4GVUA

Lyngbyastatin 7-porcine pancreatic elastase co-crystal structure
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent elastase inhibitors from cyanobacteria: structural basis and mechanisms mediating cytoprotective and anti-inflammatory effects in bronchial epithelial cells.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Chymotrypsin-like elastase family member 1
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gvuA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gvuA01
1HLTH 3SJ8A 3SW2B 1OWKA 1Y3VA 1SGRE 4X2XA 2NU4E 1SHHB 2SNVA 1KXAA 2EI8A 1K1JA 1C1WH 1N6YA 4IBLH 5JB8S 5CHAB 2G00A 1WTHD 1TIOA 2AEIH 5PTPA 2NU2E 1O3KA 1TGCA 3SNBA 2J4IA 3PO1C 3UREA 3M5NA 1SG8B 2ZG0H 3ATWA 3FP8E 1LKAA 2VIOA 1MTWA 1ZSKA 1INCA 1UO6A 2ZU1A 1LHFH 1GHBF 2HNTE 4MNWA 2PKSC 1A2CH 4TYDA 4AYYB 1AZ8A 1G3EA 1SFIA 1AZZA 1WQVH 5ABWA 1IQEA 3ZZAA 4O3UA 1DWBH 2TPIZ 4AFSA 1HJ9A 3LJOA 4JZIA 5F8TA 1J14A 4BXSA 1T4VH 2BMGB 1OXGA 1K2I1 1BTXA 1FZZA 2H9TH 3RXCA 2TGDA 1GJ7B 3JZ2B 2BVRH 2CF9H 3UUZA 3UWIA 2ZGXH 1B0FA 2PFEA 3MWIU 4E05H 2ZI2H 5C3NA 1GBIA 3T27A 4ABBA 8ESTE 2SGFE 1TGSZ 1O0DH 1K28D 2FOGA 3K6ZA 3MH5A 4ABFA 3M3TA 4Y7BA 3A8AA 2R0LA 4DURA 2IJOB 2F9PA 3W95A 3GY5A 1FQ3A 4JYVH 5C5OA 2C8WB 2G4TA 1Y5BT 1T8NA 1DX5M 4IC5A 2QY0B 4CR5A 3TIUA 3QLPH 3BTTE 4WVPE 5L2YH 2H5DA 1G32B 2ANYA 1ZSJA 2GP9B 2XBYA 4ZKRU 1FAKH 1FAXA 2JETC 3LGVA 1N1LA 5GJ4B 4X1PU 2PTCE 3A83A 4WH8A 3ZZCA 2J92A 1O3HA 1UTPA 2J95A 2GV7A 3RXQA 3TGIE 1M9UA 3ZV8A 4Q7XA 2GCTB 2OQUA 3EAJA 1VR1H 4NIWA 1BMLA 3RXBA 4ABJA 4K1SA 3I78A 2GD4B 4Q80A 1ELFA 4GAWA 2YOLA 1O38A 1D6WA 1KY9A 2VGCB 3SQHE 1DS2E 5JYIA 2HNTF 1XVOA 4UFGH 3TPIZ 1IQLA 1SGCA 1HAPH 1OS8A 2OUAA 1SLXB 1SQAA 3TH3H 1FONA 3LH1A 3UPEA 1VCQA 3ZVDA 1BB0B 1TPAE 2SNWA 1UTLM 2Y7XA 4A92A 1O2YA 3BG4C 2FOMB 1SPJA 3PTBA 2SGDE 5GDSH 4Q7YA 2YNBA 1T31A 4WMFA 2CHAC 1OWJA 1PJPA 4ABGA 4DW2U 1GHZA 3S69A 2SGAA 3MH4A 1OP2A 1QCPA 4GHTA 6ESTA 2ZNKH 4NIYA 4X6NA 1EZQA 1PQAA 3I29A 3O8BA 2J34A 2JKHA 1TBRH 1MCTA 4F49A 4XOJA 1OSSA 3T62A 2XXLA 1WTGH 2ZHQH 4Y8YA 2PW8H 3GDVA 2OBOA 2OLGA 1AFQB 5AHGH 1NC6A 4MTBA 4TPIZ 1NRRH 1O3CA 2BY8X 3OTJE 5A2MH 1GI0A 4SGAE 2GT7A 2G5VA 2NU1E 2VNTA 1QHRB 4THNH 1ANDA 4TWWA 5A0AE 1GI4A 4RN6A 3T2NA 1EJNA 5B6OA 9LPRA 4X8SH 1D3TB 1UCYE 1EPTB 3IITA 3NZIA 8GCHG 4JZ1A 1ELAA 1C5QA 1DOJA 4VGCB 4BTIB 4INKA 2CN0H 4OGYA 1YBWA 1DITH 2WPHS 2FS9A 1OKXA 1AVWA 1QBOA 4MNVA 4MPWA 4FXGH 1O2XA 2BHGA 1O2GH 2Y5HA 4ASHA 2ALVA 2A5KA 4B2AA 3LGIA 1BDAA 3ZZ4A 3S0NA 2HPPH 3FP7E 3SO3A 1V2NT 5HYOA 1PQ5A 1C5RA 1S81A 3LONA 1O2IA 2ZKSA 5TCAA 1YPHE 1N6XA 4WMDA 1VGCB 2TBSA 1RS0A 3P70B 1RTFB 3KQEA 4O97A 1TPOA 3QTVH 4H42U 4YOGA 2GTBA 1T8OA 3PMBB 1O3JA 3A8DA 1C2JA 1C2LA 1NPMA 1HAXB 1GL1A 1SL3A 2Y6TA 1CT4E 2GMTC 1TYNA 3QUMP 1V2UT 2FYQA 2HRVA 4HI3A 4UDWH 3NXPA 4MLFB 2B5TB 4IMQA 4R0IA 1P01A 3A7XA 1RXPA 2DE9A 4UFDH 1O3OA 2TRMA 1O2QA 1P04A 1AMHA 1BA8B 4H6SB 2Z94A 2R2WU 1ZHRA 1ACBE 3L6PA 2IN2A 1P0SH 1Z8GA 3LGTA 1TOMH 1GBBA 2A5AA 3MO9A 1YYY1 4B76A 3A7ZA 3RXEA 3KNXA 1YPLH 1L0ZA 2PHBA 3ZVAA 2AGEX 4FUBA 1MD7A 1FXYA 1Z8IB 2R3YA 3M7TA 1TGTA 1H8IH 1NO9H 1GJ9B 1LVOA 1ZPZA 1YPKH 3DFJA 3UNSA 1O3GA 1T32A 1CU1A 1LKBA 2ZGJA 1O2RA 3MO6A 3GISB 1MAYA 4Y0YE 1O3EA 4Q2KA 2OTVA 3B8JA 2QV1A 1SGPE 2P95A 4YT7H 1KXBA 1VJAU 3DHKH 3LOXA 3PMHB 4KTCA 3SUDA 1O2OA 4JCNA 1QA7A 4K8YA 5GCHF 4X1QU 2ZPSA 1ANEA 2B8OH 3U1IB 5HMAA 4YLQH 1BQYA 1S0QA 2FDAA 1SLVB 2ZGBH 5LPFA 1GDQA 1CO7E 3Q76A 3LH3A 2H9HA 3TK9A 1RJXB 1EAWA 1C1MA 3QZRA 3SJ9A 4ABAA 1O5CB 4GCHF 2ZFQH 3AASA 3ATMA 3SN8A 1MMJN 4I7YH 3SU3A 1UTKA 5FX6A 2VJ1A 2GMTB 4ISHH 2GCTC 3L33A 1GI6A 1G2LA 4X1NU 2JH0D 2CF8H 1HB0B 2OC7A 5EU8A 3NKKA 3IG6B 2C90B 1GBEA 1LPGB 3M7UA 3DD2H 2PSYA 1P3EA 5JPMH 3NK8A 4KELA 1J15A 1S6FA 2DUCA 1BRAA 3HPTB 1P2IA 3WY8A 2XWBI 1BTYA 2Y5GA 2W7UA 1FNIA 2ODQA 2ALPA 4NIVA 4CRGA 1P57B 1SFQB 1QY6A 2Y82A 3AW0A 1WV7H 1YCPK 1XKAC 2C8XB 4H6TA 2BD5A 2UWOA 1QQ4A 1ZGIA 3F1SB 4K2YA 1F5KU 4D7GA 4DGJA 1TRNA 4Q7ZA 1GI5A 3MFJA 4AFZA 2FODA 3UOUA 2WPLS 1UCYH 5C20A 1ESTA 3RXPA 1RFNA 3K2UA 3UQOA 2Q6DA 1AUJA 2VWNA 2PKAA 3SQEE 1D3QB 1OP8A 1Y5AT 1QA0A 5C2ZA 4ZKNU 1C9PA 1O3AA 4Y6DA 2PGQB 1PPEE 1OPHB 5A09A 1GMCF 2BDHA 2F3CE 3ZVGA 4AN7A 3VGCB 1NESE 3LC5A 4X2WA 2AMDA 1O2SA 4AG2A 1W10U 2CGAA 2STBE 3H7OA 1FJSA 1O2ZA 1T4UH 1MU8B 3DA9B 2PKSB 2OBQA 2ZZUH 3SUFA 2A0QB 3U98H 1OX1A 3ZZ9A 3ODDA 1GCDA 4YOJA 3BIUH 1TWXB 5CHAC 2QIQA 3BTFE 5C1YA 1NROH 1S82A 1GL0E 2AMQA 2BLVA 1GPZA 1SC8U 3SU2A 3ATLA 3KCGH 3SU6A 5C1XA 2ZWLH 1SGFA 3SGAE 5F8XA 1N8OB 1TE0A 2Y80A 5L30H 4XBBA 1S0RA 5EPNA 3LPRA 3B23B 4WMEA 1SLWB 1UHBB 1Z8JB 1EOJA 2FM2A 3PLPA 3SHCH 1TQ0B 1NRPH 2ZFTA 1MTNB 1TOCB 1HYLA 1GHBG 4CR9A 3DT0H 1P02A 1PPZA 2BQ6B 1GBTA 1O3LA 3PWCA 2VGCC 4A5TS 1C9TA 1OP0A 3LJJA 1BTPA 2B0FA 1CGIE 2HVXA 2ZO3H 1D3DB 4NZQA 4Y0ZE 1LTOA 1TNGA 5DP9A 1MKWK 5LPRA 2FOFA 4KP0A 4Y79A 2CXVA 1YPEH 2Z9GA 2BY7X 3KQDA 2P94A 3FZZA 2BY9X 1CGHA 1UVOA 1JWTA 2NU0E 3LGYA 3KGPA 1AIXH 1ZR0A 3SJOA 3SJIA 3RLWH 1ZMLA 2GGVB 3UR6A 2WPMS 3A82A 4NA9H 4IMZA 1LDTT 1ZTLA 5K0HA 1QQUA 1ARCA 3P8GA 1GG6B 3V3MA 1GWAA 3ESTA 3ZZ3A 3KIDU 5DO4H 3F9EA 