4GVLA

Crystal structure of the gsuk rck domain
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
455
structure length
455
Chain Sequence
APWIERRLRYHPTIELPDDTRGHILIFGIDPITRTLIRKLESRNHLFVVVTDNYDQALHLEEQEGFKVVYGSPTDAHVLAGLRVAAARSIIANLSDPDNANLCLTVRSLCQTPIIAVVKEPVHGELLRLAGANQVVPLTRILGRYLGIRATTCGALAHILDSFGNLQIAELPVHGTPFAGKTIGESGIRQRTGLSIIGVWERGSLTTPQRETVLTEQSLLVLAGTKSQLAALEYLIGEAPEDELIFIIGHGRIGCAAAAFLDRKPVPFILIDRQESPVCNDHVVVYGDATVGQTLRQAGIDRASGIIVTTNDDSTNIFLTLACRHLHSHIRIVARANGEENVDQLYAAGADFVVSNASVGANILGNLLEHKESAFLSEGMAVFRRPLPPAMAGKTIAETRLRPLTGCSIVAIEAPDRADILISPPPETILAEGARLILIGTSEQEKTFDQTIAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct gating mechanisms revealed by the structures of a multi-ligand gated K(+) channel.
pubmed doi rcsb
source organism Geobacter sulfurreducens
molecule tags Transport protein
molecule keywords TrkA domain protein
total genus 134
structure length 455
sequence length 455
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 4gvlA03
3.30.70.1450 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Regulator of K+ conductance, C-terminal domain 4gvlA04
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gvlA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gvlA02
1ONOA 2WYVA 4A2CA 4CQMB 3B1FA 3U4DA 2GGSA 3BMQA 4U0KA 5DOZA 4J1QA 5KJ6A 1QYWA 4YEDA 3I5MA 1YKFA 5F1KA 4UUMA 2H9IA 3A28A 2Y1GA 3SBOA 2Q46A 5ICSA 2BKAA 5CAEA 2GERA 4NFSA 1UDBA 3QQPA 5CDTA 3TF5A 1Z82A 3W6ZA 4LCJA 3FNGA 4OSOA 4R16A 1OI7A 1VJTA 4QUKA 1H6BA 4G2NA 2EHDA 3JQ7B 1IHYA 4DC1A 4Z9YA 4Z0TA 1O94A 4OIMA 5HWSA 3L4BA 1ZJZA 4YJDA 4CM5A 5JY1A 2JKVA 1TA4A 5JFOA 3TWOA 2PZLA 1ZJYA 1DLJA 3BHMA 4BNXA 1MLDA 1KEPA 5I9NA 1TVEA 2Z5LA 2AHRA 4FDAA 3NV9A 4GGPA 1LEHA 1DC3A 1YQDA 5TS3A 1SB8A 5KJFA 3F5SA 2C7GA 5I9MA 1HRDA 1PEDA 4E5PA 3AUSA 3GLQA 4FN4A 4CQLA 1FDWA 1A5ZA 1B3BA 1H6AA 4EUHA 4JQCA 4PG6A 5EIOA 2W98A 3FWNA 3F6YA 3GAFA 2AQ8A 3F47A 3VKVA 1ZK2A 2H63A 4CMHA 5IDYA 4EBFA 1R4NB 1A9ZA 1EE9A 3G0OA 1IUKA 1X1TA 3DONA 4M54A 4NU6A 3FN4A 3A9WA 1XU7A 1RM5A 4CMGA 1VJ0A 3WOHA 3VH2A 2VWHA 5JLAA 2WM3A 2DPHA 3KUXA 3AOGA 4BNYA 1WW8A 1M6HA 3WJAA 3MWEB 3WYEA 4DLAA 2EJWA 2DKNA 5DCYA 1MA0A 1UDAA 2I76A 4D79A 3LT1A 2R6JA 4M55A 4YAJA 1ISIA 2VT3A 3GK3A 3BHJA 1YRLA 4OXYA 3E5MA 4XGKA 5T8KC 2YQ5A 3BMOB 1R0KA 1DEHA 2WD7B 1EK5A 5IXSA 3BMNB 1ZK3A 2SCUA 3HFGA 4WUVA 2YHUA 5T6BA 5G2OA 2PD4A 3WBFA 5CDYA 3I4CA 3ZW8A 1DPGA 4YYZA 3I3OA 3V2UA 4CM4A 2A4KA 2Q1WA 3WTBA 4FGSA 3DDNA 4QFDA 3DEYX 4BKPA 4ALMA 3FPCA 2F00A 4XX0A 1PR3A 4BNJA 1CERA 1DC4A 1UP7A 3JYPA 1PQPA 4HFRA 4BNZA 4RQTA 2GLXA 2VN8A 2VHVA 4R1NA 2ZATA 4TKMA 3H5AA 2I67A 3JQAB 3PFFA 1B8UA 1MFZA 4BO4A 3AFMA 1NVGA 3BMQB 5F3RA 1DIRA 1ZIDA 2UDPA 4D42A 3U3XA 1QYXA 5B37A 1S6YA 4TKLA 2QIOA 3H9GA 1IULA 4Z9FA 1LUAA 3QWHA 1O9BA 1YE3A 3NRCA 2JFHA 3PZRA 3ORFA 2EW2A 4IS2A 1KS9A 2AEFA 3MTJA 3DBVO 3VZQA 2ZJ1A 1NWHA 2BLLA 5TRTA 2EG9A 2WE8A 4Y6RA 1GZ3A 3HDHA 3ZNPA 3UCFA 4I9UA 4IS3A 1WAMA 1ONPA 2C82A 4BGUA 3MJSA 2BGMA 2GN9A 3NAQA 1P44A 5LCXA 3QVSA 4ALLA 5A4DA 3I9OA 5JO9A 3S1LA 1MX3A 4UUPA 1JVBA 1ZSYA 2XPCA 4IDGA 3JQCA 4XA8A 3KEOA 3LQFA 3AW9A 1KVRA 3WR5A 3SC4A 3B70A 4JNKA 1MV8A 4P8RA 3TJRA 1LNQA 4LRSB 2H1SA 4BNFA 1MGOA 4IXTA 1U4OA 3UXYA 1VJ1A 1YBVA 1EVYA 1T26A 1EUCA 2ZYDA 1BW9B 2P68A 4CQMA 2DBRA 1QRRA 1DOHA 3HB4X 4IQGA 4J4TA 1V6AA 4UAGA 4FC7A 1FDSA 2NVWA 4QECA 3H9QA 4QTZA 1GCOA 4XYLA 4ZU3A 4B3JA 5TGDA 3U49A 5HRUA 1CQIA 4J1NA 2O23A 3RKUA 4WASA 3WFJA 2GN4A 3VH3A 1UUFA 4OOEA 2W2LD 3RU9A 1XELA 4WE3A 3WGOA 5C7IO 4TRMA 4CMBA 4XD2A 2GF2A 4X54A 2R2GA 4QX6A 3PHGA 3TN7A 1ENOA 3QWBA 4Y98A 4RJTA 2CFCA 1U1IA 2PD6A 4ILKA 1ZH8A 3PIDA 3S55A 3WMXA 4AG3A 5JC1A 1EVZA 1LBEA 2NV6A 5BSGA 4IIVA 2VQ3A 4NBTA 3S2IA 5K6AA 4O5OA 1EMDA 1D1SA 1BGVA 1HWYA 3JQEA 1P74A 3E6AA 5EQDA 4OHUA 4J4HA 2DBVO 1TB4A 1HYEA 1GZ4A 1H94A 2IXAA 3GF4A 2C54A 4I9NA 4AJIA 1Q7GA 4RZIA 3F1KA 2WYWA 5KJ1A 4XWYA 4RDHA 3RSHA 4RQUA 4K6CA 5AVOA 3L0DA 3K2BA 4CM9A 4RVDA 5B12A 3A1NA 2BMAA 1E6UA 1HE3A 1ZUD1 1GUYA 4J16A 4NH4A 1CEQA 4L8VA 3KOUA 4PCVA 4R4JA 3DC2A 4KWIA 3DR3A 4IMPA 3WQQA 2J3KA 2GZ3A 3NT4A 2NTJA 2QZZA 1ZK1A 5LDGA 1M67A 2NTNA 4R68A 3CZRA 5JNLA 4DLBA 4XRGA 2W2KA 4GX5A 4WKGA 4E5NA 4ZQFA 3KLMX 3LLVA 1XA0A 3WIEA 1PZEA 4O0LA 3F3SA 1C0IA 3GGOA 1O5IA 5KKAA 4BO7A 4TRJA 1GTMA 3X2EA 3E9QA 3DHYA 1YVEI 1JWAB 2NU7A 3ZZNA 4IIUA 3JQ9C 3LU1A 3N7UA 3ROQA 4R5MA 1E1LA 1M75A 4IDCA 2JFFA 1SZJG 2WMDA 4AJKA 4PG8A 3ENNA 1N8KA 3A06A 1EFKA 2YY7A 3INTA 4N5NA 1BWSA 4G81A 1V3UA 4GAEA 1YJ8A 3K2EA 4RO0A 2J3HA 4XR4A 5T5QA 1LDNA 4NMHA 4J2OA 4FOSA 1OC2A 3WSVA 1DC6A 2J8ZA 5DBFA 5A9SA 3MJCA 1R6DA 4LGVA 4NZ9A 1LLDA 1L1FA 1PGNA 1PZFA 4FFMA 2B5WA 2X0JA 3DMTA 5JBIA 4L4XA 3L9XA 3CEAA 4QT0A 4XGNA 8LDHA 1DBVO 2VWPA 3H5RA 3LDHA 1C1XA 3OJFA 4B4VA 4HXYA 5KJEA 4FGWA 4WOJA 3DHNA 2VNAA 2G76A 1GD1O 5FI5A 2Q2WA 4ALJA 5JE8A 3PYXA 4JBHA 4EJ6A 4XB2A 1JLLA 3GZNB 1E3WA 2O4UX 3EYWA 4RVFA 3DOCA 4D7AA 1IPFA 3JQAA 3GRPA 5A06A 5L53A 2HU2A 3ROMA 3EDMA 1A4IA 4CMIA 2X8LA 3LF2A 3OP4A 1PR9A 4A10A 1HETA 4W99A 1XCBA 3MCVA 1AHIA 4CR8A 3AM5A 5BSEA 1WDMA 4W82A 4J43A 3ICPA 4OGWA 1E3JA 4A0SA 4MKZA 1Y8QB 1G0OA 1NAIA 4NBWA 1HSOA 3PFWO 1W4ZA 4RF5A 