4GVBB

Crystal structure of the virally encoded antifungal protein, kp6, heterodimer
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
74
Chain Sequence
PRPVMCQCVDTTNGGVRLDAVTRAACSIDGYYTEKDGFCRAKYSWDLFTSGQFYQACLRYSHAGTNCQPDPQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Atomic Structure of the Virally Encoded Antifungal Protein, KP6.
pubmed doi rcsb
molecule tags Toxin
molecule keywords KP6 killer toxin subunit alpha
total genus 16
structure length 74
sequence length 78
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.440 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Killer toxin KP6 alpha-subunit 4gvbB00
4GVBB 4GVBA 1KP6A
chains in the Genus database with same CATH superfamily
3CCSS 3KK3A 4A46A 3QGIA 1J5OA 2H65B 4ZIWA 3DGPA 1UW9A 2MQPA 3IG1B 2YNHA 1RAEB 3DLBA 1VFJA 4MKYA 3F73A 2PEBA 1LWFB 3CIMA 4Y2AA 4WYWA 2JJ4D 4WJBA 1G1XA 3KJVB 5IC4B 4YFUA 4TU8A 4R0JA 2D1CA 3MI7X 1HKAA 4DX7A 3BQ0A 3MM8A 1KQFB 5EWEA 1KQGB 1S6OA 4IFVA 2ERRA 3KDNA 2FGCA 1ZTWA 1YI2S 4LF5J 2BKOA 1JQGA 1UPPA 2QMXA 4TXSA 1RQ0A 4J90A 3BSNA 4NASA 4GMKA 1PC5A 4N8NA 3N6LA 3GFZA 5B0AA 4ECVA 4UW2A 3PO4A 3GE9A 4A4JA 4MK7A 3MUVP 4EZ9A 4RX6A 2ZE2A 1RAOA 1VLOA 3OR1B 4N8OA 3IG1A 3UD4P 4KJIA 2VG7A 4OZ3A 3FCWA 2D3ZA 2QL5B 3GG1A 4LRCA 3Q2SC 4QU7A 4TLQA 3SCLE 3CDWA 2F8MA 5A8KA 2ZH6A 2VBXA 2CQCA 2CPEA 3I9ZA 5E3CA 4UF4A 2V2KA 1X8DA 1WEZA 4ZCMA 1EIYB 2Q66A 4LSNB 3W2VB 1NDPA 2IMOA 4ZVSB 3R9LA 2HVHA 4NRTA 1X9MA 2DGOA 4J9OA 4YOEA 2BW7A 3MFIA 2ZHAA 1RHUB 2GS8A 2OAUA 3CMAS 3OTEA 1NK4A 2UVWA 4IQMA 2AJ4A 4LIRA 1NKBA 2IY5B 2DH8A 1T8EA 3MMAA 2NS1B 3T5HA 2CZVC 3VAJA 2QYGA 2CQ3A 3DMJB 1FE4A 2BE7D 3FEYB 4FF4A 5ETSA 1HQUB 2MLYA 3U02A 4WXWA 4DR3J 2VD3A 3BJYA 5BYSA 2XNRA 4O3SA 2AW0A 3U1LA 3VAKA 4P10A 3GYXB 4ITSA 1NK8A 2B51A 3R3TA 2ACYA 1RABB 3DRYA 2KTQA 2V50A 2A18A 1S77D 5H9FK 2XZWA 2K7KA 3ENAA 4Y00A 1P9QC 5DZ7A 3D67A 3DRRB 3UR0A 4O0IA 1XNQJ 1BE4A 3TO8A 1VK3A 3V5RA 4Q0BB 4XAKA 1T03A 2IM0A 1W26A 2VC0A 3QIDA 4A8YA 1PBAA 3RBEA 1A9NB 1SV5B 2E1CA 2VODA 4B3RJ 2I0XA 3KK2A 7FD1A 4DQIA 1FRHA 4HTJA 3QLHB 3DMJA 3ZZUA 1CS4A 2DYAA 1VHFA 3SBMA 3EMTA 4PYDA 1HWLA 1VS3A 3OL7A 1IBLF 1EARA 1YBAA 2IC3A 2DY9A 3DOLA 4OYOA 2UUBF 2G2ZA 4K7QA 4I0WA 4V1Ak 3A3NB 1B0VA 1F0XA 2Q3PA 3NCQA 4LRAA 3EZ5A 1MROB 2J9EA 3PDNA 4USTA 4DV1F 1IR0A 1T9YA 3CC7S 3V6JA 1KVIA 4ZPWR 3HMJG 2DIVA 3HPOA 2DXFA 1FRKA 2OLWA 3NGDA 4WKYA 1OY6A 3MECB 3OFEA 3QZ8A 3C46A 3JTOA 2V0NA 5EHHA 2YH1A 2FC9A 2V63A 1NK5A 2JC1A 3OTOJ 4Q8EA 2HQDA 5IC6B 2G9OA 2CDQA 2N4CA 2OUGA 3K7RA 3LP0A 4S0MA 2XO6A 4DFMA 1O0PA 3V6DA 2A10A 2ADCA 1PC4A 1JLCB 2H4YB 4CLSA 1HPZA 1QD1A 2XS5A 3QT5A 3SEOA 2H3EB 2IC3B 5KT2A 6FD1A 4RL1A 2F63A 2YKOA 1S1WB 4RUAA 1RT5B 3CW2C 4BLGA 3PJ9A 3QT6A 1ICEB 1TKDA 4ICLB 3G82B 3RB6A 4B9SA 2OD4A 1UPMB 3C66A 3GJQB 5ETTA 1SKRA 4HEA9 4FKXA 2PA3A 1X9WA 3Q2TC 3NG8A 2FJXA 4ED0A 3OD2A 1QAYA 3L7UA 5KFMA 5A2QU 3IRWP 4DL2A 3PVXA 1M1KT 2KL8A 2UXCF 2OPQB 1OY9A 2CZ9A 4CIOA 1U1NA 2IJFA 1X7VA 1FESA 3G6XA 1RCOB 2KDOA 3I82A 1S6PA 1SKWA 2LFVA 3DLLQ 3DLJA 5CYQB 3M1VA 4RUCA 3PX4A 4CTAA 1C2PA 4CI0B 2HHVA 2HQ3A 4HTIA 3CJSA 3BKUA 2FVSA 1FK9A 4F04B 3AJ1A 4RU9A 3PW2A 2V8GA 4BHQA 4NXNJ 2DB1A 5HROB 3HD1A 1JIHA 4IYQA 4QYZK 4DV6F 5H9EK 3AOBA 2BYCA 2V68A 2X1BA 1R3NA 4HI1A 3TW0A 3SSSA 2YBVA 2WSEC 4CP5A 5E2QA 4ZS6A 4O3NA 2EW9A 3WX8A 4GKKF 4O23A 5IM0A 1SPBP 5LOQA 1AUSL 5FDLA 4WZQA 2VF3A 1XR6A 4NLOA 3G86A 5B0BA 1RTDB 2Q1LA 4ZCLA 3CC4S 2XS2A 3OT9A 1EB0A 5A2QY 3N5BA 4RNMA 3PY8A 1L5UA 4B9VA 3R6GB 3PKYA 2LA6A 1KP6A 2XEXA 4C11B 1ZAWA 1BGXT 3K8WA 2BA9A 1HBOA 1HIYA 2W7OA 3KYLA 4KHMA 3Q86A 1LW2A 3ZZOA 2G1HA 1GMWD 1UWBA 3V4IA 2JFDA 3HX9A 2DHGA 4PQUB 4FZVA 1UEVA 1PO6A 3RRGA 1QTMA 5D77A 1NSKL 3D28A 4RU2A 1KOOA 2KJWA 2KT3A 5B0DA 5I3UA 4B3MJ 1T3NA 1HBUA 4HI2A 2D7SA 4C3LA 4CH0S 1BQNA 1FNOA 4PCQA 2BVZA 2IAJB 4TNOA 3KJQB 5F3ZA 1JMTA 2G1DA 3BBFA 5E3RA 4O3QA 5DG7A 2XMKA 4ZVGA 4ED8A 4CCHA 3MXHP 1CJKA 4J9KA 2PA8D 3W5XA 3OBIA 3K5MA 2E5JA 2GCFA 2DGVA 1RWOB 2OO4A 5ETRA 3RR7A 3DLKB 2OH2A 2LVWA 1TFYA 2ZDOA 1UVKA 2HRYA 1H7WA 4CLYA 1LOUA 3Q8PB 4G1PA 4CDIA 3BEGB 2ZOFA 5KFTA 2DCUB 4UOFA 2QLWA 2NYHA 3AOCA 1CJVB 3UN3A 4R5PB 3BGUA 3NWGA 1JLAB 4WP8A 1S57A 4FVCA 4DR1J 1XR5A 2C2KB 2GIRA 4O4GA 2HHWA 2VFSA 4QWAA 4K4XA 5D4PA 1DLOA 1VGYA 3CCQS 1GK8A 1R8AA 1N52B 2DGQA 3QLHA 4ZPVR 4ZIVA 5DQGA 4A8WA 2RQKA 3M9OB 3GMGA 2DNQA 4USHA 4KGMA 4ES3A 5M2RA 1T9UA 2NYIA 3W5YA 4DV4F 1KLNA 1LWCA 2OSQA 1KQSR 1MSWD 2MKSA 4RNFA 1V3RA 1TKZA 4TQRA 4ELUA 4PWDA 2M7SA 2J0XA 1R8CA 3W7BA 4JI3J 2O1PA 4I4BA 2BUNA 2ZKUA 1Q5YA 3GWCA 4QWCA 3H98A 4M95A 1NH7A 3VGTA 2GJFA 4ZCKA 4CH7A 5HSPA 3GYGA 5F8GA 3TAPA 2HQIA 3DC2A 3POTB 2PFFB 1URRA 1HNIA 1H6KX 2AJ1A 3O2IA 2ROGA 4DWIA 1IKXA 1R8BA 1MW7A 3NCRA 4Y2CA 2H9ZA 5ETLA 2Y9HA 4LVOP 2HG4A 1JNRB 1MLAA 4YDXA 2DTJA 5L38A 1VQ5S 4B9UA 2IMWP 5I3QA 4HKQA 2LQ9A 4A8OA 3V6DB 3G2XA 2KYXA 4OL8A 5JMNA 1IJEB 1RE1B 2B7CB 3UR3C 2Y0SD 1GAOA 4JB8B 2PI5A 2E9TA 3J81j 4NL5A 2HSEB 2MHNA 2ZJRQ 2YKNB 1C4CA 1CULB 4O3RA 3DU5A 1WI6A 2FYXA 5FLXY 1EX8A 4TU9A 3BN4A 4GKJF 1HNWF 3WC2A 1OSDA 1WG5A 1LWXA 1DHMA 2Z2ZA 4DPUA 4CQ1A 4XPEA 2CQHA 2E1AA 5D0EA 2K1RB 2YWHA 1L3SA 4C8OA 1SUQB 1N48A 5AJ3F 4DUTA 2FZCB 4FXWA 4FYVB 2ZWPA 4WFYA 4KIAA 1IKXB 5CA5A 1NLKL 2E9ZA 1RT4A 3JSRA 4I56A 5C2GA 1JJCB 3AY0A 3G8SA 2IBKA 1F2GA 4KO0B 3M32A 4WXOA 5J2MB 1SJFA 5HO4A 4TU7A 3DN9A 2RNEA 1RU2A 3C15A 4MFBA 4ANEA 4OI2A 1IVZA 2BANB 1S49A 5BXIA 3GONA 5D6GA 2IM2A 3FSYA 2YWEA 2V9KA 3TEHB 2R2TA 2FUG9 2AWZA 1X4CA 2XZDB 3K5PA 3LOUA 1CVJA 1XMQJ 1VIXA 1VQSA 3H5SA 3M2UB 2V8DA 2ZH7A 3TAMB 4M5IA 4OZ2A 3M6UA 2GJ2A 2FLOA 2KHCA 1Y10A 3ILOA 2E5LJ 1BXNA 4UT4A 5CYMB 1N5YB 2NQPA 5EWGA 2E1MC 2WB1D 5K8MA 5F8MA 5J2QA 4TN2A 5DS7A 3B78A 1ZM4A 4E98A 3PIPQ 4KO0A 1IM6A 3V6HA 4K5RA 2DR6A 1UWAA 2CPJA 2HVIA 4Q8FA 1VK8A 2ZDPA 3M8PB 2RAQA 2PC6A 1FTRA 2OFGX 1RHMB 1TL1B 3WZ0A 1XMQF 1EJ7L 5M2PA 3TRGA 1NO8A 1R0AB 1AB8A 3BM7A 3M2UA 3NLCA 1N36F 3CDEA 1S5ZA 1CC7A 3MCOA 3ELHA 4NLYA 4XDDA 3CEDA 3MM9A 3BKTA 4IG0A 2H5EA 2IPOB 2QG9B 4G65A 5HK4A 2WOMB 3QQCD 5M2UA 4KPYA 3C6UA 1KFDA 3K57A 2HHQA 1RWXB 3B54A 5DDQC 1JLQB 4F4WA 5IT9Y 2J8SA 1C0TB 2LXIA 2OPRB 1VQ4S 5D15A 4YR3A 2DNMA 4HYKA 2NSCA 5A8WA 3R5DA 4DN0A 5DM7Q 4NCGB 4OZ5A 4M5LA 3ICLA 1IWAA 4OQJA 5J1PA 1S9FA 2HNYB 1UJ4A 4DV7F 1S4EA 2XY5A 3BGRB 1JB0C 2KI2A 1QUVA 4KV8A 4JI6F 3J81U 1E6YB 2R2RA 1VBYA 1I6JA 2LEBA 2EC0A 2DK2A 1UKUA 3FEXB 4IRKA 3IRXA 5GMEA 1I1GA 3MCNA 2UP1A 1BY9A 5EGYA 2DKOB 1TQLA 1VBKA 5D3GB 4QW9A 4DOZA 3C3LA 2GO8A 3H2VE 3VALA 2QTWA 4OX8A 1DBDA 1NMEB 1YRUA 2VFUA 1HQEB 1Y3JA 3JB9k 5LJ5Y 3A12A 4MYUA 1SIZA 5J1EA 1N5SA 2QA1A 1CJVA 2J9DA 3KLFB 1CPZA 2L9NA 3L09A 4PUOB 1ZPWX 2HZCA 2LLZA 3ET6A 3QFHA 2DHXA 2C3MA 3FJ2A 1VLYA 1U2RA 3H7HB 4RW9A 4F7VA 4B3SF 2G2YA 1KQKA 2ZHOA 3M2RB 4W90B 3UNGC 4J91A 4LF7J 4OZJA 1T9XA 3MCSA 2CG4A 2YNFA 4RZRA 1FKOA 2WSCC 1HQUA 2C2ZB 3MM7B 3PO5A 4JP8A 1RWUA 2AP6A 3GR1A 3DLHA 3FC9A 2YKMA 4HT5A 3W65A 2VQEF 2C3YA 3PX6A 3OQ2A 1RTZA 4X66F 4FYWB 1A6LA 1TKTA 3THPA 2DNNA 1SJRA 2LEPA 3OHAA 3W8GA 1M1GA 2J6TA 4UOCA 1FXRA 1NZAA 1Y4ZB 3AT1B 1N4LA 4X4QA 3EXCX 4LF4F 4ILMA 5J1EB 5HAOA 4CZCA 4G3IA 1QLNA 2KFNA 4UQGA 2LU2A 3I4HX 1M5PC 4P74A 4Q0BA 2WRMA 3A3PB 2GHVC 2P9GA 1S97A 5HLFB 2RDIA 2BRLA 2WCXA 3KHHA 2XMJA 3HVRA 4D3GA 2VPXB 3DDIA 3KK2B 4R8UB 3OLBA 2XGPA 3CC2S 1FKAF 2OGUA 3CE8A 1WOOA 1G2EA 1HWKA 3ULHA 4N56A 4DR5J 1RLCL 2VFRA 4K50A 4KC5A 2P5VA 5D8HB 2W1BA 3D66A 1RTJB 4NZ6A 2KXHA 5HI7A 2HBYB 8AT1B 5C25B 4YEAA 3JQKA 1YJTA 1YDLA 1FF2A 1AA1B 1MN9A 3HHLA 3I0SA 4OIXA 4WIIA 2W9CB 1U47A 1JJ2R 2C2MB 2BXJA 2FY8A 3NBPB 1B70B 1D8ZA 2ZM6F 3BYPA 4CWBA 5D0GA 1YITS 2GMJA 4RPFA 2EFPA 4DQSA 2QL9B 1SJ1A 1U0HA 3O6QA 4ES1A 2ZD1B 3MECA 5H1SV 4JI1F 4U96A 3OVSA 2XBPA 3ZTOA 1S59A 1WDTA 4TLRA 2BEFA 1ZH5A 4R25A 2Q6CA 4B9LA 2HGLA 3BSCA 2OHDA 1TFWA 3DOMA 4NLVA 3VVUA 2XO7A 3NCPA 1S48A 4M94A 4UZBA 4PPDA 2ZFHA 4BC9A 3V81B 3GG0A 1F9FA 1NEEA 1I51B 4DUYF 1LK5A 3O5TB 2JWNA 1N36J 1Q82T 2AJ0A 4OYPA 1RT5A 4K4SA 4DSEA 2HRUA 1R0CB 3IR5B 2HGNA 2M88A 1IXKA 3S8SA 2MKCA 3BREA 4LSLA 4WPAA 3L7OA 2Z8QA 3C6TB 3MUMP 5AXMA 5J1NA 2KG1A 3SI8A 3MM5A 2GHWA 3QT7A 5HMZA 4LBHA 2Y1JA 2FJWA 4ECWA 3H42A 3AD8C 2RT3A 3HDSA 1VI7A 3GCXP 1RHKB 4Y34A 3H5XA 1JLGB 4NLQA 3TJAA 1UL3A 4LMZA 3A3OB 1RYSA 4ZP9A 2VBZA 1FFWB 4CLLA 1CLFA 2ACMA 5CYQA 3SDEA 3R2DJ 3R7NB 2IA6A 1FRLA 3K17A 1RT3B 3H59A 4P71A 4OI0A 2YNIA 3L3CA 4JI8F 4P9SA 3W1YC 1FK9B 4FP9A 1MWQA 3IS9B 1S6UA 1OPIA 2GMLA 4ZITA 4RUHA 5KG7A 2WVCA 1Q8BA 4LRDA 4DV3F 1RJJA 2IRUA 5KFDA 3BN7A 4HT7A 4KR0B 1F5BA 4U8VA 4DBQA 1APSA 3UQSA 2KU7A 3RZAA 3FKBA 4C2MA 3C6UB 4OYBA 5GADI 2HNDA 2KVQE 2WHOA 1ZETA 1UA0A 4WCEQ 3RB3A 2UVUA 2UXCJ 2APOA 1K0VA 4FF1A 1S12A 1HHQA 2Y1RI 3G4SS 1LWEB 4ANDA 4QWDA 4CLFA 1MWYA 1B0PA 3CD7A 4OYIA 1PG5B 1J5OB 3LAKA 5C24B 2IBOA 3TZXA 3MMBA 3UWTA 1N0VC 5F8LA 1CJUB 3LWLA 4GVBB 2V4JB 1RT3A 2ZC3A 1LW0B 5IOLA 3R1LA 1X5OA 5AXLA 1FRMA 2NLWA 2HZAA 2XULA 3KJVA 4B9MA 1WD6A 1Q8IA 1Y9OA 3M2VB 3PW5A 4F4KA 3PNIA 2RHQB 1YIJS 1FFGB 1G6BA 6AT1B 2BJ1A 3SXLA 3EVOA 2FVCA 2EI5A 3CJ4A 2OPSA 5HP1A 4CLWA 2GQQA 2W8KA 2B9YA 2BQ3A 3AFGA 4C8LA 1YG0A 2XSJB 2X7IA 3HHLD 4LBIA 5IWAJ 4IRCA 1N33F 1DTQB 1LWEA 3NS5A 4DPOA 2GIFA 2AKWB 1BWVA 3PXGa 1QTNB 3C16A 2N7CA 2IRXA 1SJ4P 1VCTA 3MGJA 4OI4A 5GMDA 4HH0A 3QAEA 3LP1A 4OYAA 9ATCB 1H2UX 3DRPB 1RT6B 2BV3A 1CS4B 3D0HE 3QSYB 2CPZA 2UUBJ 1WEXA 2XI3A 1S1VA 1LW0A 4JI5J 1S1UA 2CQ4A 2J9DE 4W4MA 3BH7B 3QSIA 3TOQA 2CADA 1YKWA 3OPKA 3FRZA 3TZZA 2R8KA 1RAJA 5HVGA 2MZTA 2X51A 2J7UA 4ZLJA 5AE2A 4NYOA 3TA2A 4IDKB 1KTQA 2ADBA 2BOPA 4DR7J 3VGVA 3P8BB 1PYOB 2MZ1A 1IBCB 4OFZA 4GC7A 1ZYQA 1ZS6A 1CJTB 1JXEA 1HBNB 2EPIA 4L3KA 2QN6B 4PAAA 2ZH2A 1GNKA 4ED1A 2Y0BB 2YX4A 2H5JB 3EJMA 4OX9F 4WFAQ 1VISA 2BX6A 3BGFA 2CPIA 2JRSA 5B7WA 3TVYA 3O44A 1AFIA 5IQ6A 1JLBA 1RAGB 2QJ3A 1WC1A 4QBUA 5JJBA 4Q45A 3EYZA 1VOMA 1Q16B 3D6MB 1ZAVA 1RLDA 4KGVB 1X4HA 4ZHRA 5C7PA 5HMWA 1NB2A 5AT1B 3DXSX 3G6ES 4F4ZA 1I5OB 2DGSA 5HN0A 4RW6B 5T7LB 3D1OA 2XQCA 3RAQA 3N79A 3VAIA 3G82A 2DHSA 4USKA 