1ZJDA 1GJ4H 4B75A 4GLYA 3GCNA 1EJAA 2J9NA 1LHGH 1HGTH 3M35A 1OYTH 1QGFA 1BMAA 1QL7A 1AKSA 2VWLA 4Z0KA 4JZEH 1LHEH 4KTUA 1YPJH 4LK4A 1O3IA 1T8MA 5LH8A 1QIXB 5GWZA 1BHXB 1XVMA 3TJOA 5SGAE 5FBEA 1GHVH 5DKMA 2BD4A 1MH0A 2VH0A 2FWWA 3K65B 3UOPA 4D9RA 1S84A 4GCHG 3HKIB 2Y81A 2QXGA 1XMNB 5FPTA 1FMGA 2IOTA 3A8BA 1HRTH 1QJ1B 4D7FA 4NFEA 1MQ6A 3BV9B 2OQ5A 1GGDC 4B71A 1NY22 1TGNA 1V2TT 4BAOB 1A3BH 1O3DA 3RU4T 4FVBA 1H9IE 5DJ7A 3RC6A 4CRDA 1P8VC 2O8TA 1TLDA 3KN2A 1GI3A 1O3BA 2TIOA 2THFB 4AFQA 1C5PA 3EA7A 1HJ8A 1LHDH 3GCTF 2AH4X 1G36A 4NCYA 5E0GA 1Y3YA 4XBDA 5TCCA 3GCOA 3SU0A 1C2IA 2FPZA 1GHAG 4YTAA 2BVSH 2QC2A 2WPJS 3PO1B 4K3JA 1E35B 1C5ZB 2QYIA 1AVGH 5DP7A 3GCHC 1WBGB 2Z3DA 3LT3A 3LIWA 4RKOB 2W26A 3U1JB 1UTQA 4K5ZA 2P16A 3SV6A 3I77A 2XBVA 4AOQA 3MU8A 1ZMJA 2ZFPH 3MH7A 1ELGA 3PYHA 1DWCH 2OXSA 3E8LA 1GJ5H 1UVSH 4OGXA 1O35A 2FX6A 1ETRH 4BXWA 3SJKA 1ELVA 3ATKA 1Q31A 2EC9H 4MPXA 5AF9H 2ZHFH 3TH2H 4TPYA 4LXBH 1J8AA 1O31A 1FN6A 1O2UA 2P3TB 3E6PH 4J1YA 1HNEE 3BTKE 2F83A 5ETXA 4D8NA 1XXDA 1FY3A 1F5LA 3PWBA 2GV6A 3E0PB 3N7OA 4FUFA 1Y59T 2ZU4A 1J17T 1XUIA 3U8OH 1BTHH 1ZLRA 1KLJH 1F2SE 8GCHF 4BAMB 3QX5H 2BB4A 3ENSB 5T3HA 2EA3A 2BZ6H 1MBQA 3MH6A 4GVUA 3SI4H 1E0FD 4O9VA 1O2VA 4DIHH 2Z7FE 2P8OB 4MQAA 3V0XA 4Y71A 4X8VH 4O03A 2FOEA 2J38A 1NT1A 5E0HA 2PTNA 1BRBE 2WUBA 5HGGA 1KTSB 2GZ8A 2ZDVH 5C1UA 1DFPA 3VXEH 2QCYA 3RXJA 4MVNA 3KQCA 3QO6A 4LOYH 1IQKA 2FEQH 1X7AC 3O8CA 1OWEA 3VB6A 2HALA 4FU7A 3RM2H 3UWJH 1F0SA 3EA9A 3AAVA 1D3PB 1AE5A 2Z9JA 3EQ0H 1YLCA 1DVAH 3ZZDA 3RMNH 2C4FH 4AGJA 1HCGA 4O3TA 4UEHH 1ZOMA 1SOZA 1BBRE 2PR3A 2FTLE 1IQGA 3D49H 3RXGA 3ELAH 2BZAA 2BQWB 1K9OE 4JZFH 1EXFA 1ELCA 2VVCA 2D26C 1LCYA 3UNQA 1GCTB 1UVUH 1QB6A 3Q77A 2BQ7B 3VB3A 1LPKB 2GX4A 3M37A 5IDKA 2UUFB 4INLA 2OC0A 1SGQE 1ETTH 4NWLA 1BBRH 1C5WB 1Z8RA 2LNCA 4MNYA 1UTOA 6GCHG 1ELDE 3TNSA 3JZ1B 1C1SA 2M5TA 4XFQA 5DGJA 4NSYA 3QDZB 1EATA 1EX3A 2A2QH 4X6MA 1C1NA 1H1BA 4IGDA 2UUKB 1CQQA 2J2UA 2BDIA 3ZZ7A 3V13A 1C4V2 2BDCA 8LPRA 5C5NA 1P2OA 1THPB 1P9UA 2OINA 1ANBA 4FUHA 1JXPA 5DP6A 4ABIA 1Q3XA 1VITH 1FI8A 1VITG 1LMWB 1IQHA 4I32A 3RC4A 1GI8B 1KYNA 4ZKOU 2ZC9H 4BOHA 1BTWA 3UTUH 1P03A 2BY5X 2FS8A 2WV4A 1TX8A 1ID5H 1L2EA 1Z6JH 7GCHF 2BM2A 2WYJA 3VFEA 3A7WA 1FUJA 1GI7B 1SGTA 5E0JA 2HPQH 5TJXA 1L1GA 4X6OA 3RXKA 1HAIH 2VB0A 3M5MA 1KLTA 3SV8A 3T28A 3TH4H 1K1PA 4ABDA 3TJVA 3F6UH 4OS1A 1A61H 1KTTB 1QFKH 1JBUH 1P09A 4HTCH 1Q2WA 2D2DA 6LPRA 1AB9B 2GKVE 1C5UA 2TGTA 3RU4E 1V2QT 5EPYA 2BX4A 4IW4E 2GCHG 1Z1JA 3BIVH 1DUAA 4ZXYH 1G37A 1CA8B 1EAUA 1G2MA 2A7JA 1K21H 2SFAA 1EUFA 1BCUH 1Z1IA 3P92A 1C5NH 3EGKH 3MHWU 1O2TA 1EZUC 1UVTH 1GDUA 4ISOA 3ZV9A 3ZVCA 1O3FA 1EZXC 3OX7U 4X2YA 1MU6B 1O5FH 4ISIH 4X1SU 3RXFA 3IWMA 2WPKS 2R3UA 3QK1A 2QXIA 4DOQA 1HJAC 1GJ8B 1H9LB 1YF4A 2VINA 1W7GH 1KDQB 1BOQA 1HXFH 3BTGE 5FX5A 2ZHEH 3URCA 2Z6BD 3SGQE 1TNIA 1AWHB 5A8XA 1MAXA 2VWOA 1EJMA 5CE1A 1QBVH 4NZLA 3SV2H 5A0BA 1MKXK 1KIGH 2R0KA 2BY6X 3H7TA 5JBBS 4GPGA 1N8OC 2ZHDA 2XC4A 1FV9A 3RP2A 4CRAA 1P06A 2P3UB 2BOHB 2BTCE 2W7SA 1MTSA 2XW9A 4D9QA 1OWIA 3C27B 1TBZH 4UFFH 2KAIA 4BANB 1QURH 1THSH 4K69A 2FOCA 1EB1H 2FYRA 5C67A 1TBQH 2ZQ2A 2VIVA 1NFYA 3EDXB 3AAUA 2VIDA 3T29A 1S6HA 3GYMA 1Y3XA 4ZUHA 3RXOA 1JMOH 3MI4A 1W2KH 1P2KA 3HGPA 2H5CA 2IPHA 1BTZA 2AIPA 2XWAA 1K1OA 5ESBA 1IHSH 1AKSB 4MDSA 2GVFA 3RXLA 2BDBA 5DG6A 1D9IA 1K1NA 2A1DB 5JBAS 2UUYA 1KXCA 4I8JA 5HM2A 1O30A 4ZHLU 1QRXA 4WJG2 3V7TA 3D23A 2FLBH 4GHQA 2CJIA 3KF2A 1GHAF 1HXEH 2SGQE 5FCRA 6CHAC 4OS4A 2BD7A 2BDAA 5GPIB 4E7NA 1BHXF 1ABJH 3MNXA 3RDZA 1VGCC 1H9HE 1W7XH 1UK3A 2XBXA 3BTWE 3PMJA 3EA8A 4AG1A 3RXAA 1PYTD 5T6FA 2TGAA 2F9OA 3OY5U 1ZMNA 4BTUB 1O39A 1IQJA 1DSTA 3GYLB 2H1UA 1GG6C 2C8ZB 3UIRA 4QT8C 1TALA 3D62A 1QB1A 1SI5H 1A46H 3E16B 5FCKA 2ZEBA 1HFDA 1J9CH 2ZFSA 2ZTXA 1GBAA 1NRQH 1C1RA 1EPTC 1L4DA 3ZZ8A 1ZRKA 2PV9B 3SNCA 3VB5A 2BYAX 3PLBA 2W3KA 1W8BH 1AU8A 3RC5A 1O34A 2OP9A 1B7XB 2C3SA 2WV5A 1JIRA 1L1JA 1W14U 1DPOA 3HK3B 1EZSC 1ANCA 5J4QA 4XSKU 2CHAB 3VPKA 3S9CA 1SGFG 1DICA 1JIMA 1IQMA 4MNXA 3P8NA 2A32A 1GJCB 1GHXH 1L4ZA 4H4FA 5FAHA 3SV9A 1WOFA 3QZQA 4U30A 5J4SA 5LGOA 1FY5A 5L2ZH 1AE8H 1GBHA 2P93A 1CBWB 2BVXH 1O3MA 3E91A 1ESBA 2BLOA 3EE0B 5CMXH 3FZDA 4Y10E 1YCPM 5AFYH 1OWDA 4FUGA 1DWEH 4TY6A 3T26A 4F4OC 3PROA 2A5IA 2P3FH 3GOVB 1V6DA 1LVMA 1OOKB 3AW1A 5GXPA 1HAGE 3ZVBA 1FIZA 3BSQA 5AFZH 1CT2E 1GBMA 1WSSH 2O8UA 1XUFA 1C5XB 1LHCH 1O5GH 2ZHWH 1O2KA 2R9PA 1HAHH 5HM9A 1KXFA 3HATH 3BTME 3QGNB 2AGIX 2ZU5A 4B2BA 3STJA 3E1XB 1AY6H 1QJ6B 2Y5FA 1Y3WA 4CBOA 2H6MA 4OS6A 1V2JT 4JYUH 2VVUA 4YT6H 4IC6A 3OU0A 1LQEA 3D65E 3CENA 1K1MA 2PUQH 1B0EA 8KME2 2Z9IA 1C1PA 5BRRE 4BAQB 3S7HB 4YESB 1CHGA 1QNJA 2Q6GA 4UD9H 1PPHE 1HAZB 4A1VA 1RTKA 3S9AA 3T5FH 4JZDH 1CA0B 1UTMA 1XUKA 2B9LA 3LC3A 2G81E 5A8ZA 3MTYA 4SGBE 2UUJB 2A4OA 7ESTE 1E36B 1TAWA 1QRWA 1SB1H 2F91A 1EP5A 1DLEA 1AGJA 1K1IA 4ABHA 4U2WA 3ZZ6A 2JH5D 3GY3A 1ZRBA 1B5GH 4FUDA 3SU5A 1HAVB 3BEFB 1SGNE 3RXTA 4PROA 1NS3A 1KLIH 1DXWA 3VB4A 2ILNA 1C4Y2 4OS2A 1HBTH 3Q3YA 2D1JA 2OCVB 3ATIA 5F03A 3UR9A 3A88A 3RMLH 4FUJA 3SORA 1DSUA 1GJBB 2BD3A 2BDYA 2BX3A 2ZA5A 4K8BA 