4GVBB

Crystal structure of the virally encoded antifungal protein, kp6, heterodimer
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
74
Chain Sequence
PRPVMCQCVDTTNGGVRLDAVTRAACSIDGYYTEKDGFCRAKYSWDLFTSGQFYQACLRYSHAGTNCQPDPQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Atomic Structure of the Virally Encoded Antifungal Protein, KP6.
pubmed doi rcsb
molecule tags Toxin
molecule keywords KP6 killer toxin subunit alpha
total genus 16
structure length 74
sequence length 78
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.440 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Killer toxin KP6 alpha-subunit 4gvbB00
1KP6A 4GVBA 4GVBB
chains in the Genus database with same CATH superfamily
3IP0A 4K4SA 2B7BB 2RVJA 2FLNA 4A4JA 2LXIA 1S99A 2PFDA 3K58A 2EK6A 2E1RA 1KR4A 1KTQA 1YQHA 2P9EA 3SSSA 4LFAF 3RB6A 1P27B 1REVB 4NZ0A 3LTOA 4OIXA 4LF1A 4O0NA 3UNYA 3WIUA 3GCWP 3GFYA 5GAEI 3PKMA 5THWA 3G71S 4XPCA 2PSZA 2MJUA 1MN7A 2NYHA 4USWA 5CYMA 3VTIA 4E8UA 2BKPA 2WONA 3VQSA 3VAFA 1B70B 4NI2A 2KHDA 2FY8A 1G2EA 1PC5A 1HHQA 2MYFA 2PMWA 3GCXP 2F63A 4XTTA 4YEAA 5A8WB 1ROFA 2GO9A 1U0SA 2MKIA 4DHVA 1UVLA 2DH8A 3N5BA 5B09A 2OPRB 5C42B 2XS2A 3HHDA 2K06A 2RMLA 5HLFB 1U6BA 3AA9A 2MGZA 4QYZK 1WC1A 1AA1B 1DJ0A 4N5SA 3RW7A 1PKUA 4JI0F 5L9XA 2KT2A 1IJFB 5KT7A 3C19A 1QE1B 1TL3B 2DHHA 5CYQB 2DNKA 3L95X 1YHQS 3CO9A 2HQFA 2KXFA 2RUGA 4XK8C 4ZLPA 2UU9J 3IAS9 2KN4A 2MJNA 3TO8A 2ZH5A 4F2RA 4B3RF 4CO3A 2UXBJ 1U1PA 3S1TA 3HFVA 3AQOA 2XMVA 2BW7A 2VPYB 4OI2A 4DSIA 3MR5A 2OHDA 2KFNA 3HSZA 1DURA 3ETOA 3W5XA 1S4EA 2I9SA 3HHEA 3GYXB 1S9FA 3QO9B 3ENWA 2N3OA 3F73A 1LK7A 1MN9A 2EXUA 1XBWA 3R2CJ 5GMKa 3CPWR 2W01A 5EX3A 5HANA 2ROGA 2B9EA 5L1JA 3VQTA 1T94A 2C3YA 4NXMJ 1N33J 2XYGB 1QAJA 3MMCB 4IKAA 2UXDF 1I6JA 3EZOA 3BN7A 1VQMS 3WDOA 3DFEA 1HBUA 2CUYA 2CQ1A 4WZQA 4CQ1A 1HQEB 1DBDA 2Q3PA 5DLGA 4M63A 3GU0A 4NLPA 4K50A 5HK4A 4NX9A 1S49A 5ADZA 3J7AN 2GS8A 1DTQB 1Z2ZA 3F0NA 4USIA 1FNXH 1MLAA 2LXUA 3QLHA 4I2PA 4MH8A 4HDGA 4TNOA 2C2EA 3MM5A 5B0AA 1HNVA 3DRYA 2IJNA 4DEZA 3N6NA 1JX4A 1FKPB 4DU8A 4PUOB 1S6QA 2WVFA 3A8IA 1VIXA 2OPPB 2ZH8A 2HHWA 2FVCA 3LUYA 3VAIA 3EGWB 2ZWPA 3TOQA 3J81j 4A8QA 1W2IA 2RIJA 2AV5A 5H9FJ 3Q0AA 3A8EA 1SJ3P 3SSRA 4ECXA 1B0PA 5H9FK 3G8SA 2IC3A 2YVSA 1G6BA 2A2CA 2BA9A 3FK4A 2CWXA 3GSDA 3MAHA 1TKXA 1XERA 2VG7B 5JJBA 2IBOA 3OVAA 1X9SA 1KN6A 3CB4A 1CJKA 2F8MA 3Q89A 1C0TB 4EWTA 2GC8A 3WC0A 4BC9A 4LFCF 1AFJA 1QAXA 3M8ZA 4I4BA 1MMDA 2NUHA 2OPSA 4P73A 4K4TA 4DSEA 2HWHA 4UT4A 1WORA 1TQLA 3ZC4A 3AH6A 3KLIA 2DO4A 1S1UB 2DNZA 2MHNA 3DLJA 1FFSB 4FDFA 4ZVSB 2CPHA 3PYGA 4Y2IA 5BXIA 4JYAJ 3BEGB 2DRAA 1G7CB 4DR7F 1JIHA 5KFBA 1A6LA 4ID5A 4CO2A 2IDLA 2NXUA 2R7UA 2YPZA 3OXLA 3LAKA 2QLBB 3A1YG 1FKOB 1CQMA 3DLEA 4WIIA 1L3SA 1H72C 1FTCA 3CE8A 2JWNA 3NCQA 5HVFA 2AGQA 2H48B 3L4BC 2X3GA 1B4SA 4RNOA 3IRWP 2BBEA 2L9DA 3NLCA 3ITHB 3QIDA 4PWWA 1TK0A 2R8JA 5C2CA 3T1HJ 2BJ3A 2J9DE 1QAIA 1UEKA 2CWKA 3KK1B 3CNQP 5KFKA 1S1VA 1NMEB 2MGZB 2A18A 3K89A 3AD7C 2RSQA 1D8YA 1HARA 2HBZB 2M5YA 3ZZPA 1OYDA 2BACA 5KFWA 2MHEA 1ZTWA 1CQNA 3HSGA 3NNAA 5LJ5Y 2XNQA 3FEYB 4QR1A 2UXCJ 3L09A 2JLEA 1HI0P 2J6UA 3L7PA 4HHHA 1X60A 1ZH5A 3MZIA 2WB1D 2IMOA 2KKHA 5HQMA 4ELTA 3Q8RB 2LVWA 2J8SA 1FEHA 5GADU 2MSSA 2ZITA 3HJVA 3RBEA 4UY8T 3MAAB 1VIOA 3WZ0A 3S8SA 3SI8A 2VG5B 4DDFA 4O44A 2E1AA 2V0NA 2XEXA 1V9OA 4RKUC 3VVTA 1TP7A 3BM7A 5M2PA 1TL7B 5L46A 2KG1A 3ZZUA 3QO9A 3D0GE 1NZAA 1U8WA 3IBCB 4P10A 1VBXA 4M5GA 2KVQE 1Z1ZA 3L7UA 4TXSA 1HLWA 3SV3A 1RXOB 5I42B 1NJWA 3AB2B 3C15B 3R7NB 4O3PA 5DQGA 3R5GA 1DQAA 1RJJA 1Z4UA 2RNEA 2RU9A 2VH7A 2GQ2A 1UFLA 3ISND 3NWRA 4EFAC 5L39A 3PW7A 2C2MB 3GLJA 3M32B 4B9VA 3B78A 1IUJA 3RJMB 3PJXA 3U1LA 1RWKB 2X51A 1IWAA 2VFRA 4HHJA 4PAAA 3I9ZA 2ADCA 4EZ6A 3QIPA 1ZAWA 1WF0A 5ETOA 2YPYA 2VIHA 3TANA 3RR8A 2CQHA 4NEZA 4G6VB 4IG3A 4M5HA 3HK2A 3I96A 3SXLA 3WQPA 1N6QA 1F6TA 1T3OA 1S76D 1WHVA 4ECYA 2ZKUA 2RQMA 1XQIA 1LWFB 2O1PA 4B9LA 5KAKA 3NS7B 3CD0A 3GV8B 2HHVA 2DJWA 3OUYB 1LEOA 2XLJA 4OX6A 4U95A 3I32A 4QIEA 5F8HA 1LW2B 1TU0B 5A2QU 5LMNF 2ERRA 4HTJA 4NLTA 4WBFA 2APOA 2ZM6F 4J9QA 2FLPA 3CJSA 4JI4F 3NMAA 4A46A 4LFBJ 3UPFA 2KI2A 1KEKA 5IOLA 1RHUB 2PFFB 1QE1A 1TL3A 2UUWA 3CJ8A 2YKNB 5CYQA 3VGTA 4ED8A 4QWBA 5HVHA 1XR7A 1WDDA 3DRPA 3I9V9 5D4OA 1ZA1B 2H4WB 3DOMA 4G1QA 1TKZB 4RW9B 2KT5A 2MQMA 4J9NA 4U9RA 1U1KA 2J6SA 1CPZA 1YITS 3EZUA 2KG0A 3V6JA 2PT0A 4PG5A 1X4DA 2BRKA 2MZRA 3RBDA 1M5VC 3T1AA 2Z0GA 2JC1A 3DRSA 1O5JA 4RL1A 3JYTB 3KNGA 1XNRJ 3VAKA 1WHWA 4PYDA 3V6HA 2UUCJ 4K7QA 5GAEU 3EPIA 1HNWF 1LWCB 4DJBA 2W9AA 4M5IA 4ILMA 4PCQA 3CDAA 3RAMA 2O67A 1LWCA 2AZ3A 4CIOA 2EKYA 4DR4J 1EQMA 3ULHA 1LKZA 1OY6A 4OV1A 1RTDB 1IR0A 1RLDA 2V68A 2QTWA 2ZE2B 5KFFA 1NPPA 2AP6A 4K4XA 3R1HA 2J0SD 4ZPCA 3RZAA 5CA5A 5M2UA 4TU9A 1RAAB 3R6GB 1XMOF 2GQQA 1SXLA 4E2FB 4AL6A 2ZH2A 2P2CB 1X4EA 1FCAA 1VI7A 2BJEA 3NAHA 4BWMA 3NGKA 4ES2A 1IBMF 1RB0A 3HHLC 2SXLA 3O8WA 4NYPA 1TAUA 4R8UA 2IMWP 1XC9A 1SJFA 4NLVA 5D0HA 4ZVUB 1NRKA 2QLFB 1KLMB 1CS4B 2CNKB 1NDCA 2FHJD 3SEOA 3HT3A 1SJ4P 2J5AA 3FBBA 4TY8A 3QJLA 1RWNB 1FE4A 2PIIA 3GV5B 2Z57B 5KFGA 1ELOA 3RAXA 1URRA 1E6YA 3MAAA 3MM7B 4EO8A 2HEKA 2ROPA 5MAOA 1HBNA 2J7WA 3AD8C 1KC8T 3CTRA 3M9MB 2WCXA 2LDYA 4PXBA 5GAGI 2C2DA 1X4CA 3ZZOA 2OEJA 2YXLA 3CJTA 3KK2A 3ONQA 4RW6B 4CM2A 3T3FA 3CMES 4Y2AA 1CBKA 1JLQA 5LMUF 2PD1A 3KLIB 1L3UA 4OHWA 2OPPA 4C48A 4KGKA 4NA2A 1FX2A 1MWYA 1Y5NB 2QLWA 4U7CA 1SKSA 1AB8A 2J7UA 1FKPA 3WIVA 1IBLJ 2E7XA 3FSYA 4KQZA 1C0UA 3CCMS 1RWVB 1V6HA 5HBMA 3O44A 4DV0J 1NKCA 2RD5C 3DOKA 1FDNA 1KBRA 3W2VA 1NHKL 1RE1B 1UPPA 3O6QA 4Q44A 3GIIA 2F4FA 1ZAVA 2ZEJA 2HBRB 2XSFA 1IKVA 2YH0A 5CZXA 4LQ9A 3CXCR 4BS2A 1SJRA 4IRKA 3GILA 3V5RA 3ITHA 2UU9F 4LF9F 3LO3A 1XMQF 1RHKB 1X4BA 5E33A 1RCOB 5J1PA 5AXNA 3SZ2A 3SBMA 5HP1B 1NK5A 2ZDOA 3C16A 6AT1B 1T05B 2C2NA 3DLEB 4K0KJ 5IT0A 1YWXA 4OHXA 2HMIA 2ATCB 5ETSA 3I31A 3CCRS 2O66A 5DZ6A 4O3QA 4KKOA 3MEDA 5BYQA 1KSPA 3GV7B 1TFYA 3D0IE 4M5MA 3SFGA 2IVYA 3QZ7A 1V3ZA 3LWLA 3NAIA 3T1YJ 4KPCA 3H0PA 1K73T 4JV5J 2DNMA 1UFWA 1TL7A 5I3UA 4OHZA 3B6BA 4I69A 3HM9A 4FF3A 2CJ9A 2M52A 2F9DA 3IWLA 3RW6A 4ZVPB 4NPOA 2AEFA 2LU2A 5E3AA 3R7SB 5HMXA 2BJ8A 4IH5A 2NUUG 4K5SA 1VOMA 3GFZA 4WFYA 4AUKA 1ZYQA 1F9EB 3KLHB 1H38A 4YP3A 2QGFB 4PWUA 5CHCB 3BGOP 3GONA 5DDPC 5KFYA 2FIUA 3BPDA 4JI2F 3ZZ0A 3OL7A 3W2WB 3Q2SC 3V4IA 3PV8A 5DG8A 1AUDA 5F0WA 3VALA 3HHLD 3I0SB 1TUWA 2HSEB 2LP4A 2N7CA 3G8TA 1NCLA 3CCZA 4WU3A 4ZPAA 4DPWA 2QX0A 1HWIA 1X5SA 2RILA 2J0QD 4LFAJ 3NNHA 2LQ5A 4ECTA 1S1VB 4RBVA 3GJSB 4F2SA 4O0IA 2AF6A 3PRVA 5A8WA 5HMWA 3BO3A 1AFIA 2ZC4A 1GEHA 1VQSA 5D78A 4I2QB 1LWFA 3PFEA 4NZ7A 5J1EA 3J80Y 3K5LA 4W92B 2IYGA 3Q8YA 1RT7B 4NCGB 3NGTA 3FBCA 3VVUA 1OSCA 1T11A 4PPDA 3MAQA 2R42A 4M95A 2QG9B 3N4WA 1R7IA 4WK3A 4Z37A 1S0NA 4ID5B 1H74A 4FBTA 4DQIA 4MKYA 3BSCA 4OZ3A 3L9ZA 3DHXA 2CPDA 5LL6d 3BB5A 2B9XA 4XAKA 4F3MA 3QGGA 2OKQA 3T19A 1RAGB 2CQDA 1R8HA 1EKRA 4B3TF 3R7BB 1DHMA 2XO6A 1UW9A 1HKAA 2H1YA 5K8OA 1C0UB 1BGXT 2C3MA 1DQ8A 2A0FB 1FD2A 3KYLA 1QUPA 3H4BA 4JV0A 3OUYA 5KFXA 2X1AA 1Q0NA 2HG4A 4J9VA 2BXJA 3LA0A 2QA4G 2B5JB 2EBEA 4FKYA 3H25A 2G1HA 4TVAB 3B4MA 3H8YA 2KVIA 2ZH9A 4LF9J 4OYWA 3OLAA 1LFWA 5ETMA 1B3TA 1XEZA 5AT1B 2PI4A 3GWCA 1Y3KA 3MECA 3X3UA 2R8KA 4OZ2A 2PO4A 1FRIA 4Q43A 3KXDA 4J9SA 1R0AA 4ILLA 5SUHA 3CJ4A 4CLFA 3FUYA 2BQRA 4QW9A 3DDIA 2XMJA 4P2FA 5AXMA 4IG3B 1EQ0A 2DNGA 1FNOA 3HZEA 3DDNA 2IM1A 3G8QA 4QIGA 1CG2A 1PYTA 3A3PB 3HVTB 1N33F 1TKTB 1M5KC 1HI8A 5L8RC 2JEGA 1JMTA 3AHPA 2RS8A 2HKEA 4LSLA 2MQLA 3A12A 3TEHB 3GFXA 7FDRA 5K9FA 4DV7J 1FK9A 1HNVB 2Z58B 3GJRB 4AYBD 1A9NB 1PIEA 3UCUP 2FY1A 3V2UC 2DR6A 4FYXB 3PO5A 3QGHA 1G3OA 3LQVA 4DPTA 3HSDA 1J5EJ 3DC2A 1JKHB 1MROB 4C9DA 1WEXA 2VD3A 2D1CA 2VFTA 3IM9A 5HL7Q 5JUMA 1XWLA 2W8KA 3W62A 1Q7LB 3JB9k 1CEZA 1XIQA 2DNPA 2VC1A 1DZ5A 3IWNC 4UW2A 3T5HA 2XLKA 4KT0C 4USKA 4DX8H 3RTVA 3DLKB 4RU2A 1FDBA 3FEXB 1R3NA 3MUVP 4LF6F 1TMMA 1YLXA 1REVA 4FXWA 1RT2B 3E01B 3J80U 2PDAA 1RU2A 1FERA 4ZVFA 3O2IA 4IH6A 1PJ7A 1Y10A 2G9OA 2OSQA 3RGIA 3VZIA 2HK2A 4P72A 3IC1A 3CMAS 3EGNA 3M8WA 1SL0A 3QT6A 1YJRA 1UAWA 2WVBA 3UN5A 3PIOQ 5A76A 3HXMA 1RT1B 3H20A 4J9KA 1RAIB 2LEPA 4H54A 4KJIA 2K7JA 5EX0A 4LMZA 2H54B 2FD2A 4OMFG 4DQQA 2OMOA 3ILJA 2CDRB 1BUXA 2OEKA 1PILA 2YNIB 1E6VA 4G1PA 2HHPA 1Y00A 2V8GA 4NMLA 2V4JA 3D5MA 3RG6A 4Z7CA 2MLZA 2ZBIA 5C7PA 3Q8PB 2ZHAA 4N47A 1U1QA 2GHPA 3IBFB 3N6LA 3NS5A 3PYFA 1WI8A 2JVRA 2CQ0A 9RUBA 3PACA 3BO2A 4JI7F 3KNAA 3W65A 1WKLA 2QIFA 1FKOA 4DR7J 3BREA 1RT5A 3FVYA 3HT0A 4NLQA 3KUGA 1H3DA 1T05A 4F36A 5IFMA 3CJ5A 4OJ1A 2EBGA 2C2RA 2OH2A 4AT1B 7FD1A 3UD5A 3OTCA 3W66A 4TQRA 3J7YI 4C6AA 2IY5B 4DL0C 4DXLA 1U1MA 3M9NB 2QA1A 4MT1A 3PO4A 2C2ZB 5CYMB 4ID8A 2B5JA 3W2VB 2XHCA 4CYUA 4NA3A 4C0HA 9ATCB 2VFUA 1ZM2A 2ACYA 2F5GA 3ZTOA 1Y7PA 2XLIA 3T1HF 4MYUA 4C7QA 1FFWB 2YNGB 4K4WA 4F4AA 4DL5A 4MAKA 3KHGA 1WC6A 3IMQJ 3PRDA 2GA7A 4WXOA 3MM8B 2YH1A 2VG7A 1RTJA 3NGSA 2E5LJ 4GMKA 5IC4B 2FJXA 1MW7A 1S7IA 4EZ9A 1T9XA 3QAUA 4JV1A 2NXJA 4PKDB 3MEEB 3KHRA 1JLEB 1H2VZ 1F3FA 4UOGA 1T9UA 4H4OB 1FDAA 4X4PA 2GHVC 3R3TA 1FTRA 5IM0A 1WF2A 4UOHA 3MMBA 5I42A 4IRCA 3SMZA 3UDCA 4RNMA 4DR6F 1BC6A 4DPOA 1N8RT 4TYBA 4XPEA 2V9KA 3TUZC 1NAQA 2R7RA 4PUOA 4ZN3A 4DPYA 2IYIA 2ZH4A 1GT8A 4ECZA 2IJFA 2MTLA 1SKUB 2BQ3A 3UD4P 1U49A 1JLGA 1JXVA 1F2GA 1NJIT 2KO1A 2IPOB 3G6VA 4OI3A 1EJ7L 1FKAF 3CCUS 3RYLA 1S97A 3H5SA 4TLQA 1GH8A 1O6XA 2BJ7A 4MKVA 3M7VA 3LF0A 5A8RA 1BE4A 3FCWA 1B99A 1X4GA 2I1RA 3LGHA 5KG2A 3Q8VA 2GNKA 1HWUA 1OPZA 2V8DA 2WBRA 3M2RA 4DQPA 1S6OA 3NP5A 4QQBA 1QVFR 1X4FA 2FZGB 2CDQA 1LW2A 4LRCA 1WOOA 1YJVA 2AJ1A 2W2OP 1WSRA 3I6PA 3N0VA 3HF5A 2VQFF 3TAPA 3HKWA 2AU0A 4I56A 2DK2A 2VQEF 1PG5B 1UVNA 1BWEA 2EFNA 1IKYA 2RHSB 3CW2C 2N3LA 3UVJA 3ZTRA 2YNHB 2MB0B 4ZMMA 2KU7A 5HI7A 4KGXB 2BEFA 1ZPVA 4G1IA 2QT7A 2JDJA 4G1QB 1U0HA 2HHTA 5HP1A 4CO4A 1I94F 5ETLA 2HFZA 3V81A 4DV6J 2ZM6J 4C8OA 3EJMA 4P6QA 2MKKA 1Q82T 3PJWA 4P2XA 3CCJS 2XMMA 1UVKA 4C3LA 4TQSA 4DV2J 2V5HG 3QJJA 2BUNA 3IGNA 3BGRB 3I82A 5LM7E 