3NEPX 4E2XA 2PD3A 1E3LA 2NNLD 5MGBA 2HJSA 4FBGA 2RHCA 3D5TA 1LSJA 5FF9A 4J90A 4CMEA 4JGBA 3DZJA 3VTFA 4D0SA 1LQTA 1B8VA 1ZCJA 5L3ZA 4DIOA 2RAFA 1HDOA 5G4KA 2G5CA 2BHLA 1UR5A 4CLHA 3FNEA 4R3WA 2WDZA 5K9ZA 4KTTE 4YAGA 5A3VA 4IXWA 1B8PA 1Q2XA 1X1EA 1VLLA 1I2ZA 1E5LA 4BGEA 4DYVA 3V1YA 4R1SA 4DVJA 2J6IA 7MDHA 2BFAA 2RH8A 4IY1A 5H83A 2PKQP 3GGPA 4DQXA 5F1OA 3ZV6A 1VL0A 3UCXA 4F6LA 1JA9A 1JAXA 3HZZA 4E2WA 3O38A 3WLFA 3CE6A 3DMYA 1KIFA 4LVCA 1HZJA 5IF3A 1KVSA 4RVGA 5EINA 1ZK0A 2YJZA 3LYLA 1YDWA 1JN0A 1QLHA 1U8FO 4DQUA 1GEGA 1XU9A 1PQWA 3KHUA 2OP0A 3M1LA 2ZB8A 1Q0QA 2A94A 2PH3A 5G4LA 1I3MA 4PLPA 3VKUA 1XIVA 1QV6A 2WEKA 4BS9A 1YDEA 3FBGA 4KP7A 5AOVA 2Y1CA 5JO0A 4EEZA 3OM9A 4MP3A 4AVYA 1KYQA 3IJRA 2DBZA 4J9VA 1WMBA 1PL6A 1PQUA 1ZZEA 1E5QA 1JKJA 1N1EA 3FWZA 3GH3A 3KYCA 3OJOA 3OMLA 5HA5A 1HLPA 2RH4A 4UREA 1EVIA 4F46A 1I36A 1U7HA 4NJMB 4BGIA 3C8MA 1DHRA 1N9GA 3I4FA 3PHHA 4BMNA 4UEJA 5J23A 4ITUA 4K6FA 4LN1A 2C07A 4P4NA 4BNVA 1X0XA 2X0RA 4CUZA 2X86A 2BKPA 3VZSA 2CDCA 3VAZA 4CM6A 3ASUA 5BSHA 2UVDA 2O2YA 5TIIA 1E0DA 1R4MA 4ID9A 2PGJA 3WNQA 5IZCC 1GYRA 2Q1SA 1VL6A 2Q45A 1Q1NA 1I2BA 4XCVA 1YONA 4RPKA 4ZD6A 4E5YA 1ISHA 1NAHA 2ZKLA 1BW9A 2BGKA 2IEBA 1NASA 5EERA 4RPJA 2YFHA 1NBOA 3D3WA 1E7SA 4U8GA 4E4YA 5BNIA 3KVOA 1JW9B 4OL9A 2PK3A 5KVCA 4BMVA 5JDIC 3IMFA 3WJ7A 1NVMB 1NXQA 4II3A 4HWKA 4UEOA 2D4AA 1NFFA 3K6JA 3FF4A 4XQGA 4BVAA 1O0SA 1D4FA 4IMRA 3D4PA 4EGFA 4FFNA 2C0CA 2DBQA 2WD8A 4LW8A 1DHTA 4E5KA 1UXJA 4INAA 2D0IA 4FIZA 3TZ6A 3ONFA 1AUPA 5A05A 4JJGA 3JD2A 5EPOA 4XTTA 1MB4A 1R12A 2X58A 1JKIA 4EDFA 1XKQA 1K6IA 1QSGA 2DUUA 4OYRA 1Z45A 1GEEA 3ZU4A 1G0NA 4I1IA 1OZAA 2E6UX 3RC1A 4F45A 2P91A 1HE2A 2EV9A 5F21A 1H2HA 2JD0A 2D2IA 4JIGA 5I7FA 2HK7A 3K31A 4YT8A 2FZEA 3QVOA 5JDCC 4OQYA 1CIVA 1PJ2A 3OJLA 4TRRA 4L76A 4WLFA 4DRYA 4YPOA 1IZ9A 1U3UA 4B4OA 4TSKA 3DAFA 3RAJA 2JAPA 3HG7A 4EYEA 3TOZA 3BTVA 3DTYA 1NP3A 2YV3A 3P5SA 3GT0A 3H9EO 4KDEA 3WGGA 5L4SA 4YA6A 1I3NA 3H4VA 3PRJA 4WCFB 1BHSA 1ENPA 4YRAA 4QO7A 2O3SA 1DRUA 5CDSA 2ZCVA 4FJ1A 4JCOA 1SPXA 1Z6ZA 1I5RA 2D3TA 3UICA 3AUUA 3HJAA 4M49A 3X2FA 2HMSA 1DAOA 4IINA 4DTIA 4XYGA 1IY8A 1DDOA 1H6DA 1GYPA 3PLNA 4UVEA 4FB5A 2BRUA 2BD0A 1KC3A 1PSDA 4BB6A 5A1TA 4Y6PA 5IXYA 2AG8A 4PLWA 1XSEA 2VUSA 3WG9A 3IJPA 1PS9A 1YB1A 2Q99A 5U4QA 4CLRA 4HX5A 4IDFA 3D1LA 4FS3A 1DIBA 5G0TA 1ENZA 3IS3A 1ZEMA 1ORRA 2EIHA 1BTOA 2VWGA 1DLIA 3GVIA 4WLVA 1YBAA 1SNYA 3JSAA 3OF2A 2B83A 4CLXA 1H5QA 3V1TC 4MDHA 2IZZA 3TRIA 4GWKA 4YT5A 4BKQA 1ZW1A 4I5DA 4JP3A 3CTMA 2Q2QA 5BT9A 3ZU2A 3DZGA 4RPHA 3RUFA 2FR8A 4BNKA 4YWJA 2JJYA 3PWZA 2FR0A 3RUAA 2GDZA 1E7QA 1N92A 1N1GA 2C2YA 1CDOA 3CZMA 3M2TA 5L95A 3PQDA 3ZWWA 1L7EA 3Q2IA 3OEWA 4IBOA 1LDYA 5IN4A 4NIMA 1HSZA 3PDUA 3ZHBA 2FSSA 1PWXA 4CR7A 2AQIA 3JQ8B 3IQDB 4DUPA 1UXKA 3AI3A 1PJCA 3BMCA 3GDGA 3GNSA 2HKIA 3PJEA 4BNNA 1PS8A 1LJ8A 2YV1A 1U4SA 2FN7A 3QW2A 1GZ6A 4YQYA 3C1AA 3FNFA 1A7KA 2NU6A 3E9MA 1WDKA 1SAYA 1ZMOA 1ZXBA 4GX2A 4HBGA 1T1SA 1FDUA 1H9BA 1ENYA 2AA3A 2AXQA 3ASVA 3JQBA 3Q11A 2H5LA 5EMHA 3FR8A 1X0VA 2ZYAA 2V6GA 2Y1EA 1BRMA 4DGSA 3SJUA 3K9QO 4DA9A 2PZMA 2FHSA 4DMMA 3INGA 2VOJA 3H9JA 3JQDA 2B5VA 4OJNA 5A9TA 4J91A 2LDBA 4IM7A 1LLQA 5C7OO 3FCOA 4N7RA 4AJPA 3GMDA 3ZGYA 2JHGA 2OO5A 4GVLA 2X5KO 2OMEA 1LC3A 4FQ8A 5BNFA 5AXBA 5I7EA 2CD9A 3ENKA 1E3IA 4UVIA 3N74A 4RF2A 4HV4A 4YB8A 4YQZA 1BSVA 1DFGA 4HFMA 4G65A 3CH6A 3MJTA 4MVJD 2O48X 1E7WA 2QYTA 1MC4A 3MWDB 4AJ1A 3QY9A 3CKYA 3JQFA 3H5NA 1YL6A 1E1MA 2HMVA 4WGGA 3EVNA 2C20A 3PXXA 5A3JA 1D7OA 1NR7A 4CMJA 3B6ZA 2O7QA 3JQGA 1PTJA 4OXKA 3VDRA 3RFXA 3BTUA 3W4IA 3MZ0A 3GNQA 2IDZA 4OH1A 1GCUA 3H3JA 3O8QA 2BFPA 4FFRA 2V7PA 3MJVA 2NM0A 3HN7A 3JYQA 3BAZA 5A5EA 2ZB4A 3TZKA 2I66A 3LC7O 1PJLA 4PVCA 3RU7A 2OORA 1QR6A 4B79A 2CDBA 3OJEA 1GQYA 4HFNA 3I9LA 1YWGO 4CM4B 2D1YA 2WWRA 5IZCA 5GZ6A 1LSUA 3ADPA 4NBVA 1KERA 1KC1A 3QWIA 1K89A 1NX6A 4EUEA 3PQFA 2VRCA 4PRKA 4RGBA 1FDTA 2B4RO 3GNTA 5MDHA 3HB5X 1LRKA 3PJFA 1Q0HA 4XIJA 4BNLA 2CVZA 3NTQA 3GA0A 3I9KA 1AN9A 1N7GA 3GVCA 4ZGWA 3TZCA 4H15A 2YV2A 2VZ8A 2NWQA 4CUKA 3GVXA 2FR1A 1NYTA 4DPLA 5CPFA 3PWKA 3FSRA 3VHRA 1T2EA 2OBNA 1CQJA 4LISA 2IZ0A 4ND3A 1QYVA 3FI9A 2PZJA 1B14A 2E48A 1OMOA 2PKRA 3C85A 4IZHA 5TLSA 1BVUA 1OC4A 2EP7A 1OFGA 4EW6A 1VRWA 4B3HA 4BIIA 2G17A 3L6EA 3T4EA 3ZNOA 4IGEA 4I08A 3MJ4A 3RUDA 5B4UA 3Q6IA 2O2SA 4MVJI 4FJ2A 4GSLA 1F06A 4BO6A 3H2ZA 9LDBA 2H6EA 1OBFO 3RJ9A 2FPIA 1BDMA 2D8AA 3DOOA 1HXHA 1R15A 1OAAA 1XLTA 3R0IA 3LVFO 4CM3A 3OIGA 2NQ8A 3ETDA 5DDIP 2X4GA 2C29D 4R9RA 2CUKA 2FRDA 4RVSA 1PJ3A 3EZLA 4GX0A 3CMCO 2ZB7A 3UVEA 1FF9A 2NVUA 3KEQA 3KXDA 4GKVA 3WGTA 3DBRB 1U28A 2DUWA 1KVTA 9LDTA 4FFPA 1LDEA 5TX7A 4EITA 3HFSA 1DIGA 4WNCA 3BZUA 2LDXA 4BO5A 1ULUA 2HLPA 3VTZA 1LDGA 1DC5A 3AM4A 3DBLB 3H9UA 2QG4A 2DVMA 1TT5A 4A7PA 2DQ4A 4I5GA 4NK5A 1E1NA 3F46A 2O7SA 2PKQO 4CMEC 4P22A 3ZWYA 4HFJA 1YBMA 4J0EA 3IP3A 3U62A 3OBBA 4C7KA 3QVTA 3EHEA 3FRJA 4JXKA 1BXZA 2EF1A 1AE1A 3AY7A 5IG2A 2ZQZA 1TI7A 2DTEA 2O3RA 2R00C 4WECA 5KWEA 1KBZA 2JAHA 4DMLA 1DO8A 4GI2A 1MFPA 2WSBA 3EUWA 3HN2A 5L4LA 4DBVO 3IKVA 1N2SA 2C5EA 4BQRA 3H2SA 3B20A 4ND1A 1LX6A 1J4AA 4J1TA 5DCWA 5EJ2A 3ANMA 2EGGA 4BGVA 4HY3A 4DPMA 3RBZA 1F17A 2OHXA 5ER9A 1JQBA 