4GVUA

Lyngbyastatin 7-porcine pancreatic elastase co-crystal structure
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title Potent elastase inhibitors from cyanobacteria: structural basis and mechanisms mediating cytoprotective and anti-inflammatory effects in bronchial epithelial cells.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gvuA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gvuA01
1BBRE 3UY9A 1ELVA 1TPAE 2AIQA 1QJ7B 1BTZA 2RCEA 3SHAH 4VGCC 5EOKA 1SGIB 3SV6A 1G3DA 1PYTC 5EU8A 5GDSH 1KTTB 1GCTC 2ZDLA 4HFPB 1T8MA 3B23B 5GJ4B 4CRCA 1GBAA 5LH8A 1S0RA 2XTTB 1IQNA 2WPJS 3ZYEA 2PW8H 1SGDE 3M61U 1E36B 3SNAA 1VZQH 3LGIA 1H9HE 4D76A 1VR1H 3ZZ4A 1C5SA 3S7HB 3A8AA 2VB0A 1HFDA 1LHEH 1O35A 2HNTF 1GCTB 2STBE 1CA0C 4ASHA 3LJJA 2CMYA 2ALVA 4I33A 5C20A 5GCHG 2W3KA 3ZZ6A 4IBLH 5BRRE 1O2MA 3F9HA 1A46H 2WUBA 1F0SA 2O8WA 1ZYOA 1MD8A 1F0RA 2EI8A 4AGJA 1TRMA 1XKAC 3MHWU 1PJPA 3AW1A 5DP3A 1ZMNA 1K28D 3QZQA 1K21H 1WYKA 2RA0A 4AX9H 3QGNB 1Z71A 1QTFA 2F9VA 1TLDA 4LK4A 1N1LA 2W26A 4A1VA 1SGYE 1F7ZA 4YT7H 2V6NA 3QDZB 1E34B 4B2AA 3ODFA 3MO9A 1CT4E 4IS5A 1MKXH 1GMCF 2HNTE 2UWOA 3MH6A 2BLVA 3LC5A 2GMTC 2OD3B 1Z1JA 3FFGA 4K3JA 1HB0B 3RXUA 2FLBH 1KXCA 4JMYA 1BRUP 4MPXA 2VIWA 4BTTB 2GDEH 1EOJA 1UJ1A 3S0NA 1C1TA 1C5QA 1L1NA 1N8OB 4Q80A 4Y0YE 2ZDVH 1TABE 1G9IE 2VIQA 2XBWA 2C8XB 1SGFA 3E0PB 2BY9X 2YNBA 5ETXA 1ELGA 4O3TA 3F6UH 1BMLA 3GCTF 2OC7A 5FBIA 4CRFA 2TGPZ 1PQ7A 1C1MA 2ZCHP 2IOTA 1OWIA 5A8XA 3IG6B 2OUAA 3LIWA 1O5BB 3BN9A 1GMCG 3MNCA 1MCTA 4WMFA 1OKXA 4GPGA 1C5YB 2J95A 3M3SA 4D7FA 1XX9A 1ZPBA 1O2VA 2J9NA 2CN0H 1EP6A 1O5FH 3A80A 3RMLH 4AG1A 1YC0A 2ZF0H 4RN6A 3GICB 2HGTH 4BXSA 1DM4B 2ZG0H 3GCTG 3QTVH 1A5GH 2VIVA 2ZU5A 4B75A 1SBWA 4CRDA 1GI4A 4TY6A 3EQ0H 5A0CA 3RXSA 2Y81A 1AWFH 2D8WA 4X8SH 2FTMA 2GX4A 2XBXA 4X6PA 1BHXF 1LKBA 4ESTE 2A32A 1AFQB 3Q00A 1EZUC 2FXRA 1P05A 4BOHA 2G8TA 2GD4B 3T26A 1W2KH 4R8TB 1AN1E 3BV9B 1LHFH 2BOKA 4GUXA 3SUEA 1BHXB 3K65B 5HM2A 4FUHA 4GLYA 1OXGA 1AIXH 5AHGH 3RP2A 1LVBA 8LPRA 5FAHA 4NA7A 1TIOA 3JZ1B 1UTKA 3HGNA 1OSSA 2ZGJA 1EXFA 2JH0D 1BMMH 4NA8A 3ZVEA 2OQUA 1LQDB 3EGKH 3TGIE 2A4GA 3ZZ8A 9LPRA 3S9BA 1O3EA 1ZPZA 3NPSA 1OX1A 3P8FA 3SBKA 1Q31A 2Y82A 2AMQA 1AE5A 4FUIA 3URDA 1RFNA 1O2PA 1WQSA 3ZV9A 3MWIU 1LQEA 2LPRA 1GBJA 3PTBA 1AVXA 5DP6A 4OS5A 1CT0E 2BVSH 4D9RA 1A7SA 1DSUA 1O2WA 1SQTA 3K9XB 1TNKA 1UTQA 3T25A 1V2LT 2GZ8A 5DPAA 4I8KA 2ZNKH 3M5MA 5L6NH 1T8OA 1C4V2 5C1XA 2P3FH 2QCYA 1SHYA 2CHAC 1GJ8B 1O38A 2ALPA 2G52A 5T6DA 3SU4A 1MKWH 3A83A 1QFKH 2BB4A 1GDQA 1TA6A 1HAOH 5FBEA 1ZOMA 4MQAA 1RIWB 4CREA 3H7OA 2A7HA 1TYNA 1RXPA 2QF3A 3LH1A 2QIQA 2W3IA 3VB6A 4ABHA 4AORA 5JB9S 4X2XA 4JZIA 2BDAA 4ABGA 3M37A 4ABIA 1AE8H 4X2YA 1HXFH 3W94A 1EX3A 1C5ZB 4AOQA 1ZHMA 1NZQH 2PUQH 2I6QA 1FXYA 2BY5X 2F83A 2G5NA 2J4IA 5A8YA 1N6YA 6GCHF 4JK6A 1K1IA 4K8YA 6ESTA 1SMFE 1BRBE 2XCNA 3AAUA 3SHCH 1ARBA 2UUKB 1FN6A 1T8NA 2GCTC 3T5FH 1RRKA 1OPHB 2ZHFH 4A5TS 2BDYA 2P59A 1FQ3A 1GJBB 4MVNA 1QJ6B 1HIAA 4CH8B 1GHXH 1Z6EA 1SB1H 3LGUA 1TBZH 2A4RA 5TCCA 5JBTA 3RXHA 1C2LA 1MMJN 3D23A 4E7NA 3TJNA 3ZVDA 1A4WH 1W14U 2XC5A 3A8CA 1D6WA 2JETC 3I29A 4FU9A 1O3GA 2OXSA 1O2SA 1XUHA 3GCOA 1CBWB 1KIGH 5EQSA 1SLWB 1J16A 6GCHG 2FOGA 3NZIA 1BTXA 1LKAA 1Y5UT 2TIOA 1O34A 3MU4A 5AF9H 3Q3XA 1EASA 3MTYA 5L2YH 1G30B 3SOSA 1GHWH 2Z7FE 2I6SA 3ZV8A 1CGJE 1S0QA 3UQVA 3MU5A 1GHAF 1T31A 4AB9A 3U8RH 4ZHLU 3SN8A 1HAVA 1VITH 1TNGA 1QRWA 3A85A 4HTCH 4U30A 3KHVA 1YPHE 1IAUA 5DK1A 3F1SB 1PPFE 1YPEH 2CJIA 4NIWA 1GI0A 1KXBA 3SO3A 2NU1E 5AVDA 2BOHB 1H9LB 1Z1IA 2O8LA 4XOJA 3ZVCA 3ZYDA 4BTUB 1FY1A 1BTWA 3M7UA 4DVAU 3SZNA 2Z6BD 5CHAC 2A4QA 2PV9B 1B5GH 1W11U 4FU8A 4NSYA 4UD9H 3RXJA 1BMNH 3RM2H 1GHAG 4NIVA 1ZGVA 2J2UA 4MNXA 3FZZA 5DO4H 1LMWB 4UONA 1W7GH 2DE9A 1G36A 4WH8A 1F2SE 4ZMAH 1UK2A 3ESTA 3GYLB 2PTCE 4MPWA 1GJ5H 2A7JA 5GXPA 2GTBA 3R3GB 3DUXH 2BXTH 2QV1A 2G4UA 1GI5A 1DY9A 3E0NB 1P3EA 2ZHDA 1TA2A 1ZRBA 1HJAB 4B76A 1DWDH 2OBQA 1D6RA 1W8BH 1EPTA 3LGTA 3VXEH 4DGJA 2AS9A 1SGEE 3FVFB 2AMDA 2BD4A 1MAYA 1W12U 2H2ZA 3FP7E 2H9TH 1DANH 1NRSH 4CHAB 3MNSA 4GCHF 1UCYE 1TFXA 2ZFSA 3SU3A 1GMHF 1FPHH 1FY8E 1OS8A 4CR9A 2BDHA 2AMPA 1FIWA 4H6TA 2BTCE 3EAJA 1B0EA 4THNH 2GCHF 1O2OA 2TBSA 2VIPA 2BD8A 4UE7H 4JYUH 3STIA 1C1UH 4X1RU 4WMDA 1G3EA 1FDPA 2XWAA 2ZFFH 3ZZBA 2XBYA 2AH4X 5T6FA 4Y8XA 1P2KA 2BZAA 1ELTA 2FOFA 5FX5A 1SL3A 1TONA 3BTDE 2D2DA 4GCHG 4Y0ZE 1GMHG 3RXEA 1V2VT 4DG4A 4DY7B 1O2NA 3MYWA 5HXFA 4BANB 3KEEA 1OWDA 1D9IA 1DT2A 2FOBA 4O9VA 1LPGB 4X1NU 1YCPM 2H6MA 4YLUA 2GCHG 5T6GA 5FPYA 2HPPH 4RKJB 1PQAA 1A3BH 2O8TA 4MNYA 2VVCA 2NU3E 1HUTH 2B8OH 5L30H 3JZ2B 1V2OT 1QQUA 3RU4T 3EYDA 2SGEE 3STJA 2ZGCA 1TPPA 2BX3A 2F91A 3F9GA 3PO1B 1HBTH 3PWCA 1SLVB 1HNEE 1C5VA 3U8TH 4A1TA 2OP9A 2TGTA 4I7YH 4F4OC 3BTQE 5EGMA 1S82A 1PPBH 3VPKA 4ISHH 2P16A 1YPLH 1CT2E 1MU8B 5EPYA 3T28A 5HM9A 3QZRA 4WJG2 3RMMH 4X1PU 5C1UA 1XXFA 1LVYA 1UK4A 3VGCB 1MBMA 1GBIA 5PTPA 1Y8TA 1O2XA 4FUGA 2ZDMA 3SGBE 5JYIA 2QXHA 3HPTB 1QA7A 1K9OE 2CF8H 4IMQA 4YESB 1G2MA 2BD2A 2RG3A 2Z94A 2PGQB 2A4OA 2B0FA 1ESAA 3UR6A 3PM3A 1ZJKA 2BQ7B 2BDBA 1AO5A 