4GVBB

Crystal structure of the virally encoded antifungal protein, kp6, heterodimer
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
74
Chain Sequence
PRPVMCQCVDTTNGGVRLDAVTRAACSIDGYYTEKDGFCRAKYSWDLFTSGQFYQACLRYSHAGTNCQPDPQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KP6 killer toxin subunit alpha
publication title The Atomic Structure of the Virally Encoded Antifungal Protein, KP6.
pubmed doi rcsb
molecule tags Toxin
total genus 16
structure length 74
sequence length 78
ec nomenclature
pdb deposition date 2012-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.440 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Killer toxin KP6 alpha-subunit 4gvbB00
4GVBA 1KP6A 4GVBB
chains in the Genus database with same CATH superfamily
3JYTA 3BSAA 1BD6A 4B02A 5FLXU 2VPZB 5AT1B 1WKJA 1LEOA 2D1CA 3CMES 3I4PA 3TANA 4NA1A 3QFHA 2D74B 1WC5A 3BR9A 3BGUA 4KY3A 2VFVA 3W2WA 2XCAA 1RU2A 1JNZB 1CJVA 2L9WA 1TAUA 2K1RA 1ZAXA 4FPIA 3CT9A 2ROGA 4ZHRB 1RA7A 1FRXA 1HQEA 2JLGA 1PO6A 2MZQA 4RUBA 4UW2A 4K59A 1NEEA 1UAWA 4DL5A 2WVBA 5J1PA 2GA7A 3ZFVA 4X66F 2BM1A 2FHJA 3R9LA 2CVIA 3KJNB 1FEHA 5F8HA 3BO2A 5IWAJ 3VAFA 5D15A 1S57A 2GHPA 2HNYB 1BGXT 1LWCA 1G6BA 2F40A 4ETXA 4CNYA 4NZ7A 1OYEA 2LECA 3DRRB 2GIFA 4JI6J 3TVZA 5D3GA 2V4JB 2YPYA 1VS3A 2CQPA 2FTRA 2V69A 4CI0B 4NEZA 3ENQA 5LMUF 2KTQA 2B9XA 2Z56B 2LMIA 4NLXA 1NDKA 2H4WB 4P71A 3FDSA 3KLVA 3BPDA 3RJMB 3D1OA 4MIBA 2BXJA 3H90A 2A18A 4FPRA 1NDLA 4J9LA 2WONB 3LO3A 3CCZA 2WVFA 3M8SA 1PC5A 4A48A 3T1HJ 2CJYB 4IO9Q 2B4PA 4OYWA 3BKFA 3RGIA 5BXIA 4R0JA 4DQIA 2AHOB 4MJKA 2VA2A 2ILZA 2D3ZA 1N5SA 2O01C 2KKHA 4ANDA 1QE1B 1UA1A 3KHGA 3KLGB 3QBCA 2XYPB 4QYZJ 4WU3A 5HVFA 1Y11A 1CVJA 5IC6B 1RABB 4ZJQA 1G4CA 1S9FA 1K1SA 3C15B 1Q8BA 1RB0A 3Q86A 2MLXA 3NRBA 2XS5A 3CJ3A 2BE2B 2VONA 2RE1A 3UDVA 4A8QA 3O6QA 3G6VA 5LOQA 4C3LA 2UZAA 3PJWA 5J2NB 2IIHA 3KNGA 4N7TA 4C8KA 3TA0A 2CQHA 4O3SA 4K4UA 3W62A 1TL7B 2C2KB 3R8YA 2E9TA 3VWSA 4H4MA 1FEEA 1JLCA 1RACB 2HG4A 4V1Ak 3FMWA 1D0EA 4CM2A 3ENWA 3DOMA 3FK4A 4LF7J 3OUYA 4DZDA 3ZTPA 3JAMU 3D6TB 2DISA 1RGVA 3DLEA 3IG1B 3TAPA 3RBZA 1E6VA 1UCNA 4OX6A 1GMVA 3AQPA 2HVZA 1ZZFA 1B0VA 3BYPA 1C0TB 3UI3A 2F65A 2V68A 4WE1A 1U6ZA 2JRSA 4EWTA 3MPUB 4PWUA 1JX4A 3SSSA 3TA1A 5B0AA 4RW4B 3NS7B 4HH0A 2MXYA 3OL6A 3LPYA 3SSQA 4ECTA 1O5JA 1LNQA 4B3MJ 5HVGA 4DUYJ 1M5OC 2VQFJ 4H4OB 1S1TB 4RNNA 4K4WA 4RW8B 3EVMA 3NGRA 2VOPA 4NMLA 4Q45A 2J6SA 1IR2A 2J9DE 3BO4A 3M9NB 5HATA 1S1VB 4XO0A 3R1HA 1J5OA 3EVOA 4ED2A 5C24B 1KQKA 3AJ2A 4ELVA 2EFPA 2QX0A 4AFFA 5KFNA 1C0UA 1VK8A 2AMCB 4M5IA 4K7QA 1D3WA 3BV8A 3OTEA 4HI2A 1NSAA 1YBTA 3C3LA 2QTWA 2ZKTA 3FQKA 1VLYA 2ASJA 2NXNA 1T7PA 3KHRA 4P6QA 3LWMA 2NS1B 3H40A 2FJVA 3FZBA 3VZHA 2VA3A 3PV8A 3O3LA 3CJRA 1C1CA 1NK4A 1OO0B 3S6EA 4I2QA 2ZDPA 5IC4B 4PG8A 3FBCA 3FGVA 4GO5X 5HN0A 3AA9A 2DCLA 3CCRS 4GRSA 1TP7A 4DPOA 2PC6A 3HVTB 5IM0B 1LOUA 4UUWA 3AOBA 1N5YB 4K4XA 1HWUA 4ER8A 3K2YA 4I64A 3CNQP 3I0RA 2N3OA 4Y2AA 4FZVA 1T9UA 3GJTB 3LQVA 4O3PA 3VGVA 1T05A 3C14A 2X1FA 1WG1A 3VAIA 5AJ3J 1RTDB 4DFJA 2FVPA 3FJ2A 2W7OA 3V81A 3D3CJ 4UF4A 1RUSA 5JJBA 4HYKA 1NPPA 1WACA 4TLRA 5U47A 4A8XA 1LW0A 2APOA 2BYCA 2AYEA 1IWGA 4LFCJ 4KYZA 5HBMA 5THWA 5B09A 1KHVA 1WWHA 5A8KA 1KC8T 1HBOB 3LAMA 4CLZA 1RJJA 1DQ8A 4A8WA 3AOAA 3IR6B 4USHA 2M88A 1N5QA 3P5BP 1GFWB 2ASYA 3QAUA 4KPCA 5B0EA 4K2XA 5B0DA 4IUFA 2A2CA 2SXLA 4USKA 3CJSA 3DMJB 3DRYA 5IV3A 4RUCA 1SC4B 3KG4A 2Y0BB 4NZ0A 2BJ7A 3K5MA 2F9JA 3OT9A 1UJ4A 3MMJA 4WKRA 1FRHA 1XMBA 4YY3J 2ILYA 4GVLA 5GADI 2YWKA 4FXVA 4KTQA 2MKIA 3J7YU 1X0PA 1HBNA 2RQKA 3KK2B 1JIHA 5K8MA 3C19A 4LUBA 1XWLA 3B54A 4WXOA 2HWIA 3NS5A 3PTWA 1F9EB 3RB0A 2ZH5A 2M0GB 1NJYA 3HI9A 3DXSX 3ADAC 2KRBA 2B56A 4MMOA 4C2MA 2OFGX 4OHVA 3EPIA 1WC4A 4FN5A 3GSDA 2XY5A 1VGYA 4LRBA 3T5KA 1O0PA 2QL9B 3WIVA 5LM7E 4MH8A 4A8KA 4ID8A 2MYFA 2R7RA 3EXCX 4KAIA 2BE9B 1WHXA 1B4SA 2L3MA 3CW2C 3W9JA 2LA6A 3US5A 1A7GE 5E33A 1VC0A 5E41A 3U02A 2FY8A 4ECYA 1IKWB 5IWAF 3TW0A 4M63A 4X65J 2HHWA 3FEZA 1PCAA 1HD0A 4PRFA 1F3FA 2EWHA 3L09A 2DRAA 3MPWA 5KG6A 4JI6F 2CZ4A 2LXFA 5LSRA 1A6LA 3DRSA 4C48A 1PKUA 1LWEA 1W26A 2GQCA 4DS4A 1HIYA 5G0RA 1ZOTA 3GILA 1WG5A 4B17A 4DR1F 3CDUA 1X9MA 2BABA 2IM0A 1VQ4S 2AIRB 5D4NA 2UUCF 4LREA 3MFIA 2R7OA 4LJMA 2MZRA 4U9RA 2QFIA 1H73A 1SVDA 5F8NA 2BJ9A 1ZETA 1QDUB 4HHUA 1UTAA 4O4GA 2CPFA 1PYTA 3N0VA 4L3NA 3LWLA 1ZZNA 2ZH9A 5K14B 2N7YA 3ZNJ1 2AJFE 1CEZA 1VRTA 2C2MB 1APSA 3GFYA 3EXYA 2Y1RI 3W63A 3PO5A 2CZVC 1WF2A 4NWBA 1R8HA 1WHWA 4PWDA 2ZHBA 1U25A 4ILLA 2UUAF 2VG7A 2BBEA 1GX5A 3SCIE 3G71S 2RMLA 4ECZA 2CA9A 1SJ3P 3CWJA 2FIUA 2V94A 1TKZA 1RT2B 4U95A 4E98A 2DNRA 1WJ9A 4A47A 1QAJA 3PEJA 4IH5A 5J2QB 1JK9B 2PO4A 2NUUG 5GAHU 2RVJA 4R8UA 3KNAA 3F41A 2XMVA 1RWOB 1X60A 2NXEA 1S72S 2KG1A 1NB7A 4C8LA 3SCKE 4Q44A 3QLHB 2HFZA 5F9LA 4LF7F 3LP1A 2R7UA 2AZ1A 4ECSA 2VHGA 4MTPA 1NKCA 4DQRA 2MKKA 3P8BB 4DU8A 2DR7A 1N32J 4FXWA 3SEOA 1H74A 5KFTA 3PYFA 4DCOB 1WELA 1F6TA 1RTHB 2J5AA 4ZVEA 2OSRA 2LEBA 2Z2YB 4BLGA 1IKXB 3ILIA 2ZWPA 1MLAA 2BKPA 4USVA 4WYWA 4B3MF 2FUG9 1GT8A 3TO8A 1ZTWA 4IRKA 1HARA 2Z2MA 5JMNA 1T0TV 3D68A 3P4UB 4OYIA 3ZZTA 4K0KJ 2E1PA 4DR3J 4OZ0A 4IKAA 4WU2A 1S0NA 2Q66A 1H2UX 1T3OA 2OPRB 4AYBD 2QRRA 4ZVSB 3N5BA 3ZZ0A 3M9MB 1JXEA 2AGOA 2OD4A 1DAXA 2D9PA 2PD1A 3K7RA 3QT7A 5K8NA 4KGMA 1U24A 3GYXB 3H20A 3P3DA 4HL9A 4C3MA 4KV8A 1AFIA 2ZBPA 5D4OA 3I5AA 2NSCA 1W25A 2AT1B 4WBFA 3QJJA 2ZM6J 2O3DA 3SCJE 2O1PA 2KT5A 4EO8A 3R27A 2DNKA 3PNIA 5HMYA 5C25B 5CD4A 5D0GA 2YY3A 4FYVB 2KZMA 1JLAA 3QIPB 2FJDB 1TAQA 4Q0BB 1YKWA 4B9MA 2CQ0A 3GFXA 3UQSA 5J1NA 1OJ4A 2RUGA 2GQQA 2HQFA 5A8RA 4ZVGA 1YQHA 3MM9A 1NUEA 2RIJA 1FJGF 2YH0A 2YKNA 3HHLB 2YNHA 2O67A 1X31C 2V4QA 1HWLA 2CWKA 2Y1LB 2F4VF 1U7LA 2B6AB 3KHLA 4IR1A 2UXDJ 1NPRA 1XEZA 1U1OA 2FJWA 2M70A 3MUTP 1XMOJ 2JH3A 1XMQJ 2CPIA 4F3MA 1SBRA 1BQNB 2XZDB 1HHTP 3IR7B 1U1QA 4CM0A 1S77D 4BC9A 2RU3A 4OX9J 4OHYA 1B70B 4ZHRA 5ETKA 1VQPS 3BO3A 1X5SA 2KJWA 4TY9A 3TQEA 4ED7A 2HQ3A 2PA8D 2AJ2A 2BOPA 1UJ5A 2CPEA 3OVBA 4LQ9A 4LIRA 1RAAB 1M5KC 4JV5J 4B9UA 2VPWB 3A8EA 3MMCB 4NLRA 2EFGA 2NZCA 2RQMA 1REVB 3DLGB 4RBUA 5A0YB 1ZA2B 1WF1A 2BJ1A 2HNYA 2MLYA 2ZH1A 2CNKB 1DBDA 3HT0A 4CIOA 4ZJLA 3MCSA 3DRRA 1SC3B 1DFDA 1SUQB 5AXMA 1UPMB 3EZUA 3H5YA 1WC0A 1TFYA 2N4DA 2W7AA 4Y6IA 1H98A 2KT2A 4JYAF 1RXOB 1Q0NA 3M6XA 1HNXF 1FRIA 2Z30B 5E3PA 4DR2F 2KFZA 3M9OB 5H1SV 3IBCB 2G1HA 2EXUA 3NMRA 4ZVFA 2ZH4A 3DC2A 4N76A 3G82A 1NAQA 1R3NA 3M8QB 1N0UA 3QT8A 3OFEA 4NZ6A 4UQGA 3PW7A 3WBZA 3R1LA 3V4IB 2QLJB 2W4DA 2GVDB 3R97A 1QE1A 4X62J 2LA4A 4R5PB 5IT9Y 3ULHA 3KLGA 1RAJA 1ZBTA 1L5UA 1AXQA 1U1RA 4ZCKA 1P1TA 1P6TA 2VBYA 4JP8A 3THPA 4B9LA 2VPXB 1T9VA 4JBCA 2XHWA 2BE2A 3M7VA 4QWBA 4IRDA 3GR1A 1HW9A 2IVYA 1EP4B 2PEHA 1WEZA 3N79A 5HI7A 1MMNA 1WC1A 2H5IB 2BZ2A 2HYIB 3OLBA 4N41A 2AKWB 4CO5A 1Q78A 3MEGB 4U96A 3V6HA 4KGKA 1XQIA 4WP9A 3DU5A 1VC5A 3FCWA 3FSYA 2G2ZA 2CYYA 4PCQA 5ETRA 4F50A 2M5YA 3HFZB 3R5AA 2LQ5A 4ZMMA 3M6VA 2HHXA 4LF6F 3U1LA 1Q86T 2WSEC 3RBDA 4Q8FA 1FVSA 5GVQA 1IKYA 2CG8A 2DNYA 2LQBA 3RAXA 4OJ3A 3HF5A 3EPGA 3G8QA 4ZVRB 2HWHA 4JI2J 3J7ZT 4ANCA 1JLGB 2VC0A 4A8OA 2CWXA 1KTQA 2Q6CA 3AJ1A 3PYEA 1XK8A 4ES2A 3IAS9 3BPSP 1GK8A 2GFFA 1HHSA 1JKHB 4P7TA 1VBYA 3TZXA 3IC1A 1DQAA 3EGZA 2R2SA 1FX4A 4B3RJ 4RW4A 1BLUA 4ZPBA 4BBYA 1Q7YT 4ECQA 3MR5A 2HHHJ 2I38A 2DHXA 1F5BA 4DCPB 3K59A 3J80Y 1MWYA 2A0FB 4IDKA 4FS1A 4YOEA 1WOSA 3ZZUA 3UE2A 1T02A 2FZKB 4RW8A 3PEHA 4DMZA 1YK9A 3BGFA 1X8DA 3MI7X 5KFQA 2DO0A 2YH1A 4DPTA 1S1VA 2CUYA 5DQGA 5EN1A 1SXLA 3IRWP 2OELA 5C24A 5KFRA 2V67A 3ENVA 1NBEB 1PBAA 2VF3A 1RCXB 3CMQA 4DV6J 2F1FA 3Q8SB 1RTJB 3OFHA 3R7NB 1UP1A 1RWWB 2W1BA 2J9EA 3QNWB 3M4XA 1S9EB 2DO4A 2E66A 2JWNA 3A8KA 2WVDA 2R8IA 2V8HA 4U67Q 1KS2A 2W2OP 4DN9A 1EAYC 3CUNA 4GC7A 4RNFA 4BWJA 3V6KA 2DT9A 4RW6B 3TAMB 2DJWA 1DTQA 1BHNA 4DR6J 4FXDA 1CULB 4CT8A 2A10A 2FLOA 3I55S 1FDAA 3HVTA 5IM0A 3CB4A 3MR7A 1QAXA 3ILLA 2HFSA 1JWWA 1SIWB 2VDIA 2H5EA 2HQCA 3V5RA 3FVYA 4RBTA 3NCQA 4KGZB 1N36F 1B3TA 4LT6A 1YI2S 1CJKB 1F1BB 3OL7A 3NGTA 3KUEA 5L1LA 5ETOA 1SL0A 3NGDA 1MN7A 4C11B 1PJ6A 4K0KF 3HZGA 1RTDA 1X0FA 2W2NP 3HDSA 3PX6A 4C0HA 5C42B 4OIXA 3JQMA 3CJ0A 4Q2MA 2ZVIA 3HM9A 4RL1A 4G1QA 3KFWX 1IBLJ 2DB1A 5HROB 3CVKA 4HKQA 1FDDA 4KRWA 4NCBA 3FFIB 1VCTA 2YX7A 2DPIA 4EI2A 2QEXS 2LP4A 2OPPB 2FHKA 1RT5B 1U6FA 2K3KA 4LFBJ 1R8PA 3CC4S 1HFEL 4J7CA 1HBOA 1I94F 5DLGA 3IA0A 2DNMA 4O23A 5DJBA 1RLDA 3D5MA 4NXMJ 2DGTA 2CADA 1REGX 2R3VA 1ZS6A 3ISZA 1IR1A 4MKVA 1F9FA 4N47A 2WRMA 1O8BA 2XNRA 4DV2F 3D1QA 3TI0A 3DMJA 4DN0A 2H65B 2D69A 1U1NA 1VMBA 1SPBP 2G0IA 3BREA 3DYAB 3W5XA 5GAEI 5AE2A 3CDWA 5KFHA 3FKBA 1D9AA 4KT0C 1YSJA 4IQMA 2FPHX 3D7SB 4JI8J 4AL6A 3ILOA 4RX6A 3OXLA 1FESA 1HQEB 5ETTA 2P9CA 4OI3A 1RAOA 4EGLA 4J9PA 4CZCA 1XTZA 5AXKA 1V3RA 5D0HA 1X5PA 2OO4A 4DU7A 1HBMA 1Z1ZA 3UCUP 4C8OA 3AQOA 2QA4S 4C8MA 4ECRA 4DR7J 4ALZA 3N28A 1RQ0A 3MF5A 4P73A 1XMOF 3MCOA 1RE1B 4FBUA 4JI0J 3CE8A 3M2VB 1DJ0A 5ADZA 2ACMA 4YB1P 5KG3A 4W98A 4OX9F 2YTCA 5HL7Q 3GPAA 1ELOA 4FVCA 3GE9A 1R0BG 4ZPTR 5ETPA 2ZBIA 2DTJA 2HFOA 4NX9A 3W8GA 5A2QU 1EJ7L 1NK0A 1YIJS 4WFBQ 1PIEA 3BBBA 2CJAA 4IFVB 1GX6A 1DTTB 1T95A 4JV5F 3R5BA 1IKWA 4A8SA 2W01A 3P6YC 1SQEA 4C7QA 2Z2LA 4J91A 1ZM2A 1S6UA 3TVYA 1VIOA 3FCHA 2IRXA 3OTBA 4M5NA 2QA1A 4LF4J 3N5FA 3GSIA 2HGMA 3VV2B 1X4EA 2B5JA 3OSNA 4MIWA 5CD4H 1VC6A 1LW2B 3M2UB 3D9BA 2CJQA 2KFNA 1X4HA 3GP9A 1CJTB 1FNXH 3O1LA 3HHKA 2MZSA 2AYMA 3I82A 2EEYA 2CQ4A 4HDHA 2UXCJ 1X7VA 2IJNA 1HNVB 1S1WB 2BW7A 4P9SA 1KN6A 5DDQC 8RUCA 4A46A 4CO1A 3HZEA 1A0OB 4ZPAA 3MMAB 4M94A 2F8EX 3EYZA 2CDRB 3GB0A 3ETMA 4EYHB 2YKMA 4AD6A 3EE3A 3K89A 2CXEA 3GTYX 2ZOGA 3FBEA 4I56A 5K14A 3UCGA 4YFUA 2CFXA 3GG1A 2CKWA 4H4MB 2Y1JA 2CQIA 3CMAS 1JJ2R 1NHVA 1RHJB 2MMYA 1U09A 3OUYB 4JI4F 1GQEA 3IBWA 3WC2A 3KLEA 3GLJA 2HBRB 3AJDA 5L38A 4K8RA 1N0VC 2DGWA 4ZVHA 3DLEB 1FKPA 3IRXA 2W8KA 3MCNA 2DHSA 1E6VB 3HJVA 2NZ4A 2QZ8A 4Y3CA 1W7WA 4NLQA 2GMHA 5L9XA 1RT2A 4CLUA 4Q7AA 5J2MB 2B4OA 3VGUA 3HHEA 2OHDA 3O5TB 3V6DB 5E3AA 3HPOA 1K0TA 1S48A 1TL5A 