1EOLA 1C1VH 4I8LA 1F0RA 1EKBB 2XBWA 1PPBH 2ZU3A 2H2ZA 2F9NA 2WINI 3ZYDA 4AGKA 2Y7ZA 2ESTE 1C1QA 1C5SA 2AMPA 2HWLB 1SLUB 4ZHMU 5FPYA 3Q3XA 3TGJE 1IQIA 4TWYA 1U6QA 1MCVA 2PKAB 3AVZA 5F6MA 2OC1A 3RXSA 2H9EH 3M5LA 4FUIA 2PWXA 3A84A 3MU0A 5AVDA 1O2LA 1YC0A 5I46H 1GGDB 1C5LH 1YPMH 1Z6EA 4KGAA 4ZAEA 1BZXE 1TNKA 3PTNA 4GUXA 1P05A 1GMHF 4HFPB 4VGCC 1SSXA 5E8EH 4CRCA 5FPSA 2I6QA 4MG3A 2A4GA 3PV4A 4OS5A 1ESAA 3HKJB 3SZNA 1TPPA 1C1TA 2ODPA 2QGRA 1LQDB 3SNEA 3OSYA 1BITA 2VIWA 2NWNA 1EASA 2FO9A 4NA8A 2GCHF 2K1QA 3DUXH 3RXIA 2ZDAH 3ZZBA 2ZCHP 1Y5UT 1OYQA 1P2QA 5GIBA 1QL8A 2O9QA 3BEUA 1TMUH 1G3DA 4NG9H 1UTJA 3K6YA 4E06H 4XE4A 4ZROA 5JDUB 2G52A 1LVYA 4IS5A 1MTNC 3MU1A 5FHTA 1NN6A 3A86A 4UONA 4WWYA 1LVBA 3GICB 4CHAB 1AFEH 1CHOF 1GHWH 5DP5A 1FY1A 1LPZB 3RXHA 2VIPA 3SBKA 1TRMA 3M3VA 4X2VA 4Y11E 4DJZB 3ZYEA 2DE8A 2Z3CA 1MUEB 1BJUA 3KQBA 1GBDA 1GVKB 4U01A 4CH8B 1O5AB 3BN9A 1T7CA 2OD3B 2XCFA 1HJAB 1C2GA 1YLDA 1ZPBA 3SNDA 2ZPRA 3LGWA 2A31A 2XC5A 1XM1A 1G3CA 3GY6A 2JH6D 4I8KA 1TA6A 2ZF0H 2F9BH 1SGEE 3BTHE 1PPCE 1GVLA 3BF6H 1GI1A 3F9FA 3Q3KA 3B9FH 3M61U 3U69H 1O3PB 2ZDMA 1ARBA 4FUEA 4D76A 2W5EA 2YNAA 2A2XH 1JRSA 2XCNA 1G30B 4CRFA 2ZTYA 3DFLA 1E37B 4HZHA 3TGKE 5EG4A 2ZGHA 3RXRA 3SGBE 4YM9A 4XDEA 1GMDG 1AQ7A 4B73A 3SHAH 5GCHG 2GZ9A 3TITA 1FY4A 1WU1A 2ZFRH 2PSXA 4X0WU 2W3IA 1GBCA 3FANA 5DP4A 4FUCA 1WQSA 2RG3A 4Z6AH 1MKWH 4YOIA 1WYKA 1UTNA 1W0ZU 2Q1JA 5A8YA 1AI8H 1HAOH 2Z9LA 3ODFA 3M7QA 1VCWA 2F9VA 3MO3A 1WAYB 1KXEA 3VXFH 3L3TA 1SR5C 4I31A 4UE7H 3V12A 2LPRA 2FI3E 1S5SA 5EW2H 4ZXXH 2BLQA 2RDLA 3NCLA 1IAUA 1YM0A 4JK6A 3T25A 1BUIA 1KDQA 1V2VT 1RRKA 1GCTC 1C5TA 2SGPE 1GHYH 1HAYB 2ANKH 1UK4A 3S9BA 1TMBH 1CHOG 2BXUH 4AX9H 1GMCG 1D6RA 1V2RT 4ZKSU 9ESTA 5G4BA 1C1UH 3P8OA 1NU9A 2R2MB 6CHAB 1G3BA 4KTSA 3SOSA 5EQQA 1RGQA 2GT8A 4NA7A 4Y7AA 3ZVEA 1DT2A 1TMTH 2ZIQH 3SUEA 1PPGE 1TGBA 1TQ7B 1TNHA 2O8LA 3U8TH 4WF8A 4Y8XA 2G8TA 7KMEH 2EI7A 1BT7A 1O2PA 1P2NA 4CH2B 4WXIA 3RLYH 2ULLA 5DK1A 1BTUA 4MPVA 4AZ2B 3GDSA 1GBJA 3M36A 4A1TA 2AFQB 3U8RH 1A1RA 2GZ7A 1LO6A 3H5CB 1CGJE 4ZMAH 1A5IA 2ODYB 4FVDA 1TNJA 4BNRA 2AS9A 3MNCA 3PM3A 4DY7B 1DXPA 1SOTA 2UWPA 4AORA 1XUGA 4FU9A 3MOCA 1O5BB 1V2LT 2FTMA 1OWHA 2WYGA 1BMNH 1UJ1A 1ZTKA 1PYTC 2A45B 2J94A 1GI2A 1CE5A 4I33A 4DIIH 1C2FA 2WUCA 3R3GB 4BAHB 2O8WA 2ZGCA 1SQOA 3CS7A 1ZJKA 3QWCH 1P2JA 2G55A 1A7SA 2QXHA 1W13U 2ZCLP 3CP7A 1YCPH 1VZQH 1NM6A 3MYWA 3GY7A 2XNIA 1DY9A 2QN5T 1NTPA 1RIWC 3TJUA 4Y76A 3KHVA 4R8TB 1CBWC 3UFAA 3M5OA 5FBIA 1O32A 1FN8A 4K1EA 2BXTH 1YGCH 2O8MA 3O8RA 1NRSH 1VCPA 3TLOA 5JB9S 1VJ9U 1QB9A 2HOBA 3RM0H 5JBCS 1KXDA 3GCHB 3VB7A 4AB9A 3UNRA 1RD3B 1XUHA 3A87A 1SGDE 1V3XA 2C93B 3PMAB 1F0TA 4GSOA 4CBNA 1O5EH 3BTDE 1O2MA 5I25A 3P8FA 2FI5E 1F92A 1GJ6A 2ZDNA 1ZSLA 3G01A 1Z71A 5ESTE 1BJVA 1EB2A 2QF3A 1W0YH 1A5HA 1TA2A 2ZDLA 1O2NA 3A7VA 1GJAB 2VU8E 1C4U2 2FLRH 2VIQA 3UY9A 1H8DH 4CHAC 3Q00A 1O2JA 4WH6A 1IQFA 2XRCA 3TVJB 3A8CA 1G9IE 2Q6FA 1MQ5A 2PUXB 1P9SA 4A6LA 4RKJB 2ZFFH 1QRZA 3FP6E 2FOHA 4X6PA 2GDEH 1RTLA 2A4RA 1PFXC 3BTEE 1CT0E 1WCZA 1MTUA 3O8DA 3A7YA 3RMMH 3GDUA 4JYTA 2ZQ1A 1QR3E 2CV3A 1AVXA 3PB1E 2CMYA 1EAIA 1GMDF 3SNAA 3HK6B 1HUTH 3A80A 1P3CA 1ZPCA 3LKWA 2BD8A 4I8HA 3E0NB 2A7HA 1SMFE 4LZ4B 1BRCE 1Z7KA 3MNSA 1ZGVA 4KKDA 1UMAH 3VEQB 1FY8E 1UVPA 1MBMA 2HGTH 5L6NH 1C5MD 2ZP0H 2F9UA 4DT7B 3RXVA 4WXVA 1SGYE 3GCTG 4K1TA 1DLKB 3CS0A 3FAOA 1TX7A 3TNTA 2G4UA 1V2ST 3A89A 1QJ7B 1C5YB 5FXLA 1F5RA 1AO5A 4FU8A 4AFUA 1GMHG 1O37A 3QN7A 2VH6A 2AERH 3F9GA 1DANH 1EAXA 4NGAH 1O36A 2XC0A 4BTTB 1ZYOA 2VWMA 4LZ1H 4IN2A 1TPSA 1AFQC 2QA9E 1AHTH 1J16A 1O2WA 3K9XB 3RUOA 5H4IB 3LU9B 1IHTH 1C2MA 3FVFB 3LGUA 1W3CA 1JRTA 1A0HB 2FMJA 1W12U 1FPCH 1AWFH 1RIWB 5F8ZA 1A0JA 5EXNA 3OY6U 2UWLA 1NU7B 1A3EH 1MZAA 1ELTA 1EQ9A 2I6SA 1H4WA 1ZTJA 1HAVA 1S85A 1DY8A 1AB9C 4X1RU 3U9AH 3MNBA 1V2OT 1FDPA 2ZPQA 1VITF 2A7CA 4INHA 1MTVA 3SUGA 3E90B 1NFWA 1O2HA 4TY7A 4OS7A 1W11U 1CA0C 1BRUP 4RSPA 4ZHAA 4HGCA 1P2MA 1O33A 1GDNA 4ISNA 4NIXA 1TFXA 5DP3A 5EODA 3EYDA 2P8OC 4NFFA 1MKXH 1C5VA 1F7ZA 2ZU2A 3KL6A 1FPHH 4X8UH 4K60A 3A7TA 2ZDKA 5DP8A 2XTTB 3SV7A 1GI9B 2AYWA 5A0CA 3TU7H 3SI3H 1C1OA 1KSNA 1QBNA 1S83A 2G5NA 1L1NA 3NWUA 3VGCC 1THRH 2SGEE 1YPGH 1DDJA 5E2OA 2FZZA 7GCHG 3SU4A 4A7IB 2ASUB 1NZQH 1IOEA 2FI4E 5EQRA 4E7RG 1XUJA 3W94A 3TK5A 5E2PA 2Z9KA 3QGJA 2FESH 2ZECA 4B1TA 2ANMH 2QXJA 2PGBB 4I8GA 1SVPA 4IN1A 1C2KA 1GVZA 1C2EA 1TNLA 1GBFA 3BTQE 1YPHC 3FFGA 1JOUB 2AIQA 1T8LA 2NU3E 2AGGX 1D4PB 1SGIB 1HDTH 2FXRA 2FX4A 4DCDA 1F0UA 1HV7A 1V2KT 1V2PT 1C2HA 1P10A 2BDGA 2RA3A 2BOKA 5K7RA 1QTFA 1ZHPA 1HIAA 4CRBA 3F9HA 1XX9A 1AUTC 1AN1E 5EXMA 5T6GA 3PLKA 1E38B 1YKTA 1YP9A 2ZCKP 2BD9A 3UQVA 3MU5A 1TONA 6GCHF 1NFUA 2OC8A 2EEKA 3RXMA 4DG4A 4AYVB 1UK2A 1PQ8A 1SQTA 3C1KA 2TGPZ 5EQSA 2D8WA 1ABIH 2BLWA 2EI6A 2P59A 1CVWH 4DVAU 2VVVA 4WY3A 1ZHMA 1GJDB 1ETSH 3QTOH 1ORFA 2FP7B 3NUMA 7LPRA 5EXLA 1P12E 3MU4A 4MPUA 2GDDA 1Y8TA 3ZVFA 4ZH8A 3KEEA 2C8YB 1NRNH 1XKBC 4JK5A 1A0LA 2ZTZA 1AD8H 4BAKB 1ELEE 1EP6A 2FIRH 2B7DH 3A85A 3M3SA 1TB6H 1PPFE 4CREA 2WPIS 1SBWA 1MZDA 5IYTA 3RXDA 3P95A 4NWKA 1FLEE 3LDXH 3RXUA 1NFXA 3A81A 1CSOE 1P11E 3P6ZB 1GBKA 3SU1A 2KAIB 3F68H 5HXFA 2ANWA 1IQNA 3URDA 5EOKA 1HPGA 5EGMA 3TK6A 4X8TH 2V6NA 3HGNA 4J2YB 2FOAA 2RA0A 1K22H 1HIAB 3RU4D 3RMOH 1DUEA 1EPTA 3BEIB 4U32A 4Y8ZA 2XYAA 5EW1H 1BIOA 2A4QA 1DM4B 3STIA 2V3HH 1XXFA 3ZZ5A 3GY4A 4AB8A 1E34B 2PLXA 3P17H 4M7GA 4UFEH 4ABEA 1ELBA 4B2CA 1V2WT 3OYPA 3NPSA 1K1LA 1A5GH 1PQ7A 1BBRK 1TABE 3BG4B 4XBCA 1O3NA 1QL9A 1DE7H 1C2DA 1V2MT 1A4WH 2HNTC 2QAAA 2Z3EA 1UCYK 3GY2A 2FOBA 2RCEA 4YZUA 3TJNA 1UHBA 1GBLA 4NSVA 2V0BA 5DPAA 5JBTA 2V3OH 2G51A 2V35A 3E3TA 3S7KB 1FIWA 4YLUA 1SHYA 3BG8A 1TRYA 1C5OH 4B74A 4ESTE 2QF0A 4JMYA 1MD8A 1WUNH 1BMMH 1DWDH 1O5DH 2BD2A 2HLCA 3GY8A 3R0FA 4ISLA 5T6DA 5LPEA 1ZZZA 3ITIA 3MMGA 4YO9A 2JETB 4A1XA 1TX6A 1Y3UA 5BPEA 2STAE