2XXLA 3SUDA 1EZXC 1C2GA 3BTKE 1O3CA 1C1QA 3BTTE 1SQOA 2BHGA 1O3IA 2R0KA 1ESBA 3T2NA 1DWEH 2H9EH 3U98H 4ABAA 3TNTA 3T29A 2VWMA 2RA3A 1MTNC 1V2PT 2BXUH 3M5OA 1T4VH 4Y71A 1NS3A 2NU0E 2FP7B 1TX8A 4MDSA 1TRYA 5SGAE 2ZGXH 2P93A 1Z8IB 3OYPA 3LDXH 1QJ1B 2TPIZ 1QGFA 2PSYA 3RU4E 1P8VC 1FY5A 4INHA 5F8ZA 7KMEH 4MG3A 4GHQA 1Y59T 1D3DB 1O33A 4INLA 1KYNA 2ZU2A 5JDUB 1C2EA 1WSSH 2JH6D 1QL7A 3PMJA 1WU1A 1C1NA 3VXFH 1G2LA 2ZGBH 2SNVA 1PPEE 3WY8A 1XUIA 3V13A 4NG9H 2AGEX 2A45B 1EJMA 2V3HH 3RMOH 1GHBF 1O2ZA 3UTUH 1BTHH 4NA9H 1XUFA 2ZHQH 1UTJA 2FTLE 3OU0A 4ABFA 4B2BA 4LOYH 1SHHB 2ZFQH 1C5MD 4VGCB 1MAXA 1KXAA 1V2WT 2ANKH 1P04A 3A7VA 1L4DA 1TNIA 1ETTH 1A5IA 1V2QT 3FANA 4MPVA 1JBUH 2A5KA 2DE8A 1CA8B 3SQHE 1INCA 3ZZ7A 1L2EA 4NCYA 3PWBA 2ZU3A 1T7CA 4K1SA 2SFAA 1OWEA 4X1SU 2QN5T 1AFEH 5B6OA 1GHBG 3M5LA 1C9TA 1E35B 1ZZZA 1YPGH 2XWBI 3ELAH 2Y80A 4UFFH 1QRXA 3T62A 1TALA 3UR9A 1NFWA 1ZMLA 3A7WA 1CA0B 4FUBA 1J9CH 3S9AA 3M3VA 1PPCE 4Y79A 2A7CA 4KTSA 5BPEA 3E1XB 3SJ9A 3MH4A 3URCA 1CGHA 4X8TH 1BTPA 5AFYH 1DOJA 1C1OA 3UIRA 1EAIA 1NFYA 4OS2A 1GJCB 5EXLA 1TQ7B 3PROA 4WXIA 1EOLA 3RXLA 5E0JA 3SI4H 5DG6A 3M35A 1KXDA 1T8LA 2VH6A 3RXRA 1VJAU 2H9HA 3GY4A 7GCHF 1KXEA 1QCPA 1OP0A 1RTFB 1XUKA 3BTWE 1YCPH 1GVLA 2ODPA 1P2JA 1EAUA 1XM1A 1P2OA 2CXVA 3EA9A 1HRTH 1K2I1 1SLXB 2HVXA 1S85A 5GPIB 3SU2A 3K6YA 3E90B 1MTSA 4ABJA 3R0FA 1OP2A 1IHTH 1P2MA 4CBOA 4GHTA 1SI5H 1HJ9A 8ESTE 1FAXA 1E38B 2FMJA 2GMTB 3ODDA 1DDJA 4X2VA 1UVPA 3VB4A 2B7DH 3P17H 2P3UB 3E6PH 1GGDC 1AGJA 1WV7H 3BTME 4XE4A 3CP7A 5ESTE 5JBBS 3KQDA 1P9SA 1ELAA 1BITA 3SNDA 2EC9H 1O5AB 1P2QA 2OINA 1H1BA 1TRNA 1XXDA 5HGGA 7GCHG 1TE0A 1Z6JH 4JZFH 3AASA 4KTCA 1PQ5A 4K5ZA 1GJDB 2WV5A 5TCAA 4AZ2B 4R0IA 1P2NA 3A84A 1A5HA 1NRRH 3ITIA 1O2JA 1A0LA 4GVUA 3HK6B 2PUXB 1J15A 3TGKE 1NO9H 1A3EH 3H5CB 1O2GH 3SU6A 3F9EA 1F0TA 1P01A 1WAYB 1TOMH 3FAOA 1O30A 1ESTA 4H4FA 2P8OC 4DT7B 1NT1A 1MKXK 1NU7B 3TH4H 3SNBA 4LZ4B 1BTUA 2Q6FA 1THSH 1FY3A 2FOCA 2XYAA 2A0QB 2ZTZA 1TQ0B 1G37A 1FIZA 2K1QA 2WV4A 3C27B 5AFZH 3U9AH 4B73A 4E7RG 5C3NA 5G4BA 1O3DA 2SGAA 4BAQB 5GIBA 3MO6A 3ZVGA 4ZUHA 1DICA 1FY4A 4CRAA 2R2MB 3H7TA 3DD2H 1MTWA 5FXLA 1HV7A 1UVTH 3I77A 1AU8A 2EI7A 3HKIB 4AFUA 2C3SA 1IQKA 1EZQA 1O3MA 2Y7XA 3TLOA 2FIRH 4Y8ZA 4E05H 1DXWA 1C1WH 3FP6E 1TMBH 1V2RT 5K0HA 1O3NA 1KLJH 2M5TA 2IN2A 3SW2B 1OP8A 3DFJA 3RMNH 2ANMH 2P94A 4I8GA 1SGNE 8GCHF 1HAIH 1C2FA 3SORA 2ZFTA 2ANYA 1UVSH 1NFUA 2YNAA 1MBQA 2Q6GA 2ZFRH 1TB6H 2WPIS 3U8OH 1Q3XA 2O8UA 1RTKA 1UO6A 3GISB 1OYTH 1GBTA 3GDUA 1ETRH 3TJUA 1H9IE 1O2QA 1XMNB 2A31A 1PQ8A 2ULLA 3UWIA 1IHSH 2JH5D 4NZQA 1NM6A 1DPOA 3RXQA 3RXGA 4KP0A 1KXFA 2FOAA 1BB0B 3IITA 1HLTH 1HPGA 4D9QA 4ZROA 5JB8S 5ABWA 4Y6DA 1YBWA 5TJXA 1JMOH 1A2CH 3DFLA 1O37A 3VEQB 1Y5AT 2TRMA 1NN6A 5F8XA 1BQYA 1O36A 3BEUA 1CHOF 1HYLA 2GDDA 5EPNA 1GCDA 3LGVA 5FCRA 1G32B 1EAWA 1DWCH 4AG2A 4AYVB 1AHTH 1CVWH 2A5AA 3RXOA 3A81A 4HZHA 4Z6AH 1ELDE 2CHAB 1AZ8A 2J94A 4AYYB 3TVJB 3MU0A 3BEIB 1V2NT 4MNWA 1BZXE 1QB1A 4WVPE 3GY3A 1OWJA 1O5CB 1P3CA 1XVMA 1ZTKA 1MQ5A 2TGDA 4X1QU 1C1RA 3RXVA 1WQVH 5CMXH 2VWOA 1TMUH 3E3TA 2PGBB 2F9PA 2GT8A 3HATH 4AFZA 1AVWA 1GPZA 5HMAA 4ZKRU 2BX4A 5C2ZA 3RXKA 1CHOG 1SGQE 3LC3A 4IW4E 3TK5A 5E2OA 1VGCC 3SNEA 1YPKH 3SU1A 4UDWH 4NWLA 2GCTB 1O3LA 5EODA 1F92A 1MKWK 1FPCH 2PLXA 3RXAA 2F9BH 1GJAB 1LCYA 2ZQ1A 4Y76A 4D7GA 6CHAC 2W7UA 1DITH 2ZHEH 2C4FH 1P11E 1THRH 1JIRA 2C8ZB 1C1PA 1B7XB 1VGCB 3E16B 5FCKA 5E2PA 2BDGA 2XBVA 3OSYA 2JETB 3A7YA 3LGYA 1WUNH 1AQ7A 1Y3XA 1BIOA 4F49A 1GJ4H 1DUAA 1ANEA 1QHRB 2JKHA 4D8NA 1H8IH 2GP9B 3Q77A 4GSOA 2VNTA 1AB9C 3EDXB 2VWNA 4K1TA 3SUGA 3B9FH 4K69A 4AN7A 3ZZ9A 1C9PA 1SGRE 1F0UA 1JIMA 1UK3A 1MTVA 4XBCA 4B2CA 3A88A 3I78A 1ZRKA 3RLWH 2ZQ2A 2P3TB 3GDVA 4ABEA 1AD8H 1NRNH 1PPGE 2ZDKA 3D62A 3HKJB 2D26C 3TITA 1BTYA 1OYQA 1AUJA 8KME2 2FYRA 5LPFA 1BOQA 2C8WB 4RKOB 2FDAA 1F5LA 1S6HA 4FVDA 3QX5H 4B74A 2G51A 3OX7U 1BRAA 5CHAB 4ABDA 2AEIH 2HPQH 2OTVA 2Z9LA 3AVZA 4NFEA 2ZTXA 2ZU1A 3Q3KA 2FI4E 2ZEBA 2VVVA 2ZI2H 3KNXA 4JZ1A 3LGWA 4INKA 4FVBA 4X2WA 2WPHS 4OS7A 1NPMA 1TOCB 2HRVA 2PSXA 1S83A 1YPMH 1GMDF 2HLCA 1ABJH 2BD9A 2EI6A 1S5SA 2OC1A 3RXIA 2F9NA 1O3AA 4ZKOU 2H1UA 1C4Y2 2UUFB 2VGCC 3UWJH 4XBDA 4Y11E 3GCNA 3D49H 4ZH8A 4AFSA 2Z9KA 2GZ7A 1G3BA 1O5EH 5LPEA 2ZP0H 3A87A 2BVXH 1UMAH 3BG4C 1WOFA 1V2TT 4E06H 2GZ9A 1FLEE 2ESTE 1ZSLA 4XSKU 3SQEE 1IQEA 1BRCE 2R0LA 1S6FA 4MPUA 3ZVAA 3TNSA 5DP5A 1MQ6A 1GMDG 1BBRH 1GBEA 1L1GA 2ZO3H 3ZZCA 1UVUH 1WTGH 1QNJA 3P95A 3QN7A 2ZPSA 3RM0H 1UHBB 1E0FD 1BA8B 1HAHH 2QF0A 1HAXB 1Y3VA 2QY0B 1C5UA 1SSXA 1F5KU 5I46H 3RXBA 1V2JT 2VVUA 3B8JA 1Z8JB 1DE7H 3A8BA 1L0ZA 3UUZA 3ZVBA 2KAIB 3NKKA 2FLRH 5C1YA 1SGTA 1D3QB 2R2WU 5J4QA 1RGQA 2OBOA 2THFB 1BJUA 1KY9A 2BLOA 2G4TA 5C5OA 5L2ZH 3RXDA 1O2YA 1TNLA 3OY6U 1O5DH 1NY22 5DP9A 1H8DH 2ZKSA 4OS4A 1P12E 2VWLA 1C5LH 2ZIQH 1DSTA 4K2YA 1O2KA 3RU4D 2FODA 1DUEA 3QO6A 4A7IB 4BAMB 2RDLA 1TMTH 2QXJA 1TGCA 4Q7XA 5H4IB 2OC8A 4WY3A 5A8ZA 1AWHB 3MNBA 3SJKA 1P9UA 1JRSA 1IQHA 1BT7A 3UPEA 3M36A 1O39A 3MH7A 3U1JB 1J17T 5FX6A 2FM2A 3PLKA 4TPIZ 3F9FA 1QB6A 3P8GA 4IN2A 1LPZB 5E8EH 4B71A 1QIXB 2AIPA 