4YMEA 1FI4A 3GP9A 1U6FA 1SJQA 1C1CB 4O3RA 4EU0A 4ECWA 3OHAA 3PHTA 3OW2R 1VFJA 1Q81T 2F65A 1FNMA 1ACMB 1I51B 1NSAA 3V4MA 1GMUA 4DL6A 2VONA 1CC8A 1UEVA 1KFSA 4F50A 2J8AA 2BKOA 2X3DA 4OHVA 1UP1A 5B0CA 1FX4A 2ILYA 2RKIA 3IGVA 3W8GA 3K59A 2JEIA 4ALZA 5DDRC 1R0CB 4CT8A 1PBAA 5M2RA 2HFOA 3MF5A 2M4MA 2LFVA 5A0YB 1AXQA 4O44B 3K5NA 1RWPB 1S1WB 2FC8A 3BR9A 4KE5A 5T41A 1AZSA 1LQ9A 4JI6F 5DDOC 3JSMA 2H9ZA 2MQPA 2HS3A 2A2DA 1R89A 1P6TA 1ZS6A 2CVIA 2EFGA 2FGCA 2JOQA 3PJ9A 2XMAA 2VPWB 2XGQA 2AJQA 1Q7YT 3QWUA 2ZZMA 4YB6A 4ED3A 5FIIA 5E0OA 1R8AA 2JNJA 4K2XA 2ZHBA 1CJVB 1FRJA 2OD6A 3A8KA 3D68A 1RTIA 4JP8A 2FJDB 5KG4A 1LWXA 3MM9A 3PRBA 1NSQA 1UJ5A 4KR0B 5B0DA 3P8BB 3ZZRA 4DV4J 3CULA 3CCTA 2M8HA 4E0DA 4QPTA 1HBOB 3M1VB 4HACB 1RTDA 4IRDA 4GKJF 1SUQB 4CLKA 2XCAA 1N5YA 1U8SA 2V8PA 4ELUA 4WKRA 5DJBA 2G13A 2KFZA 2CZ4A 4LR8A 1NDKA 1SL2A 4BBYA 4KFBB 1LXJA 2XI2A 2XMTA 2NLWA 2M2BA 3C6UA 3OQ2A 5RUBA 2Q79A 5CD4H 2D3UA 3OV7A 4V19J 1KFDA 1P1TA 3DI6A 2HHSA 1WF1A 4U6PA 1SIWB 4IO1A 3M6VA 3AFGA 1TK8A 3CCVS 2AYEA 2CJXB 3BF4A 3HI9A 1QJHA 4JI8J 4NZ6A 1R43A 2RRNA 3GSIA 4C11A 4YUDA 3FJ2A 2HVDA 1L3TA 2DR7A 2GVDB 3ZTQA 2AZ1A 1PYSB 1ZM3A 2DIUA 3K5OA 4LSLB 3VHQA 3ELHA 2XY5A 3JQJA 5CYJA 3D1OA 4ES1A 3RR7A 3V4IB 1R8BA 3BV8A 2D3OR 5CXTA 2ALYB 1RT4A 2DHGA 2RQKA 3PKYA 4UY85 5C42A 2JJ4D 2LQ9A 3KLFA 2VB6A 2VL1A 1Q8IA 2H5EA 2HS0A 3ILIA 1NHVA 2HURA 3JXOA 1FWPA 3TZXA 5F8GA 2W9BA 4DL3A 2BDPA 2MMYA 2G1DA 4ETZA 4OYXA 3MOZA 2B51A 3P45B 4RW4B 2HIYA 1CC7A 1SC6A 1T7PA 2HW3A 1SQGA 3BBBA 2FLOA 5BYRA 2DHSA 2H3EB 1NJZA 4ZIVA 4R5PB 1J5OA 4TY9A 1NJXA 3TW0A 1S9GA 1VRQC 2FJEB 2DRBA 2XSJB 3IRXB 1OPIA 2VG6A 3T9ZA 3F44A 4OI4A 5F41A 5KFHA 4RUCA 3QIPB 2CRLA 4NLYA 4YOEA 2D74B 4JUZA 1ITPA 1KLNA 2CYYA 2ZDPA 2DPIA 1JLBB 2K1RA 4QR0A 1GMVA 1R27B 4NXNF 3MEEA 2KZMA 1V5VA 3CDUA 5IQQA 4JI0J 2K1RB 2XGPA 4IQMA 4JI2J 2AQ4A 3LGNA 3TQEA 2WVCA 8RUCA 3MEGB 4B3RJ 3C15A 2RJZA 3MPVA 3M2UB 5J1EB 2CPJA 2UXBF 3DGVA 3I55S 2VFSA 2C3PA 1UVJA 2EG2A 3BGFA 3QBCA 4ENOA 3EDQB 1RAOA 4ANCA 2MKYA 1URNA 5AE2A 4RW8B 2AT1B 5A0YA 4QWAA 1Q95G 1PYOB 2WSEC 3FEZA 3H4DA 4LF7F 2NQPA 4ZN1A 1OQ3A 3Q8UA 2LMIA 1YIJS 4B3SJ 3UDEA 2QA4S 3TUPA 1YX2A 4Q8EA 4NCBA 2KDOA 2YWHA 4QWEA 4WPAA 2UXDJ 2LLZA 2DBBA 4WIQA 1XJWB 1RT4B 4RUBA 1OO0B 3LPYA 4ECVA 1NK6A 1GTEA 3AODA 3QQCD 1SL1A 1ZETA 3TX8A 5DQIA 3QMQA 3RB4A 2W2NP 1XTZA 4NCAA 1WEZA 2CPXA 2GGPB 2VBZA 4O23A 2HFVA 1NUEA 2V4JB 4FP9A 3HP6A 2DGWA 1N56A 2JC0A 2MQ8A 2PC6A 3NCRA 4NOHA 3NCPA 3D6MB 4B9NA 4Q0BA 3C6TA 2FHJA 3Q23A 2G4BA 3ZXWA 1LK5A 4C8MA 4J9MA 1H0HB 1MU2B 1IKWA 2ZOMA 3FSIA 4GO7X 3CC7S 5H9EK 3OTOF 3HLUA 1SVDA 4ZPVR 2R2SA 2ZUAA 1QAYA 1D0EA 2PGCA 5L1KA 1SH3A 2K3IA 2V2QA 1VDHA 1FVSA 1NNDA 4FYVB 3LP1A 3TVKA 1HBMB 4KFBA 2B6AA 4MKAA 4P71A 2HHXA 1RT2A 3E01A 3F41A 3R1LA 3CJ2A 4J9UE 2CJQA 3RBXA 2VA3A 4PWDA 3D2WA 4DUTA 1T9YA 4N8OA 1SV5A 1H98A 4L6V3 1KHVA 4RNFA 1JXEA 2DD8S 4DL4A 4PQUA 1IM4A 2XWXA 4ZPTR 4DR5J 4KHPF 3V6DA 4DV7F 1YJ9S 5KFAA 4KYZA 4KHMA 4GRSA 3SQGB 4CTAB 3M8YA 5KFZA 4CH0S 4ZLLA 3M8SA 3G6XA 3M8PA 2IA6A 4MTPA 5D77A 3UE2A 1OIAA 4A8XA 5A6PA 1LW0A 3FKBA 3KLEA 5DETA 1U25A 2HGNA 2QL5B 3MCSA 2UP1A 3KJQB 4DN0A 3MEKA 2GVZA 3MCNA 3GYNA 5B0GA 4OI0A 5C5JA 5KT5A 4WP9A 3THTA 1M1KT 3MTKA 2C1EB 4X2BA 4ED2A 1TKTA 3U7JA 3ENQA 3R27A 3NNCA 4OL8A 2EPIA 3MR6A 3PZPA 5LSLA 1KD1T 1TKDA 5IS2A 3ZNUA 5I3UB 4J9PA 1OS5A 2CFXA 4ES3A 3LW5C 1X5OA 2BV3A 2XI3A 5U47A 2XMUA 2E9TA 3M8RA 3VAMA 4Y34A 2DR8A 4NLGA 5KFQA 2XG8A 2I5JB 1FRXA 1RSCA 3QNWB 4P9SA 2HWIA 1R31A 1H6KX 2OMLA 4U96A 5J2MB 5CCLA 4YB1P 5LT5A 2CZVC 1JXLA 5BJRA 2NR0A 4WWSA 4ZPBA 2YX1A 3BKTA 3SCKE 4DCPB 2DVIA 1FE0A 1NPRA 2DTJA 3TAMB 4Q5VA 2WBMA 2A3JA 3M9OB 2CKWA 3MMAA 3QT8A 1RA7A 1WD6A 4KSEB 5C25A 2BOPA 3KK1A 3KFWX 4X84A 2OIHA 2KYZA 3ILLA 1RTZA 2AJ2A 1ZZFA 4CO0A 4WYLA 2XQCA 3OJSA 3CCQS 2VICA 1JNZB 4JI7J 2G2YA 5IWAF 1VHIA 4NLDA 4OYMA 3LOUA 1WI6A 4F3QA 4USMA 2PEBA 1YDLA 4DV5F 2D7SA 2FDNA 2YNHA 4KHRA 4I2QA 3RUBL 2XC9A 4NLUA 3TJ8A 3DHWC 4ZCKA 2J9CA 2QJ3A 4IYQA 1HNIB 4EYHB 1MU2A 1M0SA 1KNZA 1H7WA 1YRXA 2MSTA 1UVIA 2BKNA 5HROA 4M1KA 3KJVB 1VQ5S 2QFIA 2KXNB 3JS9A 4DR3J 4Q2LA 1KQKA 2RH3A 5HN0A 4A8SA 2YKMA 4J91A 2FHOB 4KGVB 1GXTA 2BE2B 4P74A 4C97A 3CF5Q 2CA9A 1CJKB 5CZVA 1N5QA 1M1GA 2DNLA 4YR0A 2E5GA 2FC9A 3KLVA 5G0RB 3R8YA 4WFNQ 3BH6B 4V1Ak 2HLTA 5DM7Q 2B4PA 6FDRA 1M1HA 2YWGA 5IV3A 1CSJA 3TZYA 4HR2A 1A0OB 2DYAA 4MIAA 3CDEA 3W60A 4PQUB 3OR1A 4Y0FA 4QIWD 4DV1J 3DRRB 4PEOA 1O8BA 1XMBA 3EXYA 4I64A 2ZD1A 2VJVA 3FFIA 1IBKJ 4LT6A 4DR6J 2CQIA 3BKUA 4W98A 4IO9Q 2IRXA 4A8FA 2UVVA 3BJYA 4P7TA 4RBUA 2GCFA 2C22A 1IR2A 1QSLA 1P1LA 3LP1B 2OFGX 1TR0A 1SUQA 3TNVA 1N5YB 1JJ4A 4ZJOA 2WVDA 2OELA 1UPMB 2L9WA 4ZPWR 1TVRA 2EFOA 4BLGA 4OYZA 4CLUA 2Y8WA 1WC5A 3D1HA 3K8WA 4JI4J 4LFBF 1F60B 5GAGU 1QD1A 1RAFB 1M90T 3K8VA 2UUBJ 2ZBCA 2MPUA 3R5AA 4FBUA 3IR5B 4USVA 5J2MA 2DGOA 3ENVA 1W26A 2J9DA 2O01C 2Z56B 1Y11A 4P52A 4F26A 5EWEA 2R7WA 2JX2A 4UQTA 4A8MP 2XSJA 1HYSB 3UN3A 3TX0A 1C4AA 3DRPB 1Q78A 4QW8A 3GIKA 1NB2A 3I87A 2RRAA 1VCTA 5LJ3Y 3MUMP 2WOMB 4PG6A 1M5PC 3OR2A 3DLBA 1EETA 4B3OA 3PCOB 2XZDB 1X4HA 3DYAA 4TU8A 1RADB 3PR5B 3AY0A 4ZVOB 4F4WA 1QY7A 4LSNB 3D6HB 3PW5A 1N54B 1WWHA 5E5NA 2UUCF 4QYZJ 1KHWA 5KT3A 4LF8J 2AJFE 2EC0A 1PC4A 3HVAA 5D0RA 2FJVA 3CCLS 5IT9U 5DS7A 2N7YA 2YWKA 2U1AA 2DIVA 1S1XB 2CQPA 4RR5A 2DH9A 4XIUA 1HMVA 4PXDA 1NK0A 3MXHP 2KHCA 1KVJA 3DM2B 3IS9A 1NEEA 3J7Z5 3BPSP 3H2UB 2C2KB 3GR1A 2E1MC 4OI6A 4RWXA 5LOQA 2RDJA 4X4UA 4DZ6A 1F9HA 1SC1B 1VC5A 4H4MB 1UJ4A 1IBMJ 1N48A 2KRBA 3HD2A 3PYEA 4KAIA 3SDEA 4C0OC 3ENAA 1M5SA 2CPYA 3FCVA 4K2JA 3AJ2A 1P8GA 3QSIA 3US5A 4OHYA 1HI1A 3GYGA 4MK9A 5T7LB 3BN4A 3KG4A 4ZS6A 1SH0A 3EDRB 1RT3B 2VBYA 5KFTA 4DQRA 4Y28C 1L3KA 3MDFA 4IQXA 3GPAA 3IG1B 2HIQA 4MIBA 1FA0A 4O4RA 4PABA 2WW4A 1KOHA 4O3SA 2HHUA 4RW7A 3BYPA 4Y2MA 1Q1KA 4C3MA 4DG1B 4C8ZA 1HFEL 2HRYA 4QBUA 3HSJA 2EC2A 4R5PA 4IFVB 1J5OB 4ILRA 3FFIB 3MFHA 2G0IA 2WAQD 2ZFHA 3T9NA 1QTNB 3BBCA 4R0JA 4Q0BB 4ZP9A 2QYGA 2DNRA 3HULA 1U26A 2R2UA 3Q2TC 1HD1A 4DU7A 4DF8A 2DGSA 1NJYA 2MQOA 3J7ZT 1IR1A 2JL9A 1EIYB 2OTLS 3NOCA 4WXWA 2DT9A 4NE9C 4OX9J 2QMXA 5ETTA 2AYBA 3N5FA 1RTHB 3FBFA 3AXMA 3MWBA 1P9YA 4LREA 3RB0A 2FVRA 4KGMA 5IQ6A 5EHHA 2R7SA 2V8VA 2ZBQA 3KLGA 1U1LA 2QMUB 2UZAA 1VK8A 1IQZA 5KG6A 1K9MT 4A47A 4WFAQ 1EP4B 2V4RA 2EEYA 2HPUA 3CIMA 5HSPA 4DV4F 4EBCA 1AZSB 1LWEB 4WTYA 3VF0B 4WKYA 1X0FA 3BR8A 1GFWB 1IXKA 2R3VA 3A4TA 3I0RA 5DRKA 3V6KA 5J2NA 5HLFA 2M8DB 5KFVA 5F3ZA 1T3NA 1PCAA 2QEXS 1G1XA 3G2XA 5GADI 2W2PP 4IFVA 1VBZA 5K5MA 2OO4A 4NEYA 3Q22A 1WG5A 4C8YA 2OPQB 2ABYA 3AA8A 4W90B 3FGVA 4G65A 1RT6A 5AE3A 3MGJA 4USUA 3T1YF 1RKIA 1RDRA 1RABB 2UUTA 1YBTA 4RU9A 2VPXB 1JLCA 2Y1LB 1HQUA 3C16B 2F1FA 4TYAA 5A6WA 4U7UK 4I6WA 2NPFA 2PA3A 2MEWA 3THPA 3TR5A 4C98A 2IVMA 1EARA 2IAJB 2P5VA 3DYAB 1Z2LA 3TJAA 3DNCA 2WB4A 5KFLA 4JBCA 3UDVA 1ZPWX 3VCDA 4X66J 4JI8F 3AOCA 4C8LA 4B3OB 2B9YA 3DU5A 1K8AT 2YKAA 3DOKB 2AKWB 3A3NB 3EVMA 4NA1A 4P75A 3BQ1A 2CQ3A 4ZHRA 3CMQA 1HR0J 4X4RA 4DL2A 1QVGR 2MKHA 2QYCA 3MMCA 2VASA 3NKYA 2Q1LA 1S1XA 2QO3A 3N6MA 4KV8B 4WE1A 3EPGA 5G4DA 1RT7A 1JNRB 4NCGA 2L08A 3FBEA 1F2HA 1HPZA 1YVFA 3OTBA 1JB0C 1IKYB 3QGPA 2IC3B 4KH0B 4WP3A 4XDDA 3UVJB 4CDIA 5JMNA 3CD6S 3G96A 1ZTTA 1SH2A 3JSRA 3QAEA 2ACMA 5E41A 1BMQB 2KT3A 2H5IB 2LXFA 4LRAA 1REGX 1W7WA 4N7TA 2MKSA 1DARA 4NLXA 2VC0A 5K8NA 4OYPA 5AXLA 5B0BA 2GO8A 5DG9A 4DSKA 3I56S 2KZZA 1XNQF 2ZC3A 3AJDA 3NGRA 3MPUB 1U1NA 3X1LB 5AJ3F 1KWMA 3M2UA 4QIFA 1E6VB 1S57A 2EK1A 4C2MA 1B0VA 1WHYA 2OPRA 3L3CA 5KFPA 3HHLA 3KDOA 2HFUA 4BC7A 1LNQA 1UMJA 3TRGA 2XYPB 3HPOA 4X64J 3D6TB 3H42A 1BQXA 2CQ2A 2OAUA 3F56A 1BWVA 4HLBA 1VQNS 5A8KA 1HNZF 2WZ1A 4K4UA 2BE2A 2Z2LA 2VG6B 4LBHA 4MIWA 4OX7A 4PZVA 4C0BA 1UWAA 2RB7A 2ZVIA 4HI2A 3ZZYA 2P8IA 1BQMB 1RI7A 3M2VA 3IG1A 1RBAA 4LF7J 4URQU 1W2BR 1IWGA 3C14B 1JLFA 2BJDA 4B3MF 1NSKL 4N77A 3OR1B 4X65J 3M8QA 3OHBA 2N4CA 1XR5A 1JKHA 1IKVB 1MROA 3BGLA 3BSOA 3KG1A 3KOAA 3MM8A 1U48A 4OZJA 3THVA 4H4KC 1VISA 5F8IA 4F02A 4GKKJ 2ZVSA 1CULB 5L1LA 2IFXA 4URGA 2LQ8A 2IVFB 2MZSA 1Q5VA 4CH1A 3TA2A 5KFJA 3SYZA 1SIZA 1IKXA 1GMWD 2MQNA 3IR7B 4USTA 1FVQA 2VKZG 4OI1A 4X4TA 3QRQA 3KJFB 5DGAA 2GJ2A 4MYTA 5K20B 1F1BB 4PG7A 5EGYA 2MKJA 3LP0A 4RUAA 3RU0A 2QC3A 1RUSA 2WRMA 4O4GB 5C24A 1O51A 4J9RA 2DY9A 3W7BA 4ZVTB 4ICLA 5JVHQ 1YG0A 2AEMA 2ASYA 1NK7A 5F9LA 4M5KA 2Z2ZA 3QT5A 4I7FB 1PAEX 2AX0A 3S01A 1TMJA 4DMZA 2Q43A 1HW9A 2KL8A 3WHIA 4LF4F 1SJ1A 3FZ2A 2VUGA 2FYXA 1YZ7A 3IR6B 4DR5F 4KHPJ 2NCKL 2KB2A 4LSZB 3MCOA 2NPIA 1QM9A 2G2OA 1H2TZ 4D3GA 2UUAJ 1RT1A 3POTA 2Z4PA 2DXEA 3R97A 2R2TA 3KHHA 4RZRA 1FRMA 1GQEA 4DV3F 1WOPA 2CVEA 2CAJA 3PX0A 4FNHA 3OTEA 4P2SA 5F8LA 4QU6A 2C3OA 3V6DB 2RRBA 4Y2KA 1ICEB 2QFJA 4JB8B 2KRRA 1TL1B 4EK2A 1DY3A 2P6SA 3BSNA 4UOFA 1VQ9S 1K0TA 1S1WA 1U1RA 3CGIA 2AGOA 3W8PA 3H5UA 5KFOA 5CAAA 1DRZA 5ETQA 2DKOB 2W4PA 3DOLA 4JI1J 4OLPA 4ATNA 2FVPA 2GAGC 4YN3B 5GMDA 4ED0A 5D8HB 2PMHA 2BE9B 2YQ0A 5T7LA 5KG5A 4HTIA 5B7WA 4FKXA 4EEYA 2YKMB 2E5LF 1Y5IB 3K5MA 2Q6BA 1DLOB 3AOBA 2H65B 3CVKA 5I3PA 5FLXY 5HO4A 1NH7A 2GMHA 1SC3B 3ET6A 5AE1A 5A2QY 1U45A 3BDEA 3B54A 4KIAA 4DFPA 1BHNA 1X0PA 1TL1A 3O3LA 2L3MA 1X5TA 4WU2A 4OX8A 5BR8J 1VQKS 1TV6A 2DNYA 3RRGA 2LKZA 3MEDB 5CCMA 1N32J 2CQ4A 1HBMA 1YJUA 7AT1B 1HHTP 2VOPA 2DGXA 3Q24A 2B4UA 2R7OA 1S79A 3C14A 2WTFA 5CD4A 3UW1A 4O4GA 1UVMA 1BQMA 2V6AA 3M2VB 2AHOB 2XBPA 4CLZA 1OYEA 5IT4A 2NYIA 2M9KA 3ETMA 3E8OA 3N79A 4Y2CA 1YGYA 5DG7A 2IDEA 2Q66A 2DY1A 2E1PA 4FYYB 3SFUA 2HQGA 3OSPA 3B82A 1FXLA 3GFHA 4Y6IA 5B08A 2FTRA 3M2RB 4ZLJA 3OT9A 5HBMB 3SIPB 3D0HE 3U1MA 3UDLA 1NKEA 2A6OA 3DLHA 3E51A 3GJQB 2J7KA 2W7PA 4C4WA 3DN9A 1LOUA 4N76A 1CJVA 1RHMB 4LVNP 3HHLB 4DOZA 2QLXA 3CT9A 2Y1RI 3IAM9 3BYRA 1FFGB 2K7KA 3ZZZA 3W9IA 1LFPA 1TKXB 2B0GA 4O3OA 1D9DA 1FESA 2DNQA 5L38A 3S6EA 5D3GA 1UZDA 3MR7A 4X4VA 1JLAB 3LP2A 3HVRA 2VQEJ 1VQ6S 5LSRA 2DXDA 2BZ2A 2IRUA 1RWXB 3M05A 4CP5A 1KRPA 4LRDA 1VBYA 2WHOA 5HQLA 2FJAB 3KKFA 4DLGA 4FF2A 5DLFA 2DHAA 2CQBA 1CJTB 1YSJA 2CQGA 2MLYA 2YKQA 3H59A 5C2GA 3OVSA 