2PSZA 4WP3A 1YRXA 2RQMA 4GRSA 2G0IA 3D1HA 2BE9B 2YH0A 2HQCA 3P3DA 2HRTA 1M5KC 2G4BA 1UAWA 2GVDA 3H90A 3AJDA 3KXDA 2WZ1A 1WF0A 4Y2KA 3UI3A 4F2SA 5KFXA 1RWVB 2FHJA 4AFFA 1UZHA 2LCWA 5DGAA 4DR2J 3NXZA 3DOMB 1HHSA 1MU2B 3QWUA 1NHKL 2L9DA 2ALZA 3Q22A 2QGFB 3MFHA 1QVGR 4QIFA 1PYSB 4DHVA 3UD3P 2MZJA 3L95X 2HVZA 4YDDB 3W61A 5A6PA 1KHVA 4AQYF 1PBUA 3SQGB 5KG5A 2MQQA 4QR2A 2HW3A 1CEZA 3KG1A 1RT1B 4Y0FA 1S72S 2HBRB 3H2UB 1AXQA 3SFGA 2J7KA 3T1HF 4ILLA 2NZCA 3D3BJ 1E6VB 3EGVA 5EN1A 2ALYB 4USJC 1P27B 2GVDB 2A0FB 3CULA 2CJYB 3QAUA 2PEHA 3W2WB 4U7UK 5KFNA 1HR0F 2B6AA 1ZZFA 1S0OA 4TYBA 3Q8VA 4LREA 2HFUA 3C15B 4PXEA 5A76A 3CJKB 1WOPA 4FYDA 1JLCA 3F0NA 3D0GE 4EZ6A 2QRRA 1RWNB 4CO3A 1JXLA 3HZEA 2I5JA 2XY7A 3GYNA 3FZBA 4NPOA 1IKVA 1T11A 2HFZA 5C42A 1F1BB 2H4WB 1EKRA 1VQ7S 2V9WA 1Y5NB 2W4CA 4HVZA 3NAIA 1NCLA 4I68A 5KFEA 2LP4A 3FCHA 3EWGA 3L9ZA 1AZSA 5MLCV 2D9PA 3NMAA 1N5YA 5GAEU 2PT0A 1SQFA 1T9WA 3VGUA 2ZOGA 2RSQA 2XNQA 3TX0A 1WTFA 2VQFF 4N5SA 1DTTA 1HNVB 3LA0A 2ZVIA 4WK1A 5HANA 5KFUA 1IBMF 2O3DA 4L72B 3B4DA 2EK1A 2NPIA 2YKQA 1BLUA 3MM6B 4J5OA 4RLEA 1SJ3P 2IAJA 1V9OA 2DITA 4URSA 2DISA 4QCLA 2DNZA 2VG7B 2J6UA 4TY9A 2I8EA 5DJBA 5CCMA 2GHPA 2V4JA 1NJWA 4ED4A 3Q23A 2YPYA 4WTYA 1YJWS 4OJ3A 4MK8A 5C42B 2R8IA 3SZ2A 2MZSA 2CPYA 3S01A 3OUYB 3SV3A 2MKYA 4KYZA 2FY1A 3MUTP 2HHHJ 4WP9A 2OTLS 4P72A 2FPHX 5H9FJ 2QEXS 2LU1A 3ILLA 1HW8A 5ETMA 2H54B 4MK9A 2KB2A 2HFSA 4Y6IA 1M5OC 5J2PA 2ILZA 2XSJA 2O5DA 2MXYA 4IR9A 3TQ1A 4NLTA 5A8WB 4DUZJ 4O4GB 3T5KA 1UETA 4DF4A 2WBMA 1X4GA 3CJRA 3WC0A 3FGVA 5KT7A 3BGRA 3T5LA 2I2YA 4A8SA 3U1NA 4IRDA 4F02A 1RBAA 2QSFA 3CJ8A 2LKZA 2XMMA 2DGWA 3JYTA 3J7A1 2BMBA 2ZUGA 1OIAA 2V4QA 1S6QA 3IRXB 3PCOB 1M5VC 3CCWA 2YXLA 3J80Y 4KKOB 2A6OA 3GLJA 4EBCA 2PDAA 2EBGA 1U24A 2R7TA 2L08A 1TMMA 4I6AA 4RNNA 1SC3B 4EUVA 4HLBA 2OEJA 3MCMA 3THTA 5ETKA 1FD8A 5B08A 3OVAA 3OJUA 3MR6A 2Z56B 3R5CA 5GAGU 1WDDA 4FF3A 5RUBA 4DG1B 1RUSA 4B9TA 1HYSB 1GMUA 3CDBA 5LL6d 4A8XA 1GEHA 3I55S 1S7IA 3VZIA 3CO0P 2O01C 1FWLA 2R7OA 2WVEA 3ITHA 4HDGA 4X4PA 5HBMA 4ZLLA 2L41A 8RUCA 2MMYA 4P75A 2DJWA 5HATA 3GP9A 1X0FA 1V6HA 2R9LA 2DHAA 4ANCA 2QFJA 1FKOB 1RAIB 2VBWA 2RIJA 1CBKA 3QGPA 5KFWA 5JVHQ 2M4MA 2AYBA 3MTJA 3Q8RB 4YN3B 1IBMJ 2Z2MA 1D1UA 4DR3F 2C2OB 2LDIA 4M5NA 2CG8A 1WC4A 1N5TA 2DBBA 3EE3A 4WE1B 5B09A 2D3O1 3NGKA 1RBOB 1U02A 2GC8A 2Q6BA 4E8UA 1OPZA 2F4FA 2M8DB 1OO0B 1Q95G 3MD3A 3MAAB 4EYIB 1WOSA 5CYJA 9RUBA 2B5JB 2K06A 3OHBA 1VQKS 3QIPB 1RT4B 3MPUB 4NEYA 2AGPA 4MKAA 1UVMA 2A6MA 4JI2F 3HJFA 4C3KA 3NAHA 2G0CA 4DCPB 2DR5A 4V19X 1SH0A 3IO1A 2KZMA 3AODA 3OW2R 1SVDA 4F3OA 4LF4J 1OWXA 1YJ7A 1FRIA 2CQIA 4QIGA 1S79A 1X4FA 4C8ZA 2BZ2A 2OI2A 3LTOA 3PW0A 3K0JA 2KO1A 2IA0A 2DNOA 2OPPB 3DRSA 4OJ1A 3BH6B 1MG7A 1YRTA 3BS9A 3HSDA 3MEDB 4RWXA 3TAMA 2BW2A 2VQEJ 5HJYA 3FEZA 2K2PA 2G2OA 2HS3A 4WE1A 2CQ0A 2N3OA 4DSLA 4P73A 3R2CJ 2ZJQQ 1NH8A 1NU4A 4CT9A 5KFAA 5CYMA 1QSLA 1FJ7A 2BJEA 4MJKA 3JQMA 3SSQA 4CT8A 5F9NA 1YJVA 2CUYA 2VU5A 4GO5X 4Y65A 3KUHA 2RF2B 2W8LA 4QU6A 1T7PA 3NNCA 2ZD1A 3N6MA 1HBMA 2DNKA 2OPQA 5KG1A 4EO8A 5DG9A 2HFOA 3D1QA 4HDHA 3K5NA 2DO4A 2MY8A 3NGUA 5DDPC 5DDOC 2VC1A 1XMBA 3ETOA 3W66A 3ZZPA 1YSJA 3BGLA 2FTRA 2A2CA 4MKVA 4DLGA 2R2SA 1B7FA 5CQGA 3EGZA 2LDYA 2G13A 3V81A 4Y2MA 1O51A 1XBWA 3UPFA 1VQPS 1F5CA 2VKZG 5EWFA 4UY8T 4CLTA 1IN0A 3C8YA 3N6NA 3DHXA 1FJEB 4DR4J 2ZH1A 3LGHA 4ID8A 1XNRF 2GGPA 1GXTA 3GIRA 3RBXA 5E3PA 1DAXA 1H73A 2XHWA 1RTIA 3DOKB 3FBBA 1GX6A 1DQAA 4J37A 4QQBA 3ZTPA 4CO1A 2ZBQA 2JDJA 4DPTA 1VRTA 3TNVA 4RNOA 4TQSA 2R7RA 1RAAB 2YWFA 5JUMA 2Y1IA 3FUYA 5CXTA 4U6PA 2UUAF 2OPRA 3KOAA 2LQBA 1ZM2A 3R7BB 5LXYA 4GC6A 2R8JA 2XWYA 4M63A 4DV0J 1Y5LB 3M6VA 2HQFA 3DCAA 4MAKA 4RR5A 2F9JA 2N82B 5KFRA 1DQ8A 1X9SA 1HQ2A 4ID5B 4XPCA 2FLLA 2R7UA 3MD1A 5KOXA 4NCAA 1KVJA 5CABA 4OX9J 1I94J 3JTPA 4N47A 2ZBPA 4WFBQ 3OV7A 2MQNA 5KFKA 1ELOA 2NUUG 2PIIA 2BJ9A 5KFQA 5LJ3Y 2ASYA 4YHHJ 4KY3A 2XCAA 1WHXA 3MEEA 2FLNA 4JI7J 4KHPF 2EEYA 1U0SA 2WONA 4OX7A 3O1LA 4DPWA 2V2QA 2JL9A 3OTBA 2CJ9A 3GQCA 1VRTB 3V4IB 4F0HA 1KLMB 5K20B 3KLFA 4H54A 2HURA 3HD2A 3PIOQ 2Y8WA 3CO9A 3GSDA 1KDNA 4Z7CA 2M2BA 2MLXA 1M5HA 1LXNA 1BQNB 1RHJB 4DL5A 1YJNS 4DL6A 1FRXA 3QZ7A 1F6TA 2EK6A 3H2LA 5KFBA 4P2SA 1O5JA 3HVAA 4F4XA 5J2MA 4LFBJ 1H2VZ 1O6XA 1R89A 4ZVRB 1NHUA 2HBZB 4YUDA 4MIWA 4ZPCA 2AYGA 4O44B 5IWAF 3KNAA 1N33J 4P2MA 3DLKA 3KHLA 2BQUA 3DDKA 1WWHA 3PACA 2VOOA 2R42A 3HK2A 5JXSA 2WOMA 4MH8A 3EPIA 4CYUB 3B6BA 2QFIA 1Q8KA 3Q8UA 1C1CB 1X60A 2HQGA 3QMQA 2RH3A 2RQCA 2ASJA 2IDLA 1XIQA 2RRAA 1UVJA 1JLAA 1KKHA 2MKJA 3TVKA 4ES2A 2J76E 3IMQJ 1VMBA 2BACA 2LQ5A 3J7YI 5J2NA 3EZUA 3C16B 4LF9J 2NR0A 1DLOB 1XN9A 4NYPA 3MAQA 3S1TA 3T1YJ 2K8GA 5LM7E 3GFYA 1QM9A 2UV8A 4IOCQ 1UP1A 2XYGB 5CAAA 3LGNA 4CH1A 2YNGA 1XK8A 3UCGA 3GV8B 2W2MP 2N4DA 2J0QD 4KFBA 2JLGA 5F8NA 1G3OA 1LFPA 2VG6B 4Q7AA 1IR1A 3I31A 4PG8A 1RHQB 4NX9A 2RRNA 4QW8A 4YY3F 2HHTA 3F56A 4PEOA 5A8RA 4DL3A 3MTKA 3GJTB 3KDOA 2CNNB 2JNJA 1NJYA 1S10A 1VR6A 4NXNF 3EDQB 4DX8H 5FJ4A 1K47A 2CQDA 1P1TA 3B4MA 3DDNA 4PPZA 1C1BA 2P9EA 3KUEA 4C48A 3FK4A 1RWPB 1GTEA 1QSYA 1T03B 4C4WA 3AD7C 4OLPA 3JS9A 1DFDA 3M8YA 1REVA 1FVQA 4IOBA 4PQAA 2HYIB 4IOAQ 3ZNUA 1QAIA 3DYAA 5I4MA 3KJNB 3RRKA 3ISZA 2HHUA 3JSYA 2XTJP 4LIWA 4X65J 1U4BA 1KTVA 1DURA 4EBDA 3KLIB 3QFWA 2ZH8A 4DCJB 2AYEA 4X84A 1UEUA 3AQPA 2MKIA 3LANA 2RU9A 3MURP 2V8PA 1ZAXA 3KKFA 3FQLA 3LO3A 3CCLS 2YQ0A 3E51A 3FBCA 4RO0A 3TUPA 2I38A 2K1RA 1JLEB 4C8MA 2AZ1A 1OY8A 2X3DA 1TV6A 5KFJA 1FFSB 5LMUF 4DV2J 2PD1A 4EGLA 2FZGB 3P49B 5MAOA 4CM0A 4ZPBA 3TAQA 2ASLA 1T0TV 4DR1F 3BPSP 1YK9A 3LW5C 3N4WA 5E3QA 4JV2A 2B3TB 3CD5A 1YZ7A 4I2QA 3R8YA 3RAMA 4DUYJ 1U49A 3A1YG 4L74A 4LR9A 1JLFB 3CJ5A 4CNZA 3THVA 1WKKA 1I94F 2OMLA 1LWFA 2YQ1A 4DZ6A 2W7AA 2Z4PA 2VA2A 3BZQA 5KFIA 1Z1ZA 4JI1J 4FNHA 4PABA 1RAHB 4AD6A 4MYTA 1WHVA 4CO0A 1N88A 1XMOF 2MDAA 2OKQA 2LYVA 4C9DA 2RILA 1NZ8A 4R0EA 1RB0A 2ZC4A 3OVBA 1NDKA 3CF5Q 1B0TA 5GMKa 3T1AA 1FX4A 3UO0A 1VQYA 5L46A 1H74A 2ZBIA 2JEIA 2KH9A 3P45B 3QGGA 3TZWA 2AEJA 4L73A 2VFVA 1Y7PA 5HL7Q 3CUNA 3RB4A 1WORA 4DR4F 1V3ZA 3AB4B 4LR8A 4J9RA 1T9VA 1KR4A 2YVSA 4UZCA 1N6QB 2J5AA 4DZDA 1UA1A 1JLFA 4PG4A 5KFFA 1WC3A 2BQRA 2ZHBA 5CD4H 2I1RA 2P6TA 1Q0NA 4FYYB 2LQJA 5BR8J 2KHDA 4QYRA 1NB7A 4ZDNA 3L4BC 3DI6B 2IVYA 3FMBA 1EAYC 3JAMU 3PR5B 3CJ0A 3VAFA 5L8RC 2GNKA 3M2VA 1WC6A 1Q4RA 3EVMA 4UTGA 4DMZA 4EI2A 2BE2A 2Q43A 3CTRA 4FXVA 2AIRB 1JLQA 2OPSB 5HP1B 4ZP7A 1AUDA 1SCJB 2MSTA 1TMJA 3VCDA 1WUUA 1DTQA 2BJDA 3ETMA 3NGTA 2NPFA 3BPDA 2DNRA 2C42A 3PM9A 4J9MA 4LBPA 4WYLA 3TUZC 1UVNA 5KT5A 3JAMY 3MM6A 3P6YC 2LXFA 2QV6A 3DGPB 4M5JA 3FBFA 4ED2A 4NE9C 2B0GA 2KRBA 2QMUB 2MY7A 4K4VA 2V5HG 3BGOP 1U1LA 3T9NA 4X65F 3H25A 3FQKA 4ED5A 4QR0A 3SCIE 1H0HB 2M0GB 4K8RA 1HHTP 1RKIA 2ZEJA 5A0YB 3M9MB 1LW2B 2PGCA 3M6XA 3DRRA 4NLWA 2V4RA 2AJFE 2QYCA 2BOAA 2AU0A 1IM4A 1U7LA 2ZOMA 1JNZB 3I96A 2DEIA 3R5BA 5J2PB 2KJVA 2U1AA 4RBVA 2VONA 2JFKA 2FVPA 2CNLB 1CJTA 3ET6B 3MR5A 2UVRA 4AUKA 5ETPA 4DL4A 2R7WA 5J2QB 3VAGA 4N41A 1TKXA 3MEKA 3P96A 4NLSA 3BO2A 4FBTA 4RW8B 3HHNB 2ROEA 3U27A 1FT8A 2QE5A 2X1FA 5IT0A 4BS2A 2YNGB 2B8PA 1UJ5A 3BKFA 1S6QB 4U7UD 1U1MA 4IR1A 2HZVA 2BJ3A 2W4DA 3CCTA 2YKMB 5D78A 4ATNA 2XLIA 5G0RA 2VPWB 3I56S 3IM9A 4X4UA 4Q2LA 1VRQC 4DU8A 3DLGB 4ETXA 4F67A 5F8IA 1W2IA 2EVZA 2DPIA 3J7AN 3OL6A 1KSPA 2VG5B 1FWPA 3GIJA 2NZ4A 2P2CB 3K59A 3R97A 3FRYA 2CNOB 4O3OA 2FZKB 4ZVTB 1S9GB 4K4TA 1JX4A 3BO3A 5LMNF 2F65A 3DRXA 2UUCF 3LWMA 4J9NA 2F8EX 3ZXWA 2W9BB 2Y1LB 3OJSA 3BSOA 1REVB 5HBMB 4ELTA 3D4JA 3IXQA 3LP0B 2M8HA 3SQOP 5L9NA 3IM8A 3LP1B 3NP5A 4R8UA 3AXKA 3EGWB 3DRPA 1YTYA 5LMUJ 5F41A 1RWKB 4C97A 5CCLA 1GFWB 2OSRA 1S1UB 5KFSA 2HBQB 2IVMA 1RTJA 4JYAJ 5GAGI 4DL7A 5K8OA 3Q8SB 2MZRA 1S1WA 1FEEA 2ROPA 3BBCA 2XLJA 2J6SA 5DQIA 3CJQA 3NBPA 4YP3A 4C0HA 2KN4A 3CWJA 1TK0A 4KGXB 1RT7B 2DH7A 3M8WA 4X64F 2HFVA 1SL2A 4IDKA 2W2PP 3W5ZA 4ZPAA 2DR8A 2E5LF 2COLA 2QSWA 2KFYA 4RBTA 3OFGA 2FJDB 2IYGA 3JQJA 4DN9A 4H4MB 2C2NA 4UUWA 4QZVB 3WIUA 1NKEA 4H4KC 1L3VA 1Q78A 1Y0HA 1TL5A 4JV0A 3UNYA 4KHPJ 1OQ3A 3MPDA 2E1RA 2DXDA 1SH2A 4FS2A 1TK8A 2XLKA 2GO9A 2H48B 1UCNA 4WFXA 4ZJLA 4YB1P 2G0JA 1S0MA 2FHMA 4MMOA 4LF6F 1N32F 2MLZA 4HHUA 3KHGA 4NRUA 4YY3J 4FN5A 5T7LA 1T3OA 5KAKA 1NUEA 5IQQA 5E41A 2KXNB 3PG9A 1X0PA 4YR2A 2ZNYA 3CCUS 1VQMS 2V69A 1TR0A 2DT9A 2W2NP 4NXMF 3OFHA 2VQFJ 2Z0GA 5B0GA 5DG8A 4X4OA 1CQNA 2DR7A 1KN6A 4NYZA 2QO3A 1R43A 2Q79A 1HNWJ 2DGTA 5HQ8A 1TUWA 2A2DA 3NWRA 5K9FA 1YX2A 4DX6A 4X4TA 4K4YA 1K44A 4USUA 5FDLB 3TUJC 5KFCA 5L1KA 4DQRA 1QE1B 3G6YA 2YWGA 2LXUA 3QBCA 1N6QA 2RU3A 4C0BA 1FVSA 3MHYA 1S0VA 4RUBA 4NLDA 1SBRA 2K3KA 4U9RA 4CO5A 5LSLA 1Q7YT 3TARA 2RD5C 4P7VA 4OHVA 2R8HA 3HFVA 3CDUA 3SQGA 3ILIA 3OUYA 4F4AA 2ZJPQ 4JBCA 1FKPB 2W4PA 4C0OC 3IWLA 2DIUA 1VJQA 5DETA 3W9IA 4U7CA 4ECUA 2GGPB 4LFAF 3E01B 3CB4A 3MM8B 1I3OB 1RTIB 3DOKA 1PAEX 1DY3A 1TU0B 1V3SA 2MGZA 3I6PA 3R5GA 3IGNA 4ECQA 2HNDB 4ECSA 3PW4A 4TVAB 1M90T 5KFOA 4PQUA 1IQTA 3HSZA 2EXUA 5KG0A 4FF2A 3W2WA 1PCAA 4JI3F 2VH7A 1REGX 2VIHA 5I3UB 4EEYA 5KG3A 3UVJB 4XIUA 1SIWB 3HXMA 4J9LA 3UD5A 3FSIA 3TI0A 2RMLA 1QE1A 4AE5A 4IH6A 1HLWA 2R8GA 2DCLA 2NCKL 4KHRA 2YPZA 4K4ZA 3VGSA 3CJTA 3PJWA 4ID5A 1FHTA 1V5IB 2V8HA 2VASA 1QDUB 4OHYA 4UOGA 2ATLA 2WVFA 1XJWB 4LQ3A 2GVZB 4OYMA 4ZA1A 4M1KA 4DXLA 3H5YA 1DRZA 1EP4A 2E1PA 4DR2F 4OMFG 1GH8A 1FKPA 1FXDA 1EETB 3MM9B 2EFVA 4I7FA 3S7RA 5K14B 2EBEA 4AL6A 1U45A 4AL5A 4LSNA 3W2VA 1UTAA 2C1EB 3ZZ0A 4V19J 4K0KF 3JTNA 3R1HA 3Q83A 1FX2A 3EUNA 4HH1A 3J7ZT 1IBKF 2D69A 1R0BG 1IKWB 4FYXB 1MMLA 1X5TA 4DS4A 1VRUA 1FERA 3MPYA 4LF2A 4P6QA 5D4OA 3IGVA 5IM0B 3MMAB 3VAHA 4DV0F 2LQ8A 1KD1T 2O67A 3X3UA 4ECTA 4YB7A 3ZTQA 3KLEB 2BDPA 5ADZA 2VBYA 1SL1A 2UUAJ 2ZKTA 4O3PA 4A47A 1GXLA 3LPYA 1S1VB 3I87A 3EM1A 1AYEA 1R8PA 5E5NA 3IAM9 7AT1B 3NS7B 4PWDB 3CJ2A 1MNEA 4YB6A 4EU0A 1XNRJ 2RHSB 3UN2A 2QL7B 3CD6S 3OL8A 2VJUA 1JKHA 1TL3B 2BJ8A 1RSCA 1YLXA 3QO9B 1KWMA 3VF0B 2YX7A 3D7SB 3A8JA 4BC7A 2XI2A 4E2FB 3MEGA 3GZ7A 3RW6A 1L3TA 2NSBA 2B5JA 1TELA 4DF8A 1UFKA 4C98A 4UY85 2IM1A 