1JNRB 1TK8A 3QZ8A 3QLHA 2DR5A 3RG6A 5DQHA 1HBUB 4JB8B 1FK9B 1SC6A 3PCOB 3ZZPA 1FWPA 2AQ4A 1RP5A 2KL8A 3G6ES 2Z2ZA 3GCWP 1M5SA 1S0VA 4DV1J 4TNOA 4I1TA 2ZBCA 4RUHA 2VICA 4FKYA 2GVZA 2V2VA 3J81j 1UVKA 3CPWR 2XSFA 4LRDA 4CTAB 2CAJA 2QA4G 3DU6A 2XMMA 4OL8A 5KFLA 4HEA9 1RT1B 5D4PA 4GKJF 2HKEA 2HRUA 3JTOA 5KFYA 1SH3A 4JV0A 3JB9k 3NMAA 1RTHA 3KJFB 3JQKA 3QZ7A 4DSEA 1JLBB 1KFSA 3U7JA 2VH7A 3K8WA 3ILJA 5EWEA 3O8WA 1NDPA 5B0FA 1N48A 4LFAJ 3OL9A 1S0OA 3FBBA 3D6HB 3LP0B 1FTRA 2LQ9A 4MK8A 1NHUA 3KYLA 4TLQA 3I87A 4QW8A 2KU7A 2OPRA 3OTCA 4ZIVA 2LEAA 5D6GA 3MPVA 1Q79A 1NSPA 1KKHA 2E7WA 2ZH2A 2DK2A 3M1VB 1C1CB 3BSNA 1FKOB 2ZDOA 4URSA 4W4MA 4I2QB 1DY3A 3HO1A 4ZP9A 2CJXB 2CPZA 2HZVA 4KKOB 4A8MP 3KKFA 3HXMA 1JB0C 1OIAA 4JI3J 1S7HA 2HZAA 4OZLA 3CO0P 4P2MA 3GJRB 5C25A 4IOAQ 3H5UA 1KOHA 2IHR1 1H3DA 2E5JA 3MAAA 3QIPA 1YG0A 4Q0BA 2QMUB 3NLCA 3ZTQA 5BYSA 3EZOA 2Q6BA 4KFBA 3WHIA 3E01B 1VYAA 1VQLS 2VBWA 3MEEB 2DXEA 4Y0FA 2LU1A 1WEXA 4CDIA 4ZOSA 1FRMA 5HBMB 3UD4P 3TJ9A 3K5NA 4W90B 1OQ3A 2W9CB 2RHQB 3HHLA 2G1DA 1Q53A 1Y5LB 1ZM3A 3VGTA 3TZWA 3W3SA 1KHWA 4LR7A 3RBXA 1UFWA 2WSCC 1HI8A 4DSIA 4PXEA 2B6AA 4DPUA 3CCMS 1OY9A 2DR9A 1N33F 2NXJA 1B7YB 1WTFA 2KN4A 3EMTA 1EX8A 1FXRA 2LXIA 3CIZA 1BQNA 2MKSA 1QD1A 5ETMA 2FZGB 3N6MA 1XN9A 4RW7B 1N6QB 4HT7A 1SKRA 1B0TA 4S0MA 3G6YA 1XNQF 3QGIA 4F02A 2HMIB 4EK2A 2FZCB 3H4BA 2IYGA 1VHIA 4WJBA 1FDBA 5C7PA 2BMBA 3GIRA 1HBNB 4IH6A 3OTOJ 1V5IB 1BQMB 4DLEA 2OPQB 4F25A 1UW4A 3MMCA 1KOOA 2VODA 2CQ3A 4CLPA 5F3TA 3HK2A 5F3ZA 3DRXA 1ZYQA 1Q7LB 4ITSA 2CQ2A 1VRUB 1U8SA 2O66A 2Q43A 2VJVA 3O2IA 5IOLA 3DOLB 4UY85 1BQXA 5KG7A 3ZC4A 2UU9F 2DHHA 1NSKL 5KT4A 2IM2A 4GKKJ 4RWWA 3MD1A 5BYQA 4Y2CA 4IG3A 2DHGA 3BEGB 3SZ2A 4QQBA 1C4AA 3K58A 2ZZNA 2CVEA 4V19X 3CCVS 1PSDA 3QQCD 4NLSA 3KK3B 1N34J 1Z2LA 2C2OB 4ECUA 4ECVA 4TYBA 1IBCB 1U0HA 3M8QA 3PRVA 1XERA 2AJ1A 2BOAA 4PUOB 4AL7A 4MFBB 4ED0A 4DDFA 3OTDA 2HQIA 4WTOB 4EBEA 4DV7J 4DV3J 3V4IA 2IRUA 1QTMA 4JI0F 1KLMB 3GIMA 4DL6A 3M8RA 2V0NA 2GVDA 5A6PA 1UEKA 1FO1A 1DLOA 4R5PA 4FKXA 4FS2A 4J90A 4ZCIA 2A6MA 1WKLA 3NWRA 4JI5F 5KFBA 1C1BB 1M1KT 2OEMA 1KNZA 3Q83A 2KG0A 2CNNB 2BM0A 3HVAA 3E8OA 5G0RB 2EBEA 2ZE2B 1FFSB 4X4UA 3HHNB 2MJNA 7FD1A 3NKYA 4YQWA 2PMZD 2BX6A 3PRDA 4GO7X 1IXKA 1EP4A 3DLLQ 4MAKA 1JLFB 2V63A 3DNCA 3K57A 3P45B 4RJVA 2NCKL 2HQDA 4DV0J 1DARA 2Z58B 4ZIWA 3MEGA 4O4GB 4Z7YA 3PKYA 1RAFB 3A1YG 2R2UA 1FNOA 2FVQA 1JLEB 2VASA 2EW9A 1HI1A 2YX4A 2AYBA 2B4UA 2Q79A 3GWCA 5B7WA 2YX1A 4OI1A 3H2LA 3RRKA 4MYTA 1ZAWA 4WFXA 1NJXA 1L3SA 1N54B 1U8WA 4PWDB 3VAGA 2RRNA 1KP6A 1JLGA 1TL3B 1D8YA 5E5NA 1RTIA 3PZPA 5BJRA 3DLHA 5KG4A 4DUZF 3CJ8A 2VBXA 4PYAA 4KIAA 1Y3KA 5F0WA 3AFGA 1JKHA 4UZBA 2ABYA 4J9VA 2VZ9A 4L6V3 1M5HA 1IJEB 2JX2A 2DIUA 3MTJA 2AYGA 3C6TA 2IJRA 2XLJA 2PMWA 2BE7D 5F8GA 1TKXA 2NXUA 3LANA 1KQSR 2EKNA 2F7VA 2H3EB 5DDPC 1IBMJ 1SJQA 5DM7Q 1DRZA 4F0HA 4OI2A 2I5JB 1HQUA 2VKRA 1L3KA 1S6PA 1TZ0A 3VVUA 4NCAA 4B9VA 2PI5A 2FVCA 2QA2A 4YDXA 1JJHA 1GTHA 4ZPCA 2V5HG 2PT0A 3CJ5A 2PA3A 2FJEB 1YITS 4KJIA 3DGVA 2HAFA 3MMBB 2NLWA 5IQQA 2XHCA 1RTJA 1OMSA 2X1BA 1WD6A 4EEYA 1JXLA 4LVNP 3T6BA 1X4DA 1VQ6S 4K5SA 4YEAA 1P1LA 2JFDA 2DH8A 4OYXA 3Q8UA 1WF0A 2QLBB 1H0HB 4X64F 1VQ9S 2Z4PA 1Y9OA 2E5HA 2ROPA 4TU7A 4I7FA 2BJ8A 3TAMA 1T9TA 4J9SA 1R8AA 1CULA 1Q82T 2Z8QA 1VIXA 5M2UA 3DGPA 4ED8A 3L7UA 2MQNA 4LF9J 2C42A 1VJWA 3PW0A 2C2EA 2FJBB 2R9LA 5DZ6A 4QU6A 1NH7A 2UV8A 1IUJA 1CJKA 2HGNA 1SL2A 3UR3C 1VQ7S 3BDPA 3HT3A 4C11A 3RB6A 3C16B 5L39A 3JS9A 5T7LB 1FWLA 1TVRB 3SQGB 2W9BB 2BDPA 2XC9A 3CCQS 3IMQJ 3F56A 4A4JA 1TK5A 1NK5A 4ZP8A 1UZHA 2ZITA 3M6UA 4DV4F 1NLKL 3W8PA 4OJ1A 1LFPA 2OPPA 2UXBJ 3PKMA 5KTQA 3T5HA 3Q8YA 3UNGC 3WQPA 5B08A 4AL5A 2V9WA 5KFJA 1RYRA 3MURP 1U1MA 5A8RB 4IR9A 2WW4A 4ZITA 3CGIA 3AD8C 3FRZA 3FEXB 2YNHB 2QLWA 2QSWA 3SV3A 1X4BA 3SI8A 2R2TA 1IR0A 2OLWA 2C3YA 3CULA 2P6SA 1SKSA 3DYAA 3JXOA 3V2UC 4DV5J 1VQSA 2XB2D 2KM8C 1RU1A 4U8VA 4CO4A 3NCPA 2X3GA 3CJQA 3RYLA 3QRQA 4J5OA 4B3SJ 4OZ1A 3U27A 4YUDA 3MGJA 4LBPA 4UT4A 3N01A 3TYTA 1IBKJ 3HP6A 2CJBA 2RDIA 4JI7F 3D0GE 3KOAA 4Z7CA 4PXDA 2KT3A 3CC7S 3W5YA 2CJKA 2HVHA 3BH7B 5H9FK 1N5TA 5MAOA 4C0OC 2XI3A 1TMJA 4YS2A 1BC6A 2N4CA 2W2MP 3M2VA 2ZJRQ 2QYCA 2X3DA 3AB2B 4FP9A 3IFEA 1UW9A 5EUHA 4PXBA 1J5EJ 4KHPJ 2OMOA 2W7PA 2AD9A 2YNGB 5KFOA 2XMTA 1V3ZA 1YHQS 1X4GA 2VUGA 4DR4F 1WHYA 1SI9A 3RR7A 1SL1A 2VBZA 4MKBA 2IDEA 2IM3A 5EWFA 3GZ7A 4IFVA 1DTTA 4GVBA 4O3OA 1XR5A 3Q0AA 2UUBJ 3W9HA 2ZJPQ 1UFKA 3PHEA 1U4BA 3NNCA 3CJKB 5F8MA 5LMNF 1HA1A 3G82B 4WCEQ 3Q2TC 5K20B 2EBGA 4OYZA 4NLTA 4QIVA 2CPDA 1XNRJ 3M8WA 4DZ6A 4CO2A 3HX9A 3JTNA 4HACB 4XAKA 2FVRA 2ZOFA 4U7UK 4ED1A 1LW2A 3M2UA 3R6LB 3KLIA 1U1LA 5JUMA 1RK8A 1CJTA 2Y0SD 4DPYA 3LW5C 1YJWS 2IAJB 3A3OB 1V6HA 3UNYA 2OJ3A 3CCTA 1GMUA 2EG1A 2D41A 1HNVA 1MMLA 2KXHA 1S1WA 3PFEA 3PR5B 3MFHA 4K5RA 4F4AA 1N56A 3SIPB 3PACA 1S6QB 4KC5A 2UVRA 5GAGU 5HK4A 3G6XA 1HR0J 3MMAA 2KZZA 1SKWA 1R0AB 2W24A 3CJTA 1F2GA 4BHQA 3SCLE 2LEPA 3Q8QB 4ID5B 3NBPB 3TVKA 4HT5A 2XO6A 2DGUA 3FEYB 5KFSA 3NL0A 3BKTA 5B0GA 4AXJA 3QGPA 4LQ3A 4PAAA 2JEFA 2XWYA 3PYGA 1U2CA 1LXJA 2BVZA 1B99A 1S10A 5IT4A 3ZNUA 3PX4A 3QT5A 2B8PA 5A6WA 1IKYB 5EHHA 1O51A 4IRCA 3IWLA 3PIPQ 5F41A 2MQQA 4LF2A 4CNZA 3GR0A 2RKIB 1UMJA 5DG8A 3QRPA 4LSNB 3H42A 5E0OA 1WSRA 2YNIA 2N7CA 5J2MA 1M5VC 2ZZTA 5M2RA 3V6DA 4U7CA 1UWBB 2G4BA 3R3TA 4N56A 1HBUA 4ZCMA 1FK9A 4HHHA 1AZSB 1RT6B 4IDKB 2D3OR 4PXCA 4NXNF 2QO3A 1JLQB 3DI6A 3EM1A 2E5LJ 1HQ2A 1YBAA 1ZAVA 1RWKB 1T03A 2I2YA 4AT1B 3SMZA 2QJ3A 3A8JA 1O6XA 4CTAA 2JEGA 2Y9HA 3RAMA 2R7SA 1EB0A 1RT1A 2ZH6A 2HHVA 2WB4A 4YN3B 1FJ7A 4FF1A 2HIQA 2P9EA 4D3HA 1SIZA 2WW8A 3AH6A 4URQU 1JLBA 3UFCX 5HLFB 4DXLA 1RDRA 3D54A 3PY8A 2AEJA 2MSSA 4USWA 1IBMF 3LP0A 4LRAA 5D78A 3TNVA 2Y3YA 5E3RA 2PIIA 3A8IA 1XBWA 4LRCA 3MAHA 2FYXA 4YDDB 4ZLLA 2YXLA 2JVOA 3NEKA 3PRBA 3GV5B 2L48A 2E5GA 1P27B 3M1VA 2F8HA 4ES3A 1FKOA 1DTQB 1YJ9S 3CF5Q 5A8WA 1R43A 4UOCA 3IP0A 5BYRA 2HVEA 3DXBA 3W2VB 1EIYB 4E2FB 4KKOA 1N88A 4EZ9A 2M52A 1XR7A 2FLNA 1FD2A 1HHQA 5ITHA 4Y2IA 2XS2A 4DF4A 5BR8F 1CS4A 1RHRB 2XSJB 4Y28C 1RSCA 4I6WA 3KWMA 2GQ2A 4PZVA 4NYZA 2I0XA 3KUGA 3MPDA 1N5VA 4FF4A 1QAIA 3BQ2A 2W4CA 3GYGA 1TL1A 3QRRA 2J7KA 4G1QB 3E01A 3KDNA 3R7BB 5ETLA 4DL0C 3MM7B 1EKRA 2DY9A 3MEEA 2VFUA 3ELHA 2DKOB 1AUDA 2LXUA 3KK1B 3UN3A 4E8UA 5SZTA 4DL2A 1V3SA 5H9EK 1R6YA 1WC6A 2E44A 2W9CA 1UVMA 3PDNA 2C22A 2MQMA 3OW2R 1CQNA 2G0CA 2DD8S 4DUTA 2N82B 2BQ3A 2KXFA 4X84A 5H9FJ 1RT7B 1HNZF 1JMTA 2J8AA 2B7BB 4OQJA 3TUPA 5D8HB 4MKAA 3OVSA 3CSKA 1NK8A 1GXTA 3DKDA 1UVLA 4R0EA 3CEDA 1QAYA 1ZH5A 2XMAA 2W2QP 5HSPA 4RW7A 3ZZYA 4ZLNA 2HVIA 2UXBF 3V6JA 1N6QA 2QL7B 3R5DA 4DL4A 4QZVB 1Q4RA 1RHQB 2W4PA 2HMIA 4F4KA 1VQOS 2DGOA 3QPIA 2V2ZA 2R8KA 2DYAA 1BQMA 3T5JA 2OPQA 4O44B 1HNWF 1BMQB 2FJXA 5CYMB 1HBMB 1EETB 2V2KA 1V9OA 1VRUA 4UZCA 3UVJB 1YWXA 2QLFB 5CABA 5KFMA 3DOLA 2GW8A 2WHOA 3SXLA 1VQMS 4DFMA 4OJGA 2KVQE 3AA8A 2OPSB 1FF2A 1CQMA 1KVKA 4DV5F 2IPOB 3VZIA 1K9MT 2XI2A 3PR4A 3BKUA 3QT6A 2AP6A 1S4FA 3C46A 2DNQA 4B3SF 3AD7C 1U2RA 1RAGB 2J8SA 2GS8A 1RCOB 3PFOA 5GADU 1Y0HA 1IBKF 3ET6B 3SFGA 2XMKA 3KK3A 3D3BJ 1URRA 4FVMA 2LDIA 4C6AA 3L4BC 1AT1B 2XM3A 3SQOP 5ETNA 4PUOA 1KONA 4MFBA 2EK6A 4HLBA 4ZPWR 1KLMA 2BACA 1FCAA 3PM9A 5KG5A 3SFUA 2B5JB 4DJBA 2JSXA 2UP1A 3G9CA 4URGA 3QFWA 1C1BA 3B6BA 1R27B 4LF8J 1RKJA 3PJ9A 4OYMA 4OYBA 5F9NA 4KH1B 2OEKA 2RHSB 4CT9A 4P7VA 5KT2A 2J7UA 1NJZA 2ZE2A 5LXYA 4YB5A 2HHSA 3BGLA 3E3XA 2UUBF 4UOHA 2KO1A 2M7SA 1YLXA 3HD1A 5HJYA 1QSSA 1HPZA 4KHRA 2E1MC 1JLFA 2IVMA 2AGQA 3T1HF 2WCXA 3MOZA 3ENAA 4K4ZA 3L7PA 3TEGA 2HHUA 1TUWA 2I1RA 5MLCV 1KTVA 3Q2SC 2YKMB 2YWFA 2RILA 2JEJA 2F63A 4IYQA 3JSMB 2M4MA 4CLYA 1JLEA 4P72A 3KLFB 1CBKA 2P2CB 4NL5A 1J27A 5CHCB 4WFYA 1SJFA 1XIQA 2ZUAA 4X4RA 2A2DA 2K7JA 3EUNA 4ED6A 5K9FA 1K47A 3KLEB 1GMWD 1TL3A 1VRQC 1Q81T 3JTPA 2FC9A 1HR0F 1FKPB 3IRXB 2JNJA 3X1LB 3AT1B 3Q8RB 2OSQA 5KFPA 4PG4A 1RBAA 1YJVA 4I4BA 4DX5A 1LQ9A 1K8AT 5D0EA 2X7IA 1C4CA 3NGKA 5CQGA 2LCWA 2GAGC 2RH3A 5HP1B 4E0DA 4IOCQ 2R7WA 2IC3B 1NMEB 1ZA1B 4F4WA 4DQSA 2HEKA 4N5SA 2I5JA 4P75A 3R2CJ 3C6UB 3TJAA 2FC8A 1S0MA 1X5TA 2XY6A 1KVJA 1WKKA 4JUZA 2XTJP 2V9KA 3ZXWA 1CJUB 2GVZB 2M2BA 4CH1A 1RT4A 4MKYA 2AW0A 1ZTTA 1PAEX 3MWBA 2RB7A 3PJXA 2ZHAA 3LAKA 3MMBA 3J81Y 3ONQA 3OXGA 2C2RA 2BUNA 5HJXA 3C8YA 3UN5A 3CTRA 4MYUA 2MY7A 3IGVA 2C2DA 4DUYF 1OQ6A 2QN6B 2E1AA 4U7UD 4Q8EA 3D1HA 2VQFF 1UJ6A 5FJ4A 2LDYA 3LGMA 1RADB 2HRTA 2RDDA 3BBFA 4NASA 4O4RA 3VQSA 5I3PA 1SCJB 2M3DA 2OTJS 1NXIA 3M30B 1S49A 3HLUA 2XYGB 1WEYA 1PBUA 4O3QA 5IZHA 2E29A 1CG2A 5H9EJ 2HSEB 2J0WA 2DITA 3TARA 1TMMA 3GONA 2OFHX 5L46A 2E7VA 1PGZA 4RNOA 4ZDNA 4FBTA 5IT9U 2BV3A 4OFZA 3RAQA 3C16A 5GMDA 1YVFA 4NLVA 2IBOA 5KFIA 5T7LA 2YNFB 3OSPA 1TVRA 3SQGA 4IG0B 4C8NA 2W9BA 1D09B 2YWEA 1BWVA 4WFZA 3MAAB 2ZWOA 2VG5B 1S5ZA 1X4CA 4KFBB 4ZN1A 1NNDA 2J9DA 3A4TA 3HKWA 2QYGA 3TJ8A 4PQUA 5CH7B 2AGPA 1I6JA 4DCJB 4NE9C 3BS9A 2ZD1A 1X4AA 3S8SA 3OHBA 4C3KA 3OV7A 2XBPA 5DZ7A 1DQ9A 3VHQA 1EARA 2NUHA 5CCMA 2OKQA 1S7IA 1MWQA 1U0SA 2JZ5A 1LV5A 5AJ3F 4HTIA 3MUMP 4F4ZA 1ZPVA 5KFCA 2VV5A 2DGVA 1ACMB 4TN2A 1RHKB 4ZK7M 1P9QC 4F04B 2WB1D 2MEWA 2HZCA 4H54A 2CQBA 3Q89A 1RWUA 4MK7A 3QAEA 2RD5C 2YKAA 2MLZA 1GMWA 4LFCF 1T3NA 3CDBA 1WC3A 2HBYB 3N4WA 2JC1A 2CJ9A 3MTKA 1UPPA 2AZ3A 4QR2A 2HS4A 4OZ2A 3DCAA 3RW6A 4USMA 1UETA 2PDAA 4DSJA 3NAIA 4CLSA 1Z4UA 1MN9A 4RR5A 3EZ5A 3ISND 2XLKA 5ETSA 1N52B 5D4LA 3IXQA 1MNEA 3MECB 3QYYA 4BCAA 5E3QA 4J9KA 3A3NB 3J80U 1Q5VA 2V8DA 1CC7A 4DL7A 3EWGA 4OZ3A 2XZTB 1EQMA 3BGRB 3T1AA 5J1EA 1U48A 2E9RX 4ZP7A 2YNGA 3L7OA 4Y2MA 4EU0A 1XC9A 4YY3F 5GAGI 1Q95G 3HSDA 1TFWA 4ZS6A 3QWPA 3W1YC 4IG3B 5I3UB 4DR1J 3M8PB 2UUCJ 5DS7A 1ZPWX 2PFFB 2IRYA 2V50A 3CD6S 1UZDA 5KT5A 3M8ZA 4WTYA 4DPXA 4ELUA 3CIMA 4QYRA 5EX3A 3KJQB 4G6VB 3CJKA 1U2FA 5HANA 2XNQA 4ZVPB 2H5JB 4M5KA 1U0HB 3JQJA 3SDEA 4NLOA 4UUXA 2XEXA 3K5PA 4HACA 5KFKA 4WZMA 2DHAA 4X4QA 1FX2A 3NAHA 5JXSA 1DLOB 1HNIA 3QWUA 3D4JA 2YWHA 2HHTA 1OSDA 3FCVA 4C8ZA 2IAJA 4QWCA 3W60A 3UR0A 1Y5NB 3TUIC 2K3IA 1Q1KA 3TQ1A 