1R0AB 3AQPA 1QDUB 1N4LA 1I94J 2P9GA 3LAMA 1NO8A 5ETNA 3RRKA 1BXNA 2EWHA 3VV2B 2E5JA 2M70A 2VF3A 3WBZA 2EI5A 1RU1A 2EFVA 1F5CA 4FN5A 1FO1A 1N5SA 2MKCA 1Q53A 2RQ4A 3QATA 3DXBA 1UL3A 2BANB 3D1QA 3DLGA 2J76E 2J9EA 4J7CA 1TK5A 2VA2A 4NYOA 2AW0A 2F4VF 1C1BB 2BANA 3DLGB 1GXUA 2I0XA 2DCLA 3KDNA 5KFSA 1ZOTA 1VRUB 1JLBA 1YK9A 2K3KA 4HH0A 4UTGA 2W1BA 5D6GA 5F8MA 3NGDA 1TVRB 2OSRA 3KHLA 3DDKA 3TVYA 1ULRA 3BGUA 3U1NA 2YWWA 4OYBA 4K4VA 1PO6A 4B9TA 2VOOA 3ICLA 1NLKL 4RPFA 1T03A 2HFNA 4K59A 2AYMA 2YNFA 1Y5LB 3GE9A 4LUBA 5KFIA 5KFUA 4AE5A 2ALZA 4M5JA 1UFKA 5EN1A 1IJEB 2GV1A 2MY8A 3R9LA 3ADAC 2QLJB 4FS1A 1IBKF 4JI6J 2KH9A 4LF8F 4IUFA 2X1FA 1RISA 3JSYA 3R5DA 4FXVA 1MWZA 5GVQA 4ER8A 2LEBA 2ADBA 4DBQA 2RAQA 1YKWA 4L76A 4MJKA 3UI3A 1RT5B 4ZVEA 1OJ4A 2OEMA 1WEYA 4IFYA 2ASDA 1N5VA 2I38A 2DCUB 3JTPA 2XMKA 4DR2J 1G4CA 1RWUA 4N41A 1S0VA 1VQ8S 2GGPA 3DU6A 3GB0A 4ZHRB 4LJMA 1YJ7A 2KJWA 1TUGB 2BE7D 2RDIA 3H2LA 4M5DB 4AXIA 2CPEA 4N8NA 2BMBA 5T14A 3ZNJ1 1V3SA 2RDDA 4KO0A 4DX7A 4DFKA 2JEFA 5EUHA 1UA1A 2GFFA 3CDBA 4WFBQ 1XK8A 5K14A 2R7QA 5HVGA 3POTB 1FT8A 2Y0SD 4NWBA 2EFPA 4LRBA 2FVSA 4GKJJ 3UNGC 2FLLA 2E9ZA 2JHEA 5E7OB 3MECB 4Q2MA 4ZJQA 1YJTA 4HEA9 4JOUA 2AWZA 2FUG9 1S59A 4NLSA 2CJYB 2ZH6A 2WOMA 3IA0A 4CLYA 1RLCL 2XTJP 3OJUA 4F7VA 4WK1A 3TI0A 1PBUA 1VRTB 1WJ9A 2PA8D 2JH3A 1B0TA 2W9CB 1HR0F 2WVEA 4M5NA 4CLWA 1FRKA 2HS4A 3QLHB 4QR2A 5C25B 1WC4A 4EBDA 1JLAA 3LP2B 4BWJA 3NMRA 2RHQB 2D3O1 2LQBA 3WX8A 2M0GB 1GX6A 4LVOP 1EX8A 1A7GE 1YBUA 3Q8QB 3KLGB 2VKRA 2OJ3A 1LV5A 3I5BA 3KLEB 3QFWA 2L9NA 2N4DA 4U8VA 3ZZTA 4DSFA 1VK3A 2BVZA 2W4DA 3M8PB 4FYDA 1Y0HA 2DGVA 3GG0A 4QU7A 4ZPDA 2CADA 3I4HX 3PFOA 5HQ8A 3HD1A 2YY3A 3QSYB 1WTBA 4I7FA 3D9BA 2V50A 3E3XA 4WTOB 1YTYA 1NSPA 1NDPA 3IM8A 3A3OB 4CLPA 5J2PB 3HVTA 1U47A 1Y9OA 3QRRA 2E5IA 1P9QC 2V67A 2FJWA 2DNHA 3TYTA 1FXDA 2W4CA 3OXFA 3A13A 4DR4F 1VQYA 4KB7A 1N0VC 4DUYJ 1HIYA 1YZ6A 2LYVA 2DPJA 4USHA 1AROP 2K8GA 2POKA 4IG0B 2LA4A 1X7VA 2HNYB 2O3DA 4DS5A 4UUXA 4WFZA 4FF1A 3TUJC 2OI2A 4F0KA 4B08A 1JK9B 2JFDA 1K1SA 4DFMA 4R0EA 4UZCA 4X66F 3MD3A 4I0WA 4NXNJ 4YHHJ 4UQGA 4QYRA 2A1BA 2CPIA 3C3LA 3E2EA 4X62J 1HYSA 1NDLA 1KQSR 4LBPA 4RBTA 3AJ1A 4MFBA 4TLRA 3EE3A 5MLCV 2HHHJ 4I6AA 4LBIA 3H5YA 1RAHB 1UWBB 4X4QA 2Y9HA 3OFHA 4A48A 2CJKA 3P49B 2R7VA 3FQLA 4NI2B 2LECA 1OMSA 1TZ0A 1TAQA 1ZBTA 2I6WA 3MR2A 4AL7A 3FSXA 4CLSA 4RLEA 3CJ0A 1YRTA 4WCEQ 2WK4A 5EDWA 1SBRA 1R8PA 2DISA 4AFFA 2V9WA 2FPHX 4B3SF 5LXYA 3B4DA 4ZDNA 1RWMB 1UJ6A 2ZWOA 2H5JB 1S1UA 1OY8A 1QUVA 1WELA 3TWZA 4B02A 4YDDB 1M5OC 3PW0A 2LDIA 3DRRA 4WZMA 4AL5A 2W7AA 1J27A 5HJXA 3TAQA 1FDDA 2ZJPQ 5DM6Q 1XNQJ 4WP8A 1QSYA 4F04B 5D3GB 3MM9B 3SV4A 1HMVB 5KFDA 3GZ7A 4DX5A 1HPZB 3KUHA 2YKOA 1ZZNA 2L48A 4H4KA 3DMJA 1PJ6A 1RAJA 4MMOA 4RW6A 2RQCA 4AQYJ 4CH7A 2XS5A 1ZAXA 1FJCA 5F0UA 3DOMB 2BJ1A 4ED7A 1HQ2A 4USJC 1UTAA 2Q6CA 3W3SA 4RNHA 2IA0A 4U67Q 4U8YA 3UN2A 1HNZJ 3OTOJ 4DS4A 2B3TB 4ED5A 4OZLA 3HJFA 1GXLA 2HHQA 4RO0A 5J2QB 1WC0A 3CIZA 2AD9A 4HI1A 4WJBA 2RKIB 3PW2A 2BX6A 3BS9A 1N34J 4F0MA 1KVKA 1HQUB 4DCOB 3T41A 3UQSA 2CNLB 4FVCA 4LRFA 2V69A 5E3QA 2EW9A 4LR7A 5KG1A 4DFJA 5EWFA 1SI9A 4X65F 1RA6A 3VAHA 1D8ZA 1FWKA 3Q8SB 3W5YA 1U09A 5IC6B 1D1UA 4YQWA 3QJPA 1JLEA 3MTJA 4J37A 4ANEA 5KFRA 4J9OA 1S6PB 4IDKB 3FRZA 3PG9A 5G0RA 2CPFA 1U24A 4GKKF 1CVJA 4X4SA 2GIFA 4OJGA 2L41A 3FMWA 4M5DA 2G0JA 3CUNA 2VODA 1D9AA 4KGZB 2DITA 2YNGA 3R5CA 5D0GA 4HHUA 1N0UA 2IRYA 1DFDA 4DI6A 1WTFA 2GJFA 1AT1B 4YR2A 3JYTA 5H9EJ 2XM3A 3DKDA 3JAMY 2ZOFA 1S6UA 1Q86T 3EICA 4BCAA 2HZVA 1F3VA 4J90A 4BHQA 1EHWA 2I2YA 2KFYA 4NRTA 3MM7A 3RAQA 4ED6A 3EGVA 4CCHA 2HAFA 2DGUA 5FDLA 3UR3C 5D4NA 1TKZA 1NHUA 2E7WA 2MZTA 3QPIA 4L74A 2U2FA 4IOBA 4RUHA 3TZZA 3T5LA 2M88A 2DEJA 4ZP8A 5AXKA 1S7HA 3HDSA 2RS2A 1JJ2R 1I3OB 4CNYA 4DQSA 4LFCJ 4KPYA 2D69A 2B8QA 2B7CB 4UOCA 3FCHA 5SZTA 1LW0B 3BH7B 2ZH3A 4EMDA 4FNIA 4J5OA 2ZNZA 2HK3A 6FD1A 1VQ4S 4OZ0A 1JLGB 4WFXA 2EFQA 1D3WA 3D7SB 2PEHA 5KT4A 3QWPA 4DV3J 3KMQA 1VBKA 1EAYC 5IWAJ 3PHEA 4K5RA 3D66A 5JXSA 2XY6A 4JYAF 4DV5J 2IM0A 2NZCA 4OYOA 2MQQA 4F4YA 2HVHA 2HBYB 5DZ7A 4ZVRB 1VLYA 3WC2A 4KRWA 4DPUA 3TUIC 4DL7A 3MEGA 1KQFB 2MY7A 2R8HA 1LWEA 2W24A 3BZQA 4DUZJ 1N88A 1F0XA 4JI1F 1JJCB 2OUGA 1RAEB 1VQOS 2HNDA 3CJKA 4HYKA 4DR3F 2C2OB 2LEAA 3W9JA 1MMLA 1WOSA 2H51B 2B43A 2NSBA 4KC5A 4OZ1A 4YY3F 3MD1A 1RTJB 2NXEA 3EYZA 1HQEA 3C6TB 3EXCX 3EMTA 1VJWA 4HT5A 3DM2A 3IS9B 4OJ3A 2W8LA 1T02A 1RP5A 4D3HA 2DB1A 2UXCF 1UW4A 2XZTB 1UEUA 2OPSB 1D09B 2UV8G 3G87A 2K2PA 3M6WA 4Y00A 2Y3YA 5CH7B 1FWLA 4EI2A 5K8MA 5KG7A 1HD0A 2HVEA 5IZHA 4OQJA 1Q16B 3CJ3A 1T0TV 5DDQC 2ZJRQ 4I67A 3KK2B 4DV1F 1KDNA 1RGVA 1BY9A 2AIRB 2EG1A 3IXQA 1S1TA 3H2VE 1N32F 5HMYA 4CO5A 2FB0A 4QWDA 2Z2MA 3FNNA 5KFEA 1CLFA 2HRTA 2D3ZA 1GTHA 1VS3A 2BABA 4RW8A 4AXJA 1RKJA 1RT6B 4U7UD 3L7OA 1O0PA 3W63A 4A8KA 1Q79A 1VYAA 1S12A 3UO0A 2YWEA 4ZIWA 4GVBA 2NREA 2XULA 2Z8QA 4ELVA 1ZM4A 1CULA 4J9LA 1U2FA 2UUBF 1AUSL 3BQ2A 2Y1IA 2IJRA 1U1OA 4I68A 1S6PA 2COLA 1RBLA 2CQCA 4DN9A 2CG8A 2MZJA 3N01A 1EP4A 3I0SA 5KOWA 3EX7B 1W25A 2V2ZA 3M6UA 2E1CA 2J0XA 2GMLA 3HO1A 1RHJB 2B6AB 3KJNB 2IHR1 1KVIA 1WSVA 1JLFB 1RWOB 2HNYA 3O5TB 3HZGA 2DH7A 2NSCA 4IG0A 4F0HA 3D67A 2BW2A 2Z2YB 3DXSX 1CJUA 2PE8A 2ZUGA 4NMXA 2YWFA 2ASLA 3NEKA 2PI5A 4LF5F 3IO1A 1XN9A 2DXFA 2AJ0A 2PN6A 3RB3A 2ZNYA 3OFFA 5L9NA 4HACA 3NL0A 2GQCA 2WSFC 3EVWA 4Z7YA 4L3NA 4NLWA 3BQ0A 3GR0A 1KS2A 2VZ9A 3PEHA 2CZ9A 4YDXA 1FJEB 2E9RX 2KJVA 3PNIA 3KLFB 3G6YA 3DMJB 4TKTA 1RT3A 1VC0A 1K1QA 1F5AA 3G9CA 2RU3A 4A8WA 3FRYA 3C46A 3ZTSA 2F4VJ 2WSCC 3SCIE 2UVUA 1DAXA 5D4PA 3KLHA 3OBIA 1CJTA 3W1YC 1FD8A 3UR0A 1NBEB 1QLNA 4DX6A 3U27A 2ZBPA 1RQ0A 1HNXJ 2A10A 1OWXA 1VQLS 3EUNA 4ANDA 3FC9A 2BM0A 4GVBB 3ZFVA 1RYRA 1EZZB 4F3OA 2BYCA 5KTQA 1H2UX 4JI3F 5IM0B 1RWWB 2WONB 4C8NA 1HNWJ 4C8KA 3D3CJ 2GIRA 3AAWB 4KTQA 3C6UB 4JI5F 1RCXB 4TU7A 1NM2A 2MZ1A 4UZBA 2QZ8A 3I5AA 3TARA 2KYXA 1S1TB 3LP0B 4HDHA 1LXNA 1AYEA 3NWGA 5K14B 3RBZA 1U6ZA 2DNOA 1BLUA 1KQGB 1S5ZA 2HZCA 3DCAA 3I4PA 4OX9F 2W7OA 4DR2F 4CZCA 1RHRB 1IN0A 1X5PA 4QZVB 4FXDA 1KLMA 4URSA 2HAIA 5BYSA 4EGLA 1XMOJ 4NRUA 2QV6A 4PXEA 4HKQA 4CLTA 1VHFA 1S9GB 2IM2A 1VJQA 2YKPA 2B9WA 2GVDA 3EM1A 3PDNA 4L3KA 1RTIB 2FHMA 2HRUA 4YR3A 1EKSA 3OD2A 2CPZA 3SCJE 2OFHX 3JQKA 5HROB 1Y4ZB 2C28A 3LANA 3IN5A 4QWCA 3R6LB 2VDIA 5IT9Y 3G82B 4B17A 1KONA 2JRSA 4LIRA 4K4ZA 3DOLB 2J6TA 3VAGA 2HNZB 5IXUA 5HMZA 1HBNB 4I6YA 2ZE2A 1U7LA 2F40A 2V63A 4DR1F 1HWJA 1OQ6A 2GAHC 3MPYA 4PYAA 4EYIB 1T03B 4PWDB 2E7VA 4NLOA 4ECSA 4ZKAA 1TL4A 3NRBA 3EVOA 1BQNA 4PR6A 1CS4A 1N52B 2RE1A 2V2KA 4HT7A 4CO1A 4DCJB 1CJUB 5GAHU 3P5BP 4XDCA 3PIPQ 3P5TL 1R0BG 2M3DA 2ZD1B 3TEGA 5FLXU 5LMUJ 1C4CA 1OY9A 2JFKA 2ATLA 5F8JA 2YNIA 3CWJA 3T6BA 3MURP 3PY8A 1RTHA 3IBWA 3P4UB 4IR9A 3BKFA 3RRHA 2OGUA 3FMBA 4IH7A 5KFCA 3MR3A 4B9UA 2I8EA 4CTAA 4DV0F 1Y3JA 3GJTB 1IKWB 2VU5A 2JLGA 1IQTA 3KUEA 1HHSA 2HGLA 1U2CA 3QYYA 1T95A 1MG7A 3BGRA 2ZZTA 4QPXA 1WG1A 4WF9Q 3BSAA 4RW9A 2HFSA 2GIQA 4ERDA 2FZKB 3GIRA 4YS2A 1XMQJ 3LPEA 2DGTA 3CD7A 5KFNA 2V8HA 3GIMA 4DPXA 1PAUB 3NS6A 1TTHB 2ZHOA 3DRSB 3MPDA 3N9UC 2HYIB 3IFEA 3CCSS 2B8PA 3U02A 3QZ8A 5F9NA 4TN2A 2Y1JA 4JV5F 4OYAA 4C3KA 1FRHA 4S0MA 2OTJS 4ZVHA 4F4KA 3SDEB 2XY7A 2XHWA 3OR2B 3OSNA 2XYHB 2NZ4A 5AJ3J 2P9CA 4Z2XA 3QRPA 3JSBA 3G86A 3V81B 8ATCB 1N6QB 3TA1A 2DR5A 4Y3CA 2VPZB 3T6JA 2XB2D 1V3RA 2YKNA 1YI2S 4X62F 3UD3P 4JV2A 3OTDA 2QSWA 3NXZA 4X64F 3JSMB 3WX4A 1NK8A 2QE5A 3H5XA 1YBAA 2LQJA 5D0EA 3JTNA 4FZVA 1QSSA 1U4BA 2AYGA 2HHHF 1YRUA 3NBPB 4M8LA 5C24B 3C2PA 3M32A 2HNDB 4ZP6A 2QL7B 2ZKTA 3CJKB 2R7XA 2KXHA 2BM1A 3LGMA 5KT2A 4GO5X 1E6YB 4FPRA 2I5JA 2HWTA 3CO0P 5IV4A 1RZMA 4FS2A 2D41A 4ZVQB 2W9CA 1NKBA 1B7FA 4LF2A 2MZQA 2ZBRA 4B3MJ 1WDTA 1HWLA 2X1GA 3TZWA 4NXMF 1FRLA 2CJAA 4P7VA 4MK8A 5GAHI 1FJ7A 8AT1B 3MMBB 2N82B 3IWXA 3CC4S 2DO0A 3UWTA 2FGOA 3FQKA 4F4ZA 4A8YA 1SCJB 1DLOA 4UF4A 4CLLA 4CWBA 5I3QA 2BOAA 2BRLA 2NXNA 2W9BB 4B3TJ 3M8QB 3NGUA 3MPWA 1U02A 4AQYF 5F3TA 3LH2S 3AD9C 4HH1A 4KO0B 2QSFA 3K2YA 1MMNA 2F8EX 2UVWA 4L72B 2QRRA 1RK8A 4XO0A 1X4AA 2GW8A 3UCZP 2FZCB 3GTYX 3H90A 3ILOA 3VGVA 4IFYB 2DHXA 2IBKA 3OPKA 4YB5A 1FJGJ 2VDHA 2PMZD 1WKJA 1N34F 2VG5A 3K5PA 3HMJG 3CJQA 1YJNS 3OLBA 2MDAA 4RW7B 3J81U 1SB6A 4CM0A 2ZZNA 4OYIA 1VMBA 3CC2S 3HX9A 2R4FA 3B8HA 3MUTP 3OVBA 2E44A 1K44A 2CG4A 2VFVA 2YNFB 4LF4J 2GZOA 4KV8A 4QJVA 4WE1B 2CIMA 3W5ZA 2QN6B 1APSA 3M30A 4ZCLA 1T9TA 2LA6A 3W61A 4QOTA 2CNOB 2OLWA 3VAJA 3G6ES 3PM9A 4DSLA 2Y0BB 3ISZA 4H4MA 2MXYA 1Q4RA 4ZJLA 2UUAF 3QT7A 2DR9A 1VQPS 1SQFA 2F8HA 2ILZA 5ETPA 2CNNB 3HVWA 3PEJA 3W9HA 3MFIA 3KJVA 1J5EF 3IRXA 3PXGa 1MNEA 1VRUA 4OZNA 1WC3A 4O3NA 3MOJB 2CJBA 1S0OA 1S9EA 4ED4A 1C0TA 2AX1A 4KKOB 2QMWA 4RW4A 2HMIB 5F8NA 1DQ9A 4GC6A 4LF6J 2D9PA 4N56A 2HGMA 2GHWA 3R5BA 1TELA 1UZHA 4A8OA 2XCPA 4LSNA 1X9MA 1TUVA 2XWYA 4PG8A 5HJYA 1NZ8A 2OD4A 3J7A1 2RT3A 3K7RA 2P6TA 3HHNB 3NBPA 4Q8FA 4ITSA 4MKBA 5H1SV 3OL6A 1PSDA 1Q8BA 4EBEA 1QTMA 4TY8B 1VQ7S 2IIHA 3AXKA 3NOGA 1V5IB 5L1IA 2FVQA 2JEJA 4F8RA 2JZ5A 3H7HB 4LIWA 2M7SA 4L75A 3TAMA 2QA2A 2HQIA 2IAJA 3W64A 5KOXA 3C8YA 4PRFA 4C11B 2JLFA 3GMGA 2Y8YA 1H73A 3EGZA 1JLCB 1X8DA 1B64A 2RUSA 4HVZA 4CNZA 4DSJA 1ZA2B 5ETVA 5ETKA 1DTQA 5DQHA 3SSQA 1L3VA 1AW0A 1C1CA 1NH8A 2R8GA 3MI7X 2HQ3A 4DWIA 2ZH7A 5BR8F 3NG8A 1HW8A 1RYSA 2J0WA 3T5JA 1J2VA 3BBFA 4W4MA 2O5DA 2ZH1A 3H98A 3PTWA 3UFCX 1GK8A 4EO6A 5D4LA 1NK4A 2X7IA 4DG1A 1XR6A 4F67A 2AJ4A 3OXGA 3M6XA 5D15A 3J81Y 1U0HB 2BR0A 2VV5A 4YB7A 4BDPA 4IOAQ 1RBOB 5HAOA 3W2WA 3JAMU 5A8KB 4DZDA 5E3CA 4DUZF 3PX6A 1UA0A 3OFEA 2UVRA 4X4NA 1WKKA 4I2PB 4GC7A 2ROEA 2X1BA 2C42A 3CSKA 1C1BA 4FYWB 1S9EB 1UWBA 1X31C 1SC4B 1Q8KA 1ZM9A 3I5CA 1KKHA 4RWWA 4YY3J 2UV8A 5EWGA 3K0JA 3D3BJ 1Q8LA 1R8CA 3CCES 3T5KA 3G4SS 1YJWS 1KOOA 2GMJA 3BDPA 1VGYA 2NXCA 4ECUA 3ET6B 1L5UA 3KTQA 2G2ZA 3GIJA 1NK9A 4B9MA 1RACB 2XZWA 1HBUB 4X4OA 2OP5A 5CQGA 2R7TA 4KY3A 4NASA 1U2RA 1N5TA 4NYZA 3M30B 2B4OA 3BO4A 3DLKA 3VR1A 4Q7AA 5B0EA 1WUUA 4HL9A 1JJHA 4PPZA 4IR1A 3DGPA 3HCXA 3PW4A 3AOAA 1HNIA 2E29A 4CI0B 1KTVA 4LQ3A 2BQUA 2DGQA 3HFKA 4ZCIA 2FHKA 4FVMA 4ED1A 1S10A 1MWQA 4RNNA 2HVZA 1FF2A 3D28A 1SPBP 1TL5A 2AMCB 3D6FB 4CRJA 1K47A 4MK7A 1WHXA 3H40A 5LMNJ 1B7YB 3MMJA 4ECQA 1BD6A 3KMSA 3K57A 1IKXB 2VBWA 1N36F 2LCWA 1FK9B 2YX4A 5KG0A 5CABA 4ETXA 3N28A 2R2RA 2V94A 3ISNC 4FF4A 3ZO7A 5A8RB 1R6VA 4ZCMA 3JQMA 1T9VA 5LXRA 2V34A 2KM8B 2KM8C 1H7XA 5KFMA 1S4FA 2B56A 4PG4A 2FQQB 5KT6A 1WACA 5KG3A 2E5HA 1HWKA 2R9LA 2NS1B 4LR9A 1HA1A 1PJ5A 4ZVGA 4OFZA 3VGUA 3EWGA 2MLXA 2LU1A 1NPKA 5FD1A 3GG1A 2VQFJ 1SQEA 4K8RA 2GX8A 4I1TA 3PR4A 4IOCQ 3MM6A 4LF5J 1XNRF 2HZAA 1JQGA 1WG4A 1RHQB 2HBQB 1VRTA 1UKUA 3AB4B 3HKZD 3MCMA 1S6QB 1F5BA 2G0CA 1I1GA 1DTTB 2ZOGA 4ZK7M 3KK3A 1S0MA 4R8UB 4CYUB 4ZITA 3D54A 5ITHA 4B9SA 2JVOA 3PX4A 3CD5A 3MM5B 4FPIA 1IM6A 2W2QP 4ICLB 4QCLA 3I0RB 5J2NB 2HLUA 3R5JB 4KH1B 4ZP7A 5LSOA 2H4YB 5JVGQ 1K0VA 2XMWA 3PYDA 3VWSA 4DV6F 3QFHA 4NL5A 2FJBB 2JSXA 2RF2B 2HVIA 2YBVA 3EZ5A 3CEDA 2F3JA 3AT1B 4DV2F 1UCNA 1WNEA 5E3RA 1T8EA 3OL9A 1S48A 5DGBA 1KP6A 2Z30B 3DRXA 3HHKA 3JTOA 3KWMA 1GX5A 1NB7A 2DRDA 2XNRA 1PGZA 3FZBA 1S72S 1C2PA 2R8IA 1HNXF 4EUVA 5FDLB 3GQCA 1D9FA 1JLQB 1SV5B 4WYWA 3TJ9A 3ZTPA 3R2DJ 1FJGF 5J1NA 2IM3A 3Q86A 1OSDA 1TFWA 1VC6A 1GNKA 1GAOA 4DLEA 1N36J 1IVZA 4M5LA 4OV6A 4K4YA 2YQ3A 3J7YU 1SKRA 4JI3J 3M4XA 1F9FA 2B4VA 1IBCB 3CJRA 3DGPB 3LALA 4PXCA 1S77D 2C3UA 4JI5J 1FXRA 4P2MA 4Q45A 5FJ4A 3D4JA 3O1LA 4F4XA 1Q5YA 2ASJA 2AGPA 4L73A 2V2VA 2VBXA 3NY0A 3VZHA 1TV6B 2GJIA 3OFGA 3TA0A 4CT9A 1NXIA 2YX7A 3SQOP 4E98A 3HFZB 3S7RA 3P96A 5ETRA 2V4QA 1IBLF 3P6YC 2HQDA 4Y65A 2DEIA 4R25A 4MFBB 4QIVA 3PVXA 1X9WA 3TP2A 4V19X 4ZOSA 2WW8A 3TQ1A 1R6YA 4IDKA 4RX6A 5E3PA 3OL8A 4NLRA 4KBIA 1GMWA 1VR6A 2E66A 1FEEA 2YQ1A 3KG0A 4OLOA 2W2MP 5HATA 3DI6B 1M5HA 2YTCA 4OJHA 3CCWA 2KTQA 4AD6A 1MSWD 2BJ9A 3DLLQ 2QL9B 2A6MA 4GVLA 4K0KF 3UCGA 5I4MA 2OPQA 3C66A 2VJUA 2RF2A 3SCLE 1JWWA 2F9JA 1VLOA 1BQNB 4ZLNA 4DR1J 3CDWA 5J2QA 2XS7A 1EETB 1NU4A 2W25A 3VGSA 1HL6A 4DUYF 4OZ5A 1T9WA 2F7VA 4YFUA 4M94A 1HBOA 2DNNA 3M1VA 3MMAB 3FDSA 5GMEA 5J2PA 1DTTA 3KK3B 1I5OB 4UUWA 2D9OA 3QGIA 2AEJA 5B0FA 3LWMA 2ZJQQ 2HNZA 4F25A 5K8PA 4ZA1A 2GVZB 3MM6B 2XO7A 4ECRA 4G3IA 3G82A 5E2QA 3A8JA 2HQCA 4H4OA 4YHHF 5DO2A 1FHTA 1UETA 2CXEA 2EVZA 3Q83A 4DF4A 1SKWA 4PQAA 4RJVA 3P3DA 1EB0A 3SQGA 2VHGA 3MHYA 2EKNA 3TVZA 3K17A
chains in the Genus database with same CATH topology
1KP6A 4GVBA 4GVBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KP6 A;  4GVB A;  4GVB B; 
#chains in the Genus database with same CATH topology
 3IP0 A;  4K4S A;  2B7B B;  2RVJ A;  2FLN A;  4A4J A;  2LXI A;  1S99 A;  2PFD A;  3K58 A;  2EK6 A;  2E1R A;  1KR4 A;  1KTQ A;  1YQH A;  2P9E A;  3SSS A;  4LFA F;  3RB6 A;  1P27 B;  1REV B;  4NZ0 A;  3LTO A;  4OIX A;  4LF1 A;  4O0N A;  3UNY A;  3WIU A;  3GCW P;  3GFY A;  5GAE I;  3PKM A;  5THW A;  3G71 S;  4XPC A;  2PSZ A;  2MJU A;  1MN7 A;  2NYH A;  4USW A;  5CYM A;  3VTI A;  4E8U A;  2BKP A;  2WON A;  3VQS A;  3VAF A;  1B70 B;  4NI2 A;  2KHD A;  2FY8 A;  1G2E A;  1PC5 A;  1HHQ A;  2MYF A;  2PMW A;  3GCX P;  2F63 A;  4XTT A;  4YEA A;  5A8W B;  1ROF A;  2GO9 A;  1U0S A;  2MKI A;  4DHV A;  1UVL A;  2DH8 A;  3N5B A;  5B09 A;  2OPR B;  5C42 B;  2XS2 A;  3HHD A;  2K06 A;  2RML A;  5HLF B;  1U6B A;  3AA9 A;  2MGZ A;  4QYZ K;  1WC1 A;  1AA1 B;  1DJ0 A;  4N5S A;  3RW7 A;  1PKU A;  4JI0 F;  5L9X A;  2KT2 A;  1IJF B;  5KT7 A;  3C19 A;  1QE1 B;  1TL3 B;  2DHH A;  5CYQ B;  2DNK A;  3L95 X;  1YHQ S;  3CO9 A;  2HQF A;  2KXF A;  2RUG A;  4XK8 C;  4ZLP A;  2UU9 J;  3IAS 9;  2KN4 A;  2MJN A;  3TO8 A;  2ZH5 A;  4F2R A;  4B3R F;  4CO3 A;  2UXB J;  1U1P A;  3S1T A;  3HFV A;  3AQO A;  2XMV A;  2BW7 A;  2VPY B;  4OI2 A;  4DSI A;  3MR5 A;  2OHD A;  2KFN A;  3HSZ A;  1DUR A;  3ETO A;  3W5X A;  1S4E A;  2I9S A;  3HHE A;  3GYX B;  1S9F A;  3QO9 B;  3ENW A;  2N3O A;  3F73 A;  1LK7 A;  1MN9 A;  2EXU A;  1XBW A;  3R2C J;  5GMK a;  3CPW R;  2W01 A;  5EX3 A;  5HAN A;  2ROG A;  2B9E A;  5L1J A;  3VQT A;  1T94 A;  2C3Y A;  4NXM J;  1N33 J;  2XYG B;  1QAJ A;  3MMC B;  4IKA A;  2UXD F;  1I6J A;  3EZO A;  3BN7 A;  1VQM S;  3WDO A;  3DFE A;  1HBU A;  2CUY A;  2CQ1 A;  4WZQ A;  4CQ1 A;  1HQE B;  1DBD A;  2Q3P A;  5DLG A;  4M63 A;  3GU0 A;  4NLP A;  4K50 A;  5HK4 A;  4NX9 A;  1S49 A;  5ADZ A;  3J7A N;  2GS8 A;  1DTQ B;  1Z2Z A;  3F0N A;  4USI A;  1FNX H;  1MLA A;  2LXU A;  3QLH A;  4I2P A;  4MH8 A;  4HDG A;  4TNO A;  2C2E A;  3MM5 A;  5B0A A;  1HNV A;  3DRY A;  2IJN A;  4DEZ A;  3N6N A;  1JX4 A;  1FKP B;  4DU8 A;  4PUO B;  1S6Q A;  2WVF A;  3A8I A;  1VIX A;  2OPP B;  2ZH8 A;  2HHW A;  2FVC A;  3LUY A;  3VAI A;  3EGW B;  2ZWP A;  3TOQ A;  3J81 j;  4A8Q A;  1W2I A;  2RIJ A;  2AV5 A;  5H9F J;  3Q0A A;  3A8E A;  1SJ3 P;  3SSR A;  4ECX A;  1B0P A;  5H9F K;  3G8S A;  2IC3 A;  2YVS A;  1G6B A;  2A2C A;  2BA9 A;  3FK4 A;  2CWX A;  3GSD A;  3MAH A;  1TKX A;  1XER A;  2VG7 B;  5JJB A;  2IBO A;  3OVA A;  1X9S A;  1KN6 A;  3CB4 A;  1CJK A;  2F8M A;  3Q89 A;  1C0T B;  4EWT A;  2GC8 A;  3WC0 A;  4BC9 A;  4LFC F;  1AFJ A;  1QAX A;  3M8Z A;  4I4B A;  1MMD A;  2NUH A;  2OPS A;  4P73 A;  4K4T A;  4DSE A;  2HWH A;  4UT4 A;  1WOR A;  1TQL A;  3ZC4 A;  3AH6 A;  3KLI A;  2DO4 A;  1S1U B;  2DNZ A;  2MHN A;  3DLJ A;  1FFS B;  4FDF A;  4ZVS B;  2CPH A;  3PYG A;  4Y2I A;  5BXI A;  4JYA J;  3BEG B;  2DRA A;  1G7C B;  4DR7 F;  1JIH A;  5KFB A;  1A6L A;  4ID5 A;  4CO2 A;  2IDL A;  2NXU A;  2R7U A;  2YPZ A;  3OXL A;  3LAK A;  2QLB B;  3A1Y G;  1FKO B;  1CQM A;  3DLE A;  4WII A;  1L3S A;  1H72 C;  1FTC A;  3CE8 A;  2JWN A;  3NCQ A;  5HVF A;  2AGQ A;  2H48 B;  3L4B C;  2X3G A;  1B4S A;  4RNO A;  3IRW P;  2BBE A;  2L9D A;  3NLC A;  3ITH B;  3QID A;  4PWW A;  1TK0 A;  2R8J A;  5C2C A;  3T1H J;  2BJ3 A;  2J9D E;  1QAI A;  1UEK A;  2CWK A;  3KK1 B;  3CNQ P;  5KFK A;  1S1V A;  1NME B;  2MGZ B;  2A18 A;  3K89 A;  3AD7 C;  2RSQ A;  1D8Y A;  1HAR A;  2HBZ B;  2M5Y A;  3ZZP A;  1OYD A;  2BAC A;  5KFW A;  2MHE A;  1ZTW A;  1CQN A;  3HSG A;  3NNA A;  5LJ5 Y;  2XNQ A;  3FEY B;  4QR1 A;  2UXC J;  3L09 A;  2JLE A;  1HI0 P;  2J6U A;  3L7P A;  4HHH A;  1X60 A;  1ZH5 A;  3MZI A;  2WB1 D;  2IMO A;  2KKH A;  5HQM A;  4ELT A;  3Q8R B;  2LVW A;  2J8S A;  1FEH A;  5GAD U;  2MSS A;  2ZIT A;  3HJV A;  3RBE A;  4UY8 T;  3MAA B;  1VIO A;  3WZ0 A;  3S8S A;  3SI8 A;  2VG5 B;  4DDF A;  4O44 A;  2E1A A;  2V0N A;  2XEX A;  1V9O A;  4RKU C;  3VVT A;  1TP7 A;  3BM7 A;  5M2P A;  1TL7 B;  5L46 A;  2KG1 A;  3ZZU A;  3QO9 A;  3D0G E;  1NZA A;  1U8W A;  3IBC B;  4P10 A;  1VBX A;  4M5G A;  2KVQ E;  1Z1Z A;  3L7U A;  4TXS A;  1HLW A;  3SV3 A;  1RXO B;  5I42 B;  1NJW A;  3AB2 B;  3C15 B;  3R7N B;  4O3P A;  5DQG A;  3R5G A;  1DQA A;  1RJJ A;  1Z4U A;  2RNE A;  2RU9 A;  2VH7 A;  2GQ2 A;  1UFL A;  3ISN D;  3NWR A;  4EFA C;  5L39 A;  3PW7 A;  2C2M B;  3GLJ A;  3M32 B;  4B9V A;  3B78 A;  1IUJ A;  3RJM B;  3PJX A;  3U1L A;  1RWK B;  2X51 A;  1IWA A;  2VFR A;  4HHJ A;  4PAA A;  3I9Z A;  2ADC A;  4EZ6 A;  3QIP A;  1ZAW A;  1WF0 A;  5ETO A;  2YPY A;  2VIH A;  3TAN A;  3RR8 A;  2CQH A;  4NEZ A;  4G6V B;  4IG3 A;  4M5H A;  3HK2 A;  3I96 A;  3SXL A;  3WQP A;  1N6Q A;  1F6T A;  1T3O A;  1S76 D;  1WHV A;  4ECY A;  2ZKU A;  2RQM A;  1XQI A;  1LWF B;  2O1P A;  4B9L A;  5KAK A;  3NS7 B;  3CD0 A;  3GV8 B;  2HHV A;  2DJW A;  3OUY B;  1LEO A;  2XLJ A;  4OX6 A;  4U95 A;  3I32 A;  4QIE A;  5F8H A;  1LW2 B;  1TU0 B;  5A2Q U;  5LMN F;  2ERR A;  4HTJ A;  4NLT A;  4WBF A;  2APO A;  2ZM6 F;  4J9Q A;  2FLP A;  3CJS A;  4JI4 F;  3NMA A;  4A46 A;  4LFB J;  3UPF A;  2KI2 A;  1KEK A;  5IOL A;  1RHU B;  2PFF B;  1QE1 A;  1TL3 A;  2UUW A;  3CJ8 A;  2YKN B;  5CYQ A;  3VGT A;  4ED8 A;  4QWB A;  5HVH A;  1XR7 A;  1WDD A;  3DRP A;  3I9V 9;  5D4O A;  1ZA1 B;  2H4W B;  3DOM A;  4G1Q A;  1TKZ B;  4RW9 B;  2KT5 A;  2MQM A;  4J9N A;  4U9R A;  1U1K A;  2J6S A;  1CPZ A;  1YIT S;  3EZU A;  2KG0 A;  3V6J A;  2PT0 A;  4PG5 A;  1X4D A;  2BRK A;  2MZR A;  3RBD A;  1M5V C;  3T1A A;  2Z0G A;  2JC1 A;  3DRS A;  1O5J A;  4RL1 A;  3JYT B;  3KNG A;  1XNR J;  3VAK A;  1WHW A;  4PYD A;  3V6H A;  2UUC J;  4K7Q A;  5GAE U;  3EPI A;  1HNW F;  1LWC B;  4DJB A;  2W9A A;  4M5I A;  4ILM A;  4PCQ A;  3CDA A;  3RAM A;  2O67 A;  1LWC A;  2AZ3 A;  4CIO A;  2EKY A;  4DR4 J;  1EQM A;  3ULH A;  1LKZ A;  1OY6 A;  4OV1 A;  1RTD B;  1IR0 A;  1RLD A;  2V68 A;  2QTW A;  2ZE2 B;  5KFF A;  1NPP A;  2AP6 A;  4K4X A;  3R1H A;  2J0S D;  4ZPC A;  3RZA A;  5CA5 A;  5M2U A;  4TU9 A;  1RAA B;  3R6G B;  1XMO F;  2GQQ A;  1SXL A;  4E2F B;  4AL6 A;  2ZH2 A;  2P2C B;  1X4E A;  1FCA A;  1VI7 A;  2BJE A;  3NAH A;  4BWM A;  3NGK A;  4ES2 A;  1IBM F;  1RB0 A;  3HHL C;  2SXL A;  3O8W A;  4NYP A;  1TAU A;  4R8U A;  2IMW P;  1XC9 A;  1SJF A;  4NLV A;  5D0H A;  4ZVU B;  1NRK A;  2QLF B;  1KLM B;  1CS4 B;  2CNK B;  1NDC A;  2FHJ D;  3SEO A;  3HT3 A;  1SJ4 P;  2J5A A;  3FBB A;  4TY8 A;  3QJL A;  1RWN B;  1FE4 A;  2PII A;  3GV5 B;  2Z57 B;  5KFG A;  1ELO A;  3RAX A;  1URR A;  1E6Y A;  3MAA A;  3MM7 B;  4EO8 A;  2HEK A;  2ROP A;  5MAO A;  1HBN A;  2J7W A;  3AD8 C;  1KC8 T;  3CTR A;  3M9M B;  2WCX A;  2LDY A;  4PXB A;  5GAG I;  2C2D A;  1X4C A;  3ZZO A;  2OEJ A;  2YXL A;  3CJT A;  3KK2 A;  3ONQ A;  4RW6 B;  4CM2 A;  3T3F A;  3CME S;  4Y2A A;  1CBK A;  1JLQ A;  5LMU F;  2PD1 A;  3KLI B;  1L3U A;  4OHW A;  2OPP A;  4C48 A;  4KGK A;  4NA2 A;  1FX2 A;  1MWY A;  1Y5N B;  2QLW A;  4U7C A;  1SKS A;  1AB8 A;  2J7U A;  1FKP A;  3WIV A;  1IBL J;  2E7X A;  3FSY A;  4KQZ A;  1C0U A;  3CCM S;  1RWV B;  1V6H A;  5HBM A;  3O44 A;  4DV0 J;  1NKC A;  2RD5 C;  3DOK A;  1FDN A;  1KBR A;  3W2V A;  1NHK L;  1RE1 B;  1UPP A;  3O6Q A;  4Q44 A;  3GII A;  2F4F A;  1ZAV A;  2ZEJ A;  2HBR B;  2XSF A;  1IKV A;  2YH0 A;  5CZX A;  4LQ9 A;  3CXC R;  4BS2 A;  1SJR A;  4IRK A;  3GIL A;  3V5R A;  3ITH A;  2UU9 F;  4LF9 F;  3LO3 A;  1XMQ F;  1RHK