2P5UA 1KEVA 3KYBA 4YJGA 5TF4A 5IDXA 3SLGA 2YHIA 5I7SA 1HE5A 2P9CA 4I9HA 2Q4BA 4KWHA 4CMCA 3VVBA 3I1JA 4J7CA 3LK7A 1PJSA 5ILOA 3P19A 1TLTA 1I33A 1B16A 3KO8A 4BNWA 4YRBA 1LRJA 4NPCA 4CMKA 1C0LA 2NTVA 4ESOA 2OL4A 3RC9A 4IJVA 4NFHA 4E33A 4R01A 1NTOA 1U3WA 3JD4A 4KDFA 1HT0A 3RUIA 3ZHZA 1O89A 4XIYA 4CLEA 1NM5A 2Y93A 5G0SA 3WTCA 2YUTA 5I8ZA 5CFZA 4H7PA 3AY6A 3AU9A 4U6SA 2YYYA 3JYNA 1T2FA 2C7VA 3LC2O 4B8WA 1H0KA 1Y8RB 1E3WB 2V6MA 1YL7A 1XQ1A 2VOEA 4J7UA 2FY8A 2OBYA 3I23A 4HNHA 3ZDFA 2BFMA 4J6FA 5COBA 2UUOA 1WWKA 3E82A 1HYHA 3CINA 4CPDA 3EMKA 3UFXA 2NVUB 1JAYA 1GDHA 1HDZA 4XYMA 3FD8A 3ZNQA 3GC6A 3PHJA 2GZ1A 3OIDA 5EN4A 4PLHA 1QKIA 5TQVA 2CMDA 5A9SB 4HKTA 3ZWMA 3C7AA 1P1FA 3IUSA 5JCJA 1U5CA 4MPDA 3NDJA 1FDVA 1ZSVA 3EW7A 4U0JA 5CPBA 4MO2A 2YDXA 4D44A 4RORA 1QLJA 2VZ0A 4LCEA 4TMFA 4L4RA 3NKLA 4KMSA 4XZ3A 1K5HA 1Z73A 1EZ4A 3WLEA 1EDOA 2QRKA 1ONNA 3GFGA 4QO8A 4YT4A 2IYOA 1LDBA 5G4KB 2I99A 3L4SO 4CUJA 1IPEA 1Y7TA 3MTGA 4E2YA 4PZEA 4Z0PA 1OOEA 4PLFA 1J0XO 3LSYA 2AEMA 4XB1A 5JAQA 1AHHA 1Z7BA 4ZJUA 1IYZA 1CYDA 3QV1A 4Z0HO 2BF7A 2GZ2A 4J4BA 4D3SA 2NQTA 3RUHA 1YB4A 5COQA 1PJBA 5ILGA 1F8FA 4WEQA 3KB6A 4GVXA 1DIHA 2CY0A 1HDRA 1GPDG 3O4RA 5JSFA 4AJOA 2ZQYA 2O3JA 3NGXA 4ALKA 4K1LA 3TQHA 2Z95A 2CSUA 3JD3A 4JROA 1MXFA 1YS4A 2HCTA 1E6WA 2C2XA 4D0RA 4EJMA 1Y8QA 1DXYA 3V1UA 4RCVA 4E21A 3CXRA 4B7CA 5KVVA 5IAAA 3GN1A 5T64A 3KYDB 2I3AA 3EK2A 3KLPX 3RBXA 3RI3A 4DQVA 4E5MA 1YOVA 3E03A 4DPKA 4KUEA 4JBIA 1JKFA 1X7HA 2ZTVA 2DPGA 3DXFA 2VUTA 4N54A 5CP8A 1E3EA 3HNPA 2CVQA 4IJUA 4PLZA 1KOLA 2GYYA 4YAKA 1RM3A 3RKRA 4R1UA 4JLWA 5H82A 3RC7A 5KTKA 4H16A 1HTBA 3ZWBA 5IDQA 1W73A 1WNTA 4WK6A 5IN5A 5HBRA 3ULKA 3DZIA 4MVJP 3DHEA 3C7DB 3F5QA 3HDYA 5DP1A 1RM4A 4UUOA 3KSDO 4XYBA 5JAMA 3OETA 3NJ8A 4DBZA 2HUNA 1IB6A 3GOHA 5ENDA 1E7RA 4E13A 3HDJA 2QRLA 3EGOA 3F4BA 4DIFA 5JPIA 3PTZA 4HNGA 5GZ3A 4L74A 1R0LA 5A9RA 3QJ5A 3JD1A 4GX1A 3KSZO 2FMUA 5U1PA 3ZWAA 3PYMA 3WQRA 3ZNNA 4NDNE 5KVSA 1T1RA 4L73A 1WXDA 1IOLA 4GGOA 4UVDA 5L40A 1D1TA 3NJ4A 4ZRMA 4PLYA 2P9GA 5IJZA 4U7WA 4E3ZA 1GUFA 4NI5A 3FPLA 5CDUA 1Y5MA 4NQZA 4ROSA 1HLDA 4XQCA 1KVQA 2HQ1A 3I6IA 1LTHR 2ZTLA 3DOJA 3G1UA 3GEMA 3SJ7A 3O03A 1ID1A 1ISFA 4BO9A 4BO8A 4DREA 2JL1A 2WE7A 4OOFA 3BTSA 5FEUA 3AOEA 4CM1A 4HADA 3JQFC 4K28A 5TT1A 1UJMA 2PR2A 4IDEA 1F0YA 3V2HA 3BTOA 4YTEA 3WYCA 1I8TA 4MP8A 3MOIA 3C1TA 2B4QA 2J5KA 2A9FA 2PGLA 1DRVA 5G0WA 1RYEA 2YDYA 1R16A 2AMFA 3O9ZA 4E2ZA 4GLOA 3C7CB 1C0PA 3GPDG 5DF1A 4AJJA 4DYDA 4XGIA 3GRKA 3ITKA 4J3FA 2P5YA 4TROA 4BO3A 3ZI0A 4M86A 5A04A 4YJGB 4BB5A 4EI2A 3W8FA 2CVOA 4F3YA 3PGJA 3QP9A 4GL4A 3I9NA 1WZIA 2JFGA 4Q3AA 3WYBA 2AG5A 1ZVMA 4DXHA 1BG6A 1LSOA 1PGJA 3BA1A 3HWRA 4YJFA 2JCVA 4GQAA 2EW8A 4TZKA 4CM9D 2Z1MA 2JD1A 2QW8A 3STHA 3PQEA 3COSA 5HTOA 1PL8A 3K92A 4MKXA 5A02A 1GQQA 1HL3A 2QZ9A 2VRBA 3TOXA 1M66A 5L7TA 3PZBA 4XQ9A 2ZTMA 1SO8A 2R00A 2AE2A 2VHZA 4CV0A 4PZCA 4B3IA 1Y8RA 1EQUA 4DC0A 2BH9A 4MP6A 1VM6A 3TZQA 3RC2A 2YZ7A 4FPXA 3JCZA 1N5DA 4XDYA 2NADA 3W8DA 3ROPA 3ZN2A 4CLOA 5CDGA 5HS4A 3OQ1A 4BV9A 3PIIA 1LDMA 4UUNA 2E4AA 1BXGA 3OA2A 5BR7A 3L4BC 3I52A 1A71A 3KRTA 4IUYA 5JAZA 3VH1A 4Z3DA 5CG2A 4N5LA 5ADHA 2I6TA 2I9PA 2Y1FA 3UH1A 1E7MA 1P0FA 4AJ4A 2B4TO 1C0KA 3GPIA 3NDIA 4II2A 1M6WA 4BNHA 3ZV3A 4ZQEA 3ZH2A 4IQ0A 4WJZA 3ZWNA 5ICMA 1Z7EA 5LDHA 4N5MA 2GSDA 3ZWXA 4G5HA 3AI2A 1WDLA 4P4GA 3GAZA 4XDZA 2UYYA 1A72A 2ZJ0A 1EDZA 4BHTA 3LT2A 1GYQA 1SCUA 3KZVA 4NG5A 5L45A 3HQ4O 4QSMA 1A27A 2QX7A 2EWMA 3U09A 2XXJA 1I2CA 5JAIA 4OSPA 3RFTA 4UULA 4C7JA 4GLLA 1A9YA 2Q4EA 1A4UA 1CETA 3B1JA 5HS6A 3UOGA 1LQUA 4A73A 4RV9A 1M2WA 3RIHA 3SX2A 2VCYA 4JX8A 4ONEA 4MIEA 4O6VA 2G0TA 1I0ZA 3H6KA 4RDIA 1P45A 4DL9A 4YRDA 3TZHA 2Q3EA 2X6TA 3FNHA 3K5PA 3TNLA 2X22A 5AYVA 3VPGA 3DAGA 1T25A 4A27A 1Y9AA 1R66A 4OKIA 2X9VA 3V2GA 4LSMA 5ITVA 2ZCUA 3W8EA 1ZBQA 1YJQA 1UP6A 4QFCA 3EVTA 4XEHA 2Y99A 4WCFA 3WWYA 2J3IA 3DMTC 3WS7A 2J5RA 3GR6A 5I7VA 2D5AA 2TMGA 3LF1A 1H2BA 5TT0A 1TXGA 3L6OO 2W8ZA 1MP0A 1V3VA 1JWBB 2EKPA 1B7GO 1HF3A 4MVJH 1X7DA 5FFFA 3W6UA 1Y6JA 2CDAA 1PX0A 5EL0A 4RZHA 2PFGA 1MUUA 2Q1UA 2ET6A 1P3DA 2A35A 3OA0A 1T2DA 3ZV4A 3TDKA 4FW8A 2V65A 3AJRA 2GN8A 4HP8A 3LZ6A 1GAEO 2B36A 4ZA2A 1O95A 1QMGA 3IKTA 4NBRA 3OH8A 1CWUA 1LXCA 1S7CA 3L07A 3GQVA 4FFOA 2O50A 2RCYA 2GUGA 2JD2A 4WLOA 3V8BA 2BKOA 1P1KA 1TEHA 3D5QA 1Y9EA 1K3TA 4E32A 1YQGA 4WCDA 2AEJA 3GZ4A 3GVHA 4M1QA 2X9GA 3SEFA 4GWGA 3E1KA 3NUGA 1BDBA 3S2GA 1I24A 1ZSNA 4RLSA 1T2AA 2GR9A 4KUHA 3JD0A 1IE3A 1LC0A 4XQEA 3S2FA 3DZBA 2V6BA 1O6ZA 2ZIZA 4R51A 4PIVA 5COAA 4CL3A 4JJFA 1UP4A 4GBJA 2DFDA 4ZHSA 4EUFA 1JVSA 5CEFA 1KVUA 1WP4A 4UVHA 3JQBC 3Q9UA 3E18A 3CPSA 4Z6KA 3AWDA 5AQ1A 1QYDA 5KJCA 3OQ6A 3SVTA 4Z9XA 3QLJA 5F5LA 2NVBA 1G1AA 2E37A 3NGLA 4CM8B 1I30A 1E6EA 2BGLA 3VH4A 3VPSA 5BSFA 4YDRA 3ONDA 1GR0A 1NHGA 3F1LA 1EBUA 2IYPA 2PLAA 1V0JA 4Q3BA 4NFYA 3TL3A 1C1DA 3QWAA 3ABIA 1N9GB 1V3TA 1P77A 3A4VA 3JQGB 3UCEA 5BNTA 2D5CA 1R4NA 5JYDA 4PLCA 4I5EA 2XF8A 3PEFA 2PZKA 1ZEJA 4YAIA 2W2LA 1E7YA 1XR3A 1ZMTA 2QYSA 3ANNA 3FBTA 3IAHA 5GY7A 3UUWA 3ROKA 3ZWCA 1H9AA 2BI8A 3ZU3A 3OICA 1U3TA 5JMWA 3DBLA 4BKOA 1IZ0A 3VVCA 3ZHYA 4IDDA 4LRTB 2X0NA 4CL8A 3DFUA 4PLVA 3LLSA 4MVJE 1NPTO 1AXGA 2CF5A 