;  4S0M A;  2CQ0 A;  4USM A;  4PXE A;  3L09 A;  1XMQ J;  2EEY A;  1NB7 A;  1IBL J;  2VA2 A;  5LXY A;  4O0I A;  5C2C A;  2WBM A;  3VQT A;  4HEA 9;  4FS1 A;  4DPT A;  2AQ4 A;  2R8H A;  3KNG A;  3QAE A;  3ONQ A;  1ITP A;  4NYO A;  3W9J A;  1EJ7 L;  1LWC B;  2NSC A;  1VCT A;  5LMN J;  3QLH B;  2JVR A;  3OTB A;  4DL7 A;  4CH1 A;  2WAQ D;  3GR0 A;  4X65 J;  1ICE B;  2RD5 C;  2L9N A;  4OYM A;  1IBC B;  2ROE A;  2BM0 A;  3MMJ A;  3MD3 A;  4RW9 A;  3T1Y J;  3GZ7 A;  2VV5 A;  3FSX A;  3I6P A;  2RQK A;  4V1A k;  2BRL A;  3OJS A;  2GVD A;  3TP2 A;  4G6V B;  1RA6 A;  3CW2 C;  2VFR A;  4H4O B;  4YDX A;  4U95 A;  1RTI A;  2FJD B;  1WC1 A;  3R7N B;  3FQK A;  2RDJ A;  1FRK A;  4LBI A;  3O1L A;  2W4C A;  3EXY A;  2M9K A;  4PCQ A;  3HJV A;  2HHT A;  4CO4 A;  2HHQ A;  1HBO A;  3UNY A;  4TN2 A;  1VQN S;  4F67 A;  3OLB A;  3VAI A;  4ZJO A;  1LK5 A;  1QTM A;  2H5J B;  2JOQ A;  2CNK B;  1S7I A;  2QX0 A;  2OPP B;  2C3O A;  3FZB A;  4TLQ A;  1QAX A;  2PE8 A;  4A47 A;  4QJV A;  3TJ9 A;  4KJI A;  1Y3K A;  5IOL A;  1Q7L B;  1R8H A;  1SUQ B;  5IFM A;  1BQN B;  1N36 J;  4FVM A;  3D3C J;  1DLO B;  3DMJ B;  4OX9 J;  3LQV A;  2W4P A;  4FKX A;  2DD8 S;  2MQQ A;  4O44 A;  2LXF A;  2PMW A;  2MKC A;  1CUL A;  3JTN A;  2OFG X;  4WE1 B;  2Z4P A;  4O3O A;  1TK5 A;  2DKO B;  2YQ0 A;  1B3T A;  3MGJ A;  3IA0 A;  4C6A A;  1RT3 B;  5AXN A;  1D0E A;  1B0V A;  4QCL A;  3V81 B;  5IV3 A;  3OTD A;  2CKW A;  1HNZ J;  4X4T A;  3R27 A;  2OAU A;  2HND B;  3BZQ A;  1TQL A;  4DCO B;  4QWB A;  5M2P A;  4RUB A;  1YLX A;  3MOZ A;  1ZYQ A;  2DNL A;  2XNQ A;  1N56 A;  3MCM A;  2BW2 A;  5KTQ A;  2B56 A;  3V4I A;  1S9F A;  1JMT A;  1GMW D;  1S7H A;  1H98 A;  4IQM A;  4LRA A;  4LQ9 A;  2J0Q D;  3UN3 A;  3D1H A;  4USH A;  2QA2 A;  1AUD A;  4ECT A;  2KZM A;  2A6M A;  1YJU A;  1SQG A;  1Q78 A;  3HLU A;  5A76 A;  3TZY A;  1EKR A;  4YB7 A;  2MQ8 A;  4UQG A;  2LDI A;  1PC5 A;  5IC6 B;  3PW5 A;  2HBQ B;  2Z57 B;  1EKS A;  1PSD A;  3CJQ A;  4OX8 A;  4KR0 B;  1GAO A;  2XSJ A;  1UL3 A;  2DCU B;  2JLG A;  3DYA A;  1DQ8 A;  1HW8 A;  4F0K A;  3IP0 A;  1YKW A;  1N5Y B;  1C4C A;  4P52 A;  4RNM A;  5J2M A;  3G8Q A;  3UD4 P;  1UW9 A;  2KT5 A;  2KRR A;  3MWB A;  1RIS A;  1WTB A;  2VG6 B;  2LEA A;  2YX7 A;  2BVZ A;  4N5S A;  3W1Y C;  3AJ1 A;  4ZP6 A;  1HBM B;  1NK9 A;  2KFZ A;  4KHP F;  3L9Z A;  3HFZ B;  2G2O A;  1AT1 B;  4KFB B;  3W2V A;  1HHS A;  1Q5Y A;  2HWH A;  4RNF A;  2WVE A;  1ZTT A;  1UWB B;  1BWV A;  1ZBT A;  2UV8 A;  3M4X A;  3G82 A;  3HSZ A;  1RHR B;  3PEJ A;  1IR2 A;  1X5P A;  3X3U A;  2Y1J A;  2F3J A;  3L7O A;  3AOB A;  4NMX A;  5JXS A;  1S0M A;  4NLD A;  4CO3 A;  5C5J A;  3HZG A;  1DBD A;  4IOC Q;  4RNH A;  3GFX A;  1Q4R A;  4ZHR A;  1XK8 A;  3B54 A;  4RZR A;  3HXM A;  4ED8 A;  1QD1 A;  3R9L A;  1WG1 A;  4CH0 S;  1HR0 J;  3A4T A;  4WP3 A;  1T94 A;  1VK8 A;  4FF3 A;  1FNM A;  3AH6 A;  5F8J A;  1RTD B;  3DGP A;  4ELU A;  2BKP A;  3MUM P;  1UMJ A;  3CSK A;  4HH0 A;  2ZJP Q;  5HJX A;  3DLG A;  4WP8 A;  2Q6B A;  2V50 A;  3KK2 A;  1ZM2 A;  6FDR A;  2AGP A;  2EFG A;  4ICL B;  1WNE A;  2KVQ E;  1HIY A;  4K4S A;  4KHM A;  2YKN B;  1B7F A;  3C15 B;  1EQM A;  2KB2 A;  3NAH A;  2XMU A;  3M8P B;  3S01 A;  4NZ6 A;  4UOC A;  3ZTS A;  4TXS A;  1NCL A;  2UP1 A;  3GU0 A;  5ETO A;  4V19 J;  4O3N A;  3KK3 A;  4A8Y A;  2DH9 A;  1NH8 A;  1MWZ A;  4M5M A;  1ELO A;  3CUN A;  1S49 A;  5CYQ B;  2ZUA A;  1NKC A;  5K8P A;  4BBY A;  2MLX A;  2J6U A;  1UEV A;  4ECX A;  1N4L A;  1FKO A;  5HBM A;  2D7S A;  2I9S A;  2FZG B;  1SJ3 P;  2BDP A;  4NLU A;  1CJV B;  1URN A;  3IN5 A;  5EWF A;  2A2D A;  4P71 A;  1HD1 A;  4LF6 J;  4JV2 A;  2RS2 A;  1Q79 A;  4ZPW R;  4UUW A;  2YKQ A;  2VPY B;  1CSJ A;  1NSQ A;  4UW2 A;  1K73 T;  5LMU J;  1H0H B;  3OSP A;  1UZD A;  3DOL B;  2X7I A;  1XMQ F;  2AZ3 A;  3LP1 A;  3D3B J;  1IBL F;  3UR0 A;  1KSP A;  2RQ4 A;  3FJ2 A;  2DNZ A;  5HP1 A;  4RW4 B;  4DV2 F;  3K5M A;  3GIM A;  2E66 A;  2OJ3 A;  2BJ9 A;  4TNO A;  1KC8 T;  4NI2 B;  4B3R J;  3JXO A;  3TA1 A;  3FBE A;  1F9H A;  3CD0 A;  5LMN F;  5DRK A;  3GFZ A;  4ZLP A;  4LR8 A;  1S4F A;  1RBA A;  4DSJ A;  3MF5 A;  2J6S A;  3Q2S C;  5DZ6 A;  3UN2 A;  2BAB A;  1FRM A;  1ROF A;  5IV4 A;  2KHC A;  1U25 A;  2OSQ A;  1S72 S;  4IUF A;  5GAG I;  2VG5 A;  4U6P A;  2GCF A;  3OPK A;  2RNE A;  2XSF A;  2ADC A;  1ZM9 A;  4RWW A;  2PII A;  5C24 B;  3DXB A;  2H5I B;  1HHT P;  2WTF A;  1VRU A;  4ED7 A;  1FNO A;  3KG4 A;  2MZR A;  4P9S A;  2YKA A;  2JDJ A;  1FX2 A;  4OYO A;  4OI4 A;  4FXW A;  2ZNZ A;  2GQ2 A;  1J5E F;  3KMQ A;  4DFM A;  4P72 A;  3W5X A;  4Y65 A;  4PWD B;  1N36 F;  2DVI A;  5KFR A;  1RBO B;  3V6D A;  1DTQ A;  3GV5 B;  2C2R A;  2GA7 A;  3AB2 B;  2I0X A;  4W92 B;  1T3O A;  1EET B;  2AX0 A;  1C1B B;  2DNR A;  1PAE X;  1WHV A;  4LQ3 A;  4JV1 A;  2QSF A;  2BAN B;  1WI8 A;  2R7U A;  1MWQ A;  4UF4 A;  3IM9 A;  4KGZ B;  3M2V B;  2LYV A;  