B;  1X4B A;  5E33 A;  1RCO B;  5J1P A;  5AXN A;  3SZ2 A;  3SBM A;  5HP1 B;  1NK5 A;  2ZDO A;  3C16 A;  6AT1 B;  1T05 B;  2C2N A;  3DLE B;  4K0K J;  5IT0 A;  1YWX A;  4OHX A;  2HMI A;  2ATC B;  5ETS A;  3I31 A;  3CCR S;  2O66 A;  5DZ6 A;  4O3Q A;  4KKO A;  3MED A;  5BYQ A;  1KSP A;  3GV7 B;  1TFY A;  3D0I E;  4M5M A;  3SFG A;  2IVY A;  3QZ7 A;  1V3Z A;  3LWL A;  3NAI A;  3T1Y J;  4KPC A;  3H0P A;  1K73 T;  4JV5 J;  2DNM A;  1UFW A;  1TL7 A;  5I3U A;  4OHZ A;  3B6B A;  4I69 A;  3HM9 A;  4FF3 A;  2CJ9 A;  2M52 A;  2F9D A;  3IWL A;  3RW6 A;  4ZVP B;  4NPO A;  2AEF A;  2LU2 A;  5E3A A;  3R7S B;  5HMX A;  2BJ8 A;  4IH5 A;  2NUU G;  4K5S A;  1VOM A;  3GFZ A;  4WFY A;  4AUK A;  1ZYQ A;  1F9E B;  3KLH B;  1H38 A;  4YP3 A;  2QGF B;  4PWU A;  5CHC B;  3BGO P;  3GON A;  5DDP C;  5KFY A;  2FIU A;  3BPD A;  4JI2 F;  3ZZ0 A;  3OL7 A;  3W2W B;  3Q2S C;  3V4I A;  3PV8 A;  5DG8 A;  1AUD A;  5F0W A;  3VAL A;  3HHL D;  3I0S B;  1TUW A;  2HSE B;  2LP4 A;  2N7C A;  3G8T A;  1NCL A;  3CCZ A;  4WU3 A;  4ZPA A;  4DPW A;  2QX0 A;  1HWI A;  1X5S A;  2RIL A;  2J0Q D;  4LFA J;  3NNH A;  2LQ5 A;  4ECT A;  1S1V B;  4RBV A;  3GJS B;  4F2S A;  4O0I A;  2AF6 A;  3PRV A;  5A8W A;  5HMW A;  3BO3 A;  1AFI A;  2ZC4 A;  1GEH A;  1VQS A;  5D78 A;  4I2Q B;  1LWF A;  3PFE A;  4NZ7 A;  5J1E A;  3J80 Y;  3K5L A;  4W92 B;  2IYG A;  3Q8Y A;  1RT7 B;  4NCG B;  3NGT A;  3FBC A;  3VVU A;  1OSC A;  1T11 A;  4PPD A;  3MAQ A;  2R42 A;  4M95 A;  2QG9 B;  3N4W A;  1R7I A;  4WK3 A;  4Z37 A;  1S0N A;  4ID5 B;  1H74 A;  4FBT A;  4DQI A;  4MKY A;  3BSC A;  4OZ3 A;  3L9Z A;  3DHX A;  2CPD A;  5LL6 d;  3BB5 A;  2B9X A;  4XAK A;  4F3M A;  3QGG A;  2OKQ A;  3T19 A;  1RAG B;  2CQD A;  1R8H A;  1EKR A;  4B3T F;  3R7B B;  1DHM A;  2XO6 A;  1UW9 A;  1HKA A;  2H1Y A;  5K8O A;  1C0U B;  1BGX T;  2C3M A;  1DQ8 A;  2A0F B;  1FD2 A;  3KYL A;  1QUP A;  3H4B A;  4JV0 A;  3OUY A;  5KFX A;  2X1A A;  1Q0N A;  2HG4 A;  4J9V A;  2BXJ A;  3LA0 A;  2QA4 G;  2B5J B;  2EBE A;  4FKY A;  3H25 A;  2G1H A;  4TVA B;  3B4M A;  3H8Y A;  2KVI A;  2ZH9 A;  4LF9 J;  4OYW A;  3OLA A;  1LFW A;  5ETM A;  1B3T A;  1XEZ A;  5AT1 B;  2PI4 A;  3GWC A;  1Y3K A;  3MEC A;  3X3U A;  2R8K A;  4OZ2 A;  2PO4 A;  1FRI A;  4Q43 A;  3KXD A;  4J9S A;  1R0A A;  4ILL A;  5SUH A;  3CJ4 A;  4CLF A;  3FUY A;  2BQR A;  4QW9 A;  3DDI A;  2XMJ A;  4P2F A;  5AXM A;  4IG3 B;  1EQ0 A;  2DNG A;  1FNO A;  3HZE A;  3DDN A;  2IM1 A;  3G8Q A;  4QIG A;  1CG2 A;  1PYT A;  3A3P B;  3HVT B;  1N33 F;  1TKT B;  1M5K C;  1HI8 A;  5L8R C;  2JEG A;  1JMT A;  3AHP A;  2RS8 A;  2HKE A;  4LSL A;  2MQL A;  3A12 A;  3TEH B;  3GFX A;  7FDR A;  5K9F A;  4DV7 J;  1FK9 A;  1HNV B;  2Z58 B;  3GJR B;  4AYB D;  1A9N B;  1PIE A;  3UCU P;  2FY1 A;  3V2U C;  2DR6 A;  4FYX B;  3PO5 A;  3QGH A;  1G3O A;  3LQV A;  4DPT A;  3HSD A;  1J5E J;  3DC2 A;  1JKH B;  1MRO B;  4C9D A;  1WEX A;  2VD3 A;  2D1C A;  2VFT A;  3IM9 A;  5HL7 Q;  5JUM A;  1XWL A;  2W8K A;  3W62 A;  1Q7L B;  3JB9 k;  1CEZ A;  1XIQ A;  2DNP A;  2VC1 A;  1DZ5 A;  3IWN C;  4UW2 A;  3T5H A;  2XLK A;  4KT0 C;  4USK A;  4DX8 H;  3RTV A;  3DLK B;  4RU2 A;  1FDB A;  3FEX B;  1R3N A;  3MUV P;  4LF6 F;  1TMM A;  1YLX A;  1REV A;  4FXW A;  1RT2 B;  3E01 B;  3J80 U;  2PDA A;  1RU2 A;  1FER A;  4ZVF A;  3O2I A;  4IH6 A;  1PJ7 A;  1Y10 A;  2G9O A;  2OSQ A;  3RGI A;  3VZI A;  2HK2 A;  4P72 A;  3IC1 A;  3CMA S;  3EGN A;  3M8W A;  1SL0 A;  3QT6 A;  1YJR A;  1UAW A;  2WVB A;  3UN5 A;  3PIO Q;  5A76 A;  3HXM A;  1RT1 B;  3H20 A;  4J9K A;  1RAI B;  2LEP A;  4H54 A;  4KJI A;  2K7J A;  5EX0 A;  4LMZ A;  2H54 B;  2FD2 A;  4OMF G;  4DQQ A;  2OMO A;  3ILJ A;  2CDR B;  1BUX A;  2OEK A;  1PIL A;  2YNI B;  1E6V A;  4G1P A;  2HHP A;  1Y00 A;  2V8G A;  4NML A;  2V4J A;  3D5M A;  3RG6 A;  4Z7C A;  2MLZ A;  2ZBI A;  5C7P A;  3Q8P B;  2ZHA A;  4N47 A;  1U1Q A;  2GHP A;  3IBF B;  3N6L A;  3NS5 A;  3PYF A;  1WI8 A;  2JVR A;  2CQ0 A;  9RUB A;  3PAC A;  3BO2 A;  4JI7 F;  3KNA A;  3W65 A;  1WKL A;  2QIF A;  1FKO A;  4DR7 J;  3BRE A;  1RT5 A;  3FVY A;  3HT0 A;  4NLQ A;  3KUG A;  1H3D A;  1T05 A;  4F36 A;  5IFM A;  3CJ5 A;  4OJ1 A;  2EBG A;  2C2R A;  2OH2 A;  4AT1 B;  7FD1 A;  3UD5 A;  3OTC A;  3W66 A;  4TQR A;  3J7Y I;  4C6A A;  2IY5 B;  4DL0 C;  4DXL A;  1U1M A;  3M9N B;  2QA1 A;  4MT1 A;  3PO4 A;  2C2Z B;  5CYM B;  4ID8 A;  2B5J A;  3W2V B;  2XHC A;  4CYU A;  4NA3 A;  4C0H A;  9ATC B;  2VFU A;  1ZM2 A;  2ACY A;  2F5G A;  3ZTO A;  1Y7P A;  2XLI A;  3T1H F;  4MYU A;  4C7Q A;  1FFW B;  2YNG B;  4K4W A;  4F4A A;  4DL5 A;  4MAK A;  3KHG A;  1WC6 A;  3IMQ J;  3PRD A;  2GA7 A;  4WXO A;  3MM8 B;  2YH1 A;  2VG7 A;  1RTJ A;  3NGS A;  2E5L J;  4GMK A;  5IC4 B;  2FJX A;  1MW7 A;  1S7I A;  4EZ9 A;  1T9X A;  3QAU A;  4JV1 A;  2NXJ A;  4PKD B;  3MEE B;  3KHR A;  1JLE B;  1H2V Z;  1F3F A;  4UOG A;  1T9U A;  4H4O B;  1FDA A;  4X4P A;  2GHV C;  3R3T A;  1FTR A;  5IM0 A;  1WF2 A;  4UOH A;  3MMB A;  5I42 A;  4IRC A;  3SMZ A;  3UDC A;  4RNM A;  4DR6 F;  1BC6 A;  4DPO A;  1N8R T;  4TYB A;  4XPE A;  2V9K A;  3TUZ C;  1NAQ A;  2R7R A;  4PUO A;  4ZN3 A;  4DPY A;  2IYI A;  2ZH4 A;  1GT8 A;  4ECZ A;  2IJF A;  2MTL A;  1SKU B;  2BQ3 A;  3UD4 P;  1U49 A;  1JLG A;  1JXV A;  1F2G A;  1NJI T;  2KO1 A;  2IPO B;  3G6V A;  4OI3 A;  1EJ7 L;  1FKA F;  3CCU S;  3RYL A;  1S97 A;  3H5S A;  4TLQ A;  1GH8 A;  1O6X A;  2BJ7 A;  4MKV A;  3M7V A;  3LF0 A;  5A8R A;  1BE4 A;  3FCW A;  1B99 A;  1X4G A;  2I1R A;  3LGH A;  5KG2 A;  3Q8V A;  2GNK A;  1HWU A;  1OPZ A;  2V8D A;  2WBR A;  3M2R A;  4DQP A;  1S6O A;  3NP5 A;  4QQB A;  1QVF R;  1X4F A;  2FZG B;  2CDQ A;  1LW2 A;  4LRC A;  1WOO A;  1YJV A;  2AJ1 A;  2W2O P;  1WSR A;  3I6P A;  3N0V A;  3HF5 A;  2VQF F;  3TAP A;  3HKW A;  2AU0 A;  4I56 A;  2DK2 A;  2VQE F;  1PG5 B;  1UVN A;  1BWE A;  2EFN A;  1IKY A;  2RHS B;  3CW2 C;  2N3L A;  3UVJ A;  3ZTR A;  2YNH B;  2MB0 B;  4ZMM A;  2KU7 A;  5HI7 A;  4KGX B;  2BEF A;  1ZPV A;  4G1I A;  2QT7 A;  2JDJ A;  4G1Q B;  1U0H A;  2HHT A;  5HP1 A;  4CO4 A;  1I94 F;  5ETL A;  2HFZ A;  3V81 A;  4DV6 J;  2ZM6 J;  4C8O A;  3EJM A;  4P6Q A;  2MKK A;  1Q82 T;  3PJW A;  4P2X A;  3CCJ S;  2XMM A;  1UVK A;  4C3L A;  4TQS A;  4DV2 J;  2V5H G;  3QJJ A;  2BUN A;  3IGN A;  3BGR B;  3I82 A;  5LM7 E;  4YME A;  1FI4 A;  3GP9 A;  1U6F A;  1SJQ A;  1C1C B;  4O3R A;  4EU0 A;  4ECW A;  3OHA A;  3PHT A;  3OW2 R;  1VFJ A;  1Q81 T;  2F65 A;  1FNM A;  1ACM B;  1I51 B;  1NSA A;  3V4M A;  1GMU A;  4DL6 A;  2VON A;  1CC8 A;  1UEV A;  1KFS A;  4F50 A;  2J8A A;  2BKO A;  2X3D A;  4OHV A;  1UP1 A;  5B0C A;  1FX4 A;  2ILY A;  2RKI A;  3IGV A;  3W8G A;  3K59 A;  2JEI A;  4ALZ A;  5DDR C;  1R0C B;  4CT8 A;  1PBA A;  5M2R A;  2HFO A;  3MF5 A;  2M4M A;  2LFV A;  5A0Y B;  1AXQ A;  4O44 B;  3K5N A;  1RWP B;  1S1W B;  2FC8 A;  3BR9 A;  4KE5 A;  5T41 A;  1AZS A;  1LQ9 A;  4JI6 F;  5DDO C;  3JSM A;  2H9Z A;  2MQP A;  2HS3 A;  2A2D A;  1R89 A;  1P6T A;  1ZS6 A;  2CVI A;  2EFG A;  2FGC A;  2JOQ A;  3PJ9 A;  2XMA A;  2VPW B;  2XGQ A;  2AJQ A;  1Q7Y T;  3QWU A;  2ZZM A;  4YB6 A;  4ED3 A;  5FII A;  5E0O A;  1R8A A;  2JNJ A;  4K2X A;  2ZHB A;  1CJV B;  1FRJ A;  2OD6 A;  3A8K A;  3D68 A;  1RTI A;  4JP8 A;  2FJD B;  5KG4 A;  1LWX A;  3MM9 A;  3PRB A;  1NSQ A;  1UJ5 A;  4KR0 B;  5B0D A;  3P8B B;  3ZZR A;  4DV4 J;  3CUL A;  3CCT A;  2M8H A;  4E0D A;  4QPT A;  1HBO B;  3M1V B;  4HAC B;  1RTD A;  4IRD A;  4GKJ F;  1SUQ B;  4CLK A;  2XCA A;  1N5Y A;  1U8S A;  2V8P A;  4ELU A;  4WKR A;  5DJB A;  2G13 A;  2KFZ A;  2CZ4 A;  4LR8 A;  1NDK A;  1SL2 A;  4BBY A;  4KFB B;  1LXJ A;  2XI2 A;  2XMT A;  2NLW A;  2M2B A;  3C6U A;  3OQ2 A;  5RUB A;  2Q79 A;  5CD4 H;  2D3U A;  3OV7 A;  4V19 J;  1KFD A;  1P1T A;  3DI6 A;  2HHS A;  1WF1 A;  4U6P A;  1SIW B;  4IO1 A;  3M6V A;  3AFG A;  1TK8 A;  3CCV S;  2AYE A;  2CJX B;  3BF4 A;  3HI9 A;  1QJH A;  4JI8 J;  4NZ6 A;  1R43 A;  2RRN A;  3GSI A;  4C11 A;  4YUD A;  3FJ2 A;  2HVD A;  1L3T A;  2DR7 A;  2GVD B;  3ZTQ A;  2AZ1 A;  1PYS B;  1ZM3 A;  2DIU A;  3K5O A;  4LSL B;  3VHQ A;  3ELH A;  2XY5 A;  3JQJ A;  5CYJ A;  3D1O A;  4ES1 A;  3RR7 A;  3V4I B;  1R8B A;  3BV8 A;  2D3O R;  5CXT A;  2ALY B;  1RT4 A;  2DHG A;  2RQK A;  3PKY A;  4UY8 5;  5C42 A;  2JJ4 D;  2LQ9 A;  3KLF A;  2VB6 A;  2VL1 A;  1Q8I A;  2H5E A;  2HS0 A;  3ILI A;  1NHV A;  2HUR A;  3JXO A;  1FWP A;  3TZX A;  5F8G A;  2W9B A;  4DL3 A;  2BDP A;  2MMY A;  2G1D A;  4ETZ A;  4OYX A;  3MOZ A;  2B51 A;  3P45 B;  4RW4 B;  2HIY A;  1CC7 A;  1SC6 A;  1T7P A;  2HW3 A;  1SQG A;  3BBB A;  2FLO A;  5BYR A;  2DHS A;  2H3E B;  1NJZ A;  4ZIV A;  4R5P B;  1J5O A;  4TY9 A;  1NJX A;  3TW0 A;  1S9G A;  1VRQ C;  2FJE B;  2DRB A;  2XSJ B;  3IRX B;  1OPI A;  2VG6 A;  3T9Z A;  3F44 A;  4OI4 A;  5F41 A;  5KFH A;  4RUC A;  3QIP B;  2CRL A;  4NLY A;  4YOE A;  2D74 B;  4JUZ A;  1ITP A;  1KLN A;  2CYY A;  2ZDP A;  2DPI A;  1JLB B;  2K1R A;  4QR0 A;  1GMV A;  1R27 B;  4NXN F;  3MEE A;  2KZM A;  1V5V A;  3CDU A;  5IQQ A;  4JI0 J;  2K1R B;  2XGP A;  4IQM A;  4JI2 J;  2AQ4 A;  3LGN A;  3TQE A;  2WVC A;  8RUC A;  3MEG B;  4B3R J;  3C15 A;  2RJZ A;  3MPV A;  3M2U B;  5J1E B;  2CPJ A;  2UXB F;  3DGV A;  3I55 S;  2VFS A;  2C3P A;  1UVJ A;  2EG2 A;  3BGF A;  3QBC A;  4ENO A;  3EDQ B;  1RAO A;  4ANC A;  2MKY A;  1URN A;  5AE2 A;  4RW8 B;  2AT1 B;  5A0Y A;  4QWA A;  1Q95 G;  1PYO B;  2WSE C;  3FEZ A;  3H4D A;  4LF7 F;  2NQP A;  4ZN1 A;  1OQ3 A;  3Q8U A;  2LMI A;  1YIJ S;  4B3S J;  3UDE A;  2QA4 S;  3TUP A;  1YX2 A;  4Q8E A;  4NCB A;  2KDO A;  2YWH A;  4QWE A;  4WPA A;  2UXD J;  2LLZ A;  2DBB A;  4WIQ A;  1XJW B;  1RT4 B;  4RUB A;  1OO0 B;  3LPY A;  4ECV A;  1NK6 A;  1GTE A;  3AOD A;  3QQC D;  1SL1 A;  1ZET A;  3TX8 A;  5DQI A;  3QMQ A;  3RB4 A;  2W2N P;  1XTZ A;  4NCA A;  1WEZ A;  2CPX A;  2GGP B;  2VBZ A;  4O23 A;  2HFV