2KI2A 3M32B 2HNDB 2UUAJ 1UEVA 4Z2XA 3UN2A 2ADCA 4N8NA 3IN5A 1S6QA 1IN0A 4DG1B 2VU5A 2DNOA 1IKVB 4DWIA 4NOHA 4Y65A 2G2OA 3MHYA 4IQXA 3RUBL 4Q2LA 8AT1B 2ZUGA 4X65F 1R0AA 2H51B 2MZTA 3D6MB 2RQ4A 1FFWB 2B43A 2L08A 4UOFA 4ID5A 1NK6A 3NBPA 4LMZA 1E6YB 5FLXY 2E1CA 2CPHA 2C3OA 5CZVA 2CNLB 3G2XA 2C28A 3ZTOA 3TZZA 2RRBA 4LF8F 2J9CA 1HD1A 1BUXA 2UV8G 1I3OB 4DSLA 3GV7B 4I6YA 2ZZMA 1R31A 4YP3A 4B3TJ 4RU2A 1U1KA 1S9GB 4X4PA 4GMKA 1KFDA 1GTEA 3OLAA 2MB0B 2RKIA 2G13A 1RTIB 3B82A 1ZM4A 2MHNA 4L3KA 4LSNA 3MOJB 3VAKA 4CQ1A 1F2HA 3ITHA 1R89A 3KJVB 4RLEA 3F0NA 1VBKA 2DNZA 1NB2A 3FBFA 3BF4A 2PI4A 1YBUA 1UWBA 4NLDA 4K2JA 5J2PB 1HMVB 4I0WA 4NLYA 3RR8A 4ANEA 5HMZA 1U45A 2YQ0A 2MQPA 1VBXA 3C6TB 1TKXB 1AZSA 1L3VA 4FYXB 4ZPDA 2C3MA 2M8HA 1RT6A 2BKOA 3K8VA 4WFAQ 5FDLB 3UWTA 2R8GA 1JLQA 1HQUB 3Q8PB 2CIMA 1RTZA 3MM5A 1S99A 3TZYA 5M2PA 2NSBA 4PR6A 1S6PB 3R6GB 7AT1B 2EC2A 3H5SA 3G4SS 2PN6A 2AJ4A 3QIDA 4H4KA 2ACYA 2KM8B 4B3OB 4FYYB 3PX0A 2QGFB 4EYIB 5HLFA 3BSOA 2BA9A 2GMJA 4DR5J 3GIIA 2HHQA 2RJZA 2ZBQA 1KD1T 1FJCA 1HWKA 2CQCA 4CWBA 3QO9A 2B9EA 1KEKA 3GJSB 3WC0A 1LWFB 2E7XA 1LFWA 3TEHB 4PYDA 2NQPA 2VIHA 2DH9A 2GC8A 1YDLA 3CD7A 4HI1A 3FMBA 1RA6A 1RAIB 2WOMB 1N32F 4C9DA 4CYUB 4I7FB 5L1JA 1I51B 4DX6A 1G7CB 1TELA 3KG0A 4IFYB 3TWZA 2WZ1A 5HO4A 3GJQB 2ZNZA 1VQKS 5C2CA 3DGPB 3H25A 4NLGA 3W2VA 1FJGJ 1YZ6A 2B7CB 2GJIA 1H7XA 4Y34A 6FDRA 4QPXA 1DZ5A 4P10A 3CDEA 5AE3A 1K0VA 1T8EA 2UUWA 1BXNA 2COLA 4WXWA 1NPKA 2XSJA 2F4VJ 1IQTA 4LSLB 3VAJA 1OY6A 1HI0P 3D67A 2JC0A 4HH1A 2A3JA 4AUKA 4NRTA 2R7XA 4DR3F 1Z2ZA 4JI1J 2NPIA 4YB6A 2POKA 2NR0A 9RUBA 5EGYA 1PG5B 1A9NB 3KDOA 3JAMY 4G1IA 2L9NA 3J7YI 3MM7A 5AXLA 4KGXB 4ZVUB 4USJC 1RKIA 2CZ9A 1B64A 4LBHA 3CCUS 3KK1A 3Q8VA 1S1XB 1IJFB 2XMUA 1RBLA 2ADBA 1KQGB 2HNZB 2ZM6F 4CH0S 2W9AA 1VOMA 5AE1A 1RT7A 3OJUA 1U1PA 1NSQA 4OHZA 3TOQA 3H8YA 2AU0A 2ASDA 3BDEA 4A8YA 1BY9A 2OIHA 5F0UA 5KG1A 4JYAJ 1MU2B 4YR0A 3HKZD 1HNXJ 5GMKa 4F8RA 4F26A 3AOCA 2KHDA 4H4KC 2AV5A 4KQZA 1VDHA 4HVZA 4DPWA 4DR2J 2WBRA 4F2SA 1OS5A 4RBVA 2LQJA 4LVOP 3OR2B 5ETVA 2OD6A 3ISNC 4EMDA 1IM6A 3QSIA 2YKOA 5KG2A 1FE4A 4DX8H 3V4MA 2HBQB 4O44A 1CSJA 2K7KA 2C3UA 4RPFA 2GIRA 4UTGA 2XQCA 5CYMA 4P52A 4EUVA 1S97A 1QLNA 5LL6d 2J76E 3SV4A 1EETA 4DSFA 2UXDF 2LLZA 1HW8A 4DBQA 3UVJA 3UD3P 1AW0A 5CZXA 4L76A 3OL8A 4M5DB 2F4FA 1XMQF 2OPSA 1RT3B 2HPUA 4X4OA 1QUVA 4PG6A 2KVIA 3P96A 4WYLA 2VB6A 1F0XA 5GAEU 2HURA 4QU7A 4J9RA 2XMWA 3NCRA 5IS2A 3AODA 3EGNA 1TKDA 3HVRA 2G0JA 3PW2A 3ICLA 2ZC4A 3ET6A 4NYPA 4QCLA 2GJ2A 2YQ1A 2XO7A 4OMFG 5T41A 4GVBB 1OY8A 4KH0B 3HCXA 3MR3A 4LIWA 4OV6A 2J0SD 2GMLA 2XS7A 2EPIA 3U1NA 1AYEA 4R25A 3PW4A 3BSCA 1M90T 2EKYA 2NYHA 2LYVA 3T3FA 4QIEA 4DHVA 3OR1B 1Y00A 2ASLA 3CCES 1FXLA 2IA6A 4J9UE 2OI2A 2G2YA 5L9NA 6AT1B 4LF6J 1Y10A 3KLIB 4NCGB 1UVIA 4RW9B 4KE5A 1V5VA 2E9ZA 2FLPA 2GO9A 1RWNB 2GJFA 4TU9A 4CLFA 4CO3A 2HGLA 3I96A 4TQRA 1S6OA 4WWSA 2ZVSA 2J0QD 2OUGA 1FERA 2FJAB 4X4SA 3TA2A 2QIFA 4NI2B 5DGAA 2KHCA 3I4HX 3JSYA 5GAHI 2HFVA 5LJ3Y 5HAOA 5DDRC 5DQIA 3NXZA 2KYXA 1RWPB 3JSMA 4O0IA 4X62F 4CLWA 3FUYA 1UKUA 3KLFA 2JLFA 2IA0A 2P8IA 5HMWA 1NCLA 4QBUA 1SKUB 4PKDB 4QJVA 3FRYA 4F2RA 5IV4A 2W8LA 3LGHA 2DXFA 3CCWA 2BEFA 3WX4A 4LF5J 2Z0GA 2DGQA 3DHXA 3H0PA 2HRYA 2IFXA 1Q16B 4CLTA 3SSRA 1FNMA 4P2SA 1NJWA 2YNIB 2NREA 1F3VA 3PG9A 1I1GA 1PYOB 2JJ4D 1EKSA 4PPDA 2WBMA 4KO0A 1RZMA 5HP1A 3I0SB 4I69A 3VVTA 4X4VA 4WPAA 4UY8T 2IC3A 3K5OA 3CC2S 4B3TF 4TY8B 3C6UA 4PABA 3DLKB 3T1YJ 2AJ0A 2JL9A 4DI6A 4N77A 4JI2F 2DR6A 4O0NA 3NG8A 3DI6B 1OWXA 5L1KA 1CJUA 3GYNA 1T03B 2V34A 1S4EA 1GEHA 2ZEJA 1GAOA 5RUBA 1KSPA 2DXDA 2XMJA 4WF9Q 2C2ZB 3ETOA 1N36J 2PE8A 4NLPA 4B3RF 2P9GA 3DM2B 2QSFA 4M5JA 2B8QA 2HHHF 3M05A 2V8GA 3PVXA 3LP2B 1RAHB 3P49B 2YKPA 4CRJA 3H4DA 4K4SA 3I31A 4OHWA 3TP2A 1G1XA 4I2PB 1H6KX 3BQ1A 4C98A 1YZ7A 3O44A 3OPKA 4WZQA 1HYSA 4QPTA 4DOZA 1YJUA 3I9V9 5G4DA 2DR8A 3UW1A 1NH8A 2DNPA 3TAQA 1VK3A 3M30A 5DM6Q 3HVWA 1D8ZA 4I68A 2AEFA 3FZ2A 2QT7A 2YKQA 1I94J 5A8WB 2CQDA 5KFUA 2RF2A 1N4LA 2IJFA 4DV6F 1W2IA 2LFVA 5KT7A 3VAMA 1T9WA 4KB7A 3DDIA 3IS9B 1NRKA 3HULA 4DR5F 3LH2S 1YRTA 2VL1A 2HFNA 4QR1A 3IBFB 4DV2J 1CS4B 1TR0A 4ZKAA 3D6FB 3OFGA 2MY8A 5DG9A 3QGHA 2HLUA 3AY0A 2YNFA 2RT3A 4IG0A 3TR5A 1DURA 2B4VA 2VG5A 4KGVB 4CP5A 1TL1B 1TKTB 1EZZB 1Y5IB 4AQYJ 4DR6F 4QW9A 4C0BA 2HQGA 3BQ0A 1WDDA 4QWDA 1FE0A 2YWWA 4OI6A 4L74A 1S1UB 5LT5A 3KTQA 1F9HA 3OJSA 3BBCA 2ROEA 2DNHA 1R8BA 3TUZC 1WDTA 2HAIA 3MM8B 2MQOA 4V19J 1LWXA 1NM2A 1OSCA 3J7AN 1KBRA 3ZZZA 4F7VA 4P2FA 2DBBA 2J6TA 2D3O1 2B51A 3Q23A 4B9SA 4TKTA 1MWZA 5JVGQ 4JI1F 3CCSS 3H59A 4DFPA 2MKCA 1IBLF 4PG5A 1FDNA 4DS5A 2FHMA 3I9ZA 1GXUA 4J9QA 1S59A 4ICLB 4B08A 2DIVA 2HK3A 1PJ7A 5I42B 4LFBF 3MDFA 2BKNA 4WFNQ 3CJ2A 3W9IA 1SC1B 3NNHA 2W25A 3GCXP 4ZVTB 4NXMF 2I6WA 1U26A 1F60B 3VQTA 1U6BA 2AX0A 2MZJA 5CA5A 3MECA 3MXHP 5KFAA 4B9TA 2MGZB 2ZH8A 3X3UA 2MKHA 1K1QA 4F0MA 2FGOA 2ZH7A 3QJPA 2CQ1A 3EX7B 2VOOA 2V4JA 2R8JA 3T6JA 1AUSL 2MPUA 4OZ5A 3BGRA 4OI0A 1NK9A 2IDLA 4Y2KA 3E51A 3W65A 5CCLA 2ZJQQ 4WKYA 3QATA 4JV2A 4DQQA 5I3UA 3M8PA 4JI8F 2BJDA 2WONA 4ZVQB 2HBZB 2QL5B 1PYSB 4RWXA 1X9WA 2R8HA 2B9WA 1T9XA 1SQGA 4XDCA 4CLLA 4OZJA 2PGCA 4OHXA 2BQRA 3I56S 1S76D 1MROB 1VLOA 3WDOA 4DR7F 1VFJA 5LSLA 2MHEA 2NXCA 2MDAA 5DG7A 3DOKB 2BANB 1PC4A 1RWXB 3C15A 1Q8LA 4J9OA 1D1UA 2R7TA 2JHEA 1N8RT 2RRAA 4JI4J 2N3LA 2EC0A 3M32A 1QY7A 3HHDA 2HNDA 3W64A 1VQNS 1UEUA 1NZ8A 3RZAA 2DNLA 4J37A 3WZ0A 4ZJOA 4DG1A 3W5ZA 1AROP 4RNHA 3MM6B 1IKVA 2XLIA 3CCLS 3WX8A 2JOQA 5J2NA 4WK1A 1HPZB 3MEDB 1TUGB 3NOCA 3R5CA 5HVHA 3RW7A 1Q8IA 5AXNA 1TK0A 1TL7A 4PPZA 3UDLA 2U1AA 2L9DA 4YR2A 5DDOC 4EFAC 2VFTA 4LF4F 1E6YA 2JEIA 2R2RA 4OLOA 4OZNA 3EJMA 5D77A 1R8CA 2Y8WA 2D7SA 3L9ZA 3NWGA 1JXVA 2BRKA 2GAHC 1QSYA 1Y7PA 4EZ6A 2OEJA 2QV6A 1FXDA 1T11A 3M2RB 4PWWA 3U1MA 2H1YA 3IG1A 2UXCF 4X4NA 1S9GA 1VISA 2JFKA 4IOBA 2IM1A 3MR2A 3H5XA 2KB2A 1C0TA 4F4XA 1BWEA 1R6VA 1M1HA 5CYQB 1R7IA 1VQ5S 3WIUA 4OJHA 4GKJJ 2DRBA 3KJVA 2KDOA 3DN9A 1FD8A 2YWGA 3H7HB 2E1RA 1S12A 3OHAA 2FY1A 5J2PA 1HMVA 2LVWA 1WOOA 4KPYA 4ZCLA 3B78A 2AJQA 1UA0A 3RB4A 2FDNA 1PAUB 4H4OA 1FRLA 1S1TA 1FTCA 1FKAF 3POTB 4Q5VA 5DO2A 4FF3A 3DRPB 5FDLA 2HWTA 4LF5F 1FRJA 2WTFA 5K8PA 3HD2A 3BN4A 1GXLA 2QC3A 2Q1LA 2DCUB 1FT8A 1EQ0A 4DQPA 1TQLA 2YVSA 5EWGA 1KR4A 3I6PA 3VTIA 1RT4B 2DH7A 4B3OA 2EI5A 1TL4A 4XK8C 4QOTA 3FNNA 2ZOMA 1NZAA 1B0PA 1KWMA 2VG6B 1TV6B 1RLCL 1AA1B 2DGSA 2CPXA 4ILMA 3GIJA 4XDDA 2ALZA 1IWAA 1LWFA 3JSRA 3T1YF 1H2TZ 3KLHB 4RKUC 3NP5A 3W61A 3IWXA 1Q5YA 4DV1F 4RNMA 2OTLS 4YHHJ 3H2VE 4QWEA 2B9YA 2C3PA 4U6PA 3OXFA 2LU2A 2WOMA 4CYUA 6FD1A 4USIA 4IFYA 1N5YA 2FB0A 1VR6A 3LUYA 2UVVA 1MMDA 3Q24A 3KUHA 2D9OA 3NNAA 4QR0A 3GG0A 1S79A 3IAM9 4L75A 4C8YA 3D66A 3MUVP 1SV5B 4A8FA 1RWVB 1LK7A 3S7RA 3CO9A 3BR8A 4LFAF 3PW5A 1B7FA 4DLGA 4LSLA 1GH8A 4K50A 1YJ7A 3CCJS 1JQGA 1N33J 2FD2A 2R4FA 1WUUA 1YRXA 5KT6A 3A13A 5C2GA 2BQUA 3AB4B 3E2EA 3OFFA 1Q8KA 3DDNA 3VF0B 2BRLA 2OH2A 2RAQA 3F44A 4I6AA 1UVNA 4WIIA 1L3TA 2BR0A 4NPOA 3NGSA 1XNQJ 1J2VA 5KOWA 4O3RA 4PQUB 2UVUA 5KFXA 2VQEJ 3UD5A 2OGUA 4X2BA 4W92B 2Y1IA 2GGPB 2LKZA 3I5BA 2ZD1B 1S1XA 3RB3A 3FC9A 2BW2A 2PSZA 3KMSA 3JYTB 2GZOA 2HNZA 4BC7A 4UQTA 8ATCB 2ZKUA 2GCFA 1IQZA 3L3CA 4JI3F 3R5GA 4CLKA 3VGSA 3HMJG 1RBOB 3W2WB 2UU9J 2GNKA 1G3OA 1H2VZ 2HK2A 1CJVB 2K1RB 3GQCA 2RS8A 2DPJA 1QSLA 4AQYF 3PO4A 3GFHA 3PYDA 4B9NA 1Y4ZB 1MU2A 3DDKA 2RS2A 2YPZA 4NA2A 3J7Z5 2ATCB 2OAUA 4ZLJA 4HDGA 3KK2A 3OR2A 4OX7A 3BH6B 4NA3A 1SB6A 4TVAB 3MCMA 3NOGA 1ZM9A 1SQFA 2MZ1A 4KHMA 2I8EA 1IVZA 2IBKA 5ETQA 3THVA 3I32A 4CCHA 4KR0B 3PHTA 3UPFA 3TX8A 2PFDA 1LWCB 2QLXA 3R7SB 4M5DA 2J0XA 3CXCR 1TTHB 1RT3A 3RU0A 5D3GB 4LR9A 3J7A1 4JI5J 4D3GA 2FHOB 2PEBA 4FDFA 3K17A 5J1EB 2CQGA 2XG8A 3VCDA 3K5LA 3N6LA 2KJVA 1UWAA 3LGNA 3IGNA 2NPFA 3AHPA 4ELTA 5DGBA 1YGYA 1RHUB 3TX0A 5LSOA 1G2EA 4OYOA 4NEYA 5DLFA 3RBEA 5KT3A 3BGOP 3OTOF 4FYDA 3I5CA 2ATLA 2YQ3A 4F0KA 3MZIA 5CYJA 3OD2A 2RQCA 4YMEA 4UOGA 5KFDA 1F5AA 3SDEB 3RTVA 2MQLA 2CDQA 1M0SA 3OR1A 4LSZB 4GKKF 3FSXA 4ES1A 4NCGA 1HNIB 4RUAA 2DY1A 3M6WA 4RW9A 1KDNA 1ICEB 4M95A 1U49A 4ZLPA 1MSWD 3SYZA 1FHTA 2FQQB 2MJUA 4NI2A 4DUZJ 2DRDA 1N34F 3T5LA 3IM9A 4PQAA 2GIQA 2BJEA 4BDPA 3HHLD 2J7WA 1QUPA 4ZN3A 4DV7F 5DETA 4DV3F 1VI7A 1CLFA 1NDCA 1YJNS 4ED3A 1JJ4A 3T41A 2IMOA 5F8LA 1X4FA 2GV1A 1JLCB 4JOUA 5HMXA 5KFFA 2ERRA 2HS0A 1DHMA 2XY7A 3CDAA 3VAHA 3DOMB 4QWAA 3HSJA 3LA0A 3D2WA 4OYAA 4OX8A 3GIKA 1YRUA 1RWMB 2XCPA 1W2BR 3ZTSA 2EFNA 3OQ2A 5IQ6A 3LTOA 2CPJA 3QMQA 7FDRA 3QJLA 1SJ4P 3ZZRA 2A1BA 2H54B 2F8MA 2QFJA 4WE1B 5KFWA 1KVIA 1H38A 1BE4A 4DV0F 4LF1A 1UL3A 5KFVA 5J2QA 3EGVA 2MSTA 3ITHB 4WIQA 2VDHA 4TU8A 4IH7A 3KG1A 4TXSA 4WK3A 5E3CA 3TUJC 5IXUA 2LQ8A 2C1EB 1WOPA 2KXNB 3I0SA 2H9ZA 1SJRA 1FI4A 2BJ3A 2GX8A 3W7BA 1YJTA 2EFVA 4X64J 3AXKA 3OVAA 4TY8A 3BN7A 3BYRA 3DLKA 5CAAA 2M9KA 3MAQA 4JV1A 1NKBA 1IM4A 3MM5B 4G1PA 5K8OA 4ZPVR 1J5OB 2RSQA 5A2QY 1VBZA 3HSGA 2P6TA 1IKXA 1UFLA 1P8GA 3ZO7A 1C0UB 4EO6A 4OYPA 3FSIA 3DM2A 2J6UA 2Q3PA 2HLTA 9ATCB 1C2PA 2A6OA 4K4YA 4M8LA 1NK7A 3LP2A 3R2DJ 4Z37A 4YB7A 5HQMA 5C5JA 2KYZA 2CNOB 4ATNA 4I2PA 4NLUA 2MKJA 3FQLA 3D28A 1VQ8S 1LXNA 3QO9B 5L1IA 3ZTRA 3UO0A 4DV4J 2H4YB 1UVJA 4DL3A 1QM9A 3B8HA 4Q43A 5A76A 2G9OA 2HFUA 4BWMA 5HQ8A 2D3UA 4ERDA 2DNNA 4G3IA 4QIFA 1QJHA 1ROFA 2O5DA 3NY0A 4ECWA 2DVIA 2AX1A 2DEJA 4PG7A 2WVCA 3I0RB 4M5GA 2QMXA 3IS9A 2RNEA 1RHMB 2HHPA 1T05B 3C14B 4FNHA 5FIIA 2RU9A 1VQYA 4OI4A 4G65A 2OMLA 5F8JA 1HLWA 1T94A 4LR8A 5SUHA 1K44A 5KFGA 4ZP6A 3V81B 4GC6A 3UDCA 1URNA 2IYIA 2CPYA 1KQFB 4YHHF 3Q22A 4ZA1A 2XULA 2Z57B 2EFQA 1TKTA 2IMWP 1F5CA 1LW0B 1HWJA 1FVQA 4X4TA 3GFZA 3D0HE 5L8RC 5A8KB 2WAQD 1S1UA 2I9SA 3IWNC 4DX7A 4LF9F 4KSEB 4O3NA 1CC8A 2U2FA 1LK5A 4X66J 3VALA 1X5OA 4ETZA 3MM8A 4N8OA 1Y3JA 2VD3A 4JI7J 4XPEA 4J9NA 2UVWA 4PEOA 3UCZP 3H2UB 3PXGa 5F8IA 3IM8A 2IY5B 1FJEB 3EDRB 1VJQA 4OV1A 2B0GA 2KRRA 5I3QA 1NKEA 3R5JB 1P9YA 3T19A 3AD9C 3CD5A 2XWXA 1WG4A 1NHKL 4C4WA 4LBIA 2AEMA 4C97A 1PJ5A 5LMUJ 4RU9A 4DR4J 1RI7A 4ICLA 1HWIA 4DF8A 4DEZA 2VQEF 2R42A 4M1KA 