1V2UT 1ELCA 2GGVB 1BDAA 2BY6X 1GBLA 4A92A 1P06A 1UVOA 1WCZA 2R3YA 1C2DA 4KTUA 4Q2KA 3GY2A 4I8JA 2BY7X 3P8OA 1RD3B 1TAWA 3PV4A 2BZ6H 9ESTA 1PPZA 1MCVA 4YOIA 5EQQA 1GG6C 1NC6A 4OGXA 4X6OA 4JCNA 1ANBA 1MZAA 2WYGA 4JZEH 3ATKA 4ZAEA 3CENA 5DGJA 2FI3E 1UTMA 4FUDA 3SU5A 4CBNA 5F03A 3KQBA 4ZKSU 2ZDAH 1MUEB 4FU7A 1V2KT 2WYJA 3Q3YA 1MH0A 3V3MA 1AY6H 1MTNB 4XBBA 1EPTC 1P2IA 1C5TA 1HDTH 2Z9JA 1YF4A 5DP4A 1LVOA 1W0YH 5EXMA 3HK3B 3U1IB 3RXMA 1GG6B 3L6PA 1O3PB 2ZC9H 3BEFB 1P09A 1GI7B 1THPB 1GWAA 1OWHA 1ZHPA 3ATMA 4RSPA 5EXNA 1GDUA 1QL9A 3KN2A 4QT8C 3TU7H 1EKBB 4GAWA 2FS8A 4U01A 1PYTD 1GDNA 1GI1A 4ZHMU 3PMBB 2GV7A 1D4PB 3SUFA 1P03A 5GCHF 4NZLA 1GBCA 3LPRA 1W13U 3W95A 1C1VH 1O2UA 3TPIZ 2PKAB 1OOKB 2ZPQA 1CHGA 4TWYA 1O31A 1LDTT 3PLBA 2HNTC 4J2YB 5FPSA 3LT3A 3ATWA 1GL1A 3TGJE 3FP8E 1ZGIA 5T3HA 1TGNA 1O5GH 1MD7A 4Q7YA 4O03A 1FMGA 3UREA 5JBCS 2BLWA 1UTLM 1JRTA 5IDKA 5A0BA 1K1OA 1EAXA 2PWXA 2QXIA 2Y5GA 5FPTA 4DIHH 1DLKB 3UOPA 3NCLA 4ZHAA 2P95A 1O3BA 5IYTA 3BF6H 3RUOA 4WWYA 4ZXYH 3L3TA 1C5XB 1QR3E 3LU9B 2F9UA 4YLQH 1ELEE 2SGDE 1O3JA 1ELBA 1GJ6A 4NIXA 4Y8YA 3UOUA 3SGAE 4FUCA 4YT6H 4I8LA 1O2TA 3S7KB 2VJ1A 4O3UA 4BNRA 3RLYH 1Z8RA 3PB1E 1CGIE 3MOCA 2ILNA 4K1EA 1C5NH 1N8OC 3P70B 2AGIX 1GJ9B 1V3XA 1SOZA 3QK1A 2BMGB 3CS0A 3ZZAA 5I25A 2OLGA 1A1RA 2FX4A 1RS0A 1SQAA 2ZU4A 2PKSC 3MO3A 5DP8A 2ZCKP 2BDCA 1ZSJA 3K6ZA 2AERH 1GHYH 3O8CA 1AKSB 1QL8A 2HWLB 2XCFA 3P8NA 1GVKB 1QRZA 5EG4A 2V35A 1CQQA 1D3PB 4LZ1H 1LPKB 4BAKB 1GI2A 2FI5E 1N6XA 3MFJA 1TPSA 1V2MT 3MH5A 3PYHA 3BSQA 1Y3UA 1T4UH 2PKSB 3V0XA 3KL6A 2Z9GA 5EQRA 3SGQE 4LXBH 4YTAA 1T32A 1Z7KA 1JWTA 2Z3CA 4CRGA 3KQCA 1IQLA 1GI6A 1GGDB 3A8DA 1P02A 4MTBA 2ZWLH 2SGPE 5C5NA 1FUJA 1EB2A 3PMAB 4ISLA 2ASUB 3O8BA 1BJVA 2CF9H 2XC0A 3QWCH 3FZDA 4OGYA 1C2JA 1DS2E 2LNCA 3GCHC 1CO7E 1YCPK 4AB8A 3GY8A 7LPRA 3ZZDA 2FOMB 1AFQC 4DJZB 1OWKA 5GWZA 1BMAA 5J4SA 1GI9B 1MU6B 2CGAA 5A0AE 4X8UH 2FEQH 3LONA 1L4ZA 1TX7A 1KDQB 2BQWB 2QA9E 2P8OB 1AZZA 1QURH 2DUCA 3OTJE 5ESBA 3TK9A 2B5TB 4BXWA 3GCHB 3MNXA 1EZSC 1HAYB 4WH6A 2Q6DA 4NGAH 1FN8A 2BY8X 3SU0A 4TYDA 4FXGH 1Q2WA 1P0SH 1ELFA 4ISIH 2W7SA 2XNIA 3TJOA 5EW2H 1CU1A 4TWWA 2G00A 2ZDNA 1XUJA 3RXCA 1SGPE 1SLUB 2FZZA 1KSNA 1QBNA 4J1YA 2C90B 2FS9A 1JOUB 1LHDH 1E37B 1PPHE 1HGTH 1H4WA 3RXPA 1BCUH 1K1LA 4SGBE 4JYTA 1W7XH 2WINI 1GI3A 1NU9A 2CV3A 4OS6A 4TY7A 4U32A 1AI8H 1HXEH 1IQGA 4CH2B 1YPJH 3NUMA 4X6NA 2PTNA 1K1MA 2ZHWH 1VCPA 2FPZA 2V3OH 2AGGX 1ORFA 1ZPCA 1RIWC 8GCHG 3UNQA 1TWXB 4ZKNU 4KGAA 1SPJA 4O97A 2ZZUH 1AVGH 1NRPH 5A2MH 2Y5HA 1YGCH 1W0ZU 1XKBC 4Y7AA 5LPRA 2WPKS 3L33A 3MI4A 1J14A 1F5RA 1GI8B 4KKDA 4Z0KA 1QBOA 2VU8E 2NWNA 1EB1H 1K1JA 1O3HA 1GBMA 2TGAA 3TIUA 3GOVB 1C2MA 3N7OA 2UWLA 4YZUA 2ZTYA 1HCGA 3F68H 3LKWA 3RDZA 1TBRH 1RJXB 1EJAA 1TGTA 3O8RA 2VIDA 1ZR0A 1GBKA 1UHBA 1K1PA 1UCYH 3GYMA 1G3CA 5E0GA 3AAVA 1FZZA 1GHVH 4DOQA 4WXVA 2G55A 3O8DA 4H42U 3OY5U 4ABBA 1S81A 1KTSB 4K8BA 3ATIA 1NFXA 1AMHA 2BQ6B 4NFFA 1K22H 1L1JA 2HALA 1C5RA 3EA8A 2BD7A 1K1NA 2ZFPH 1C5PA 1DFPA 1FV9A 4UFDH 1GJ7B 2PR3A 1LHCH 2Y5FA 1YPHC 1O0DH 1P10A 1A0HB 1W10U 1A0JA 2KAIA 3MU1A 3PMHB 1J8AA 1CBWC 3HGPA 1FONA 2J38A 4PROA 1ZMJA 1HJ8A 1O3KA 4DURA 1SC8U 1ANCA 1HAPH 1TNJA 1NROH 2QYIA 2BYAX 2FO9A 1C4U2 1ZTJA 3KGPA 5K7RA 4YO9A 2QGRA 5CE1A 3BIVH 2O8MA 2PHBA 4JZDH 1P57B 3P92A 2Z3DA 4TPYA 1FI8A 1YYY1 3A82A 4CR5A 2IJOB 1O3FA 2PFEA 4A6LA 1O2RA 1V6DA 1B0FA 3DT0H 1SGFG 1IOEA 2W5EA 3BTHE 5LGOA 1IQFA 3GY6A 2OC0A 6CHAB 4JYVH 1YM0A 5F8TA 1ABIH 1UCYK 1IQJA 2OQ5A 4YOJA 1O2LA 4IC6A 2V0BA 1M9UA 3E91A 2HOBA 1LO6A 3IWMA 3LH3A 4DW2U 3DHKH 2UWPA 2IPHA 3QLPH 2GKVE 1DXPA 1V2ST 2ODYB 4A1XA 1YKTA 1QBVH 2UUJB 1HAGE 4KELA 4B1TA 2F9OA 4FUEA 1EUFA 4NWKA 3UNRA 1AB9B 3BIUH 1NTPA 4IMZA 7ESTE 2H5DA 1S84A 3V12A 3BTFE 3EE0B 1SFQB 3SNCA 1HJAC 2WPLS 1SR5C 1C1SA 2GT7A 3E8LA 4I32A 2J92A 4X6MA 4Q7ZA 4IN1A 1O3OA 2XRCA 3QUMP 3M5NA 3LOXA 4JK5A 1NESE 3KQEA 2Q1JA 4CHAC 5C67A 3UFAA 1TNHA 1ARCA 1JXPA 1TX6A 4WMEA 3VB5A 3SJOA 3SV2H 4H6SB 2BLQA 3M3TA 3DA9B 3SV7A 1DX5M 1EP5A 1YLCA 1XUGA 3KCGH 1YP9A 3ZZ5A 1ZSKA 3SV9A 3P6ZB 2A5IA 2BVRH 5DJ7A 3V7TA 3RC4A 3NWUA 2Z9IA 3RXFA 1EQ9A 3TJVA 1VITF 4AFQA 1EJNA 4M7GA 4Y7BA 4UFGH 3ZVFA 3C1KA 4OS1A 1WTHD 2PKAA 2BD3A 6LPRA 4BAOB 2O9QA 4XFQA 1SVPA 2B9LA 3A7XA 1ZHRA 3BTGE 1GBFA 3CS7A 1LVMA 1SOTA 1UTOA 3VFEA 2QAAA 1AUTC 2UUYA 2VGCB 2XW9A 1HAZB 3MU8A 3PLPA 4Y10E 2QC2A 3BTEE 1O32A 1DVAH 2VINA 2VIOA 4BTIB 4AGKA 1UTNA 1DLEA 4DCDA 1VJ9U 1DWBH 4IC5A 4MNVA 3BG4B 4IGDA 1GBDA 2ZPRA 4NIYA 1VITG 3A7ZA 3BG8A 1O2HA 1Y3WA 2WPMS 3VB7A 2QXGA 4FUFA 3Q76A 5EW1H 2ZCLP 3D65E 1X7AC 3K2UA 2FOHA 3A7TA 3AW0A 2EA3A 3PO1C 1Y3YA 5E0HA 4I31A 1XVOA 1VCWA 3TH2H 3S9CA 2G81E 4ISOA 4SGAE 3RXTA 1SFIA 2XC4A 2Z3EA 4I8HA 1UTPA 4FUJA 4HGCA 2WUCA 1ETSH 1ID5H 1GBBA 4UEHH 3S69A 2A2XH 2GVFA 1HIAB 1MZDA 1TPOA 4X8VH 2SGFE 3VGCC 3A86A 1YLDA 5FHTA 3M7QA 1IQIA 3LJOA 3QTOH 4U2WA 4ZXXH 1TBQH 1A61H 1QA0A 3M7TA 3A89A 2D1JA 2AFQB 5F6MA 2ZECA 1ZJDA 3PTNA 2R3UA 3KF2A 1SGCA 2YOLA 4NSVA 5HYOA 2ANWA 3U69H 1D3TB 1GBHA 2ZA5A 1TGBA 4DIIH 3G01A 1AKSA 1GHZA 1BBRK 2FOEA 3UQOA 1C2IA 1IQMA 4MLFB 4HI3A 2VH0A 4YOGA 5JPMH 2FESH 3TH3H 1TGSZ 2R9PA 1BUIA 4WF8A 3RC6A 3NXPA 1FJSA 2EEKA 2NU2E 1GL0E 3RC5A 1C2HA 1C5WB 5JBAS 1CE5A 1HAVB 1VCQA 2AYWA 2C8YB 2BM2A 4YM9A 3T27A 1QY6A 1C2KA 1CSOE 1MTUA 2A2QH 2SNWA 3ATLA 3GY5A 3KIDU 1ZTLA 4K60A 1GVZA 3SJIA 4X0WU 2F3CE 2J34A 2NU4E 2FX6A 2STAE 4XDEA 1FNIA 1Z8GA 4BAHB 1FAKH 2Y7ZA 4UFEH 4CRBA 3SI3H 2ZGHA 1ACBE 1ANDA 1PFXC 3UNSA 1KLIH 3SJ8A 2C93B 3SV8A 1SG8B 2SGQE 1O2IA 3ENSB 3TK6A 1C5OH 1LTOA 3EA7A 2FWWA 2BD5A 3MMGA 1DY8A 2Y6TA 3GDSA 1QB9A 1KDQA 2G5VA 3QGJA 2A1DB 2BDIA 2OCVB 3VB3A 1KLTA 1ZLRA 1WBGB 1QQ4A 1EATA 1NRQH 5DP7A 3ZZ3A 3GY7A 2ODQA 2H5CA 1RTLA 1LHGH 5DKMA 1W3CA 1Y5BT 5A09A 2GV6A 1EPTB 2FYQA 1U6QA 4ISNA 3NK8A