2FGC A;  2B7B B;  2KDO A;  4C0H A;  2KI2 A;  4B17 A;  4DQP A;  1CJK A;  4AND A;  2OPR B;  1U0H A;  1TAU A;  4OIX A;  4PG5 A;  2MY7 A;  4DV5 F;  4WYW A;  3NBP A;  2HQD A;  3CJR A;  3PY8 A;  3CD6 S;  5GAH I;  1Q8B A;  2EK6 A;  4IG3 B;  2RSQ A;  1UJ6 A;  3GIL A;  2JFK A;  3MCS A;  3MAQ A;  1BWE A;  4MKA A;  4LSN B;  5IQQ A;  3M8S A;  2F4V J;  2EFN A;  5KFX A;  3D7S B;  5SZT A;  3PDN A;  2EXU A;  1UW4 A;  3HHL C;  3PIP Q;  2D3O R;  2A1B A;  2LMI A;  3QT5 A;  3DI6 A;  4J9U E;  2FHJ D;  3MUT P;  2HEK A;  2QSW A;  4ZVU B;  4DQR A;  4ZVS B;  4IH7 A;  2PGC A;  1NKE A;  3H7H B;  5IWA J;  4XPC A;  3TWZ A;  3QAT A;  1U1L A;  3MMC B;  3LTO A;  1NHV A;  3C6U A;  3A8E A;  5DDR C;  2MQL A;  4ZVF A;  2ZH9 A;  3T5K A;  3RBZ A;  1XQI A;  2VPZ B;  4KV8 B;  2DR7 A;  5B0F A;  2PN6 A;  1MU2 A;  4GC7 A;  4CLP A;  3MR5 A;  1WC5 A;  1RZM A;  4EBE A;  1RE1 B;  4ZP9 A;  3DLE A;  3QT6 A;  4Q2L A;  1F6T A;  3HI9 A;  3RB4 A;  2JLF A;  4LRD A;  1IJE B;  5ETT A;  2Z0G A;  2QE5 A;  5G0R A;  5LOQ A;  2K06 A;  3MM9 A;  2DHA A;  4QU7 A;  3UVJ B;  2CNN B;  1U1M A;  1QY7 A;  4B08 A;  2J8S A;  4R8U A;  3D54 A;  3FZ2 A;  8AT1 B;  2RKI A;  3EDR B;  4C3M A;  2QFI A;  1RGV A;  2OHD A;  3MM6 B;  4ZLL A;  2M70 A;  3J7Y I;  3MMB A;  2CPZ A;  1S1X A;  1RT6 A;  3EPG A;  4CP5 A;  3M05 A;  3CC4 S;  4OZJ A;  4ECY A;  4ANE A;  4HT7 A;  5A2Q U;  3N79 A;  3U1N A;  4F2S A;  4ECV A;  3H90 A;  4KO0 A;  1KQS R;  3MPU B;  3M2U B;  2XHC A;  5C25 A;  1TFW A;  2HZA A;  5CH7 B;  1EX8 A;  2QFJ A;  1K44 A;  1Z2Z A;  3T9Z A;  1HR0 F;  1JLA B;  2CQ4 A;  2ZOG A;  1Q0N A;  1SL2 A;  4MT1 A;  1UVJ A;  5JUM A;  5F3T A;  4CYU A;  2QC3 A;  5D0E A;  1M1H A;  4PUO B;  1VQK S;  1TKD A;  1F3F A;  4GKJ J;  5DGB A;  2OGU A;  3SXL A;  2UUA J;  1T9U A;  5EDW A;  2YX1 A;  4M5H A;  2ZH4 A;  3W8P A;  3IBC B;  3RJM B;  3MEK A;  1RK8 A;  2C3M A;  2I38 A;  4BHQ A;  2JEJ A;  4YDD B;  2G4B A;  2CJK A;  3CNQ P;  3IS9 A;  3PV8 A;  1TL3 B;  5B09 A;  3I0S B;  4ZLN A;  2B9W A;  4U8V A;  4DV0 J;  3WQP A;  2V8G A;  3MEC B;  4ZPB A;  3UCG A;  5CYJ A;  4C48 A;  3PX4 A;  1RBL A;  1PAU B;  1M5K C;  3I87 A;  3T6J A;  2VG7 B;  4G1Q A;  3ITH A;  2ASJ A;  1VHI A;  1S6O A;  3PJ9 A;  4JI2 J;  2L48 A;  1WC3 A;  1NPR A;  3CE8 A;  2AJ1 A;  4LR9 A;  2XTJ P;  2G1H A;  2G9O A;  2IMW P;  4DR1 J;  2E9R X;  2YWK A;  3MM8 A;  1KHW A;  5KFQ A;  2PFD A;  3MM5 B;  2DRA A;  3MAH A;  1IKV B;  1B64 A;  1RJJ A;  4ZMM A;  1FE0 A;  3VGU A;  1X4A A;  4QW8 A;  1JLG A;  2RU9 A;  1VJQ A;  2RF2 A;  2CWX A;  3QGG A;  1MMN A;  1UEK A;  3LGM A;  2UUC F;  4UOG A;  3BGR A;  2CRL A;  1VRT A;  1DAR A;  3DU5 A;  1YJ9 S;  4XO0 A;  2GJI A;  3MMA A;  4YB1 P;  3RYL A;  1KS2 A;  4RUA A;  2J7W A;  3KLE A;  1FF2 A;  3HHE A;  1IM4 A;  3DRR A;  3VVU A;  5FD1 A;  2DTJ A;  3HD2 A;  1S0V A;  1FKA F;  2RU3 A;  2XI3 A;  1Q82 T;  3D0G E;  4WK3 A;  4CO2 A;  2VH7 A;  3Q22 A;  4O4G B;  2MZJ A;  3D4J A;  1S76 D;  3KJN B;  1HNI B;  3A13 A;  3GFH A;  4ETZ A;  3GV8 B;  2ILY A;  3GB0 A;  2MKJ A;  2BUN A;  1OO0 B;  1F5C A;  2X1A A;  4EUV A;  3CDU A;  3NGS A;  4DV1 F;  3OFF A;  4QYZ J;  3H4D A;  4Q5V A;  3HO1 A;  3PNI A;  3TZW A;  4LFC J;  2R3V A;  2CQD A;  3NNH A;  4ED4 A;  4AXI A;  4E98 A;  1IR1 A;  4YN3 B;  1FES A;  2ZH3 A;  3M1V A;  3SQG A;  2IRU A;  2ZZN A;  2B6A A;  5H9F K;  2ABY A;  3GIR A;  5ETL A;  2HLT A;  1F2H A;  1RA7 A;  3OTE A;  5CD4 H;  2DNY A;  2HS3 A;  5F9N A;  5LM7 E;  1MRO A;  1OY9 A;  5A8R A;  2A2C A;  2WSE C;  3VZH A;  3UDE A;  5LL6 d;  1H2U X;  3MED B;  2ZH8 A;  3C14 A;  4EO8 A;  5FDL A;  1RAD B;  4EO6 A;  2XGP A;  1Y10 A;  2C3Y A;  3PO5 A;  2J6T A;  4F4W A;  1U1P A;  5J2P B;  5KFY A;  4R5P A;  2NXJ A;  5BXI A;  3DKD A;  1VC6 A;  1P1L A;  1HPZ A;  3DOM A;  5D77 A;  2XS7 A;  5A6W A;  2C2Z B;  2I5J B;  2CQB A;  4UST A;  4P7T A;  2HFV A;  4PYD A;  3KDO A;  2VBX A;  3MR3 A;  2QN6 B;  2R2U A;  4ZVR B;  4Q8E A;  3PAC A;  2F4V F;  5KFL A;  3M8Q A;  4PRF A;  2KT2 A;  1NK5 A;  2NUH A;  2MHN A;  1YJ7 A;  4LFB J;  3IWX A;  3H59 A;  1DZ5 A;  2CVI A;  3D6T B;  1MG7 A;  1SIZ A;  1NDL A;  2KJV A;  2HBZ B;  2PC6 A;  4C97 A;  1OY6 A;  1O8B A;  2GVZ B;  5IWA F;  1LOU A;  5HRO A;  5MLC V;  4DU8 A;  3R6L B;  2OEL A;  2BA9 A;  5AE2 A;  1GMU A;  2YNG A;  2I1R A;  3US5 A;  4DUZ J;  3ILL A;  4FVC A;  4IFV A;  1UKU A;  3V4M A;  1TUW A;  5L39 A;  1IKX B;  2V9K A;  4J9Q A;  4HTI A;  3CC7 S;  1RAA B;  2HVE A;  2HMI B;  2BJ8 A;  2YQ3 A;  3ZZZ A;  4CH7 A;  2AU0 A;  4RNO A;  3T1A A;  2ZWP A;  1FKP B;  4ZIV A;  3CJ8 A;  4USI A;  1XMB A;  5DQH A;  5KT4 A;  5T7L A;  4HAC B;  1T05 A;  1QSL A;  2GC8 A;  1RAE B;  2Q1L A;  4LF5 J;  2BE7 D;  3UW1 A;  4R0E A;  1RTH A;  2DYA A;  2RHQ B;  3L7U A;  1B99 A;  1XNQ F;  5B0D A;  2J9D A;  3KG1 A;  1N0U A;  4DFK A;  3MEG B;  1DUR A;  2DH7 A;  4EMD A;  1FWP A;  4XK8 C;  3BYP A;  4F3M A;  5A0Y B;  4M8L A;  4OZ5 A;  4KB7 A;  3W64 A;  1ZOT A;  3ZZT