3PWSA 3DAPA 3RD5A 1EUZA 2NU9A 5B1YA 3BMNA 2G1UA 1T24A 2X0IA 3D4OA 4RF4A 5DNAA 2JCXA 2X5OA 3DWFA 5TJ9A 1P0CA 1V9LA 5I8WA 4CM7A 2JHFA 5L7WA 4OMUA 2FZWA 2PTGA 1VSUA 2DAPA 3G3EA 3PI7A 3QVWA 4ZN6A 3PLRA 4MIYA 1RKXA 3WQSB 1H93A 2B35A 4IZIA 4GSKA 1EK6A 2GCGA 4HUJA 2EGHA 1X15A 1PZGA 2P9EA 1ZKMA 4RLHA 2VHXA 3Q0EA 1BVRA 4A5OA 3O8QB 1JDJA 3JQ8A 4ZQGA 2EXXA 2GRAA 5L4NA 3B1KA 1F12A 3WGZA 3DO5A 4XJTA 4Q3DA 2EP5A 1U3VA 1XGKA 4FD3A 3QRWA 1PJQA 3IUPA 3JYLA 1DIAA 3BIOA 3K8ZA 4URFA 4DLLA 2PY6A 2OZPA 1LRLA 1NWCA 3RVDA 1V35A 1P1JA 3ON5A 3KM0A 4E12A 5THKA 5HM8A 3DBRA 5B4TA 2IE0A 5JW6A 5K0ZA 2HDHA 1ISGA 3Q9NA 4W9NA 2FSVA 4Z3KA 2GNAA 2P2SA 3D3WB 2EJVA 4PN3A 2WJPA 3CSDA 4IQ8A 3GN2A 2YHIB 2OXIA 4ND5A 5CEEA 5DZSA 1EFLA 2OOSA 2Q1TA 3NT2A 3K30A 3PYLA 5JDCA 1B2LA 1I3LA 3ZU5A 1EBFA 3BXXA 1I3KA 3HDQA 5DOVA 4BNUA 1ULSA 5GZ1A 2E82A 4MINA 5JMPA 1IL0A 1FJHA 5DBIA 4F6CA 1E92A 1VL8A 3R3JA 4IDBA 4KUGA 2I5PO 2ZTUA 4XKJA 4KTVE 5IDWA 2PV7A 3RCBA 2CF6A 1ISMA 3PPIA 5JXWA 1ARZA 1DRWA 3RUCA 3PGXA 4BL5A 4I5FA 3ZW9A 1U9JA 2RHRA 4PRLA 3LT4A 4FSHA 4PG4A 4EJ0A 4J0FA 3TL2A 4TZTA 3A14A 1RPNA 3ANLA 3UF0A 1Y1PA 4RPLA 5F1PA 4OXNA 2TMDA 2NLOA 3TFQA 3VZPA 1SBYA 3RFVA 1ADBA 3WFIA 4D3FA 1GL3A 1P1RA 2NU8A 1PJ4A 3C24A 4CMAA 3JQAD 4ZICA 5JDIA 1O8CA 2HO5A 2X5JO 3UGKA 3AOEC 4GMFA 3JQ7A 3WICA 3U0BA 3MEQA 2P4HX 3GFBA 1ML3A 4D3DA 2QRJA 1I32A 1HDXA 1V8BA 4MVJM 2VYVA 3EY4A 2VTEA 3IC5A 1U8XX 2FWMX 4RL6A 1U7TA 2X23A 4CV1A 4Q3EA 3KSUA 1EUDA 3HE3A 4KZPA 4P38A 1SMKA 2HMUA 3RASA 4RPGA 2Q2VA 3D0OA 2VYNA 1D3AA 4YT2A 3R1IA 2NUAA 3CMMA 3IP1A 3NTRA 3H3FA 1PJTA 3WB9A 4D46A 1X13A 4LMRA 4D41A 3QIVA 2HMWA 1FXSA 3U4CA 2GN6A 1K2WA 4MKRA 3T7EA 3DBHA 2Z1NA 3V5NA 3GUYA 3FTNA 1NHWA 2C5AA 3RBVA 1P31A 4QEDA 5U9CA 1SOWA 5DP2A 4OM8A 4OQZA 2EEZA 3DFZA 1T4DA 4AL4A 3LT0A 1PU2A 3OIFA 1UXIA 5KIAA 2RBEA 4NR0A 4YS2A 1F8GA 4OKNA 3S8MA 4PG7A 4BNIA 1C3VA 3D7LA 1I10A 2AE1A 3QA9A 2B0JA 3L9WA 1YOVB 1T2CA 4WCFC 4P4LA 5KKCA 3U4HA 4MVJG 1MG5A 4WLEA 4WOKA 4NU5A 1UDCA 3ZWVA 3I6QA 3C3XA 3WXBA 4MVJA 4UEKA 2HAEA 4R54A 4YBZA 5DN9A 3GDOA 5KVQA 2EKLA 3U5TA 5G0UA 1K6XA 2J3JA 2Y67A 1P9LA 2FP4A 2WYUA 4ZQBA 1D8AA 3I9JA 4UVGA 3UAGA 4BO1A 3UN1A 2Y0EA 1B0AA 3AM3A 4ZVVA 3D4NA 2VWQA 1YB5A 3W1VA 1XG5A 3JV7A 5L51A 1Q7BA 4CJXA 4W6ZA 1QXSA 5EQFA 1NQTA 4L0QA 4TQGA 5JS6A 2X1HA 4PG5A 1E3SA 4R41A 1NFRA 3TFOA 5TSDA 5JY6A 4Y67A 3WIDA 1VKOA 3ICCA 4PVDA 4Y6SA 4R9SA 1Q0LA 3GEGA 4CV3A 4CM8A 2GO1A 4Y8VA 3K73O 4Y9DA 2VRCD 5F5NA 1XHLA 3TSCA 1RM0A 4CMIB 3PVZA 1ADCA 1UH5A 4E0BA 3P7MA 3N58A 5JYEA 4BNMA 5L9AA 2EERA 5DBGA 4K9DA 3ITDA 4DWVA 2O4CA 1GUZA 1PL7A 4FOOA 2DM6A 3WGHA 3GHHA 4NNJA 5KNLA 1LU9A 4R69A 3OQBA 1ZK4A 1JU9A 1HYGA 4J1SA 5KOIA 1RYDA 1YQXA 2PWZA 1VCTA 2IZ1A 1LLCA 1PGPA 3GG2A 1K6JA 3DBHB 3P2YA 3M6IA 4GH5A 3WGIA 4KQXA 3FR7A 3GGGA 3JYOA 1WLYA 4LMPA 3JQ6A 2FPGA 2IEDA 4TVOA 3UW3A 4YAEA 3GHYA 3SLKA 3VDQA 4MOWA 4YACA 3VPXA 3P2OA 4XJSA 3ZCXA 3OSUA 3WDSA 2BELA 2POQX 3IIEA 2NSDA 1Q7CA 4JJIA 1DJQA 1J49A 4FCCA 1HDCA 1VC2A 1LSSA 4E31A 1UZNA 1F14A 4KOAA 3ETEA 1C14A 5I9LA 1Z74A 3I9MA 2ZB3A 1HE4A 5AXCA 2AW5A 2DTXA 2WTBA 2HMTA 3GG9A 2O3QA 1DSSG 4OAQA 2PH5A 2QQ5A 3W4KA 5A5FA 2G82A 1CRWG 3NYWA 1HZZA 3PHIA 1QORA 1WZEA 5TJHA 3L77A 4CLDA 5KCZA 2Y1DA 3H8VA 3JQ9A 4FJ0A 3R3SA 3PHLA 4PLTA 2HRBA 2BFOA 4O59O 5FI3A 1YO6A 3Q2KA 1HEUA 1U2DA 3IDSA 1XQ6A 1A7AA 1VE9A 4WLNA 1RWBA 1EQ2A 2PNFA 5TC4A 4BKUA 2EKQA 3M2PA 3Q3CA 4NHEA 4GKBA 5C37A 4B8ZA 2XOXA 1Y81A 2VTDA 4I8XA 2W2KB 3WSWA 2BKNA 4JN6B 5EESA 3D64A 3PJGA 1G6KA 3QE3A 4U5QA 1C1XB 3RWBA 2VZ9A 1UZLA 2RIRA 4S1VA 3L6DA 1QG6A 5L7YA 4BNTA 4AJHA 2DFVA 4Q3NA 2CZCA 1DJNA 2VT2A 3EC7A 3KYDA 3OECA 3QSGA 1R37A 5AXDA 2HK9A 2Y68A 4Q39A 5BQFA 1GV1A 3HSKA 3C1OA 5FYDA 3ZHXA 4B7XA 3DZFA 3WBBA 4D45A 3ZV5A 4ALNA 2OUIA 3VOSA 3D3EA 4FR5A 1ZFNA 4WPGA 1GFSA 3DQPA 4A03A 1YL5A 5K6AC 1CF2O 4MVJF 1DFHA 5ITWA 1W6UA 4IDAA 1R0SA 4TVBA 3ST7A 5C5IA 4LSWA 1I01A 1UAYA 2VHWA 1GPJA 2X7HA 3NTOA 5G0VA 4C4OA 4RVHA 2VHYA 1GQ2A 2V6FA 1ZO8A 4ALIA 1N7HA 2Q50A 3DZKA 1EE2A 3WX0A 5DCUA 1E77A 4FFLA 4O1MA 4ZQHA 3UHAA 4BKRA 2DTDA 3U9LA 4AJLA 4KQWA 1PGOA 5JC8A 4ND2A 1HDYA 3BMCB 2HK8A 1TT7A 4ZRNA 5IFLA 2ILTA 5GMOA 3GEDA 5LC1A 3ADOA 4M8SA 2AQHA 4NJOA 3KYCB 6ADHA 2F1KA 1QP8A 2GD1O 3FTPA 4CQLB 4IPTA 4M87A 4W9NC 1YXMA 3DZHA 3ZWOA 3AUTA 2X9NA 8ADHA 1P1IA 1XDWA 1QYCA 2GASA 3INRA 5JCJD 1DFIA 1B3RA 3PP8A 4L9RA 4RF3A 5CEJA 3CUKA 5TNXA 1HKUA 4MIOA 4W7HA 1XEAA 3SC6A 1BXKA 3BYZA 3NX4A 4J7XA 5A03A 4YCAA 1J6UA 4PLGA 5T57A 3GZNA 1NQOA 1AGNA 2E49A 3OHSX 1EVJA 1SEVA 4IJKA 4H3VA 1YGYA 3CIFA 2C59A 1BXGB 2UAGA 2YQ4A 3NT5A 4K26A 1KY4A 4CR6A 2HSDA 2O3TA 3T7CA 4CQMD 1KETA 1PWZA 3IOYA 5CHEA 2I3GA 1NNUA 4J2HA 2B69A 5IZ4A 2VUUA 4O63O 3O26A 4NJMA 1NPDA 1LA2A 2NACA 2OP1A 4IGFA 4BUCA 3PJDA 1TT5B 2DU8A 4LVUA 4PZDA 5ENVA 4YXFA 4FC6A 1B15A 4BOYA 4JK3A 1SEPA 4QQRA 3WWZA 4BMSA 1UZMA 2W4QA 4YJHB 3NDRA 3VZRA 1NQ5A 1WVGA 2YW9A 4WEOA 2YFQA 4R1TA 4YJFB 1B26A 4Q9NA 3AI1A 2I65A 1GADO 3DL2A 4LK3A 3G79A 3GY0A 2P4QA 1YH3A 2VYVD 3U4IA 4OO3A 1PZHA 3W4JA 4E30A 3BMOA 2WD7A 3FHLA 4CV2A 3GDFA 3QVXA 1WPQA 3R6DA 4B4UA 3KETA 3ONEA 1SOVA 1NQAO 3E48A 1NFQA 1VSVA 2VYND 3HHPA 1GV0A 3MJEA 1ADFA 1UAGA 5T8KA 5AXAA 4AJ2A 4BO2A 