1GQEA 2Z57B 3HHLC 3M8QB 2GZOA 5J2NB 3ZZYA 1RDRA 2WBRA 5T14A 3EDRB 4ZP8A 3Q8YA 3K2YA 3R27A 5KG4A 3TP2A 4NI2A 2EC2A 3TVZA 1MWZA 4JI5F 1JLBB 3IWNC 1TVRB 3M6WA 3MM7A 4M5DA 5DRKA 3ADAC 3DRSB 2MZQA 2EFGA 5BYRA 3PKMA 4KSEB 4RW6A 1W7WA 2XMWA 3TX8A 4Z2XA 4DSFA 2B8QA 3UCUP 1R27B 5GAHU 2A1BA 1RT7A 3GJRB 1RGVA 3J7YU 2WTFA 4DV6J 1U2CA 1PAUB 2DPJA 4PG5A 2J0WA 2RF2A 1HNXF 1OJ4A 1KBRA 2CRLA 1GX5A 3TEGA 2ZH3A 2E7WA 3A8KA 3VWSA 4ALZA 3ISNC 1N34F 1FCAA 2MYFA 3PHEA 4LF1A 2M70A 4IG3A 3KNGA 1YBUA 3D3CJ 3SCKE 3ZTSA 2HHHF 5D4LA 5IS2A 3HZGA 4LRBA 4CLPA 4YMEA 1LV5A 2ZZMA 4JV5F 3WX4A 4MIAA 2VPYB 4DX5A 5HQMA 1D09B 1WACA 1HL6A 3US5A 4DL0C 4OHZA 2EKYA 3B8HA 2PMWA 2FC8A 4ED6A 4USWA 2K3IA 4DCOB 3NNHA 1LNQA 4YQWA 3QRPA 5HJXA 4X62J 3ZTRA 1VC6A 1FRJA 1FNXH 3HHLB 3I0SB 2BRKA 2UZAA 2VDHA 1VQNS 5KFVA 2HWHA 3D6HB 4ICLA 1P6TA 3FVYA 1HNZJ 4LVNP 1HNZF 4IO9Q 3PRBA 2XMAA 3M30A 4RW7B 2FJBB 4X4SA 1ZA2B 4IKAA 5U47A 1OSCA 2YWWA 4FPIA 4X62F 3LUYA 2UU9F 4DV5J 2CQBA 1L3KA 3VHQA 2CFXA 3MOZA 4BCAA 4H4OA 1ZM9A 1YJRA 3MMCA 1F9HA 4QYZJ 1FXLA 2PO4A 3FMWA 2FQQB 1ZA1B 3M8PA 1RBLA 4I2QB 2QX0A 5CZXA 4LRFA 1BMQB 1DZ5A 2CNKB 2CQPA 2KXFA 1XWLA 2HHPA 1R31A 1SC6A 2OEMA 4DSKA 3C2PA 4ZVPB 2P6SA 1J5EJ 3LALA 1N34J 4EBEA 2OPPA 3AXMA 1X4EA 2L9WA 2GAHC 2ZITA 2C3OA 1D0EA 1HNXJ 4ZVEA 4PWWA 1U25A 3OR2B 2DD8S 3DHWC 3RJMB 1C4AA 1AZSB 4AXJA 5D0HA 1QUPA 2W2QP 5L39A 2MGZB 2HFNA 3SMZA 2MSSA 4JOUA 1D9AA 4EK2A 1IKYB 4OX6A 1PSDA 3HSGA 5ETOA 1U1OA 2HS0A 1BQXA 1D3WA 4C3MA 1R7IA 2D74B 1RHRB 4H4OB 3D2WA 4UQTA 2JX2A 4DV3J 3T1HJ 2E5GA 4DUZF 1D9DA 4TKTA 1RU1A 1U48A 4N76A 3PJXA 2VICA 1X5SA 3OXGA 2YNHB 3BF4A 3CJ3A 1FI4A 2DXEA 1J5EF 2RJZA 3E8OA 2WVDA 1U8WA 3G9CA 2BM1A 1NSAA 5IXUA 3AQOA 3RUBL 1EP4B 2XMTA 5D3GA 4K59A 4NZ7A 1HBOB 4PYAA 1NNDA 2HAIA 2WVBA 3FDSA 1HQEA 2MQOA 1NM2A 1MMNA 2FJAB 4QIEA 4JI0J 1C1CA 3IR6B 2UU9J 1XNQF 2AYMA 4XTTA 2HLUA 4JI4J 2VZ9A 3W3SA 2J7WA 4ZCIA 3JXOA 3KK1B 3CCRS 1U8SA 5I42A 3DFEA 1HI0P 4A8FA 4KPCA 4QOTA 2RQ4A 5GVQA 1WSVA 3M2RA 3OFFA 1LKZA 2N3LA 1XR7A 3HJVA 1BHNA 4WK3A 1P8GA 3AHPA 3I0RA 4OV1A 3J7Z5 5DGBA 3JYTB 4ECYA 1ZTTA 1L3UA 4BWJA 3D0IE 4KFBB 2R3VA 3IWXA 2AX0A 2RUGA 4ZVQB 4OZNA 4H4KA 3IR7B 3M05A 4ED3A 1IBKJ 2B9EA 1HWUA 1ZM3A 3GR0A 3MPVA 5SUHA 2QA4G 4JV5J 1V5VA 2VA3A 4K0KJ 1Q53A 3KJFB 3KLGA 1UEKA 1GXUA 4EWTA 3QPIA 2JVOA 1B4SA 1FDAA 2C2DA 2CIMA 2UVVA 4LFCF 2UXBJ 2D3OR 4NLPA 2FHKA 2AZ3A 2W24A 3IBWA 1SB6A 4QIWD 1R6YA 4DR7F 2CJQA 5GAHI 3HLUA 3N5FA 2POKA 5IV4A 5I42B 3PYDA 3TJ9A 2JH3A 5C2CA 2NREA 4KH1B 1FJCA 3OXLA 1DARA 1DQ9A 1TKXB 4U95A 4Q2MA 2B7BB 4J9QA 3GJSB 2D9OA 4EFAC 3I0RB 2Z2YB 3AB2B 2MQLA 1S9EA 1JJHA 4WZMA 5KFYA 4UUXA 2DRBA 2HHXA 1LWCB 2HNZA 1RKJA 1EQMA 1SQGA 3T6BA 4DFJA 2ZH4A 1WNEA 4IO1A 4WBFA 5FIIA 3C14B 4ZVHA 3DLGA 5AE3A 2W9CA 4W92B 2X1AA 2XG8A 4X4RA 2YY3A 3KLGB 1TL7B 2FGOA 1R6VA 4LFAJ 3KG0A 4MKBA 1BQMB 3W9JA 1OS5A 3CDAA 3MAAA 3GV5B 3OLAA 2XYHB 2GQCA 3P4UB 1MN7A 2RS8A 1YQHA 4HHHA 3JSMB 4LJMA 2CPXA 3N01A 1IQZA 4PUOA 4WKRA 2K7JA 4HACA 4A8QA 2RE1A 4IG3B 1HBNA 3K89A 3DM2B 2DR9A 2HMIB 1JWWA 3ZFVA 4OJGA 3I9V9 4RJVA 4WF9Q 1LK7A 5SZTA 3QJPA 2RKIB 1RADB 1WJ9A 1YWXA 3CCVS 1UJ6A 3T5JA 5FLXU 4OHXA 4OZLA 1H2TZ 2DHHA 3ZNJ1 2RDDA 2M3DA 1H72C 4WWSA 5LSOA 2W2OP 2ZH5A 4OLOA 3BV8A 2Y3YA 2XMVA 3M9NB 1FEHA 1WELA 2OMOA 4NLRA 3I5AA 1NK0A 2OTJS 4LSLB 1Q79A 4JV1A 3PFEA 2CYYA 1H98A 1SUQA 2CVIA 2IYIA 1NSQA 4I67A 4DR6J 1FJGF 1U6FA 2E9RX 4LR7A 2ZZNA 1RP5A 1ZBTA 4FPRA 5CD4A 1N5QA 2CVEA 1N32J 1WF2A 2JEGA 1WC0A 2KYZA 3I5BA 4JI4F 2UXDJ 2F4VF 3QJLA 3KMQA 4C8NA 1Q5VA 3HHDA 3MR7A 3VTIA 2BKPA 3W64A 2RRBA 4ZPTR 3DU6A 2V67A 2J9CA 1RK8A 3SDEB 3KMSA 2KT5A 2NXEA 4F8RA 4M5HA 4RBUA 4JI8J 2DRDA 3HF5A 3TA1A 5KFHA 1R8HA 1EKSA 1TL4A 1NRKA 4ZN3A 4E0DA 4NA3A 3W62A 1Q8LA 1YVFA 4HHJA 2P9CA 4FVMA 3TWZA 4X64J 5DDRC 4F2RA 4W98A 4MT1A 5BJRA 1FDDA 1JLEA 2GIQA 4OYXA 4RKUC 4DJBA 4A8MP 1D9FA 2H5IB 2DO0A 1IKYA 2NUHA 3RTVA 4F0KA 4CO2A 3UDLA 2QA4S 4IH5A 4ZJOA 4G1QA 2ZH9A 4JYAF 3M8SA 3M8ZA 4B3TJ 2F40A 1TP7A 4NWBA 3PEJA 1NPRA 3G71S 1NAQA 1S6PB 2ZE2B 4RNHA 1FE0A 3WQPA 1K1QA 3MOJB 2UUTA 3MMBB 2CQGA 2IJRA 2FHJD 3G6VA 2ZNZA 1CJUA 1RWMB 4B17A 2AQ4A 3IBCB 4LSZB 3HKWA 4YB5A 3K5OA 4ILRA 1IKVB 2UUCJ 1TAUA 4X4VA 4O4RA 2RB7A 4K5SA 5L1IA 3IC1A 2H51B 1KS2A 3AOAA 3J81Y 2IVFB 2KFZA 4G1IA 1U09A 4KGKA 1HW9A 2WONB 3ONQA 5DZ6A 1WEYA 5EUHA 3OSNA 1N56A 5CHCB 4YR0A 4NA2A 3MM5B 2Y8YA 3OXFA 1C0TA 3M7VA 3GCWP 3OL9A 1M0SA 4L76A 4M5GA 1P9YA 4G1QB 5B0EA 1HNVA 5DLGA 4I6WA 3UVJA 2AT1B 1JLGA 5DO2A 5E7OB 4CM2A 2HNYA 1Y00A 1OMSA 2ZM6J 3HULA 5K8NA 2B56A 3CXCR 1RTDA 4GKJJ 5G4DA 2GX8A 3PTWA 5ITHA 1RT6A 4DI6A 2MTLA 5KT4A 2BR0A 1SI9A 4WTOB 5F0WA 4XDCA 1HMVA 2DY1A 4NMLA 3KFWX 1KNZA 2J8AA 4AYBD 3DI6A 1U6ZA 3J80U 3F44A 1Z2ZA 2DH9A 3CSKA 4O44A 3DXBA 3MDFA 4PXBA 1SC1B 2V2ZA 3TJ8A 4CLZA 3AJ2A 3AA8A 1TK5A 4DSIA 3QWPA 5K14A 3PYEA 4B3OB 4BDPA 4CYUA 1UWBB 4IFVB 1NSPA 1NPKA 1O8BA 1WG4A 2V94A 2MHEA 2F1FA 2C3PA 5KFPA 2PE8A 3BDEA 2JOQA 3IAS9 1S9GA 2FDNA 4AT1B 3RU0A 4AXIA 2VKRA 2EFNA 1RZMA 2VDIA 3MPWA 1B3TA 4LF8J 3NL0A 4BWMA 4UOHA 4RW9B 2W9BA 1Z2LA 5KTQA 3HCXA 2ABYA 1S7HA 2DGUA 3KHRA 3RBZA 2PFDA 1WKLA 3OR1A 4DFKA 1RT2A 4DQPA 1SKUB 2QT7A 4PWUA 2YNFB 3SFUA 1AW0A 1ZZNA 3T6JA 4YS2A 1CJKB 1ROFA 2HIQA 3DOLB 2HNZB 4Q43A 2XB2D 2AEMA 2OEKA 3NGRA 2N7YA 4ZHRB 4ER8A 1VQ9S 4OHWA 4WU2A 2XHCA 4XO0A 2MEWA 3EXYA 1ULRA 1MROA 5ETNA 3M8RA 3QT8A 4LF7F 3H40A 2DNGA 1Y3KA 2B4UA 2BBEA 1IWGA 2FHOB 3HT0A 3PYGA 1BQMA 3QATA 2W25A 3PFOA 3UE2A 2V6AA 3VQSA 3R5JB 4DG1A 2KG0A 5LMNJ 4MIBA 4ZLPA 1NK7A 1FDBA 2R7SA 4ETZA 2HEKA 3HFZB 5K8PA 2B9XA 2IFXA 3M8QA 2W9AA 3C19A 1U26A 1H3DA 2HVEA 4DLEA 2EG2A 2DVIA 2QIFA 4KBIA 1B64A 4QPTA 1WHYA 2M5YA 4J9PA 4NI2B 1S1XB 3G87A 1W2BR 4PXDA 2JVRA 1BWEA 4X2BA 5E3AA 4KAIA 1JXVA 5C25A 2HWIA 4C8YA 5G0RB 1KHWA 3P5BP 5KFZA 1LXJA 3EX7B 4LUBA 4KB7A 2GFFA 1AROP 1RT1A 3HI9A 3U1MA 4JI6J 4X4NA 2HPUA 4ED7A 3KLHB 2JLEA 3IFEA 3NMRA 3P5TL 2WAQD 1NBEB 2W7PA 1WG1A 1URNA 5L9XA 1RI7A 2HK2A 4DR5F 1U0HB 5H9EJ 1F2HA 2KRRA 5CZVA 5IT4A 3HHKA 2XC9A 2FVQA 2W01A 2D3UA 2OELA 2M9KA 1TAQA 4Z37A 1VQ8S 1U1QA 4TY8B 1NDLA 4FDFA 5B0CA 4EMDA 1CSJA 3IBFB 1SQEA 3PRDA 4P7TA 2CPDA 3HKZD 4USVA 4F3QA 4F3MA 3Q0AA 1EQ0A 4MTPA 2EFQA 4Q5VA 2XSFA 2LMIA 1S1XA 3CMQA 3FZ2A 3GB0A 3W9HA 1J2VA 7FDRA 2DEJA 1RCXB 3LQVA 3VV2B 3V6KA 1Q7LB 2YQ3A 5DLFA 3H0PA 4AL7A 1OYEA 5KG6A 2F8HA 2VJVA 2MPUA 1HWIA 4WU3A 5FD1A 2FIUA 5HROA 5BYQA 1NK6A 4X66J 1J27A 2LEAA 3E01A 2UV8G 5AE1A 2DGXA 2JC0A 3I5CA 1SJQA 3ENVA 3M30B 1IUJA 1SXLA 4RW7A 4Y2IA 3GTYX 4PZVA 3G96A 2IDEA 1DTTB 2L48A 2IHR1 4H4MA 4B3SJ 2KZZA 4O0NA 3M32B 5EDWA 2O66A 4URQU 1D8YA 1VC5A 3HM9A 1BC6A 4ECRA 3T19A 1MU2A 3GFXA 1VQ6S 4Z7YA 3BQ1A 2M52A 1HFEL 2CWKA 1HI1A 2I9SA 3CT9A 3MMJA 4QJVA 2JLFA 2MQMA 2XZTB 4OJHA 5F3TA 2AD9A 4FXDA 4FNIA 1G7CB 3CCMS 1HI8A 2YNIB 3MF5A 3CCZA 3TQEA 4RW4B 3IA0A 1ITPA 4KH0B 2Z2LA 4Y28C 3OR2A 5K5MA 3RG6A 4I7FB 2VL1A 4ZN1A 2B4PA 4NMXA 1Q86T 4M8LA 4EYHB 5LT5A 1UVIA 3NRBA 5L1JA 4NLUA 2HVDA 3D6TB 2EFOA 3SCJE 1NXIA 4GVLA 2B6AB 1YBTA 2ZBRA 4F25A 3FSXA 1YJUA 2KM8C 4DV7J 3W8PA 2GV1A 3SIPB 4J9VA 5JVGQ 2KT2A 2GJIA 1HBUB 2IRYA 4ECXA 3BYRA 1K9MT 1NJXA 4NXMJ 1T02A 5HMXA 3CCES 3CJKA 1A0OB 4IFYB 2QC3A 3H20A 1TL1A 4I69A 4CTAB 1ACMB 4NLXA 3UDCA 3GIKA 2I5JB 2HWTA 2OP5A 1BUXA 1Z4UA 4KGZB 3VVTA 4USMA 2E7VA 4WFNQ 3PW7A 3Q89A 2AEFA 4RW4A 8ATCB 4LF6J 3OSPA 2DRAA 4D3HA 1M5SA 2GMHA 1JKHB 1TL3A 3QO9A 3OTOF 3GIMA 5A0YA 3BR9A 3CGIA 2X1GA 3CIZA 4B3OA 1QJHA 4N7TA 3NOCA 5KT3A 4GO7X 4J9UE 4ZP6A 1CG2A 1WTBA 1U1PA 4P52A 4C7QA 2RUSA 3RR8A 2KKHA 2QLXA 1JK9B 3TA0A 4USIA 4QPXA 4R5PA 2NXNA 2VUGA 2C28A 1NKCA 1KRPA 1H38A 1HA1A 4B3TF 3KK1A 1XERA 5DM6Q 4C6AA 4LFBF 4NCGA 5KT6A 2C22A 3MAHA 1C0UA 1S0NA 3QRRA 1HYSA 3D54A 4ZOSA 1UZDA 2WW4A 2UUWA 1PJ6A 2ZZTA 3HHEA 4OV6A 3ZZRA 4IFYA 4FS1A 3ZC4A 3WBZA 1M1HA 1LEOA 4M5DB 4M5MA 2GVZA 2CJXB 1UW4A 3E3XA 3PEHA 4DV4J 4QR1A 1VQOS 2AGOA 4PG6A 5KFGA 1BD6A 2Z58B 4CLUA 2BABA 1EETA 3PR4A 1SL0A 1GTHA 2MKHA 2VOPA 4I2PA 1EHWA 2VG5A 3D68A 1A7GE 3G8TA 4A8KA 4JI7F 3AH6A 5B0FA 3RW7A 5KOWA 2J0SD 1ZPVA 3WDOA 2RVJA 4ZPDA 3QIPA 1IKWA 4IH7A 1NPPA 5THWA 4NLGA 2F4VJ 2B43A 1S76D 1VRUB 5IV3A 2F5GA 2HS4A 4OYZA 1RXOB 2PN6A 1C0UB 2IM3A 1IR2A 4DEZA 5KG2A 2C2RA 1PGZA 3KLVA 4LQ9A 4QWBA 2MKKA 3KLEA 4IUFA 3LPEA 1K1SA 2VB6A 3PRVA 3LGMA 4QWEA 2R7VA 1WSRA 5AJ3J 2ZUAA 2CWXA 3LP2B 3QGHA 1CULA 2QZ8A 2ATCB 2XWXA 3MEDA 2C3UA 3C14A 3EVWA 4B02A 3MR3A 1WF1A 4QIVA 2E66A 4F0MA 1X31C 5A8RB 2HLTA 2SXLA 2F9DA 3PHTA 4I2PB 3KLHA 1TL7A 4B3MF 1LQ9A 4LF9F 2CQ2A 5E33A 4FBUA 1X4BA 4M5KA 4C8KA 4DSJA 2R7QA 1HD0A 1RA7A 2CDRB 4BBYA 5GADU 3BQ2A 1HBMB 3ZO7A 2DNHA 2MJNA 2VFTA 3D6FB 5HLFA 3H8YA 4TY8A 5HQLA 1NK9A 5KFLA 5E0OA 4F26A 3NY0A 4URGA 2E5HA 3GSIA 3A8EA 3S6EA 4TYAA 1HWJA 2D41A 2XCPA 2ILYA 3B82A 3F41A 2MJUA 1VQLS 1TVRA 3UDEA 2CXEA 3DKDA 3LP2A 2CJBA 4DDFA 3OTCA 3ZZTA 1CC8A 1XTZA 2GAGC 1TUGB 1FTCA 4I6YA 5L1LA 2JEFA 1QAJA 3K58A 4G6VB 3WHIA 1IJFB 2EKNA 2NXCA 3EICA 5D0RA 5T41A 2GQ2A 1FA0A 3ENWA 1E6VA 1FDNA 3LH2S 1F3VA 1HNIB 3KUGA 2R7XA 4DPYA 3H4BA 1YGYA 4LF5F 4L6V3 1P1LA 3D5MA 3CPWR 3N9UC 3TZYA 1X5PA 2CPFA 1T05A 3BO4A 5D4NA 4A48A 3CD0A 1Y11A 3DGVA 5AXKA 2EG1A 1TZ0A 3VZHA 2IIHA 1F3FA 2E7XA 2MQ8A 3DLEB 3TYTA 2U2FA 4YHHF 1Q81T 1JJ4A 3G8QA 4LFCJ 1OYDA 2UXBF 6FDRA 3M1VB 4K2JA 3SV4A 2PMHA 1W25A 3NGSA 2C2EA 4Y3CA 3OTDA 2F7VA 5HVFA 3TANA 1R0AA 2JEJA 2PI4A 4JI2J 1T95A 5BR8F 2CZ4A 3UFCX 4KRWA 2V8VA 2B4VA 2AGQA 1G4CA 2XY6A 5LSRA 1X4AA 3W60A 3D9BA 1HARA 2BJ7A 2VV5A 3MEEB 4IG0B 2B4OA 3LAMA 1KEKA 2HKEA 3BBBA 1RISA 3NEKA 1QY7A 2AV5A 2KVIA 3EGNA 5I3PA 3C6TA 3SSRA 4CNYA 1S1TB 2ZVSA 2E44A 4ECZA 1PILA 4U67Q 1VC0A 2FJEB 3FFIB 2LA4A 4KTQA 3CMES 3DNCA 3N28A 3V2UC 3NKYA 2AJQA 2HGMA 2AX1A 3KK3B 1GMVA 2XMUA 2YKPA 3RAXA 1NJIT 3EPGA 5CH7B 1QVFR 3DLEA 3NS6A 3W63A 2FD2A 2AF6A 2BM0A 2BANA 2XYPB 1E6YA 4JI0F 1Y5IB 3PX0A 1XMOJ 2RS2A 1T94A 4ZVOB 2HK3A 4ZVFA 2V34A 4PXCA 1RTHB 3T3FA 2OIHA 2B9WA 3CNQP 1RYRA 2EWHA 1PIEA 3O8WA 4PKDB 4C11A 4DS5A 2ZBCA 5LXRA 3GFHA 5DQHA 2WB4A 3GU0A 3FNNA 5ETQA 3VQTA 2XGQA 1XC9A 1RWWB 