A;  2DIU A;  1D09 B;  2M7S A;  2HIQ A;  2R4F A;  3EGW B;  5KG1 A;  4OYW A;  2GIQ A;  1RAC B;  1RHM B;  3W5Y A;  2HHU A;  2HHP A;  4KH0 B;  5H9E J;  4F36 A;  2J9D E;  4I2Q B;  1KTV A;  2FVR A;  4DN9 A;  1YX2 A;  3H8Y A;  3KUG A;  1P9Y A;  3NCR A;  1RHJ B;  3ZO7 A;  1TV6 B;  2UVW A;  2YVS A;  3LUY A;  4I67 A;  1UTA A;  4TYA A;  1HI8 A;  1WG5 A;  1FJG F;  1UET A;  3PM9 A;  2CPD A;  1JLC A;  3KKF A;  2GIR A;  3OVA A;  2ZHO A;  3QNW B;  2XWY A;  3CXC R;  1U8W A;  3HD1 A;  4DPO A;  1ARO P;  4JI5 F;  4DV0 F;  5D4L A;  4NLP A;  3IWL A;  4IRK A;  4YUD A;  4B3M J;  4OLP A;  3OVB A;  4OJG A;  4RBT A;  2HFN A;  3FRZ A;  3KUH A;  1RWU A;  3F0N A;  4F4Z A;  3VWS A;  2RUS A;  2VC0 A;  1S12 A;  1VLY A;  1CS4 A;  3ZZ0 A;  1U2C A;  4DQQ A;  5A8W A;  2V6A A;  4ZDN A;  2DNO A;  2HK2 A;  2RH3 A;  1R0A A;  1NLK L;  1VQY A;  1WWH A;  5L1L A;  4ZP8 A;  2BR0 A;  3R6G B;  4K4V A;  4DR1 F;  2QYG A;  4CO1 A;  2V69 A;  2FC8 A;  4GMK A;  3ZZY A;  1S4E A;  4DR6 J;  3G4S S;  2EFO A;  3GYG A;  4X62 J;  2LEB A;  3QO9 A;  1FTR A;  3DHX A;  3GCW P;  4X64 F;  3PW2 A;  1WEY A;  2RML A;  2L3M A;  2AX1 A;  4ED1 A;  1JWW A;  3R2D J;  4IG0 B;  2HRT A;  3SMZ A;  2ZKU A;  1R6V A;  2KYX A;  2WON A;  2ERR A;  3QIP B;  2Z58 B;  3SV4 A;  2DGV A;  4RKU C;  4CNY A;  2YNH B;  2AV5 A;  1VDH A;  1VK3 A;  2GZO A;  1TL1 A;  1YIT S;  2NXE A;  3W2W B;  1Q53 A;  4B9M A;  2APO A;  1H6K X;  3HJF A;  1FE4 A;  1S6P A;  1S57 A;  2PDA A;  2YWG A;  3G86 A;  2VJV A;  1RYS A;  4ZVT B;  3P3D A;  2PFF B;  4JUZ A;  5DDP C;  3L3C A;  1VBX A;  3RAM A;  1GTE A;  3EWG A;  1XMO J;  2VD3 A;  1SC3 B;  3I5C A;  3IG1 A;  2XO6 A;  2DK2 A;  4IH6 A;  1HNV A;  2L9D A;  2ZH5 A;  4C8M A;  3C16 A;  1Y5N B;  2YH0 A;  2K7K A;  4EEY A;  3M2R A;  1AB8 A;  1UP1 A;  1LWF A;  3GFY A;  1VIX A;  1HI1 A;  3HDS A;  4Y2M A;  1KD1 T;  2YH1 A;  3ICL A;  1JLQ A;  4CQ1 A;  4L72 B;  2VOD A;  2OML A;  2NXU A;  2XZT B;  4LFC F;  1VQM S;  4LSL B;  2MKK A;  5I3U A;  1UVK A;  4ZJL A;  3KLI B;  4DV7 F;  3P49 B;  4YR0 A;  1VBY A;  2XNR A;  1LV5 A;  2W9A A;  5E41 A;  3TAP A;  4W4M A;  3T9N A;  3UE2 A;  4DWI A;  3M8Z A;  5F3Z A;  3E01 A;  3OL6 A;  3FFI B;  3ETO A;  1SXL A;  2HHV A;  1HQU B;  5J2Q B;  3A3O B;  3FC9 A;  2DXF A;  4K4T A;  1X5T A;  2Y1R I;  3GQC A;  2CAD A;  1HMV B;  2LLZ A;  5DGA A;  5SUH A;  3DRS A;  2DIV A;  4FXD A;  5IC4 B;  2XC9 A;  4U7U D;  1CC8 A;  2BXJ A;  3NS5 A;  4WKY A;  4DV3 F;  3HUL A;  3TAR A;  3MUR P;  4AE5 A;  1Q81 T;  1HNW F;  1PJ5 A;  2J7U A;  5C42 A;  2D3U A;  4CLS A;  3AOA A;  1F3V A;  3JYT A;  1V5I B;  3ET6 B;  1X7V A;  2N3O A;  2F8E X;  1REV B;  4OLO A;  1T95 A;  4FN5 A;  4DR4 J;  4KKO B;  5I42 A;  3MOJ B;  4WFA Q;  1N8R T;  3ZTR A;  4I56 A;  2OEJ A;  3G8S A;  2HYI B;  2GHV C;  5L9X A;  2VFS A;  2FHK A;  1HQE A;  3OVS A;  1UPM B;  1V3R A;  5LXR A;  3NNC A;  3WX8 A;  2FY1 A;  3NXZ A;  4PWW A;  2B51 A;  3AA8 A;  2UUW A;  3CCU S;  4LFB F;  1M90 T;  4ELT A;  2BQR A;  1R3N A;  2YNI A;  3VAK A;  1N52 B;  2YWW A;  2NZ4 A;  4ED6 A;  1U1N A;  1IQT A;  4HH1 A;  2B9E A;  4FBU A;  1LFP A;  1RCX B;  2EBE A;  2DR9 A;  4URQ U;  1M5V C;  5L46 A;  3DFE A;  4DR7 J;  4NCB A;  4D3G A;  4ED0 A;  4EYI B;  4L73 A;  2KVI A;  1CC7 A;  4UY8 5;  4FNH A;  1VR6 A;  4UOF A;  4J9O A;  4BDP A;  1FX4 A;  1G2E A;  4ERD A;  4DN0 A;  4OHW A;  1CJT B;  5E7O B;  4XDD A;  2FIU A;  2R2S A;  1VQO S;  2W8K A;  1R43 A;  1N5S A;  1SJQ A;  2NCK L;  3M9N B;  1TKX A;  4BCA A;  4PZV A;  1E6Y B;  3R1L A;  2XMA A;  5CYM B;  3Q8R B;  4RR5 A;  1T9X A;  2VZ9 A;  4RW6 B;  1JKH B;  2IJR A;  3CCS S;  4CRJ A;  4NLY A;  2DGT A;  2VQF F;  4DSI A;  4LF1 A;  2CJ9 A;  4LF5 F;  1RTZ A;  4DS4 A;  2JRS A;  3U1M A;  3O2I A;  2ZZT A;  5K8O A;  5IT4 A;  1NUE A;  3I56 S;  5B0G A;  4PQU B;  3P4U B;  2LKZ A;  1LWC A;  2B8P A;  3B8H A;  1R0B G;  5LSL A;  3LP2 B;  4H4K A;  2NYI A;  1BUX A;  3QLH A;  1ZA2 B;  1N88 A;  2HUR A;  4J9M A;  3TX0 A;  4B9U A;  1U24 A;  4NLV A;  3I32 A;  3CCR S;  4B9S A;  5BYQ A;  1H2V Z;  4QW9 A;  4P2F A;  2G0I A;  4B9L A;  1LEO A;  1MMD A;  2XMK A;  3HHD A;  3W63 A;  1LW0 A;  5E3P A;  2ZE2 B;  1F9F A;  2X1B A;  4H4O A;  5ITH A;  4X4P A;  3DLJ A;  5CAA A;  3ILI A;  2ROG A;  1FXR A;  2Q43 A;  4U7C A;  2WK4 A;  5HLF B;  2HNZ A;  5F8L A;  1PJ6 A;  4DV6 J;  5KFO A;  4JOU A;  4LRC A;  2ZKT A;  4Y28 C;  1OWX A;  1S77 D;  2UUB F;  6AT1 B;  1NSP A;  2QLX A;  2JJ4 D;  1X4E A;  2GX8 A;  4NXN J;  2OPP A;  1Y0H A;  4DXL A;  4OX6 A;  1Y00 A;  2CQH A;  2JVO A;  3MZI A;  3EYZ A;  5D6G A;  2I8E A;  2Y1L B;  3TQE A;  3CJ3 A;  4OZL A;  4QQB A;  3U02 A;  3FEZ A;  1SKR A;  2X1F A;  1SUQ A;  3MM7 B;  1BQN A;  2QIF A;  3NOC A;  1DLO A;  1R8A A;  3DMJ A;  4JI7 F;  4XTT A;  4A8Q A;  2HGN A;  3QQC D;  2BYC A;  8RUC A;  3QZ7 A;  3LP0 B;  1UPP A;  3QAU A;  4Y2A A;  4CM0 A;  2H4Y B;  2DHH A;  2CWK A;  1FJC A;  4EU0 A;  1D8Y A;  1VC5 A;  2KN4 A;  1PJ7 A;  