2FOIA 2XXBA 5T67A 4MJLA 1P1HA 4JBGA 2Y0CA 4CLOB 1PGQA 1DB3A 1VI2A 4GPD1 1U2GA 4XYEA 4EEXA 1JTVA 1X7GA 2Y05A 3G49A 1PS0A 3JXOA 2DC1A 1RJWA 3JTMA 4B4WA 2Y1OA 1AXEA 4RVUA 1W0CA 4B7UA 1T4BA 3AU8A 3OEYA 1FMCA 3KV3O 5THQA 5ES3A 3GUCA 3RQSA 4QXMA 4L75A 7ADHA 5ER6A 1SC6A 5B4VA 1W8DA 3E8XA 4AJNA 4ND4A 3VC7A 3I83A 3TPCA 1KEWA 1VKNA 3GMSA 3GVPA 1ISJA 5C3MA 1MG0A 2DT5A 2PGDA 1ZNQO 3SXPA 1K0UA 1XYGA 4J9UE 1DAPA 2D59A 3PDJA 2GPTA 1CJCA 3AUAA 1PIWA 4WNIA 2JCYA 1ZXLA 5C7LO 2ZYGA 4TWRA 3RROA 4E6PA 4TRNA 2Y0DA 6LDHA 5DT9A 3VPHA 4XRRA 1R4MB 2QHXA 3PK0A 1WMAA 3H65A 2A92A 1IHXA 4W4TA 3QHAA 1ADGA 1U5AA 1VPDA 4S3MA 4BQPA 1P33A 4BNGA 3VPFA 2OFPA 2VNSA 3S2EA 1Y5RA 2CNBA 2IXBA 5JCXA 2O3UA 2UUPA 2HRZA 4L4SA 2DLDA 4D43A 1C1DB 1NR1A 1QV7A 4J49A 4Q3CA 1KEUA 4R3NA 4YJHA 3G17A 1E1KA 2OGUA 3QWFA 1BMDA 3HADA 3DTTA 2W90A 1MC5A 3AY3A 2PA3A 3OFSA 3AK4A 4U6QA 4JP2A 4W7IA 4DIBA 4IJWA 4EZBA 3Q1LA 1FK8A 2Q49A 1GY8A 3RJ5A 3F4LA 5H81A 1MXHA 2BI7A 1M76A 1LI4A 1H6CA 5FWNA 1LLUA 3K96A 3LC1O 3KBOA 3WGYA 2FPPA 2IRWA 4PGFA 3KTDA 3AFNA 5DULA 4A26A 1X14A 1UXHA 2J5QA 3E5RA 4WLUA 4BO0A 4GMGA 4M89A 4BV8A 1Z75A 5CG1A 4CLRB 4YVFA 3ZWPA 4YR9A 3BHIA 4NBUA 1L7DA 1EEHA 3MOGA 4AJEA 4R5HA 3H7AA 4AICA 1NVTA 4PFJA 3WGQA 4CODB 3ETGA 3F9IA 3M1AA 3EZYA 4NK4A 3UKOA 1HDGO 3IL2A 3WNVA 3EAGA 4N18A 1NPYA 2AQKA 2UV8A 3WMWA 3DB2A 1SB9A 2Y66A 3E9NA 2IODA 2B37A 3OJ0A 3RUEA 1KY5A 2HJRA 3T4XA 1UXGA 1GU7A 3HUDA 1J5PA 1XWFA 2XAAA 4AFNA 4XR9A 2ZK7A 3G1TA
chains in the Genus database with same CATH superfamily
1ONOA 2AFIE 3NS7A 5NLLA 3N5CA 5KX5B 3PNYA 3BSAA 1H6BA 3HVWA 3CC7S 4CYUA 5HWSA 4YJDA 3J80A 3PPVA 5I5GA 1EP4B 4LF5F 3OT1A 2JLWA 5JH7F 5AVXA 3F5SA 4C8NA 3J7YI 3FGNA 3RK4A 2CPYA 1X86B 3F6YA 2GO9A 1ZK2A 2CYAA 1SQ0A 4E14A 4CEHA 1X1TA 4IGIA 4Q9AA 4ELUA 4Y2YA 1XU7A 2VPWB 2AOUB 4JH0A 1KQ3A 4YB1P 4DR6J 4DLAA 2PBRA 2RRNA 3TQQA 3GBSA 3LT1A 1EJBA 4ECUA 1X38A 5IXUA 3WRVA 3SXUB 4H77A 3ZKAA 4LF6J 4I4BA 4EPRA 4X00A 3L7UA 3MYYA 4BKPA 2C28A 3I2JA 3TLJA 1A69A 2I67A 3JQAB 1XF1A 4U3JB 3HVIA 5F3RA 5CB4F 1EESA 3DMJB 1USGA 4EF5A 5F8NA 4BC1A 4Y6OA 1DC7A 4UOCA 5I7WA 1KS9A 3VZQA 1S59A 3I28A 4FOLA 3EGZA 1GZ3A 3DMHA 4WTYA 2GJKA 2ANCA 2GN1A 2D5IA 2R8PA 1N34B 4JSRA 3MI7X 1V6SA 2F4VF 4TTVA 1OZHA 2PUCA 4X6YA 1MN7A 1D6NA 3JAMA 2H1SA 1XZCA 3OEEA 4HWGA 1Y3IA 1HBOB 4DV2F 4JXJA 4FC7A 2A2ZA 2NVWA 2V9PA 1Y7LA 2QC3A 3R1HA 3I39X 1CQIA 3VH3A 3N5KA 3AA8A 1YC2A 1GOTA 1FX1A 4WU2A 4G0QA 1ZW6A 3QLEA 4Y98A 2BMDA 4M1MA 2FFAA 3LMKA 3LVQE 3ZBQA 2D1TA 2W0SA 4BLOA 3HI6A 1SULA 1T9AA 5TEWA 4FF2A 1QHSA 5JVDF 3F1KA 3UCZP 3PR3A 3WB1A 1FTGA 2FUG1 3CUWA 1X80A 4DV4B 4QOHA 4FFBB 1E6UA 1EGAA 3HXTA 3B38A 1KSGA 1MU0A 1M67A 1Z2OX 4KBYA 4GX5A 4NP6A 4NA3A 1TZCA 2XB6A 1YVEI 1JWAB 3NKYA 1QBGA 1TUIA 4HX2A 5C1BA 4OM7A 1SZJG 3NYQA 3C3WA 5D1HA 3W63A 2JIZD 2IRYA 4NLUA 1BZYA 1LDNA 3MJCA 4PHCA 1WA5A 3I55S 2BGUA 1DLOA 1GRCA 2LYVA 4IDQA 5LKAA 2G5PA 1GD1O 1RC8A 2O4UX 4KV7A 3OCZA 4ZYTA 4D7AA 4J7AA 4WERA 1QD1A 1KKMA 1TPZA 1U1QA 4NCAA 1V25A 4W82A 5K20B 2ZZTA 2PUHA 3UC9A 4IAOA 3SMVA 1Y1TA 2WZQA 3PO4A 2YL2A 3EXEB 3IQIX 4EARA 3W5DA 1US8B 1DXQA 5JYBA 2EI5A 3NAIA 2RHCA 4JGBA 2P69A 1VJWA 1YJ9S 1DG9A 3A1VA 3HY6A 4QYZK 3BJEA 4QHTA 4KY3A 2WDZA 1OKKD 4OFZA 1VLLA 1FUYB 4IH6A 5ICEA 4POAA 1JA9A 3GR1A 1JAXA 2O19A 4MUHA 1X4GA 2CPEA 2E1AA 5F73A 3CR3C 2D0DA 1YHNA 1QLHA 5CM2Z 2PH3A 2WEKA 1F5AA 3PC8A 4D0NA 2GSWA 4J9VA 1PQUA 5HHTA 4IIJF 4UEJA 3MT0A 5D4OA 1IEWA 4AMZA 1RT5B 3RBAA 3OJSA 2OTLS 3D28A 1RXYA 3GA5A 3WNQA 3QQCD 5KYUA 4YRZA 1R0AB 4QGAA 3ISJA 4W4MA 3B4DA 2VP4A 3MSXA 1VHTA 4JI6F 5A2QY 5ARDA 3E3NA 4JCCA 1KL7A 3VAMA 2VBXA 4CN8A 2I87A 3QIDA 1SUWA 4ANDA 1MB2A 5LQAA 5JDIC 3IMFA 3NHLA 4IYQA 2MHNA 1BE1A 3K6JA 4KRXA 4BN5A 1XMQF 3NHPA 2B9WA 3QO9B 3V00A 1JKIA 1X3LA 2XGPA 4Q16A 1Z45A 3AERB 1QOQB 4PQGA 1WEHA 1U6JA 2VPYA 3A4TA 3QTTA 1R0WA 4RHCA 5DQHA 2IQ5A 4P7KA 2IHKA 1RJFA 4L76A 5AI9A 2PMBA 3K70D 3CGGA 3BD7A 3J81U 1FC0A 5BWLA 3D5EA 3S6JA 5DISB 2M2IA 1GQSA 5DU2A 1I5RA 4IG0A 2ST1A 3V80A 3HTXA 3JTOA 4M49A 4JMLA 4YRTA 1YE5A 2HMSA 4IINA 5JD5A 5CYQA 1Q3KA 1XRSB 1MRZA 4MLZA 3KQPA 4PLWA 2P2YA 3QXXA 3OAAD 2AL7A 1GAWA 5G0TA 3D1LA 4FS3A 1Y5IB 1ENZA 3IS3A 4G63A 2YIMA 4RYLA 1RA6A 2GIFA 2K8GA 2CLCX 4IIFA 3NIWA 1H5QA 5BNWA 3V1TC 1N5RA 3TRIA 1ABBA 4I5DA 1GAJA 2Q4DA 2NSYA 3MLAA 4XB6B 1QK3A 2IBOA 2GCOB 3FNRA 1N92A 3CZMA 2FCRA 5BVHA 3Q2IA 3OEWA 4L5BA 1ORDA 4K0RA 3R7LA 1TCAA 2ALZA 1RCTE 1U9CA 3BXZA 4LX0A 1WUUA 4Y2TA 3K5MA 3HHNB 4M5IA 2LNDA 2GM4A 1H4VB 2F3RA 4O3RA 2ZYAA 3CDEA 1L3KA 1X5TA 1XXHE 1SCJA 4TTSA 1LKZA 3OFND 1QIDA 3RB4A 4W9RA 1DRZA 3MJTA 1K97A 3NC4A 3QY9A 1U3CA 2D7CA 2JFQA 3A6FA 3CH7A 1DY3A 3MCSA 1JHVA 3TZKA 5EJ6A 1IUJA 1GJRA 5GTDA 4L3OA 4LBVA 3Q5DA 3UJBA 3OSPA 4DKJA 1WIWA 3WRYC 1KC1A 2B5JB 2VRCA 3TTVA 3EOBI 3GELA 3W5BA 2YKQA 4GIBA 2CVZA 2R62A 2EBGA 4AECA 3O0DA 4PX2A 2JA1A 3DOLB 4P71A 1LTQA 4IHJB 4DN6A 2YNGB 6NULA 1TYAE 3C85A 1WKCA 3DGPB 3PD1A 2YQ1A 3RUDA 3FDJA 2R8RA 2X3GA 4Q19A 3H2ZA 1OBFO 4ZPWR 2JGDA 1QHHB 3DMRA 4AKSA 1XZLA 1TAUA 3C14C 2CEAA 2VB6A 5DM60 1L1EA 4GX0A 2B8TA 4DOZA 3CKMA 1GZDA 2VHJA 3DBRB 4KN8A 3TR5A 3F6SA 4KFUA 3A6EA 3M82A 2BLNA 1N6IA 4I8DA 5IWAJ 4NK5A 3O2IA 5IP5A 1GU1A 3AY7A 4FNMA 