3E2EA 3IN5A 2FLPA 1KOHA 1FNMA 4PG7A 2Z30B 2JZ5A 4OZ0A 3WIVA 3M4XA 2AJ2A 4ZK7M 1S1TA 1GT8A 5F9LA 5F8JA 3TUIC 1TUVA 3KG4A 2X3GA 4ELVA 5IT9U 1WI8A 1RAFB 3MZIA 1WKJA 1UMJA 4DV2F 3KTQA 4Q44A 4EO6A 4F36A 1KC8T 3RRHA 3HT3A 4GKKJ 1UFWA 4JUZA 2FB0A 5C24A 1U6BA 2QLBB 2OFHX 3RGIA 4ZKAA 4WFZA 3HO1A 3QJJA 1WHWA 2IJNA 3U7JA 3NOGA 3AAWB 1S9EB 3O3LA 1PYTA 2YKAA 4GVBA 1RTHA 5C5JA 3GIIA 3H5UA 1LFWA 4K2XA 1HMVB 2BKNA 1IBLJ 2F3JA 2VG6A 4KKOA 4WIQA 4CLKA 5A8KB 4LF8F 4RWWA 4ERDA 5ETVA 2GW8A 2NXJA 2WW8A 4OI1A 3VR1A 1VHIA 2YX1A 1YHQS 1WC5A 3N0VA 2YTCA 2WK4A 2PMZD 1NDCA 4LT6A 4B3RF 3MEGB 2DNLA 1RACB 3L7PA 3KWMA 4PR6A 4NZ0A 1U1RA 2XS7A 2DNYA 3UCZP 3Q8QB 3NNAA 1KLMA 2QLJB 3HFKA 1NJZA 3JSBA 4NA1A 3T9ZA 3A4TA 1YJ9S 2KM8B 3HSJA 1N8RT 1CQMA 5EX0A 3ITHB 1ZOTA 3R5AA 3K5LA 3VAMA 4DV5F 2QA2A 3DM2A 2CA9A 2DNPA 5F8HA 3SYZA 4DU7A 2ZWOA 2CPHA 3HVTB 3I32A 3IP0A 4KV8B 3DYAB 4RW8A 1PJ7A 5EX3A 1RT2B 3MR2A 3CCJS 2R4FA 4IQXA 1KFSA 1K0TA 2CAJA 3GILA 2VPZB 3KLIA 3GV7B 1TKZB 5IFMA 4DQQA 1SKSA 2FVRA 4L3NA 3FCVA 1FWKA 3R7SB 1GMWA 4P2XA 2R2UA 3Q24A 2WSFC 1UVLA 4B08A 1F60B 1UFLA 3A13A 5AXNA 3T1YF 4K4UA 3QYYA 3POTA 4KQZA 2V2VA 3GPAA 1TV6B 4HL9A 3H4DA 1K73T 5GAEI 1OQ6A 2FJVA 1VBXA 2JSXA 1AT1B 3PYFA 4XK8C 2CQ1A 4CRJA 3UW1A 4DFPA 1SV5A 2CJAA 3QNWB 2HHSA 3HVTA 3V4MA 3CVKA 2AHOB 3A8IA 2AMCB 2QMWA 1PKUA 3UDVA 4J9SA 1VBZA 1U1KA 2RDJA 1N5VA 1XEZA 2L3MA 5F0UA 1U2FA 3T41A 1YZ6A 1KVKA 2GA7A 2YKNA 4NEZA 4U8YA 4J7CA 3PZPA 1HR0J 3I4PA 1F5AA 1N0UA 4ZVUB 1SH3A 1S99A 4DV1J 2JHEA 2CKWA 1MMDA 3R6LB 1TKTB 4I64A 3BB5A 4DPXA 3EZOA 4PRFA 3BDPA 3TR5A 1F9EB 4OI3A 3HVWA 3PV8A 4P2FA 1RA6A 4K4WA 4ZLNA 1AFJA 3ENQA 1C1BB 2A3JA 2E29A 2HAFA 3X1LB 3AD9C 3FBEA 2E5IA 3LF0A 2QLFB 3JSMA 1VJWA 2ASDA 1VYAA 3BSAA 3AA9A 1T05B 4AQYJ 4B9NA 3MWBA 4N77A 1T9TA 2P8IA 1QSSA 4HACB 2HMIA 2LECA 4HR2A 3MMCB 4F4YA 1X4DA 2OJ3A 1EZZB 1XQIA 3RB0A 1KONA 1N54B 4MFBB 1VIOA 5IZHA 1K8AT 1HPZB 1PJ5A 2H1YA 2HIYA 2RKIA 1FO1A 4F50A 3ZZZA 3UN5A 4ZMMA 3K8VA 4OI6A 1B7YB 3HP6A 1DJ0A 1S4FA 2UXDF 1FD2A 4FKYA 2CJKA 4NCBA 2YWKA 3IS9A 5HVHA 4L75A 1TTHB 3QRQA 4ENOA 1SC4B 1B99A 2NXUA 2OD6A 4I1TA 2MB0B 1FJGJ 4DR6F 1HD1A 4KE5A 2BE2B 4NOHA 1NHVA 3BR8A 4OYWA 1QAXA 3ISND 1H7XA 4KT0C 3RYLA 1VDHA 4OZ1A 4ZJQA 5HMYA 4CO4A 3ILJA 3FFIA 1Q1KA 2XM3A 3RBDA 2VHGA 5A6WA 2I6WA
chains in the Genus database with same CATH topology
4GVBB 4GVBA 1KP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GVB B;  4GVB A;  1KP6 A; 
#chains in the Genus database with same CATH topology
 3CCS S;  3KK3 A;  4A46 A;  3QGI A;  1J5O A;  2H65 B;  4ZIW A;  3DGP A;  1UW9 A;  2MQP A;  3IG1 B;  2YNH A;  1RAE B;  3DLB A;  1VFJ A;  4MKY A;  3F73 A;  2PEB A;  1LWF B;  3CIM A;  4Y2A A;  4WYW A;  2JJ4 D;  4WJB A;  1G1X A;  3KJV B;  5IC4 B;  4YFU A;  4TU8 A;  4R0J A;  2D1C A;  3MI7 X;  1HKA A;  4DX7 A;  3BQ0 A;  3MM8 A;  1KQF B;  5EWE A;  1KQG B;  1S6O A;  4IFV A;  2ERR A;  3KDN A;  2FGC A;  1ZTW A;  1YI2 S;  4LF5 J;  2BKO A;  1JQG A;  1UPP A;  2QMX A;  4TXS A;  1RQ0 A;  4J90 A;  3BSN A;  4NAS A;  4GMK A;  1PC5 A;  4N8N A;  3N6L A;  3GFZ A;  5B0A A;  4ECV A;  4UW2 A;  3PO4 A;  3GE9 A;  4A4J A;  4MK7 A;  3MUV P;  4EZ9 A;  4RX6 A;  2ZE2 A;  1RAO A;  1VLO A;  3OR1 B;  4N8O A;  3IG1 A;  3UD4 P;  4KJI A;  2VG7 A;  4OZ3 A;  3FCW A;  2D3Z A;  2QL5 B;  3GG1 A;  4LRC A;  3Q2S C;  4QU7 A;  4TLQ A;  3SCL E;  3CDW A;  2F8M A;  5A8K A;  2ZH6 A;  2VBX A;  2CQC A;  2CPE A;  3I9Z A;  5E3C A;  4UF4 A;  2V2K A;  1X8D A;  1WEZ A;  4ZCM A;  1EIY B;  2Q66 A;  4LSN B;  3W2V B;  1NDP A;  2IMO A;  4ZVS B;  3R9L A;  2HVH A;  4NRT A;  1X9M A;  2DGO A;  4J9O A;  4YOE A;  2BW7 A;  3MFI A;  2ZHA A;  1RHU B;  2GS8 A;  2OAU A;  3CMA S;  3OTE A;  1NK4 A;  2UVW A;  4IQM A;  2AJ4 A;  4LIR A;  1NKB A;  2IY5 B;  2DH8 A;  1T8E A;  3MMA A;  2NS1 B;  3T5H A;  2CZV C;  3VAJ A;  2QYG A;  2CQ3 A;  3DMJ B;  1FE4 A;  2BE7 D;  3FEY B;  4FF4 A;  5ETS A;  1HQU B;  2MLY A;  3U02 A;  4WXW A;  4DR3 J;  2VD3 A;  3BJY A;  5BYS A;  2XNR A;  4O3S A;  2AW0 A;  3U1L A;  3VAK A;  4P10 A;  3GYX B;  4ITS A;  1NK8 A;  2B51 A;  3R3T A;  2ACY A;  1RAB B;  3DRY A;  2KTQ A;  2V50 A;  2A18 A;  1S77 D;  5H9F K;  2XZW A;  2K7K A;  3ENA A;  4Y00 A;  1P9Q C;  5DZ7 A;  3D67 A;  3DRR B;  3UR0 A;  4O0I A;  1XNQ J;  1BE4 A;  3TO8 A;  1VK3 A;  3V5R A;  4Q0B B;  4XAK A;  1T03 A;  2IM0 A;  1W26 A;  2VC0 A;  3QID A;  4A8Y A;  1PBA A;  3RBE A;  1A9N B;  1SV5 B;  2E1C A;  2VOD A;  4B3R J;  2I0X A;  3KK2 A;  7FD1 A;  4DQI A;  1FRH A;  4HTJ A;  3QLH B;  3DMJ A;  3ZZU A;  1CS4 A;  2DYA A;  1VHF A;  3SBM A;  3EMT A;  4PYD A;  1HWL A;  1VS3 A;  3OL7 A;  1IBL F;  1EAR A;  1YBA A;  2IC3 A;  2DY9 A;  3DOL A;  4OYO A;  2UUB F;  2G2Z A;  4K7Q A;  4I0W A;  4V1A k;  3A3N B;  1B0V A;  1F0X A;  2Q3P A;  3NCQ A;  4LRA A;  3EZ5 A;  1MRO B;  2J9E A;  3PDN A;  4UST A;  4DV1 F;  1IR0 A;  1T9Y A;  3CC7 S;  3V6J A;  1KVI A;  4ZPW R;  3HMJ G;  2DIV A;  3HPO A;  2DXF A;  1FRK A;  2OLW A;  3NGD A;  4WKY A;  1OY6 A;  3MEC B;  3OFE A;  3QZ8 A;  3C46 A;  3JTO A;  2V0N A;  5EHH A;  2YH1 A;  2FC9 A;  2V63 A;  1NK5 A;  2JC1 A;  3OTO J;  4Q8E A;  2HQD A;  5IC6 B;  2G9O A;  2CDQ A;  2N4C A;  2OUG A;  3K7R A;  3LP0 A;  4S0M A;  2XO6 A;  4DFM A;  1O0P A;  3V6D A;  2A10 A;  2ADC A;  1PC4 A;  1JLC B;  2H4Y B;  4CLS A;  1HPZ A;  1QD1 A;  2XS5 A;  3QT5 A;  3SEO A;  2H3E B;  2IC3 B;  5KT2 A;  6FD1 A;  4RL1 A;  2F63 A;  2YKO A;  1S1W B;  4RUA A;  1RT5 B;  3CW2 C;  4BLG A;  3PJ9 A;  3QT6 A;  1ICE B;  1TKD A;  4ICL B;  3G82 B;  3RB6 A;  4B9S A;  2OD4 A;  1UPM B;  3C66 A;  3GJQ B;  5ETT A;  1SKR A;  4HEA 9;  4FKX A;  2PA3 A;  1X9W A;  3Q2T C;  3NG8 A;  2FJX A;  4ED0 A;  3OD2 A;  1QAY A;  3L7U A;  5KFM A;  5A2Q U;  3IRW P;  4DL2 A;  3PVX A;  1M1K T;  2KL8 A;  2UXC F;  2OPQ B;  1OY9 A;  2CZ9 A;  4CIO A;  1U1N A;  2IJF A;  1X7V A;  1FES A;  3G6X A;  1RCO B;  2KDO A;  3I82 A;  1S6P A;  1SKW A;  2LFV A;  3DLL Q;  3DLJ A;  5CYQ B;  3M1V A;  4RUC A;  3PX4 A;  4CTA A;  1C2P A;  4CI0 B;  2HHV A;  2HQ3 A;  4HTI A;  3CJS A;  3BKU A;  2FVS A;  1FK9 A;  4F04 B;  3AJ1 A;  4RU9 A;  3PW2 A;  2V8G A;  4BHQ A;  4NXN J;  2DB1 A;  5HRO B;  3HD1 A;  1JIH A;  4IYQ A;  4QYZ K;  4DV6 F;  5H9E K;  3AOB A;  2BYC A;  2V68 A;  2X1B A;  1R3N A;  4HI1 A;  3TW0 A;  3SSS A;  2YBV A;  2WSE C;  4CP5 A;  5E2Q A;  4ZS6 A;  4O3N A;  2EW9 A;  3WX8 A;  4GKK F;  4O23 A;  5IM0 A;  1SPB P;  5LOQ A;  1AUS L;  5FDL A;  4WZQ A;  2VF3 A;  1XR6 A;  4NLO A;  3G86 A;  5B0B A;  1RTD B;  2Q1L A;  4ZCL A;  3CC4 S;  2XS2 A;  3OT9 A;  1EB0 A;  5A2Q Y;  3N5B A;  4RNM A;  3PY8 A;  1L5U A;  4B9V A;  3R6G B;  3PKY A;  2LA6 A;  1KP6 A;  2XEX A;  4C11 B;  1ZAW A;  1BGX T;  3K8W A;  2BA9 A;  1HBO A;  1HIY A;  2W7O A;  3KYL A;  4KHM A;  3Q86 A;  1LW2 A;  3ZZO A;  2G1H A;  1GMW D;  1UWB A;  3V4I A;  2JFD A;  3HX9 A;  2DHG A;  4PQU B;  4FZV A;  1UEV A;  1PO6 A;  3RRG A;  1QTM A;  5D77 A;  1NSK L;  3D28 A;  4RU2 A;  1KOO A;  2KJW A;  2KT3 A;  5B0D A;  5I3U A;  4B3M J;  1T3N A;  1HBU A;  4HI2 A;  2D7S A;  4C3L A;  4CH0 S;  1BQN A;  1FNO A;  4PCQ A;  2BVZ A;  2IAJ B;  4TNO A;  3KJQ B;  5F3Z A;  1JMT A;  2G1D A;  3BBF A;  5E3R A;  4O3Q A;  5DG7 A;  2XMK A;  4ZVG A;  4ED8 A;  4CCH A;  3MXH P;  1CJK A;  4J9K A;  2PA8 D;  3W5X A;  3OBI A;  3K5M A;  2E5J A;  2GCF A;  2DGV A;  1RWO B;  2OO4 A;  5ETR A;  3RR7 A;  3DLK B;  2OH2 A;  2LVW A;  1TFY A;  2ZDO A;  1UVK A;  2HRY A;  1H7W A;  4CLY A;  1LOU A;  3Q8P B;  4G1P A;  4CDI A;  3BEG B;  2ZOF A;  5KFT A;  2DCU B;  4UOF A;  2QLW A;  2NYH A;  3AOC A;  1CJV B;  3UN3 A;  4R5P B;  3BGU A;  3NWG A;  1JLA B;  4WP8 A;  1S57 A;  4FVC A;  4DR1 J;  1XR5 A;  2C2K B;  2GIR A;  4O4G A;  2HHW A;  2VFS A;  4QWA A;  4K4X A;  5D4P A;  1DLO A;  1VGY A;  3CCQ S;  1GK8 A;  1R8A A;  1N52 B;  2DGQ A;  3QLH A;  4ZPV R;  4ZIV A;  5DQG A;  4A8W A;  2RQK A;  3M9O B;  3GMG A;  2DNQ A;  4USH A;  4KGM A;  4ES3 A;  5M2R A;  1T9U A;  2NYI A;  3W5Y A;  4DV4 F;  1KLN A;  1LWC A;  2OSQ A;  1KQS R;  1MSW D;  2MKS A;  4RNF A;  1V3R A;  1TKZ A;  4TQR A;  4ELU A;  4PWD A;  2M7S A;  2J0X A;  1R8C A;  3W7B A;  4JI3 J;  2O1P A;  4I4B A;  2BUN A;  2ZKU A;  1Q5Y A;  3GWC A;  4QWC A;  3H98 A;  4M95 A;  1NH7 A;  3VGT A;  2GJF A;  4ZCK A;  4CH7 A;  5HSP A;  3GYG A;  5F8G A;  3TAP A;  2HQI A;  3DC2 A;  3POT B;  2PFF B;  1URR A;  1HNI A;  1H6K X;  2AJ1 A;  3O2I A;  2ROG A;  4DWI A;  1IKX A;  1R8B A;  1MW7 A;  3NCR A;  4Y2C A;  2H9Z A;  5ETL A;  2Y9H A;  4LVO P;  2HG4 A;  1JNR B;  1MLA A;  4YDX A;  2DTJ A;  5L38 A;  1VQ5 S;  4B9U A;  2IMW P;  5I3Q A;  4HKQ A;  2LQ9 A;  4A8O A;  3V6D B;  3G2X A;  2KYX A;  4OL8 A;  5JMN A;  1IJE B;  1RE1 B;  2B7C B;  3UR3 C;  2Y0S D;  1GAO A;  4JB8 B;  2PI5 A;  2E9T A;  3J81 j;  4NL5 A;  2HSE B;  2MHN A;  2ZJR Q;  2YKN B;  1C4C A;  1CUL B;  4O3R A;  3DU5 A;  1WI6 A;  2FYX A;  5FLX Y;  1EX8 A;  4TU9 A;  3BN4 A;  4GKJ F;  1HNW F;  3WC2 A;  1OSD A;  1WG5 A;  1LWX A;  1DHM A;  2Z2Z A;  4DPU A;  4CQ1 A;  4XPE A;  2CQH A;  2E1A A;  5D0E A;  2K1R B;  2YWH A;  1L3S A;  4C8O A;  1SUQ B;  1N48 A;  5AJ3 F;  4DUT A;  2FZC B;  4FXW A;  4FYV B;  2ZWP A;  4WFY A;  4KIA A;  1IKX B;  5CA5 A;  1NLK L;  2E9Z A;  1RT4 A;  3JSR A;  4I56 A;  5C2G A;  1JJC B;  3AY0 A;  3G8S A;  2IBK A;  1F2G A;  4KO0 B;  3M32 A;  4WXO A;  5J2M B;  1SJF A;  5HO4 A;  4TU7 A;  3DN9 A;  2RNE A;  1RU2 A;  3C15 A;  4MFB A;  4ANE A;  4OI2 A;  1IVZ A;  2BAN B;  1S49 A;  5BXI A;  3GON A;  5D6G A;  2IM2 A;  3FSY A;  2YWE A;  2V9K A;  3TEH B;  2R2T A;  2FUG 9;  2AWZ A;  1X4C A;  2XZD B;  3K5P A;  3LOU A;  1CVJ A;  1XMQ J;  1VIX A;  1VQS A;  3H5S A;  3M2U B;  2V8D A;  2ZH7 A;  3TAM B;  4M5I A;  4OZ2 A;  3M6U A;  2GJ2 A;  2FLO A;  2KHC A;  1Y10 A;  3ILO A;  2E5L J;  1BXN A;  4UT4 A;  5CYM B;  1N5Y B;  2NQP A;  5EWG A;  2E1M C;  2WB1 D;  5K8M A;  5F8M A;  5J2Q A;  4TN2 A;  5DS7 A;  3B78 A;  1ZM4 A;  4E98 A;  3PIP