4N56 A;  4WE1 A;  1DFD A;  4N77 A;  1XTZ A;  2B4O A;  3KJV B;  1RT3 A;  1T9W A;  1CEZ A;  3IMQ J;  3SFG A;  1SL1 A;  3V81 A;  1KN6 A;  3HHN B;  4MAK A;  3B4M A;  3OD2 A;  4AQY J;  4IR1 A;  2HND A;  5T41 A;  3E51 A;  5B08 A;  4NL5 A;  3HVT B;  3M7V A;  3SIP B;  5KFP A;  1ZPW X;  3PYF A;  4OZ2 A;  5L8R C;  1VQ7 S;  5DG8 A;  1FNX H;  2YWH A;  3MD1 A;  4LMZ A;  4ZVQ B;  4C4W A;  2NXN A;  3CO0 P;  4MIA A;  1B70 B;  1BQX A;  4ES3 A;  4B3O B;  3BQ0 A;  2IYG A;  4V19 X;  3MHY A;  3TUZ C;  1T9Y A;  4B9V A;  3CCW A;  1BC6 A;  4GVB B;  1U0S A;  1U1R A;  4NCA A;  1M1K T;  4FYX B;  3W60 A;  4EI2 A;  3NGU A;  2CJA A;  3K58 A;  1BGX T;  4DMZ A;  5F0W A;  2D74 B;  2E5I A;  2AJ0 A;  3FBB A;  1X9W A;  2PEH A;  1WKJ A;  2F8H A;  2E7X A;  5E3R A;  5L1I A;  1XMO F;  1WOO A;  1N5Y A;  1H3D A;  2WB1 D;  4O4R A;  1ZAX A;  1RAB B;  2KG0 A;  3JSM B;  1OPI A;  2VG6 A;  2ALZ A;  5HQ8 A;  4FYV B;  3R97 A;  5D78 A;  4RBV A;  9ATC B;  3O5T B;  1YRT A;  2RUG A;  1TKT B;  1NK4 A;  2XY6 A;  3DN9 A;  1HBM A;  3TI0 A;  1X9S A;  4C3L A;  1SJF A;  3A8I A;  1IUJ A;  4KFB A;  1RWV B;  3Q24 A;  1I5O B;  2VOO A;  4IKA A;  3H25 A;  2B4U A;  3BPS P;  1CPZ A;  5LT5 A;  1WEX A;  4IOB A;  7AT1 B;  2ZUG A;  4D3H A;  1RUS A;  5GVQ A;  2DNN A;  1UWB A;  3QFW A;  2OD4 A;  4WPA A;  1FI4 A;  2AGO A;  4X4S A;  3CB4 A;  4KQZ A;  4YB5 A;  4Q0B B;  4IH5 A;  3A3N B;  2WW4 A;  4FKY A;  4DSK A;  1AFI A;  4L3K A;  2M4M A;  1KFD A;  3GR1 A;  1S5Z A;  3KK1 B;  4RLE A;  4FP9 A;  3GG1 A;  4WFX A;  3K17 A;  1RAO A;  3BPD A;  3VR1 A;  4DPW A;  1RTD A;  2HHX A;  3BB5 A;  4Q7A A;  4F2R A;  1P9Q C;  3FMW A;  2JZ5 A;  3W61 A;  4DR4 F;  1VQ6 S;  2ASL A;  1H74 A;  1RI7 A;  1V3Z A;  4HHH A;  4PKD B;  3UDC A;  2E1R A;  1M5S A;  4Y2C A;  3B82 A;  1P27 B;  2IA6 A;  1FRX A;  4DG1 B;  2HZC A;  2YKN A;  1HL6 A;  3C15 A;  1TFY A;  3M8P A;  4UUX A;  1RWN B;  1SH2 A;  4UTG A;  1GTH A;  4P6Q A;  3SCI E;  1Q8L A;  2GHP A;  4J9N A;  5G4D A;  3WX4 A;  4PYA A;  4ELV A;  4ILM A;  5CYQ A;  4HI1 A;  4K4Z A;  4I6A A;  1WDT A;  1XJW B;  1NEE A;  4I4B A;  4F04 B;  2IC3 B;  4IRC A;  4ZCL A;  1YSJ A;  2HNY B;  2EG1 A;  2XBP A;  3V6K A;  1CJV A;  2HFU A;  2V8V A;  2PA8 D;  3D67 A;  3OQ2 A;  2XMM A;  1O0P A;  1TL4 A;  3D6F B;  3GON A;  1S97 A;  3KXD A;  3CGI A;  4X2B A;  4DR5 F;  4EWT A;  4L6V 3;  4QWD A;  4LF9 J;  2LQ5 A;  5E3A A;  5FLX Y;  2ZBQ A;  1N54 B;  4HHJ A;  2H3E B;  3DOL A;  3QT7 A;  2E5L F;  3J7A 1;  2XCP A;  4RW4 A;  3BYR A;  2J9E A;  1OSC A;  2PA3 A;  4TVA B;  1W25 A;  3SQO P;  5GAG U;  2LQ8 A;  1GXU A;  2V4R A;  2D41 A;  3P5T L;  3V6J A;  1HW9 A;  4DSF A;  4NI2 A;  3MPW A;  2V2V A;  2M88 A;  1MSW D;  3KDN A;  1XEZ A;  3CMA S;  4MIW A;  1BHN A;  2VBY A;  3CDB A;  4DZ6 A;  1SJ1 A;  4ZPA A;  3FRY A;  2UUT A;  1R27 B;  1C0T B;  9RUB A;  4A8K A;  2QMX A;  2UVR A;  1UEU A;  2XCA A;  2VL1 A;  4G3I A;  3PHT A;  3M8Y A;  1TUV A;  3RBD A;  2O01 C;  3T3F A;  5KFB A;  3ENW A;  4ALZ A;  1K9M T;  3HHL B;  1K1Q A;  3AY0 A;  2V8P A;  4RPF A;  1WOS A;  1JJH A;  3I4H X;  3WBZ A;  3CC2 S;  3CIM A;  2CZ9 A;  3TA2 A;  1LW2 A;  2XY5 A;  5C7P A;  4DV6 F;  3CPW R;  3PO4 A;  5C24 A;  3SZ2 A;  2P2C B;  2IBO A;  3I55 S;  1HWJ A;  3FUY A;  1FD2 A;  2FZK B;  2H48 B;  1KON A;  3OXL A;  1FJ7 A;  2HZV A;  3SFU A;  2OPQ B;  4NZ0 A;  2BKO A;  2CG8 A;  2AYG A;  1IJF B;  3TQ1 A;  5E33 A;  3CJ2 A;  3NG8 A;  3DM2 B;  4MK8 A;  2XLJ A;  2AJQ A;  1JXE A;  3FSY A;  1TK8 A;  1T11 A;  2HRU A;  2KFN A;  4KSE B;  4PWD A;  4CTA B;  2R7T A;  4KGX B;  3R2C J;  2XQC A;  1GEH A;  3PW0 A;  3O6Q A;  3HVW A;  5GMD A;  3NMR A;  3CCJ S;  4OHY A;  2G13 A;  3VZI A;  1T0T V;  2IRX A;  1XR7 A;  1FWL A;  4Y2I A;  2MGZ B;  4MKY A;  1WDD A;  4HVZ A;  2HGM A;  1C1B A;  2L08 A;  1A9N B;  1W2B R;  4OZ0 A;  2BAN A;  1RWK B;  4Y6I A;  1PIL A;  1WG4 A;  2P9C A;  3M2V A;  2Y9H A;  2WOM B;  1N48 A;  2ZD1 B;  2CYY A;  4NA2 A;  1YJN S;  1NM2 A;  2IMO A;  4EBC A;  4ATN A;  2EC2 A;  4USJ C;  5MAO A;  3Q8U A;  1WSV A;  3BQ1 A;  1URR A;  3JS9 A;  4J37 A;  4WII A;  3KLF B;  1OSD A;  3HKW A;  1BXN A;  2BJD A;  2C2O B;  1WTF A;  4IG3 A;  1NO8 A;  4I2P B;  4RU2 A;  3H5Y A;  3T5J A;  3AXK A;  4F50 A;  4O3P A;  1Y5I B;  2NLW A;  2HK3 A;  1A0O B;  4NAS A;  2CJB A;  3PXG a;  3G87 A;  4LSN A;  1B7Y B;  3ILO A;  1U45 A;  2RQC A;  3BGO P;  3CCT A;  3DLL Q;  1MN7 A;  2DNK A;  4H54 A;  2XMV A;  1SPB P;  3OR2 B;  3MPY A;  4P7V A;  3SV3 A;  1D9A A;  1HBN A;  5LJ5 Y;  4ECU A;  4K7Q A;  2MDA A;  1TVR B;  4MH8 A;  1NK8 A;  2PEB A;  2DNM A;  4DLG A;  3P96 A;  1HWL A;  3N5F A;  3BGF A;  2M5Y A;  2GMJ A;  2ZDP A;  4H4M B;  5J2N B;  3IM8 A;  3AFG A;  3MMC A;  1IKY B;  5KG5 A;  4LFA J;  2PSZ A;  4KV8 A;  3JSR A;  4M1K A;  4YR2 A;  4WP9 A;  2YXL A;  4F02 A;  5HMZ A;  2XMW A;  2J0X A;  4DUT A;  3MR2 A;  5KG0 A;  1VIS A;  2W2P P;  3FSI A;  3PRV A;  5HI7 A;  2LXI A;  1H7X A;  1E6V B;  3VAF