1VQ5S 3W6PA 1Z8FA 2QUZA 3HYRA 1KBZA 3P0FA 3WK7A 1GKLA 4Z2XA 5HO4A 5AW8A 4MZDA 3T7KA 1XNRJ 2FX2A 1FPMA 1LW7A 3GLTA 2XY6A 4I1PA 1A8UA 1PJRA 3CB2A 3OW2R 3WGVA 2R6R1 4E33A 3KYIB 1RLUA 4TYBA 3R7BB 4NWBA 3KSAC 3FC9A 1U0HB 1SB6A 3E22A 4L27A 1U99A 4LOHA 4JP5A 4KYIB 2LU2A 1N25A 1C0UB 3SC2B 2V55B 3CINA 1GDHA 4DCCA 2H31A 1O4WA 2VQFJ 1GG5A 4HKTA 3T7TA 3PUZA 4IUDS 1RKBA 1JKHB 1Q20A 4C0AC 4DPXA 4L4RA 1OD6A 3C4QA 2QRKA 2Y1LB 4C6RA 3TA2A 1RYFA 2XOEA 4D4JA 4CUJA 3K0KA 2VDQB 1ODIA 4JHXA 1GDDA 2WTEA 2C0QA 4PLFA 1CJUA 3KMSA 1VQLS 5TQ2A 2V6IA 2H9YA 3INNA 1HDRA 3UYLA 1XAGA 5FNZA 5JSFA 2LU1A 1SCUB 3E9CA 4HEJA 3JSRA 4IFTA 5I3QA 4MW1A 1UMJA 3JATA 2EFQA 3CF0A 4RD4A 4E21A 3CEDA 3CXRA 4POOA 3KYDB 4YAWA 3VO9A 1E1DA 4MK9A 1WQ3A 1ACMA 1D07A 2XA1A 1I7SB 2FJWA 1ZIPA 4FKMA 3OL9A 4M9QA 3NHBA 1N0HA 1JJ2R 3A7EA 1TNDA 1Y63A 2ZAMA 1SIOA 3C7DB 2H29A 4HQ0A 1Q0UA 4HNVA 2GEJA 1IB6A 3HDJA 1DBRA 3U4GA 1ESNA 4BFCA 2F4NA 4UZSA 5C24B 1K8YB 1VKZA 4E3ZA 4BUJA 5JJIA 2CPFA 4LIRA 1Z08A 2R66A 4KV8B 1SPBS 5FTMA 4BAGA 4ED0A 4YP0A 4NLRA 2CB9A 2PR2A 1F0YA 4WINA 3MQFA 2AFIB 2O1PA 1KHVA 4Z4EA 2H1LA 4KAXA 3BSNA 2DYAA 4IV8A 4D8YA 3AGQA 2N82B 4JOUA 3LFUA 1Z25A 4YJGB 1DO2A 2LXIA 2CXOA 2AG5A 1DAMA 5K0JA 2W8BB 2D1QA 1CUGA 3SS9X 2DH6A 1GQQA 2VRBA 5A8KA 1R8YA 2JJ2D 4R1PA 2R00A 4LQLA 1M74A 1V8FA 3EA5A 3MUNA 1UMBA 4A8OA 3RC2A 4YH1A 4RR5A 3ROPA 5FPQA 1LDMA 3CNOA 2HHHJ 1W0JA 3SM3A 5A2QU 4DCVA 1UQTA 4PUOA 4RTNA 1JLEA 1EK1A 3T9ZA 5AI6A 3FTDA 3LPCA 2IDEA 1X1DA 3ETLA 4ZQEA 4HAWA 3OTGA 1XDZA 3COWA 2E1PA 3ZWXA 3ZZMA 2WDPA 1C7ZA 1EM8B 1GYQA 2G7MC 1NH8A 4B87A 3FUWA 3RFTA 5B0CA 1S72S 1QK5A 3FFBA 2VC2B 4ZO9A 3UDVA 2Q0XA 1LQUA 1MJGA 1AUXA 4RKUC 4WBXC 1QE1A 4ONEA 1J5EF 1TJPB 3BREA 5JZMA 3DT8A 3EZFA 3VPGA 5ETLA 2V8VA 3MT7A 1VFNA 2V94A 1Y4DE 1AQYA 1XMOF 2J5RA 1WG8A 5HG0A 2AOTA 5D51S 1PI3A 3B6EA 3C15C 1TZ0A 1MP0A 3ENAA 4JI1F 1KOJA 2XGJA 1C8VB 1Z38A 3BH6A 2QI9F 1OA0A 4TTIA 2V4RA 1PHRA 4ZHQB 3VJRA 1BDHA 1NN1A 5IFMA 5GMEA 2ZRNA 3SIPA 3H2KA 2JD2A 2GARA 2J6CA 1Q84A 4YHHB 3DEKA 3RYCA 1Y9EA 1K3TA 1DG3A 4WCDA 2WIJA 2VQEJ 3GVHA 5C24A 3KHHA 3U60B 3NUGA 1JFSA 1UBFA 3LBNA 4F6RA 2GCOA 4CCHA 4U8HA 4WVLA 3UAXA 2GQ2A 3LDAA 4F04A 3G6WA 2KRRA 2H59A 3N2NA 4GYWA 3VHXA 4M4SA 1BFDA 1JIIA 1N75A 2IY9A 4X4OA 3KTAA 4B9VA 3LKZA 3I2GA 1WPGA 1KZ4A 1JMKC 1N9GB 3OE7D 3DLEB 1NE2A 3NGKA 4IRXA 4RW0A 2OAUA 2W9BA 3EVAA 2BI8A 4OAPA 3OICA 1G98A 8ABPA 4NE9A 1M5UA 1OXVA 4DU8A 1IZ0A 2AYXA 1Z0JA 4IJ6A 1B73A 4JUDX 4XUEA 4GDFA 2UUTA 1Z5VA 1NPTO 4FXVA 4FYWA 5CVJA 3M7IA 2CMFA 2X5OA 1GGFA 4URHA 2WU4A 3A3PA 2P79A 2LZ0A 4FDFA 5EJIA 2ZRMA 1KSPA 1AY0A 3TNVA 5GVQA 4YFVA 3RYIA 1V6HA 1SHUX 1QGAA 3IUPA 4OF4A 4K7JA 4P3NA 1II9A 5A1JA 4LYJA 1U0FA 5HM8A 4N0DA 1ZM4A 2P2SA 3D3WB 4A6EA 4PN3A 3T1HB 3T3EA 1XTJA 1CJTB 4OV6A 2PFDA 5C2JB 3LNCA 1RHUA 2QRMA 5KT6A 2Y6VA 1IXZA 5CDFA 3QYYA 2CADA 1WR8A 4LFBJ 2ILZA 5KFMA 1P7WA 2PV7A 1VQ1A 2DR6A 3ROZA 3LT4A 4EJ0A 4A6XA 4F4XA 3AXTA 2G7ZA 2JGLA 3UDCA 2IX9A 4YFYA 4GMFA 3Q8VA 1GCAA 5K8MA 4CG0A 1T6XA 3QT8A 3LKVA 3W8PA 1U8XX 5E0KB 4B3MJ 1TZ2A 1CUBA 2LCFA 5I5EA 2F3UA 1QGUA 3R5BA 3RU2A 4OX6A 1B0VA 1USKA 3T7EA 3NG8A 2WT9A 4U6NA 2NPFA 1CFJA 2QMYA 3WX4A 1OU0A 1PN3A 3S4YA 1N5OX 4YGXB 1O0PA 4FQ5A 3GFQA 4RBUA 2OB2A 1U8AA 4P4LA 3U4HA 2QY9A 1MG5A 3DE1X 1UDCA 2C7QA 5HILA 3ZKWB 2HAEA 1SVSA 1WUKS 4MAFA 1ECPA 3AJDA 1PT5A 5CHCB 4TM8A 1QTNA 2V7VA 4HUQB 1GAOA 3A0UA 5CA0A 4Q7LA 2F62A 5BPFA 1JNXX 3OZFA 1R9JA 1VJ5A 3H0EA 4Y8VA 1YRTA 4EFMA 4BV2A 2UVVA 4NMWA 2PXXA 3TSWA 3UJ9A 1O97C 2EERA 5DBGA 7AT1A 4UNRA 5BV2P 2Q5FA 5CB8A 3GD7A 2WJVA 2ZS7A 1ZK4A 3MXHP 1UMBB 1PGPA 3OTOF 5TV2A 4CNZA 4QIHA 2CWDA 3AHFA 1RT4A 3EMVA 4GRIA 4GM1A 2FYTA 2VTKA 2CC2A 1CUUA 1DJQA 1A2QA 1L1QA 1YRXA 3UHFA 3UBMA 3GWGA 2PUVA 2P2ZA 2RSQA 4B34A 3MPYA 4MW0A 3I9MA 4ENTA 2G5TA 1HE4A 3ZCUA 4G24A 1CRWG 2AYYA 1M6NA 3ELHA 3UVJB 5T3UA 1RTIA 4XOUA 5JVHQ 2C5SA 1BMFA 2HRBA 3T5KA 5C1IA 3MM8B 4H0CA 1U2DA 3TZBA 5ALPA 5UKDA 2ZYHA 4BKMA 4LXTA 3C3BA 2XOXA 4JI0J 3PJGA 1Y42X 2OC4A 1C1XB 3U81A 1I6MA 3RQIA 2O8FB 2XMBA 2DFVA 4ZMSA 3OECA 2X2FA 2DETA 3NWRA 5EUQB 2YICA 5J1PA 3KKFA 1RI3A 4R9VA 3ZV5A 2H1FA 1Y7HA 1NL3A 4FR5A 1RTDB 4NATA 3KLOA 1ZM3A 3PITA 2HGNA 4LXQA 1JX6A 2ZFUA 5G1OA 3E58A 5G3YA 2FVXA 4PYNA 1OWLA 3IR6A 3QY0A 4EHFA 6ADHA 4PQAA 5CK5A 3RRBA 3Q2SC 3EUNA 4CTOA 5AUNB 4PYLA 2GYUA 2GASA 2J9RA 5DIZA 3HWX1 5ELMA 4MKVA 2VPYB 3SC6A 1L4NA 4LHXA 3DI6A 1R4ZA 3NX4A 1V3RA 2BE9B 4DV7B 4EBBA 2JI6A 4BPRA 1FKOA 3BRWA 4HGRA 5JISA 5JH7A 2Q6OA 5AK4A 5DZ6A 4MI9A 5JAOA 5HZHA 4FF3A 3HUEA 4QYSA 4EY5A 2C8VA 1BXGB 2PUEA 3B8HA 4NCBA 5SZJA 4P4TA 1UEIA 3IEPA 2GK6A 3AA9A 5KFHA 4ZODA 3UO8B 2UUBJ 1WCYA 2NUTB 4DARA 2Y27A 2ZSJA 5L3QB 1TCUA 5KNDH 4BMSA 3HBFA 3QPCA 1RBLA 2YVSA 4OBEA 3E8OA 2CNKA 2YY6A 2R25B 1B26A 3AI1A 4C43A 3GY0A 2O0MA 4YUAA 1NQAO 3E48A 4ENUA 4QTYA 5HOEA 3C48A 5T8KA 4S1OA 4TQRA 2XXBA 5T67A 3ETOA 3V4RA 5HQMA 3OLYA 4FOPA 1CG2A 1CJVB 5ETMA 1J5EJ 2HQOA 4QYTA 3JAWB 1ZH0A 4G0XA 3T9NA 1JH9A 4AJNA 2V9WA 4HLUA 3LRTA 3L2OB 2B4VA 3KNZA 4UXHA 1DJOA 1WXGA 4C7QA 1D0VA 4DRXA 1TF2A 4WU3A 1ZXLA 5C7LO 1YU6A 4ZCQA 1JQ3A 1G5FA 2V03A 1R4MB 1UBMS 1WMAA 2A92A 3NMRA 2O1EA 2AJ2A 1ADGA 4BQPA 4EJFA 3RU3A 3GFFA 1KH3A 1N6NA 3TOCA 