5I42A 4MT1A 2EG2A 1SH2A 3LOUA 2F9DA 3IO1A 5B0BA 4NYOA 1X9SA 1D9DA 3HFVA 1QVFR 2JVRA 2V8PA 1REVA 3DLGA 2OP5A 5A0YA 1H7WA 3TRGA 5LMNJ 3EICA 2AWZA 4BS2A 4WP8A 2E5IA 2MGZA 3N9UC 1SUQA 2MKYA 1WTBA 4MIAA 3W66A 2NYIA 4OLPA 4ED4A 4NLWA 1FA0A 5KOXA 4ILRA 1NO8A 4FYWB 3GMGA 2C2NA 3DHWC 2ZBRA 1U02A 2VKZG 4K4TA 2WK4A 1WI6A 2JLEA 2ZH3A 4USTA 3GU0A 2QG9B 2X1GA 2R7QA 2MTLA 4AE5A 3LALA 2DEIA 4AXIA 1T9YA 3VR1A 1WSVA 4M5HA 3J81U 3AXMA 1MROA 5E2QA 3OBIA 1LKZA 2VC1A 3GV8B 3G8SA 3MR6A 2K06A 3K0JA 3AAWB 1SJ1A 3DOKA 1FWKA 2B3TB 2BANA 3B4MA 4F67A 1AB8A 3CD0A 2DNGA 1VHFA 3DRSB 3H98A 2KFYA 1TU0B 1LWEB 2DGXA 1J5EF 4KHPF 2H48B 1HL6A 3D0IE 4DSKA 3G87A 2WSFC 5B0CA 2W2PP 1RYSA 2K8GA 4L72B 2V8VA 1PILA 1YJRA 3QGGA 3HHLC 4XTTA 2RDJA 2CG4A 4K4VA 2HS3A 2XGQA 2Y8YA 3B4DA 3MM6A 3HFKA 2F3JA 3MEDA 2JDJA 2X51A 3F73A 5DRKA 1SH0A 2GO8A 1XNRF 4QIWD 2ALYB 1L3UA 5LJ5Y 3HSZA 3RRGA 1VRTB 4ENOA 3N6NA 3THTA 2PMHA 3LF0A 4QYZK 1NU4A 1RISA 2XZWA 4M5MA 2FLLA 1GNKA 1YX2A 2P5VA 4EBDA 2VFSA 3M2RA 2ZC3A 4NXNJ 3MEKA 3T9ZA 5CXTA 2F5GA 5T14A 2VG7B 5FD1A 3DLBA 2R7VA 2K2PA 1M5PC 4P74A 2M8DB 5HQLA 4FNIA 3EDQB 1I5OB 2VJUA 3NS6A 2V4RA 5CYQA 3S1TA 1TKZB 2YBVA 4FF2A 4DFKA 2FHJD 3EGWB 1ITPA 4F3OA 4F4YA 3LPEA 4P2XA 3CJ4A 1MG7A 1KLNA 4R8UB 1OPZA 3M8YA 1CPZA 5EDWA 1NJIT 2VPYB 4USUA 2CRLA 4IO1A 2VFRA 4KO0B 3G8TA 3BM7A 1WI8A 3LP1B 4Y00A 3UDEA 3POTA 5IT0A 3A3PB 3DRPA 4ZVOB 1TUVA 1D9FA 3P5TL 1YTYA 3HJFA 4YR3A 2MQ8A 4I67A 2GHVC 4CH7A 4ED5A 1WHVA 3BB5A 2HVDA 1FRKA 5I4MA 3PIOQ 4TYAA 3RRHA 3SBMA 3C2PA 2QE5A 3C66A 4U8YA 4EBCA 4HR2A 3L95X 4NMXA 5K5MA 1KRPA 2GHWA 5BR8J 1EHWA 2VG6A 1R0CB 1TV6A 2IVFB 1S9EA 4F36A 3G86A 4HHJA 2FVSA 1M1GA 3A12A 3EVWA 3KLHA 4XPCA 2E5LF 4RW6A 1OPIA 2V2QA 2HIYA 4L73A 2WVEA 4QIGA 2XGPA 1HYSB 1JJCB 4ECXA 2EK1A 5GMEA 1WORA 2EVZA 4RO0A 5E7OB 5KG0A 4CO0A 4KV8B 1RAEB 2RUSA 4RZRA 4WP3A 4XIUA 4TQSA 2RF2B 2KH9A 3JSBA 5KFEA 4M5LA 1SV5A 5KFZA 3KMQA 3T9NA 1QTNB 1K73T 3S01A 3NGUA 4KBIA 1H72C 1ULRA 3MD3A 1HNZJ 5C42A 2X1AA 3DFEA 2AF6A 4J9MA 4NRUA 3DLJA 2FGCA 2ZNYA 5JVHQ 2L41A 1JLAB 5HROA 2HW3A 5IFMA 1QVGR 2V6AA 5KAKA 2EFOA 3FFIA 4HTJA 1FFGB 1U47A 2ZHOA 1RT5A 3IR5B 1XJWB 3KXDA 3MPYA 3G96A 5LXRA 4LRFA 3MM9B 3BJYA 1AFJA 2GGPA 1OYDA 3KHHA 1WNEA 5D0RA 3QSYB 2XYHB 1HKAA 1MW7A 2UUTA 4MK9A 1XR6A 2YKNB 3BZQA 4F3QA 3ZZOA 2QMWA 2ZFHA 5EX0A 1HNWJ
chains in the Genus database with same CATH topology
4GVBA 1KP6A 4GVBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GVB A;  1KP6 A;  4GVB B; 
#chains in the Genus database with same CATH topology
 3JYT A;  3BSA A;  1BD6 A;  4B02 A;  5FLX U;  2VPZ B;  5AT1 B;  1WKJ A;  1LEO A;  2D1C A;  3CME S;  3I4P A;  3TAN A;  4NA1 A;  3QFH A;  2D74 B;  1WC5 A;  3BR9 A;  3BGU A;  4KY3 A;  2VFV A;  3W2W A;  2XCA A;  1RU2 A;  1JNZ B;  1CJV A;  2L9W A;  1TAU A;  2K1R A;  1ZAX A;  4FPI A;  3CT9 A;  2ROG A;  4ZHR B;  1RA7 A;  1FRX A;  1HQE A;  2JLG A;  1PO6 A;  2MZQ A;  4RUB A;  4UW2 A;  4K59 A;  1NEE A;  1UAW A;  4DL5 A;  2WVB A;  5J1P A;  2GA7 A;  3ZFV A;  4X66 F;  2BM1 A;  2FHJ A;  3R9L A;  2CVI A;  3KJN B;  1FEH A;  5F8H A;  3BO2 A;  5IWA J;  3VAF A;  5D15 A;  1S57 A;  2GHP A;  2HNY B;  1BGX T;  1LWC A;  1G6B A;  2F40 A;  4ETX A;  4CNY A;  4NZ7 A;  1OYE A;  2LEC A;  3DRR B;  2GIF A;  4JI6 J;  3TVZ A;  5D3G A;  2V4J B;  2YPY A;  1VS3 A;  2CQP A;  2FTR A;  2V69 A;  4CI0 B;  4NEZ A;  3ENQ A;  5LMU F;  2KTQ A;  2B9X A;  2Z56 B;  2LMI A;  4NLX A;  1NDK A;  2H4W B;  4P71 A;  3FDS A;  3KLV A;  3BPD A;  3RJM B;  3D1O A;  4MIB A;  2BXJ A;  3H90 A;  2A18 A;  4FPR A;  1NDL A;  4J9L A;  2WON B;  3LO3 A;  3CCZ A;  2WVF A;  3M8S A;  1PC5 A;  4A48 A;  3T1H J;  2CJY B;  4IO9 Q;  2B4P A;  4OYW A;  3BKF A;  3RGI A;  5BXI A;  4R0J A;  4DQI A;  2AHO B;  4MJK A;  2VA2 A;  2ILZ A;  2D3Z A;  1N5S A;  2O01 C;  2KKH A;  4AND A;  1QE1 B;  1UA1 A;  3KHG A;  3KLG B;  3QBC A;  2XYP B;  4QYZ J;  4WU3 A;  5HVF A;  1Y11 A;  1CVJ A;  5IC6 B;  1RAB B;  4ZJQ A;  1G4C A;  1S9F A;  1K1S A;  3C15 B;  1Q8B A;  1RB0 A;  3Q86 A;  2MLX A;  3NRB A;  2XS5 A;  3CJ3 A;  2BE2 B;  2VON A;  2RE1 A;  3UDV A;  4A8Q A;  3O6Q A;  3G6V A;  5LOQ A;  4C3L A;  2UZA A;  3PJW A;  5J2N B;  2IIH A;  3KNG A;  4N7T A;  4C8K A;  3TA0 A;  2CQH A;  4O3S A;  4K4U A;  3W62 A;  1TL7 B;  2C2K B;  3R8Y A;  2E9T A;  3VWS A;  4H4M A;  1FEE A;  1JLC A;  1RAC B;  2HG4 A;  4V1A k;  3FMW A;  1D0E A;  4CM2 A;  3ENW A;  3DOM A;  3FK4 A;  4LF7 J;  3OUY A;  4DZD A;  3ZTP A;  3JAM U;  3D6T B;  2DIS A;  1RGV A;  3DLE A;  3IG1 B;  3TAP A;  3RBZ A;  1E6V A;  1UCN A;  4OX6 A;  1GMV A;  3AQP A;  2HVZ A;  1ZZF A;  1B0V A;  3BYP A;  1C0T B;  3UI3 A;  2F65 A;  2V68 A;  4WE1 A;  1U6Z A;  2JRS A;  4EWT A;  3MPU B;  4PWU A;  1JX4 A;  3SSS A;  3TA1 A;  5B0A A;  4RW4 B;  3NS7 B;  4HH0 A;  2MXY A;  3OL6 A;  3LPY A;  3SSQ A;  4ECT A;  1O5J A;  1LNQ A;  4B3M J;  5HVG A;  4DUY J;  1M5O C;  2VQF J;  4H4O B;  1S1T B;  4RNN A;  4K4W A;  4RW8 B;  3EVM A;  3NGR A;  2VOP A;  4NML A;  4Q45 A;  2J6S A;  1IR2 A;  2J9D E;  3BO4 A;  3M9N B;  5HAT A;  1S1V B;  4XO0 A;  3R1H A;  1J5O A;  3EVO A;  4ED2 A;  5C24 B;  1KQK A;  3AJ2 A;  4ELV A;  2EFP A;  2QX0 A;  4AFF A;  5KFN A;  1C0U A;  1VK8 A;  2AMC B;  4M5I A;  4K7Q A;  1D3W A;  3BV8 A;  3OTE A;  4HI2 A;  1NSA A;  1YBT A;  3C3L A;  2QTW A;  2ZKT A;  3FQK A;  1VLY A;  2ASJ A;  2NXN A;  1T7P A;  3KHR A;  4P6Q A;  3LWM A;  2NS1 B;  3H40 A;  2FJV A;  3FZB A;  3VZH A;  2VA3 A;  3PV8 A;  3O3L A;  3CJR A;  1C1C A;  1NK4 A;  1OO0 B;  3S6E A;  4I2Q A;  2ZDP A;  5IC4 B;  4PG8 A;  3FBC A;  3FGV A;  4GO5 X;  5HN0 A;  3AA9 A;  2DCL A;  3CCR S;  4GRS A;  1TP7 A;  4DPO A;  2PC6 A;  3HVT B;  5IM0 B;  1LOU A;  4UUW A;  3AOB A;  1N5Y B;  4K4X A;  1HWU A;  4ER8 A;  3K2Y A;  4I64 A;  3CNQ P;  3I0R A;  2N3O A;  4Y2A A;  4FZV A;  1T9U A;  3GJT B;  3LQV A;  4O3P A;  3VGV A;  1T05 A;  3C14 A;  2X1F A;  1WG1 A;  3VAI A;  5AJ3 J;  1RTD B;  4DFJ A;  2FVP A;  3FJ2 A;  2W7O A;  3V81 A;  3D3C J;  4UF4 A;  1RUS A;  5JJB A;  4HYK A;  1NPP A;  1WAC A;  4TLR A;  5U47 A;  4A8X A;  1LW0 A;  2APO A;  2BYC A;  2AYE A;  1IWG A;  4LFC J;  4KYZ A;  5HBM A;  5THW A;  5B09 A;  1KHV A;  1WWH A;  5A8K A;  1KC8 T;  1HBO B;  3LAM A;  4CLZ A;  1RJJ A;  1DQ8 A;  4A8W A;  3AOA A;  3IR6 B;  4USH A;  2M88 A;  1N5Q A;  3P5B P;  1GFW B;  2ASY A;  3QAU A;  4KPC A;  5B0E A;  4K2X A;  5B0D A;  4IUF A;  2A2C A;  2SXL A;  4USK A;  3CJS A;  3DMJ B;  3DRY A;  5IV3 A;  4RUC A;  1SC4 B;  3KG4 A;  2Y0B B;  4NZ0 A;  2BJ7 A;  3K5M A;  2F9J A;  3OT9 A;  1UJ4 A;  3MMJ A;  4WKR A;  1FRH A;  1XMB A;  4YY3 J;  2ILY A;  4GVL A;  5GAD I;  2YWK A;  4FXV A;  4KTQ A;  2MKI A;  3J7Y U;  1X0P A;  1HBN A;  2RQK A;  3KK2 B;  1JIH A;  5K8M A;  3C19 A;  4LUB A;  1XWL A;  3B54 A;  4WXO A;  2HWI A;  3NS5 A;  3PTW A;  1F9E B;  3RB0 A;  2ZH5 A;  2M0G B;  1NJY A;  3HI9 A;  3DXS X;  3ADA C;  2KRB A;  2B56 A;  4MMO A;  4C2M A;  2OFG X;  4OHV A;  3EPI A;  1WC4 A;  4FN5 A;  3GSD A;  2XY5 A;  1VGY A;  4LRB A;  3T5K A;  1O0P A;  2QL9 B;  3WIV A;  5LM7 E;  4MH8 A;  4A8K A;  4ID8 A;  2MYF A;  2R7R A;  3EXC X;  4KAI A;  2BE9 B;  1WHX A;  1B4S A;  2L3M A;  3CW2 C;  3W9J A;  2LA6 A;  3US5 A;  1A7G E;  5E33 A;  1VC0 A;  5E41 A;  3U02 A;  2FY8 A;  4ECY A;  1IKW B;  5IWA F;  3TW0 A;  4M63 A;  4X65 J;  2HHW A;  3FEZ A;  1PCA A;  1HD0 A;  4PRF A;  1F3F A;  2EWH A;  3L09 A;  2DRA A;  3MPW A;  5KG6 A;  4JI6 F;  2CZ4 A;  2LXF A;  5LSR A;  1A6L A;  3DRS A;  4C48 A;  1PKU A;  1LWE A;  1W26 A;  2GQC A;  4DS4 A;  1HIY A;  5G0R A;  1ZOT A;  3GIL A;  1WG5 A;  4B17 A;  4DR1 F;  3CDU A;  1X9M A;  2BAB A;  2IM0 A;  1VQ4 S;  2AIR B;  5D4N A;  2UUC F;  4LRE A;  3MFI A;  2R7O A;  4LJM A;  2MZR A;  4U9R A;  2QFI A;  1H73 A;  1SVD A;  5F8N A;  2BJ9 A;  1ZET A;  1QDU B;  4HHU A;  1UTA A;  4O4G A;  2CPF A;  1PYT A;  3N0V A;  4L3N A;  3LWL A;  1ZZN A;  2ZH9 A;  5K14 B;  2N7Y A;  3ZNJ 1;  2AJF E;  1CEZ A;  1VRT A;  2C2M B;  1APS A;  3GFY A;  3EXY A;  2Y1R I;  3W63 A;  3PO5 A;  2CZV C;  1WF2 A;  4NWB A;  1R8H A;  1WHW A;  4PWD A;  2ZHB A;  1U25 A;  4ILL A;  2UUA F;  2VG7 A;  2BBE A;  1GX5 A;  3SCI E;  3G71 S;  2RML A;  4ECZ A;  2CA9 A;  1SJ3 P;  3CWJ A;  2FIU A;  2V94 A;  1TKZ A;  1RT2 B;  4U95 A;  4E98 A;  2DNR A;  1WJ9 A;  4A47 A;  1QAJ A;  3PEJ A;  4IH5 A;  5J2Q B;  1JK9 B;  2PO4 A;  2NUU G;  5GAH U;  2RVJ A;  4R8U A;  3KNA A;  3F41 A;  2XMV A;  1RWO B;  1X60 A;  2NXE A;  1S72 S;  2KG1 A;  1NB7 A;  4C8L A;  3SCK E;  4Q44 A;  3QLH B;  2HFZ A;  5F9L A;  4LF7 F;  3LP1 A;  2R7U A;  2AZ1 A;  4ECS A;  2VHG A;  4MTP A;  1NKC A;  4DQR A;  2MKK A;  3P8B B;  4DU8 A;  2DR7 A;  1N32 J;  4FXW A;  3SEO A;  1H74 A;  5KFT A;  3PYF A;  4DCO B;  1WEL A;  1F6T A;  1RTH B;  2J5A A;  4ZVE A;  2OSR A;  2LEB A;  2Z2Y B;  4BLG A;  1IKX B;  3ILI A;  2ZWP A;  1MLA A;  2BKP A;  4USV A;  4WYW A;  4B3M F;  2FUG 9;  1GT8 A;  3TO8 A;  1ZTW A;  4IRK A;  1HAR A;  2Z2M A;  5JMN A;  1T0T V;  3D68 A;  3P4U B;  4OYI A;  3ZZT A;  4K0K J;  2E1P A;  4DR3 J;  4OZ0 A;  4IKA A;  4WU2 A;  1S0N A;  2Q66 A;  1H2U X;  1T3O A;  2OPR B;  4AYB D;  2QRR A;  4ZVS B;  3N5B A;  3ZZ0 A;  3M9M B;  1JXE A;  2AGO A;  2OD4 A;  1DAX A;  2D9P A;  2PD1 A;  3K7R A;  3QT7 A;  5K8N A;  4KGM A;  1U24 A;  3GYX B;  3H20 A;  3P3D A;  4HL9 A;  4C3M A;  4KV8 A;  1AFI A;  2ZBP A;  5D4O A;  3I5A A;  2NSC A;  1W25 A;  2AT1 B;  4WBF A;  3QJJ A;  2ZM6 J;  2O3D A;  3SCJ E;  2O1P A;  2KT5 A;  4EO8 A;  3R27 A;  2DNK A;  3PNI A;  5HMY A;  5C25 B;  5CD4 A;  5D0G A;  2YY3 A;  4FYV B;  2KZM A;  1JLA A;  3QIP B;  2FJD B;  1TAQ A;  4Q0B B;  1YKW A;  4B9M A;  2CQ0 A;  3GFX A;  3UQS A;  5J1N A;  1OJ4 A;  2RUG A;  2GQQ A;  2HQF A;  5A8R A;  4ZVG A;  1YQH A;  3MM9 A;  1NUE A;  2RIJ A;  1FJG F;  2YH0 A;  2YKN A;  3HHL B;  2YNH A;  2O67 A;  1X31 C;  2V4Q A;  1HWL A;  2CWK A;  2Y1L B;  2F4V F;  1U7L A;  2B6A B;  3KHL A;  4IR1 A;  2UXD J;  1NPR A;  1XEZ A;  