A;  1N33 J;  3Q8Q B;  2IM1 A;  1JLB B;  2VJU A;  2PI4 A;  2CQ2 A;  2MYF A;  3WIU A;  2ZH2 A;  3QGI A;  1NK0 A;  1NDC A;  1NXI A;  3U7J A;  3W66 A;  4X4O A;  4DV2 J;  3UVJ A;  2KXF A;  5KOX A;  2XI2 A;  2V8H A;  4M5G A;  3CCZ A;  2GQQ A;  3TEH B;  5KT5 A;  5DG9 A;  1PO6 A;  5EWE A;  2P9G A;  2XZW A;  3MM6 A;  1FFW B;  3CJK B;  4LR7 A;  5K14 B;  1PCA A;  2AT1 B;  1SH3 A;  2R7V A;  2ZH1 A;  4QIV A;  5E3C A;  2ZVI A;  4WJB A;  2HVI A;  2DGO A;  1DQ9 A;  4J5O A;  1ZAW A;  3AQP A;  5KOW A;  1JLF B;  5DQI A;  2BJ3 A;  4U8Y A;  3AQO A;  2C2M B;  3JQJ A;  3HSJ A;  3OW2 R;  1UVI A;  3M2U A;  4LF4 F;  4Q43 A;  3T1H F;  4CNZ A;  2WCX A;  2RE1 A;  1JLA A;  3RBX A;  3BN7 A;  1Q86 T;  2DXD A;  3J7Z T;  1FEH A;  4IYQ A;  2CPY A;  4PUO A;  1GXL A;  3ENV A;  4DFP A;  5CCL A;  2ZH6 A;  3HFK A;  3BKU A;  2LEP A;  2A18 A;  2E9Z A;  2E1M C;  4B9T A;  4AL6 A;  2DGU A;  3B6B A;  2M8H A;  4IRD A;  3TVZ A;  2DIT A;  1TL3 A;  2ZJQ Q;  4A8W A;  3JQK A;  1S9G B;  1J5E J;  2ZM6 J;  3MEC A;  1FRJ A;  1RAH B;  2V2Z A;  1ZM4 A;  1Z1Z A;  1KBR A;  5KG2 A;  3CCE S;  4LF7 F;  2B0G A;  4OX7 A;  2DY9 A;  3G2X A;  3NL0 A;  2IRY A;  2VG7 A;  1ZET A;  3MFH A;  1T03 B;  4I64 A;  2E5J A;  3I96 A;  3IWN C;  1QAI A;  5L1K A;  4NYZ A;  4I68 A;  4WIQ A;  2HWI A;  5I3P A;  3OFG A;  2IJN A;  5L38 A;  4FYD A;  1IVZ A;  2IM2 A;  3JTP A;  4CT9 A;  4RX6 A;  4QWA A;  1F5A A;  3NWR A;  4K2X A;  4LF9 F;  1KVK A;  3EIC A;  4MFB B;  3FKB A;  4P2S A;  3MM5 A;  2FJA B;  2XG8 A;  4MMO A;  1IKV A;  4DV5 J;  3NRB A;  3TRG A;  1CJU B;  4DL0 C;  2ZOF A;  1KLM A;  1RTJ B;  2A10 A;  1S10 A;  2Q66 A;  1NME B;  2KT3 A;  1JXL A;  1M5H A;  1ZPV A;  1I6J A;  4CLL A;  4DU7 A;  4Z37 A;  3R3T A;  1PIE A;  3NP5 A;  3PX6 A;  5HN0 A;  1C2P A;  3Q2T C;  4YY3 F;  1TK0 A;  4DL2 A;  2DO0 A;  1F1B B;  5D4N A;  3U27 A;  3UDV A;  4EFA C;  3VAH A;  1L3K A;  1VRT B;  4QIG A;  2BJ1 A;  1PKU A;  3MMA B;  3CMQ A;  1GFW B;  4OFZ A;  3M8W A;  4F3O A;  4O4G A;  2O3D A;  4BLG A;  1N5T A;  2V4J B;  1HNI A;  4C8L A;  1FK9 B;  3IFE A;  1VLO A;  2MQN A;  2BMB A;  1WSR A;  3QGP A;  3KTQ A;  5HAO A;  2CQP A;  3P6Y C;  2B4P A;  2EFP A;  2FC9 A;  3VAG A;  2FDN A;  5F8N A;  4UQT A;  2J76 E;  2JX2 A;  4FDF A;  1RYR A;  4DQS A;  5EN1 A;  1EHW A;  1QVF R;  3BBF A;  3GSD A;  1JQG A;  5DET A;  1O5J A;  4NZ7 A;  2OEM A;  5DO2 A;  1FEE A;  3BRE A;  3AD7 C;  3KLG B;  3NS6 A;  3LAL A;  1P6T A;  2YQ1 A;  1OIA A;  2CJX B;  1BQM B;  2XS2 A;  4EBD A;  1PC4 A;  1CVJ A;  2FJB B;  2CAJ A;  4IQX A;  2MPU A;  2Z30 B;  3ISZ A;  2B7C B;  5KFV A;  3MED A;  2F7V A;  1V9O A;  4F0M A;  1VQS A;  1O51 A;  4CLZ A;  4DLE A;  4HR2 A;  5J2P A;  1MWY A;  1VRQ C;  3BR9 A;  3C19 A;  3VAM A;  4KBI A;  5KFA A;  3MEE B;  3LOU A;  3OHB A;  1KVI A;  1AA1 B;  3BF4 A;  2P6S A;  2OD6 A;  2ZHA A;  3THV A;  1NJX A;  3GIJ A;  2I5J A;  2XYG B;  4HDG A;  4N7T A;  4TKT A;  4F4X A;  3LF0 A;  2W9C B;  3MDF A;  3V5R A;  4A8O A;  2ALY B;  2XGQ A;  1GQE A;  1IQZ A;  3PRB A;  3SBM A;  4N8O A;  1FRI A;  3M6U A;  4P2M A;  2LCW A;  4FPR A;  1W26 A;  4F7V A;  1KFS A;  1WHY A;  1RB0 A;  3FK4 A;  2OI2 A;  4MJK A;  2NPF A;  3K8V A;  3FBC A;  2BAC A;  3RR7 A;  1I94 J;  1U47 A;  2Y3Y A;  1RCO B;  4ECR A;  3LPE A;  1NHK L;  1EP4 B;  1F0X A;  4PQA A;  1ZH5 A;  2X3G A;  2VPX B;  1HBU B;  5E5N A;  1D9F A;  2AKW B;  4JI0 J;  3VAL A;  1N34 J;  4LFA F;  3CVK A;  2CJY B;  3M30 B;  2DNG A;  3EZO A;  5KFZ A;  2XO7 A;  3DOK B;  2J5A A;  1IKX A;  5DQG A;  1FDN A;  2W25 A;  1X31 C;  2DNP A;  3H2U B;  1VGY A;  3W9H A;  1F60 B;  4KT0 C;  4DV4 F;  3H5X A;  2HMI A;  2OPS B;  5L9N A;  2FGO A;  1IM6 A;  1N33 F;  4I69 A;  2UXC J;  1VFJ A;  1RT5 B;  2FHM A;  1FKP A;  3AA9 A;  2EFQ A;  3THT A;  3OLA A;  3D0H E;  4A8M P;  3KYL A;  4NPO A;  1SCJ B;  4I6W A;  4HAC A;  5KG4 A;  1S6Q B;  3HCX A;  3SSR A;  1YJW S;  5K8N A;  3TZX A;  1TMJ A;  1SKW A;  2IAJ B;  1NRK A;  2HBY B;  3D0I E;  4W90 B;  2UUC J;  3PW4 A;  3QYY A;  3QJP A;  3MEG A;  2B8Q A;  2BW7 A;  1U1O A;  1RT4 B;  3NGT A;  3CME S;  1LXN A;  3EVW A;  2YX4 A;  4WKR A;  2HHH F;  5M2R A;  3BDP A;  3OXF A;  4FF2 A;  2AYM A;  2A6O A;  1FVQ A;  1QJH A;  3GYX B;  1JNR B;  4BWM A;  5GMK a;  5IZH A;  1MN9 A;  5KFI A;  1RHU B;  2QV6 A;  2G0J A;  2FJV A;  2BOP A;  3Q83 A;  1FHT A;  4RNN A;  4LRE A;  4I2Q A;  2AYE A;  1RWW B;  2KH9 A;  1GX5 A;  4DPU A;  4OI6 A;  2P9E A;  1XER A;  2ZVS A;  4LF8 F;  3V6H A;  4C8O A;  5KFC A;  1IKW B;  1TV6 A;  3R5G A;  2EFV A;  5IS2 A;  3TJ8 A;  3PYD A;  3BSO A;  4G1I A;  4P73 A;  3K8W A;  1NU4 A;  3QMQ A;  4M5D B;  3IRX B;  4DV1 J;  3HT0 A;  1U6F A;  5HVF A;  1YK9 A;  3ENQ A;  3P45 B;  3M6X A;  4OZ1 A;  1NPP A;  4NLT A;  1TMM A;  2DGW A;  1RT2 B;  1GK8 A;  2AEJ A;  3SDE B;  4RJV A;  4URS A;  3LO3 A;  5B0A A;  1RHK B;  4TLR A;  4WTY A;  1S9E B;  2FLN A;  3VTI A;  4MYU A;  2ZM6 F;  1G7C B;  2JLE A;  1GXT A;  1PYS B;  