A;  1NUE A;  2V4J B;  4FP9 A;  3HP6 A;  2DGW A;  1N56 A;  2JC0 A;  2MQ8 A;  2PC6 A;  3NCR A;  4NOH A;  3NCP A;  3D6M B;  4B9N A;  4Q0B A;  3C6T A;  2FHJ A;  3Q23 A;  2G4B A;  3ZXW A;  1LK5 A;  4C8M A;  4J9M A;  1H0H B;  1MU2 B;  1IKW A;  2ZOM A;  3FSI A;  4GO7 X;  3CC7 S;  5H9E K;  3OTO F;  3HLU A;  1SVD A;  4ZPV R;  2R2S A;  2ZUA A;  1QAY A;  1D0E A;  2PGC A;  5L1K A;  1SH3 A;  2K3I A;  2V2Q A;  1VDH A;  1FVS A;  1NND A;  4FYV B;  3LP1 A;  3TVK A;  1HBM B;  4KFB A;  2B6A A;  4MKA A;  4P71 A;  2HHX A;  1RT2 A;  3E01 A;  3F41 A;  3R1L A;  3CJ2 A;  4J9U E;  2CJQ A;  3RBX A;  2VA3 A;  4PWD A;  3D2W A;  4DUT A;  1T9Y A;  4N8O A;  1SV5 A;  1H98 A;  4L6V 3;  1KHV A;  4RNF A;  1JXE A;  2DD8 S;  4DL4 A;  4PQU A;  1IM4 A;  2XWX A;  4ZPT R;  4DR5 J;  4KHP F;  3V6D A;  4DV7 F;  1YJ9 S;  5KFA A;  4KYZ A;  4KHM A;  4GRS A;  3SQG B;  4CTA B;  3M8Y A;  5KFZ A;  4CH0 S;  4ZLL A;  3M8S A;  3G6X A;  3M8P A;  2IA6 A;  4MTP A;  5D77 A;  3UE2 A;  1OIA A;  4A8X A;  5A6P A;  1LW0 A;  3FKB A;  3KLE A;  5DET A;  1U25 A;  2HGN A;  2QL5 B;  3MCS A;  2UP1 A;  3KJQ B;  4DN0 A;  3MEK A;  2GVZ A;  3MCN A;  3GYN A;  5B0G A;  4OI0 A;  5C5J A;  5KT5 A;  4WP9 A;  3THT A;  1M1K T;  3MTK A;  2C1E B;  4X2B A;  4ED2 A;  1TKT A;  3U7J A;  3ENQ A;  3R27 A;  3NNC A;  4OL8 A;  2EPI A;  3MR6 A;  3PZP A;  5LSL A;  1KD1 T;  1TKD A;  5IS2 A;  3ZNU A;  5I3U B;  4J9P A;  1OS5 A;  2CFX A;  4ES3 A;  3LW5 C;  1X5O A;  2BV3 A;  2XI3 A;  5U47 A;  2XMU A;  2E9T A;  3M8R A;  3VAM A;  4Y34 A;  2DR8 A;  4NLG A;  5KFQ A;  2XG8 A;  2I5J B;  1FRX A;  1RSC A;  3QNW B;  4P9S A;  2HWI A;  1R31 A;  1H6K X;  2OML A;  4U96 A;  5J2M B;  5CCL A;  4YB1 P;  5LT5 A;  2CZV C;  1JXL A;  5BJR A;  2NR0 A;  4WWS A;  4ZPB A;  2YX1 A;  3BKT A;  3SCK E;  4DCP B;  2DVI A;  1FE0 A;  1NPR A;  2DTJ A;  3TAM B;  4Q5V A;  2WBM A;  2A3J A;  3M9O B;  2CKW A;  3MMA A;  3QT8 A;  1RA7 A;  1WD6 A;  4KSE B;  5C25 A;  2BOP A;  3KK1 A;  3KFW X;  4X84 A;  2OIH A;  2KYZ A;  3ILL A;  1RTZ A;  2AJ2 A;  1ZZF A;  4CO0 A;  4WYL A;  2XQC A;  3OJS A;  3CCQ S;  2VIC A;  1JNZ B;  4JI7 J;  2G2Y A;  5IWA F;  1VHI A;  4NLD A;  4OYM A;  3LOU A;  1WI6 A;  4F3Q A;  4USM A;  2PEB A;  1YDL A;  4DV5 F;  2D7S A;  2FDN A;  2YNH A;  4KHR A;  4I2Q A;  3RUB L;  2XC9 A;  4NLU A;  3TJ8 A;  3DHW C;  4ZCK A;  2J9C A;  2QJ3 A;  4IYQ A;  1HNI B;  4EYH B;  1MU2 A;  1M0S A;  1KNZ A;  1H7W A;  1YRX A;  2MST A;  1UVI A;  2BKN A;  5HRO A;  4M1K A;  3KJV B;  1VQ5 S;  2QFI A;  2KXN B;  3JS9 A;  4DR3 J;  4Q2L A;  1KQK A;  2RH3 A;  5HN0 A;  4A8S A;  2YKM A;  4J91 A;  2FHO B;  4KGV B;  1GXT A;  2BE2 B;  4P74 A;  4C97 A;  3CF5 Q;  2CA9 A;  1CJK B;  5CZV A;  1N5Q A;  1M1G A;  2DNL A;  4YR0 A;  2E5G A;  2FC9 A;  3KLV A;  5G0R B;  3R8Y A;  4WFN Q;  3BH6 B;  4V1A k;  2HLT A;  5DM7 Q;  2B4P A;  6FDR A;  1M1H A;  2YWG A;  5IV3 A;  1CSJ A;  3TZY A;  4HR2 A;  1A0O B;  2DYA A;  4MIA A;  3CDE A;  3W60 A;  4PQU B;  3OR1 A;  4Y0F A;  4QIW D;  4DV1 J;  3DRR B;  4PEO A;  1O8B A;  1XMB A;  3EXY A;  4I64 A;  2ZD1 A;  2VJV A;  3FFI A;  1IBK J;  4LT6 A;  4DR6 J;  2CQI A;  3BKU A;  4W98 A;  4IO9 Q;  2IRX A;  4A8F A;  2UVV A;  3BJY A;  4P7T A;  4RBU A;  2GCF A;  2C22 A;  1IR2 A;  1QSL A;  1P1L A;  3LP1 B;  2OFG X;  1TR0 A;  1SUQ A;  3TNV A;  1N5Y B;  1JJ4 A;  4ZJO A;  2WVD A;  2OEL A;  1UPM B;  2L9W A;  4ZPW R;  1TVR A;  2EFO A;  4BLG A;  4OYZ A;  4CLU A;  2Y8W A;  1WC5 A;  3D1H A;  3K8W A;  4JI4 J;  4LFB F;  1F60 B;  5GAG U;  1QD1 A;  1RAF B;  1M90 T;  3K8V A;  2UUB J;  2ZBC A;  2MPU A;  3R5A A;  4FBU A;  3IR5 B;  4USV A;  5J2M A;  2DGO A;  3ENV A;  1W26 A;  2J9D A;  2O01 C;  2Z56 B;  1Y11 A;  4P52 A;  4F26 A;  5EWE A;  2R7W A;  2JX2 A;  4UQT A;  4A8M P;  2XSJ A;  1HYS B;  3UN3 A;  3TX0 A;  1C4A A;  3DRP B;  1Q78 A;  4QW8 A;  3GIK A;  1NB2 A;  3I87 A;  2RRA A;  1VCT A;  5LJ3 Y;  3MUM P;  2WOM B;  4PG6 A;  1M5P C;  3OR2 A;  3DLB A;  1EET A;  4B3O A;  3PCO B;  2XZD B;  1X4H A;  3DYA A;  4TU8 A;  1RAD B;  3PR5 B;  3AY0 A;  4ZVO B;  4F4W A;  1QY7 A;  4LSN B;  3D6H B;  3PW5 A;  1N54 B;  1WWH A;  5E5N A;  2UUC F;  4QYZ J;  1KHW A;  5KT3 A;  4LF8 J;  2AJF E;  2EC0 A;  1PC4 A;  3HVA A;  5D0R A;  2FJV A;  3CCL S;  5IT9 U;  5DS7 A;  2N7Y A;  2YWK A;  2U1A A;  2DIV A;  1S1X B;  2CQP A;  4RR5 A;  2DH9 A;  4XIU A;  1HMV A;  4PXD A;  1NK0 A;  3MXH P;  2KHC A;  1KVJ A;  3DM2 B;  3IS9 A;  1NEE A;  3J7Z 5;  3BPS P;  3H2U B;  2C2K B;  3GR1 A;  2E1M C;  4OI6 A;  4RWX A;  5LOQ A;  2RDJ A;  4X4U A;  4DZ6 A;  1F9H A;  1SC1 B;  1VC5 A;  4H4M B;  1UJ4 A;  1IBM J;  1N48 A;  2KRB A;  3HD2 A;  3PYE A;  4KAI A;  3SDE A;  4C0O C;  3ENA A;  1M5S A;  2CPY A;  3FCV A;  4K2J A;  3AJ2 A;  1P8G A;  3QSI A;  3US5 A;  4OHY A;  1HI1 A;  3GYG A;  4MK9 A;  5T7L B;  3BN4 A;  3KG4 A;  4ZS6 A;  1SH0 A;  3EDR B;  1RT3 B;  2VBY A;  5KFT A;  4DQR A;  4Y28 C;  1L3K A;  3MDF A;  4IQX A;  3GPA A;  3IG1 B;  2HIQ A;  4MIB A;  1FA0 A;  4O4R A;  4PAB A;  2WW4 A;  1KOH A;  4O3S A;  2HHU A;  4RW7 A;  3BYP A;  4Y2M A;  1Q1K A;  4C3M A;  4DG1 B;  4C8Z A;  1HFE L;  2HRY A;  4QBU A;  3HSJ A;  2EC2 A;  4R5P A;  4IFV B;  1J5O B;  4ILR A;  3FFI B;  3MFH A;  2G0I A;  2WAQ D;  2ZFH A;  3T9N A;  1QTN B;  3BBC A;  4R0J A;  4Q0B B;  4ZP9 A;  2QYG A;  2DNR A;  3HUL A;  1U26 A;  2R2U A;  3Q2T C;  1HD1 A;  4DU7 A;  4DF8 A;  2DGS A;  1NJY A;  2MQO A;  3J7Z T;  1IR1 A;  2JL9 A;  1EIY B;  2OTL S;  3NOC A;  4WXW A;  2DT9 A;  4NE9 C;  4OX9 J;  2QMX A;  5ETT A;  2AYB A;  3N5F A;  1RTH B;  3FBF A;  3AXM A;  3MWB A;  1P9Y A;  4LRE A;  3RB0 A;  2FVR A;  4KGM A;  5IQ6 A;  5EHH A;  2R7S A;  2V8V A;  2ZBQ A;  3KLG A;  1U1L A;  2QMU B;  2UZA A;  1VK8 A;  1IQZ A;  5KG6 A;  1K9M T;  4A47 A;  4WFA Q;  1EP4 B;  2V4R A;  2EEY A;  2HPU A;  3CIM A;  5HSP A;  4DV4 F;  4EBC A;  1AZS B;  1LWE B;  4WTY A;  3VF0 B;  4WKY A;  1X0F A;  3BR8 A;  1GFW B;  1IXK A;  2R3V A;  3A4T A;  3I0R A;  5DRK A;  3V6K A;  5J2N A;  5HLF A;  2M8D B;  5KFV A;  5F3Z A;  1T3N A;  1PCA A;  2QEX S;  1G1X A;  3G2X A;  5GAD I;  2W2P P;  4IFV A;  1VBZ A;  5K5M A;  2OO4 A;  4NEY A;  3Q22 A;  1WG5 A;  4C8Y A;  2OPQ B;  2ABY A;  3AA8 A;  4W90 B;  3FGV A;  4G65 A;  1RT6 A;  5AE3 A;  3MGJ A;  4USU A;  3T1Y F;  1RKI A;  1RDR A;  1RAB B;  2UUT A;  1YBT A;  4RU9 A;  2VPX B;  1JLC A;  2Y1L B;  1HQU A;  3C16 B;  2F1F A;  4TYA A;  5A6W A;  4U7U K;  4I6W A;  2NPF A;  2PA3 A;  2MEW A;  3THP A;  3TR5 A;  4C98 A;  2IVM A;  1EAR A;  2IAJ B;  2P5V A;  3DYA B;  1Z2L A;  3TJA A;  3DNC A;  2WB4 A;  5KFL A;  4JBC A;  3UDV A;  1ZPW X;  3VCD A;  4X66 J;  4JI8 F;  3AOC A;  4C8L A;  4B3O B;  2B9Y A;  3DU5 A;  1K8A T;  2YKA A;  3DOK B;  2AKW B;  3A3N B;  3EVM A;  4NA1 A;  4P75 A;  3BQ1 A;  2CQ3 A;  4ZHR A;  3CMQ A;  1HR0 J;  4X4R A;  4DL2 A;  1QVG R;  2MKH A;  2QYC A;  3MMC A;  2VAS A;  3NKY A;  2Q1L A;  1S1X A;  2QO3 A;  3N6M A;  4KV8 B;  4WE1 A;  3EPG A;  5G4D A;  1RT7 A;  1JNR B;  4NCG A;  2L08 A;  3FBE A;  1F2H A;  1HPZ A;  1YVF A;  3OTB A;  1JB0 C;  1IKY B;  3QGP A;  2IC3 B;  4KH0 B;  4WP3 A;  4XDD A;  3UVJ B;  4CDI A;  5JMN A;  3CD6 S;  3G96 A;  1ZTT A;  1SH2 A;  3JSR A;  3QAE A;  2ACM A;  5E41 A;  1BMQ B;  2KT3 A;  2H5I B;  2LXF A;  4LRA A;  1REG X;  1W7W A;  4N7T A;  2MKS A;  1DAR A;  4NLX A;  2VC0 A;  5K8N A;  4OYP A;  5AXL A;  5B0B A;  2GO8 A;  5DG9 A;  4DSK A;  3I56 S;  2KZZ A;  1XNQ F;  2ZC3 A;  3AJD A;  3NGR A;  3MPU B;  1U1N A;  3X1L B;  5AJ3 F;  1KWM A;  3M2U A;  4QIF A;  1E6V B;  1S57 A;  2EK1 A;  4C2M A;  1B0V A;  1WHY A;  2OPR A;  3L3C A;  5KFP A;  3HHL A;  3KDO A;  2HFU A;  4BC7 A;  1LNQ A;  1UMJ A;  3TRG A;  2XYP B;  3HPO A;  4X64 J;  3D6T B;  3H42 A;  1BQX A;  2CQ2 A;  2OAU A;  3F56 A;  1BWV A;  4HLB A;  1VQN S;  5A8K A;  1HNZ F;  2WZ1 A;  4K4U A;  2BE2 A;  2Z2L A;  2VG6 B;  4LBH A;  4MIW A;  4OX7 A;  4PZV A;  4C0B A;  1UWA A;  2RB7 A;  2ZVI A;  4HI2 A;  3ZZY A;  2P8I A;  1BQM B;  1RI7 A;  3M2V A;  3IG1 A;  1RBA A;  4LF7 J;  4URQ U;  1W2B R;  1IWG A;  3C14 B;  1JLF A;  2BJD A;  4B3M F;  1NSK L;  4N77 A;  3OR1 B;  4X65 J;  3M8Q A;  3OHB A;  2N4C A;  1XR5 A;  1JKH A;  1IKV B;  1MRO A;  3BGL A;  3BSO A;  3KG1 A;  3KOA A;  3MM8 A;  1U48 A;  4OZJ A;  3THV A;  4H4K C;  1VIS A;  5F8I A;  4F02 A;  4GKK J;  2ZVS A;  1CUL B;  5L1L A;  2IFX A;  4URG A;  2LQ8 A;  2IVF B;  2MZS A;  1Q5V A;  4CH1 A;  3TA2 A;  5KFJ A;  3SYZ A;  1SIZ A;  1IKX A;  1GMW D;  2MQN A;  3IR7 B;  4UST A;  1FVQ A;  2VKZ G;  4OI1 A;  4X4T A;  3QRQ A;  3KJF B;  5DGA A;  2GJ2 A;  4MYT A;  5K20 B;  1F1B B;  4PG7 A;  5EGY A;  2MKJ A;  3LP0 A;  4RUA A;  3RU0 A;  2QC3 A;  1RUS A;  2WRM A;  4O4G B;  5C24 A;  1O51 A;  4J9R A;  2DY9 A;  3W7B A;  4ZVT B;  4ICL A;  5JVH Q;  1YG0 A;  2AEM A;  2ASY A;  1NK7 A;  5F9L A;  4M5K A;  2Z2Z A;  3QT5 A;  4I7F B;  1PAE X;  2AX0 A;  3S01 A;  1TMJ A;  4DMZ A;  2Q43 A;  1HW9 A;  2KL8 A;  3WHI A;  4LF4 F;  1SJ1 A;  3FZ2 A;  2VUG A;  2FYX A;  1YZ7 A;  3IR6 B;  4DR5 F;  4KHP J;  2NCK L;  2KB2 A;  4LSZ B;  3MCO A;  2NPI A;  1QM9 A;  2G2O A;  1H2T Z;  4D3G A;  2UUA J;  1RT1 A;  3POT A;  2Z4P A;  2DXE A;  3R97 A;  2R2T A;  3KHH A;  4RZR A;  1FRM A;  1GQE A;  4DV3 F;  1WOP A;  2CVE A;  2CAJ A;  3PX0 A;  4FNH A;  3OTE A;  4P2S A;  5F8L A;  4QU6 A;  2C3O A;  3V6D B;  2RRB A;  4Y2K A;  1ICE B;  2QFJ A;  4JB8 B;  2KRR A;  1TL1 B;  4EK2 A;  1DY3 A;  2P6S A;  3BSN A;  4UOF A;  1VQ9 S;  1K0T A;  1S1W A;  1U1R A;  3CGI A;  2AGO A;  3W8P A;  3H5U A;  5KFO A;  5CAA A;  1DRZ A;  5ETQ A;  2DKO B;  2W4P A;  3DOL A;  4JI1 J;  4OLP A;  4ATN A;  2FVP A;  2GAG C;  4YN3 B;  5GMD A;  4ED0 A;  5D8H B;  2PMH A;  2BE9 B;  2YQ0 A;  5T7L A;  5KG5 A;  4HTI A;  5B7W A;  4FKX A;  4EEY A;  2YKM B;  2E5L F;  1Y5I B;  3K5M A;  2Q6B A;  1DLO B;  3AOB A;  2H65 B;  3CVK A;  5I3P A;  5FLX Y;  5HO4 A;  1NH7 A;  2GMH A;  1SC3 B;  3ET6 A;  5AE1 A;  5A2Q Y;  1U45 A;  