chains in the Genus database with same CATH superfamily
1HLTH 3SJ8A 3SW2B 1OWKA 1Y3VA 1SGRE 4X2XA 2NU4E 1SHHB 2SNVA 1KXAA 2EI8A 1K1JA 1C1WH 1N6YA 4IBLH 2K8IA 5JB8S 5CHAB 2G00A 1WTHD 1TIOA 2AEIH 5PTPA 2NU2E 1O3KA 1TGCA 3SNBA 2J4IA 3PO1C 3UREA 3M5NA 1SG8B 2ZG0H 3ATWA 3FP8E 1LKAA 2VIOA 1MTWA 1ZSKA 1INCA 1UO6A 2ZU1A 1LHFH 1GHBF 2HNTE 4MNWA 2PKSC 1A2CH 4TYDA 4AYYB 1AZ8A 1E79D 1G3EA 1SFIA 1AZZA 1WQVH 5ABWA 1IQEA 3ZZAA 4O3UA 1DWBH 2TPIZ 4AFSA 1HJ9A 3LJOA 1MABB 4JZIA 5F8TA 1J14A 4BXSA 1T4VH 2BMGB 4OM9A 1OXGA 1K2I1 4HG6A 1BTXA 3MQKC 1FZZA 2H9TH 3RXCA 2TGDA 1GJ7B 3JZ2B 2BVRH 3OE7D 2CF9H 3UUZA 3UWIA 2ZGXH 1B0FA 2PFEA 3MWIU 4E05H 2ZI2H 5C3NA 1GBIA 3T27A 4ABBA 3PRBA 8ESTE 2SGFE 1TGSZ 1O0DH 1K28D 2FOGA 3K6ZA 3F3BA 3MH5A 4ABFA 3M3TA 4Y7BA 3A8AA 2R0LA 4DURA 2IJOB 2F9PA 5CHBA 3W95A 3GY5A 1FQ3A 4JYVH 5C5OA 2C8WB 2G4TA 3SYJA 1Y5BT 1T8NA 1DX5M 4IC5A 2QY0B 4CR5A 3TIUA 3QLPH 3BTTE 4WVPE 5L2YH 2H5DA 1G32B 2ANYA 1ZSJA 2GP9B 2XBYA 4ZKRU 1FAKH 1FAXA 2JETC 3DSOA 3LGVA 1N1LA 4Q63A 5GJ4B 4X1PU 2PTCE 2J98B 3A83A 4WH8A 3ZZCA 2J92A 1O3HA 1UTPA 2J95A 2GV7A 3F2HA 3RXQA 3TGIE 1M9UA 3ZV8A 4Q7XA 2GCTB 2OQUA 3EAJA 1VR1H 4NIWA 1BMLA 3RXBA 4ABJA 4K1SA 3I78A 2GD4B 4Q80A 1ELFA 4GAWA 2YOLA 1O38A 1D6WA 1KY9A 2VGCB 3SQHE 1DS2E 5JYIA 2HNTF 1XVOA 4UFGH 3TPIZ 1IQLA 1SGCA 1HAPH 1OS8A 2OUAA 1SLXB 1SQAA 3TH3H 1FONA 3LH1A 3UPEA 1VCQA 3ZVDA 1BB0B 1TPAE 2SNWA 1UTLM 2Y7XA 3FOAA 4A92A 1O2YA 3BG4C 2FOMB 1SPJA 3PTBA 2SGDE 5GDSH 4Q7YA 2YNBA 1T31A 4WMFA 2CHAC 1OWJA 2CK3D 2LP6A 1PJPA 4ABGA 4DW2U 1GHZA 3S69A 2SGAA 2KCAA 3MH4A 1OP2A 1QCPA 4GHTA 6ESTA 2ZNKH 2KCOA 4NIYA 4X6NA 1EZQA 1PQAA 3I29A 3O8BA 2J34A 2JKHA 1TBRH 1MCTA 4F49A 4XOJA 1OSSA 3T62A 2XXLA 1WTGH 2ZHQH 4Y8YA 2PW8H 3GDVA 2OBOA 2OLGA 1AFQB 5AHGH 1NC6A 2V7QD 4MTBA 4TPIZ 1NRRH 1O3CA 2BY8X 3OTJE 5A2MH 1GI0A 4SGAE 2GT7A 2G5VA 2NU1E 2VNTA 1QHRB 2WPDD 4THNH 1ANDA 4TWWA 5A0AE 1GI4A 4RN6A 3T2NA 1K0HA 1EJNA 5B6OA 9LPRA 4X8SH 1D3TB 1UCYE 2YMSD 1EPTB 3IITA 3NZIA 8GCHG 4JZ1A 1ELAA 2M2AA 1C5QA 1DOJA 4VGCB 4BTIB 4INKA 2CN0H 4OGYA 1YBWA 1DITH 2WPHS 2FS9A 1OKXA 1AVWA 1QBOA 4MNVA 4MPWA 4FXGH 5HKKD 1O2XA 2BHGA 1O2GH 2Y5HA 4ASHA 2ALVA 2A5KA 4B2AA 3LGIA 1BDAA 3ZZ4A 3S0NA 2HPPH 3FP7E 3SO3A 1V2NT 5HYOA 3GS9A 1PQ5A 1C5RA 1S81A 3N7DA 3LONA 1O2IA 2ZKSA 5TCAA 1YPHE 1N6XA 4WMDA 1VGCB 2TBSA 1RS0A 3P70B 1RTFB 3KQEA 4O97A 1TPOA 3QTVH 4H42U 4YOGA 2GTBA 1T8OA 3F0PA 3PMBB 1O3JA 2YMSB 3A8DA 1C2JA 1C2LA 1NPMA 1HAXB 1GL1A 1SL3A 2Y6TA 1CT4E 2GMTC 1TYNA 3QUMP 1V2UT 2FYQA 2HRVA 4HI3A 4UDWH 3NXPA 4MLFB 2B5TB 4IMQA 4R0IA 1P01A 3A7XA 1RXPA 2DE9A 4UFDH 2TRMA 1O3OA 1O2QA 1P04A 1AMHA 1BA8B 4H6SB 2Z94A 2R2WU 1ZHRA 1ACBE 3L6PA 2KR7A 2IN2A 1P0SH 1Z8GA 3LGTA 1TOMH 1GBBA 2A5AA 3MO9A 1YYY1 4B76A 3A7ZA 3RXEA 3KNXA 1KMHB 1L0ZA 2PHBA 1YPLH 3F2FA 3ZVAA 2AGEX 4FUBA 1MD7A 1FXYA 1Z8IB 2R3YA 3M7TA 1TGTA 5F53A 1H8IH 1FX0B 1NO9H 1GJ9B 1NBMD 2JJ2D 1LVOA 1ZPZA 1YPKH 3DFJA 3UNSA 1O3GA 1T32A 2JIZD 1CU1A 1LKBA 2ZGJA 1O2RA 3MO6A 3GISB 1MAYA 4P02A 4Y0YE 1O3EA 4Q2KA 4AC9A 2OTVA 3B8JA 2QV1A 1SGPE 2P95A 4YT7H 1KXBA 1VJAU 3DHKH 3LOXA 3PMHB 4KTCA 3SUDA 1O2OA 4JCNA 1QA7A 4K8YA 5GCHF 4X1QU 2ZPSA 1ANEA 2B8OH 3U1IB 5HMAA 4YLQH 2W6JD 1BQYA 1S0QA 2FDAA 1SLVB 2ZGBH 5LPFA 2XNDD 1GDQA 1CO7E 3Q76A 3LH3A 2H9HA 3TK9A 1RJXB 1EAWA 1C1MA 3QZRA 3SJ9A 4ABAA 1O5CB 2KFWA 4GCHF 2ZFQH 3AASA 3ATMA 3SN8A 1MMJN 4I7YH 3SU3A 1UTKA 5FX6A 2VJ1A 2GMTB 4ISHH 2GCTC 3L33A 1GI6A 1G2LA 4X1NU 2JH0D 2CF8H 1HB0B 2OC7A 5EU8A 3NKKA 3IG6B 2C90B 1GBEA 1LPGB 1WXRA 3M7UA 3DD2H 2PSYA 1P3EA 5JPMH 3NK8A 3OFND 4KELA 1J15A 1S6FA 2DUCA 1BRAA 3HPTB 1P2IA 3WY8A 5DN6D 3H09A 2XWBI 1BTYA 2Y5GA 2W7UA 1FNIA 3EE7A 2ODQA 2ALPA 4NIVA 4CRGA 1P57B 1SFQB 1QY6A 2Y82A 3AW0A 1WV7H 1YCPK 1XKAC 2C8XB 4H6TA 2BD5A 2UWOA 1ZGIA 1QQ4A 1H8ED 3F1SB 1F5KU 4K2YA 4D7GA 4DGJA 1TRNA 4Q7ZA 1GI5A 3MFJA 4AFZA 2FODA 3UOUA 2WPLS 1UCYH 5C20A 1ESTA 3RXPA 1RFNA 3K2UA 3UQOA 2Q6DA 1AUJA 2PKAA 2VWNA 3SQEE 1D3QB 1OP8A 1Y5AT 1QA0A 5C2ZA 4ZKNU 1C9PA 1O3AA 4Y6DA 2PGQB 1PPEE 1OPHB 5A09A 1GMCF 2BDHA 2F3CE 3ZVGA 4AN7A 3VGCB 1NESE 3LC5A 1W0JD 4X2WA 2AMDA 1O2SA 3N7EA 4AG2A 1W10U 2CGAA 2STBE 3H7OA 1FJSA 1O2ZA 1T4UH 1MU8B 1NBME 3DA9B 2PKSB 2OBQA 2ZZUH 3SUFA 2A0QB 3U98H 1OX1A 3ZZ9A 3ODDA 1GCDA 4YOJA 3BIUH 3WW7A 1TWXB 5CHAC 2QIQA 3BTFE 5C1YA 1NROH 1S82A 1GL0E 2AMQA 2BLVA 1GPZA 1SC8U 3SU2A 3ATLA 3KCGH 3SU6A 5C1XA 2ZWLH 