Q;  4KO0 A;  1IM6 A;  3V6H A;  4K5R A;  2DR6 A;  1UWA A;  2CPJ A;  2HVI A;  4Q8F A;  1VK8 A;  2ZDP A;  3M8P B;  2RAQ A;  2PC6 A;  1FTR A;  2OFG X;  1RHM B;  1TL1 B;  3WZ0 A;  1XMQ F;  1EJ7 L;  5M2P A;  3TRG A;  1NO8 A;  1R0A B;  1AB8 A;  3BM7 A;  3M2U A;  3NLC A;  1N36 F;  3CDE A;  1S5Z A;  1CC7 A;  3MCO A;  3ELH A;  4NLY A;  4XDD A;  3CED A;  3MM9 A;  3BKT A;  4IG0 A;  2H5E A;  2IPO B;  2QG9 B;  4G65 A;  5HK4 A;  2WOM B;  3QQC D;  5M2U A;  4KPY A;  3C6U A;  1KFD A;  3K57 A;  2HHQ A;  1RWX B;  3B54 A;  5DDQ C;  1JLQ B;  4F4W A;  5IT9 Y;  2J8S A;  1C0T B;  2LXI A;  2OPR B;  1VQ4 S;  5D15 A;  4YR3 A;  2DNM A;  4HYK A;  2NSC A;  5A8W A;  3R5D A;  4DN0 A;  5DM7 Q;  4NCG B;  4OZ5 A;  4M5L A;  3ICL A;  1IWA A;  4OQJ A;  5J1P A;  1S9F A;  2HNY B;  1UJ4 A;  4DV7 F;  1S4E A;  2XY5 A;  3BGR B;  1JB0 C;  2KI2 A;  1QUV A;  4KV8 A;  4JI6 F;  3J81 U;  1E6Y B;  2R2R A;  1VBY A;  1I6J A;  2LEB A;  2EC0 A;  2DK2 A;  1UKU A;  3FEX B;  4IRK A;  3IRX A;  5GME A;  1I1G A;  3MCN A;  2UP1 A;  1BY9 A;  5EGY A;  2DKO B;  1TQL A;  1VBK A;  5D3G B;  4QW9 A;  4DOZ A;  3C3L A;  2GO8 A;  3H2V E;  3VAL A;  2QTW A;  4OX8 A;  1DBD A;  1NME B;  1YRU A;  2VFU A;  1HQE B;  1Y3J A;  3JB9 k;  5LJ5 Y;  3A12 A;  4MYU A;  1SIZ A;  5J1E A;  1N5S A;  2QA1 A;  1CJV A;  2J9D A;  3KLF B;  1CPZ A;  2L9N A;  3L09 A;  4PUO B;  1ZPW X;  2HZC A;  2LLZ A;  3ET6 A;  3QFH A;  2DHX A;  2C3M A;  3FJ2 A;  1VLY A;  1U2R A;  3H7H B;  4RW9 A;  4F7V A;  4B3S F;  2G2Y A;  1KQK A;  2ZHO A;  3M2R B;  4W90 B;  3UNG C;  4J91 A;  4LF7 J;  4OZJ A;  1T9X A;  3MCS A;  2CG4 A;  2YNF A;  4RZR A;  1FKO A;  2WSC C;  1HQU A;  2C2Z B;  3MM7 B;  3PO5 A;  4JP8 A;  1RWU A;  2AP6 A;  3GR1 A;  3DLH A;  3FC9 A;  2YKM A;  4HT5 A;  3W65 A;  2VQE F;  2C3Y A;  3PX6 A;  3OQ2 A;  1RTZ A;  4X66 F;  4FYW B;  1A6L A;  1TKT A;  3THP A;  2DNN A;  1SJR A;  2LEP A;  3OHA A;  3W8G A;  1M1G A;  2J6T A;  4UOC A;  1FXR A;  1NZA A;  1Y4Z B;  3AT1 B;  1N4L A;  4X4Q A;  3EXC X;  4LF4 F;  4ILM A;  5J1E B;  5HAO A;  4CZC A;  4G3I A;  1QLN A;  2KFN A;  4UQG A;  2LU2 A;  3I4H X;  1M5P C;  4P74 A;  4Q0B A;  2WRM A;  3A3P B;  2GHV C;  2P9G A;  1S97 A;  5HLF B;  2RDI A;  2BRL A;  2WCX A;  3KHH A;  2XMJ A;  3HVR A;  4D3G A;  2VPX B;  3DDI A;  3KK2 B;  4R8U B;  3OLB A;  2XGP A;  3CC2 S;  1FKA F;  2OGU A;  3CE8 A;  1WOO A;  1G2E A;  1HWK A;  3ULH A;  4N56 A;  4DR5 J;  1RLC L;  2VFR A;  4K50 A;  4KC5 A;  2P5V A;  5D8H B;  2W1B A;  3D66 A;  1RTJ B;  4NZ6 A;  2KXH A;  5HI7 A;  2HBY B;  8AT1 B;  5C25 B;  4YEA A;  3JQK A;  1YJT A;  1YDL A;  1FF2 A;  1AA1 B;  1MN9 A;  3HHL A;  3I0S A;  4OIX A;  4WII A;  2W9C B;  1U47 A;  1JJ2 R;  2C2M B;  2BXJ A;  2FY8 A;  3NBP B;  1B70 B;  1D8Z A;  2ZM6 F;  3BYP A;  4CWB A;  5D0G A;  1YIT S;  2GMJ A;  4RPF A;  2EFP A;  4DQS A;  2QL9 B;  1SJ1 A;  1U0H A;  3O6Q A;  4ES1 A;  2ZD1 B;  3MEC A;  5H1S V;  4JI1 F;  4U96 A;  3OVS A;  2XBP A;  3ZTO A;  1S59 A;  1WDT A;  4TLR A;  2BEF A;  1ZH5 A;  4R25 A;  2Q6C A;  4B9L A;  2HGL A;  3BSC A;  2OHD A;  1TFW A;  3DOM A;  4NLV A;  3VVU A;  2XO7 A;  3NCP A;  1S48 A;  4M94 A;  4UZB A;  4PPD A;  2ZFH A;  4BC9 A;  3V81 B;  3GG0 A;  1F9F A;  1NEE A;  1I51 B;  4DUY F;  1LK5 A;  3O5T B;  2JWN A;  1N36 J;  1Q82 T;  2AJ0 A;  4OYP A;  1RT5 A;  4K4S A;  4DSE A;  2HRU A;  1R0C B;  3IR5 B;  2HGN A;  2M88 A;  1IXK A;  3S8S A;  2MKC A;  3BRE A;  4LSL A;  4WPA A;  3L7O A;  2Z8Q A;  3C6T B;  3MUM P;  5AXM A;  5J1N A;  2KG1 A;  3SI8 A;  3MM5 A;  2GHW A;  3QT7 A;  5HMZ A;  4LBH A;  2Y1J A;  2FJW A;  4ECW A;  3H42 A;  3AD8 C;  2RT3 A;  3HDS A;  1VI7 A;  3GCX P;  1RHK B;  4Y34 A;  3H5X A;  1JLG B;  4NLQ A;  3TJA A;  1UL3 A;  4LMZ A;  3A3O B;  1RYS A;  4ZP9 A;  2VBZ A;  1FFW B;  4CLL A;  1CLF A;  2ACM A;  5CYQ A;  3SDE A;  3R2D J;  3R7N B;  2IA6 A;  1FRL A;  3K17 A;  1RT3 B;  3H59 A;  4P71 A;  4OI0 A;  2YNI A;  3L3C A;  4JI8 F;  4P9S A;  3W1Y C;  1FK9 B;  4FP9 A;  1MWQ A;  3IS9 B;  1S6U A;  1OPI A;  2GML A;  4ZIT A;  4RUH A;  5KG7 A;  2WVC A;  1Q8B A;  4LRD A;  4DV3 F;  1RJJ A;  2IRU A;  5KFD A;  3BN7 A;  4HT7 A;  4KR0 B;  1F5B A;  4U8V A;  4DBQ A;  1APS A;  3UQS A;  2KU7 A;  3RZA A;  3FKB A;  4C2M A;  3C6U B;  4OYB A;  5GAD I;  2HND A;  2KVQ E;  2WHO A;  1ZET A;  1UA0 A;  4WCE Q;  3RB3 A;  2UVU A;  2UXC J;  2APO A;  1K0V A;  4FF1 A;  1S12 A;  1HHQ A;  2Y1R I;  3G4S S;  1LWE B;  4AND A;  4QWD A;  4CLF A;  1MWY A;  1B0P A;  3CD7 A;  4OYI A;  1PG5 B;  1J5O B;  3LAK A;  5C24 B;  2IBO A;  3TZX A;  3MMB A;  3UWT A;  1N0V C;  5F8L A;  1CJU B;  3LWL A;  4GVB B;  2V4J B;  1RT3 A;  2ZC3 A;  1LW0 B;  5IOL A;  3R1L A;  1X5O A;  5AXL A;  1FRM A;  2NLW A;  2HZA A;  2XUL A;  3KJV A;  4B9M A;  1WD6 A;  1Q8I A;  1Y9O A;  3M2V B;  3PW5 A;  4F4K A;  3PNI A;  2RHQ B;  1YIJ S;  1FFG B;  1G6B A;  6AT1 B;  2BJ1 A;  3SXL A;  3EVO A;  2FVC A;  2EI5 A;  3CJ4 A;  2OPS A;  5HP1 A;  4CLW A;  2GQQ A;  2W8K A;  2B9Y A;  2BQ3 A;  3AFG A;  4C8L A;  1YG0 A;  2XSJ B;  2X7I A;  3HHL D;  4LBI A;  5IWA J;  4IRC A;  1N33 F;  1DTQ B;  1LWE A;  3NS5 A;  4DPO A;  2GIF A;  2AKW B;  1BWV A;  3PXG a;  1QTN B;  3C16 A;  2N7C A;  2IRX A;  1SJ4 P;  1VCT A;  3MGJ A;  4OI4 A;  5GMD A;  4HH0 A;  3QAE A;  3LP1 A;  4OYA A;  9ATC B;  1H2U X;  3DRP B;  1RT6 B;  2BV3 A;  1CS4 B;  3D0H E;  3QSY B;  2CPZ A;  2UUB J;  1WEX A;  2XI3 A;  1S1V A;  1LW0 A;  4JI5 J;  1S1U A;  2CQ4 A;  2J9D E;  4W4M A;  3BH7 B;  3QSI A;  3TOQ A;  2CAD A;  1YKW A;  3OPK A;  3FRZ A;  3TZZ A;  2R8K A;  1RAJ A;  5HVG A;  2MZT A;  2X51 A;  2J7U A;  4ZLJ A;  5AE2 A;  4NYO A;  3TA2 A;  4IDK B;  1KTQ A;  2ADB A;  2BOP A;  4DR7 J;  3VGV A;  3P8B B;  1PYO B;  2MZ1 A;  1IBC B;  4OFZ A;  4GC7 A;  1ZYQ A;  1ZS6 A;  1CJT B;  1JXE A;  1HBN B;  2EPI A;  4L3K A;  2QN6 B;  4PAA A;  2ZH2 A;  1GNK A;  4ED1 A;  2Y0B B;  2YX4 A;  2H5J B;  3EJM A;  4OX9 F;  4WFA Q;  1VIS A;  2BX6 A;  3BGF A;  2CPI A;  2JRS A;  5B7W A;  3TVY A;  3O44 A;  1AFI A;  5IQ6 A;  1JLB A;  1RAG B;  2QJ3 A;  1WC1 A;  4QBU A;  5JJB A;  4Q45 A;  3EYZ A;  1VOM A;  1Q16 B;  3D6M B;  1ZAV A;  1RLD A;  4KGV B;  1X4H A;  4ZHR A;  5C7P A;  5HMW A;  1NB2 A;  5AT1 B;  3DXS X;  3G6E S;  4F4Z A;  1I5O B;  2DGS A;  5HN0 A;  4RW6 B;  5T7L B;  3D1O A;  2XQC A;  3RAQ A;  3N79 A;  3VAI A;  3G82 A;  2DHS A;  4USK A;  2PSZ A;  4WP3 A;  1YRX A;  2RQM A;  4GRS A;  2G0I A;  3D1H A;  2BE9 B;  2YH0 A;  2HQC A;  3P3D A;  2HRT A;  1M5K C;  2G4B A;  1UAW A;  2GVD A;  3H90 A;  3AJD A;  3KXD A;  2WZ1 A;  1WF0 A;  4Y2K A;  3UI3 A;  4F2S A;  5KFX A;  1RWV B;  2FHJ A;  4AFF A;  1UZH A;  2LCW A;  5DGA A;  4DR2 J;  3NXZ A;  3DOM B;  1HHS A;  1MU2 B;  3QWU A;  1NHK L;  2L9D A;  2ALZ A;  3Q22 A;  2QGF B;  3MFH A;  1QVG R;  4QIF A;  1PYS B;  4DHV A;  3UD3 P;  2MZJ A;  3L95 X;  2HVZ A;  4YDD B;  3W61 A;  5A6P A;  1KHV A;  4AQY F;  1PBU A;  3SQG B;  5KG5 A;  2MQQ A;  4QR2 A;  2HW3 A;  1CEZ A;  3KG1 A;  1RT1 B;  4Y0F A;  1S72 S;  2HBR B;  3H2U B;  1AXQ A;  3SFG A;  2J7K A;  3T1H F;  4ILL A;  2NZC A;  3D3B J;  1E6V B;  3EGV A;  5EN1 A;  2ALY B;  4USJ C;  1P27 B;  2GVD B;  2A0F B;  3CUL A;  2CJY B;  3QAU A;  2PEH A;  3W2W B;  4U7U K;  5KFN A;  1HR0 F;  2B6A A;  1ZZF A;  1S0O A;  4TYB A;  3Q8V A;  4LRE A;  2HFU A;  3C15 B;  4PXE A;  5A76 A;  3CJK B;  1WOP A;  4FYD A;  1JLC A;  3F0N A;  3D0G E;  4EZ6 A;  2QRR A;  1RWN B;  4CO3 A;  1JXL A;  3HZE A;  2I5J A;  2XY7 A;  3GYN A;  3FZB A;  4NPO A;  1IKV A;  1T11 A;  2HFZ A;  5C42 A;  1F1B B;  2H4W B;  1EKR A;  1VQ7 S;  2V9W A;  1Y5N B;  2W4C A;  4HVZ A;  3NAI A;  1NCL A;  4I68 A;  5KFE A;  2LP4 A;  3FCH A;  3EWG A;  3L9Z A;  1AZS A;  5MLC V;  2D9P A;  3NMA A;  1N5Y A;  5GAE U;  2PT0 A;  1SQF A;  1T9W A;  3VGU A;  2ZOG A;  2RSQ A;  2XNQ A;  3TX0 A;  1WTF A;  2VQF F;  4N5S A;  1DTT A;  1HNV B;  3LA0 A;  2ZVI A;  4WK1 A;  5HAN A;  5KFU A;  1IBM F;  2O3D A;  4L72 B;  3B4D A;  2EK1 A;  2NPI A;  2YKQ A;  1BLU A;  3MM6 B;  4J5O A;  4RLE A;  1SJ3 P;  2IAJ A;  1V9O A;  2DIT A;  4URS A;  2DIS A;  4QCL A;  2DNZ A;  2VG7 B;  2J6U A;  4TY9 A;  2I8E A;  5DJB A;  5CCM A;  2GHP A;  2V4J A;  1NJW A;  4ED4 A;  3Q23 A;  2YPY A;  4WTY A;  1YJW S;  4OJ3 A;  4MK8 A;  5C42 B;  2R8I A;  3SZ2 A;  2MZS A;  2CPY A;  3S01 A;  3OUY B;  3SV3 A;  2MKY A;  4KYZ A;  2FY1 A;  3MUT P;  2HHH J;  4WP9 A;  2OTL S;  4P72 A;  2FPH X;  5H9F J;  2QEX S;  2LU1 A;  3ILL A;  1HW8 A;  5ETM A;  2H54 B;  4MK9 A;  2KB2 A;  2HFS A;  4Y6I A;  1M5O C;  5J2P A;  2ILZ A;  2XSJ A;  2O5D A;  2MXY A;  4IR9 A;  3TQ1 A;  4NLT A;  5A8W B;  4DUZ J;  4O4G B;  3T5K A;  1UET A;  4DF4 A;  2WBM A;  1X4G A;  3CJR A;  3WC0 A;  3FGV A;  5KT7 A;  3BGR A;  3T5L A;  2I2Y A;  4A8S A;  3U1N A;  4IRD A;  4F02 A;  1RBA A;  2QSF A;  3CJ8 A;  2LKZ A;  2XMM A;  2DGW A;  3JYT A;  3J7A 1;  2BMB A;  2ZUG A;  1OIA A;  2V4Q A;  1S6Q A;  3IRX B;  3PCO B;  1M5V C;  3CCW A;  2YXL A;  3J80 Y;  4KKO B;  2A6O A;  3GLJ A;  4EBC A;  2PDA A;  2EBG A;  1U24 A;  2R7T A;  2L08 A;  1TMM A;  4I6A A;  4RNN A;  1SC3 B;  4EUV A;  4HLB A;  2OEJ A;  3MCM A;  3THT A;  5ETK A;  1FD8 A;  5B08 A;  3OVA A;  3OJU A;  3MR6 A;  2Z56 B;  3R5C A;  5GAG U;  1WDD A;  4FF3 A;  5RUB A;  4DG1 B;  1RUS A;  4B9T A;  1HYS B;  1GMU A;  3CDB A;  5LL6 d;  4A8X A;  1GEH A;  3I55 S;  1S7I A;  3VZI A;  3CO0 P;  2O01 C;  1FWL A;  2R7O A;  2WVE A;  3ITH A;  4HDG A;  4X4P A;  5HBM A;  4ZLL A;  2L41 A;  8RUC A;  2MMY A;  4P75 A;  2DJW A;  5HAT A;  3GP9 A;  1X0F A;  1V6H A;  2R9L A;  2DHA A;  4ANC A;  2QFJ A;  1FKO B;  1RAI B;  2VBW A;  2RIJ A;  1CBK A;  3QGP A;  5KFW A;  5JVH Q;  2M4M A;  2AYB A;  3MTJ A;  3Q8R B;  4YN3 B;  1IBM J;  2Z2M A;  1D1U A;  4DR3 F;  2C2O B;  2LDI A;  4M5N A;  2CG8 A;  1WC4 A;  1N5T A;  2DBB A;  3EE3 A;  4WE1 B;  5B09 A;  2D3O 1;  3NGK A;  1RBO B;  1U02 A;  2GC8 A;  2Q6B A;  4E8U A;  1OPZ A;  2F4F A;  2M8D B;  1OO0 B;  1Q95 G;  3MD3 