4XIU A;  1WEZ A;  3AHP A;  1RXO B;  4ZIW A;  5ETV A;  1YGY A;  2W2O P;  3EJM A;  2V63 A;  2O67 A;  1M1G A;  1HHQ A;  3C3L A;  3AXM A;  1KQG B;  5AE3 A;  2QL9 B;  3J81 j;  2VHG A;  1X5S A;  3FQL A;  5CZV A;  4ENO A;  4K8R A;  1V6H A;  2CQI A;  1JJC B;  2M0G B;  2DR8 A;  1UZH A;  4EZ9 A;  5J1E B;  4NLS A;  3QRR A;  3OL9 A;  3VGV A;  3AJ2 A;  1HWU A;  3LAK A;  3GWC A;  5HQM A;  2DCL A;  2BE2 B;  2RIL A;  4JV5 F;  5CCM A;  4X66 F;  2GQC A;  4F8R A;  5ETR A;  4NX9 A;  5I4M A;  4IG0 A;  1AZS A;  2QL5 B;  3I4P A;  3JAM Y;  1EIY B;  4PXD A;  4OJH A;  3QIP A;  3QZ8 A;  4NEY A;  2ZIT A;  1ZZN A;  3AB4 B;  2YNH A;  5ETS A;  4NXM F;  1APS A;  2Y0B B;  3CCL S;  4C2M A;  2HFO A;  3CD5 A;  1EAR A;  1KEK A;  2JWN A;  4DCJ B;  1QAY A;  5KFW A;  3W2W A;  2N82 B;  4Y3C A;  4LVN P;  1D1U A;  2F9D A;  2LQ9 A;  2POK A;  4DPY A;  3I0R B;  1QTN B;  3LWL A;  4DSE A;  2N7Y A;  2WW8 A;  4ZCM A;  3JTO A;  2LP4 A;  2EVZ A;  4AD6 A;  3E8O A;  4NEZ A;  2BX6 A;  4ETX A;  1PYT A;  5KFG A;  2R7O A;  3L95 X;  4R0J A;  1N32 J;  1WC6 A;  2VFV A;  3AOD A;  1KRP A;  2AJ4 A;  4IR9 A;  1RT1 B;  2LU2 A;  3QSI A;  1IBM F;  4DR2 F;  4LSL A;  2DGX A;  4ZS6 A;  3EX7 B;  2DIS A;  3QJL A;  4PEO A;  3KLI A;  1VQ4 S;  2XZD B;  3MUV P;  2MKS A;  1OYD A;  1XNQ J;  1JLQ B;  4CLU A;  4F3Q A;  4DF8 A;  3ZTO A;  5HVG A;  3FFI A;  1JJ4 A;  3QWU A;  3M6W A;  3I9Z A;  1U8S A;  1HQU A;  3SSS A;  5J2Q A;  4BWJ A;  2JH3 A;  3UN5 A;  1WC4 A;  3D66 A;  2Q3P A;  3PR4 A;  2CQ1 A;  1L3V A;  2BBE A;  2VOP A;  2IDL A;  4JI8 J;  2J0W A;  3PCO B;  2EK1 A;  2K1R B;  5IT9 Y;  1YBT A;  3KHH A;  3IGV A;  3KHR A;  2D3Z A;  3VVT A;  1LFW A;  3ZNJ 1;  3LPY A;  3ET6 A;  3VQS A;  3DXS X;  1TTH B;  4ZOS A;  3PFE A;  1REV A;  4F25 A;  1Q95 G;  4KKO A;  3LWM A;  3KFW X;  2RRB A;  1FJG J;  3UO0 A;  3DLK B;  4LSZ B;  1NAQ A;  5KFN A;  1WAC A;  2GW8 A;  2BV3 A;  4RW8 A;  4JBC A;  3UFC X;  1LQ9 A;  3BKT A;  4GVL A;  4JI5 J;  2LVW A;  4PPZ A;  3ZXW A;  3BDE A;  3DDI A;  3HSD A;  2W9B B;  1I94 F;  2CNO B;  3C6T B;  1RQ0 A;  1Y7P A;  2VFT A;  5F8G A;  4Q2M A;  3TW0 A;  2A0F B;  5H9F J;  4JI0 F;  2X3D A;  3HFV A;  3NGR A;  1N34 F;  4PXB A;  2MJU A;  4NA3 A;  3EZU A;  1QSY A;  5CAB A;  1P8G A;  4NYP A;  3ZZU A;  2HQG A;  3ZFV A;  5KFU A;  5EX3 A;  1CJT A;  4LBH A;  3H5U A;  4JI6 J;  2D9P A;  5DG7 A;  4WFY A;  1JJ2 R;  4ZK7 M;  1KWM A;  4Z7C A;  2YWF A;  1E6Y A;  4PR6 A;  1LNQ A;  2BEF A;  5CYM A;  2UXC F;  1S1W B;  2DR5 A;  1IXK A;  4RW6 A;  1JKH A;  1OJ4 A;  2PT0 A;  3A8K A;  4X64 J;  4JI3 F;  5KFS A;  3BBB A;  5CQG A;  2NS1 B;  3IC1 A;  2F9J A;  1RLC L;  1UFW A;  2HKE A;  3QBC A;  4K5S A;  1NSK L;  3PVX A;  4PQU A;  2KO1 A;  1FDA A;  3LP2 A;  2PD1 A;  4ILL A;  4B02 A;  3Q23 A;  2YNF B;  4JI1 F;  2K7J A;  4QR2 A;  3HP6 A;  5EGY A;  2QLW A;  2V94 A;  3W3S A;  1YIJ S;  5DS7 A;  2UXD J;  1HWK A;  1U09 A;  2LA6 A;  2ZE2 A;  4E0D A;  2RAQ A;  1HNX F;  3GTY X;  3QID A;  5HVH A;  4EGL A;  2DJW A;  1RAF B;  4ES1 A;  2UU9 J;  3ZZP A;  4XDC A;  2QTW A;  2F1F A;  4C0B A;  3MAA B;  2IJF A;  1LW0 B;  3W65 A;  5HLF A;  3PFO A;  1RWX B;  2FQQ B;  1RT7 B;  4P74 A;  1LXJ A;  5HAT A;  2YY3 A;  1RSC A;  2OP5 A;  4DL4 A;  3HHK A;  1KKH A;  3VGS A;  2IHR 1;  3PJW A;  4TY8 B;  3IGN A;  4KGV B;  4NCG B;  2HNZ B;  2QRR A;  1TR0 A;  2KHD A;  5A8K B;  2FZC B;  3MR7 A;  2XWX A;  3MR6 A;  3OL8 A;  4DV7 J;  1SKS A;  2E7W A;  4M5K A;  3MM7 A;  1XWL A;  4RUC A;  2C42 A;  2MKH A;  1DTT B;  2PMH A;  3LP0 A;  4ANC A;  4CLW A;  3G6X A;  2WSC C;  4FPI A;  1X5O A;  1T7P A;  1MML A;  3DCA A;  1Y5L B;  3KJV A;  4F4K A;  5BYR A;  3UDL A;  4YME A;  4IDK B;  4DV3 J;  2B5J B;  2MSS A;  5CZX A;  1HNW J;  3GCX P;  4N8N A;  5ETP A;  3UD3 P;  2JEG A;  3M9O B;  4M5L A;  3LGN A;  2F40 A;  1VQ5 S;  2K2P A;  3SYZ A;  3HVT A;  1TAQ A;  4O0N A;  4Q44 A;  2MST A;  2IA0 A;  3SSQ A;  4B3T J;  3TVK A;  3Q89 A;  2H9Z A;  2GGP B;  4KGM A;  5IM0 B;  3H0P A;  2GNK A;  4J9V A;  2R8K A;  3CDW A;  2RHS B;  1VMB A;  4M95 A;  4C8K A;  4WCE Q;  4B3O A;  4GRS A;  3OUY B;  1U6Z A;  2XLK A;  2YTC A;  4FXV A;  4WZQ A;  4GVB A;  2XHW A;  2RDD A;  2IVM A;  2WVD A;  2H4W B;  2HFS A;  3N6L A;  1WF0 A;  3W62 A;  3NCP A;  4EYH B;  3Q8Y A;  4HTJ A;  4JI4 J;  4NRT A;  4DS5 A;  3RW7 A;  4ZN3 A;  2XY7 A;  1KDN A;  3CJ5 A;  3BN4 A;  3BO3 A;  1EQ0 A;  3WDO A;  4KGK A;  2GJF A;  4OL8 A;  4NRU A;  4OJ1 A;  5K8M A;  2HGL A;  2R8G A;  2W2Q P;  1YVF A;  4USV A;  3TJA A;  4DOZ A;  2MKY A;  2MKI A;  5KT3 A;  3TAM B;  2HWT A;  2QYC A;  3N5B A;  1YG0 A;  3JSM A;  4NOH A;  4OYB A;  2HFZ A;  4X4U A;  2L9W A;  5D0R A;  1NPK A;  4IO1 A;  3F41 A;  1Q5V A;  4Q45 A;  4NLR A;  3BGU A;  3FMB A;  1N32 F;  1TKT A;  2W24 A;  1HYS B;  3EVO A;  3WC2 A;  3DGV A;  4OYI A;  3WHI A;  4ZVH A;  4QPX A;  2FLO A;  4WXW A;  2VQF J;  2VQE J;  2KXH A;  1FTC A;  1OQ6 A;  2CZV C;  1XC9 A;  4ED2 A;  4DPX A;  2DPJ A;  3FGV A;  1TKZ B;  2BOA A;  4CLT A;  4J9K A;  3EVM A;  2W7O A;  3IBF B;  5E3Q A;  3PHE A;  2HAI A;  5DJB A;  1S1T B;  2V9W A;  2BJE A;  2VON A;  1D9D A;  3ZNU A;  2R9L A;  3A8J A;  4MK9 A;  4Q0B A;  3CCM S;  2CZ4 A;  4ES2 A;  3P5B P;  4TQS A;  4CT8 A;  2AP6 A;  2VIC A;  3W8G A;  1HI0 P;  1MLA A;  3UPF A;  4G65 A;  4JI8 F;  4I0W A;  3KK1 A;  3RB0 A;  3T6B A;  2DGS A;  2EKY A;  1R0C B;  2CXE A;  3H2V E;  1N6Q B;  2Y8W A;  2FUG 9;  4BC9 A;  2OEK A;  2H65 B;  2VBW A;  2CIM A;  5HMX A;  1WJ9 A;  1K47 A;  1S1U B;  2MLY A;  1U49 A;  1NBE B;  2B9Y A;  4M5I A;  1VI7 A;  3C8Y A;  4JP8 A;  1YTY A;  2KG1 A;  3IXQ A;  3EXC X;  2UUB J;  2XLI A;  5DZ7 A;  1KNZ A;  1PBU A;  4DG1 A;  2DPI A;  2H51 B;  4CCH A;  2FJX A;  2ZZM A;  2ZHB A;  3TO8 A;  2HQI A;  5THW A;  3MPV A;  3D6M B;  5KFE A;  2W4D A;  4ZLJ A;  1HA1 A;  4NML A;  3KLH B;  1C1C A;  3BO2 A;  4I7F B;  2GO9 A;  5KT2 A;  3EE3 A;  1R7I A;  4QR0 A;  4CDI A;  5IT0 A;  1X8D A;  2G2Z A;  2NUU G;  1VHF A;  4JI7 J;  1KVJ A;  2IC3 A;  1SVD A;  2BQU A;  1QVG R;  2HNY A;  2OKQ A;  1FRL A;  4CI0 B;  3D9B A;  3NCQ A;  3NGD A;  1GMV A;  3HZE A;  2GAG C;  2MZ1 A;  1T8E A;  2D69 A;  4J9P A;  4ER8 A;  1TL7 B;  1HWI A;  1FJE B;  2W8L A;  2GV1 A;  2GJ2 A;  4JI6 F;  1PGZ A;  4ECQ A;  4LT6 A;  5DLG A;  3K89 A;  3Q8S B;  4LBP A;  1DJ0 A;  1SBR A;  4ID5 B;  4NA1 A;  5D0G A;  2R42 A;  5GAD U;  1QE1 B;  1NKB A;  4USU A;  3Q0A A;  3NS7 B;  5DDQ C;  2AEF A;  3THP A;  3DRP B;  5H1S V;  4O23 A;  2YKO A;  4HL9 A;  4X4R A;  2RQM A;  3VV2 B;  3LW5 C;  3GJQ B;  1Q16 B;  3M6V A;  2ZC3 A;  3FCH A;  1RAG B;  3T5L A;  3RR8 A;  2HAF A;  1SIW B;  5T14 A;  4RWX A;  2ZNY A;  4IFY B;  3R8Y A;  1K1S A;  5B0C A;  5L1J A;  3SCJ E;  2QMW A;  4J9L A;  2C3P A;  1C0T A;  3HSG A;  1ZTW A;  4OI0 A;  4C8Y A;  2UXD F;  4F4A A;  2HSE B;  3K5L A;  3OFE A;  2I2Y A;  3P8B B;  2E9T A;  2W2N P;  3HHL A;  2UU9 F;  4RW7 B;  4X65 F;  3BBC A;  2WVC A;  3KG0 A;  5D15 A;  1W7W A;  2M8D B;  3MTJ A;  3T1Y F;  2V2Q A;  2IVF B;  1S59 A;  4ZPC A;  3KJQ B;  2N3L A;  4YOE A;  1C0U A;  4A46 A;  3BJY A;  2P5V A;  4Y2K A;  4MYT A;  4CLK A;  4KE5 A;  1EZZ B;  3RG6 A;  1AYE A;  2OPQ A;  1LW2 B;  1L3U A;  1AUS L;  4CLF A;  3DRY A;  3DM2 A;  4B9N A;  1VJW A;  4HI2 A;  3JQM A;  4YB6 A;  4DX5 A;  1S1V B;  4CTA A;  4DJB A;  2RS8 A;  4WWS A;  5CD4 A;  3RAX A;  2ZDO A;  5ADZ A;  4U9R A;  2RDI A;  1RWM B;  2MGZ A;  5ETM A;  2ACM A;  4Y34 A;  1Y9O A;  4OX9 F;  5D3G B;  5FLX U;  1NK6 A;  3CD7 A;  2JHE A;  1I3O B;  5KFM A;  1NJI T;  2WOM A;  2LDY A;  3DDK A;  3UR3 C;  2ZD1 A;  4WYL A;  2WBR A;  3J7A N;  1VQL S;  3H4B A;  4OMF G;  3QFH A;  1NJZ A;  1SI9 A;  2XS5 A;  4PAA A;  1HNZ F;  4B3T F;  2Z2Z A;  3BEG B;  2PMZ D;  3KLF A;  3HM9 A;  1G1X A;  3OR1 B;  5F0U A;  4I2P A;  4C11 B;  1JLE B;  1Q8I A;  4XAK A;  3FEX B;  1XNR J;  5HSP A;  2MQO A;  5I3Q A;  4TYB A;  1JB0 C;  2E5G A;  2BE9 B;  2VKR A;  1TP7 A;  3OR2 A;  3W7B A;  2KJW A;  3J81 U;  1TVR A;  4UZC A;  4JI4 F;  3M9M B;  4BS2 A;  5F8H A;  3WZ0 A;  5IXU A;  1Y4Z B;  2MJN A;  2LEC A;  2DT9 A;  4HKQ A;  1LWE B;  3IR6 B;  2UVV A;  1H72 C;  2YPZ A;  4H4M A;  5J2N A;  3R7B B;  1TZ0 A;  2CJQ A;  1IKY A;  4DL5 A;  3EGZ A;  1HBN B;  3AT1 B;  4GC6 A;  1N0V C;  4TQR A;  4OI2 A;  1PG5 B;  3POT B;  4JYA J;  3QPI A;  4USW A;  4F26 A;  3D1Q A;  2QA1 A;  2YKM B;  2AF6 A;  5HK4 A;  2NR0 A;  1CLF A;  3TYT A;  4DR5 J;  3RZA A;  2GHW A;  2OTJ S;  7FDR A;  1SV5 B;  2KU7 A;  3JSY A;  1E6V A;  4RU9 A;  1J5O B;  2YWE A;  1GNK A;  1U7L A;  1JLB A;  3M32 B;  2IIH A;  2R7R A;  1B0T A;  1XN9 A;  2E5L J;  2U2F A;  1PYO B;  1AXQ A;  3OXG A;  2VQE F;  1YZ7 A;  5LSO A;  1FFS B;  1UVM A;  3QT8 A;  4ZN1 A;  4ZPT R;  2VBZ A;  4CIO A;  1VYA A;  2UV8 G;  2OUG A;  1WC0 A;  3CJK A;  5K14 A;  2AMC B;  5ETN A;  2C3U A;  3UWT A;  4WXO A;  1J2V A;  3NMA A;  1JLF A;  1A7G E;  2AD9 A;  1UJ4 A;  3M8R A;  4ID8 A;  3I5A A;  4U67 Q;  1X4B A;  2G1D A;  3KHL A;  3Q8P B;  3DNC A;  1OS5 A;  1NJY A;  1QM9 A;  1A6L A;  5KFJ A;  4RW9 B;  4RUH A;  3A1Y G;  3OL7 A;  3LAN A;  3TUJ C;  5AJ3 J;  2GVD B;  2OFH X;  3ZZO A;  2EBG A;  1RTI B;  3LAM A;  1H38 A;  3K5O A;  2V0N A;  1R89 A;  2IM0 A;  1EB0 A;  3PG9 A;  3R5B A;  3BKF A;  3IBW A;  1HBO B;  3H20 A;  4HLB A;  5DLF A;  2ZEJ A;  3K57 A;  4AYB D;  3RBE A;  1R31 A;  2ZJR Q;  1S9G A;  3D2W A;  2DHS A;  2P6T A;  3ULH A;  3BV8 A;  1R8C A;  4OJ3 A;  1RAJ A;  2HS0 A;  2ZBC A;  2DRB A;  4PG8 A;  1NZ8 A;  2HHS A;  2QLJ B;  1T03 A;  4DBQ A;  5AT1 B;  3V2U C;  4U7U K;  1GH8 A;  4B3S J;  3S8S A;  2YKP A;  1T9T A;  2AGQ A;  2QMU B;  4O44 B;  3GII A;  3NLC A;  1WEL A;  2CG4 A;  1DAX A;  1FWK A;  4DCP B;  1CUL B;  4P10 A;  2FLL A;  2LFV A;  1SKU B;  2WVB A;  4MFB A;  4LF6 F;  4Z7Y A;  1IWG A;  1I1G A;  1UCN A;  3IAS 9;  1YJV A;  2M2B A;  3H2L A;  3DU6 A;  1CJU A;  2DGQ A;  4ZP7 A;  5KT6 A;  5LMU F;  3GJR B;  1YRX A;  