1SGFA 3SGAE 5F8XA 1N8OB 1TE0A 2Y80A 5L30H 4XBBA 5EJZA 1S0RA 5EPNA 3LPRA 3B23B 4WMEA 1SLWB 2JJ1D 1UHBB 1Z8JB 4B6FA 1EOJA 2FM2A 3PLPA 3SHCH 1W0KD 1TQ0B 1NRPH 2ZFTA 1MTNB 1TOCB 1HYLA 1GHBG 4CR9A 3DT0H 1P02A 1PPZA 2BQ6B 1GBTA 1O3LA 3PWCA 2VGCC 4A5TS 1C9TA 1OP0A 3LJJA 1BTPA 2B0FA 1CGIE 2HVXA 2ZO3H 1D3DB 4NZQA 4Y0ZE 1LTOA 1TNGA 5DP9A 1MKWK 5LPRA 2FOFA 4KP0A 4Y79A 2CXVA 1YPEH 2Z9GA 2BY7X 3KQDA 2P94A 3FZZA 4YXWD 2BY9X 1CGHA 5T1VA 1UVOA 1JWTA 2NU0E 3LGYA 3KGPA 1AIXH 1ZR0A 1WDIA 3SJOA 3SJIA 3RLWH 1ZMLA 2GGVB 3UR6A 2WPMS 3A82A 4NA9H 4IMZA 1LDTT 1ZTLA 5K0HA 1QQUA 1ARCA 3P8GA 1GG6B 3V3MA 1GWAA 3ESTA 3ZZ3A 3KIDU 5DO4H 3F9EA 1ZJDA 1GJ4H 4B75A 4GLYA 3GCNA 1EJAA 2J9NA 1LHGH 1HGTH 3M35A 1OYTH 1QGFA 1BMAA 1QL7A 1AKSA 2VWLA 4Z0KA 4JZEH 1LHEH 4KTUA 1YPJH 4LK4A 1O3IA 1T8MA 5LH8A 1QIXB 5GWZA 1BHXB 1XVMA 3TJOA 5SGAE 5FBEA 1GHVH 5DKMA 2BD4A 1MH0A 2VH0A 2FWWA 3K65B 3UOPA 4D9RA 1S84A 4GCHG 3HKIB 2Y81A 2QXGA 1XMNB 5FPTA 1FMGA 2IOTA 3A8BA 1HRTH 1QJ1B 4D7FA 4NFEA 1MQ6A 3BV9B 2OQ5A 1GGDC 4B71A 1NY22 1TGNA 2QF4A 1V2TT 4BAOB 1A3BH 1O3DA 2L74A 3RU4T 4FVBA 1H9IE 4FOUC 5DJ7A 3RC6A 4CRDA 1P8VC 2O8TA 1TLDA 3KN2A 5IK2D 1GI3A 1O3BA 2TIOA 2THFB 2YMSC 1C5PA 4AFQA 3EA7A 1HJ8A 1LHDH 3GCTF 2AH4X 1G36A 4NCYA 5E0GA 1Y3YA 4XBDA 5TCCA 3GCOA 3SU0A 1C2IA 2FPZA 1GHAG 4YTAA 2BVSH 2QC2A 2WPJS 3PO1B 4K3JA 1E35B 1C5ZB 2QYIA 1AVGH 5DP7A 3GCHC 1WBGB 2Z3DA 3LT3A 3LIWA 4RKOB 2W26A 3U1JB 1UTQA 4K5ZA 2P16A 3SV6A 3I77A 2XBVA 5FL7D 3MU8A 4AOQA 1ZMJA 2ZFPH 3MH7A 1ELGA 3PYHA 1DWCH 2OXSA 3E8LA 1GJ5H 4ZCNA 1UVSH 1OHHD 1SKYE 4OGXA 1O35A 2FX6A 1ETRH 4BXWA 3SJKA 1ELVA 3ATKA 4ACAA 1Q31A 2EC9H 4MPXA 5AF9H 2ZHFH 3TH2H 4TPYA 4LXBH 1J8AA 1O31A 1FN6A 1O2UA 2P3TB 3E6PH 4J1YA 1HNEE 3BTKE 2F83A 5ETXA 4D8NA 1XXDA 2HVYB 1FY3A 1F5LA 1YLNA 3PWBA 2GV6A 3E0PB 3N7OA 4FUFA 1Y59T 2ZU4A 1J17T 1XUIA 3U8OH 1BTHH 1ZLRA 1KLJH 1F2SE 8GCHF 4BAMB 3QX5H 2BB4A 3ENSB 5T3HA 2EA3A 2BZ6H 1MBQA 3MH6A 4GVUA 3SI4H 1E0FD 4O9VA 1O2VA 4DIHH 2Z7FE 2P8OB 4MQAA 3V0XA 1UW7A 4Y71A 4X8VH 4O03A 2FOEA 2J38A 3ZIAD 1NT1A 5E0HA 2PTNA 1BRBE 2WUBA 5HGGA 1KTSB 2GZ8A 2IPQX 2ZDVH 5C1UA 4I86A 1DFPA 3VXEH 4F48B 2QCYA 3RXJA 4MVNA 3KQCA 3QO6A 4LOYH 5C0TA 1IQKA 2FEQH 1X7AC 3O8CA 1OWEA 3VB6A 2HALA 4FU7A 3RM2H 3UWJH 1F0SA 3EA9A 3AAVA 1D3PB 1AE5A 2Z9JA 3EQ0H 1YLCA 1DVAH 3ZZDA 3RMNH 2C4FH 4AGJA 1HCGA 4O3TA 2KCYA 4UEHH 1ZOMA 1SOZA 1BBRE 2PR3A 2FTLE 1IQGA 3D49H 3RXGA 3ELAH 2BZAA 2BQWB 1K9OE 4JZFH 1EXFA 1ELCA 2VVCA 2D26C 1LCYA 3UNQA 1GCTB 1UVUH 1QB6A 3Q77A 2BQ7B 3VB3A 1LPKB 2GX4A 3M37A 5IDKA 2UUFB 4INLA 2OC0A 1SGQE 1ETTH 4NWLA 3FN8A 1BBRH 1C5WB 1Z8RA 2LNCA 4MNYA 1UTOA 6GCHG 1ELDE 3TNSA 3JZ1B 1C1SA 5EJ1A 2M5TA 4XFQA 5DGJA 2KZ4A 4NSYA 3QDZB 1EATA 1EX3A 2A2QH 2V3MA 1C1NA 1H1BA 3OEED 4IGDA 2UUKB 4X6MA 1CQQA 2J2UA 2BDIA 3ZZ7A 3V13A 1C4V2 2BDCA 8LPRA 5C5NA 1P2OA 1THPB 1P9UA 2OINA 1ANBA 4FUHA 1JXPA 5DP6A 2WZQA 4ABIA 1Q3XA 1VITH 1FI8A 1VITG 1LMWB 1IQHA 4I32A 2WSSD 3RC4A 1GI8B 1KYNA 4ZKOU 2ZC9H 4BOHA 1BTWA 3UTUH 1P03A 3DCLA 2BY5X 2FS8A 2WV4A 1TX8A 1ID5H 1L2EA 1Z6JH 7GCHF 2BM2A 2WYJA 3VFEA 3A7WA 1FUJA 1GI7B 1SGTA 5E0JA 2HPQH 5TJXA 1L1GA 4X6OA 3RXKA 5EIYA 1HAIH 2VB0A 3M5MA 1KLTA 3SV8A 3T28A 3TH4H 1K1PA 4ABDA 3TJVA 3F6UH 4OS1A 1A61H 1KTTB 1QFKH 1JBUH 1P09A 4HTCH 1Q2WA 2D2DA 1BMFD 1AB9B 2GKVE 6LPRA 1C5UA 2TGTA 3RU4E 1V2QT 5EPYA 2BX4A 4IW4E 2GCHG 1Z1JA 3BIVH 1DUAA 4ZXYH 1G37A 1CA8B 1EAUA 1G2MA 2A7JA 5C0UA 1K21H 2SFAA 1EUFA 1BCUH 3OEHD 1Z1IA 3P92A 1C5NH 3EGKH 3DSPA 3MHWU 1O2TA 1EZUC 1UVTH 1GDUA 4ISOA 3ZV9A 3ZVCA 1O3FA 1EZXC 3OX7U 4X2YA 1MU6B 1O5FH 4ISIH 4X1SU 3RXFA 3IWMA 2WPKS 2R3UA 3QK1A 2QXIA 4DOQA 1HJAC 1GJ8B 1H9LB 1YF4A 2VINA 1W7GH 1KDQB 1BOQA 1HXFH 3BTGE 5FX5A 2ZHEH 3URCA 2Z6BD 3SGQE 1TNIA 1AWHB 5A8XA 1MAXA 2VWOA 1EJMA 5CE1A 1QBVH 4NZLA 3SV2H 5A0BA 1MKXK 1KIGH 2R0KA 2BY6X 3H7TA 5JBBS 4GPGA 1N8OC 2ZHDA 1FV9A 2XC4A 3RP2A 4CRAA 1P06A 2P3UB 2BOHB 2BTCE 2W7SA 1MTSA 2XW9A 4D9QA 1OWIA 3C27B 1TBZH 4UFFH 2KAIA 4BANB 1QURH 1THSH 4K69A 2FOCA 1EB1H 2FYRA 4Q4LA 5C67A 1TBQH 2RFKC 2ZQ2A 2VIVA 1NFYA 2F4LA 3EDXB 3AAUA 4RI0A 2VIDA 3T29A 1S6HA 3GYMA 4Z1MD 1Y3XA 4ZUHA 3RXOA 1JMOH 3MI4A 1W2KH 1P2KA 3HGPA 2H5CA 2IPHA 1BTZA 2AIPA 2XWAA 1K1OA 5ESBA 1IHSH 1AKSB 4MDSA 2GVFA 3RXLA 2BDBA 5DG6A 1D9IA 1K1NA 2A1DB 5JBAS 2UUYA 4DT4A 1KXCA 4I8JA 5HM2A 1O30A 4ZHLU 1QRXA 4WJG2 3V7TA 3D23A 2FLBH 4GHQA 2CJIA 3KF2A 1GHAF 1HXEH 2SGQE 5FCRA 6CHAC 4OS4A 2BD7A 2BDAA 5GPIB 1E1RD 4E7NA 4M9FA 1BHXF 1ABJH 3MNXA 3RDZA 1VGCC 1H9HE 1W7XH 1UK3A 2XBXA 3BTWE 3PMJA 3EA8A 4AG1A 3RXAA 1PYTD 5T6FA 2TGAA 2F9OA 3OY5U 1ZMNA 4BTUB 1O39A 1IQJA 1DSTA 3GYLB 2H1UA 1GG6C 2C8ZB 3UIRA 4QT8C 1TALA 3D62A 1QB1A 1SI5H 1A46H 3E16B 5FCKA 2ZEBA 1HFDA 1J9CH 2ZFSA 2ZTXA 1GBAA 1NRQH 1C1RA 1EPTC 1L4DA 3ZZ8A 1ZRKA 2PV9B 3SNCA 3VB5A 2BYAX 3PLBA 2W3KA 1W8BH 1AU8A 3RC5A 1O34A 2OP9A 1B7XB 2C3SA 2WV5A 1JIRA 1L1JA 1W14U 1DPOA 3HK3B 1EZSC 1ANCA 5J4QA 4XSKU 2CHAB 3VPKA 3S9CA 1SGFG 1DICA 1JIMA 1IQMA 4MNXA 3P8NA 2A32A 1GJCB 1GHXH 1L4ZA 4H4FA 5FAHA 3SV9A 1WOFA 3QZQA 2J98A 4U30A 5J4SA 5LGOA 1FY5A 5L2ZH 1AE8H 1GBHA 2P93A 1CBWB 2BVXH 3PV2A 1O3MA 3E91A 1ESBA 2BLOA 