A;  3MAA B;  4EYI B;  1WOS A;  5CYJ A;  9RUB A;  2B5J B;  2K06 A;  3OHB A;  1VQK S;  3QIP B;  1RT4 B;  3MPU B;  4NEY A;  2AGP A;  4MKA A;  1UVM A;  2A6M A;  4JI2 F;  3HJF A;  4C3K A;  3NAH A;  2G0C A;  4DCP B;  2DR5 A;  4V19 X;  1SH0 A;  3IO1 A;  2KZM A;  3AOD A;  3OW2 R;  1SVD A;  4F3O A;  4LF4 J;  1OWX A;  1YJ7 A;  1FRI A;  2CQI A;  4QIG A;  1S79 A;  1X4F A;  4C8Z A;  2BZ2 A;  2OI2 A;  3LTO A;  3PW0 A;  3K0J A;  2KO1 A;  2IA0 A;  2DNO A;  2OPP B;  3DRS A;  4OJ1 A;  3BH6 B;  1MG7 A;  1YRT A;  3BS9 A;  3HSD A;  3MED B;  4RWX A;  3TAM A;  2BW2 A;  2VQE J;  5HJY A;  3FEZ A;  2K2P A;  2G2O A;  2HS3 A;  4WE1 A;  2CQ0 A;  2N3O A;  4DSL A;  4P73 A;  3R2C J;  2ZJQ Q;  1NH8 A;  1NU4 A;  4CT9 A;  5KFA A;  5CYM A;  1QSL A;  1FJ7 A;  2BJE A;  4MJK A;  3JQM A;  3SSQ A;  4CT8 A;  5F9N A;  1YJV A;  2CUY A;  2VU5 A;  4GO5 X;  4Y65 A;  3KUH A;  2RF2 B;  2W8L A;  4QU6 A;  1T7P A;  3NNC A;  2ZD1 A;  3N6M A;  1HBM A;  2DNK A;  2OPQ A;  5KG1 A;  4EO8 A;  5DG9 A;  2HFO A;  3D1Q A;  4HDH A;  3K5N A;  2DO4 A;  2MY8 A;  3NGU A;  5DDP C;  5DDO C;  2VC1 A;  1XMB A;  3ETO A;  3W66 A;  3ZZP A;  1YSJ A;  3BGL A;  2FTR A;  2A2C A;  4MKV A;  4DLG A;  2R2S A;  1B7F A;  5CQG A;  3EGZ A;  2LDY A;  2G13 A;  3V81 A;  4Y2M A;  1O51 A;  1XBW A;  3UPF A;  1VQP S;  1F5C A;  2VKZ G;  5EWF A;  4UY8 T;  4CLT A;  1IN0 A;  3C8Y A;  3N6N A;  3DHX A;  1FJE B;  4DR4 J;  2ZH1 A;  3LGH A;  4ID8 A;  1XNR F;  2GGP A;  1GXT A;  3GIR A;  3RBX A;  5E3P A;  1DAX A;  1H73 A;  2XHW A;  1RTI A;  3DOK B;  3FBB A;  1GX6 A;  1DQA A;  4J37 A;  4QQB A;  3ZTP A;  4CO1 A;  2ZBQ A;  2JDJ A;  4DPT A;  1VRT A;  3TNV A;  4RNO A;  4TQS A;  2R7R A;  1RAA B;  2YWF A;  5JUM A;  2Y1I A;  3FUY A;  5CXT A;  4U6P A;  2UUA F;  2OPR A;  3KOA A;  2LQB A;  1ZM2 A;  3R7B B;  5LXY A;  4GC6 A;  2R8J A;  2XWY A;  4M63 A;  4DV0 J;  1Y5L B;  3M6V A;  2HQF A;  3DCA A;  4MAK A;  4RR5 A;  2F9J A;  2N82 B;  5KFR A;  1DQ8 A;  1X9S A;  1HQ2 A;  4ID5 B;  4XPC A;  2FLL A;  2R7U A;  3MD1 A;  5KOX A;  4NCA A;  1KVJ A;  5CAB A;  4OX9 J;  1I94 J;  3JTP A;  4N47 A;  2ZBP A;  4WFB Q;  3OV7 A;  2MQN A;  5KFK A;  1ELO A;  2NUU G;  2PII A;  2BJ9 A;  5KFQ A;  5LJ3 Y;  2ASY A;  4YHH J;  4KY3 A;  2XCA A;  1WHX A;  3MEE A;  2FLN A;  4JI7 J;  4KHP F;  2EEY A;  1U0S A;  2WON A;  4OX7 A;  3O1L A;  4DPW A;  2V2Q A;  2JL9 A;  3OTB A;  2CJ9 A;  3GQC A;  1VRT B;  3V4I B;  4F0H A;  1KLM B;  5K20 B;  3KLF A;  4H54 A;  2HUR A;  3HD2 A;  3PIO Q;  2Y8W A;  3CO9 A;  3GSD A;  1KDN A;  4Z7C A;  2M2B A;  2MLX A;  1M5H A;  1LXN A;  1BQN B;  1RHJ B;  4DL5 A;  1YJN S;  4DL6 A;  1FRX A;  3QZ7 A;  1F6T A;  2EK6 A;  3H2L A;  5KFB A;  4P2S A;  1O5J A;  3HVA A;  4F4X A;  5J2M A;  4LFB J;  1H2V Z;  1O6X A;  1R89 A;  4ZVR B;  1NHU A;  2HBZ B;  4YUD A;  4MIW A;  4ZPC A;  2AYG A;  4O44 B;  5IWA F;  3KNA A;  1N33 J;  4P2M A;  3DLK A;  3KHL A;  2BQU A;  3DDK A;  1WWH A;  3PAC A;  2VOO A;  2R42 A;  3HK2 A;  5JXS A;  2WOM A;  4MH8 A;  3EPI A;  4CYU B;  3B6B A;  2QFI A;  1Q8K A;  3Q8U A;  1C1C B;  1X60 A;  2HQG A;  3QMQ A;  2RH3 A;  2RQC A;  2ASJ A;  2IDL A;  1XIQ A;  2RRA A;  1UVJ A;  1JLA A;  1KKH A;  2MKJ A;  3TVK A;  4ES2 A;  2J76 E;  3IMQ J;  1VMB A;  2BAC A;  2LQ5 A;  3J7Y I;  5J2N A;  3EZU A;  3C16 B;  4LF9 J;  2NR0 A;  1DLO B;  1XN9 A;  4NYP A;  3MAQ A;  3S1T A;  3T1Y J;  2K8G A;  5LM7 E;  3GFY A;  1QM9 A;  2UV8 A;  4IOC Q;  1UP1 A;  2XYG B;  5CAA A;  3LGN A;  4CH1 A;  2YNG A;  1XK8 A;  3UCG A;  3GV8 B;  2W2M P;  2N4D A;  2J0Q D;  4KFB A;  2JLG A;  5F8N A;  1G3O A;  1LFP A;  2VG6 B;  4Q7A A;  1IR1 A;  3I31 A;  4PG8 A;  1RHQ B;  4NX9 A;  2RRN A;  4QW8 A;  4YY3 F;  2HHT A;  3F56 A;  4PEO A;  5A8R A;  4DL3 A;  3MTK A;  3GJT B;  3KDO A;  2CNN B;  2JNJ A;  1NJY A;  1S10 A;  1VR6 A;  4NXN F;  3EDQ B;  4DX8 H;  5FJ4 A;  1K47 A;  2CQD A;  1P1T A;  3B4M A;  3DDN A;  4PPZ A;  1C1B A;  2P9E A;  3KUE A;  4C48 A;  3FK4 A;  1RWP B;  1GTE A;  1QSY A;  1T03 B;  4C4W A;  3AD7 C;  4OLP A;  3JS9 A;  1DFD A;  3M8Y A;  1REV A;  1FVQ A;  4IOB A;  4PQA A;  2HYI B;  4IOA Q;  3ZNU A;  1QAI A;  3DYA A;  5I4M A;  3KJN B;  3RRK A;  3ISZ A;  2HHU A;  3JSY A;  2XTJ P;  4LIW A;  4X65 J;  1U4B A;  1KTV A;  1DUR A;  4EBD A;  3KLI B;  3QFW A;  2ZH8 A;  4DCJ B;  2AYE A;  4X84 A;  1UEU A;  3AQP A;  2MKI A;  3LAN A;  2RU9 A;  3MUR P;  2V8P A;  1ZAX A;  3KKF A;  3FQL A;  3LO3 A;  3CCL S;  2YQ0 A;  3E51 A;  3FBC A;  4RO0 A;  3TUP A;  2I38 A;  2K1R A;  1JLE B;  4C8M A;  2AZ1 A;  1OY8 A;  2X3D A;  1TV6 A;  5KFJ A;  1FFS B;  5LMU F;  4DV2 J;  2PD1 A;  4EGL A;  2FZG B;  3P49 B;  5MAO A;  4CM0 A;  4ZPB A;  3TAQ A;  2ASL A;  1T0T V;  4DR1 F;  3BPS P;  1YK9 A;  3LW5 C;  3N4W A;  5E3Q A;  4JV2 A;  2B3T B;  3CD5 A;  1YZ7 A;  4I2Q A;  3R8Y A;  3RAM A;  4DUY J;  1U49 A;  3A1Y G;  4L74 A;  4LR9 A;  1JLF B;  3CJ5 A;  4CNZ A;  3THV A;  1WKK A;  1I94 F;  2OML A;  1LWF A;  2YQ1 A;  4DZ6 A;  2W7A A;  2Z4P A;  2VA2 A;  3BZQ A;  5KFI A;  1Z1Z A;  4JI1 J;  4FNH A;  4PAB A;  1RAH B;  4AD6 A;  4MYT A;  1WHV A;  4CO0 A;  1N88 A;  1XMO F;  2MDA A;  2OKQ A;  2LYV A;  4C9D A;  2RIL A;  1NZ8 A;  4R0E A;  1RB0 A;  2ZC4 A;  3OVB A;  1NDK A;  3CF5 Q;  1B0T A;  5GMK a;  3T1A A;  1FX4 A;  3UO0 A;  1VQY A;  5L46 A;  1H74 A;  2ZBI A;  2JEI A;  2KH9 A;  3P45 B;  3QGG A;  3TZW A;  2AEJ A;  4L73 A;  2VFV A;  1Y7P A;  5HL7 Q;  3CUN A;  3RB4 A;  1WOR A;  4DR4 F;  1V3Z A;  3AB4 B;  4LR8 A;  4J9R A;  1T9V A;  1KR4 A;  2YVS A;  4UZC A;  1N6Q B;  2J5A A;  4DZD A;  1UA1 A;  1JLF A;  4PG4 A;  5KFF A;  1WC3 A;  2BQR A;  2ZHB A;  5CD4 H;  2I1R A;  2P6T A;  1Q0N A;  4FYY B;  2LQJ A;  5BR8 J;  2KHD A;  4QYR A;  1NB7 A;  4ZDN A;  3L4B C;  3DI6 B;  2IVY A;  3FMB A;  1EAY C;  3JAM U;  3PR5 B;  3CJ0 A;  3VAF A;  5L8R C;  2GNK A;  3M2V A;  1WC6 A;  1Q4R A;  3EVM A;  4UTG A;  4DMZ A;  4EI2 A;  2BE2 A;  2Q43 A;  3CTR A;  4FXV A;  2AIR B;  1JLQ A;  2OPS B;  5HP1 B;  4ZP7 A;  1AUD A;  1SCJ B;  2MST A;  1TMJ A;  3VCD A;  1WUU A;  1DTQ A;  2BJD A;  3ETM A;  3NGT A;  2NPF A;  3BPD A;  2DNR A;  2C42 A;  3PM9 A;  4J9M A;  4LBP A;  4WYL A;  3TUZ C;  1UVN A;  5KT5 A;  3JAM Y;  3MM6 A;  3P6Y C;  2LXF A;  2QV6 A;  3DGP B;  4M5J A;  3FBF A;  4ED2 A;  4NE9 C;  2B0G A;  2KRB A;  2QMU B;  2MY7 A;  4K4V A;  2V5H G;  3BGO P;  1U1L A;  3T9N A;  4X65 F;  3H25 A;  3FQK A;  4ED5 A;  4QR0 A;  3SCI E;  1H0H B;  2M0G B;  4K8R A;  1HHT P;  1RKI A;  2ZEJ A;  5A0Y B;  3M9M B;  1LW2 B;  2PGC A;  3M6X A;  3DRR A;  4NLW A;  2V4R A;  2AJF E;  2QYC A;  2BOA A;  2AU0 A;  1IM4 A;  1U7L A;  2ZOM A;  1JNZ B;  3I96 A;  2DEI A;  3R5B A;  5J2P B;  2KJV A;  2U1A A;  4RBV A;  2VON A;  2JFK A;  2FVP A;  2CNL B;  1CJT A;  3ET6 B;  3MR5 A;  2UVR A;  4AUK A;  5ETP A;  4DL4 A;  2R7W A;  5J2Q B;  3VAG A;  4N41 A;  1TKX A;  3MEK A;  3P96 A;  4NLS A;  3BO2 A;  4FBT A;  4RW8 B;  3HHN B;  2ROE A;  3U27 A;  1FT8 A;  2QE5 A;  2X1F A;  5IT0 A;  4BS2 A;  2YNG B;  2B8P A;  1UJ5 A;  3BKF A;  1S6Q B;  4U7U D;  1U1M A;  4IR1 A;  2HZV A;  2BJ3 A;  2W4D A;  3CCT A;  2YKM B;  5D78 A;  4ATN A;  2XLI A;  5G0R A;  2VPW B;  3I56 S;  3IM9 A;  4X4U A;  4Q2L A;  1VRQ C;  4DU8 A;  3DLG B;  4ETX A;  4F67 A;  5F8I A;  1W2I A;  2EVZ A;  2DPI A;  3J7A N;  3OL6 A;  1KSP A;  2VG5 B;  1FWP A;  3GIJ A;  2NZ4 A;  2P2C B;  3K59 A;  3R97 A;  3FRY A;  2CNO B;  4O3O A;  2FZK B;  4ZVT B;  1S9G B;  4K4T A;  1JX4 A;  3BO3 A;  5LMN F;  2F65 A;  3DRX A;  2UUC F;  3LWM A;  4J9N A;  2F8E X;  3ZXW A;  2W9B B;  2Y1L B;  3OJS A;  3BSO A;  1REV B;  5HBM B;  4ELT A;  3D4J A;  3IXQ A;  3LP0 B;  2M8H A;  3SQO P;  5L9N A;  3IM8 A;  3LP1 B;  3NP5 A;  4R8U A;  3AXK A;  3EGW B;  3DRP A;  1YTY A;  5LMU J;  5F41 A;  1RWK B;  4C97 A;  5CCL A;  1GFW B;  2OSR A;  1S1U B;  5KFS A;  2HBQ B;  2IVM A;  1RTJ A;  4JYA J;  5GAG I;  4DL7 A;  5K8O A;  3Q8S B;  2MZR A;  1S1W A;  1FEE A;  2ROP A;  3BBC A;  2XLJ A;  2J6S A;  5DQI A;  3CJQ A;  3NBP A;  4YP3 A;  4C0H A;  2KN4 A;  3CWJ A;  1TK0 A;  4KGX B;  1RT7 B;  2DH7 A;  3M8W A;  4X64 F;  2HFV A;  1SL2 A;  4IDK A;  2W2P P;  3W5Z A;  4ZPA A;  2DR8 A;  2E5L F;  2COL A;  2QSW A;  2KFY A;  4RBT A;  3OFG A;  2FJD B;  2IYG A;  3JQJ A;  4DN9 A;  4H4M B;  2C2N A;  4UUW A;  4QZV B;  3WIU A;  1NKE A;  4H4K C;  1L3V A;  1Q78 A;  1Y0H A;  1TL5 A;  4JV0 A;  3UNY A;  4KHP J;  1OQ3 A;  3MPD A;  2E1R A;  2DXD A;  1SH2 A;  4FS2 A;  1TK8 A;  2XLK A;  2GO9 A;  2H48 B;  1UCN A;  4WFX A;  4ZJL A;  4YB1 P;  2G0J A;  1S0M A;  2FHM A;  4MMO A;  4LF6 F;  1N32 F;  2MLZ A;  4HHU A;  3KHG A;  4NRU A;  4YY3 J;  4FN5 A;  5T7L A;  1T3O A;  5KAK A;  1NUE A;  5IQQ A;  5E41 A;  2KXN B;  3PG9 A;  1X0P A;  4YR2 A;  2ZNY A;  3CCU S;  1VQM S;  2V69 A;  1TR0 A;  2DT9 A;  2W2N P;  4NXM F;  3OFH A;  2VQF J;  2Z0G A;  5B0G A;  5DG8 A;  4X4O A;  1CQN A;  2DR7 A;  1KN6 A;  4NYZ A;  2QO3 A;  1R43 A;  2Q79 A;  1HNW J;  2DGT A;  5HQ8 A;  1TUW A;  2A2D A;  3NWR A;  5K9F A;  1YX2 A;  4DX6 A;  4X4T A;  4K4Y A;  1K44 A;  4USU A;  5FDL B;  3TUJ C;  5KFC A;  5L1K A;  4DQR A;  1QE1 B;  3G6Y A;  2YWG A;  2LXU A;  3QBC A;  1N6Q A;  2RU3 A;  4C0B A;  1FVS A;  3MHY A;  1S0V A;  4RUB A;  4NLD A;  1SBR A;  2K3K A;  4U9R A;  4CO5 A;  5LSL A;  1Q7Y T;  3TAR A;  2RD5 C;  4P7V A;  4OHV A;  2R8H A;  3HFV A;  3CDU A;  3SQG A;  3ILI A;  3OUY A;  4F4A A;  2ZJP Q;  4JBC A;  1FKP B;  2W4P A;  4C0O C;  3IWL A;  2DIU A;  1VJQ A;  5DET A;  3W9I A;  4U7C A;  4ECU A;  2GGP B;  4LFA F;  3E01 B;  3CB4 A;  3MM8 B;  1I3O B;  1RTI B;  3DOK A;  1PAE X;  1DY3 A;  1TU0 B;  1V3S A;  2MGZ A;  3I6P A;  3R5G A;  3IGN A;  4ECQ A;  2HND B;  4ECS A;  3PW4 A;  4TVA B;  1M90 T;  5KFO A;  4PQU A;  1IQT A;  3HSZ A;  2EXU A;  5KG0 A;  4FF2 A;  3W2W A;  1PCA A;  4JI3 F;  2VH7 A;  1REG X;  2VIH A;  5I3U B;  4EEY A;  5KG3 A;  3UVJ B;  4XIU A;  1SIW B;  3HXM A;  4J9L A;  3UD5 A;  3FSI A;  3TI0 A;  2RML A;  1QE1 A;  