1U1O A;  2FJW A;  2M70 A;  3MUT P;  1XMO J;  2JH3 A;  1XMQ J;  2CPI A;  4F3M A;  1SBR A;  1BQN B;  2XZD B;  1HHT P;  3IR7 B;  1U1Q A;  4CM0 A;  1S77 D;  4BC9 A;  2RU3 A;  4OX9 J;  4OHY A;  1B70 B;  4ZHR A;  5ETK A;  1VQP S;  3BO3 A;  1X5S A;  2KJW A;  4TY9 A;  3TQE A;  4ED7 A;  2HQ3 A;  2PA8 D;  2AJ2 A;  2BOP A;  1UJ5 A;  2CPE A;  3OVB A;  4LQ9 A;  4LIR A;  1RAA B;  1M5K C;  4JV5 J;  4B9U A;  2VPW B;  3A8E A;  3MMC B;  4NLR A;  2EFG A;  2NZC A;  2RQM A;  1REV B;  3DLG B;  4RBU A;  5A0Y B;  1ZA2 B;  1WF1 A;  2BJ1 A;  2HNY A;  2MLY A;  2ZH1 A;  2CNK B;  1DBD A;  3HT0 A;  4CIO A;  4ZJL A;  3MCS A;  3DRR A;  1SC3 B;  1DFD A;  1SUQ B;  5AXM A;  1UPM B;  3EZU A;  3H5Y A;  1WC0 A;  1TFY A;  2N4D A;  2W7A A;  4Y6I A;  1H98 A;  2KT2 A;  4JYA F;  1RXO B;  1Q0N A;  3M6X A;  1HNX F;  1FRI A;  2Z30 B;  5E3P A;  4DR2 F;  2KFZ A;  3M9O B;  5H1S V;  3IBC B;  2G1H A;  2EXU A;  3NMR A;  4ZVF A;  2ZH4 A;  3DC2 A;  4N76 A;  3G82 A;  1NAQ A;  1R3N A;  3M8Q B;  1N0U A;  3QT8 A;  3OFE A;  4NZ6 A;  4UQG A;  3PW7 A;  3WBZ A;  3R1L A;  3V4I B;  2QLJ B;  2W4D A;  2GVD B;  3R97 A;  1QE1 A;  4X62 J;  2LA4 A;  4R5P B;  5IT9 Y;  3ULH A;  3KLG A;  1RAJ A;  1ZBT A;  1L5U A;  1AXQ A;  1U1R A;  4ZCK A;  1P1T A;  1P6T A;  2VBY A;  4JP8 A;  3THP A;  4B9L A;  2VPX B;  1T9V A;  4JBC A;  2XHW A;  2BE2 A;  3M7V A;  4QWB A;  4IRD A;  3GR1 A;  1HW9 A;  2IVY A;  1EP4 B;  2PEH A;  1WEZ A;  3N79 A;  5HI7 A;  1MMN A;  1WC1 A;  2H5I B;  2BZ2 A;  2HYI B;  3OLB A;  4N41 A;  2AKW B;  4CO5 A;  1Q78 A;  3MEG B;  4U96 A;  3V6H A;  4KGK A;  1XQI A;  4WP9 A;  3DU5 A;  1VC5 A;  3FCW A;  3FSY A;  2G2Z A;  2CYY A;  4PCQ A;  5ETR A;  4F50 A;  2M5Y A;  3HFZ B;  3R5A A;  2LQ5 A;  4ZMM A;  3M6V A;  2HHX A;  4LF6 F;  3U1L A;  1Q86 T;  2WSE C;  3RBD A;  4Q8F A;  1FVS A;  5GVQ A;  1IKY A;  2CG8 A;  2DNY A;  2LQB A;  3RAX A;  4OJ3 A;  3HF5 A;  3EPG A;  3G8Q A;  4ZVR B;  2HWH A;  4JI2 J;  3J7Z T;  4ANC A;  1JLG B;  2VC0 A;  4A8O A;  2CWX A;  1KTQ A;  2Q6C A;  3AJ1 A;  3PYE A;  1XK8 A;  4ES2 A;  3IAS 9;  3BPS P;  1GK8 A;  2GFF A;  1HHS A;  1JKH B;  4P7T A;  1VBY A;  3TZX A;  3IC1 A;  1DQA A;  3EGZ A;  2R2S A;  1FX4 A;  4B3R J;  4RW4 A;  1BLU A;  4ZPB A;  4BBY A;  1Q7Y T;  4ECQ A;  3MR5 A;  2HHH J;  2I38 A;  2DHX A;  1F5B A;  4DCP B;  3K59 A;  3J80 Y;  1MWY A;  2A0F B;  4IDK A;  4FS1 A;  4YOE A;  1WOS A;  3ZZU A;  3UE2 A;  1T02 A;  2FZK B;  4RW8 A;  3PEH A;  4DMZ A;  1YK9 A;  3BGF A;  1X8D A;  3MI7 X;  5KFQ A;  2DO0 A;  2YH1 A;  4DPT A;  1S1V A;  2CUY A;  5DQG A;  5EN1 A;  1SXL A;  3IRW P;  2OEL A;  5C24 A;  5KFR A;  2V67 A;  3ENV A;  1NBE B;  1PBA A;  2VF3 A;  1RCX B;  3CMQ A;  4DV6 J;  2F1F A;  3Q8S B;  1RTJ B;  3OFH A;  3R7N B;  1UP1 A;  1RWW B;  2W1B A;  2J9E A;  3QNW B;  3M4X A;  1S9E B;  2DO4 A;  2E66 A;  2JWN A;  3A8K A;  2WVD A;  2R8I A;  2V8H A;  4U67 Q;  1KS2 A;  2W2O P;  4DN9 A;  1EAY C;  3CUN A;  4GC7 A;  4RNF A;  4BWJ A;  3V6K A;  2DT9 A;  4RW6 B;  3TAM B;  2DJW A;  1DTQ A;  1BHN A;  4DR6 J;  4FXD A;  1CUL B;  4CT8 A;  2A10 A;  2FLO A;  3I55 S;  1FDA A;  3HVT A;  5IM0 A;  3CB4 A;  3MR7 A;  1QAX A;  3ILL A;  2HFS A;  1JWW A;  1SIW B;  2VDI A;  2H5E A;  2HQC A;  3V5R A;  3FVY A;  4RBT A;  3NCQ A;  4KGZ B;  1N36 F;  1B3T A;  4LT6 A;  1YI2 S;  1CJK B;  1F1B B;  3OL7 A;  3NGT A;  3KUE A;  5L1L A;  5ETO A;  1SL0 A;  3NGD A;  1MN7 A;  4C11 B;  1PJ6 A;  4K0K F;  3HZG A;  1RTD A;  1X0F A;  2W2N P;  3HDS A;  3PX6 A;  4C0H A;  5C42 B;  4OIX A;  3JQM A;  3CJ0 A;  4Q2M A;  2ZVI A;  3HM9 A;  4RL1 A;  4G1Q A;  3KFW X;  1IBL J;  2DB1 A;  5HRO B;  3CVK A;  4HKQ A;  1FDD A;  4KRW A;  4NCB A;  3FFI B;  1VCT A;  2YX7 A;  2DPI A;  4EI2 A;  2QEX S;  2LP4 A;  2OPP B;  2FHK A;  1RT5 B;  1U6F A;  2K3K A;  4LFB J;  1R8P A;  3CC4 S;  1HFE L;  4J7C A;  1HBO A;  1I94 F;  5DLG A;  3IA0 A;  2DNM A;  4O23 A;  5DJB A;  1RLD A;  3D5M A;  4NXM J;  2DGT A;  2CAD A;  1REG X;  2R3V A;  1ZS6 A;  3ISZ A;  1IR1 A;  4MKV A;  1F9F A;  4N47 A;  2WRM A;  1O8B A;  2XNR A;  4DV2 F;  3D1Q A;  3TI0 A;  3DMJ A;  4DN0 A;  2H65 B;  2D69 A;  1U1N A;  1VMB A;  1SPB P;  2G0I A;  3BRE A;  3DYA B;  3W5X A;  5GAE I;  5AE2 A;  3CDW A;  5KFH A;  3FKB A;  1D9A A;  4KT0 C;  1YSJ A;  4IQM A;  2FPH X;  3D7S B;  4JI8 J;  4AL6 A;  3ILO A;  4RX6 A;  3OXL A;  1FES A;  1HQE B;  5ETT A;  2P9C A;  4OI3 A;  1RAO A;  4EGL A;  4J9P A;  4CZC A;  1XTZ A;  5AXK A;  1V3R A;  5D0H A;  1X5P A;  2OO4 A;  4DU7 A;  1HBM A;  1Z1Z A;  3UCU P;  4C8O A;  3AQO A;  2QA4 S;  4C8M A;  4ECR A;  4DR7 J;  4ALZ A;  3N28 A;  1RQ0 A;  3MF5 A;  4P73 A;  1XMO F;  3MCO A;  1RE1 B;  4FBU A;  4JI0 J;  3CE8 A;  3M2V B;  1DJ0 A;  5ADZ A;  2ACM A;  4YB1 P;  5KG3 A;  4W98 A;  4OX9 F;  2YTC A;  5HL7 Q;  3GPA A;  1ELO A;  4FVC A;  3GE9 A;  1R0B G;  4ZPT R;  5ETP A;  2ZBI A;  2DTJ A;  2HFO A;  4NX9 A;  3W8G A;  5A2Q U;  1EJ7 L;  1NK0 A;  1YIJ S;  4WFB Q;  1PIE A;  3BBB A;  2CJA A;  4IFV B;  1GX6 A;  1DTT B;  1T95 A;  4JV5 F;  3R5B A;  1IKW A;  4A8S A;  2W01 A;  3P6Y C;  1SQE A;  4C7Q A;  2Z2L A;  4J91 A;  1ZM2 A;  1S6U A;  3TVY A;  1VIO A;  3FCH A;  2IRX A;  3OTB A;  4M5N A;  2QA1 A;  4LF4 J;  3N5F A;  3GSI A;  2HGM A;  3VV2 B;  1X4E A;  2B5J A;  3OSN A;  4MIW A;  5CD4 H;  1VC6 A;  1LW2 B;  3M2U B;  3D9B A;  2CJQ A;  2KFN A;  1X4H A;  3GP9 A;  1CJT B;  1FNX H;  3O1L A;  3HHK A;  2MZS A;  2AYM A;  3I82 A;  2EEY A;  2CQ4 A;  4HDH A;  2UXC J;  1X7V A;  2IJN A;  1HNV B;  1S1W B;  2BW7 A;  4P9S A;  1KN6 A;  5DDQ C;  8RUC A;  4A46 A;  4CO1 A;  3HZE A;  1A0O B;  4ZPA A;  3MMA B;  4M94 A;  2F8E X;  3EYZ A;  2CDR B;  3GB0 A;  3ETM A;  4EYH B;  2YKM A;  4AD6 A;  3EE3 A;  3K89 A;  2CXE A;  3GTY X;  2ZOG A;  3FBE A;  4I56 A;  5K14 A;  3UCG A;  4YFU A;  2CFX A;  3GG1 A;  2CKW A;  4H4M B;  2Y1J A;  2CQI A;  3CMA S;  1JJ2 R;  1NHV A;  1RHJ B;  2MMY A;  1U09 A;  3OUY B;  4JI4 F;  1GQE A;  3IBW A;  3WC2 A;  3KLE A;  3GLJ A;  2HBR B;  3AJD A;  5L38 A;  4K8R A;  1N0V C;  2DGW A;  4ZVH A;  3DLE B;  1FKP A;  3IRX A;  2W8K A;  3MCN A;  2DHS A;  1E6V B;  3HJV A;  2NZ4 A;  2QZ8 A;  4Y3C A;  1W7W A;  4NLQ A;  2GMH A;  5L9X A;  1RT2 A;  4CLU A;  4Q7A A;  5J2M B;  2B4O A;  3VGU A;  3HHE A;  2OHD A;  3O5T B;  3V6D B;  5E3A A;  3HPO A;  1K0T A;  1S48 A;  1TL5 A;  1JNR B;  1TK8 A;  3QZ8 A;  3QLH A;  2DR5 A;  3RG6 A;  5DQH A;  1HBU B;  4JB8 B;  1FK9 B;  1SC6 A;  3PCO B;  3ZZP A;  1FWP A;  2AQ4 A;  1RP5 A;  2KL8 A;  3G6E S;  2Z2Z A;  3GCW P;  1M5S A;  1S0V A;  4DV1 J;  4TNO A;  4I1T A;  2ZBC A;  4RUH A;  2VIC A;  4FKY A;  2GVZ A;  2V2V A;  3J81 j;  1UVK A;  3CPW R;  2XSF A;  4LRD A;  4CTA B;  2CAJ A;  2QA4 G;  3DU6 A;  2XMM A;  4OL8 A;  5KFL A;  4HEA 9;  1RT1 B;  5D4P A;  4GKJ F;  2HKE A;  2HRU A;  3JTO A;  5KFY A;  1SH3 A;  4JV0 A;  3JB9 k;  3NMA A;  1RTH A;  3KJF B;  3JQK A;  3QZ7 A;  4DSE A;  1JLB B;  1KFS A;  3U7J A;  2VH7 A;  3K8W A;  3ILJ A;  5EWE A;  3O8W A;  1NDP A;  5B0F A;  1N48 A;  4LFA J;  3OL9 A;  1S0O A;  3FBB A;  3D6H B;  3LP0 B;  1FTR A;  2LQ9 A;  4MK8 A;  1NHU A;  3KYL A;  4TLQ A;  3I87 A;  4QW8 A;  2KU7 A;  2OPR A;  3OTC A;  4ZIV A;  2LEA A;  5D6G A;  3MPV A;  1Q79 A;  1NSP A;  1KKH A;  2E7W A;  2ZH2 A;  2DK2 A;  3M1V B;  1C1C B;  3BSN A;  1FKO B;  2ZDO A;  4URS A;  4W4M A;  4I2Q B;  1DY3 A;  3HO1 A;  4ZP9 A;  2CJX B;  2CPZ A;  2HZV A;  4KKO B;  4A8M P;  3KKF A;  3HXM A;  1JB0 C;  1OIA A;  4JI3 J;  1S7H A;  2HZA A;  4OZL A;  3CO0 P;  4P2M A;  3GJR B;  5C25 A;  4IOA Q;  3H5U A;  1KOH A;  2IHR 1;  1H3D A;  2E5J A;  3MAA A;  3QIP A;  1YG0 A;  4Q0B A;  2QMU B;  3NLC A;  3ZTQ A;  5BYS A;  3EZO A;  2Q6B A;  4KFB A;  3WHI A;  3E01 B;  1VYA A;  1VQL S;  2VBW A;  3MEE B;  2DXE A;  4Y0F A;  2LU1 A;  1WEX A;  4CDI A;  4ZOS A;  1FRM A;  5HBM B;  3UD4 P;  3TJ9 A;  3K5N A;  4W90 B;  1OQ3 A;  2W9C B;  2RHQ B;  3HHL A;  2G1D A;  1Q53 A;  1Y5L B;  1ZM3 A;  3VGT A;  3TZW A;  3W3S A;  1KHW A;  4LR7 A;  3RBX A;  1UFW A;  2WSC C;  1HI8 A;  4DSI A;  4PXE A;  2B6A A;  4DPU A;  3CCM S;  1OY9 A;  2DR9 A;  1N33 F;  2NXJ A;  1B7Y B;  1WTF A;  2KN4 A;  3EMT A;  1EX8 A;  1FXR A;  2LXI A;  3CIZ A;  1BQN A;  2MKS A;  1QD1 A;  5ETM A;  2FZG B;  3N6M A;  1XN9 A;  4RW7 B;  1N6Q B;  4HT7 A;  1SKR A;  1B0T A;  4S0M A;  3G6Y A;  1XNQ F;  3QGI A;  4F02 A;  2HMI B;  4EK2 A;  2FZC B;  3H4B A;  2IYG A;  1VHI A;  4WJB A;  1FDB A;  5C7P A;  2BMB A;  3GIR A;  1HBN B;  4IH6 A;  3OTO J;  1V5I B;  1BQM B;  4DLE A;  2OPQ B;  4F25 A;  1UW4 A;  3MMC A;  1KOO A;  2VOD A;  2CQ3 A;  4CLP A;  5F3T A;  3HK2 A;  5F3Z A;  3DRX A;  1ZYQ A;  1Q7L B;  4ITS A;  2CQ2 A;  1VRU B;  1U8S A;  2O66 A;  2Q43 A;  2VJV A;  3O2I A;  5IOL A;  3DOL B;  4UY8 5;  1BQX A;  5KG7 A;  3ZC4 A;  2UU9 F;  2DHH A;  1NSK L;  5KT4 A;  2IM2 A;  4GKK J;  4RWW A;  3MD1 A;  5BYQ A;  4Y2C A;  4IG3 A;  2DHG A;  3BEG B;  3SZ2 A;  4QQB A;  1C4A A;  3K58 A;  2ZZN A;  2CVE A;  4V19 X;  3CCV S;  1PSD A;  3QQC D;  4NLS A;  3KK3 B;  1N34 J;  1Z2L A;  2C2O B;  4ECU A;  4ECV A;  4TYB A;  1IBC B;  1U0H A;  3M8Q A;  3PRV A;  1XER A;  2AJ1 A;  2BOA A;  4PUO B;  4AL7 A;  4MFB B;  4ED0 A;  4DDF A;  3OTD A;  2HQI A;  4WTO B;  4EBE A;  4DV7 J;  4DV3 J;  3V4I A;  2IRU A;  1QTM A;  4JI0 F;  1KLM B;  3GIM A;  4DL6 A;  3M8R A;  2V0N A;  2GVD A;  5A6P A;  1UEK A;  1FO1 A;  1DLO A;  4R5P A;  4FKX A;  4FS2 A;  4J90 A;  4ZCI A;  2A6M A;  1WKL A;  3NWR A;  4JI5 F;  5KFB A;  1C1B B;  1M1K T;  2OEM A;  1KNZ A;  3Q83 A;  2KG0 A;  2CNN B;  2BM0 A;  3HVA A;  3E8O A;  5G0R B;  2EBE A;  2ZE2 B;  1FFS B;  4X4U A;  3HHN B;  2MJN A;  7FD1 A;  3NKY A;  4YQW A;  2PMZ D;  2BX6 A;  3PRD A;  4GO7 X;  1IXK A;  1EP4 A;  3DLL Q;  4MAK A;  1JLF B;  2V63 A;  3DNC A;  3K57 A;  3P45 B;  4RJV A;  2NCK L;  2HQD A;  4DV0 J;  1DAR A;  2Z58 B;  4ZIW A;  3MEG A;  4O4G B;  4Z7Y A;  3PKY A;  1RAF B;  3A1Y G;  2R2U A;  1FNO A;  2FVQ A;  1JLE B;  2VAS A;  2EW9 