3EE0B 5CMXH 3FZDA 2XOKD 4Y10E 1YCPM 5DSFA 5AFYH 1OWDA 4FUGA 1DWEH 4TY6A 3T26A 4F4OC 3PROA 2A5IA 2P3FH 3GOVB 1V6DA 1LVMA 1OOKB 3AW1A 5GXPA 1HAGE 3ZVBA 1FIZA 3BSQA 5AFZH 1CT2E 1GBMA 1WSSH 2O8UA 1XUFA 1C5XB 1LHCH 1O5GH 2ZHWH 1O2KA 2R9PA 1HAHH 5HM9A 1KXFA 3HATH 3BTME 3QGNB 2AGIX 5GNDA 2ZU5A 4B2BA 3STJA 3E1XB 1AY6H 1QJ6B 2Y5FA 1Y3WA 4CBOA 2H6MA 4OS6A 1V2JT 5KGOA 4JYUH 2VVUA 4YT6H 4IC6A 3OU0A 1LQEA 3D65E 3CENA 1K1MA 2PUQH 1B0EA 8KME2 2Z9IA 1C1PA 3UB0A 5BRRE 4BAQB 3S7HB 4YESB 1CHGA 1QNJA 2Q6GA 4UD9H 1PPHE 1HAZB 4A1VA 1RTKA 3S9AA 3T5FH 4JZDH 1CA0B 1UTMA 1XUKA 2B9LA 3LC3A 2G81E 5A8ZA 3MTYA 4SGBE 2UUJB 2A4OA 7ESTE 1E36B 3F2GA 1TAWA 1QRWA 1SB1H 2F91A 1EP5A 1DLEA 1AGJA 1K1IA 4ABHA 4U2WA 3ZZ6A 2JH5D 3GY3A 2J97A 1ZRBA 1B5GH 4FUDA 3SU5A 1HAVB 3BEFB 1SGNE 3RXTA 4PROA 1NS3A 1KLIH 1DXWA 3VB4A 2ILNA 1C4Y2 4OS2A 1HBTH 3Q3YA 2D1JA 2OCVB 3ATIA 5F03A 3UR9A 3A88A 4TSFD 3RMLH 4FUJA 3SORA 1DSUA 1GJBB 2BD3A 2BDYA 2BX3A 2ZA5A 4K8BA 4RT1A 1EOLA 3KYFA 1C1VH 4I8LA 1F0RA 1EKBB 2XBWA 1PPBH 2ZU3A 2H2ZA 2F9NA 2WINI 5HIZA 3ZYDA 4AGKA 2Y7ZA 2ESTE 1C1QA 1C5SA 2AMPA 2HWLB 1SLUB 4ZHMU 5FPYA 3Q3XA 3TGJE 1IQIA 4TWYA 1U6QA 1MCVA 2PKAB 2WHXA 3AVZA 5F6MA 2OC1A 3RXSA 2H9EH 3M5LA 3OTPA 4FUIA 2PWXA 3A84A 3MU0A 5AVDA 1O2LA 2QF5A 1YC0A 5I46H 1GGDB 1C5LH 1YPMH 1Z6EA 4KGAA 4ZAEA 1BZXE 1TNKA 3PTNA 4GUXA 1P05A 1GMHF 4HFPB 4VGCC 1SSXA 5E8EH 4CRCA 5FPSA 2I6QA 4MG3A 2A4GA 3PV4A 4OS5A 1ESAA 3HKJB 3SZNA 1TPPA 1C1TA 2ODPA 2QGRA 1LQDB 3SNEA 3OSYA 1BITA 2VIWA 2NWNA 3NRLA 1EASA 2FO9A 4NA8A 2GCHF 2K1QA 3DUXH 3RXIA 3OAAD 2ZDAH 3ZZBA 2ZCHP 1Y5UT 1OYQA 1P2QA 5GIBA 1QL8A 2LELA 2O9QA 1TMUH 3BEUA 1G3DA 4NG9H 1UTJA 2EQNA 3K6YA 4E06H 4XE4A 4ZROA 5JDUB 2G52A 1LVYA 4IS5A 1MTNC 3MU1A 5FHTA 1NN6A 3A86A 4UONA 4WWYA 1LVBA 3GICB 4CHAB 1AFEH 1CHOF 1GHWH 5DP5A 1FY1A 1LPZB 3RXHA 2VIPA 3SBKA 1TRMA 3M3VA 4X2VA 4Y11E 4DJZB 3ZYEA 2DE8A 2Z3CA 1MUEB 1BJUA 3KQBA 1GBDA 1GVKB 4FETA 4U01A 4CH8B 1O5AB 3BN9A 1T7CA 2OD3B 2XCFA 1HJAB 1C2GA 1YLDA 1ZPBA 3SNDA 2ZPRA 3LGWA 2A31A 2XC5A 1XM1A 1G3CA 3GY6A 2JH6D 4I8KA 1TA6A 2ZF0H 2F9BH 1SGEE 3BTHE 1PPCE 1GVLA 3BF6H 1GI1A 3F9FA 3Q3KA 3B9FH 3M61U 3U69H 1O3PB 2ZDMA 1ARBA 4FUEA 4D76A 2W5EA 2YNAA 2A2XH 1JRSA 2XCNA 2K0QA 1G30B 4CRFA 2ZTYA 3DFLA 1E37B 4HZHA 3TGKE 5EG4A 2ZGHA 3RXRA 3SGBE 4YM9A 4XDEA 1GMDG 1AQ7A 4B73A 3SHAH 5GCHG 2GZ9A 2PP6A 3TITA 1FY4A 1WU1A 2ZFRH 1SQRA 2PSXA 4X0WU 2W3IA 1GBCA 3FANA 5DP4A 4FUCA 1WQSA 2RG3A 4Z6AH 1MKWH 4YOIA 1WYKA 1UTNA 1W0ZU 2Q1JA 5A8YA 1AI8H 1HAOH 2Z9LA 3ODFA 3M7QA 1VCWA 2F9VA 3MO3A 1WAYB 1KXEA 3VXFH 3L3TA 1SR5C 4I31A 5KEDA 4UE7H 3V12A 2LPRA 2FI3E 1S5SA 5EW2H 4ZXXH 2BLQA 2RDLA 3NCLA 1IAUA 1YM0A 4JK6A 3T25A 1BUIA 1KDQA 1V2VT 1RRKA 1GCTC 1C5TA 2SGPE 1GHYH 5EJLA 1HAYB 2ANKH 1UK4A 3S9BA 1TMBH 2WV9A 1CHOG 1QZ8A 2BXUH 4AX9H 1GMCG 1D6RA 1V2RT 4ZKSU 9ESTA 5G4BA 1C1UH 3P8OA 1NU9A 2R2MB 6CHAB 4P00A 1G3BA 4KTSA 3SOSA 5EQQA 1RGQA 2GT8A 4NA7A 4Y7AA 3ZVEA 1DT2A 1TMTH 2ZIQH 3SUEA 2F43B 1PPGE 1TGBA 1TQ7B 3AK5A 1TNHA 2O8LA 3U8TH 4WF8A 4Y8XA 2G8TA 7KMEH 2EI7A 1BT7A 1O2PA 1P2NA 4CH2B 4WXIA 3VG8A 3RLYH 2ULLA 5DK1A 1BTUA 4MPVA 4AZ2B 3GDSA 1GBJA 3M36A 4A1TA 2AFQB 5C17A 3U8RH 1A1RA 2GZ7A 1LO6A 3H5CB 1CGJE 4ZMAH 1A5IA 2ODYB 4FVDA 1TNJA 4BNRA 2AS9A 3MNCA 2EY4C 3PM3A 4DY7B 1DXPA 1SOTA 2J5UA 2UWPA 3CNRA 4AORA 1XUGA 4FU9A 3MOCA 1O5BB 1V2LT 2FTMA 1OWHA 2WYGA 1BMNH 1UJ1A 1ZTKA 1PYTC 2A45B 2J94A 1GI2A 1CE5A 2IJD1 4I33A 4DIIH 1C2FA 2WUCA 3R3GB 4BAHB 2O8WA 2ZGCA 1SQOA 3CS7A 1ZJKA 3QWCH 1P2JA 2G55A 1A7SA 2QXHA 5KECA 1W13U 2ZCLP 3CP7A 2RDEA 1YCPH 1VZQH 1NM6A 3MYWA 3GY7A 2XNIA 1DY9A 2QN5T 1NTPA 1RIWC 3TJUA 2GJGA 4Y76A 1H8HD 3KHVA 4R8TB 1CBWC 3UFAA 3M5OA 5FBIA 1O32A 1FN8A 4K1EA 2BXTH 1YGCH 2O8MA 3O8RA 1NRSH 1VCPA 3TLOA 5JB9S 1VJ9U 1QB9A 2HOBA 3RM0H 5JBCS 1KXDA 3GCHB 1VKYA 3VB7A 4AB9A 3UNRA 1RD3B 1XUHA 3A87A 1SGDE 1V3XA 2C93B 3PMAB 1F0TA 4GSOA 4CBNA 1O5EH 3BTDE 1O2MA 5I25A 3P8FA 2FI5E 1F92A 1GJ6A 2ZDNA 1ZSLA 3G01A 2OK5A 1Z71A 5ESTE 1BJVA 1EB2A 3WWFA 2QF3A 1W0YH 1A5HA 1TA2A 2ZDLA 1O2NA 3A7VA 1GJAB 1C4U2 2VU8E 2FLRH 2VIQA 3UY9A 1H8DH 3FO8D 4CHAC 3KYGA 3Q00A 2L6OA 1O2JA 4WH6A 1IQFA 2XRCA 3TVJB 3A8CA 4RT0A 1G9IE 2Q6FA 1MQ5A 2PUXB 1P9SA 4A6LA 4RKJB 2ZFFH 1QRZA 3FP6E 2FOHA 4X6PA 2GDEH 1RTLA 2A4RA 4TT3D 1PFXC 3BTEE 1CT0E 1WCZA 1MTUA 3O8DA 3A7YA 3RMMH 3GDUA 4JYTA 2ZQ1A 1QR3E 2CV3A 1AVXA 3PB1E 2CMYA 1EAIA 1GMDF 3SNAA 3HK6B 1HUTH 3A80A 1P3CA 3FKSD 1ZPCA 3LKWA 2BD8A 4I8HA 3E0NB 2A7HA 1SMFE 4LZ4B 1BRCE 1Z7KA 3MNSA 1ZGVA 4KKDA 1UMAH 3VEQB 1FY8E 1UVPA 1MBMA 2HGTH 5L6NH 1C5MD 2ZP0H 2F9UA 4DT7B 3RXVA 4WXVA 1SGYE 3F0OA 3GCTG 4K1TA 1DLKB 3CS0A 3FAOA 1TX7A 3TNTA 2G4UA 1V2ST 3A89A 1QJ7B 1C5YB 5FXLA 1F5RA 1AO5A 4FU8A 4AFUA 1GMHG 1O37A 3QN7A 2VH6A 2AERH 3F9GA 1DANH 1EAXA 3PV5A 1O36A 4NGAH 2XC0A 4BTTB 1ZYOA 2VWMA 4LZ1H 4IN2A 1TPSA 4ASUD 1AFQC 2QA9E 1YWUA 1AHTH 1J16A 1O2WA 3K9XB 3RUOA 5H4IB 3LU9B 1IHTH 1C2MA 3FVFB 3LGUA 2KCPA 1W3CA 1JRTA 1A0HB 2FMJA 1W12U 1FPCH 1AWFH 1RIWB 5F8ZA 1A0JA 5EXNA 3OY6U 1S6LA 2UWLA 1NU7B 1A3EH 1MZAA 1ELTA 1EQ9A 2I6SA 3U28C 1H4WA 1ZTJA 1HAVA 1S85A 1DY8A 1AB9C 4X1RU 3U9AH 3MNBA 1V2OT 1FDPA 