chains in the Genus database with same CATH superfamily
1BBRE 3UY9A 1ELVA 1TPAE 2AIQA 1QJ7B 1BTZA 2RCEA 5KEDA 3SHAH 4VGCC 5EOKA 1SGIB 4B6EA 3SV6A 1G3DA 1PYTC 5EU8A 5GDSH 1KTTB 1GCTC 2ZDLA 4HFPB 1T8MA 3B23B 5GJ4B 4CRCA 1GBAA 5LH8A 1S0RA 2XTTB 1IQNA 2WPJS 3ZYEA 2PW8H 1SGDE 3M61U 1E36B 3SNAA 1VZQH 3LGIA 1H9HE 4D76A 1VR1H 3ZZ4A 1C5SA 3S7HB 3A8AA 2VB0A 1HFDA 1LHEH 1O35A 2HNTF 1GCTB 2STBE 1CA0C 1WDIA 3LJJA 4ASHA 2CMYA 2ALVA 4I33A 5C20A 5GCHG 2W3KA 3ZZ6A 4IBLH 5BRRE 1O2MA 3F9HA 1A46H 2WUBA 1F0SA 2O8WA 1ZYOA 1MD8A 2J98A 1F0RA 2EI8A 5FL7D 4AGJA 1TRMA 1XKAC 3MHWU 1PJPA 3AW1A 2KZ4A 5DP3A 2IJD1 1ZMNA 1K28D 3QZQA 5CDFE 5EJ1A 1K21H 1WYKA 2RA0A 4TT3D 4AX9H 3QGNB 1Z71A 1QTFA 2F9VA 1TLDA 4LK4A 1N1LA 2W26A 4A1VA 1SGYE 1F7ZA 4YT7H 2V6NA 3QDZB 1E34B 4B2AA 3ODFA 3MO9A 1CT4E 4IS5A 1MKXH 1GMCF 2HNTE 2UWOA 3MH6A 2BLVA 3LC5A 2GMTC 2OD3B 1Z1JA 3FFGA 4K3JA 1HB0B 3RXUA 2FLBH 1KXCA 4JMYA 1BRUP 4MPXA 2VIWA 4BTTB 2GDEH 1EOJA 1UJ1A 3S0NA 1C1TA 1C5QA 1L1NA 1N8OB 4Q80A 4Y0YE 2ZDVH 1TABE 1G9IE 2VIQA 2XBWA 5HKKD 2C8XB 1SGFA 3E0PB 2BY9X 2YNBA 5ETXA 2OK5A 1ELGA 4O3TA 3F6UH 1BMLA 3GCTF 2OC7A 5FBIA 4CRFA 2TGPZ 1PQ7A 1C1MA 2ZCHP 2IOTA 1UW7A 1OWIA 5A8XA 3IG6B 2OUAA 3LIWA 1O5BB 3BN9A 1GMCG 3MNCA 1MCTA 4WMFA 1OKXA 2EQNA 4GPGA 1C5YB 2J95A 3M3SA 4D7FA 5CHBA 1XX9A 1ZPBA 1O2VA 2J9NA 2CN0H 4ACBA 1EP6A 1O5FH 3A80A 3RMLH 4AG1A 1YC0A 2ZF0H 4RN6A 3GICB 2HGTH 4BXSA 1DM4B 2ZG0H 3GCTG 3QTVH 1A5GH 2VIVA 2ZU5A 5DSFA 1SBWA 4B75A 4CRDA 1GI4A 4TY6A 3EQ0H 5A0CA 3RXSA 2Y81A 1AWFH 2D8WA 4X8SH 2FTMA 2GX4A 2XBXA 4X6PA 1BHXF 1LKBA 4ESTE 2A32A 1AFQB 3Q00A 1EZUC 2FXRA 1P05A 4BOHA 2G8TA 2GD4B 3T26A 1W2KH 3PV2A 4R8TB 1AN1E 3BV9B 1LHFH 2BOKA 4GUXA 3SUEA 1BHXB 3K65B 5HM2A 4FUHA 4GLYA 1OXGA 2JIZD 1AIXH 5AHGH 3RP2A 1LVBA 8LPRA 5FAHA 2QF4A 4NA7A 1TIOA 3JZ1B 1UTKA 3HGNA 1OSSA 2ZGJA 1EXFA 2JH0D 1BMMH 4NA8A 3ZVEA 2OQUA 1LQDB 4B6FA 3EGKH 3TGIE 2A4GA 3ZZ8A 9LPRA 3S9BA 1O3EA 1ZPZA 3NPSA 1OX1A 1BMFD 3P8FA 3SBKA 1Q31A 2Y82A 2AMQA 1AE5A 4FUIA 3URDA 1RFNA 1O2PA 1WQSA 3ZV9A 3MWIU 1LQEA 2GJGA 1QZ8A 2LPRA 1GBJA 2VBCA 1AVXA 3PTBA 4OS5A 5DP6A 1CT0E 2BVSH 4D9RA 1A7SA 1DSUA 1O2WA 1SQTA 3K9XB 1TNKA 1UTQA 3T25A 1V2LT 2GZ8A 5DPAA 4I8KA 2ZNKH 3M5MA 5L6NH 1T8OA 1C4V2 5C1XA 2P3FH 3N7EA 2QCYA 1SHYA 2CHAC 1GJ8B 1O38A 2ALPA 2G52A 5T6DA 3SU4A 1MKWH 3A83A 1QFKH 4RT1A 2BB4A 1GDQA 1TA6A 1HAOH 5FBEA 1ZOMA 4MQAA 1RIWB 4CREA 3H7OA 2A7HA 1TYNA 1RXPA 2QF3A 3LH1A 2QIQA 2W3IA 3VB6A 4ABHA 4AORA 5JB9S 4X2XA 4JZIA 2BDAA 4ABGA 3M37A 4ABIA 1AE8H 4X2YA 1HXFH 4AC9A 5KECA 3W94A 1EX3A 1C5ZB 4AOQA 1ZHMA 1NZQH 2PUQH 2I6QA 1FXYA 2BY5X 2G5NA 2J4IA 2F83A 5A8YA 1N6YA 6GCHF 4JK6A 1K1IA 4K8YA 6ESTA 1SMFE 1BRBE 2XCNA 3AAUA 3SHCH 1ARBA 2UUKB 1FN6A 1T8NA 2GCTC 3T5FH 1RRKA 1OPHB 2ZHFH 4A5TS 2BDYA 2P59A 1FQ3A 1GJBB 4MVNA 3WW7A 1QJ6B 1HIAA 4CH8B 1GHXH 1Z6EA 4HG6A 1SB1H 3LGUA 1TBZH 2A4RA 5TCCA 5JBTA 3RXHA 1C2LA 1MMJN 3D23A 4E7NA 3TJNA 3ZVDA 1A4WH 1W14U 2XC5A 3A8CA 1D6WA 2JETC 3I29A 4FU9A 1O3GA 2OXSA 1O2SA 1XUHA 3GCOA 1CBWB 1KIGH 5EQSA 2YMSC 1SLWB 1J16A 6GCHG 2FOGA 3NZIA 1BTXA 1LKAA 1Y5UT 2TIOA 1O34A 3MU4A 5AF9H 3Q3XA 1EASA 3MTYA 5L2YH 1G30B 3SOSA 1GHWH 2Z7FE 3ZIAD 2I6SA 3ZV8A 1CGJE 1S0QA 3UQVA 3MU5A 1GHAF 1T31A 4AB9A 2JJ1D 3U8RH 4ZHLU 3SN8A 1HAVA 1VITH 2YMSB 1TNGA 1QRWA 3A85A 4HTCH 4U30A 3KHVA 1YPHE 1IAUA 5DK1A 3F1SB 1PPFE 1YPEH 2CJIA 4NIWA 1GI0A 1KXBA 3SO3A 2NU1E 5AVDA 2BOHB 1H9LB 1Z1IA 2O8LA 4XOJA 3ZVCA 3ZYDA 4BTUB 1FY1A 1BTWA 3M7UA 2KFWA 4DVAU 3SZNA 2Z6BD 5CHAC 2A4QA 2PV9B 1B5GH 1W11U 4FU8A 4NSYA 4UD9H 3RXJA 1BMNH 3RM2H 1GHAG 4NIVA 1ZGVA 2J2UA 4MNXA 2HVYB 3FZZA 5DO4H 1LMWB 4UONA 1W7GH 2DE9A 1G36A 4WH8A 1F2SE 4ZMAH 1UK2A 3ESTA 3GYLB 2PTCE 4MPWA 1GJ5H 2A7JA 5GXPA 2AHME 2GTBA 3R3GB 3DUXH 2BXTH 2QV1A 2G4UA 1GI5A 1DY9A 3E0NB 1P3EA 2ZHDA 1TA2A 1ZRBA 3F3BA 1HJAB 4B76A 1DWDH 2OBQA 1D6RA 1W8BH 1EPTA 3LGTA 3VXEH 4DGJA 2AS9A 1SGEE 3FVFB 2AMDA 2BD4A 1MAYA 1W12U 2H2ZA 3FP7E 2H9TH 1DANH 1NRSH 4CHAB 3MNSA 4GCHF 1UCYE 1TFXA 3U28C 2ZFSA 3SU3A 1GMHF 1FPHH 1FY8E 1OS8A 3FOAA 4CR9A 2BDHA 2AMPA 1FIWA 4H6TA 2BTCE 3EAJA 1B0EA 4THNH 2GCHF 1O2OA 2TBSA 2VIPA 2BD8A 4UE7H 4JYUH 3STIA 1C1UH 4X1RU 4WMDA 1G3EA 1FDPA 2XWAA 2ZFFH 3ZZBA 2XBYA 2AH4X 5T6FA 4Y8XA 1P2KA 2BZAA 1ELTA 2FOFA 5FX5A 1SL3A 1TONA 3BTDE 5C0TA 2D2DA 4GCHG 4TSFD 4Y0ZE 1GMHG 3RXEA 1V2VT 4DG4A 2V3MA 2WHXA 4DY7B 1O2NA 5HIZA 3MYWA 5HXFA 4BANB 3KEEA 1OWDA 1D9IA 1DT2A 2FOBA 4O9VA 