4AE5 A;  4IH6 A;  1HLW A;  2R8G A;  2DCL A;  2NCK L;  4KHR A;  2YPZ A;  4K4Z A;  3VGS A;  3CJT A;  3PJW A;  4ID5 A;  1FHT A;  1V5I B;  2V8H A;  2VAS A;  1QDU B;  4OHY A;  4UOG A;  2ATL A;  2WVF A;  1XJW B;  4LQ3 A;  2GVZ B;  4OYM A;  4ZA1 A;  4M1K A;  4DXL A;  3H5Y A;  1DRZ A;  1EP4 A;  2E1P A;  4DR2 F;  4OMF G;  1GH8 A;  1FKP A;  1FXD A;  1EET B;  3MM9 B;  2EFV A;  4I7F A;  3S7R A;  5K14 B;  2EBE A;  4AL6 A;  1U45 A;  4AL5 A;  4LSN A;  3W2V A;  1UTA A;  2C1E B;  3ZZ0 A;  4V19 J;  4K0K F;  3JTN A;  3R1H A;  3Q83 A;  1FX2 A;  3EUN A;  4HH1 A;  3J7Z T;  1IBK F;  2D69 A;  1R0B G;  1IKW B;  4FYX B;  1MML A;  1X5T A;  4DS4 A;  1VRU A;  1FER A;  3MPY A;  4LF2 A;  4P6Q A;  5D4O A;  3IGV A;  5IM0 B;  3MMA B;  3VAH A;  4DV0 F;  2LQ8 A;  1KD1 T;  2O67 A;  3X3U A;  4ECT A;  4YB7 A;  3ZTQ A;  3KLE B;  2BDP A;  5ADZ A;  2VBY A;  1SL1 A;  2UUA J;  2ZKT A;  4O3P A;  4A47 A;  1GXL A;  3LPY A;  1S1V B;  3I87 A;  3EM1 A;  1AYE A;  1R8P A;  5E5N A;  3IAM 9;  7AT1 B;  3NS7 B;  4PWD B;  3CJ2 A;  1MNE A;  4YB6 A;  4EU0 A;  1XNR J;  2RHS B;  3UN2 A;  2QL7 B;  3CD6 S;  3OL8 A;  2VJU A;  1JKH A;  1TL3 B;  2BJ8 A;  1RSC A;  1YLX A;  3QO9 B;  1KWM A;  3VF0 B;  2YX7 A;  3D7S B;  3A8J A;  4BC7 A;  2XI2 A;  4E2F B;  3MEG A;  3GZ7 A;  3RW6 A;  1L3T A;  2NSB A;  2B5J A;  1TEL A;  4DF8 A;  1UFK A;  4C98 A;  4UY8 5;  2IM1 A;  1GQE A;  2Z57 B;  3HHL C;  3M8Q B;  2GZO A;  5J2N B;  3ZZY A;  1RDR A;  2WBR A;  5T14 A;  3EDR B;  4ZP8 A;  3Q8Y A;  3K2Y A;  3R27 A;  5KG4 A;  3TP2 A;  4NI2 A;  2EC2 A;  3TVZ A;  1MWZ A;  4JI5 F;  1JLB B;  3IWN C;  1TVR B;  3M6W A;  3MM7 A;  4M5D A;  5DRK A;  3ADA C;  3DRS B;  2MZQ A;  2EFG A;  5BYR A;  3PKM A;  4KSE B;  4RW6 A;  1W7W A;  2XMW A;  3TX8 A;  4Z2X A;  4DSF A;  2B8Q A;  3UCU P;  1R27 B;  5GAH U;  2A1B A;  1RT7 A;  3GJR B;  1RGV A;  3J7Y U;  2WTF A;  4DV6 J;  1U2C A;  1PAU B;  2DPJ A;  4PG5 A;  2J0W A;  2RF2 A;  1HNX F;  1OJ4 A;  1KBR A;  2CRL A;  1GX5 A;  3TEG A;  2ZH3 A;  2E7W A;  3A8K A;  3VWS A;  4ALZ A;  3ISN C;  1N34 F;  1FCA A;  2MYF A;  3PHE A;  4LF1 A;  2M70 A;  4IG3 A;  3KNG A;  1YBU A;  3D3C J;  3SCK E;  3ZTS A;  2HHH F;  5D4L A;  5IS2 A;  3HZG A;  4LRB A;  4CLP A;  4YME A;  1LV5 A;  2ZZM A;  4JV5 F;  3WX4 A;  4MIA A;  2VPY B;  4DX5 A;  5HQM A;  1D09 B;  1WAC A;  1HL6 A;  3US5 A;  4DL0 C;  4OHZ A;  2EKY A;  3B8H A;  2PMW A;  2FC8 A;  4ED6 A;  4USW A;  2K3I A;  4DCO B;  3NNH A;  1LNQ A;  4YQW A;  3QRP A;  5HJX A;  4X62 J;  3ZTR A;  1VC6 A;  1FRJ A;  1FNX H;  3HHL B;  3I0S B;  2BRK A;  2UZA A;  2VDH A;  1VQN S;  5KFV A;  2HWH A;  3D6H B;  4ICL A;  1P6T A;  3FVY A;  1HNZ J;  4LVN P;  1HNZ F;  4IO9 Q;  3PRB A;  2XMA A;  3M30 A;  4RW7 B;  2FJB B;  4X4S A;  1ZA2 B;  4IKA A;  5U47 A;  1OSC A;  2YWW A;  4FPI A;  4X62 F;  3LUY A;  2UU9 F;  4DV5 J;  2CQB A;  1L3K A;  3VHQ A;  2CFX A;  3MOZ A;  4BCA A;  4H4O A;  1ZM9 A;  1YJR A;  3MMC A;  1F9H A;  4QYZ J;  1FXL A;  2PO4 A;  3FMW A;  2FQQ B;  1ZA1 B;  3M8P A;  1RBL A;  4I2Q B;  2QX0 A;  5CZX A;  4LRF A;  1BMQ B;  1DZ5 A;  2CNK B;  2CQP A;  2KXF A;  1XWL A;  2HHP A;  1R31 A;  1SC6 A;  2OEM A;  4DSK A;  3C2P A;  4ZVP B;  2P6S A;  1J5E J;  3LAL A;  1N34 J;  4EBE A;  2OPP A;  3AXM A;  1X4E A;  2L9W A;  2GAH C;  2ZIT A;  2C3O A;  1D0E A;  1HNX J;  4ZVE A;  4PWW A;  1U25 A;  3OR2 B;  2DD8 S;  3DHW C;  3RJM B;  1C4A A;  1AZS B;  4AXJ A;  5D0H A;  1QUP A;  2W2Q P;  5L39 A;  2MGZ B;  2HFN A;  3SMZ A;  2MSS A;  4JOU A;  1D9A A;  4EK2 A;  1IKY B;  4OX6 A;  1PSD A;  3HSG A;  5ETO A;  1U1O A;  2HS0 A;  1BQX A;  1D3W A;  4C3M A;  1R7I A;  2D74 B;  1RHR B;  4H4O B;  3D2W A;  4UQT A;  2JX2 A;  4DV3 J;  3T1H J;  2E5G A;  4DUZ F;  1D9D A;  4TKT A;  1RU1 A;  1U48 A;  4N76 A;  3PJX A;  2VIC A;  1X5S A;  3OXG A;  2YNH B;  3BF4 A;  3CJ3 A;  1FI4 A;  2DXE A;  1J5E F;  2RJZ A;  3E8O A;  2WVD A;  1U8W A;  3G9C A;  2BM1 A;  1NSA A;  5IXU A;  3AQO A;  3RUB L;  1EP4 B;  2XMT A;  5D3G A;  4K59 A;  4NZ7 A;  1HBO B;  4PYA A;  1NND A;  2HAI A;  2WVB A;  3FDS A;  1HQE A;  2MQO A;  1NM2 A;  1MMN A;  2FJA B;  4QIE A;  4JI0 J;  1C1C A;  3IR6 B;  2UU9 J;  1XNQ F;  2AYM A;  4XTT A;  2HLU A;  4JI4 J;  2VZ9 A;  3W3S A;  2J7W A;  4ZCI A;  3JXO A;  3KK1 B;  3CCR S;  1U8S A;  5I42 A;  3DFE A;  1HI0 P;  4A8F A;  4KPC A;  4QOT A;  2RQ4 A;  5GVQ A;  1WSV A;  3M2R A;  3OFF A;  1LKZ A;  2N3L A;  1XR7 A;  3HJV A;  1BHN A;  4WK3 A;  1P8G A;  3AHP A;  3I0R A;  4OV1 A;  3J7Z 5;  5DGB A;  3JYT B;  4ECY A;  1ZTT A;  1L3U A;  4BWJ A;  3D0I E;  4KFB B;  2R3V A;  3IWX A;  2AX0 A;  2RUG A;  4ZVQ B;  4OZN A;  4H4K A;  3IR7 B;  3M05 A;  4ED3 A;  1IBK J;  2B9E A;  1HWU A;  1ZM3 A;  3GR0 A;  3MPV A;  5SUH A;  2QA4 G;  4JV5 J;  1V5V A;  2VA3 A;  4K0K J;  1Q53 A;  3KJF B;  3KLG A;  1UEK A;  1GXU A;  4EWT A;  3QPI A;  2JVO A;  1B4S A;  1FDA A;  2C2D A;  2CIM A;  2UVV A;  4LFC F;  2UXB J;  2D3O R;  4NLP A;  2FHK A;  2AZ3 A;  2W24 A;  3IBW A;  1SB6 A;  4QIW D;  1R6Y A;  4DR7 F;  2CJQ A;  5GAH I;  3HLU A;  3N5F A;  2POK A;  5IV4 A;  5I42 B;  3PYD A;  3TJ9 A;  2JH3 A;  5C2C A;  2NRE A;  4KH1 B;  1FJC A;  3OXL A;  1DAR A;  1DQ9 A;  1TKX B;  4U95 A;  4Q2M A;  2B7B B;  4J9Q A;  3GJS B;  2D9O A;  4EFA C;  3I0R B;  2Z2Y B;  3AB2 B;  2MQL A;  1S9E A;  1JJH A;  4WZM A;  5KFY A;  4UUX A;  2DRB A;  2HHX A;  1LWC B;  2HNZ A;  1RKJ A;  1EQM A;  1SQG A;  3T6B A;  4DFJ A;  2ZH4 A;  1WNE A;  4IO1 A;  4WBF A;  5FII A;  3C14 B;  4ZVH A;  3DLG A;  5AE3 A;  2W9C A;  4W92 B;  2X1A A;  2XG8 A;  4X4R A;  2YY3 A;  3KLG B;  1TL7 B;  2FGO A;  1R6V A;  4LFA J;  3KG0 A;  4MKB A;  1BQM B;  3W9J A;  1OS5 A;  3CDA A;  3MAA A;  3GV5 B;  3OLA A;  2XYH B;  2GQC A;  3P4U B;  1MN7 A;  2RS8 A;  1YQH A;  4HHH A;  3JSM B;  4LJM A;  2CPX A;  3N01 A;  1IQZ A;  4PUO A;  4WKR A;  2K7J A;  4HAC A;  4A8Q A;  2RE1 A;  4IG3 B;  1HBN A;  3K89 A;  3DM2 B;  2DR9 A;  2HMI B;  1JWW A;  3ZFV A;  4OJG A;  3I9V 9;  4RJV A;  4WF9 Q;  1LK7 A;  5SZT A;  3QJP A;  2RKI B;  1RAD B;  1WJ9 A;  1YWX A;  3CCV S;  1UJ6 A;  3T5J A;  5FLX U;  4OHX A;  4OZL A;  1H2T Z;  2DHH A;  3ZNJ 1;  2RDD A;  2M3D A;  1H72 C;  4WWS A;  5LSO A;  2W2O P;  2ZH5 A;  4OLO A;  3BV8 A;  2Y3Y A;  2XMV A;  3M9N B;  1FEH A;  1WEL A;  2OMO A;  4NLR A;  3I5A A;  1NK0 A;  2OTJ S;  4LSL B;  1Q79 A;  4JV1 A;  3PFE A;  2CYY A;  1H98 A;  1SUQ A;  2CVI A;  2IYI A;  1NSQ A;  4I67 A;  4DR6 J;  1FJG F;  1U6F A;  2E9R X;  4LR7 A;  2ZZN A;  1RP5 A;  1ZBT A;  4FPR A;  5CD4 A;  1N5Q A;  2CVE A;  1N32 J;  1WF2 A;  2JEG A;  1WC0 A;  2KYZ A;  3I5B A;  4JI4 F;  2UXD J;  2F4V F;  3QJL A;  3KMQ A;  4C8N A;  1Q5V A;  3HHD A;  3MR7 A;  3VTI A;  2BKP A;  3W64 A;  2RRB A;  4ZPT R;  3DU6 A;  2V67 A;  2J9C A;  1RK8 A;  3SDE B;  3KMS A;  2KT5 A;  2NXE A;  4F8R A;  4M5H A;  4RBU A;  4JI8 J;  2DRD A;  3HF5 A;  3TA1 A;  5KFH A;  1R8H A;  1EKS A;  1TL4 A;  1NRK A;  4ZN3 A;  4E0D A;  4NA3 A;  3W62 A;  1Q8L A;  1YVF A;  4HHJ A;  2P9C A;  4FVM A;  3TWZ A;  4X64 J;  5DDR C;  4F2R A;  4W98 A;  4MT1 A;  5BJR A;  1FDD A;  1JLE A;  2GIQ A;  4OYX A;  4RKU C;  4DJB A;  4A8M P;  1D9F A;  2H5I B;  2DO0 A;  1IKY A;  2NUH A;  3RTV A;  4F0K A;  4CO2 A;  3UDL A;  2QA4 S;  4IH5 A;  4ZJO A;  4G1Q A;  2ZH9 A;  4JYA F;  3M8S A;  3M8Z A;  4B3T J;  2F40 A;  1TP7 A;  4NWB A;  3PEJ A;  1NPR A;  3G71 S;  1NAQ A;  1S6P B;  2ZE2 B;  4RNH A;  1FE0 A;  3WQP A;  1K1Q A;  3MOJ B;  2UUT A;  3MMB B;  2CQG A;  2IJR A;  2FHJ D;  3G6V A;  2ZNZ A;  1CJU A;  1RWM B;  4B17 A;  2AQ4 A;  3IBC B;  4LSZ B;  3HKW A;  4YB5 A;  3K5O A;  4ILR A;  1IKV B;  2UUC J;  1TAU A;  4X4V A;  4O4R A;  2RB7 A;  4K5S A;  5L1I A;  3IC1 A;  2H51 B;  1KS2 A;  3AOA A;  3J81 Y;  2IVF B;  2KFZ A;  4G1I A;  1U09 A;  4KGK A;  1HW9 A;  2WON B;  3ONQ A;  5DZ6 A;  1WEY A;  5EUH A;  3OSN A;  1N56 A;  5CHC B;  4YR0 A;  4NA2 A;  3MM5 B;  2Y8Y A;  3OXF A;  1C0T A;  3M7V A;  3GCW P;  3OL9 A;  1M0S A;  4L76 A;  4M5G A;  1P9Y A;  4G1Q B;  5B0E A;  1HNV A;  5DLG A;  4I6W A;  3UVJ A;  2AT1 B;  1JLG A;  5DO2 A;  5E7O B;  4CM2 A;  2HNY A;  1Y00 A;  1OMS A;  2ZM6 J;  3HUL A;  5K8N A;  2B56 A;  3CXC R;  1RTD A;  4GKJ J;  5G4D A;  2GX8 A;  3PTW A;  5ITH A;  1RT6 A;  4DI6 A;  2MTL A;  5KT4 A;  2BR0 A;  1SI9 A;  4WTO B;  5F0W A;  4XDC A;  1HMV A;  2DY1 A;  4NML A;  3KFW X;  1KNZ A;  2J8A A;  4AYB D;  3DI6 A;  1U6Z A;  3J80 U;  3F44 A;  1Z2Z A;  2DH9 A;  3CSK A;  4O44 A;  3DXB A;  3MDF A;  4PXB A;  1SC1 B;  2V2Z A;  3TJ8 A;  4CLZ A;  3AJ2 A;  3AA8 A;  1TK5 A;  4DSI A;  3QWP A;  5K14 A;  3PYE A;  4B3O B;  4BDP A;  4CYU A;  1UWB B;  4IFV B;  1NSP A;  1NPK A;  1O8B A;  1WG4 A;  2V94 A;  2MHE A;  2F1F A;  2C3P A;  5KFP A;  2PE8 A;  3BDE A;  2JOQ A;  3IAS 9;  1S9G A;  2FDN A;  4AT1 B;  3RU0 A;  4AXI A;  2VKR A;  2EFN A;  1RZM A;  2VDI A;  3MPW A;  1B3T A;  4LF8 J;  3NL0 A;  4BWM A;  4UOH A;  4RW9 B;  2W9B A;  1Z2L A;  5KTQ A;  3HCX A;  2ABY A;  1S7H A;  2DGU A;  3KHR A;  3RBZ A;  2PFD A;  1WKL A;  3OR1 A;  4DFK A;  1RT2 A;  4DQP A;  1SKU B;  2QT7 A;  4PWU A;  2YNF B;  3SFU A;  1AW0 A;  1ZZN A;  3T6J A;  4YS2 A;  1CJK B;  1ROF A;  2HIQ A;  3DOL B;  2HNZ B;  4Q43 A;  2XB2 D;  2AEM A;  2OEK A;  3NGR A;  2N7Y A;  4ZHR B;  4ER8 A;  1VQ9 S;  4OHW A;  4WU2 A;  2XHC A;  4XO0 A;  2MEW A;  3EXY A;  1ULR A;  1MRO A;  5ETN A;  3M8R A;  3QT8 A;  4LF7 F;  3H40 A;  2DNG A;  1Y3K A;  2B4U A;  2BBE A;  1IWG A;  2FHO B;  3HT0 A;  3PYG A;  1BQM A;  3QAT A;  2W25 A;  3PFO A;  3UE2 A;  2V6A A;  3VQS A;  3R5J B;  4DG1 A;  2KG0 A;  5LMN J;  4MIB A;  4ZLP A;  1NK7 A;  1FDB A;  2R7S A;  4ETZ A;  2HEK A;  3HFZ B;  5K8P A;  2B9X A;  2IFX A;  3M8Q A;  2W9A A;  3C19 A;  1U26 A;  1H3D A;  2HVE A;  4DLE A;  2EG2 A;  2DVI A;  2QIF A;  4KBI A;  1B64 A;  4QPT A;  1WHY A;  2M5Y A;  4J9P A;  4NI2 B;  1S1X B;  3G87 A;  1W2B R;  4PXD A;  2JVR A;  1BWE A;  4X2B A;  5E3A A;  4KAI A;  1JXV A;  5C25 A;  