2ZPQA 1VITF 2A7CA 4INHA 1MTVA 3SUGA 3E90B 1NFWA 1O2HA 4TY7A 4OS7A 1W11U 1CA0C 1BRUP 4RSPA 4ZHAA 4HGCA 5C94A 1P2MA 1O33A 1GDNA 3SZEA 4ISNA 4NIXA 1TFXA 5DP3A 5EODA 3EYDA 2P8OC 4NFFA 1MKXH 1C5VA 1F7ZA 2ZU2A 3KL6A 1FPHH 4X8UH 4K60A 3A7TA 2VBCA 2ZDKA 5DP8A 2XTTB 3SV7A 4F55A 1GI9B 2AYWA 5A0CA 3TU7H 3SI3H 1C1OA 1KSNA 1QBNA 4XD7D 1S83A 2G5NA 1L1NA 3NWUA 3VGCC 1THRH 2SGEE 1YPGH 1DDJA 5E2OA 2FZZA 7GCHG 3SU4A 4A7IB 4XRNA 2ASUB 1NZQH 1IOEA 2FI4E 5EQRA 4E7RG 1XUJA 3W94A 3TK5A 5E2PA 2Z9KA 3QGJA 2FESH 2ZECA 4B1TA 2ANMH 2QXJA 2PGBB 4I8GA 1SVPA 4IN1A 1C2KA 1GVZA 1C2EA 1TNLA 1GBFA 1E1QD 3BTQE 1YPHC 3FFGA 1JOUB 2AIQA 1T8LA 2NU3E 2AGGX 1D4PB 1SGIB 1HDTH 2FXRA 2FX4A 4DCDA 1F0UA 1HV7A 1V2KT 1V2PT 4B6EA 1C2HA 2KM0A 1P10A 2RA3A 2BDGA 2BOKA 5K7RA 1QTFA 1ZHPA 1HIAA 4CRBA 3F9HA 1XX9A 1AUTC 1AN1E 5EXMA 5T6GA 3PLKA 1E38B 1YKTA 2KX4A 1YP9A 2ZCKP 2BD9A 3UQVA 3MU5A 1TONA 6GCHF 1NFUA 2OC8A 2EEKA 3RXMA 4DG4A 4AYVB 1UK2A 1PQ8A 1SQTA 3C1KA 2TGPZ 2W6ID 5EQSA 2D8WA 1ABIH 2BLWA 2EI6A 2P59A 1CVWH 4DVAU 2VVVA 4WY3A 1ZHMA 2HLDD 1GJDB 1ETSH 3QTOH 1ORFA 2FP7B 3NUMA 7LPRA 5EXLA 1P12E 3MU4A 4MPUA 2GDDA 1Y8TA 3ZVFA 4ZH8A 3WWBA 3KEEA 5CDFE 2C8YB 1NRNH 1XKBC 4JK5A 1A0LA 2ZTZA 1AD8H 4BAKB 1ELEE 1EP6A 2FIRH 2B7DH 3A85A 3M3SA 1TB6H 4ACBA 1PPFE 4CREA 2WPIS 1SBWA 1MZDA 5IYTA 3RXDA 3P95A 4NWKA 1FLEE 3LDXH 3RXUA 1NFXA 3A81A 1CSOE 1P11E 3P6ZB 1COWD 1GBKA 1YY3A 3SU1A 2KAIB 3F68H 5HXFA 3W1EA 2ANWA 1IQNA 3URDA 5EOKA 1HPGA 5EGMA 3TK6A 4X8TH 2V6NA 3HGNA 4J2YB 2FOAA 2RA0A 1K22H 1HIAB 2QE7D 3RU4D 3RMOH 1DUEA 1EPTA 3BEIB 4U32A 4Y8ZA 3DSGA 2XYAA 5EW1H 1BIOA 2A4QA 1DM4B 3STIA 2V3HH 1XXFA 3PRDA 3GY4A 3ZZ5A 4AB8A 1E34B 2PLXA 3P17H 4M7GA 4UFEH 4ABEA 1ELBA 4B2CA 1V2WT 3UAIC 3OYPA 3NPSA 1K1LA 1A5GH 1PQ7A 1BBRK 1TABE 3BG4B 4XBCA 1O3NA 1QL9A 1DE7H 1EFRD 1C2DA 1V2MT 1A4WH 2QAAA 2HNTC 2Z3EA 2AHME 1UCYK 3GY2A 3KQ5A 2FOBA 2RCEA 4YZUA 3TJNA 1UHBA 1GBLA 4NSVA 2V0BA 5DPAA 5JBTA 2V3OH 2G51A 2V35A 3E3TA 3S7KB 5B6LA 1FIWA 4YLUA 1SHYA 3BG8A 1TRYA 1C5OH 4B74A 4ESTE 2QF0A 4JMYA 1MD8A 1WUNH 1BMMH 1DWDH 1O5DH 2BD2A 2HLCA 3GY8A 3R0FA 4ISLA 5T6DA 5LPEA 1ZZZA 3ITIA 2JDID 3MMGA 2JETB 4YO9A 5HIYA 4A1XA 1TX6A 1Y3UA 5BPEA 3N99A 2STAE
chains in the Genus database with same CATH topology
1HLTH 3SJ8A 3SW2B 1OWKA 1Y3VA 1SGRE 4X2XA 2NU4E 1SHHB 2SNVA 1KXAA 2EI8A 1K1JA 1C1WH 1N6YA 4IBLH 5JB8S 5CHAB 2G00A 1WTHD 1TIOA 2AEIH 5PTPA 2NU2E 1O3KA 1TGCA 3SNBA 2J4IA 3PO1C 3UREA 3M5NA 1SG8B 2ZG0H 3ATWA 3FP8E 1LKAA 2VIOA 1MTWA 1ZSKA 1INCA 1UO6A 2ZU1A 1LHFH 1GHBF 2HNTE 4MNWA 2PKSC 1A2CH 4TYDA 4AYYB 1AZ8A 1G3EA 1SFIA 1AZZA 1WQVH 5ABWA 1IQEA 3ZZAA 4O3UA 1DWBH 2TPIZ 4AFSA 1HJ9A 3LJOA 4JZIA 5F8TA 1J14A 4BXSA 1T4VH 2BMGB 1OXGA 1K2I1 1BTXA 1FZZA 2H9TH 3RXCA 2TGDA 1GJ7B 3JZ2B 2BVRH 2CF9H 3UUZA 3UWIA 2ZGXH 1B0FA 2PFEA 3MWIU 4E05H 2ZI2H 5C3NA 1GBIA 3T27A 4ABBA 8ESTE 2SGFE 1TGSZ 1O0DH 1K28D 2FOGA 3K6ZA 3MH5A 4ABFA 3M3TA 4Y7BA 3A8AA 2R0LA 4DURA 2IJOB 2F9PA 3W95A 3GY5A 1FQ3A 4JYVH 5C5OA 2C8WB 2G4TA 1Y5BT 1T8NA 1DX5M 4IC5A 2QY0B 4CR5A 3TIUA 3QLPH 3BTTE 4WVPE 5L2YH 2H5DA 1G32B 2ANYA 1ZSJA 2GP9B 2XBYA 4ZKRU 1FAKH 1FAXA 2JETC 3LGVA 1N1LA 5GJ4B 4X1PU 2PTCE 3A83A 4WH8A 3ZZCA 2J92A 1O3HA 1UTPA 2J95A 2GV7A 3RXQA 3TGIE 1M9UA 3ZV8A 4Q7XA 2GCTB 2OQUA 3EAJA 1VR1H 4NIWA 1BMLA 3RXBA 4ABJA 4K1SA 3I78A 2GD4B 4Q80A 1ELFA 4GAWA 2YOLA 1O38A 1D6WA 1KY9A 2VGCB 3SQHE 1DS2E 5JYIA 2HNTF 1XVOA 4UFGH 3TPIZ 1IQLA 1SGCA 1HAPH 1OS8A 2OUAA 1SLXB 1SQAA 3TH3H 1FONA 3LH1A 3UPEA 1VCQA 3ZVDA 1BB0B 1TPAE 2SNWA 1UTLM 2Y7XA 4A92A 1O2YA 3BG4C 2FOMB 1SPJA 3PTBA 2SGDE 5GDSH 4Q7YA 2YNBA 1T31A 4WMFA 2CHAC 1OWJA 1PJPA 4ABGA 4DW2U 1GHZA 3S69A 2SGAA 3MH4A 1OP2A 1QCPA 4GHTA 6ESTA 2ZNKH 4NIYA 4X6NA 1EZQA 1PQAA 3I29A 3O8BA 2J34A 2JKHA 1TBRH 1MCTA 4F49A 4XOJA 1OSSA 3T62A 2XXLA 1WTGH 2ZHQH 4Y8YA 2PW8H 3GDVA 2OBOA 2OLGA 1AFQB 5AHGH 1NC6A 4MTBA 4TPIZ 1NRRH 1O3CA 2BY8X 3OTJE 5A2MH 1GI0A 4SGAE 2GT7A 2G5VA 2NU1E 2VNTA 1QHRB 4THNH 1ANDA 4TWWA 5A0AE 1GI4A 4RN6A 3T2NA 1EJNA 5B6OA 9LPRA 4X8SH 1D3TB 1UCYE 1EPTB 3IITA 3NZIA 8GCHG 4JZ1A 1ELAA 1C5QA 1DOJA 4VGCB 4BTIB 4INKA 2CN0H 4OGYA 1YBWA 1DITH 2WPHS 2FS9A 1OKXA 1AVWA 1QBOA 4MNVA 4MPWA 4FXGH 1O2XA 2BHGA 1O2GH 2Y5HA 4ASHA 2ALVA 2A5KA 4B2AA 3LGIA 1BDAA 3ZZ4A 3S0NA 2HPPH 3FP7E 3SO3A 1V2NT 5HYOA 1PQ5A 1C5RA 1S81A 3LONA 1O2IA 2ZKSA 5TCAA 1YPHE 1N6XA 4WMDA 1VGCB 2TBSA 1RS0A 3P70B 1RTFB 3KQEA 4O97A 1TPOA 3QTVH 4H42U 4YOGA 2GTBA 1T8OA 3PMBB 1O3JA 3A8DA 1C2JA 1C2LA 1NPMA 1HAXB 1GL1A 1SL3A 2Y6TA 1CT4E 2GMTC 1TYNA 3QUMP 1V2UT 2FYQA 2HRVA 4HI3A 4UDWH 3NXPA 4MLFB 2B5TB 4IMQA 4R0IA 1P01A 3A7XA 1RXPA 2DE9A 4UFDH 1O3OA 2TRMA 1O2QA 1P04A 1AMHA 1BA8B 4H6SB 2Z94A 2R2WU 1ZHRA 1ACBE 3L6PA 2IN2A 1P0SH 1Z8GA 3LGTA 1TOMH 1GBBA 2A5AA 3MO9A 1YYY1 4B76A 3A7ZA 3RXEA 3KNXA 1YPLH 1L0ZA 2PHBA 3ZVAA 2AGEX 4FUBA 1MD7A 1FXYA 1Z8IB 2R3YA 3M7TA 1TGTA 1H8IH 1NO9H 1GJ9B 1LVOA 1ZPZA 1YPKH 3DFJA 3UNSA 1O3GA 1T32A 1CU1A 1LKBA 2ZGJA 1O2RA 3MO6A 3GISB 1MAYA 4Y0YE 1O3EA 4Q2KA 2OTVA 3B8JA 2QV1A 1SGPE 2P95A 4YT7H 1KXBA 1VJAU 3DHKH 3LOXA 3PMHB 4KTCA 3SUDA 1O2OA 4JCNA 1QA7A 4K8YA 5GCHF 4X1QU 2ZPSA 1ANEA 2B8OH 