4MWGA 4EB8A 2EATA 3IS9A 5B7WA 4NYJR 4XTRA 5LUAA 5SUHA 3AK4A 2MZ1A 2ZZMA 4HYYA 1RZRD 5ALIA 4FINA 4HZIA 3KLGB 2BRUC 5KTYA 4DUZB 5JXGA 4O4HF 2C2NA 1E9EA 4WK1A 2QJTA 4M89A 2GUWA 3QF4B 4JC4A 4B76A 4JA0A 4AJEA 4R5HA 4DEZA 4ZPAA 3QKTA 4GXNA 1WACA 1W44A 4B3BA 5H3LA 3BB1A 1KQGA 2OHGA 3T4XA 5K0FA 3HBLA 2WWGA 2VT7A 3FMOB 3O94A 4L9SA 1RYBA 2JFXA 2PDAA 5FBHA 4J1QA 3TB6A 4MYSA 2JIMA 3PGVA 4DR4J 2VL7A 2POCA 4N3BA 1KMMA 2Q7XA 4NFSA 4R8MA 2DPYA 1JFFA 1Z82A 1A98A 2G0NA 3JQ7B 3FNQA 3HSGA 2XQGA 3EIEA 2QSUA 2JKVA 4P3XA 1XAHA 1ZJYA 3L05A 2Z5FA 1MLDA 3TD6A 1Z3IX 3R3XA 1LEHA 5TS3A 5HF5A 2C7GA 3EZ9A 2GQQA 2P4EA 1ZY2A 1FDWA 2W2NA 3BEGB 1CJUB 2AQ8A 4JZKA 1A9ZA 1YHZA 5FUYA 2IZ7A 5IJAA 3WOHA 4CBVA 5KC9A 2DPHA 3KUXA 1NM5C 2PJUA 2Q5CA 4D79A 1NMXA 3NOXA 4CKEB 3KHTA 2V7TA 2O01C 2XMDA 3BMOB 3W5CA 1EK5A 3MOZA 5CAAA 3DYAB 5P21A 3CCJS 4PYJA 3OEHD 3IELA 3E7XA 3PC8C 3DDNA 4YECA 2J9EA 1GZ5A 3A3YA 3CMQA 5DFAA 2GLXA 4IO9Q 2CRLA 1B8UA 1ZYUA 2PRJA 1NDKA 2VQDA 3LOQA 3NS6A 4JI5J 4ES3A 3WNCA 2L0XA 5GV7A 4FB4A 4EQ6A 5FBRB 3ELUA 3DBVO 4EHJA 1MWZA 2ODPA 4LXUA 3PX7A 3O8NA 3MJSA 3I76A 5LCXA 1J0EA 3TMKA 5E9WA 3BFXA 3OKFA 5GJCA 3JQCA 4ZCIA 4KYVA 2JJ1A 4AJ2A 1HLWA 1T3LA 2Q1XA 3VV2B 1Q15A 3H5IA 3CF5Q 3PNPA 4TTJA 3BQMB 3AHJA 1FDNA 3AEUA 4KRGA 1SU8A 4B3JA 4G8BA 1FRHA 2L2QA 4UMVA 4U7UK 4J1NA 5A0YB 2RNEA 4DN9A 4BYMA 3F5FA 4U7DA 1HQUA 2QA2A 2CJXA 2RGWA 2IW3A 2XYRA 4ANEA 1RTDA 3IHLA 2KJVA 3JQEA 4QDZA 3A05A 1IN0A 1UJ6A 4FDTA 5L9XA 1AJEA 1Q7GA 5JNVA 2WYWA 2GEBA 4EUVA 1OJLA 2FH5B 4EA9A 3N2YA 4A8JB 5KTPA 3TBHA 3ND9A 2WBLC 4QYRA 1HFEL 1QJCA 2J3KA 2WTMA 4XPIA 3PX6A 5G02A 3V5RA 2W2KA 3DPIA 5EWJB 2MQ8A 1KFEB 2QTCA 5K8PA 4O0LA 1QC5B 4LV8B 1Z33A 3X2EA 4Z4IA 3NCQA 4FGZA 3R7NB 3UG6A 5ADUS 3TQTA 3CNQS 4UTPA 4OB7A 3J7ZT 1QX4A 3VAYA 4Z7YA 1YJ8A 5IH3A 4KHMA 4UAUA 2J3HA 2BRLA 1DC6A 3R7SB 2XBLA 4KXLA 2G25A 2B5WA 1X4FA 3DMTA 1DAKA 4L4XA 2OPPB 3V1MA 1RYMA 4NOKA 1Y4AE 1IQ0A 3OBIA 3BGSA 4KI7A 4Q9IA 1OB5A 4OGFA 1N4DA 3DMDA 3T9EA 3OT4A 3A70A 1W30A 7AT1B 1TK0A 3QNMA 2HVHA 2JRSA 4HDKA 1IH8A 1FRQA 2WU8A 2GBLA 2P30A 4BLWA 4USVA 4FBGA 4CMEA 2Z04A 3HBJA 3DEAA 2QYHA 1XZEA 3NLLA 5D5QA 2MQNA 1J97A 3ZZ1A 3PT5A 2HNZA 1HDOA 3CLRD 3KVNA 4PANA 1TA0A 4AKIA 5KB3A 1X1EA 2DHRA 3KKMA 1AS3A 4JI0F 3OO0A 1J2YA 3UMVA 3GGPA 1BA3A 5F1OA 2W6MA 4X94A 4IIXA 3K9FC 1EZZA 3QF7A 3QYFA 4M21A 4W5OA 2D3ZA 2SKCA 4XWWA 3G9ZA 1XO1A 3K0HA 3KHUA 5BR8B 5BOSB 4K1XA 5C8YA 2DCLA 3FIUA 3H97A 4RU1A 3WWDA 2IKSA 3I1IA 4AXXA 4O4LB 3PXEA 3E7WA 2FJUA 3KYCA 4BQOA 4IEFB 2PZBA 3MPVA 2P90A 3N28A 5J23A 2DCUB 2PWYA 2ZUBA 3TL6A 2ADFA 4E1VA 2X86A 1NHKL 1IUNA 2BKPA 4D92A 1EM6A 4QG3A 2M9KA 4G0OA 3PRBA 5IZCC 1GYRA 4X20A 4HDMA 3UAVA 4E5YA 2NZJA 3PRYA 1HBOA 1QH0A 4NHOA 1DAEA 1NASA 1YR8A 1DWUA 4MGHA 2ZPUA 1BRTA 4W5NA 1M5VC 3ZK8A 4LYFA 2G08A 4HB4A 2OKCA 3Q22A 3LPMA 3M2UB 2P40A 3FF4A 2EJUA 2OPQB 3P9QA 4KKOB 1UXJA 4INAA 3PM9A 1USVA 4YONB 1UF9A 3WGNA 2BUCA 1K6IA 3U26A 3ZJTA 2R6FA 2DUUA 4HWTA 3JAMU 4DF8A 1OAOA 2OXEA 1HQDA 4DBLE 3GLIE 2GS8A 1TMYA 3JY6A 3GBPA 4LSLB 1QAQA 2AMVA 2O2JA 1GCIA 4EWLA 2JIDA 1WCV1 3TLEA 3DAFA 4YCMA 2J8SA 4ER6A 3H9EO 4R0NA 3QFWA 4WCFB 3IP5A 1F1JA 2JKYA 1QZZA 2EG5A 5CDSA 4AKHA 2XVAA 1KE1A 1QVVA 4X66F 4U7TB 2CLOB 3EEYA 3G1WA 5AK0A 2BRUA 2ZZNA 4M38A 3LG2A 3M83A 4C4TA 2AZXA 4LF7F 1RWPB 3GYBA 4YI3A 5AUOB 4TWAA 2EFGA 3NNDA 1DCTA 3PPWA 5E7OB 4CLXA 5IT0A 2BHTA 3M1VA 2EBFX 2RHBA 2XMSA 3HU3A 1JI0A 5KAMA 4NABA 1TQ2A 2WU1A 4Z5XA 4KLRA 3BM7A 2K2WA 4INOA 4ZLLA 2OCYC 3Q7IA 1ZESA 3O3LA 1SUIA 3HWWA 2QY6A 2HN9A 2W93A 3LHSA 2VXYA 3ZWWA 2H8GA 4NIMA 5HJ5A 2BEUA 2AQIA 4UTRA 3PG9A 3BMCA 5BSVA 5AKIA 2OK7A 3D67A 2DFLA 2EYUA 2HJWA 3QW2A 4OJHA 2LVBA 4Q43A 1BH6A 2ZBQA 1TIKA 3SN6A 2AHOA 4A82A 2C4VA 1FDUA 1HQYE 3P9KA 1V1MB 4GBMA 1AKRA 1SXJA 3JQDA 4OJNA 3P27A 3ZDYB 3J80U 1NK7A 2RI6A 5E1MA 1VLYA 2YNMA 5FWXB 2YJGA 3GI1A 1MC4A 4H7DA 3O95A 2HMVA 4O3OA 1KK3A 2O7QA 3LXMA 3EFEA 2F4VJ 4OGGA 3EE3A 3O8QA 3H90A 5B57C 4XDCA 4G1PA 3HN7A 3LC7O 4FFSA 3U5ZB 3BFVA 2DO4A 1YWGO 4CM4B 2J07A 1N2EA 2PQ2A 2ROPA 2IYAA 4I4NA 4FXOA 3W2VB 3HB5X 1NSAA 1CUIA 1NBHA 2W00A 1KBRA 1WUTA 2A5DA 4ZJLA 4ZVLA 1A96A 3H5UA 2VZ8A 2YIJA 3A04A 1H74A 2H7XA 4LISA 4FEYA 1C3EA 4OQJA 3W05A 1Q17A 1C9NA 1VECA 4TMVA 4IGEA 2V7QA 1MN6A 4GRDA 4ZN1A 1IWBB 3UK6A 4I66A 4FFVA 4TYWA 1MQSA 3RJ9A 2KFYA 2FPIA 1OYOA 4HF7A 2KLHA 2FRDA 2JFWA 5HJXA 2I7DA 4IUBS 1XMJA 1AKQA 2A3JA 2HLPA 2HGMA 3VKFA 4FYPA 2PT7A 1N56A 2DQ4A 2HRUA 4LDZA 4I50B 2I03A 1I13A 3EXIB 4NTZA 1RZRA 4XD7A 1HH4A 3TLYA 5IG2A 2W9CB 3G86A 1Q1BA 1T2UA 3QNWA 4CKBA 2O3RA 1NURA 4IRUB 1U5BB 1X9GA 2HLNA 3O3CA 1MFPA 2NZVG 2VG8A 5JXHA 1H0HA 3MCZA 2YKAA 1GRVA 3CKLA 4YRRA 5CB6A 4QLAA 4J1TA 2ZWOA 4Z1MA 1QGOA 4CIOA 5AJ3J 3VR5D 2PZGA 4PW0A 2QX8A 3SLGA 2P9CA 1TLTA 3EVOA 4MMYB 4DJDC 3AP1A 4BNWA 4CMKA 4ESOA 1PVOA 3EGDB 3JD4A 5TQ0A 1HT0A 4WADA 2Y93A 2YUTA 4H7PA 2OPBA 2AX0A 2IBMA 5KC8A 5ALUA 4PC2A 3KDAA 1NBME 1NXXA 2V1UA 3I23A 3PJXA 2WKWA 1ZD1A 4UBOA 3POTA 1VDHA 4WDRA 2GZ1A 4FWIB 5TQVA 1P19A 3IM8A 1QAOA 5SZKB 3LHDA 2QLFB 3L8ZA 4KHPF 4DZ6A 4AE5A 4LCEA 3B12A 3FNNA 4XZ3A 3KXPA 1FKPA 2PRZA 3QEMB 4DL4A 2CNDA 1AQNA 2DNHA 4E2YA 3ICOA 5ALVA 3SAJA 5AKLA 2GXUA 4EJSA 4URYR 1VQKS 4YP6A 4QTTB 4WEQA 