A;  1HI1 A;  2YX4 A;  2AYB A;  2B4U A;  2Q79 A;  3GWC A;  5B7W A;  2YX1 A;  4OI1 A;  3H2L A;  3RRK A;  4MYT A;  1ZAW A;  4WFX A;  1NJX A;  1L3S A;  1N54 B;  1U8W A;  4PWD B;  3VAG A;  2RRN A;  1KP6 A;  1JLG A;  1TL3 B;  1D8Y A;  5E5N A;  1RTI A;  3PZP A;  5BJR A;  3DLH A;  5KG4 A;  4DUZ F;  3CJ8 A;  2VBX A;  4PYA A;  4KIA A;  1Y3K A;  5F0W A;  3AFG A;  1JKH A;  4UZB A;  2ABY A;  4J9V A;  2VZ9 A;  4L6V 3;  1M5H A;  1IJE B;  2JX2 A;  2DIU A;  3MTJ A;  2AYG A;  3C6T A;  2IJR A;  2XLJ A;  2PMW A;  2BE7 D;  5F8G A;  1TKX A;  2NXU A;  3LAN A;  1KQS R;  2EKN A;  2F7V A;  2H3E B;  5DDP C;  1IBM J;  1SJQ A;  5DM7 Q;  1DRZ A;  4F0H A;  4OI2 A;  2I5J B;  1HQU A;  2VKR A;  1L3K A;  1S6P A;  1TZ0 A;  3VVU A;  4NCA A;  4B9V A;  2PI5 A;  2FVC A;  2QA2 A;  4YDX A;  1JJH A;  1GTH A;  4ZPC A;  2V5H G;  2PT0 A;  3CJ5 A;  2PA3 A;  2FJE B;  1YIT S;  4KJI A;  3DGV A;  2HAF A;  3MMB B;  2NLW A;  5IQQ A;  2XHC A;  1RTJ A;  1OMS A;  2X1B A;  1WD6 A;  4EEY A;  1JXL A;  4LVN P;  3T6B A;  1X4D A;  1VQ6 S;  4K5S A;  4YEA A;  1P1L A;  2JFD A;  2DH8 A;  4OYX A;  3Q8U A;  1WF0 A;  2QLB B;  1H0H B;  4X64 F;  1VQ9 S;  2Z4P A;  1Y9O A;  2E5H A;  2ROP A;  4TU7 A;  4I7F A;  2BJ8 A;  3TAM A;  1T9T A;  4J9S A;  1R8A A;  1CUL A;  1Q82 T;  2Z8Q A;  1VIX A;  5M2U A;  3DGP A;  4ED8 A;  3L7U A;  2MQN A;  4LF9 J;  2C42 A;  1VJW A;  3PW0 A;  2C2E A;  2FJB B;  2R9L A;  5DZ6 A;  4QU6 A;  1NH7 A;  2UV8 A;  1IUJ A;  1CJK A;  2HGN A;  1SL2 A;  3UR3 C;  1VQ7 S;  3BDP A;  3HT3 A;  4C11 A;  3RB6 A;  3C16 B;  5L39 A;  3JS9 A;  5T7L B;  1FWL A;  1TVR B;  3SQG B;  2W9B B;  2BDP A;  2XC9 A;  3CCQ S;  3IMQ J;  3F56 A;  4A4J A;  1TK5 A;  1NK5 A;  4ZP8 A;  1UZH A;  2ZIT A;  3M6U A;  4DV4 F;  1NLK L;  3W8P A;  4OJ1 A;  1LFP A;  2OPP A;  2UXB J;  3PKM A;  5KTQ A;  3T5H A;  3Q8Y A;  3UNG C;  3WQP A;  5B08 A;  4AL5 A;  2V9W A;  5KFJ A;  1RYR A;  3MUR P;  1U1M A;  5A8R B;  4IR9 A;  2WW4 A;  4ZIT A;  3CGI A;  3AD8 C;  3FRZ A;  3FEX B;  2YNH B;  2QLW A;  2QSW A;  3SV3 A;  1X4B A;  3SI8 A;  2R2T A;  1IR0 A;  2OLW A;  2C3Y A;  3CUL A;  2P6S A;  1SKS A;  3DYA A;  3JXO A;  3V2U C;  4DV5 J;  1VQS A;  2XB2 D;  2KM8 C;  1RU1 A;  4U8V A;  4CO4 A;  3NCP A;  2X3G A;  3CJQ A;  3RYL A;  3QRQ A;  4J5O A;  4B3S J;  4OZ1 A;  3U27 A;  4YUD A;  3MGJ A;  4LBP A;  4UT4 A;  3N01 A;  3TYT A;  1IBK J;  3HP6 A;  2CJB A;  2RDI A;  4JI7 F;  3D0G E;  3KOA A;  4Z7C A;  4PXD A;  2KT3 A;  3CC7 S;  3W5Y A;  2CJK A;  2HVH A;  3BH7 B;  5H9F K;  1N5T A;  5MAO A;  4C0O C;  2XI3 A;  1TMJ A;  4YS2 A;  1BC6 A;  2N4C A;  2W2M P;  3M2V A;  2ZJR Q;  2QYC A;  2X3D A;  3AB2 B;  4FP9 A;  3IFE A;  1UW9 A;  5EUH A;  4PXB A;  1J5E J;  4KHP J;  2OMO A;  2W7P A;  2AD9 A;  2YNG B;  5KFO A;  2XMT A;  1V3Z A;  1YHQ S;  1X4G A;  2VUG A;  4DR4 F;  1WHY A;  1SI9 A;  3RR7 A;  1SL1 A;  2VBZ A;  4MKB A;  2IDE A;  2IM3 A;  5EWF A;  3GZ7 A;  4IFV A;  1DTT A;  4GVB A;  4O3O A;  1XR5 A;  3Q0A A;  2UUB J;  3W9H A;  2ZJP Q;  1UFK A;  3PHE A;  1U4B A;  3NNC A;  3CJK B;  5F8M A;  5LMN F;  1HA1 A;  3G82 B;  4WCE Q;  3Q2T C;  5K20 B;  2EBG A;  4OYZ A;  4NLT A;  4QIV A;  2CPD A;  1XNR J;  3M8W A;  4DZ6 A;  4CO2 A;  3HX9 A;  3JTN A;  4HAC B;  4XAK A;  2FVR A;  2ZOF A;  4U7U K;  4ED1 A;  1LW2 A;  3M2U A;  3R6L B;  3KLI A;  1U1L A;  5JUM A;  1RK8 A;  1CJT A;  2Y0S D;  4DPY A;  3LW5 C;  1YJW S;  2IAJ B;  3A3O B;  1V6H A;  3UNY A;  2OJ3 A;  3CCT A;  1GMU A;  2EG1 A;  2D41 A;  1HNV A;  1MML A;  2KXH A;  1S1W A;  3PFE A;  3PR5 B;  3MFH A;  4K5R A;  4F4A A;  1N56 A;  3SIP B;  3PAC A;  1S6Q B;  4KC5 A;  2UVR A;  5GAG U;  5HK4 A;  3G6X A;  1HR0 J;  3MMA A;  2KZZ A;  1SKW A;  1R0A B;  2W24 A;  3CJT A;  1F2G A;  4BHQ A;  3SCL E;  2LEP A;  3Q8Q B;  4ID5 B;  3NBP B;  3TVK A;  4HT5 A;  2XO6 A;  2DGU A;  3FEY B;  5KFS A;  3NL0 A;  3BKT A;  5B0G A;  4AXJ A;  3QGP A;  4LQ3 A;  4PAA A;  2JEF A;  2XWY A;  3PYG A;  1U2C A;  1LXJ A;  2BVZ A;  1B99 A;  1S10 A;  5IT4 A;  3ZNU A;  3PX4 A;  3QT5 A;  2B8P A;  5A6W A;  1IKY B;  5EHH A;  1O51 A;  4IRC A;  3IWL A;  3PIP Q;  5F41 A;  2MQQ A;  4LF2 A;  4CNZ A;  3GR0 A;  2RKI B;  1UMJ A;  5DG8 A;  3QRP A;  4LSN B;  3H42 A;  5E0O A;  1WSR A;  2YNI A;  2N7C A;  5J2M A;  1M5V C;  2ZZT A;  5M2R A;  3V6D A;  4U7C A;  1UWB B;  2G4B A;  3R3T A;  4N56 A;  1HBU A;  4ZCM A;  1FK9 A;  4HHH A;  1AZS B;  1RT6 B;  4IDK B;  2D3O R;  4PXC A;  4NXN F;  2QO3 A;  1JLQ B;  3DI6 A;  3EM1 A;  2E5L J;  1HQ2 A;  1YBA A;  1ZAV A;  1RWK B;  1T03 A;  2I2Y A;  4AT1 B;  3SMZ A;  2QJ3 A;  3A8J A;  1O6X A;  4CTA A;  2JEG A;  2Y9H A;  3RAM A;  2R7S A;  1EB0 A;  1RT1 A;  2ZH6 A;  2HHV A;  2WB4 A;  4YN3 B;  1FJ7 A;  4FF1 A;  2HIQ A;  2P9E A;  4D3H A;  1SIZ A;  2WW8 A;  3AH6 A;  4URQ U;  1JLB A;  3UFC X;  5HLF B;  4DXL A;  1RDR A;  3D54 A;  3PY8 A;  2AEJ A;  2MSS A;  4USW A;  1IBM F;  3LP0 A;  4LRA A;  5D78 A;  3TNV A;  2Y3Y A;  5E3R A;  2PII A;  3A8I A;  1XBW A;  4LRC A;  3MAH A;  2FYX A;  4YDD B;  4ZLL A;  2YXL A;  2JVO A;  3NEK A;  3PRB A;  3GV5 B;  2L48 A;  2E5G A;  1P27 B;  3M1V A;  2F8H A;  4ES3 A;  1FKO A;  1DTQ B;  1YJ9 S;  3CF5 Q;  5A8W A;  1R43 A;  4UOC A;  3IP0 A;  5BYR A;  2HVE A;  3DXB A;  3W2V B;  1EIY B;  4E2F B;  4KKO A;  1N88 A;  4EZ9 A;  2M52 A;  1XR7 A;  2FLN A;  1FD2 A;  1HHQ A;  5ITH A;  4Y2I A;  2XS2 A;  4DF4 A;  5BR8 F;  1CS4 A;  1RHR B;  2XSJ B;  4Y28 C;  1RSC A;  4I6W A;  3KWM A;  2GQ2 A;  4PZV A;  4NYZ A;  2I0X A;  3KUG A;  3MPD A;  1N5V A;  4FF4 A;  1QAI A;  3BQ2 A;  2W4C A;  3GYG A;  1TL1 A;  3QRR A;  2J7K A;  4G1Q B;  3E01 A;  3KDN A;  3R7B B;  5ETL A;  4DL0 C;  3MM7 B;  1EKR A;  2DY9 A;  3MEE A;  2VFU A;  3ELH A;  2DKO B;  1AUD A;  2LXU A;  3KK1 B;  3UN3 A;  4E8U A;  5SZT A;  4DL2 A;  1V3S A;  5H9E K;  1R6Y A;  1WC6 A;  2E44 A;  2W9C A;  1UVM A;  3PDN A;  2C22 A;  2MQM A;  3OW2 R;  1CQN A;  2G0C A;  2DD8 S;  4DUT A;  2N82 B;  2BQ3 A;  2KXF A;  4X84 A;  5H9F J;  1RT7 B;  1HNZ F;  1JMT A;  2J8A A;  2B7B B;  4OQJ A;  3TUP A;  5D8H B;  4MKA A;  3OVS A;  3CSK A;  1NK8 A;  1GXT A;  3DKD A;  1UVL A;  4R0E A;  3CED A;  1QAY A;  1ZH5 A;  2XMA A;  2W2Q P;  5HSP A;  4RW7 A;  3ZZY A;  4ZLN A;  2HVI A;  2UXB F;  3V6J A;  1N6Q A;  2QL7 B;  3R5D A;  4DL4 A;  4QZV B;  1Q4R A;  1RHQ B;  2W4P A;  2HMI A;  4F4K A;  1VQO S;  2DGO A;  3QPI A;  2V2Z A;  2R8K A;  2DYA A;  1BQM A;  3T5J A;  2OPQ A;  4O44 B;  1HNW F;  1BMQ B;  2FJX A;  5CYM B;  1HBM B;  1EET B;  2V2K A;  1V9O A;  1VRU A;  4UZC A;  3UVJ B;  1YWX A;  2QLF B;  5CAB A;  5KFM A;  3DOL A;  2GW8 A;  2WHO A;  3SXL A;  1VQM S;  4DFM A;  4OJG A;  2KVQ E;  3AA8 A;  2OPS B;  1FF2 A;  1CQM A;  1KVK A;  4DV5 F;  2IPO B;  3VZI A;  1K9M T;  2XI2 A;  3PR4 A;  3BKU A;  3QT6 A;  2AP6 A;  1S4F A;  3C46 A;  2DNQ A;  4B3S F;  3AD7 C;  1U2R A;  1RAG B;  2J8S A;  2GS8 A;  1RCO B;  3PFO A;  5GAD U;  1Y0H A;  1IBK F;  3ET6 B;  3SFG A;  2XMK A;  3KK3 A;  3D3B J;  1URR A;  4FVM A;  2LDI A;  4C6A A;  3L4B C;  1AT1 B;  2XM3 A;  3SQO P;  5ETN A;  4PUO A;  1KON A;  4MFB A;  2EK6 A;  4HLB A;  4ZPW R;  1KLM A;  2BAC A;  1FCA A;  3PM9 A;  5KG5 A;  3SFU A;  2B5J B;  4DJB A;  2JSX A;  2UP1 A;  3G9C A;  4URG A;  3QFW A;  1C1B A;  3B6B A;  1R27 B;  4LF8 J;  1RKJ A;  3PJ9 A;  4OYM A;  4OYB A;  5F9N A;  4KH1 B;  2OEK A;  2RHS B;  4CT9 A;  4P7V A;  5KT2 A;  2J7U A;  1NJZ A;  2ZE2 A;  5LXY A;  4YB5 A;  2HHS A;  3BGL A;  3E3X A;  2UUB F;  4UOH A;  2KO1 A;  2M7S A;  1YLX A;  3HD1 A;  5HJY A;  1QSS A;  1HPZ A;  4KHR A;  2E1M C;  1JLF A;  2IVM A;  2AGQ A;  3T1H F;  2WCX A;  3MOZ A;  3ENA A;  4K4Z A;  3L7P A;  3TEG A;  2HHU A;  1TUW A;  2I1R A;  5MLC V;  1KTV A;  3Q2S C;  2YKM B;  2YWF A;  2RIL A;  2JEJ A;  2F63 A;  4IYQ A;  3JSM B;  2M4M A;  4CLY A;  1JLE A;  4P72 A;  3KLF B;  1CBK A;  2P2C B;  4NL5 A;  1J27 A;  5CHC B;  4WFY A;  1SJF A;  1XIQ A;  2ZUA A;  4X4R A;  2A2D A;  2K7J A;  3EUN A;  4ED6 A;  5K9F A;  1K47 A;  3KLE B;  1GMW D;  1TL3 A;  1VRQ C;  1Q81 T;  3JTP A;  2FC9 A;  1HR0 F;  1FKP B;  3IRX B;  2JNJ A;  3X1L B;  3AT1 B;  3Q8R B;  2OSQ A;  5KFP A;  4PG4 A;  1RBA A;  1YJV A;  4I4B A;  4DX5 A;  1LQ9 A;  1K8A T;  5D0E A;  2X7I A;  1C4C A;  3NGK A;  5CQG A;  2LCW A;  2GAG C;  2RH3 A;  5HP1 B;  4E0D A;  4IOC Q;  2R7W A;  2IC3 B;  1NME B;  1ZA1 B;  4F4W A;  4DQS A;  2HEK A;  4N5S A;  2I5J A;  4P75 A;  3R2C J;  3C6U B;  3TJA A;  2FC8 A;  1S0M A;  1X5T A;  2XY6 A;  1KVJ A;  1WKK A;  4JUZ A;  2XTJ P;  2V9K A;  3ZXW A;  1CJU B;  2GVZ B;  2M2B A;  4CH1 A;  1RT4 A;  4MKY A;  2AW0 A;  1ZTT A;  1PAE X;  3MWB A;  2RB7 A;  3PJX A;  2ZHA A;  3LAK A;  3MMB A;  3J81 Y;  3ONQ A;  3OXG A;  2C2R A;  2BUN A;  5HJX A;  3C8Y A;  3UN5 A;  3CTR A;  4MYU A;  2MY7 A;  3IGV A;  2C2D A;  4DUY F;  1OQ6 A;  2QN6 B;  2E1A A;  4U7U D;  4Q8E A;  3D1H A;  2VQF F;  1UJ6 A;  5FJ4 A;  2LDY A;  3LGM A;  1RAD B;  2HRT A;  2RDD A;  3BBF A;  4NAS A;  4O4R A;  3VQS A;  5I3P A;  1SCJ B;  2M3D A;  2OTJ S;  1NXI A;  3M30 B;  1S49 A;  3HLU A;  2XYG B;  1WEY A;  1PBU A;  4O3Q A;  5IZH A;  2E29 A;  1CG2 A;  5H9E J;  2HSE B;  2J0W A;  2DIT A;  3TAR A;  1TMM A;  3GON A;  2OFH X;  5L46 A;  2E7V A;  1PGZ A;  4RNO A;  4ZDN A;  4FBT A;  5IT9 U;  2BV3 A;  4OFZ A;  3RAQ A;  3C16 A;  5GMD A;  1YVF A;  4NLV A;  2IBO A;  5KFI A;  5T7L A;  2YNF B;  3OSP A;  1TVR A;  3SQG A;  4IG0 B;  4C8N A;  2W9B A;  1D09 B;  2YWE A;  1BWV A;  4WFZ A;  3MAA B;  2ZWO A;  2VG5 B;  1S5Z A;  1X4C A;  4KFB B;  4ZN1 A;  1NND A;  2J9D A;  3A4T A;  3HKW A;  2QYG A;  3TJ8 A;  4PQU A;  5CH7 B;  2AGP A;  1I6J A;  4DCJ B;  4NE9 C;  3BS9 A;  2ZD1 A;  1X4A A;  3S8S A;  3OHB A;  4C3K A;  3OV7 A;  2XBP A;  5DZ7 A;  1DQ9 A;  3VHQ A;  1EAR A;  2NUH A;  5CCM A;  2OKQ A;  1S7I A;  1MWQ A;  1U0S A;  2JZ5 A;  1LV5 A;  5AJ3 F;  4HTI A;  3MUM P;  4F4Z A;  1ZPV A;  5KFC A;  2VV5 A;  2DGV A;  1ACM B;  4TN2 A;  1RHK B;  4ZK7 M;  1P9Q C;  4F04 B;  2WB1 D;  