1LPGB 4X1NU 1YCPM 2H6MA 4YLUA 2GCHG 5T6GA 5FPYA 3NRLA 1E79D 2HPPH 4RKJB 1PQAA 1A3BH 2O8TA 4MNYA 2VVCA 2NU3E 1HUTH 2B8OH 3CNRA 5L30H 3JZ2B 1V2OT 1QQUA 3RU4T 2QE7D 3EYDA 2SGEE 3STJA 2ZGCA 1TPPA 2BX3A 2F91A 3F9GA 3PO1B 1HBTH 2KCYA 3PWCA 1SLVB 1HNEE 1C5VA 3U8TH 4A1TA 2OP9A 2TGTA 4I7YH 4F4OC 5C0UA 3BTQE 5EGMA 1S82A 1PPBH 3VPKA 4DT4A 4ISHH 3KYGA 2P16A 1YPLH 1CT2E 1MU8B 5EPYA 3T28A 5HM9A 3H09A 3QZRA 4WJG2 3RMMH 4X1PU 5C1UA 1XXFA 1LVYA 1UK4A 3SYJA 3VGCB 1MBMA 1GBIA 5PTPA 1Y8TA 1O2XA 4FUGA 2ZDMA 3SGBE 5JYIA 2QXHA 3HPTB 1QA7A 1K9OE 2CF8H 4IMQA 4YESB 1G2MA 2BD2A 2RG3A 2Z94A 2PGQB 2A4OA 2B0FA 1ESAA 3UR6A 3PM3A 1ZJKA 2BQ7B 2BDBA 1AO5A 2XXLA 3SUDA 1EZXC 3UB0A 1C2GA 3BTKE 1O3CA 1C1QA 3BTTE 1SQOA 2BHGA 1O3IA 2R0KA 1ESBA 2LP6A 3T2NA 1DWEH 2H9EH 3U98H 4ABAA 3TNTA 3T29A 2VWMA 5F53A 2RA3A 2K0QA 1MTNC 1V2PT 2BXUH 3M5OA 1T4VH 4Y71A 1NS3A 2NU0E 2FP7B 1TX8A 4MDSA 1TRYA 5SGAE 2ZGXH 2P93A 1Z8IB 3OYPA 3LDXH 5KGOA 1QJ1B 2TPIZ 1QGFA 2PSYA 3RU4E 1P8VC 1FY5A 4INHA 5F8ZA 7KMEH 4MG3A 4GHQA 1Y59T 1D3DB 1O33A 3F0PA 4INLA 1KYNA 2KCAA 2ZU2A 1C2EA 1WSSH 2JH6D 5JDUB 1QL7A 3PMJA 1WU1A 1C1NA 3VXFH 1G2LA 2ZGBH 2SNVA 1PPEE 3WY8A 1XUIA 3V13A 4NG9H 2AGEX 2A45B 4P02A 1EJMA 2V3HH 3RMOH 1GHBF 1O2ZA 3UTUH 1BTHH 4NA9H 1XUFA 2ZHQH 1UTJA 2FTLE 3OU0A 4ABFA 4B2BA 4LOYH 1SHHB 2ZFQH 1C5MD 4VGCB 1MAXA 1KXAA 1V2WT 2ANKH 1P04A 3A7VA 1L4DA 1TNIA 1ETTH 1A5IA 1V2QT 3FANA 3KYFA 4MPVA 1JBUH 2A5KA 2DE8A 1CA8B 3SQHE 1INCA 3ZZ7A 1L2EA 3DSOA 4NCYA 3PWBA 2ZU3A 1T7CA 4K1SA 2SFAA 1OWEA 4X1SU 2QN5T 1AFEH 2M2AA 4I86A 5B6OA 1GHBG 3M5LA 1C9TA 1E35B 1ZZZA 1YPGH 2XWBI 3ELAH 2Y80A 4UFFH 1QRXA 3T62A 1TALA 3UR9A 1NFWA 1ZMLA 3A7WA 1CA0B 4FUBA 1J9CH 3S9AA 3M3VA 1PPCE 4Y79A 2A7CA 4KTSA 5BPEA 3E1XB 3SJ9A 3MH4A 3URCA 1CGHA 4X8TH 1BTPA 5AFYH 1DOJA 1C1OA 3UIRA 1EAIA 1NFYA 4OS2A 1GJCB 2L6OA 5EXLA 2HLDD 1TQ7B 3PROA 4WXIA 1EOLA 3N99A 3RXLA 5E0JA 3SI4H 5DG6A 3M35A 1KXDA 1T8LA 2VH6A 3RXRA 1VJAU 2H9HA 3GY4A 7GCHF 1KXEA 1QCPA 1OP0A 4ASUD 1RTFB 1XUKA 3BTWE 1YCPH 1GVLA 2ODPA 1P2JA 5C17A 1EAUA 1XM1A 4Q63A 1P2OA 2CXVA 3EA9A 1HRTH 1K2I1 1SLXB 2HVXA 1S85A 5GPIB 3SU2A 3K6YA 3E90B 1MTSA 4ABJA 3R0FA 1OP2A 1IHTH 1P2MA 4CBOA 4GHTA 1SI5H 1HJ9A 8ESTE 1FAXA 1E38B 2FMJA 2GMTB 3ODDA 1DDJA 4X2VA 1UVPA 3VB4A 2B7DH 3P17H 2P3UB 3E6PH 1GGDC 1AGJA 1WV7H 3BTME 4XE4A 3CP7A 5ESTE 5JBBS 3KQDA 1P9SA 1ELAA 3DCLA 1BITA 3SNDA 5T1VA 2EC9H 1O5AB 1P2QA 2OINA 1H1BA 1TRNA 1XXDA 5HGGA 7GCHG 1TE0A 1Z6JH 4JZFH 3PV5A 3AASA 4KTCA 1PQ5A 4K5ZA 1GJDB 2WV5A 5TCAA 4AZ2B 4R0IA 1P2NA 3A84A 1A5HA 1NRRH 3ITIA 1O2JA 1A0LA 4GVUA 3HK6B 2PUXB 1J15A 3TGKE 1NO9H 1A3EH 3H5CB 1O2GH 3SU6A 3F9EA 1F0TA 1P01A 1WAYB 1TOMH 3FAOA 1O30A 1ESTA 4H4FA 2P8OC 4DT7B 1NT1A 1MKXK 1NU7B 3TH4H 3SNBA 4LZ4B 1BTUA 2Q6FA 1THSH 1FY3A 5DN6D 2FOCA 2XYAA 2A0QB 2ZTZA 1TQ0B 1G37A 1FIZA 2K1QA 2WV4A 3C27B 5AFZH 3U9AH 4B73A 4E7RG 5C3NA 5G4BA 1O3DA 2SGAA 4BAQB 5GIBA 3MO6A 3ZVGA 4ZUHA 1DICA 1FY4A 4CRAA 4FETA 2R2MB 3H7TA 3DD2H 1MTWA 5FXLA 1HV7A 1UVTH 3I77A 1AU8A 2EI7A 3HKIB 4AFUA 2C3SA 1IQKA 1EZQA 1O3MA 2Y7XA 3TLOA 2FIRH 4Y8ZA 4E05H 1DXWA 1C1WH 2KCPA 1TMBH 1V2RT 3FP6E 5K0HA 1O3NA 1KLJH 2M5TA 2IN2A 3SW2B 4M9FA 1OP8A 3DFJA 3RMNH 2ANMH 2P94A 4I8GA 4OM9A 1SGNE 8GCHF 1HAIH 1C2FA 3SORA 2ZFTA 2ANYA 1UVSH 1NFUA 2YNAA 1MBQA 2Q6GA 2ZFRH 3MQKC 1TB6H 2WPIS 3FN8A 3U8OH 1Q3XA 2O8UA 1RTKA 1UO6A 3GISB 1OYTH 1GBTA 3GDUA 3DSGA 1ETRH 3TJUA 1H9IE 1O2QA 1XMNB 2A31A 1PQ8A 2ULLA 3UWIA 1IHSH 2JH5D 4NZQA 5EJZA 1NM6A 1DPOA 3RXQA 3RXGA 4KP0A 1KXFA 2FOAA 1BB0B 3IITA 4ACAA 1HLTH 1HPGA 3FKSD 4D9QA 4ZROA 5JB8S 5ABWA 4Y6DA 1YBWA 5TJXA 1WXRA 1JMOH 1A2CH 3DFLA 1O37A 3VEQB 1Y5AT 2TRMA 1NN6A 5F8XA 1BQYA 1O36A 3BEUA 1CHOF 1HYLA 2GDDA 5EPNA 1GCDA 3LGVA 5FCRA 1G32B 1EAWA 1DWCH 4AG2A 4AYVB 1AHTH 1CVWH 2A5AA 3RXOA 3A81A 4HZHA 4Z6AH 1ELDE 2CHAB 1AZ8A 2J94A 1COWD 4AYYB 3TVJB 3MU0A 3BEIB 1V2NT 4MNWA 1BZXE 1QB1A 4WVPE 3GY3A 1OWJA 1O5CB 1P3CA 1XVMA 1ZTKA 1MQ5A 2TGDA 4X1QU 1C1RA 3RXVA 1WQVH 5CMXH 2VWOA 1TMUH 3E3TA 2PGBB 2F9PA 2GT8A 3HATH 4AFZA 1AVWA 1GPZA 5HMAA 4ZKRU 2BX4A 5C2ZA 3RXKA 1CHOG 1SGQE 1E1RD 3LC3A 5B6LA 4IW4E 3TK5A 5E2OA 1VGCC 3OAAD 3SNEA 1YPKH 3SU1A 4UDWH 4NWLA 2GCTB 1YLNA 1O3LA 5EODA 1F92A 1MKWK 1FPCH 2PLXA 3RXAA 2F9BH 1GJAB 1LCYA 2W6ID 2ZQ1A 4Y76A 4D7GA 6CHAC 2W7UA 1DITH 2ZHEH 2C4FH 1P11E 1THRH 1JIRA 2C8ZB 1C1PA 1B7XB 1VGCB 3E16B 5FCKA 5E2PA 2BDGA 2XBVA 3OSYA 2JETB 3A7YA 3LGYA 1WUNH 1AQ7A 1S6LA 1Y3XA 1BIOA 3WWFA 4F49A 1GJ4H 1DUAA 1ANEA 1QHRB 2JKHA 4D8NA 1H8IH 2GP9B 3Q77A 4GSOA 2VNTA 1AB9C 3EDXB 2VWNA 4K1TA 3SUGA 3B9FH 4K69A 4AN7A 3ZZ9A 1C9PA 1SGRE 1F0UA 5EJLA 1JIMA 1UK3A 1MTVA 4XBCA 4B2CA 3A88A 1VKYA 3I78A 3FO8D 1ZRKA 3RLWH 2ZQ2A 2P3TB 3OE7D 3GDVA 4ABEA 1AD8H 1NRNH 1PPGE 2ZDKA 3D62A 3HKJB 2D26C 3TITA 1BTYA 1OYQA 1AUJA 8KME2 2F4LA 2FYRA 5LPFA 1BOQA 2C8WB 4RKOB 2FDAA 1F5LA 1S6HA 4FVDA 3QX5H 4B74A 2G51A 3OX7U 1BRAA 5CHAB 4ABDA 2AEIH 2HPQH 2OTVA 2Z9LA 3AVZA 4NFEA 2ZTXA 3F2HA 2ZU1A 3OEED 3Q3KA 2FI4E 2ZEBA 2VVVA 2ZI2H 3KNXA 4JZ1A 3LGWA 4INKA 4FVBA 4X2WA 2WPHS 4OS7A 1NPMA 1TOCB 2HRVA 2PSXA 1S83A 1YPMH 1GMDF 2HLCA 1ABJH 2BD9A 2EI6A 1S5SA 2OC1A 