4ZVE A;  1RTJ A;  1B4S A;  1WD6 A;  3VF0 B;  4ED3 A;  1IN0 A;  2R7X A;  8ATC B;  4H4K C;  5KAK A;  4QOT A;  2RIJ A;  3V4I B;  2DO4 A;  4MK7 A;  1CQN A;  3B78 A;  2N4D A;  4NE9 C;  5C2G A;  4ILR A;  4TU9 A;  1NZA A;  1FVS A;  2CUY A;  1KLM B;  3H40 A;  3PW7 A;  2HLU A;  4B3R F;  3FBF A;  3FCV A;  3J7Z 5;  1S99 A;  5KFH A;  4KRW A;  2C28 A;  1M0S A;  2V68 A;  1UVN A;  4OV6 A;  2AZ1 A;  2V5H G;  1IR0 A;  3IR5 B;  2EKN A;  1TL5 A;  4J90 A;  2GS8 A;  4J9S A;  2V4J A;  1NDP A;  2A3J A;  1ULR A;  1FK9 A;  4C0O C;  2XSJ B;  2C1E B;  4AUK A;  1T9V A;  3KLV A;  3DYA B;  4OI1 A;  1VBZ A;  1YRU A;  3VGT A;  4K0K J;  4WZM A;  2R7Q A;  5J2M B;  3DDN A;  1KLN A;  3NWG A;  4HT5 A;  3BO4 A;  3EDQ B;  2M52 A;  4K4X A;  4ZVG A;  1FXL A;  1IBK J;  1ZM3 A;  3PEH A;  3SCK E;  5EX0 A;  1D8Z A;  4QU6 A;  2GMH A;  3C66 A;  2JEI A;  2Z2L A;  1NDK A;  1QAJ A;  4W98 A;  3KLG A;  4YEA A;  1BMQ B;  2HW3 A;  1VBK A;  3W2V B;  3QGH A;  1H2T Z;  1BQM A;  5LSR A;  1BD6 A;  2VC1 A;  5ETK A;  2B9X A;  1GX6 A;  1HLW A;  3RRK A;  2R7S A;  2B3T B;  3G82 B;  3SCL E;  2YPY A;  1GMW A;  4LF4 J;  4M63 A;  3T1H J;  3PIO Q;  4IO9 Q;  3AD9 C;  4PXC A;  4DX7 A;  4NWB A;  2ASY A;  2SXL A;  3WIV A;  4N76 A;  1YHQ S;  3MEE A;  2KXN B;  1WI6 A;  2HIY A;  4PPD A;  4ZHR B;  2W7P A;  2VU5 A;  2QT7 A;  2R8I A;  2UVU A;  2AIR B;  2XYH B;  1QUP A;  2LA4 A;  2W9C A;  2BKN A;  4L3N A;  2VDI A;  1L3S A;  5KT7 A;  3DGP B;  2K3I A;  4ICL A;  1MNE A;  1XNR F;  3DLG B;  1Y3J A;  4OQJ A;  2R2T A;  3KK2 B;  4R25 A;  3HMJ G;  2KZZ A;  1X4D A;  4FF1 A;  1SJ4 P;  5KG6 A;  4DQI A;  5HO4 A;  4ZIT A;  4M5J A;  1RLD A;  1EP4 A;  2AEM A;  1RHQ B;  4LF7 J;  2B4V A;  3HVR A;  1HBU A;  2NYH A;  2H1Y A;  6FD1 A;  3KK3 B;  2MHE A;  2VB6 A;  2ZBP A;  2JNJ A;  3M30 A;  5IQ6 A;  2UXB J;  2NZC A;  1YWX A;  4JYA F;  3RTV A;  3DOK A;  2W01 A;  1YJT A;  1FKO B;  3H42 A;  4C98 A;  5HBM B;  3T41 A;  3U1L A;  3ETM A;  3F56 A;  4J91 A;  4YHH J;  1KOO A;  3X1L B;  4ZVO B;  2OPS A;  3O3L A;  4ECS A;  2VKZ G;  1WHX A;  2C2D A;  3GLJ A;  2G2Y A;  3ISN D;  1RT5 A;  1PBA A;  4P2X A;  4ZPD A;  1CG2 A;  4WBF A;  4QYZ K;  2XUL A;  4X4Q A;  1DY3 A;  1S6Q A;  2IAJ A;  5A6P A;  1M5O C;  3LH2 S;  2Z56 B;  3LP1 B;  2NXC A;  5KFF A;  5HP1 B;  5CXT A;  4M5N A;  3PYG A;  3HKZ D;  3E3X A;  1RT4 A;  2E7V A;  4OYP A;  4YY3 J;  2HHW A;  5GAD I;  5D4P A;  3N28 A;  5GME A;  1NK7 A;  4C7Q A;  3C46 A;  3J81 Y;  3BQ2 A;  1H73 A;  4GKK J;  2CVE A;  2Q79 A;  4AL5 A;  3RRG A;  2W7A A;  1REG X;  4DR3 J;  3H98 A;  2JC1 A;  5RUB A;  1RWP B;  2DHG A;  3I9V 9;  2F8M A;  2CFX A;  3CTR A;  4OYA A;  5AJ3 F;  1IKW A;  4G1P A;  2AJF E;  3TVY A;  1VOM A;  1WHW A;  4QR1 A;  4DEZ A;  2V4Q A;  4A48 A;  1Q8K A;  4M5D A;  3IRX A;  2VG5 B;  2Y0S D;  1U2F A;  2DNH A;  4GKJ F;  4RL1 A;  1J27 A;  2V8D A;  4LF2 A;  1RT2 A;  4K4Y A;  2FLP A;  2UUA F;  2WZ1 A;  3SDE A;  3I82 A;  1VRU B;  4OV1 A;  3NEK A;  1XBW A;  2CPE A;  1W2I A;  3TNV A;  4OI3 A;  1S9E A;  3L7P A;  3CJS A;  3OV7 A;  4K59 A;  3TR5 A;  3GJT B;  3CJ4 A;  3NNA A;  4WU2 A;  4JV0 A;  3N6M A;  3S7R A;  2DNQ A;  5DDO C;  1YQH A;  1LKZ A;  1EET A;  1JX4 A;  3J80 U;  4WK1 A;  4PWU A;  2CPX A;  4OHX A;  2HVH A;  4B3S F;  4LVO P;  3MI7 X;  2KM8 B;  1DTQ B;  3V6D B;  3UCZ P;  1H7W A;  4DSL A;  3HVA A;  2X51 A;  2LQB A;  1UFL A;  4UT4 A;  5J1E A;  4C9D A;  5K9F A;  4JI2 F;  3CJT A;  1QDU B;  2OPR A;  2GML A;  2KTQ A;  2IM3 A;  4KAI A;  3H5S A;  3MCN A;  1BLU A;  4QPT A;  2BE2 A;  2ROP A;  1WOP A;  3WC0 A;  5A2Q Y;  1X0F A;  4A8F A;  2WRM A;  4QIE A;  3NY0 A;  1KTQ A;  2ZBI A;  1CJK B;  1U0H B;  1WUU A;  1YBU A;  3T5H A;  3NGK A;  2OLW A;  3CO9 A;  3NBP B;  4CZC A;  1MW7 A;  3CCQ S;  3RB3 A;  4FYW B;  2WB4 A;  1SJR A;  1AZS B;  1U1Q A;  3QRP A;  4N41 A;  1S79 A;  5GAE U;  4OZ3 A;  4MTP A;  4WTO B;  3K5P A;  4NLO A;  2X1G A;  2L41 A;  2CA9 A;  1L5U A;  2AWZ A;  2IYI A;  3BSN A;  3HK2 A;  3DI6 B;  2K8G A;  2RVJ A;  3N01 A;  2RT3 A;  2HVZ A;  3I0R A;  2CDR B;  2C2N A;  2KYZ A;  1YI2 S;  3D28 A;  2FTR A;  2RRN A;  2CPI A;  2QL7 B;  4AL7 A;  4TU8 A;  2E5H A;  5H9E K;  3C6U B;  3R1H A;  2QA4 G;  2CQC A;  4X84 A;  5B0B A;  2KRB A;  5AE1 A;  3AJD A;  4DV4 J;  3BR8 A;  4K0K F;  2R2R A;  2PI5 A;  1X4C A;  4NLX A;  4DUY J;  1MU2 B;  4OHZ A;  2F5G A;  3PRD A;  1RT1 A;  1IBK F;  3DLE B;  2CPF A;  2QGF B;  2GIF A;  3GV7 B;  1OMS A;  1SC1 B;  3IO1 A;  1HD0 A;  1V5V A;  3OTO J;  5G0R B;  1KHV A;  3PX0 A;  5FII A;  3AOC A;  3K59 A;  1K0V A;  3EGV A;  3ZC4 A;  3MM9 B;  4KH1 B;  3K0J A;  2OH2 A;  1HFE L;  4I6Y A;  4R8U B;  2N4C A;  2RKI B;  2HHH J;  2DY1 A;  2IDE A;  3F44 A;  1YBA A;  1TUG B;  3K7R A;  3MMB B;  1RWO B;  4DX8 H;  1S1X B;  1RT6 B;  3E2E A;  4FYY B;  4HHU A;  1P1T A; 
#chains in the Genus database with same CATH homology
 1KP6 A;  4GVB A;  4GVB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...