2MEW A;  2HZC A;  4H54 A;  2CQB A;  3Q89 A;  1RWU A;  4MK7 A;  3QAE A;  2RD5 C;  2YKA A;  2MLZ A;  1GMW A;  4LFC F;  1T3N A;  3CDB A;  1WC3 A;  2HBY B;  3N4W A;  2JC1 A;  2CJ9 A;  3MTK A;  1UPP A;  2AZ3 A;  4QR2 A;  2HS4 A;  4OZ2 A;  3DCA A;  3RW6 A;  4USM A;  1UET A;  2PDA A;  4DSJ A;  3NAI A;  4CLS A;  1Z4U A;  1MN9 A;  4RR5 A;  3EZ5 A;  3ISN D;  2XLK A;  5ETS A;  1N52 B;  5D4L A;  3IXQ A;  1MNE A;  3MEC B;  3QYY A;  4BCA A;  5E3Q A;  4J9K A;  3A3N B;  3J80 U;  1Q5V A;  2V8D A;  1CC7 A;  4DL7 A;  3EWG A;  4OZ3 A;  2XZT B;  1EQM A;  3BGR B;  3T1A A;  5J1E A;  1U48 A;  2E9R X;  4ZP7 A;  2YNG A;  3L7O A;  4Y2M A;  4EU0 A;  1XC9 A;  4YY3 F;  5GAG I;  1Q95 G;  3HSD A;  1TFW A;  4ZS6 A;  3QWP A;  3W1Y C;  4IG3 B;  5I3U B;  4DR1 J;  3M8P B;  2UUC J;  5DS7 A;  1ZPW X;  2PFF B;  2IRY A;  2V50 A;  3CD6 S;  1UZD A;  5KT5 A;  3M8Z A;  4WTY A;  4DPX A;  4ELU A;  3CIM A;  4QYR A;  5EX3 A;  3KJQ B;  4G6V B;  3CJK A;  1U2F A;  5HAN A;  2XNQ A;  4ZVP B;  2H5J B;  4M5K A;  1U0H B;  3JQJ A;  3SDE A;  4NLO A;  4UUX A;  2XEX A;  3K5P A;  4HAC A;  5KFK A;  4WZM A;  2DHA A;  4X4Q A;  1FX2 A;  3NAH A;  5JXS A;  1DLO B;  1HNI A;  3QWU A;  3D4J A;  2YWH A;  2HHT A;  1OSD A;  3FCV A;  4C8Z A;  2IAJ A;  4QWC A;  3W60 A;  3UR0 A;  1Y5N B;  3TUI C;  2K3I A;  1Q1K A;  3TQ1 A;  2KI2 A;  3M32 B;  2HND B;  2UUA J;  1UEV A;  4Z2X A;  3UN2 A;  2ADC A;  4N8N A;  3IN5 A;  1S6Q A;  1IN0 A;  4DG1 B;  2VU5 A;  2DNO A;  1IKV B;  4DWI A;  4NOH A;  4Y65 A;  2G2O A;  3MHY A;  4IQX A;  3RUB L;  4Q2L A;  8AT1 B;  2ZUG A;  4X65 F;  1R0A A;  2H51 B;  2MZT A;  3D6M B;  2RQ4 A;  1FFW B;  2B43 A;  2L08 A;  4UOF A;  4ID5 A;  1NK6 A;  3NBP A;  4LMZ A;  1E6Y B;  5FLX Y;  2E1C A;  2CPH A;  2C3O A;  5CZV A;  2CNL B;  3G2X A;  2C28 A;  3ZTO A;  3TZZ A;  2RRB A;  4LF8 F;  2J9C A;  1HD1 A;  1BUX A;  2UV8 G;  1I3O B;  4DSL A;  3GV7 B;  4I6Y A;  2ZZM A;  1R31 A;  4YP3 A;  4B3T J;  4RU2 A;  1U1K A;  1S9G B;  4X4P A;  4GMK A;  1KFD A;  1GTE A;  3OLA A;  2MB0 B;  2RKI A;  2G13 A;  1RTI B;  3B82 A;  1ZM4 A;  2MHN A;  4L3K A;  4LSN A;  3MOJ B;  3VAK A;  4CQ1 A;  1F2H A;  3ITH A;  1R89 A;  3KJV B;  4RLE A;  3F0N A;  1VBK A;  2DNZ A;  1NB2 A;  3FBF A;  3BF4 A;  2PI4 A;  1YBU A;  1UWB A;  4NLD A;  4K2J A;  5J2P B;  1HMV B;  4I0W A;  4NLY A;  3RR8 A;  4ANE A;  5HMZ A;  1U45 A;  2YQ0 A;  2MQP A;  1VBX A;  3C6T B;  1TKX B;  1AZS A;  1L3V A;  4FYX B;  4ZPD A;  2C3M A;  2M8H A;  1RT6 A;  2BKO A;  3K8V A;  4WFA Q;  5FDL B;  3UWT A;  2R8G A;  1JLQ A;  1HQU B;  3Q8P B;  2CIM A;  1RTZ A;  3MM5 A;  1S99 A;  3TZY A;  5M2P A;  2NSB A;  4PR6 A;  1S6P B;  3R6G B;  7AT1 B;  2EC2 A;  3H5S A;  3G4S S;  2PN6 A;  2AJ4 A;  3QID A;  4H4K A;  2ACY A;  2KM8 B;  4B3O B;  4FYY B;  3PX0 A;  2QGF B;  4EYI B;  5HLF A;  3BSO A;  2BA9 A;  2GMJ A;  4DR5 J;  3GII A;  2HHQ A;  2RJZ A;  2ZBQ A;  1KD1 T;  1FJC A;  1HWK A;  2CQC A;  4CWB A;  3QO9 A;  2B9E A;  1KEK A;  3GJS B;  3WC0 A;  1LWF B;  2E7X A;  1LFW A;  3TEH B;  4PYD A;  2NQP A;  2VIH A;  2DH9 A;  2GC8 A;  1YDL A;  3CD7 A;  4HI1 A;  3FMB A;  1RA6 A;  1RAI B;  2WOM B;  1N32 F;  4C9D A;  4CYU B;  4I7F B;  5L1J A;  1I51 B;  4DX6 A;  1G7C B;  1TEL A;  3KG0 A;  4IFY B;  3TWZ A;  2WZ1 A;  5HO4 A;  3GJQ B;  2ZNZ A;  1VQK S;  5C2C A;  3DGP B;  3H25 A;  4NLG A;  3W2V A;  1FJG J;  1YZ6 A;  2B7C B;  2GJI A;  1H7X A;  4Y34 A;  6FDR A;  4QPX A;  1DZ5 A;  4P10 A;  3CDE A;  5AE3 A;  1K0V A;  1T8E A;  2UUW A;  1BXN A;  2COL A;  4WXW A;  1NPK A;  2XSJ A;  2F4V J;  1IQT A;  4LSL B;  3VAJ A;  1OY6 A;  1HI0 P;  3D67 A;  2JC0 A;  4HH1 A;  2A3J A;  4AUK A;  4NRT A;  2R7X A;  4DR3 F;  1Z2Z A;  4JI1 J;  2NPI A;  4YB6 A;  2POK A;  2NR0 A;  9RUB A;  5EGY A;  1PG5 B;  1A9N B;  3KDO A;  3JAM Y;  4G1I A;  2L9N A;  3J7Y I;  3MM7 A;  5AXL A;  4KGX B;  4ZVU B;  4USJ C;  1RKI A;  2CZ9 A;  1B64 A;  4LBH A;  3CCU S;  3KK1 A;  3Q8V A;  1S1X B;  1IJF B;  2XMU A;  1RBL A;  2ADB A;  1KQG B;  2HNZ B;  2ZM6 F;  4CH0 S;  2W9A A;  1VOM A;  5AE1 A;  1RT7 A;  3OJU A;  1U1P A;  1NSQ A;  4OHZ A;  3TOQ A;  3H8Y A;  2AU0 A;  2ASD A;  3BDE A;  4A8Y A;  1BY9 A;  2OIH A;  5F0U A;  5KG1 A;  4JYA J;  1MU2 B;  4YR0 A;  3HKZ D;  1HNX J;  5GMK a;  4F8R A;  4F26 A;  3AOC A;  2KHD A;  4H4K C;  2AV5 A;  4KQZ A;  1VDH A;  4HVZ A;  4DPW A;  4DR2 J;  2WBR A;  4F2S A;  1OS5 A;  4RBV A;  2LQJ A;  4LVO P;  3OR2 B;  5ETV A;  2OD6 A;  3ISN C;  4EMD A;  1IM6 A;  3QSI A;  2YKO A;  5KG2 A;  1FE4 A;  4DX8 H;  3V4M A;  2HBQ B;  4O44 A;  1CSJ A;  2K7K A;  2C3U A;  4RPF A;  2GIR A;  4UTG A;  2XQC A;  5CYM A;  4P52 A;  4EUV A;  1S97 A;  1QLN A;  5LL6 d;  2J76 E;  3SV4 A;  1EET A;  4DSF A;  2UXD F;  2LLZ A;  1HW8 A;  4DBQ A;  3UVJ A;  3UD3 P;  1AW0 A;  5CZX A;  4L76 A;  3OL8 A;  4M5D B;  2F4F A;  1XMQ F;  2OPS A;  1RT3 B;  2HPU A;  4X4O A;  1QUV A;  4PG6 A;  2KVI A;  3P96 A;  4WYL A;  2VB6 A;  1F0X A;  5GAE U;  2HUR A;  4QU7 A;  4J9R A;  2XMW A;  3NCR A;  5IS2 A;  3AOD A;  3EGN A;  1TKD A;  3HVR A;  2G0J A;  3PW2 A;  3ICL A;  2ZC4 A;  3ET6 A;  4NYP A;  4QCL A;  2GJ2 A;  2YQ1 A;  2XO7 A;  4OMF G;  5T41 A;  4GVB B;  1OY8 A;  4KH0 B;  3HCX A;  3MR3 A;  4LIW A;  4OV6 A;  2J0S D;  2GML A;  2XS7 A;  2EPI A;  3U1N A;  1AYE A;  4R25 A;  3PW4 A;  3BSC A;  1M90 T;  2EKY A;  2NYH A;  2LYV A;  3T3F A;  4QIE A;  4DHV A;  3OR1 B;  1Y00 A;  2ASL A;  3CCE S;  1FXL A;  2IA6 A;  4J9U E;  2OI2 A;  2G2Y A;  5L9N A;  6AT1 B;  4LF6 J;  1Y10 A;  3KLI B;  4NCG B;  1UVI A;  4RW9 B;  4KE5 A;  1V5V A;  2E9Z A;  2FLP A;  2GO9 A;  1RWN B;  2GJF A;  4TU9 A;  4CLF A;  4CO3 A;  2HGL A;  3I96 A;  4TQR A;  1S6O A;  4WWS A;  2ZVS A;  2J0Q D;  2OUG A;  1FER A;  2FJA B;  4X4S A;  3TA2 A;  2QIF A;  4NI2 B;  5DGA A;  2KHC A;  3I4H X;  3JSY A;  5GAH I;  2HFV A;  5LJ3 Y;  5HAO A;  5DDR C;  5DQI A;  3NXZ A;  2KYX A;  1RWP B;  3JSM A;  4O0I A;  4X62 F;  4CLW A;  3FUY A;  1UKU A;  3KLF A;  2JLF A;  2IA0 A;  2P8I A;  5HMW A;  1NCL A;  4QBU A;  1SKU B;  4PKD B;  4QJV A;  3FRY A;  4F2R A;  5IV4 A;  2W8L A;  3LGH A;  2DXF A;  3CCW A;  2BEF A;  3WX4 A;  4LF5 J;  2Z0G A;  2DGQ A;  3DHX A;  3H0P A;  2HRY A;  2IFX A;  1Q16 B;  4CLT A;  3SSR A;  1FNM A;  4P2S A;  1NJW A;  2YNI B;  2NRE A;  1F3V A;  3PG9 A;  1I1G A;  1PYO B;  2JJ4 D;  1EKS A;  4PPD A;  2WBM A;  4KO0 A;  1RZM A;  5HP1 A;  3I0S B;  4I69 A;  3VVT A;  4X4V A;  4WPA A;  4UY8 T;  2IC3 A;  3K5O A;  3CC2 S;  4B3T F;  4TY8 B;  3C6U A;  4PAB A;  3DLK B;  3T1Y J;  2AJ0 A;  2JL9 A;  4DI6 A;  4N77 A;  4JI2 F;  2DR6 A;  4O0N A;  3NG8 A;  3DI6 B;  1OWX A;  5L1K A;  1CJU A;  3GYN A;  1T03 B;  2V34 A;  1S4E A;  1GEH A;  2ZEJ A;  1GAO A;  5RUB A;  1KSP A;  2DXD A;  2XMJ A;  4WF9 Q;  2C2Z B;  3ETO A;  1N36 J;  2PE8 A;  4NLP A;  4B3R F;  2P9G A;  3DM2 B;  2QSF A;  4M5J A;  2B8Q A;  2HHH F;  3M05 A;  2V8G A;  3PVX A;  3LP2 B;  1RAH B;  3P49 B;  2YKP A;  4CRJ A;  3H4D A;  4K4S A;  3I31 A;  4OHW A;  3TP2 A;  1G1X A;  4I2P B;  1H6K X;  3BQ1 A;  4C98 A;  1YZ7 A;  3O44 A;  3OPK A;  4WZQ A;  1HYS A;  4QPT A;  4DOZ A;  1YJU A;  3I9V 9;  5G4D A;  2DR8 A;  3UW1 A;  1NH8 A;  2DNP A;  3TAQ A;  1VK3 A;  3M30 A;  5DM6 Q;  3HVW A;  1D8Z A;  4I68 A;  2AEF A;  3FZ2 A;  2QT7 A;  2YKQ A;  1I94 J;  5A8W B;  2CQD A;  5KFU A;  2RF2 A;  1N4L A;  2IJF A;  4DV6 F;  1W2I A;  2LFV A;  5KT7 A;  3VAM A;  1T9W A;  4KB7 A;  3DDI A;  3IS9 B;  1NRK A;  3HUL A;  4DR5 F;  3LH2 S;  1YRT A;  2VL1 A;  2HFN A;  4QR1 A;  3IBF B;  4DV2 J;  1CS4 B;  1TR0 A;  4ZKA A;  3D6F B;  3OFG A;  2MY8 A;  5DG9 A;  3QGH A;  2HLU A;  3AY0 A;  2YNF A;  2RT3 A;  4IG0 A;  3TR5 A;  1DUR A;  2B4V A;  2VG5 A;  4KGV B;  4CP5 A;  1TL1 B;  1TKT B;  1EZZ B;  1Y5I B;  4AQY J;  4DR6 F;  4QW9 A;  4C0B A;  2HQG A;  3BQ0 A;  1WDD A;  4QWD A;  1FE0 A;  2YWW A;  4OI6 A;  4L74 A;  1S1U B;  5LT5 A;  3KTQ A;  1F9H A;  3OJS A;  3BBC A;  2ROE A;  2DNH A;  1R8B A;  3TUZ C;  1WDT A;  2HAI A;  3MM8 B;  2MQO A;  4V19 J;  1LWX A;  1NM2 A;  1OSC A;  3J7A N;  1KBR A;  3ZZZ A;  4F7V A;  4P2F A;  2DBB A;  2J6T A;  2D3O 1;  2B51 A;  3Q23 A;  4B9S A;  4TKT A;  1MWZ A;  5JVG Q;  4JI1 F;  3CCS S;  3H59 A;  4DFP A;  2MKC A;  1IBL F;  4PG5 A;  1FDN A;  4DS5 A;  2FHM A;  3I9Z A;  1GXU A;  4J9Q A;  1S59 A;  4ICL B;  4B08 A;  2DIV A;  2HK3 A;  1PJ7 A;  5I42 B;  4LFB F;  3MDF A;  2BKN A;  4WFN Q;  3CJ2 A;  3W9I A;  1SC1 B;  3NNH A;  2W25 A;  3GCX P;  4ZVT B;  4NXM F;  2I6W A;  1U26 A;  1F60 B;  3VQT A;  1U6B A;  2AX0 A;  2MZJ A;  5CA5 A;  3MEC A;  3MXH P;  5KFA A;  4B9T A;  2MGZ B;  2ZH8 A;  3X3U A;  2MKH A;  1K1Q A;  4F0M A;  2FGO A;  2ZH7 A;  3QJP A;  2CQ1 A;  3EX7 B;  2VOO A;  2V4J A;  2R8J A;  3T6J A;  1AUS L;  2MPU A;  4OZ5 A;  3BGR A;  4OI0 A;  1NK9 A;  2IDL A;  4Y2K A;  3E51 A;  3W65 A;  5CCL A;  2ZJQ Q;  4WKY A;  3QAT A;  4JV2 A;  4DQQ A;  5I3U A;  3M8P A;  4JI8 F;  2BJD A;  2WON A;  4ZVQ B;  2HBZ B;  2QL5 B;  1PYS B;  4RWX A;  1X9W A;  2R8H A;  2B9W A;  1T9X A;  1SQG A;  4XDC A;  4CLL A;  4OZJ A;  2PGC A;  4OHX A;  2BQR A;  3I56 S;  1S76 D;  1MRO B;  1VLO A;  3WDO A;  4DR7 F;  1VFJ A;  5LSL A;  2MHE A;  2NXC A;  2MDA A;  5DG7 A;  3DOK B;  2BAN B;  1PC4 A;  1RWX B;  3C15 A;  1Q8L A;  4J9O A;  1D1U A;  2R7T A;  2JHE A;  1N8R T;  2RRA A;  4JI4 J;  2N3L A;  2EC0 A;  3M32 A;  1QY7 A;  3HHD A;  2HND A;  3W64 A;  1VQN S;  1UEU A;  1NZ8 A;  3RZA A;  2DNL A;  4J37 A;  3WZ0 A;  4ZJO A;  4DG1 A;  3W5Z A;  1ARO P;  4RNH A;  3MM6 B;  1IKV A;  2XLI A;  3CCL S;  3WX8 A;  2JOQ A;  5J2N A;  4WK1 A;  1HPZ B;  3MED B;  1TUG B;  3NOC A;  3R5C A;  5HVH A;  3RW7 A;  1Q8I A;  5AXN A;  1TK0 A;  1TL7 A;  4PPZ A;  3UDL A;  2U1A A;  2L9D A;  4YR2 A;  5DDO C;  4EFA C;  2VFT A;  4LF4 F;  1E6Y A;  2JEI A;  2R2R A;  4OLO A;  4OZN A;  3EJM A;  5D77 A;  1R8C A;  2Y8W A;  2D7S A;  3L9Z A;  3NWG A;  1JXV A;  2BRK A;  2GAH C;  1QSY A;  1Y7P A;  4EZ6 A;  2OEJ A;  2QV6 A;  1FXD A;  1T11 