3RXIA 2F9NA 1O3AA 4ZKOU 2H1UA 4Z1MD 1C4Y2 2UUFB 2VGCC 3UWJH 4XBDA 4Y11E 3GCNA 3D49H 4ZH8A 4AFSA 2Z9KA 2GZ7A 1G3BA 1O5EH 5LPEA 2ZP0H 3A87A 2BVXH 1UMAH 3PRDA 3BG4C 1WOFA 3AK5A 1V2TT 4E06H 2GZ9A 1FLEE 2ESTE 1ZSLA 4XSKU 3SQEE 1IQEA 1BRCE 2R0LA 1S6FA 4MPUA 3ZVAA 3TNSA 5DP5A 1MQ6A 1GMDG 1BBRH 2LELA 1GBEA 1L1GA 2ZO3H 3ZZCA 1UVUH 1WTGH 1QNJA 3P95A 3QN7A 2ZPSA 3RM0H 1UHBB 1E0FD 1BA8B 1NBMD 1HAHH 2QF0A 1HAXB 1Y3VA 4YXWD 2QY0B 1C5UA 1SSXA 1F5KU 5I46H 3RXBA 1V2JT 2VVUA 3B8JA 4Q4LA 1Z8JB 1DE7H 2JJ2D 3A8BA 1L0ZA 4RT0A 3UUZA 3ZVBA 2KAIB 3NKKA 2FLRH 5C1YA 1SGTA 1D3QB 2R2WU 5J4QA 1SKYE 1RGQA 2OBOA 2THFB 1BJUA 1KY9A 2BLOA 2G4TA 5C5OA 5L2ZH 3RXDA 1O2YA 1TNLA 3OY6U 1O5DH 1NY22 5DP9A 1H8DH 2ZKSA 4OS4A 1P12E 2VWLA 1C5LH 2ZIQH 1DSTA 4K2YA 1O2KA 3RU4D 2FODA 1DUEA 3QO6A 4A7IB 4BAMB 2RDLA 1TMTH 2QXJA 1EFRD 1TGCA 4Q7XA 5H4IB 2OC8A 4WY3A 5A8ZA 1AWHB 3MNBA 3SJKA 1P9UA 1JRSA 1IQHA 1BT7A 3UPEA 3M36A 1O39A 3MH7A 3U1JB 1J17T 5FX6A 2FM2A 4XRNA 3PLKA 4TPIZ 3F9FA 1QB6A 3P8GA 1K0HA 2KR7A 4IN2A 1LPZB 5E8EH 4B71A 3KQ5A 1QIXB 2AIPA 1V2UT 1ELCA 2GGVB 3WWBA 1BDAA 2BY6X 1GBLA 4A92A 1P06A 1UVOA 1WCZA 2R3YA 1C2DA 4KTUA 4Q2KA 3GY2A 4I8JA 2BY7X 3P8OA 1RD3B 1TAWA 3PV4A 2BZ6H 9ESTA 1PPZA 1MCVA 4YOIA 5EQQA 1GG6C 1NC6A 4OGXA 4X6OA 4JCNA 1ANBA 1MZAA 2WYGA 4JZEH 3ATKA 4ZAEA 3CENA 5DGJA 2FI3E 1UTMA 4FUDA 3SU5A 4CBNA 5F03A 3KQBA 4ZKSU 2ZDAH 1MUEB 4FU7A 1V2KT 2WYJA 3Q3YA 1MH0A 3V3MA 1AY6H 1MTNB 4XBBA 1EPTC 1P2IA 1C5TA 1HDTH 2Z9JA 1YF4A 5DP4A 1LVOA 1W0YH 5EXMA 3HK3B 3U1IB 3RXMA 1GG6B 3L6PA 1O3PB 2ZC9H 3BEFB 2XOKD 1P09A 1GI7B 2J97A 1THPB 1GWAA 1OWHA 1ZHPA 3ATMA 4RSPA 5EXNA 1GDUA 1QL9A 3KN2A 4QT8C 3TU7H 1EKBB 4GAWA 2FS8A 4U01A 1PYTD 1GDNA 1GI1A 4ZHMU 3PMBB 2GV7A 1D4PB 3SUFA 3OFND 1P03A 5GCHF 4NZLA 1GBCA 3LPRA 1W13U 3W95A 1C1VH 1O2UA 3TPIZ 2PKAB 1OOKB 2ZPQA 1CHGA 4TWYA 1O31A 1LDTT 3PLBA 2HNTC 4J2YB 5FPSA 3LT3A 3ATWA 2RFKC 1GL1A 3TGJE 3FP8E 1ZGIA 5T3HA 1TGNA 1O5GH 1MD7A 3W1EA 4Q7YA 4O03A 1FMGA 3UREA 5JBCS 2BLWA 1UTLM 1JRTA 5IDKA 5A0BA 1K1OA 1EAXA 2PWXA 2QXIA 2Y5GA 5FPTA 4DIHH 1DLKB 1W0JD 3UOPA 3NCLA 4ZHAA 2P95A 1O3BA 5IYTA 3BF6H 3RUOA 2JDID 4WWYA 4ZXYH 3L3TA 1C5XB 1QR3E 3LU9B 2F9UA 4YLQH 1ELEE 2SGDE 1O3JA 1ELBA 1GJ6A 4NIXA 4Y8YA 3UOUA 3SGAE 4FUCA 4YT6H 4I8LA 1O2TA 3S7KB 2VJ1A 4O3UA 4BNRA 3RLYH 1Z8RA 3PB1E 1CGIE 3MOCA 2ILNA 4K1EA 1C5NH 1N8OC 3P70B 2AGIX 1GJ9B 1V3XA 1SOZA 3QK1A 2BMGB 3CS0A 3ZZAA 5I25A 2OLGA 1A1RA 2FX4A 1RS0A 1SQAA 2ZU4A 2PKSC 3MO3A 5DP8A 2ZCKP 2BDCA 1ZSJA 3K6ZA 2AERH 1GHYH 3O8CA 1AKSB 1QL8A 2HWLB 2XCFA 3P8NA 1GVKB 1QRZA 5EG4A 2V35A 1CQQA 1D3PB 4LZ1H 1LPKB 4BAKB 1GI2A 1KMHB 2FI5E 1N6XA 3MFJA 1TPSA 1V2MT 3MH5A 3PYHA 3BSQA 1Y3UA 1T4UH 2PKSB 3V0XA 3KL6A 2Z9GA 5EQRA 3SGQE 4LXBH 4YTAA 1T32A 1Z7KA 1JWTA 2Z3CA 2PP6A 3N7DA 4CRGA 2IPQX 3KQCA 2KCOA 1IQLA 1GI6A 1GGDB 3A8DA 1P02A 2WZQA 4MTBA 2ZWLH 1OHHD 2SGPE 5C5NA 1FUJA 1EB2A 3PMAB 4ISLA 2ASUB 3O8BA 1BJVA 2CF9H 2XC0A 3QWCH 3FZDA 4OGYA 1C2JA 1DS2E 2LNCA 3GCHC 1CO7E 1YCPK 4AB8A 3GY8A 7LPRA 3ZZDA 2FOMB 1AFQC 4DJZB 1OWKA 5GWZA 1BMAA 4RI0A 5J4SA 1GI9B 1MU6B 2CGAA 5A0AE 4X8UH 2FEQH 3LONA 1L4ZA 1TX7A 1KDQB 2BQWB 2QA9E 4P00A 2P8OB 1AZZA 1QURH 2DUCA 3OTJE 5ESBA 3TK9A 2B5TB 4BXWA 3GCHB 3MNXA 1EZSC 1HAYB 4WH6A 2Q6DA 4NGAH 1FN8A 2BY8X 3SU0A 2QF5A 4TYDA 4FXGH 1Q2WA 1YY3A 3F2GA 1P0SH 1ELFA 4ISIH 2W7SA 2XNIA 3F2FA 3TJOA 5EW2H 1CU1A 4TWWA 2G00A 3SZEA 2ZDNA 1XUJA 3RXCA 1SGPE 1SLUB 2FZZA 1KSNA 1QBNA 4J1YA 2C90B 2FS9A 1JOUB 1LHDH 1E37B 1PPHE 1HGTH 1H4WA 3RXPA 1BCUH 1K1LA 3OTPA 4SGBE 4JYTA 1W7XH 1H8HD 2WINI 1GI3A 1NU9A 2CV3A 4OS6A 4TY7A 2XNDD 4U32A 1AI8H 1HXEH 1IQGA 4CH2B 1YPJH 3NUMA 4X6NA 2PTNA 1K1MA 2ZHWH 1VCPA 2WPDD 2FPZA 2V3OH 2AGGX 4ZCNA 5HIYA 1ORFA 1ZPCA 1RIWC 8GCHG 3UNQA 1TWXB 4ZKNU 4KGAA 1SPJA 4O97A 2ZZUH 1AVGH 1NRPH 5A2MH 2Y5HA 1YGCH 1W0ZU 1XKBC 4Y7AA 5LPRA 1H8ED 2WPKS 3L33A 3MI4A 1J14A 1F5RA 2J98B 1GI8B 4KKDA 4Z0KA 1QBOA 2VU8E 2NWNA 1EB1H 1K1JA 3OEHD 1O3HA 1GBMA 2TGAA 3TIUA 3GOVB 1C2MA 3N7OA 2UWLA 4YZUA 2ZTYA 1HCGA 3F68H 3LKWA 3RDZA 1TBRH 1RJXB 1EJAA 1TGTA 3O8RA 2VIDA 1ZR0A 1GBKA 1UHBA 1K1PA 1UCYH 3GYMA 1G3CA 5E0GA 3AAVA 1FZZA 1GHVH 4DOQA 4WXVA 2G55A 3O8DA 4H42U 3OY5U 4ABBA 1S81A 1KTSB 4K8BA 3ATIA 1NFXA 1AMHA 2BQ6B 4NFFA 4XD7D 1K22H 1L1JA 2HALA 1C5RA 3EA8A 2BD7A 1K1NA 2ZFPH 1C5PA 1DFPA 1FV9A 5GNDA 4UFDH 1GJ7B 2PR3A 1LHCH 2Y5FA 1YPHC 1O0DH 1P10A 1A0HB 1W10U 1A0JA 2KAIA 3MU1A 3PMHB 1J8AA 1CBWC 3HGPA 1FONA 2J38A 4PROA 1ZMJA 1SQRA 1HJ8A 1O3KA 4DURA 1SC8U 1ANCA 2KM0A 3VG8A 1HAPH 1TNJA 1NROH 2QYIA 2BYAX 2FO9A 1C4U2 1ZTJA 3KGPA 5K7RA 4YO9A 2QGRA 2YMSD 5CE1A 3BIVH 2O8MA 2PHBA 4JZDH 1P57B 3P92A 2Z3DA 4TPYA 1FI8A 1YYY1 3A82A 4FOUC 2IJOB 1O3FA 2PFEA 4A6LA 1O2RA 1V6DA 4CR5A 1B0FA 3DT0H 1SGFG 1IOEA 2W5EA 3BTHE 5LGOA 1IQFA 3GY6A 2OC0A 6CHAB 5IK2D 4JYVH 1YM0A 5F8TA 1ABIH 1UCYK 1IQJA 2OQ5A 4YOJA 2CK3D 1O2LA 4IC6A 2V0BA 1M9UA 3E91A 2HOBA 1LO6A 3IWMA 3LH3A 4DW2U 3DHKH 2UWPA 2IPHA 3QLPH 2GKVE 1DXPA 1V2ST 2ODYB 4A1XA 1YKTA 1QBVH 2UUJB 1HAGE 4KELA 4B1TA 2F9OA 4FUEA 1EUFA 4NWKA 3UNRA 1AB9B 3BIUH 1NTPA 4IMZA 7ESTE 2H5DA 1S84A 3V12A 3BTFE 3EE0B 1SFQB 3SNCA 