3BDE A;  3B54 A;  4KIA A;  4DFP A;  1BHN A;  1X0P A;  1TL1 A;  3O3L A;  2L3M A;  1X5T A;  4WU2 A;  4OX8 A;  5BR8 J;  1VQK S;  1TV6 A;  2DNY A;  3RRG A;  2LKZ A;  3MED B;  5CCM A;  1N32 J;  2CQ4 A;  1HBM A;  1YJU A;  7AT1 B;  1HHT P;  2VOP A;  2DGX A;  3Q24 A;  2B4U A;  2R7O A;  1S79 A;  3C14 A;  2WTF A;  5CD4 A;  3UW1 A;  4O4G A;  1UVM A;  1BQM A;  2V6A A;  3M2V B;  2AHO B;  2XBP A;  4CLZ A;  1OYE A;  5IT4 A;  2NYI A;  2M9K A;  3ETM A;  3E8O A;  3N79 A;  4Y2C A;  1YGY A;  5DG7 A;  2IDE A;  2Q66 A;  2DY1 A;  2E1P A;  4FYY B;  3SFU A;  2HQG A;  3OSP A;  3B82 A;  1FXL A;  3GFH A;  4Y6I A;  5B08 A;  2FTR A;  3M2R B;  4ZLJ A;  3OT9 A;  5HBM B;  3SIP B;  3D0H E;  3U1M A;  3UDL A;  1NKE A;  2A6O A;  3DLH A;  3E51 A;  3GJQ B;  2J7K A;  2W7P A;  4C4W A;  3DN9 A;  1LOU A;  4N76 A;  1CJV A;  1RHM B;  4LVN P;  3HHL B;  4DOZ A;  2QLX A;  3CT9 A;  2Y1R I;  3IAM 9;  3BYR A;  1FFG B;  2K7K A;  3ZZZ A;  3W9I A;  1LFP A;  1TKX B;  2B0G A;  4O3O A;  1D9D A;  1FES A;  2DNQ A;  5L38 A;  3S6E A;  5D3G A;  1UZD A;  3MR7 A;  4X4V A;  1JLA B;  3LP2 A;  3HVR A;  2VQE J;  1VQ6 S;  5LSR A;  2DXD A;  2BZ2 A;  2IRU A;  1RWX B;  3M05 A;  4CP5 A;  1KRP A;  4LRD A;  1VBY A;  2WHO A;  5HQL A;  2FJA B;  3KKF A;  4DLG A;  4FF2 A;  5DLF A;  2DHA A;  2CQB A;  1CJT B;  1YSJ A;  2CQG A;  2MLY A;  2YKQ A;  3H59 A;  5C2G A;  3OVS A;  1R0A B;  3AQP A;  1QDU B;  1N4L A;  1I94 J;  2P9G A;  3LAM A;  1NO8 A;  5ETN A;  3RRK A;  1BXN A;  2EWH A;  3VV2 B;  2E5J A;  2M70 A;  2VF3 A;  3WBZ A;  2EI5 A;  1RU1 A;  2EFV A;  1F5C A;  4FN5 A;  1FO1 A;  1N5S A;  2MKC A;  1Q53 A;  2RQ4 A;  3QAT A;  3DXB A;  1UL3 A;  2BAN B;  3D1Q A;  3DLG A;  2J76 E;  2J9E A;  4J7C A;  1TK5 A;  2VA2 A;  4NYO A;  2AW0 A;  2F4V F;  1C1B B;  2BAN A;  3DLG B;  1GXU A;  2I0X A;  2DCL A;  3KDN A;  5KFS A;  1ZOT A;  1VRU B;  1JLB A;  1YK9 A;  2K3K A;  4HH0 A;  4UTG A;  2W1B A;  5D6G A;  5F8M A;  3NGD A;  1TVR B;  2OSR A;  3KHL A;  3DDK A;  3TVY A;  1ULR A;  3BGU A;  3U1N A;  2YWW A;  4OYB A;  4K4V A;  1PO6 A;  4B9T A;  2VOO A;  3ICL A;  1NLK L;  4RPF A;  1T03 A;  2HFN A;  4K59 A;  2AYM A;  2YNF A;  1Y5L B;  3GE9 A;  4LUB A;  5KFI A;  5KFU A;  4AE5 A;  2ALZ A;  4M5J A;  1UFK A;  5EN1 A;  1IJE B;  2GV1 A;  2MY8 A;  3R9L A;  3ADA C;  2QLJ B;  4FS1 A;  1IBK F;  4JI6 J;  2KH9 A;  4LF8 F;  4IUF A;  2X1F A;  1RIS A;  3JSY A;  3R5D A;  4FXV A;  1MWZ A;  5GVQ A;  4ER8 A;  2LEB A;  2ADB A;  4DBQ A;  2RAQ A;  1YKW A;  4L76 A;  4MJK A;  3UI3 A;  1RT5 B;  4ZVE A;  1OJ4 A;  2OEM A;  1WEY A;  4IFY A;  2ASD A;  1N5V A;  2I38 A;  2DCU B;  3JTP A;  2XMK A;  4DR2 J;  1G4C A;  1RWU A;  4N41 A;  1S0V A;  1VQ8 S;  2GGP A;  3DU6 A;  3GB0 A;  4ZHR B;  4LJM A;  1YJ7 A;  2KJW A;  1TUG B;  2BE7 D;  2RDI A;  3H2L A;  4M5D B;  4AXI A;  2CPE A;  4N8N A;  2BMB A;  5T14 A;  3ZNJ 1;  1V3S A;  2RDD A;  4KO0 A;  4DX7 A;  4DFK A;  2JEF A;  5EUH A;  1UA1 A;  2GFF A;  3CDB A;  4WFB Q;  1XK8 A;  5K14 A;  2R7Q A;  5HVG A;  3POT B;  1FT8 A;  2Y0S D;  4NWB A;  2EFP A;  4LRB A;  2FVS A;  4GKJ J;  3UNG C;  2FLL A;  2E9Z A;  2JHE A;  5E7O B;  3MEC B;  4Q2M A;  4ZJQ A;  1YJT A;  4HEA 9;  4JOU A;  2AWZ A;  2FUG 9;  1S59 A;  4NLS A;  2CJY B;  2ZH6 A;  2WOM A;  3IA0 A;  4CLY A;  1RLC L;  2XTJ P;  3OJU A;  4F7V A;  4WK1 A;  3TI0 A;  1PBU A;  1VRT B;  1WJ9 A;  2PA8 D;  2JH3 A;  1B0T A;  2W9C B;  1HR0 F;  2WVE A;  4M5N A;  4CLW A;  1FRK A;  2HS4 A;  3QLH B;  4QR2 A;  5C25 B;  1WC4 A;  4EBD A;  1JLA A;  3LP2 B;  4BWJ A;  3NMR A;  2RHQ B;  2D3O 1;  2LQB A;  3WX8 A;  2M0G B;  1GX6 A;  4LVO P;  1EX8 A;  1A7G E;  1YBU A;  3Q8Q B;  3KLG B;  2VKR A;  2OJ3 A;  1LV5 A;  3I5B A;  3KLE B;  3QFW A;  2L9N A;  2N4D A;  4U8V A;  3ZZT A;  4DSF A;  1VK3 A;  2BVZ A;  2W4D A;  3M8P B;  4FYD A;  1Y0H A;  2DGV A;  3GG0 A;  4QU7 A;  4ZPD A;  2CAD A;  3I4H X;  3PFO A;  5HQ8 A;  3HD1 A;  2YY3 A;  3QSY B;  1WTB A;  4I7F A;  3D9B A;  2V50 A;  3E3X A;  4WTO B;  1YTY A;  1NSP A;  1NDP A;  3IM8 A;  3A3O B;  4CLP A;  5J2P B;  3HVT A;  1U47 A;  1Y9O A;  3QRR A;  2E5I A;  1P9Q C;  2V67 A;  2FJW A;  2DNH A;  3TYT A;  1FXD A;  2W4C A;  3OXF A;  3A13 A;  4DR4 F;  1VQY A;  4KB7 A;  1N0V C;  4DUY J;  1HIY A;  1YZ6 A;  2LYV A;  2DPJ A;  4USH A;  1ARO P;  2K8G A;  2POK A;  4IG0 B;  2LA4 A;  1X7V A;  2HNY B;  2O3D A;  4DS5 A;  4UUX A;  4WFZ A;  4FF1 A;  3TUJ C;  2OI2 A;  4F0K A;  4B08 A;  1JK9 B;  2JFD A;  1K1S A;  4DFM A;  4R0E A;  4UZC A;  4X66 F;  3MD3 A;  4I0W A;  4NXN J;  4YHH J;  4UQG A;  4QYR A;  2A1B A;  2CPI A;  3C3L A;  3E2E A;  4X62 J;  1HYS A;  1NDL A;  1KQS R;  4LBP A;  4RBT A;  3AJ1 A;  4MFB A;  4TLR A;  3EE3 A;  5MLC V;  2HHH J;  4I6A A;  4LBI A;  3H5Y A;  1RAH B;  1UWB B;  4X4Q A;  2Y9H A;  3OFH A;  4A48 A;  2CJK A;  3P49 B;  2R7V A;  3FQL A;  4NI2 B;  2LEC A;  1OMS A;  1TZ0 A;  1TAQ A;  1ZBT A;  2I6W A;  3MR2 A;  4AL7 A;  3FSX A;  4CLS A;  4RLE A;  3CJ0 A;  1YRT A;  4WCE Q;  2WK4 A;  5EDW A;  1SBR A;  1R8P A;  2DIS A;  4AFF A;  2V9W A;  2FPH X;  4B3S F;  5LXY A;  3B4D A;  4ZDN A;  1RWM B;  1UJ6 A;  2ZWO A;  2H5J B;  1S1U A;  1OY8 A;  1QUV A;  1WEL A;  3TWZ A;  4B02 A;  4YDD B;  1M5O C;  3PW0 A;  2LDI A;  3DRR A;  4WZM A;  4AL5 A;  2W7A A;  1J27 A;  5HJX A;  3TAQ A;  1FDD A;  2ZJP Q;  5DM6 Q;  1XNQ J;  4WP8 A;  1QSY A;  4F04 B;  5D3G B;  3MM9 B;  3SV4 A;  1HMV B;  5KFD A;  3GZ7 A;  4DX5 A;  1HPZ B;  3KUH A;  2YKO A;  1ZZN A;  2L48 A;  4H4K A;  3DMJ A;  1PJ6 A;  1RAJ A;  4MMO A;  4RW6 A;  2RQC A;  4AQY J;  4CH7 A;  2XS5 A;  1ZAX A;  1FJC A;  5F0U A;  3DOM B;  2BJ1 A;  4ED7 A;  1HQ2 A;  4USJ C;  1UTA A;  2Q6C A;  3W3S A;  4RNH A;  2IA0 A;  4U67 Q;  4U8Y A;  3UN2 A;  1HNZ J;  3OTO J;  4DS4 A;  2B3T B;  4ED5 A;  4OZL A;  3HJF A;  1GXL A;  2HHQ A;  4RO0 A;  5J2Q B;  1WC0 A;  3CIZ A;  2AD9 A;  4HI1 A;  4WJB A;  2RKI B;  3PW2 A;  2BX6 A;  3BS9 A;  1N34 J;  4F0M A;  1KVK A;  1HQU B;  4DCO B;  3T41 A;  3UQS A;  2CNL B;  4FVC A;  4LRF A;  2V69 A;  5E3Q A;  2EW9 A;  4LR7 A;  5KG1 A;  4DFJ A;  5EWF A;  1SI9 A;  4X65 F;  1RA6 A;  3VAH A;  1D8Z A;  1FWK A;  3Q8S B;  3W5Y A;  1U09 A;  5IC6 B;  1D1U A;  4YQW A;  3QJP A;  1JLE A;  3MTJ A;  4J37 A;  4ANE A;  5KFR A;  4J9O A;  1S6P B;  4IDK B;  3FRZ A;  3PG9 A;  5G0R A;  2CPF A;  1U24 A;  4GKK F;  1CVJ A;  4X4S A;  2GIF A;  4OJG A;  2L41 A;  3FMW A;  4M5D A;  2G0J A;  3CUN A;  2VOD A;  1D9A A;  4KGZ B;  2DIT A;  2YNG A;  3R5C A;  5D0G A;  4HHU A;  1N0U A;  2IRY A;  1DFD A;  4DI6 A;  1WTF A;  2GJF A;  1AT1 B;  4YR2 A;  3JYT A;  5H9E J;  2XM3 A;  3DKD A;  3JAM Y;  2ZOF A;  1S6U A;  1Q86 T;  3EIC A;  4BCA A;  2HZV A;  1F3V A;  4J90 A;  4BHQ A;  1EHW A;  2I2Y A;  2KFY A;  4NRT A;  3MM7 A;  3RAQ A;  4ED6 A;  3EGV A;  4CCH A;  2HAF A;  2DGU A;  5FDL A;  3UR3 C;  5D4N A;  1TKZ A;  1NHU A;  2E7W A;  2MZT A;  3QPI A;  4L74 A;  2U2F A;  4IOB A;  4RUH A;  3TZZ A;  3T5L A;  2M88 A;  2DEJ A;  4ZP8 A;  5AXK A;  1S7H A;  3HDS A;  2RS2 A;  1JJ2 R;  1I3O B;  4CNY A;  4DQS A;  4LFC J;  4KPY A;  2D69 A;  2B8Q A;  2B7C B;  4UOC A;  3FCH A;  5SZT A;  1LW0 B;  3BH7 B;  2ZH3 A;  4EMD A;  4FNI A;  4J5O A;  2ZNZ A;  2HK3 A;  6FD1 A;  1VQ4 S;  4OZ0 A;  1JLG B;  4WFX A;  2EFQ A;  1D3W A;  3D7S B;  2PEH A;  5KT4 A;  3QWP A;  4DV3 J;  3KMQ A;  1VBK A;  1EAY C;  5IWA J;  3PHE A;  4K5R A;  3D66 A;  5JXS A;  2XY6 A;  4JYA F;  4DV5 J;  2IM0 A;  2NZC A;  4OYO A;  2MQQ A;  4F4Y A;  2HVH A;  2HBY B;  5DZ7 A;  4ZVR B;  1VLY A;  3WC2 A;  4KRW A;  4DPU A;  3TUI C;  4DL7 A;  3MEG A;  1KQF B;  2MY7 A;  2R8H A;  1LWE A;  2W24 A;  3BZQ A;  4DUZ J;  1N88 A;  1F0X A;  4JI1 F;  1JJC B;  2OUG A;  1RAE B;  1VQO S;  2HND A;  3CJK A;  4HYK A;  4DR3 F;  2C2O B;  2LEA A;  3W9J A;  1MML A;  1WOS A;  2H51 B;  2B43 A;  2NSB A;  4KC5 A;  4OZ1 A;  4YY3 F;  3MD1 A;  1RTJ B;  2NXE A;  3EYZ A;  1HQE A;  3C6T B;  3EXC X;  3EMT A;  1VJW A;  4HT5 A;  3DM2 A;  3IS9 B;  4OJ3 A;  2W8L A;  1T02 A;  1RP5 A;  4D3H A;  2DB1 A;  2UXC F;  1UW4 A;  2XZT B;  1UEU A;  2OPS B;  1D09 B;  2UV8 G;  3G87 A;  2K2P A;  3M6W A;  4Y00 A;  2Y3Y A;  5CH7 B;  1FWL A;  4EI2 A;  5K8M A;  5KG7 A;  1HD0 A;  2HVE A;  5IZH A;  4OQJ A;  1Q16 B;  3CJ3 A;  1T0T V;  5DDQ C;  2ZJR Q;  4I67 A;  3KK2 B;  4DV1 F;  1KDN A;  1RGV A;  1BY9 A;  2AIR B;  2EG1 A;  3IXQ A;  1S1T A;  3H2V E;  1N32 F;  5HMY A;  4CO5 A;  2FB0 A;  4QWD A;  2Z2M A;  3FNN A;  5KFE A;  1CLF A;  2HRT A;  2D3Z A;  1GTH A;  1VS3 A;  2BAB A;  4RW8 A;  4AXJ A;  1RKJ A;  1RT6 B;  4U7U D;  3L7O A;  1O0P A;  3W63 A;  4A8K A;  1Q79 A;  1VYA A;  1S12 A;  3UO0 A;  2YWE A;  4ZIW A;  4GVB A;  2NRE A;  2XUL A;  2Z8Q A;  4ELV A;  1ZM4 A;  1CUL A;  4J9L A;  1U2F A;  2UUB F;  1AUS L;  3BQ2 A;  2Y1I A;  2IJR A;  1U1O A;  4I68 A;  1S6P A;  2COL A;  1RBL A;  2CQC A;  4DN9 A;  2CG8 A;  2MZJ A;  3N01 A;  1EP4 A;  3I0S A;  5KOW A;  3EX7 B;  1W25 A;  2V2Z A;  3M6U A;  2E1C A;  2J0X A;  2GML A;  3HO1 A;  1RHJ B;  2B6A B;  3KJN B;  2IHR 1;  1KVI A;  1WSV A;  1JLF B;  1RWO B;  2HNY A;  3O5T B;  3HZG A;  2DH7 A;  2NSC A;  4IG0 A;  4F0H A;  3D67 A;  2BW2 A;  2Z2Y B;  3DXS X;  1CJU A;  2PE8 A;  2ZUG A;  4NMX A;  2YWF A;  2ASL A;  3NEK A;  2PI5 A;  4LF5 F;  3IO1 A;  1XN9 A;  2DXF A;  2AJ0 A;  2PN6 A;  3RB3 A;  2ZNY A;  3OFF A;  5L9N A;  4HAC A;  3NL0 A;  2GQC A;  2WSF C;  3EVW A;  4Z7Y A;  4L3N A;  4NLW A;  3BQ0 A;  3GR0 A;  1KS2 A;  2VZ9 A;  3PEH A;  2CZ9 A;  4YDX A;  1FJE B;  2E9R X;  2KJV A;  3PNI A;  3KLF B;  3G6Y A;  3DMJ B;  4TKT A;  1RT3 A;  1VC0 A;  1K1Q A;  1F5A A;  3G9C A;  2RU3 A;  4A8W A;  3FRY A;  3C46 A;  3ZTS A;  2F4V J;  2WSC C;  3SCI E;  2UVU A;  1DAX A;  5D4P A;  3KLH A;  3OBI A;  1CJT A;  3W1Y C;  1FD8 A;  3UR0 A;  1NBE B;  1QLN A;  4DX6 A;  3U27 A;  2ZBP A;  1RQ0 A;  1HNX J;  2A10 A;  1OWX A;  1VQL S;  3EUN A;  4AND A;  3FC9 A;  2BM0 A;  4GVB B;  3ZFV A;  1RYR A;  1EZZ B;  4F3O A;  2BYC A;  5KTQ A;  