A;  3M2R B;  4PWW A;  3U1M A;  2H1Y A;  3IG1 A;  2UXC F;  4X4N A;  1S9G A;  1VIS A;  2JFK A;  4IOB A;  2IM1 A;  3MR2 A;  3H5X A;  2KB2 A;  1C0T A;  4F4X A;  1BWE A;  1R6V A;  1M1H A;  5CYQ B;  1R7I A;  1VQ5 S;  3WIU A;  4OJH A;  4GKJ J;  2DRB A;  3KJV A;  2KDO A;  3DN9 A;  1FD8 A;  2YWG A;  3H7H B;  2E1R A;  1S12 A;  3OHA A;  2FY1 A;  5J2P A;  1HMV A;  2LVW A;  1WOO A;  4KPY A;  4ZCL A;  3B78 A;  2AJQ A;  1UA0 A;  3RB4 A;  2FDN A;  1PAU B;  4H4O A;  1FRL A;  1S1T A;  1FTC A;  1FKA F;  3POT B;  4Q5V A;  5DO2 A;  4FF3 A;  3DRP B;  5FDL A;  2HWT A;  4LF5 F;  1FRJ A;  2WTF A;  5K8P A;  3HD2 A;  3BN4 A;  1GXL A;  2QC3 A;  2Q1L A;  2DCU B;  1FT8 A;  1EQ0 A;  4DQP A;  1TQL A;  2YVS A;  5EWG A;  1KR4 A;  3I6P A;  3VTI A;  1RT4 B;  2DH7 A;  4B3O A;  2EI5 A;  1TL4 A;  4XK8 C;  4QOT A;  3FNN A;  2ZOM A;  1NZA A;  1B0P A;  1KWM A;  2VG6 B;  1TV6 B;  1RLC L;  1AA1 B;  2DGS A;  2CPX A;  4ILM A;  3GIJ A;  4XDD A;  2ALZ A;  1IWA A;  1LWF A;  3JSR A;  3T1Y F;  1H2T Z;  3KLH B;  4RKU C;  3NP5 A;  3W61 A;  3IWX A;  1Q5Y A;  4DV1 F;  4RNM A;  2OTL S;  4YHH J;  3H2V E;  4QWE A;  2B9Y A;  2C3P A;  4U6P A;  3OXF A;  2LU2 A;  2WOM A;  4CYU A;  6FD1 A;  4USI A;  4IFY A;  1N5Y A;  2FB0 A;  1VR6 A;  3LUY A;  2UVV A;  1MMD A;  3Q24 A;  3KUH A;  2D9O A;  3NNA A;  4QR0 A;  3GG0 A;  1S79 A;  3IAM 9;  4L75 A;  4C8Y A;  3D66 A;  3MUV P;  1SV5 B;  4A8F A;  1RWV B;  1LK7 A;  3S7R A;  3CO9 A;  3BR8 A;  4LFA F;  3PW5 A;  1B7F A;  4DLG A;  4LSL A;  1GH8 A;  4K50 A;  1YJ7 A;  3CCJ S;  1JQG A;  1N33 J;  2FD2 A;  2R4F A;  1WUU A;  1YRX A;  5KT6 A;  3A13 A;  5C2G A;  2BQU A;  3AB4 B;  3E2E A;  3OFF A;  1Q8K A;  3DDN A;  3VF0 B;  2BRL A;  2OH2 A;  2RAQ A;  3F44 A;  4I6A A;  1UVN A;  4WII A;  1L3T A;  2BR0 A;  4NPO A;  3NGS A;  1XNQ J;  1J2V A;  5KOW A;  4O3R A;  4PQU B;  2UVU A;  5KFX A;  2VQE J;  3UD5 A;  2OGU A;  4X2B A;  4W92 B;  2Y1I A;  2GGP B;  2LKZ A;  3I5B A;  2ZD1 B;  1S1X A;  3RB3 A;  3FC9 A;  2BW2 A;  2PSZ A;  3KMS A;  3JYT B;  2GZO A;  2HNZ A;  4BC7 A;  4UQT A;  8ATC B;  2ZKU A;  2GCF A;  1IQZ A;  3L3C A;  4JI3 F;  3R5G A;  4CLK A;  3VGS A;  3HMJ G;  1RBO B;  3W2W B;  2UU9 J;  2GNK A;  1G3O A;  1H2V Z;  2HK2 A;  1CJV B;  2K1R B;  3GQC A;  2RS8 A;  2DPJ A;  1QSL A;  4AQY F;  3PO4 A;  3GFH A;  3PYD A;  4B9N A;  1Y4Z B;  1MU2 A;  3DDK A;  2RS2 A;  2YPZ A;  4NA2 A;  3J7Z 5;  2ATC B;  2OAU A;  4ZLJ A;  4HDG A;  3KK2 A;  3OR2 A;  4OX7 A;  3BH6 B;  4NA3 A;  1SB6 A;  4TVA B;  3MCM A;  3NOG A;  1ZM9 A;  1SQF A;  2MZ1 A;  4KHM A;  2I8E A;  1IVZ A;  2IBK A;  5ETQ A;  3THV A;  3I32 A;  4CCH A;  4KR0 B;  3PHT A;  3UPF A;  3TX8 A;  2PFD A;  1LWC B;  2QLX A;  3R7S B;  4M5D A;  2J0X A;  3CXC R;  1TTH B;  1RT3 A;  3RU0 A;  5D3G B;  4LR9 A;  3J7A 1;  4JI5 J;  4D3G A;  2FHO B;  2PEB A;  4FDF A;  3K17 A;  5J1E B;  2CQG A;  2XG8 A;  3VCD A;  3K5L A;  3N6L A;  2KJV A;  1UWA A;  3LGN A;  3IGN A;  2NPF A;  3AHP A;  4ELT A;  5DGB A;  1YGY A;  1RHU B;  3TX0 A;  5LSO A;  1G2E A;  4OYO A;  4NEY A;  5DLF A;  3RBE A;  5KT3 A;  3BGO P;  3OTO F;  4FYD A;  3I5C A;  2ATL A;  2YQ3 A;  4F0K A;  3MZI A;  5CYJ A;  3OD2 A;  2RQC A;  4YME A;  4UOG A;  5KFD A;  1F5A A;  3SDE B;  3RTV A;  2MQL A;  2CDQ A;  1M0S A;  3OR1 A;  4LSZ B;  4GKK F;  3FSX A;  4ES1 A;  4NCG A;  1HNI B;  4RUA A;  2DY1 A;  3M6W A;  4RW9 A;  1KDN A;  1ICE B;  4M95 A;  1U49 A;  4ZLP A;  1MSW D;  3SYZ A;  1FHT A;  2FQQ B;  2MJU A;  4NI2 A;  4DUZ J;  2DRD A;  1N34 F;  3T5L A;  3IM9 A;  4PQA A;  2GIQ A;  2BJE A;  4BDP A;  3HHL D;  2J7W A;  1QUP A;  4ZN3 A;  4DV7 F;  5DET A;  4DV3 F;  1VI7 A;  1CLF A;  1NDC A;  1YJN S;  4ED3 A;  1JJ4 A;  3T41 A;  2IMO A;  5F8L A;  1X4F A;  2GV1 A;  1JLC B;  4JOU A;  5HMX A;  5KFF A;  2ERR A;  2HS0 A;  1DHM A;  2XY7 A;  3CDA A;  3VAH A;  3DOM B;  4QWA A;  3HSJ A;  3LA0 A;  3D2W A;  4OYA A;  4OX8 A;  3GIK A;  1YRU A;  1RWM B;  2XCP A;  1W2B R;  3ZTS A;  2EFN A;  3OQ2 A;  5IQ6 A;  3LTO A;  2CPJ A;  3QMQ A;  7FDR A;  3QJL A;  1SJ4 P;  3ZZR A;  2A1B A;  2H54 B;  2F8M A;  2QFJ A;  4WE1 B;  5KFW A;  1KVI A;  1H38 A;  1BE4 A;  4DV0 F;  4LF1 A;  1UL3 A;  5KFV A;  5J2Q A;  3EGV A;  2MST A;  3ITH B;  4WIQ A;  2VDH A;  4TU8 A;  4IH7 A;  3KG1 A;  4TXS A;  4WK3 A;  5E3C A;  3TUJ C;  5IXU A;  2LQ8 A;  2C1E B;  1WOP A;  2KXN B;  3I0S A;  2H9Z A;  1SJR A;  1FI4 A;  2BJ3 A;  2GX8 A;  3W7B A;  1YJT A;  2EFV A;  4X64 J;  3AXK A;  3OVA A;  4TY8 A;  3BN7 A;  3BYR A;  3DLK A;  5CAA A;  2M9K A;  3MAQ A;  4JV1 A;  1NKB A;  1IM4 A;  3MM5 B;  4G1P A;  5K8O A;  4ZPV R;  1J5O B;  2RSQ A;  5A2Q Y;  1VBZ A;  3HSG A;  2P6T A;  1IKX A;  1UFL A;  1P8G A;  3ZO7 A;  1C0U B;  4EO6 A;  4OYP A;  3FSI A;  3DM2 A;  2J6U A;  2Q3P A;  2HLT A;  9ATC B;  1C2P A;  2A6O A;  4K4Y A;  4M8L A;  1NK7 A;  3LP2 A;  3R2D J;  4Z37 A;  4YB7 A;  5HQM A;  5C5J A;  2KYZ A;  2CNO B;  4ATN A;  4I2P A;  4NLU A;  2MKJ A;  3FQL A;  3D28 A;  1VQ8 S;  1LXN A;  3QO9 B;  5L1I A;  3ZTR A;  3UO0 A;  4DV4 J;  2H4Y B;  1UVJ A;  4DL3 A;  1QM9 A;  3B8H A;  4Q43 A;  5A76 A;  2G9O A;  2HFU A;  4BWM A;  5HQ8 A;  2D3U A;  4ERD A;  2DNN A;  4G3I A;  4QIF A;  1QJH A;  1ROF A;  2O5D A;  3NY0 A;  4ECW A;  2DVI A;  2AX1 A;  2DEJ A;  4PG7 A;  2WVC A;  3I0R B;  4M5G A;  2QMX A;  3IS9 A;  2RNE A;  1RHM B;  2HHP A;  1T05 B;  3C14 B;  4FNH A;  5FII A;  2RU9 A;  1VQY A;  4OI4 A;  4G65 A;  2OML A;  5F8J A;  1HLW A;  1T94 A;  4LR8 A;  5SUH A;  1K44 A;  5KFG A;  4ZP6 A;  3V81 B;  4GC6 A;  3UDC A;  1URN A;  2IYI A;  2CPY A;  1KQF B;  4YHH F;  3Q22 A;  4ZA1 A;  2XUL A;  2Z57 B;  2EFQ A;  1TKT A;  2IMW P;  1F5C A;  1LW0 B;  1HWJ A;  1FVQ A;  4X4T A;  3GFZ A;  3D0H E;  5L8R C;  5A8K B;  2WAQ D;  1S1U A;  2I9S A;  3IWN C;  4DX7 A;  4LF9 F;  4KSE B;  4O3N A;  1CC8 A;  2U2F A;  1LK5 A;  4X66 J;  3VAL A;  1X5O A;  4ETZ A;  3MM8 A;  4N8O A;  1Y3J A;  2VD3 A;  4JI7 J;  4XPE A;  4J9N A;  2UVW A;  4PEO A;  3UCZ P;  3H2U B;  3PXG a;  5F8I A;  3IM8 A;  2IY5 B;  1FJE B;  3EDR B;  1VJQ A;  4OV1 A;  2B0G A;  2KRR A;  5I3Q A;  1NKE A;  3R5J B;  1P9Y A;  3T19 A;  3AD9 C;  3CD5 A;  2XWX A;  1WG4 A;  1NHK L;  4C4W A;  4LBI A;  2AEM A;  4C97 A;  1PJ5 A;  5LMU J;  4RU9 A;  4DR4 J;  1RI7 A;  4ICL A;  1HWI A;  4DF8 A;  4DEZ A;  2VQE F;  2R42 A;  4M1K A;  5I42 A;  4MT1 A;  2EG2 A;  1SH2 A;  3LOU A;  2F9D A;  3IO1 A;  5B0B A;  4NYO A;  1X9S A;  1D9D A;  3HFV A;  1QVF R;  2JVR A;  2V8P A;  1REV A;  3DLG A;  2OP5 A;  5A0Y A;  1H7W A;  3TRG A;  5LMN J;  3EIC A;  2AWZ A;  4BS2 A;  4WP8 A;  2E5I A;  2MGZ A;  3N9U C;  1SUQ A;  2MKY A;  1WTB A;  4MIA A;  3W66 A;  2NYI A;  4OLP A;  4ED4 A;  4NLW A;  1FA0 A;  5KOX A;  4ILR A;  1NO8 A;  4FYW B;  3GMG A;  2C2N A;  3DHW C;  2ZBR A;  1U02 A;  2VKZ G;  4K4T A;  2WK4 A;  1WI6 A;  2JLE A;  2ZH3 A;  4UST A;  3GU0 A;  2QG9 B;  2X1G A;  2R7Q A;  2MTL A;  4AE5 A;  3LAL A;  2DEI A;  4AXI A;  1T9Y A;  3VR1 A;  1WSV A;  4M5H A;  3J81 U;  3AXM A;  1MRO A;  5E2Q A;  3OBI A;  1LKZ A;  2VC1 A;  3GV8 B;  3G8S A;  3MR6 A;  2K06 A;  3K0J A;  3AAW B;  1SJ1 A;  3DOK A;  1FWK A;  2B3T B;  2BAN A;  3B4M A;  4F67 A;  1AB8 A;  3CD0 A;  2DNG A;  1VHF A;  3DRS B;  3H98 A;  2KFY A;  1TU0 B;  1LWE B;  2DGX A;  1J5E F;  4KHP F;  2H48 B;  1HL6 A;  3D0I E;  4DSK A;  3G87 A;  2WSF C;  5B0C A;  2W2P P;  1RYS A;  2K8G A;  4L72 B;  2V8V A;  1PIL A;  1YJR A;  3QGG A;  3HHL C;  4XTT A;  2RDJ A;  2CG4 A;  4K4V A;  2HS3 A;  2XGQ A;  2Y8Y A;  3B4D A;  3MM6 A;  3HFK A;  2F3J A;  3MED A;  2JDJ A;  2X51 A;  3F73 A;  5DRK A;  1SH0 A;  2GO8 A;  1XNR F;  4QIW D;  2ALY B;  1L3U A;  5LJ5 Y;  3HSZ A;  3RRG A;  1VRT B;  4ENO A;  3N6N A;  3THT A;  2PMH A;  3LF0 A;  4QYZ K;  1NU4 A;  1RIS A;  2XZW A;  4M5M A;  2FLL A;  1GNK A;  1YX2 A;  2P5V A;  4EBD A;  2VFS A;  3M2R A;  2ZC3 A;  4NXN J;  3MEK A;  3T9Z A;  5CXT A;  2F5G A;  5T14 A;  2VG7 B;  5FD1 A;  3DLB A;  2R7V A;  2K2P A;  1M5P C;  4P74 A;  2M8D B;  5HQL A;  4FNI A;  3EDQ B;  1I5O B;  2VJU A;  3NS6 A;  2V4R A;  5CYQ A;  3S1T A;  1TKZ B;  2YBV A;  4FF2 A;  4DFK A;  2FHJ D;  3EGW B;  1ITP A;  4F3O A;  4F4Y A;  3LPE A;  4P2X A;  3CJ4 A;  1MG7 A;  1KLN A;  4R8U B;  1OPZ A;  3M8Y A;  1CPZ A;  5EDW A;  1NJI T;  2VPY B;  4USU A;  2CRL A;  4IO1 A;  2VFR A;  4KO0 B;  3G8T A;  3BM7 A;  1WI8 A;  3LP1 B;  4Y00 A;  3UDE A;  3POT A;  5IT0 A;  3A3P B;  3DRP A;  4ZVO B;  1TUV A;  1D9F A;  3P5T L;  1YTY A;  3HJF A;  4YR3 A;  2MQ8 A;  4I67 A;  2GHV C;  4CH7 A;  4ED5 A;  1WHV A;  3BB5 A;  2HVD A;  1FRK A;  5I4M A;  3PIO Q;  4TYA A;  3RRH A;  3SBM A;  3C2P A;  2QE5 A;  3C66 A;  4U8Y A;  4EBC A;  4HR2 A;  3L95 X;  4NMX A;  5K5M A;  1KRP A;  2GHW A;  5BR8 J;  1EHW A;  2VG6 A;  1R0C B;  1TV6 A;  2IVF B;  1S9E A;  4F36 A;  3G86 A;  4HHJ A;  2FVS A;  1M1G A;  3A12 A;  3EVW A;  3KLH A;  4XPC A;  2E5L F;  4RW6 A;  1OPI A;  2V2Q A;  2HIY A;  4L73 A;  2WVE A;  4QIG A;  2XGP A;  1HYS B;  1JJC B;  4ECX A;  2EK1 A;  5GME A;  1WOR A;  2EVZ A;  4RO0 A;  5E7O B;  5KG0 A;  4CO0 A;  4KV8 B;  1RAE B;  2RUS A;  4RZR A;  4WP3 A;  4XIU A;  4TQS A;  2RF2 B;  2KH9 A;  3JSB A;  5KFE A;  4M5L A;  1SV5 A;  5KFZ A;  3KMQ A;  3T9N A;  1QTN B;  1K73 T;  3S01 A;  3NGU A;  4KBI A;  1H72 C;  1ULR A;  3MD3 A;  1HNZ J;  5C42 A;  2X1A A;  3DFE A;  2AF6 A;  4J9M A;  4NRU A;  3DLJ A;  2FGC A;  2ZNY A;  5JVH Q;  2L41 A;  1JLA B;  5HRO A;  2HW3 A;  5IFM A;  1QVG R;  2V6A A;  5KAK A;  2EFO A;  3FFI A;  4HTJ A;  1FFG B;  1U47 A;  2ZHO A;  1RT5 A;  3IR5 B;  1XJW B;  3KXD A;  3MPY A;  3G96 A;  5LXR A;  4LRF A;  3MM9 B;  3BJY A;  1AFJ A;  2GGP A;  1OYD A;  3KHH A;  1WNE A;  5D0R A;  3QSY B;  2XYH B;  1HKA A;  1MW7 A;  2UUT A;  4MK9 A;  1XR6 A;  2YKN B;  3BZQ A;  4F3Q A;  3ZZO A;  2QMW A;  2ZFH A;  5EX0 A;  1HNW J; 
#chains in the Genus database with same CATH homology
 4GVB A;  1KP6 A;  4GVB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...