1TL1A 3LQVA 3AD9C 2ZWIA 1EBBA 4HAYA 4AJOA 1WSVA 1RP7A 3GZTB 3UGJA 4URGA 1FVFA 4WNAB 2ZXUA 3ABQB 3F73A 3V1UA 3Q8XB 3CD6S 2EZUA 3HLTA 1X8JA 1FRMA 3KLPX 3OVMA 4DPKA 4Y34A 2DPGA 2GZOA 3GTYX 4M9UA 3N5FA 1G21B 1P17A 1YAJA 1RWXA 4BMPB 3THYA 4KGKA 3VVUA 1HTBA 3HXMA 4TUYB 1UFKA 2II6A 4I1UA 3RYHB 3ULKA 3DHEA 1RM4A 1T0UA 5EIAA 3KSDO 4UQPA 1U24A 2IYXA 3MUTP 3GOHA 5ENDA 1SVNA 3RSGA 4EKGA 3PTZA 3JD1A 2HRQA 4IYJA 1UKUA 3NBPA 1EETA 3RTBA 4E98A 4U7WA 5CDUA 4NQZA 4XQCA 4J0CA 1TTTA 2CXHA 5ALWA 3WMGA 3R41A 5J2PB 2PL9A 3V8MA 4BO9A 2C3UA 4I6JA 4DREA 5K9FA 2QLBA 3V2HA 3BE4A 1YE8A 2CFOA 1QDEA 3DDHA 4IQXA 3FSEA 3RVNA 5DF1A 2F9DA 4J3FA 3BQ2A 4WBNB 2ZKIA 5K45A 2CXRA 2W22A 3BA1A 2H4YB 5DM4A 1C9MA 1B0PA 3COSA 2PRYA 4J1TC 4IFIA 3TOXA 4X1IB 4DQPA 1WL8A 4O1IA 4ACAA 4CV0A 3D2WA 1VJCA 1WXFA 5F7XA 1XZHA 2YZ7A 4UD6A 3L5OA 3ZGZA 3PIIA 2XCIA 5HE8A 3KTAB 2IVFB 2OFXA 4XCQA 3BJIC 2I6TA 1SUQA 2GNKA 1OAKA 3JSYA 3CTPA 2AI1A 4C4SA 5BMVB 5GAHU 2MLYA 4FCWA 1NQWA 4HDRB 4MKHA 2PWAA 1SH2A 3SX0A 2HNKA 5GWXA 3CMAS 3QUCA 2XXJA 1ZZGA 1G41A 3T0FA 2O8FA 1BY9A 2X0KA 5EP1A 3QSIA 1XDDA 1B6TA 4YJ3A 5BR8J 2EVZA 3C8DA 3O4HA 1P45A 2X22A 3RS5A 4B3TF 2R8GA 3NORA 1T9GS 1I1QB 2Y9MB 1B3TA 2Y99A 2J3IA 5F2EA 3DMTC 4JDPA 4JI2B 5TT0A 1ZWKA 1NSKL 3L6OO 4TTQA 2E9ZA 3G8TA 5AHKA 2Q1UA 2XO7A 4WQMA 1TVKA 2WFZA 2CJKA 1R50A 4OQEA 3ILLA 3OX3A 2YNHA 5HJYA 1DBWA 3DV9A 3GG1A 1N3YA 1MOPA 1VYVA 5AW1A 3PFIA 4IOBA 5FUWA 3R8XA 1SXJE 3UKJA 1G7TA 5ITZA 2GMLA 3SQGB 4MUNA 2VFUA 3IR7B 1F5NA 1W76A 3Q7QA 2I3ZA 2R7RA 4U8YA 3U1LA 1TV6B 5KJCA 5JCZA 1DKPA 1YNOA 3VH4A 1ZD4A 3M8YA 1DTWB 3OT9A 4CEJB 1GVNB 1GR0A 5TVGA 5GONF 2R84A 4Q3BA 2P9BA 4DXAA 5LIPA 2L48A 1R4NA 3F0NA 2XUJA 4AQYJ 1G17A 2OM2A 4OX9F 2ZVQX 4JV0A 3LHIA 4ICLA 3B51X 1HNWF 4EZIA 3DFUA 3PWSA 4V3BA 3IEUA 5KUTA 3HI9A 3EX7C 1RT3A 3P0RA 1V8OA 4DDFA 3CBQA 2JLYA 3REOA 1QO9A 2B7CB 4RLHA 1RHRB 1E99A 4Y2UA 3ZD6A 2EXXA 4Z54A 3L93A 4C78A 1RI5A 2JI7A 5DGIA 3AJAA 2ASDA 2PN1A 1Q44A 2VR1A 3F7TA 3DBRA 4PZVA 5LU8A 5JW6A 1WHTB 2BGGA 2FHPA 4QR1A 1NVBA 2YHIB 2HLDD 2X9QA 3H1GA 4C11A 3K30A 5KT5A 5H16A 3JVEA 4JY7A 1IVYA 2F1OA 4WOCA 4EHNA 5EUBA 2M32A 2XADA 4KTVE 3A6HA 6AT1A 4I14A 3UOWA 1TW3A 3RC3A 2BFEA 2NSBA 4TZTA 3A14A 1ITZA 4LYDA 3G2KA 1S2IA 5KDDA 1W29A 3WZ2A 1P1RA 2GBPA 3MGGA 4BTEA 1VE5A 5CT8A 4HMPA 3GXBA 3KTFA 5BUQA 3KG4A 3EGWA 5D3GA 2JX2A 3G82C 3VSCA 2VYVA 1JWWA 5DM0A 5EJEA 1EUDA 1O94C 2HMUA 3LHFA 2R7NA 4CDIA 3H3FA 3PXAA 4I8IA 4ZVSA 3BBLA 1RKJA 5JH7B 1EFCA 1FXSA 4N8OA 4E5DA 3GUYA 4JQOA 1NHWA 4MGYR 5CB4A 3W2GA 1P31A 2PS3A 2WWXA 4OM8A 1CJTA 4WY2A 2JCSA 1CC8A 3G8BA 2HTFA 3T3PB 3GWCA 2IP1A 5FNVA 4GR4A 3FOFC 4WLEA 2NO0A 5EZ6B 3IKJA 4ITSA 3L7BA 2W71A 2YNMD 3OR1B 2EKLA 2AN1A 5G0UA 4R5PA 2Y67A 1EI9A 4H0NA 4ZQBA 4ZKAA 1G3RA 3ZZPA 3K1YA 3RLIA 3L7PA 4KLNA 2LCQA 4ZVOB 5K3DA 4CWBA 1CEYA 3TFOA 1K8ZB 2R2SA 1YVPA 1L5NA 4TU8A 4Y6SA 2JNWA 3GFSA 4CV3A 4FYWB 1EIZA 2FUG6 1ADCA 3WV4A 3ITDA 3TDMA 3GHHA 1PJ6A 3TSZA 5KNLA 2XSFA 4O1HA 3UCUP 1U8CB 1S6UA 4JI7J 3V9PA 3M6IA 1X1SA 1YFKA 1ZU5A 3BH7A 3L8DA 1VIXA 4OIXA 1F0PA 2YCBA 3P2OA 3OSUA 4OFWA 4RZ2A 5KNBD 3MIIA 1JIXA 1OBOA 1EAMA 2BWJA 4ZDIA 2PA8D 1UZNA 4KOAA 3ROXA 5EPEA 1U2TA 1NKCA 1K0TA 1E64A 3W4KA 4FI3C 1KHHA 3DYVA 1HZZA 1C9JA 3PACA 1CF9A 2IQIA 2OBXA 2R6CA 3B4MA 3H04A 2IOQA 2OCAA 3R3SA 1LWNA 3AF1A 1TZMA 2FXIA 2GD6A 2VSFA 4EYOA 2BEKA 5EXSA 1F2TA 2VSNA 3TQSA 1IJEA 5GAHI 4FNOA 2Q7OE 4FYDA 1F0NA 4UC0A 1Y81A 3C70A 3D64A 4QODA 4ES6A 1J06A 1L7MA 1R6UA 4Y0FA 3RWBA 3EGIA 3TQRA 2AJBA 3EC7A 3OL8A 1J5OA 1ZG3A 4Y3CA 4JR2A 1HNWB 2O1XA 4AU1A 2GQ0A 3VDMA 2XTJP 3C6YA 4CW7A 2ATLA 1XX6A 2NW6A 4RLQA 3TNJA 1XMXA 2EFHB 1IBKJ 4EBEA 4ZVSB 2Q2OA 1NMEB 4KR0B 2HA7A 4QDUA 3SS7X 5HCUA 1QHIA 2CXEA 3DVAB 3PFKA 3O9VA 2DTDA 3HKBB 4B44A 5K0LA 1TX4B 3FTPA 1BWPA 4NYIR 2FP4B 1B3RA 1P6UA 4QYIB 1G291 5TNXA 4A2WA 4MIOA 3H5XA 3CCES 3R8FA 4J7XA 2HHWA 4BY9E 1H6KX 1NQOA 4MRPA 3PX2A 1YS7A 3C3EA 4BWFB 1NKEA 4EG3A 2VJMA 3M32B 1F60B 2WVCA 3FEZA 1E9BA 2Y9HA 4MLDA 4I1SA 4MB2A 1VQ7S 4IMJB 5ENVA 4FC6A 5HZKA 3WWZA 2IUSA 4DFKA 2HU7A 4A0RA 2YW9A 3CM0A 3LAWA 4RFLA 2I65A 4LQDA 5GONB 2GDJA 4DU7A 3R1LA 4OHYA 2ZPTX 4MS4B 5DI3B 2VYND 3H42A 1K08A 3T5DA 4MV9A 1PGQA 1VI2A 4COKA 3T7RA 4BFXA 5CD1A 1CUZA 3GB9A 1RWWB 1FP4B 5THQA 2V5UA 4DLUA 2GNPA 3KQHA 3RVBA 3EAFA 4YCBA 4CQ1A 3GMSA 4ZT3A 2VLBA 1EB9A 2PGDA 4H1WA 1GGKA 5CA1F 1TJNA 3NJRA 5JROA 2IYWA 4P2FA 3VPHA 5TE9A 4F1WA 4D4IA 4W4TA 2R6GA 1U5AA 1VPDA 4JYZA 1UBOS 4LF6F 2HRZA 3QOXA 4NEHB 4G3XA 2GF0A 1EJ2A 4WFJA 4P9NA 4TSRA 1YTLA 2IV7A 1EWTA 1U09A 1G8GA 1Z75A 3ISTA 2D13A 3WQBA 3HP7A 4YRPA 5I42A 3N8IA 5JNTA 4GRSA 2WKRA 1RB0A 3MEEB 4F9GA 3GJXC 3LUHA 3G0BA 1YZNA 4HNRA 4UUAA 4HQLA 5C0OE 1X4HA 1JA0A 2O2DA 3IDFA 3D4IA 3A58B 1C7IA 4ZOEA 2VG7A 5KFFA 4CEIB 1ZYQA 2QMOA 4AFNA 4ABTA 2ZK7A 1GPUA 2QPTA 1S1UA 2I7TA 4CQMB 4QGFA 3BO3A 3ZR4B 1G5QA 5F1KA 1G42A 3H8JA 2VC0A 3A28A 4LI3X 1UMCA 2RS2A 4YMVA 1SGWA 5CDTA 4R16A 4CGYA 4AG5A 3DSRA 1J2JA 1VJGA 4FZ5A 2JAWA 1WG5A 3VTAA 5AJVB 3RODA 4QGHA 3QZ8A 1M34B 1DUIA 2EW1A 4ZPJA 2JZNA 5K4GA 1YQDA 3HRHA 2RI0A 4BN0A 1H6AA 3BGDA 4JQCA 4KSYA 2O14A 3PL1A 2H63A 1IUKA 2QAGB 4M54A 1VJ0A 1G6Q1 4EBCA 1Y0BA 2IXFA 2DKNA 2I76A 4M55A 2X51A 1IFXA