1H2U X;  4JI3 F;  5IM0 B;  1RWW B;  2WON B;  4C8N A;  1HNW J;  4C8K A;  3D3C J;  2GIR A;  3AAW B;  4KTQ A;  3C6U B;  4JI5 F;  1RCX B;  4TU7 A;  1NM2 A;  2MZ1 A;  4UZB A;  2QZ8 A;  3I5A A;  3TAR A;  2KYX A;  1S1T B;  3LP0 B;  4HDH A;  1LXN A;  1AYE A;  3NWG A;  5K14 B;  3RBZ A;  1U6Z A;  2DNO A;  1BLU A;  1KQG B;  1S5Z A;  2HZC A;  3DCA A;  3I4P A;  4OX9 F;  2W7O A;  4DR2 F;  4CZC A;  1RHR B;  1IN0 A;  1X5P A;  4QZV B;  4FXD A;  1KLM A;  4URS A;  2HAI A;  5BYS A;  4EGL A;  1XMO J;  4NRU A;  2QV6 A;  4PXE A;  4HKQ A;  4CLT A;  1VHF A;  1S9G B;  2IM2 A;  1VJQ A;  2YKP A;  2B9W A;  2GVD A;  3EM1 A;  3PDN A;  4L3K A;  1RTI B;  2FHM A;  2HRU A;  4YR3 A;  1EKS A;  3OD2 A;  2CPZ A;  3SCJ E;  2OFH X;  3JQK A;  5HRO B;  1Y4Z B;  2C28 A;  3LAN A;  3IN5 A;  4QWC A;  3R6L B;  2VDI A;  5IT9 Y;  3G82 B;  4B17 A;  1KON A;  2JRS A;  4LIR A;  4K4Z A;  3DOL B;  2J6T A;  3VAG A;  2HNZ B;  5IXU A;  5HMZ A;  1HBN B;  4I6Y A;  2ZE2 A;  1U7L A;  2F40 A;  2V63 A;  4DR1 F;  1HWJ A;  1OQ6 A;  2GAH C;  3MPY A;  4PYA A;  4EYI B;  1T03 B;  4PWD B;  2E7V A;  4NLO A;  4ECS A;  4ZKA A;  1TL4 A;  3NRB A;  3EVO A;  1BQN A;  4PR6 A;  1CS4 A;  1N52 B;  2RE1 A;  2V2K A;  4HT7 A;  4CO1 A;  4DCJ B;  1CJU B;  5GAH U;  3P5B P;  4XDC A;  3PIP Q;  3P5T L;  1R0B G;  2M3D A;  2ZD1 B;  3TEG A;  5FLX U;  5LMU J;  1C4C A;  1OY9 A;  2JFK A;  2ATL A;  5F8J A;  2YNI A;  3CWJ A;  3T6B A;  3MUR P;  3PY8 A;  1RTH A;  3IBW A;  3P4U B;  4IR9 A;  3BKF A;  3RRH A;  2OGU A;  3FMB A;  4IH7 A;  5KFC A;  3MR3 A;  4B9U A;  2I8E A;  4CTA A;  4DV0 F;  1Y3J A;  3GJT B;  1IKW B;  2VU5 A;  2JLG A;  1IQT A;  3KUE A;  1HHS A;  2HGL A;  1U2C A;  3QYY A;  1T95 A;  1MG7 A;  3BGR A;  2ZZT A;  4QPX A;  1WG1 A;  4WF9 Q;  3BSA A;  4RW9 A;  2HFS A;  2GIQ A;  4ERD A;  2FZK B;  3GIR A;  4YS2 A;  1XMQ J;  3LPE A;  2DGT A;  3CD7 A;  5KFN A;  2V8H A;  3GIM A;  4DPX A;  1PAU B;  3NS6 A;  1TTH B;  2ZHO A;  3DRS B;  3MPD A;  3N9U C;  2HYI B;  3IFE A;  3CCS S;  2B8P A;  3U02 A;  3QZ8 A;  5F9N A;  4TN2 A;  2Y1J A;  4JV5 F;  4OYA A;  4C3K A;  1FRH A;  4S0M A;  2OTJ S;  4ZVH A;  4F4K A;  3SDE B;  2XY7 A;  2XHW A;  3OR2 B;  3OSN A;  2XYH B;  2NZ4 A;  5AJ3 J;  2P9C A;  4Z2X A;  3QRP A;  3JSB A;  3G86 A;  3V81 B;  8ATC B;  1N6Q B;  3TA1 A;  2DR5 A;  4Y3C A;  2VPZ B;  3T6J A;  2XB2 D;  1V3R A;  2YKN A;  1YI2 S;  4X62 F;  3UD3 P;  4JV2 A;  3OTD A;  2QSW A;  3NXZ A;  4X64 F;  3JSM B;  3WX4 A;  1NK8 A;  2QE5 A;  3H5X A;  1YBA A;  2LQJ A;  5D0E A;  3JTN A;  4FZV A;  1QSS A;  1U4B A;  2AYG A;  2HHH F;  1YRU A;  3NBP B;  4M8L A;  5C24 B;  3C2P A;  3M32 A;  2HND B;  4ZP6 A;  2QL7 B;  2ZKT A;  3CJK B;  2R7X A;  2KXH A;  2BM1 A;  3LGM A;  5KT2 A;  4GO5 X;  1E6Y B;  4FPR A;  2I5J A;  2HWT A;  3CO0 P;  5IV4 A;  1RZM A;  4FS2 A;  2D41 A;  4ZVQ B;  2W9C A;  1NKB A;  1B7F A;  4LF2 A;  2MZQ A;  2ZBR A;  4B3M J;  1WDT A;  1HWL A;  2X1G A;  3TZW A;  4NXM F;  1FRL A;  2CJA A;  4P7V A;  4MK8 A;  5GAH I;  1FJ7 A;  8AT1 B;  3MMB B;  2N82 B;  3IWX A;  3CC4 S;  2DO0 A;  3UWT A;  2FGO A;  3FQK A;  4F4Z A;  4A8Y A;  1SCJ B;  1DLO A;  4UF4 A;  4CLL A;  4CWB A;  5I3Q A;  2BOA A;  2BRL A;  2NXN A;  2W9B B;  4B3T J;  3M8Q B;  3NGU A;  3MPW A;  1U02 A;  4AQY F;  5F3T A;  3LH2 S;  3AD9 C;  4HH1 A;  4KO0 B;  2QSF A;  3K2Y A;  1MMN A;  2F8E X;  2UVW A;  4L72 B;  2QRR A;  1RK8 A;  4XO0 A;  1X4A A;  2GW8 A;  3UCZ P;  2FZC B;  3GTY X;  3H90 A;  3ILO A;  3VGV A;  4IFY B;  2DHX A;  2IBK A;  3OPK A;  4YB5 A;  1FJG J;  2VDH A;  2PMZ D;  1WKJ A;  1N34 F;  2VG5 A;  3K5P A;  3HMJ G;  3CJQ A;  1YJN S;  3OLB A;  2MDA A;  4RW7 B;  3J81 U;  1SB6 A;  4CM0 A;  2ZZN A;  4OYI A;  1VMB A;  3CC2 S;  3HX9 A;  2R4F A;  3B8H A;  3MUT P;  3OVB A;  2E44 A;  1K44 A;  2CG4 A;  2VFV A;  2YNF B;  4LF4 J;  2GZO A;  4KV8 A;  4QJV A;  4WE1 B;  2CIM A;  3W5Z A;  2QN6 B;  1APS A;  3M30 A;  4ZCL A;  1T9T A;  2LA6 A;  3W61 A;  4QOT A;  2CNO B;  2OLW A;  3VAJ A;  3G6E S;  3PM9 A;  4DSL A;  2Y0B B;  3ISZ A;  4H4M A;  2MXY A;  1Q4R A;  4ZJL A;  2UUA F;  3QT7 A;  2DR9 A;  1VQP S;  1SQF A;  2F8H A;  2ILZ A;  5ETP A;  2CNN B;  3HVW A;  3PEJ A;  3W9H A;  3MFI A;  3KJV A;  1J5E F;  3IRX A;  3PXG a;  1MNE A;  1VRU A;  4OZN A;  1WC3 A;  4O3N A;  3MOJ B;  2CJB A;  1S0O A;  1S9E A;  4ED4 A;  1C0T A;  2AX1 A;  4KKO B;  2QMW A;  4RW4 A;  2HMI B;  5F8N A;  1DQ9 A;  4GC6 A;  4LF6 J;  2D9P A;  4N56 A;  2HGM A;  2GHW A;  3R5B A;  1TEL A;  1UZH A;  4A8O A;  2XCP A;  4LSN A;  1X9M A;  1TUV A;  2XWY A;  4PG8 A;  5HJY A;  1NZ8 A;  2OD4 A;  3J7A 1;  2RT3 A;  3K7R A;  2P6T A;  3HHN B;  3NBP A;  4Q8F A;  4ITS A;  4MKB A;  5H1S V;  3OL6 A;  1PSD A;  1Q8B A;  4EBE A;  1QTM A;  4TY8 B;  1VQ7 S;  2IIH A;  3AXK A;  3NOG A;  1V5I B;  5L1I A;  2FVQ A;  2JEJ A;  4F8R A;  2JZ5 A;  3H7H B;  4LIW A;  2M7S A;  4L75 A;  3TAM A;  2QA2 A;  2HQI A;  2IAJ A;  3W64 A;  5KOX A;  3C8Y A;  4PRF A;  4C11 B;  2JLF A;  3GMG A;  2Y8Y A;  1H73 A;  3EGZ A;  1JLC B;  1X8D A;  1B64 A;  2RUS A;  4HVZ A;  4CNZ A;  4DSJ A;  1ZA2 B;  5ETV A;  5ETK A;  1DTQ A;  5DQH A;  3SSQ A;  1L3V A;  1AW0 A;  1C1C A;  1NH8 A;  2R8G A;  3MI7 X;  2HQ3 A;  4DWI A;  2ZH7 A;  5BR8 F;  3NG8 A;  1HW8 A;  1RYS A;  2J0W A;  3T5J A;  1J2V A;  3BBF A;  4W4M A;  2O5D A;  2ZH1 A;  3H98 A;  3PTW A;  3UFC X;  1GK8 A;  4EO6 A;  5D4L A;  1NK4 A;  2X7I A;  4DG1 A;  1XR6 A;  4F67 A;  2AJ4 A;  3OXG A;  3M6X A;  5D15 A;  3J81 Y;  1U0H B;  2BR0 A;  2VV5 A;  4YB7 A;  4BDP A;  4IOA Q;  1RBO B;  5HAO A;  3W2W A;  3JAM U;  5A8K B;  4DZD A;  5E3C A;  4DUZ F;  3PX6 A;  1UA0 A;  3OFE A;  2UVR A;  4X4N A;  1WKK A;  4I2P B;  4GC7 A;  2ROE A;  2X1B A;  2C42 A;  3CSK A;  1C1B A;  4FYW B;  1S9E B;  1UWB A;  1X31 C;  1SC4 B;  1Q8K A;  1ZM9 A;  3I5C A;  1KKH A;  4RWW A;  4YY3 J;  2UV8 A;  5EWG A;  3K0J A;  3D3B J;  1Q8L A;  1R8C A;  3CCE S;  3T5K A;  3G4S S;  1YJW S;  1KOO A;  2GMJ A;  3BDP A;  1VGY A;  2NXC A;  4ECU A;  3ET6 B;  1L5U A;  3KTQ A;  2G2Z A;  3GIJ A;  1NK9 A;  4B9M A;  1RAC B;  2XZW A;  1HBU B;  4X4O A;  2OP5 A;  5CQG A;  2R7T A;  4KY3 A;  4NAS A;  1U2R A;  1N5T A;  4NYZ A;  3M30 B;  2B4O A;  3BO4 A;  3DLK A;  3VR1 A;  4Q7A A;  5B0E A;  1WUU A;  4HL9 A;  1JJH A;  4PPZ A;  4IR1 A;  3DGP A;  3HCX A;  3PW4 A;  3AOA A;  1HNI A;  2E29 A;  4CI0 B;  1KTV A;  4LQ3 A;  2BQU A;  2DGQ A;  3HFK A;  4ZCI A;  2FHK A;  4FVM A;  4ED1 A;  1S10 A;  1MWQ A;  4RNN A;  2HVZ A;  1FF2 A;  3D28 A;  1SPB P;  1TL5 A;  2AMC B;  3D6F B;  4CRJ A;  1K47 A;  4MK7 A;  1WHX A;  3H40 A;  5LMN J;  1B7Y B;  3MMJ A;  4ECQ A;  1BD6 A;  3KMS A;  3K57 A;  1IKX B;  2VBW A;  1N36 F;  2LCW A;  1FK9 B;  2YX4 A;  5KG0 A;  5CAB A;  4ETX A;  3N28 A;  2R2R A;  2V94 A;  3ISN C;  4FF4 A;  3ZO7 A;  5A8R B;  1R6V A;  4ZCM A;  3JQM A;  1T9V A;  5LXR A;  2V34 A;  2KM8 B;  2KM8 C;  1H7X A;  5KFM A;  1S4F A;  2B56 A;  4PG4 A;  2FQQ B;  5KT6 A;  1WAC A;  5KG3 A;  2E5H A;  1HWK A;  2R9L A;  2NS1 B;  4LR9 A;  1HA1 A;  1PJ5 A;  4ZVG A;  4OFZ A;  3VGU A;  3EWG A;  2MLX A;  2LU1 A;  1NPK A;  5FD1 A;  3GG1 A;  2VQF J;  1SQE A;  4K8R A;  2GX8 A;  4I1T A;  3PR4 A;  4IOC Q;  3MM6 A;  4LF5 J;  1XNR F;  2HZA A;  1JQG A;  1WG4 A;  1RHQ B;  2HBQ B;  1VRT A;  1UKU A;  3AB4 B;  3HKZ D;  3MCM A;  1S6Q B;  1F5B A;  2G0C A;  1I1G A;  1DTT B;  2ZOG A;  4ZK7 M;  3KK3 A;  1S0M A;  4R8U B;  4CYU B;  4ZIT A;  3D54 A;  5ITH A;  4B9S A;  2JVO A;  3PX4 A;  3CD5 A;  3MM5 B;  4FPI A;  1IM6 A;  2W2Q P;  4ICL B;  4QCL A;  3I0R B;  5J2N B;  2HLU A;  3R5J B;  4KH1 B;  4ZP7 A;  5LSO A;  2H4Y B;  5JVG Q;  1K0V A;  2XMW A;  3PYD A;  3VWS A;  4DV6 F;  3QFH A;  4NL5 A;  2FJB B;  2JSX A;  2RF2 B;  2HVI A;  2YBV A;  3EZ5 A;  3CED A;  2F3J A;  3AT1 B;  4DV2 F;  1UCN A;  1WNE A;  5E3R A;  1T8E A;  3OL9 A;  1S48 A;  5DGB A;  1KP6 A;  2Z30 B;  3DRX A;  3HHK A;  3JTO A;  3KWM A;  1GX5 A;  1NB7 A;  2DRD A;  2XNR A;  1PGZ A;  3FZB A;  1S72 S;  1C2P A;  2R8I A;  1HNX F;  4EUV A;  5FDL B;  3GQC A;  1D9F A;  1JLQ B;  1SV5 B;  4WYW A;  3TJ9 A;  3ZTP A;  3R2D J;  1FJG F;  5J1N A;  2IM3 A;  3Q86 A;  1OSD A;  1TFW A;  1VC6 A;  1GNK A;  1GAO A;  4DLE A;  1N36 J;  1IVZ A;  4M5L A;  4OV6 A;  4K4Y A;  2YQ3 A;  3J7Y U;  1SKR A;  4JI3 J;  3M4X A;  1F9F A;  2B4V A;  1IBC B;  3CJR A;  3DGP B;  3LAL A;  4PXC A;  1S77 D;  2C3U A;  4JI5 J;  1FXR A;  4P2M A;  4Q45 A;  5FJ4 A;  3D4J A;  3O1L A;  4F4X A;  1Q5Y A;  2ASJ A;  2AGP A;  4L73 A;  2V2V A;  2VBX A;  3NY0 A;  3VZH A;  1TV6 B;  2GJI A;  3OFG A;  3TA0 A;  4CT9 A;  1NXI A;  2YX7 A;  3SQO P;  4E98 A;  3HFZ B;  3S7R A;  3P96 A;  5ETR A;  2V4Q A;  1IBL F;  3P6Y C;  2HQD A;  4Y65 A;  2DEI A;  4R25 A;  4MFB B;  4QIV A;  3PVX A;  1X9W A;  3TP2 A;  4V19 X;  4ZOS A;  2WW8 A;  3TQ1 A;  1R6Y A;  4IDK A;  4RX6 A;  5E3P A;  3OL8 A;  4NLR A;  4KBI A;  1GMW A;  1VR6 A;  2E66 A;  1FEE A;  2YQ1 A;  3KG0 A;  4OLO A;  2W2M P;  5HAT A;  3DI6 B;  1M5H A;  2YTC A;  4OJH A;  3CCW A;  2KTQ A;  4AD6 A;  1MSW D;  2BJ9 A;  3DLL Q;  2QL9 B;  2A6M A;  4GVL A;  4K0K F;  3UCG A;  5I4M A;  2OPQ A;  3C66 A;  2VJU A;  2RF2 A;  3SCL E;  1JWW A;  2F9J A;  1VLO A;  1BQN B;  4ZLN A;  4DR1 J;  3CDW A;  5J2Q A;  2XS7 A;  1EET B;  1NU4 A;  2W25 A;  3VGS A;  1HL6 A;  4DUY F;  4OZ5 A;  1T9W A;  2F7V A;  4YFU A;  4M94 A;  1HBO A;  2DNN A;  3M1V A;  3MMA B;  3FDS A;  5GME A;  5J2P A;  1DTT A;  3KK3 B;  1I5O B;  4UUW A;  2D9O A;  3QGI A;  2AEJ A;  5B0F A;  3LWM A;  2ZJQ Q;  2HNZ A;  4F25 A;  5K8P A;  4ZA1 A;  2GVZ B;  3MM6 B;  2XO7 A;  4ECR A;  4G3I A;  3G82 A;  5E2Q A;  3A8J A;  2HQC A;  4H4O A;  4YHH F;  5DO2 A;  1FHT A;  1UET A;  2CXE A;  2EVZ A;  3Q83 A;  4DF4 A;  1SKW A;  4PQA A;  4RJV A;  3P3D A;  1EB0 A;  3SQG A;  2VHG A;  3MHY A;  2EKN A;  3TVZ A;  3K17 A; 
#chains in the Genus database with same CATH homology
 1KP6 A;  4GVB A;  4GVB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...