2HWI A;  4C8Y A;  5G0R B;  1KHW A;  3P5B P;  5KFZ A;  1LXJ A;  3EX7 B;  4LUB A;  4KB7 A;  2GFF A;  1ARO P;  1RT1 A;  3HI9 A;  3U1M A;  4JI6 J;  4X4N A;  2HPU A;  4ED7 A;  3KLH B;  2JLE A;  3IFE A;  3NMR A;  3P5T L;  2WAQ D;  1NBE B;  2W7P A;  1WG1 A;  1URN A;  5L9X A;  1RI7 A;  2HK2 A;  4DR5 F;  1U0H B;  5H9E J;  1F2H A;  2KRR A;  5CZV A;  5IT4 A;  3HHK A;  2XC9 A;  2FVQ A;  2W01 A;  2D3U A;  2OEL A;  2M9K A;  1TAQ A;  4Z37 A;  1VQ8 S;  1U1Q A;  4TY8 B;  1NDL A;  4FDF A;  5B0C A;  4EMD A;  1CSJ A;  3IBF B;  1SQE A;  3PRD A;  4P7T A;  2CPD A;  3HKZ D;  4USV A;  4F3Q A;  4F3M A;  3Q0A A;  1EQ0 A;  4MTP A;  2EFQ A;  4Q5V A;  2XSF A;  2LMI A;  1S1X A;  3CMQ A;  3FZ2 A;  3GB0 A;  3W9H A;  1J2V A;  7FDR A;  2DEJ A;  1RCX B;  3LQV A;  3VV2 B;  3V6K A;  1Q7L B;  2YQ3 A;  5DLF A;  3H0P A;  4AL7 A;  1OYE A;  5KG6 A;  2F8H A;  2VJV A;  2MPU A;  1HWI A;  4WU3 A;  5FD1 A;  2FIU A;  5HRO A;  5BYQ A;  1NK6 A;  4X66 J;  1J27 A;  2LEA A;  3E01 A;  2UV8 G;  5AE1 A;  2DGX A;  2JC0 A;  3I5C A;  1SJQ A;  3ENV A;  3M30 B;  1IUJ A;  1SXL A;  4RW7 A;  4Y2I A;  3GTY X;  4PZV A;  3G96 A;  2IDE A;  1DTT B;  2L48 A;  2IHR 1;  4H4M A;  4B3S J;  2KZZ A;  4O0N A;  3M32 B;  5EDW A;  2O66 A;  4URQ U;  1D8Y A;  1VC5 A;  3HM9 A;  1BC6 A;  4ECR A;  3T19 A;  1MU2 A;  3GFX A;  1VQ6 S;  4Z7Y A;  3BQ1 A;  2M52 A;  1HFE L;  2CWK A;  1HI1 A;  2I9S A;  3CT9 A;  3MMJ A;  4QJV A;  2JLF A;  2MQM A;  2XZT B;  4OJH A;  5F3T A;  2AD9 A;  4FXD A;  4FNI A;  1G7C B;  3CCM S;  1HI8 A;  2YNI B;  3MF5 A;  3CCZ A;  3TQE A;  4RW4 B;  3IA0 A;  1ITP A;  4KH0 B;  2Z2L A;  4Y28 C;  3OR2 A;  5K5M A;  3RG6 A;  4I7F B;  2VL1 A;  4ZN1 A;  2B4P A;  4NMX A;  1Q86 T;  4M8L A;  4EYH B;  5LT5 A;  1UVI A;  3NRB A;  5L1J A;  4NLU A;  2HVD A;  3D6T B;  2EFO A;  3SCJ E;  1NXI A;  4GVL A;  2B6A B;  1YBT A;  2ZBR A;  4F25 A;  3FSX A;  1YJU A;  2KM8 C;  4DV7 J;  3W8P A;  2GV1 A;  3SIP B;  4J9V A;  5JVG Q;  2KT2 A;  2GJI A;  1HBU B;  2IRY A;  4ECX A;  3BYR A;  1K9M T;  1NJX A;  4NXM J;  1T02 A;  5HMX A;  3CCE S;  3CJK A;  1A0O B;  4IFY B;  2QC3 A;  3H20 A;  1TL1 A;  4I69 A;  4CTA B;  1ACM B;  4NLX A;  3UDC A;  3GIK A;  2I5J B;  2HWT A;  2OP5 A;  1BUX A;  1Z4U A;  4KGZ B;  3VVT A;  4USM A;  2E7V A;  4WFN Q;  3PW7 A;  3Q89 A;  2AEF A;  4RW4 A;  8ATC B;  4LF6 J;  3OSP A;  2DRA A;  4D3H A;  1M5S A;  2GMH A;  1JKH B;  1TL3 A;  3QO9 A;  3OTO F;  3GIM A;  5A0Y A;  3BR9 A;  3CGI A;  2X1G A;  3CIZ A;  4B3O A;  1QJH A;  4N7T A;  3NOC A;  5KT3 A;  4GO7 X;  4J9U E;  4ZP6 A;  1CG2 A;  1WTB A;  1U1P A;  4P52 A;  4C7Q A;  2RUS A;  3RR8 A;  2KKH A;  2QLX A;  1JK9 B;  3TA0 A;  4USI A;  4QPX A;  4R5P A;  2NXN A;  2VUG A;  2C28 A;  1NKC A;  1KRP A;  1H38 A;  1HA1 A;  4B3T F;  3KK1 A;  1XER A;  5DM6 Q;  4C6A A;  4LFB F;  4NCG A;  5KT6 A;  2C22 A;  3MAH A;  1C0U A;  1S0N A;  3QRR A;  1HYS A;  3D54 A;  4ZOS A;  1UZD A;  2WW4 A;  2UUW A;  1PJ6 A;  2ZZT A;  3HHE A;  4OV6 A;  3ZZR A;  4IFY A;  4FS1 A;  3ZC4 A;  3WBZ A;  1M1H A;  1LEO A;  4M5D B;  4M5M A;  2GVZ A;  2CJX B;  1UW4 A;  3E3X A;  3PEH A;  4DV4 J;  4QR1 A;  1VQO S;  2AGO A;  4PG6 A;  5KFG A;  1BD6 A;  2Z58 B;  4CLU A;  2BAB A;  1EET A;  3PR4 A;  1SL0 A;  1GTH A;  2MKH A;  2VOP A;  4I2P A;  1EHW A;  2VG5 A;  3D68 A;  1A7G E;  3G8T A;  4A8K A;  4JI7 F;  3AH6 A;  5B0F A;  3RW7 A;  5KOW A;  2J0S D;  1ZPV A;  3WDO A;  2RVJ A;  4ZPD A;  3QIP A;  1IKW A;  4IH7 A;  1NPP A;  5THW A;  4NLG A;  2F4V J;  2B43 A;  1S76 D;  1VRU B;  5IV3 A;  2F5G A;  2HS4 A;  4OYZ A;  1RXO B;  2PN6 A;  1C0U B;  2IM3 A;  1IR2 A;  4DEZ A;  5KG2 A;  2C2R A;  1PGZ A;  3KLV A;  4LQ9 A;  4QWB A;  2MKK A;  3KLE A;  4IUF A;  3LPE A;  1K1S A;  2VB6 A;  3PRV A;  3LGM A;  4QWE A;  2R7V A;  1WSR A;  5AJ3 J;  2ZUA A;  2CWX A;  3LP2 B;  3QGH A;  1CUL A;  2QZ8 A;  2ATC B;  2XWX A;  3MED A;  2C3U A;  3C14 A;  3EVW A;  4B02 A;  3MR3 A;  1WF1 A;  4QIV A;  2E66 A;  4F0M A;  1X31 C;  5A8R B;  2HLT A;  2SXL A;  2F9D A;  3PHT A;  4I2P B;  3KLH A;  1TL7 A;  4B3M F;  1LQ9 A;  4LF9 F;  2CQ2 A;  5E33 A;  4FBU A;  1X4B A;  4M5K A;  4C8K A;  4DSJ A;  2R7Q A;  1HD0 A;  1RA7 A;  2CDR B;  4BBY A;  5GAD U;  3BQ2 A;  1HBM B;  3ZO7 A;  2DNH A;  2MJN A;  2VFT A;  3D6F B;  5HLF A;  3H8Y A;  4TY8 A;  5HQL A;  1NK9 A;  5KFL A;  5E0O A;  4F26 A;  3NY0 A;  4URG A;  2E5H A;  3GSI A;  3A8E A;  3S6E A;  4TYA A;  1HWJ A;  2D41 A;  2XCP A;  2ILY A;  3B82 A;  3F41 A;  2MJU A;  1VQL S;  1TVR A;  3UDE A;  2CXE A;  3DKD A;  3LP2 A;  2CJB A;  4DDF A;  3OTC A;  3ZZT A;  1CC8 A;  1XTZ A;  2GAG C;  1TUG B;  1FTC A;  4I6Y A;  5L1L A;  2JEF A;  1QAJ A;  3K58 A;  4G6V B;  3WHI A;  1IJF B;  2EKN A;  2NXC A;  3EIC A;  5D0R A;  5T41 A;  2GQ2 A;  1FA0 A;  3ENW A;  1E6V A;  1FDN A;  3LH2 S;  1F3V A;  1HNI B;  3KUG A;  2R7X A;  4DPY A;  3H4B A;  1YGY A;  4LF5 F;  4L6V 3;  1P1L A;  3D5M A;  3CPW R;  3N9U C;  3TZY A;  1X5P A;  2CPF A;  1T05 A;  3BO4 A;  5D4N A;  4A48 A;  3CD0 A;  1Y11 A;  3DGV A;  5AXK A;  2EG1 A;  1TZ0 A;  3VZH A;  2IIH A;  1F3F A;  2E7X A;  2MQ8 A;  3DLE B;  3TYT A;  2U2F A;  4YHH F;  1Q81 T;  1JJ4 A;  3G8Q A;  4LFC J;  1OYD A;  2UXB F;  6FDR A;  3M1V B;  4K2J A;  3SV4 A;  2PMH A;  1W25 A;  3NGS A;  2C2E A;  4Y3C A;  3OTD A;  2F7V A;  5HVF A;  3TAN A;  1R0A A;  2JEJ A;  2PI4 A;  4JI2 J;  1T95 A;  5BR8 F;  2CZ4 A;  3UFC X;  4KRW A;  2V8V A;  2B4V A;  2AGQ A;  1G4C A;  2XY6 A;  5LSR A;  1X4A A;  3W60 A;  3D9B A;  1HAR A;  2BJ7 A;  2VV5 A;  3MEE B;  4IG0 B;  2B4O A;  3LAM A;  1KEK A;  2HKE A;  3BBB A;  1RIS A;  3NEK A;  1QY7 A;  2AV5 A;  2KVI A;  3EGN A;  5I3P A;  3C6T A;  3SSR A;  4CNY A;  1S1T B;  2ZVS A;  2E44 A;  4ECZ A;  1PIL A;  4U67 Q;  1VC0 A;  2FJE B;  3FFI B;  2LA4 A;  4KTQ A;  3CME S;  3DNC A;  3N28 A;  3V2U C;  3NKY A;  2AJQ A;  2HGM A;  2AX1 A;  3KK3 B;  1GMV A;  2XMU A;  2YKP A;  3RAX A;  1NJI T;  3EPG A;  5CH7 B;  1QVF R;  3DLE A;  3NS6 A;  3W63 A;  2FD2 A;  2AF6 A;  2BM0 A;  2BAN A;  2XYP B;  1E6Y A;  4JI0 F;  1Y5I B;  3PX0 A;  1XMO J;  2RS2 A;  1T94 A;  4ZVO B;  2HK3 A;  4ZVF A;  2V34 A;  4PXC A;  1RTH B;  3T3F A;  2OIH A;  2B9W A;  3CNQ P;  1RYR A;  2EWH A;  1PIE A;  3O8W A;  4PKD B;  4C11 A;  4DS5 A;  2ZBC A;  5LXR A;  3GFH A;  5DQH A;  2WB4 A;  3GU0 A;  3FNN A;  5ETQ A;  3VQT A;  2XGQ A;  1XC9 A;  1RWW B;  3E2E A;  3IN5 A;  2FLP A;  1KOH A;  1FNM A;  4PG7 A;  2Z30 B;  2JZ5 A;  4OZ0 A;  3WIV A;  3M4X A;  2AJ2 A;  4ZK7 M;  1S1T A;  1GT8 A;  5F9L A;  5F8J A;  3TUI C;  1TUV A;  3KG4 A;  2X3G A;  4ELV A;  5IT9 U;  1WI8 A;  1RAF B;  3MZI A;  1WKJ A;  1UMJ A;  4DV2 F;  3KTQ A;  4Q44 A;  4EO6 A;  4F36 A;  1KC8 T;  3RRH A;  3HT3 A;  4GKK J;  1UFW A;  4JUZ A;  2FB0 A;  5C24 A;  1U6B A;  2QLB B;  2OFH X;  3RGI A;  4ZKA A;  4WFZ A;  3HO1 A;  3QJJ A;  1WHW A;  2IJN A;  3U7J A;  3NOG A;  3AAW B;  1S9E B;  3O3L A;  1PYT A;  2YKA A;  4GVB A;  1RTH A;  5C5J A;  3GII A;  3H5U A;  1LFW A;  4K2X A;  1HMV B;  2BKN A;  1IBL J;  2F3J A;  2VG6 A;  4KKO A;  4WIQ A;  4CLK A;  5A8K B;  4LF8 F;  4RWW A;  4ERD A;  5ETV A;  2GW8 A;  2NXJ A;  2WW8 A;  4OI1 A;  3VR1 A;  1VHI A;  2YX1 A;  1YHQ S;  1WC5 A;  3N0V A;  2YTC A;  2WK4 A;  2PMZ D;  1NDC A;  4LT6 A;  4B3R F;  3MEG B;  2DNL A;  1RAC B;  3L7P A;  3KWM A;  4PR6 A;  4NZ0 A;  1U1R A;  2XS7 A;  2DNY A;  3UCZ P;  3Q8Q B;  3NNA A;  1KLM A;  2QLJ B;  3HFK A;  1NJZ A;  3JSB A;  4NA1 A;  3T9Z A;  3A4T A;  1YJ9 S;  2KM8 B;  3HSJ A;  1N8R T;  1CQM A;  5EX0 A;  3ITH B;  1ZOT A;  3R5A A;  3K5L A;  3VAM A;  4DV5 F;  2QA2 A;  3DM2 A;  2CA9 A;  2DNP A;  5F8H A;  3SYZ A;  4DU7 A;  2ZWO A;  2CPH A;  3HVT B;  3I32 A;  3IP0 A;  4KV8 B;  3DYA B;  4RW8 A;  1PJ7 A;  5EX3 A;  1RT2 B;  3MR2 A;  3CCJ S;  2R4F A;  4IQX A;  1KFS A;  1K0T A;  2CAJ A;  3GIL A;  2VPZ B;  3KLI A;  3GV7 B;  1TKZ B;  5IFM A;  4DQQ A;  1SKS A;  2FVR A;  4L3N A;  3FCV A;  1FWK A;  3R7S B;  1GMW A;  4P2X A;  2R2U A;  3Q24 A;  2WSF C;  1UVL A;  4B08 A;  1F60 B;  1UFL A;  3A13 A;  5AXN A;  3T1Y F;  4K4U A;  3QYY A;  3POT A;  4KQZ A;  2V2V A;  3GPA A;  1TV6 B;  4HL9 A;  3H4D A;  1K73 T;  5GAE I;  1OQ6 A;  2FJV A;  1VBX A;  2JSX A;  1AT1 B;  3PYF A;  4XK8 C;  2CQ1 A;  4CRJ A;  3UW1 A;  4DFP A;  1SV5 A;  2CJA A;  3QNW B;  2HHS A;  3HVT A;  3V4M A;  3CVK A;  2AHO B;  3A8I A;  2AMC B;  2QMW A;  1PKU A;  3UDV A;  4J9S A;  1VBZ A;  1U1K A;  2RDJ A;  1N5V A;  1XEZ A;  2L3M A;  5F0U A;  1U2F A;  3T41 A;  1YZ6 A;  1KVK A;  2GA7 A;  2YKN A;  4NEZ A;  4U8Y A;  4J7C A;  3PZP A;  1HR0 J;  3I4P A;  1F5A A;  1N0U A;  4ZVU B;  1SH3 A;  1S99 A;  4DV1 J;  2JHE A;  2CKW A;  1MMD A;  3R6L B;  1TKT B;  4I64 A;  3BB5 A;  4DPX A;  3EZO A;  4PRF A;  3BDP A;  3TR5 A;  1F9E B;  4OI3 A;  3HVW A;  3PV8 A;  4P2F A;  1RA6 A;  4K4W A;  4ZLN A;  1AFJ A;  3ENQ A;  1C1B B;  2A3J A;  2E29 A;  2HAF A;  3X1L B;  3AD9 C;  3FBE A;  2E5I A;  3LF0 A;  2QLF B;  3JSM A;  1VJW A;  2ASD A;  1VYA A;  3BSA A;  3AA9 A;  1T05 B;  4AQY J;  4B9N A;  3MWB A;  4N77 A;  1T9T A;  2P8I A;  1QSS A;  4HAC B;  2HMI A;  2LEC A;  4HR2 A;  3MMC B;  4F4Y A;  1X4D A;  2OJ3 A;  1EZZ B;  1XQI A;  3RB0 A;  1KON A;  1N54 B;  4MFB B;  1VIO A;  5IZH A;  1K8A T;  1HPZ B;  1PJ5 A;  2H1Y A;  2HIY A;  2RKI A;  1FO1 A;  4F50 A;  3ZZZ A;  3UN5 A;  4ZMM A;  3K8V A;  4OI6 A;  1B7Y B;  3HP6 A;  1DJ0 A;  1S4F A;  2UXD F;  1FD2 A;  4FKY A;  2CJK A;  4NCB A;  2YWK A;  3IS9 A;  5HVH A;  4L75 A;  1TTH B;  3QRQ A;  4ENO A;  1SC4 B;  1B99 A;  2NXU A;  2OD6 A;  4I1T A;  2MB0 B;  1FJG J;  4DR6 F;  1HD1 A;  4KE5 A;  2BE2 B;  4NOH A;  1NHV A;  3BR8 A;  4OYW A;  1QAX A;  3ISN D;  1H7X A;  4KT0 C;  3RYL A;  1VDH A;  4OZ1 A;  4ZJQ A;  5HMY A;  4CO4 A;  3ILJ A;  3FFI A;  1Q1K A;  2XM3 A;  3RBD A;  2VHG A;  5A6W A;  2I6W A; 
#chains in the Genus database with same CATH homology
 4GVB B;  4GVB A;  1KP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...