3U1IB 5HMAA 4YLQH 1BQYA 1S0QA 2FDAA 1SLVB 2ZGBH 5LPFA 1GDQA 1CO7E 3Q76A 3LH3A 2H9HA 3TK9A 1RJXB 1EAWA 1C1MA 3QZRA 3SJ9A 4ABAA 1O5CB 4GCHF 2ZFQH 3AASA 3ATMA 3SN8A 1MMJN 4I7YH 3SU3A 1UTKA 5FX6A 2VJ1A 2GMTB 4ISHH 2GCTC 3L33A 1GI6A 1G2LA 4X1NU 2JH0D 2CF8H 1HB0B 2OC7A 5EU8A 3NKKA 3IG6B 2C90B 1GBEA 1LPGB 3M7UA 3DD2H 2PSYA 1P3EA 5JPMH 3NK8A 4KELA 1J15A 1S6FA 2DUCA 1BRAA 3HPTB 1P2IA 3WY8A 2XWBI 1BTYA 2Y5GA 2W7UA 1FNIA 2ODQA 2ALPA 4NIVA 4CRGA 1P57B 1SFQB 1QY6A 2Y82A 3AW0A 1WV7H 1YCPK 1XKAC 2C8XB 4H6TA 2BD5A 2UWOA 1QQ4A 1ZGIA 3F1SB 4K2YA 1F5KU 4D7GA 4DGJA 1TRNA 4Q7ZA 1GI5A 3MFJA 4AFZA 2FODA 3UOUA 2WPLS 1UCYH 5C20A 1ESTA 3RXPA 1RFNA 3K2UA 3UQOA 2Q6DA 1AUJA 2VWNA 2PKAA 3SQEE 1D3QB 1OP8A 1Y5AT 1QA0A 5C2ZA 4ZKNU 1C9PA 1O3AA 4Y6DA 2PGQB 1PPEE 1OPHB 5A09A 1GMCF 2BDHA 2F3CE 3ZVGA 4AN7A 3VGCB 1NESE 3LC5A 4X2WA 2AMDA 1O2SA 4AG2A 1W10U 2CGAA 2STBE 3H7OA 1FJSA 1O2ZA 1T4UH 1MU8B 3DA9B 2PKSB 2OBQA 2ZZUH 3SUFA 2A0QB 3U98H 1OX1A 3ZZ9A 3ODDA 1GCDA 4YOJA 3BIUH 1TWXB 5CHAC 2QIQA 3BTFE 5C1YA 1NROH 1S82A 1GL0E 2AMQA 2BLVA 1GPZA 1SC8U 3SU2A 3ATLA 3KCGH 3SU6A 5C1XA 2ZWLH 1SGFA 3SGAE 5F8XA 1N8OB 1TE0A 2Y80A 5L30H 4XBBA 1S0RA 5EPNA 3LPRA 3B23B 4WMEA 1SLWB 1UHBB 1Z8JB 1EOJA 2FM2A 3PLPA 3SHCH 1TQ0B 1NRPH 2ZFTA 1MTNB 1TOCB 1HYLA 1GHBG 4CR9A 3DT0H 1P02A 1PPZA 2BQ6B 1GBTA 1O3LA 3PWCA 2VGCC 4A5TS 1C9TA 1OP0A 3LJJA 1BTPA 2B0FA 1CGIE 2HVXA 2ZO3H 1D3DB 4NZQA 4Y0ZE 1LTOA 1TNGA 5DP9A 1MKWK 5LPRA 2FOFA 4KP0A 4Y79A 2CXVA 1YPEH 2Z9GA 2BY7X 3KQDA 2P94A 3FZZA 2BY9X 1CGHA 1UVOA 1JWTA 2NU0E 3LGYA 3KGPA 1AIXH 1ZR0A 3SJOA 3SJIA 3RLWH 1ZMLA 2GGVB 3UR6A 2WPMS 3A82A 4NA9H 4IMZA 1LDTT 1ZTLA 5K0HA 1QQUA 1ARCA 3P8GA 1GG6B 3V3MA 1GWAA 3ESTA 3ZZ3A 3KIDU 5DO4H 3F9EA 1ZJDA 1GJ4H 4B75A 4GLYA 3GCNA 1EJAA 2J9NA 1LHGH 1HGTH 3M35A 1OYTH 1QGFA 1BMAA 1QL7A 1AKSA 2VWLA 4Z0KA 4JZEH 1LHEH 4KTUA 1YPJH 4LK4A 1O3IA 1T8MA 5LH8A 1QIXB 5GWZA 1BHXB 1XVMA 3TJOA 5SGAE 5FBEA 1GHVH 5DKMA 2BD4A 1MH0A 2VH0A 2FWWA 3K65B 3UOPA 4D9RA 1S84A 4GCHG 3HKIB 2Y81A 2QXGA 1XMNB 5FPTA 1FMGA 2IOTA 3A8BA 1HRTH 1QJ1B 4D7FA 4NFEA 1MQ6A 3BV9B 2OQ5A 1GGDC 4B71A 1NY22 1TGNA 1V2TT 4BAOB 1A3BH 1O3DA 3RU4T 4FVBA 1H9IE 5DJ7A 3RC6A 4CRDA 1P8VC 2O8TA 1TLDA 3KN2A 1GI3A 1O3BA 2TIOA 2THFB 4AFQA 1C5PA 3EA7A 1HJ8A 1LHDH 3GCTF 2AH4X 1G36A 4NCYA 5E0GA 1Y3YA 4XBDA 5TCCA 3GCOA 3SU0A 1C2IA 2FPZA 1GHAG 4YTAA 2BVSH 2QC2A 2WPJS 3PO1B 4K3JA 1E35B 1C5ZB 2QYIA 1AVGH 5DP7A 3GCHC 1WBGB 2Z3DA 3LT3A 3LIWA 4RKOB 2W26A 3U1JB 1UTQA 4K5ZA 2P16A 3SV6A 3I77A 2XBVA 4AOQA 3MU8A 1ZMJA 2ZFPH 3MH7A 1ELGA 3PYHA 1DWCH 2OXSA 3E8LA 1GJ5H 1UVSH 4OGXA 1O35A 2FX6A 1ETRH 4BXWA 3SJKA 1ELVA 3ATKA 1Q31A 2EC9H 4MPXA 5AF9H 2ZHFH 3TH2H 4TPYA 4LXBH 1J8AA 1O31A 1FN6A 1O2UA 2P3TB 3E6PH 4J1YA 1HNEE 3BTKE 2F83A 5ETXA 4D8NA 1XXDA 1FY3A 1F5LA 3PWBA 2GV6A 3E0PB 3N7OA 4FUFA 1Y59T 2ZU4A 1J17T 1XUIA 3U8OH 1BTHH 1ZLRA 1KLJH 1F2SE 8GCHF 4BAMB 3QX5H 2BB4A 3ENSB 5T3HA 2EA3A 2BZ6H 1MBQA 3MH6A 4GVUA 3SI4H 1E0FD 4O9VA 1O2VA 4DIHH 2Z7FE 2P8OB 4MQAA 3V0XA 4Y71A 4X8VH 4O03A 2FOEA 2J38A 1NT1A 5E0HA 2PTNA 1BRBE 2WUBA 5HGGA 1KTSB 2GZ8A 2ZDVH 5C1UA 1DFPA 3VXEH 2QCYA 3RXJA 4MVNA 3KQCA 3QO6A 4LOYH 1IQKA 2FEQH 1X7AC 3O8CA 1OWEA 3VB6A 2HALA 4FU7A 3RM2H 3UWJH 1F0SA 3EA9A 3AAVA 1D3PB 1AE5A 2Z9JA 3EQ0H 1YLCA 1DVAH 3ZZDA 3RMNH 2C4FH 4AGJA 1HCGA 4O3TA 4UEHH 1ZOMA 1SOZA 1BBRE 2PR3A 2FTLE 1IQGA 3D49H 3RXGA 3ELAH 2BZAA 2BQWB 1K9OE 4JZFH 1EXFA 1ELCA 2VVCA 2D26C 1LCYA 3UNQA 1GCTB 1UVUH 1QB6A 3Q77A 2BQ7B 3VB3A 1LPKB 2GX4A 3M37A 5IDKA 2UUFB 4INLA 2OC0A 1SGQE 1ETTH 4NWLA 1BBRH 1C5WB 1Z8RA 2LNCA 4MNYA 1UTOA 6GCHG 1ELDE 3TNSA 3JZ1B 1C1SA 2M5TA 4XFQA 5DGJA 4NSYA 3QDZB 1EATA 1EX3A 2A2QH 4X6MA 1C1NA 1H1BA 4IGDA 2UUKB 1CQQA 2J2UA 2BDIA 3ZZ7A 3V13A 1C4V2 2BDCA 8LPRA 5C5NA 1P2OA 1THPB 1P9UA 2OINA 1ANBA 4FUHA 1JXPA 5DP6A 4ABIA 1Q3XA 1VITH 1FI8A 1VITG 1LMWB 1IQHA 4I32A 3RC4A 1GI8B 1KYNA 4ZKOU 2ZC9H 4BOHA 1BTWA 3UTUH 1P03A 2BY5X 2FS8A 2WV4A 1TX8A 1ID5H 1L2EA 1Z6JH 7GCHF 2BM2A 2WYJA 3VFEA 3A7WA 1FUJA 1GI7B 1SGTA 5E0JA 2HPQH 5TJXA 1L1GA 4X6OA 3RXKA 1HAIH 2VB0A 3M5MA 1KLTA 3SV8A 3T28A 3TH4H 1K1PA 4ABDA 3TJVA 3F6UH 4OS1A 1A61H 1KTTB 1QFKH 1JBUH 1P09A 4HTCH 1Q2WA 2D2DA 6LPRA 1AB9B 2GKVE 1C5UA 2TGTA 3RU4E 1V2QT 5EPYA 2BX4A 4IW4E 2GCHG 1Z1JA 3BIVH 1DUAA 4ZXYH 1G37A 1CA8B 1EAUA 1G2MA 2A7JA 1K21H 2SFAA 1EUFA 1BCUH 1Z1IA 3P92A 1C5NH 3EGKH 3MHWU 1O2TA 1EZUC 1UVTH 1GDUA 4ISOA 3ZV9A 3ZVCA 1O3FA 1EZXC 3OX7U 4X2YA 1MU6B 1O5FH 4ISIH 4X1SU 3RXFA 3IWMA 2WPKS 2R3UA 3QK1A 2QXIA 4DOQA 1HJAC 1GJ8B 1H9LB 1YF4A 2VINA 1W7GH 1KDQB 1BOQA 1HXFH 3BTGE 5FX5A 2ZHEH 3URCA 2Z6BD 3SGQE 1TNIA 1AWHB 5A8XA 1MAXA 2VWOA 1EJMA 5CE1A 1QBVH 4NZLA 3SV2H 5A0BA 1MKXK 1KIGH 2R0KA 2BY6X 3H7TA 5JBBS 4GPGA 1N8OC 2ZHDA 2XC4A 1FV9A 3RP2A 4CRAA 1P06A 2P3UB 2BOHB 2BTCE 2W7SA 1MTSA 2XW9A 4D9QA 1OWIA 3C27B 1TBZH 4UFFH 2KAIA 4BANB 1QURH 1THSH 4K69A 2FOCA 1EB1H 2FYRA 5C67A 1TBQH 2ZQ2A 2VIVA 1NFYA 3EDXB 3AAUA 2VIDA 3T29A 1S6HA 3GYMA 1Y3XA 4ZUHA 3RXOA 1JMOH 3MI4A 1W2KH 1P2KA 3HGPA 2H5CA 2IPHA 1BTZA 2AIPA 2XWAA 1K1OA 5ESBA 1IHSH 1AKSB 4MDSA 2GVFA 3RXLA 2BDBA 5DG6A 1D9IA 1K1NA 2A1DB 5JBAS 2UUY<