1HJAC 2WPLS 1SR5C 1C1SA 2GT7A 3E8LA 2W6JD 4I32A 2J92A 4X6MA 4Q7ZA 4IN1A 1O3OA 2XRCA 3QUMP 3M5NA 3LOXA 4JK5A 1NESE 3KQEA 1FX0B 2Q1JA 4CHAC 2KX4A 3UFAA 5C67A 1TNHA 1ARCA 1JXPA 1TX6A 4WMEA 3VB5A 3SJOA 3SV2H 4H6SB 2BLQA 3M3TA 3DA9B 3SV7A 1DX5M 1EP5A 1YLCA 1XUGA 3KCGH 1YP9A 3ZZ5A 1ZSKA 3SV9A 3P6ZB 2A5IA 2BVRH 5DJ7A 3V7TA 3RC4A 2V7QD 3NWUA 2Z9IA 3RXFA 1EQ9A 3TJVA 1VITF 4AFQA 1EJNA 4M7GA 4Y7BA 4UFGH 3ZVFA 3C1KA 4OS1A 1WTHD 1W0KD 2BD3A 2PKAA 4BAOB 6LPRA 2O9QA 4XFQA 1SVPA 2B9LA 3A7XA 1ZHRA 3BTGE 1GBFA 3CS7A 1LVMA 1SOTA 1UTOA 3VFEA 2QAAA 3GS9A 1AUTC 2UUYA 2VGCB 2XW9A 1HAZB 3MU8A 3PLPA 4Y10E 2QC2A 3BTEE 1O32A 1DVAH 2VINA 2VIOA 4BTIB 4AGKA 1UTNA 1DLEA 4DCDA 1VJ9U 1DWBH 4IC5A 4MNVA 3BG4B 4IGDA 1GBDA 2ZPRA 4NIYA 1VITG 1MABB 3A7ZA 3BG8A 1O2HA 1Y3WA 2WPMS 3VB7A 2QXGA 1YWUA 4FUFA 3Q76A 5EW1H 2ZCLP 3D65E 1X7AC 3K2UA 2FOHA 3A7TA 3AW0A 2EA3A 3PO1C 1Y3YA 5E0HA 4I31A 1XVOA 5C94A 1VCWA 3TH2H 3S9CA 2G81E 4ISOA 4SGAE 3RXTA 1SFIA 2XC4A 2Z3EA 4I8HA 1UTPA 4FUJA 4HGCA 2WUCA 1ETSH 1ID5H 1GBBA 4UEHH 3S69A 2A2XH 2GVFA 1HIAB 1MZDA 1TPOA 4X8VH 2SGFE 2WSSD 3VGCC 3A86A 1YLDA 5FHTA 3M7QA 1IQIA 3LJOA 3QTOH 4U2WA 4ZXXH 1TBQH 1A61H 1QA0A 3M7TA 3A89A 2D1JA 2AFQB 5F6MA 5EIYA 2ZECA 1ZJDA 3PTNA 2R3UA 3KF2A 1SGCA 2YOLA 4NSVA 3EE7A 5HYOA 2ANWA 3U69H 1D3TB 1GBHA 2ZA5A 1TGBA 4DIIH 3G01A 1AKSA 1GHZA 1BBRK 2FOEA 2RDEA 3UQOA 2K8IA 1C2IA 1IQMA 4MLFB 4HI3A 2VH0A 4YOGA 5JPMH 2FESH 3TH3H 1TGSZ 2R9PA 1BUIA 4WF8A 3RC6A 3NXPA 1FJSA 2EEKA 2NU2E 1GL0E 3RC5A 1C2HA 1C5WB 5JBAS 1CE5A 1HAVB 1VCQA 2AYWA 1NBME 2C8YB 2BM2A 4F55A 3T27A 1QY6A 4YM9A 1C2KA 1CSOE 1MTUA 2A2QH 2SNWA 3ATLA 3GY5A 3KIDU 1ZTLA 4K60A 1GVZA 3SJIA 4X0WU 2F3CE 2J34A 2NU4E 2FX6A 2STAE 4XDEA 2WV9A 4F48B 1FNIA 1Z8GA 4BAHB 1FAKH 2Y7ZA 4UFEH 4CRBA 3SI3H 2ZGHA 1ACBE 1ANDA 1E1QD 3UAIC 1PFXC 3UNSA 1KLIH 3SJ8A 2C93B 3SV8A 1SG8B 2SGQE 1O2IA 3ENSB 3TK6A 1C5OH 3PRBA 1LTOA 3EA7A 2FWWA 2BD5A 3MMGA 1DY8A 3F0OA 2Y6TA 3GDSA 1QB9A 1KDQA 2G5VA 3QGJA 2F43B 2A1DB 2BDIA 2OCVB 3VB3A 1KLTA 1ZLRA 1WBGB 1QQ4A 1EATA 1NRQH 2J5UA 5DP7A 3ZZ3A 3GY7A 2ODQA 2H5CA 1RTLA 1LHGH 5DKMA 1W3CA 1Y5BT 5A09A 2GV6A 1EPTB 2EY4C 2L74A 2FYQA 1U6QA 4ISNA 3DSPA 3NK8A
chains in the Genus database with same CATH topology
1BBRE 3UY9A 1ELVA 1TPAE 2AIQA 1QJ7B 1BTZA 2RCEA 3SHAH 4VGCC 5EOKA 1SGIB 3SV6A 1G3DA 1PYTC 5EU8A 5GDSH 1KTTB 1GCTC 2ZDLA 4HFPB 1T8MA 3B23B 5GJ4B 4CRCA 1GBAA 5LH8A 1S0RA 2XTTB 1IQNA 2WPJS 3ZYEA 2PW8H 1SGDE 3M61U 1E36B 3SNAA 1VZQH 3LGIA 1H9HE 4D76A 1VR1H 3ZZ4A 1C5SA 3S7HB 3A8AA 2VB0A 1HFDA 1LHEH 1O35A 2HNTF 1GCTB 2STBE 1CA0C 4ASHA 3LJJA 2CMYA 2ALVA 4I33A 5C20A 5GCHG 2W3KA 3ZZ6A 4IBLH 5BRRE 1O2MA 3F9HA 1A46H 2WUBA 1F0SA 2O8WA 1ZYOA 1MD8A 1F0RA 2EI8A 4AGJA 1TRMA 1XKAC 3MHWU 1PJPA 3AW1A 5DP3A 1ZMNA 1K28D 3QZQA 1K21H 1WYKA 2RA0A 4AX9H 3QGNB 1Z71A 1QTFA 2F9VA 1TLDA 4LK4A 1N1LA 2W26A 4A1VA 1SGYE 1F7ZA 4YT7H 2V6NA 3QDZB 1E34B 4B2AA 3ODFA 3MO9A 1CT4E 4IS5A 1MKXH 1GMCF 2HNTE 2UWOA 3MH6A 2BLVA 3LC5A 2GMTC 2OD3B 1Z1JA 3FFGA 4K3JA 1HB0B 3RXUA 2FLBH 1KXCA 4JMYA 1BRUP 4MPXA 2VIWA 4BTTB 2GDEH 1EOJA 1UJ1A 3S0NA 1C1TA 1C5QA 1L1NA 1N8OB 4Q80A 4Y0YE 2ZDVH 1TABE 1G9IE 2VIQA 2XBWA 2C8XB 1SGFA 3E0PB 2BY9X 2YNBA 5ETXA 1ELGA 4O3TA 3F6UH 1BMLA 3GCTF 2OC7A 5FBIA 4CRFA 2TGPZ 1PQ7A 1C1MA 2ZCHP 2IOTA 1OWIA 5A8XA 3IG6B 2OUAA 3LIWA 1O5BB 3BN9A 1GMCG 3MNCA 1MCTA 4WMFA 1OKXA 4GPGA 1C5YB 2J95A 3M3SA 4D7FA 1XX9A 1ZPBA 1O2VA 2J9NA 2CN0H 1EP6A 1O5FH 3A80A 3RMLH 4AG1A 1YC0A 2ZF0H 4RN6A 3GICB 2HGTH 4BXSA 1DM4B 2ZG0H 3GCTG 3QTVH 1A5GH 2VIVA 2ZU5A 4B75A 1SBWA 4CRDA 1GI4A 4TY6A 3EQ0H 5A0CA 3RXSA 2Y81A 1AWFH 2D8WA 4X8SH 2FTMA 2GX4A 2XBXA 4X6PA 1BHXF 1LKBA 4ESTE 2A32A 1AFQB 3Q00A 1EZUC 2FXRA 1P05A 4BOHA 2G8TA 2GD4B 3T26A 1W2KH 4R8TB 1AN1E 3BV9B 1LHFH 2BOKA 4GUXA 3SUEA 1BHXB 3K65B 5HM2A 4FUHA 4GLYA 1OXGA 1AIXH 5AHGH 3RP2A 1LVBA 8LPRA 5FAHA 4NA7A 1TIOA 3JZ1B 1UTKA 3HGNA 1OSSA 2ZGJA 1EXFA 2JH0D 1BMMH 4NA8A 3ZVEA 2OQUA 1LQDB 3EGKH 3TGIE 2A4GA 3ZZ8A 9LPRA 3S9BA 1O3EA 1ZPZA 3NPSA 1OX1A 3P8FA 3SBKA 1Q31A 2Y82A 2AMQA 1AE5A 4FUIA 3URDA 1RFNA 1O2PA 1WQSA 3ZV9A 3MWIU 1LQEA 2LPRA 1GBJA 3PTBA 1AVXA 5DP6A 4OS5A 1CT0E 2BVSH 4D9RA 1A7SA 1DSUA 1O2WA 1SQTA 3K9XB 1TNKA 1UTQA 3T25A 1V2LT 2GZ8A 5DPAA 4I8KA 2ZNKH 3M5MA 5L6NH 1T8OA 1C4V2 5C1XA 2P3FH 2QCYA 1SHYA 2CHAC 1GJ8B 1O38A 2ALPA 2G52A 5T6DA 3SU4A 1MKWH 3A83A 1QFKH 2BB4A 1GDQA 1TA6A 1HAOH 5FBEA 1ZOMA 4MQAA 1RIWB 4CREA 3H7OA 2A7HA 1TYNA 1RXPA 2QF3A 3LH1A 2QIQA 2W3IA 3VB6A 4ABHA 4AORA 5JB9S 4X2XA 4JZIA 2BDAA 4ABGA 3M37A 4ABIA 1AE8H 4X2YA 1HXFH 3W94A 1EX3A 1C5ZB 4AOQA 1ZHMA 1NZQH 2PUQH 2I6QA 1FXYA 2BY5X 2F83A 2G5NA 2J4IA 5A8YA 1N6YA 6GCHF 4JK6A 1K1IA 4K8YA 6ESTA 1SMFE 1BRBE 2XCNA 3AAUA 3SHCH 1ARBA 2UUKB 1FN6A 1T8NA 2GCTC 3T5FH 1RRKA 1OPHB 2ZHFH 4A5TS 2BDYA 2P59A 1FQ3A 1GJBB 4MVNA 1QJ6B 1HIAA 4CH8B 1GHXH 1Z6EA 1SB1H 3LGUA 1TBZH 2A4RA 5TCCA 5JBTA 3RXHA 1C2LA 1MMJN 3D23A 4E7NA 3TJNA 3ZVDA 1A4WH 1W14U 2XC5A 3A8CA 1D6WA 2JETC 3I29A 4FU9A 1O3GA 2OXSA 1O2SA 1XUHA 3GCOA 1CBWB 1KIGH 5EQSA 1SLWB 1J16A 6GCHG 2FOGA 3NZIA 1BTXA 1LKAA 1Y5UT 2TIOA 1O34A 3MU4A 5AF9H 3Q3XA 1EASA 3MTYA 5L2YH 1G30B 3SOSA 1GHWH 2Z7FE 2I6SA 3ZV8A 1CGJE 1S0QA 3UQVA 3MU5A 1GHAF 1T31A 4AB9A 3U8RH 4ZHLU 3SN8A 1HAVA 1VITH 1TNGA 1QRWA 3A85A 4HTCH 4U30A 3KHVA 1YPHE 1IAUA 5DK1A 3F1SB 1PPFE 1YPEH 2CJIA 4NIWA 1GI0A 1KXBA 3SO3A 2NU1E 5AVDA 2BOHB 1H9LB 1Z1IA 2O8LA 4XOJA 3ZVCA 3ZYDA 4BTUB 1FY1A 1BTWA 3M7UA 4DVAU 3SZNA 2Z6BD 5CHAC 2A4QA 2PV9B 1B5GH 1W11U 4FU8A 4NSYA 4UD9H 3RXJA 1BMNH 3RM2H 1GHAG 4NIVA 1ZGVA 2J2UA 4MNXA 3FZZA 5DO4H 1LMWB 4UONA 1W7GH 2DE9A 1G36A 4WH8A 1F2SE 4ZMAH 1UK2A 3ESTA 3GYLB 2PTCE 4MPWA 1GJ5H 2A7JA 5GXPA 2GTBA 3R3GB 3DUXH 2BXTH 2QV1A 2G4UA 1GI5A 1DY9A 3E0NB 1P3EA 2ZHDA 1TA2A 1ZRBA 1HJAB 4B76A 1DWDH 2OBQA 1D6RA 1W8BH 1EPTA 3LGTA 3VXEH 4DGJA 2AS9A 1SGEE 3FVFB 2AMDA 2BD4A 1MAYA 1W12U 2H2ZA 3FP7E 2H9TH 1DANH 1NRSH 4CHAB 3MNSA 4GCHF 1UCYE 1TFXA 2ZFSA 3SU3A 1GMHF 1FPHH 1FY8E 1OS8A 4CR9A 2BDHA 2AMPA 1FIWA 4H6TA 2BTCE 3EAJA 1B0EA 4THNH 2GCHF 1O2OA 2TBSA 2VIPA 2BD8A 4UE7H 4JYUH 3STIA 1C1UH 4X1RU 4WMDA 1G3EA 1FDPA 2XWAA 2ZFFH 3ZZBA 2XBYA 2AH4X 5T6FA 4Y8XA 1P2KA 2BZAA 1ELTA 2FOFA 5FX5A 1SL3A 1TONA 3BTDE 2D2DA 4GCHG 4Y0ZE 1GMHG 3RXEA 1V2VT 4DG4A 4DY7B 1O2NA 3MYWA 5HXFA 4BANB 3KEEA 1OWDA 1D9IA 1DT2A 2FOBA 4O9VA 1LPGB 4X1NU 1YCPM 2H6MA 4YLUA 2GCHG 5T6GA 5FPYA 2HPPH 4RKJB 1PQAA 1A3BH 2O8TA 4MNYA 2VVCA 2NU3E 1HUTH 2B8OH 5L30H 3JZ2B 1V2OT 1QQUA 3RU4T 3EYDA 2SGEE 3STJA 2ZGCA 1TPPA 2BX3A 2F91A 3F9GA 3PO1B 1HBTH 3PWCA 1SLVB 1HNEE 1C5VA 3U8TH 4A1TA 2OP9A 2TGTA 4I7YH 4F4OC 3BTQE 5EGMA 1S82A 1PPBH 3VPKA 4ISHH 2P16A 1YPLH 1CT2E 1MU8B 5EPYA 3T28A 5HM9A 3QZRA 4WJG2 3RMMH 4X1PU 5C1UA 1XXFA 1LVYA 1UK4A 3VGCB 1MBMA 1GBIA 5PTPA 1Y8TA 1O2XA 4FUGA 2ZDMA 3SGBE 5JYIA 2QXHA 3HPTB 1QA7A 1K9OE 2CF8H 4IMQA 4YESB 1G2MA 2BD2A 2RG3A 2Z94A 2PGQB 2A4OA 2B0FA 1ESAA 3UR6A 3PM3A 1ZJKA 2BQ7B 2BDBA 1AO5A 2XXLA 3SUDA 1EZXC 1C2GA 3BTKE 1O3CA 1C1QA 3BTTE 1SQOA 2BHGA 1O3IA 2R0KA 1ESBA 3T2NA 1DWEH 2H9EH 3U98H 4ABAA 3TNTA 3T29A 2VWMA 2RA3A 1MTNC 1V2PT 2BXUH 3M5OA 1T4VH 4Y71A 1NS3A 2NU0E 2FP7B 1TX8A 4MDSA 1TRYA 5SGAE 2ZGXH 2P93A 1Z8IB 3OYPA 3LDXH 1QJ1B 2TPIZ 1QGFA 2PSYA 3RU4E 1P8VC 1FY5A 4INHA 5F8ZA 7KMEH 4MG3A 4GHQA 1Y59T 1D3DB 1O33A 4INLA 1KYNA 2ZU2A 5JDUB 1C2EA 1WSSH 2JH6D 1QL7A 3PMJA 1WU1A 1C1NA 3VXFH 1G2LA 2ZGBH 2SNVA 1PPEE 3WY8A 1XUIA 3V13A 4NG9H 2AGEX 2A45B 1EJMA 2V3HH 3RMOH 1GHBF 1O2ZA 3UTUH 1BTHH 4NA9H 1XUFA 2ZHQH 1UTJA 2FTLE 3OU0A 4ABFA 4B2BA 4LOYH 1SHHB 2ZFQH 1C5MD 4VGCB 1MAXA 1KXAA 1V2WT 2ANKH 1P04A 3A7VA 1L4DA 1TNIA 1ETTH 1A5IA 1V2QT 3FANA 4MPVA 1JBUH 2A5KA 2DE8A 1CA8B 3SQHE 1INCA 3ZZ7A 1L2EA 4NCYA 3PWBA 2ZU3A 1T7CA 4K1SA 2SFAA 1OWEA 4X1SU 2QN5T 1AFEH 5B6OA 1GHBG 3M5LA 1C9TA 1E35B 1ZZZA 1YPGH 2XWBI 3ELAH 2Y80A 4UFFH 1QRXA 3T62A 1TALA 3UR9A 1NFWA 1ZMLA 3A7WA 1CA0B 4FUBA 1J9CH 3S9AA 3M3VA 1PPCE 4Y79A 2A7CA 4KTSA 5BPEA 3E1XB 3SJ9A 3MH4A 3URCA 1CGHA 4X8TH 1BTPA 5AFYH 1DOJA 1C1OA 3UIRA 1EAIA 1NFYA 4OS2A 1GJCB 5EXLA 1TQ7B 3PROA 4WXIA 1EOLA 3RXLA 5E0JA 3SI4H 5DG6A 3M35A 1KXDA 1T8LA 2VH6A 3RXRA 1VJAU 2H9HA 3GY4A 7GCHF 1KXEA 1QCPA 1OP0A 1RTFB 1XUKA 3BTWE 1YCPH 1GVLA 2ODPA 1P2JA 1EAUA 1XM1A 1P2OA 2CXVA 3EA9A 1HRTH 1K2I1 1SLXB 2HVXA 1S85A 5GPIB 3SU2A 3K6YA 3E90B 1MTSA 4ABJA 3R0FA 1OP2A 1IHTH 1P2MA 4CBOA 4GHTA 1SI5H 1HJ9A 8ESTE 1FAXA 1E38B 2FMJA 2GMTB 3ODDA 1DDJA 4X2VA 1UVPA 3VB4A 2B7DH 3P17H 2P3UB 3E6PH 1GGDC 1AGJA 1WV7H 3BTME 4XE4A 3CP7A 5ESTE 5JBBS 3KQDA 1P9SA 1ELAA 1BITA 3SNDA 2EC9H 1O5AB 1P2QA 2OINA 1H1BA 1TRNA 1XXDA 5HGGA 7GCHG 1TE0A 1Z6JH 4JZFH 3AASA 4KTCA 1PQ5A 4K5ZA 1GJDB 2WV5A 5TCAA 4AZ2B 4R0IA 1P2NA 3A84A 1A5HA 1NRRH 3ITIA 1O2JA 1A0LA 4GVUA 3HK6B 2PUXB 1J15A 3TGKE 1NO9H 1A3EH 3H5CB 1O2GH 3SU6A 3F9EA 1F0TA 1P01A 1WAYB 1TOMH 3FAOA 1O30A 1ESTA 4H4FA 2P8OC 4DT7B 1NT1A 1MKXK 1NU7B 3TH4H 3SNBA 4LZ4B 1BTUA 2Q6FA 1THSH 1FY3A 2FOCA 2XYAA 2A0QB 2ZTZA 1TQ0B 1G37A 1FIZA 2K1QA 2WV4A 3C27B 5AFZH 3U9AH 4B73A 4E7RG 5C3NA 5G4BA 1O3DA 2SGAA 4BAQB 5GIBA 3MO6A 3ZVGA 4ZUHA 1DICA 1FY4A 4CRAA 2R2MB 3H7TA 3DD2H 1MTWA 5FXLA 1HV7A 1UVTH 3I77A 1AU8A 2EI7A 3HKIB 4AFUA 2C3SA 1IQKA 1EZQA 1O3MA 2Y7XA 3TLOA 2FIRH 4Y8ZA 4E05H 1DXWA 1C1WH 3FP6E 1TMBH 1V2RT 5K0HA 1O3NA 1KLJH 2M5TA 2IN2A 3SW2B 1OP8A 3DFJA 3RMNH 2ANMH 2P94A 4I8GA 1SGNE 8GCHF 1HAIH 1C2FA 3SORA 2ZFTA 2ANYA 1UVSH 1NFUA 2YNAA 1MBQA 2Q6GA 2ZFRH 1TB6H 2WPIS 3U8OH 1Q3XA 2O8UA 1RTKA 1UO6A 3GISB 1OYTH 1GBTA 3GDUA 1ETRH 3TJUA 1H9IE 1O2QA 1XMNB 2A31A 1PQ8A 2ULLA 3UWIA 1IHSH 2JH5D 4NZQA 1NM6A 1DPOA 3RXQA 3RXGA 4KP0A 1KXFA 2FOAA 1BB0B 3IITA 1HLTH 1HPGA 4D9QA 4ZROA 5JB8S 5ABWA 4Y6DA 1YBWA 5TJXA 1JMOH 1A2CH 3DFLA 1O37A 3VEQB 1Y5AT 2TRMA 1NN6A 5F8XA 1BQYA 1O36A 3BEUA 1CHOF 1HYLA 2GDDA 5EPNA 1GCDA 3LGVA 5FCRA 1G32B 1EAWA 1DWCH 4AG2A 4AYVB 1AHTH 1CVWH 2A5AA 3RXOA 3A81A 4HZHA 4Z6AH 1ELDE 2CHAB 1AZ8A 2J94A 4AYYB 3TVJB 3MU0A 3BEIB 1V2NT 4MNWA 1BZXE 1QB1A 4WVPE 3GY3A 1OWJA 1O5CB 1P3CA 1XVMA 1ZTKA 1MQ5A 2TGDA 4X1QU 1C1RA 3RXVA 1WQVH 5CMXH 2VWOA 1TMUH 3E3TA 2PGBB 2F9PA 2GT8A 3HATH 4AFZA 1AVWA 1GPZA 5HMAA 4ZKRU 2BX4A 5C2ZA 3RXKA 1CHOG 1SGQE 3LC3A 4IW4E 3TK5A 5E2OA 1VGCC 3SNEA 1YPKH 3SU1A 4UDWH 4NWLA 2GCTB 1O3LA 5EODA 1F92A 1MKWK 1FPCH 2PLXA <