4GVUA

Lyngbyastatin 7-porcine pancreatic elastase co-crystal structure
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title Potent elastase inhibitors from cyanobacteria: structural basis and mechanisms mediating cytoprotective and anti-inflammatory effects in bronchial epithelial cells.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gvuA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gvuA01
3MNCA 1VCQA 3SNBA 2FI3E 3Q00A 4KKDA 2ZKSA 3MOCA 2XCNA 1O5EH 4DVAU 3AVZA 1BTXA 1LVMA 1TB6H 2FS8A 3ATIA 1AHTH 3TK9A 3ENSB 1AMHA 3TH4H 3GCHB 2EA3A 3FVFB 3NWUA 3SU5A 1SGIB 1O0DH 3M35A 5HMAA 2YOLA 2R3YA 2V0BA 2J38A 2A2QH 1OP0A 2Y5HA 3V3MA 4I7YH 5CMXH 4MNYA 1O3HA 4A7IB 3KF2A 1AD8H 4J1YA 2HNTC 5FPYA 4X2VA 4BAQB 2XC5A 3P95A 1NFWA 1ABIH 1AFEH 1V2KT 1M9UA 1OP2A 1AE8H 2PWXA 3PMAB 3SHCH 2PTNA 3BN9A 1PYTD 1TQ0B 2AEIH 3QDZB 2AERH 4K60A 3GISB 3KCGH 1ETSH 5DGJA 5E8EH 1JRTA 4CH2B 1O2JA 3GCHC 3S7KB 2PLXA 3MI4A 1K21H 1O2RA 3V0XA 1GI2A 2TGAA 4JCNA 1IQJA 4INHA 1MKWK 3RXKA 1GBLA 3F9FA 4AGJA 1ZPZA 2BDAA 2AIPA 4NGAH 3KHVA 1MMJN 3PB1E 2JH6D 4AG2A 1QJ6B 2GGVB 4LZ4B 3GDUA 3RXTA 3BIUH 3EYDA 1NFXA 3SJ8A 1ETRH 2WPLS 1BTPA 4A5TS 6GCHG 2RG3A 1A2CH 2UUKB 4LK4A 3A88A 1SLVB 1TONA 1Y3XA 1UVUH 3GYLB 2WUCA 4HZHA 1DANH 1V2QT 4MPWA 4UFEH 3ESTA 4WXVA 4X1SU 1QB1A 1XUJA 1GHWH 2Q6FA 2R2MB 1MCTA 2WYJA 2C8YB 1XVMA 4NZQA 3H7TA 1TGSZ 1EB1H 3A7TA 4GSOA 2PSXA 1GCTB 5A0BA 1UTKA 1P05A 1S6FA 4F4OC 1NC6A 2GCHG 4JMYA 1PPGE 2G81E 1UCYE 1OOKB 4E7RG 3RXGA 1KXCA 4ZMAH 1F0TA 2Z9KA 4XBCA 1O2SA 1K28D 2XBVA 2YNAA 4H4FA 2Z3CA 1PFXC 3A8CA 1NU7B 5GJ4B 1UTLM 3B23B 3V13A 1A5IA 1O2UA 1UTOA 1BB0B 1TNGA 5EOKA 1EOJA 1BHXB 1BJUA 4ISHH 5C20A 3ATKA 2FOBA 2BX3A 1P04A 4XBDA 1P2JA 1NRQH 1BJVA 2BD7A 4M7GA 1YPJH 1BBRE 1CHOG 7ESTE 3L6PA 3KQBA 1ELCA 2W26A 1DM4B 3PM3A 1FY3A 3S0NA 3EAJA 1QBNA 3SO3A 2AGEX 1A0LA 1BMMH 4IN2A 3ZZ9A 3DFJA 2ANWA 4X6MA 2A5IA 4DOQA 3AASA 4H6TA 4TY6A 4BTUB 5C5NA 2UUJB 1GJ7B 2CMYA 3CS0A 3LH1A 4ZXXH 4A1XA 3Q76A 2CF8H 1C2GA 4BAHB 5JBAS 2XC0A 3SORA 1O3KA 2ZU5A 2BY5X 3F1SB 1SGRE 1NM6A 4CHAC 1IQGA 5LPRA 4RSPA 2UWPA 1LHFH 2F9OA 4MPVA 5JB9S 1GBJA 2XBXA 4WWYA 1QHRB 2VWNA 1IOEA 1C5VA 1ANCA 5EW1H 1O5AB 3ZZBA 2RCEA 3IITA 3ZZDA 1MAYA 1W13U 3T26A 5ABWA 3MHWU 1O3EA 5E0HA 1OPHB 1FPCH 3NXPA 1Y3VA 3U8RH 5HXFA 1P12E 2FP7B 1G3DA 3IG6B 4NG9H 1GBBA 4ZKSU 4R0IA 2TRMA 2OQ5A 1ESAA 2STAE 3ATLA 3M36A 1GI1A 2G8TA 3H5CB 4ZAEA 3VB5A 1UMAH 3U1IB 2FOHA 2VIQA 4BAOB 3HKJB 3TJOA 5A8YA 1FY5A 1F5LA 1QGFA 4ESTE 4ISOA 1IQLA 3PTNA 4BXSA 2NU0E 3RXSA 3STIA 4ZUHA 2XCFA 1HGTH 3WY8A 1XUHA 1C5NH 1GGDB 1DUAA 2OC8A 2PKAB 2HPQH 1EOLA 3TH2H 1V2ST 3T5FH 1FDPA 2TPIZ 1P2OA 2DE9A 4HTCH 3C27B 3Q77A 5IDKA 4ZH8A 5F03A 2VGCC 1H9HE 1DDJA 2A4RA 1AUTC 4Q7ZA 4NFFA 2BDHA 3MYWA 2ZU1A 3DA9B 1LKBA 3GOVB 3M3SA 5GDSH 3TNTA 1WSSH 1SQOA 1EP5A 2F9VA 3SU4A 1V6DA 2Y7ZA 5DG6A 2ILNA 1O34A 2Y82A 1CVWH 2XNIA 1LQDB 1YYY1 5AF9H 1D4PB 1JIRA 4FVDA 1RRKA 4I8GA 4O3TA 2VIVA 3G01A 4WMDA 1GI0A 1F0UA 1C1VH 2RA3A 1SGFG 5EQRA 5C3NA 1EJAA 2B0FA 3RXDA 1GJDB 4B2AA 1H9LB 1WQVH 5L2YH 2GX4A 3M5OA 4JZFH 4FXGH 3QX5H 1EZXC 3UNSA 3RXMA 1O39A 1ARCA 1AKSA 3P17H 2OD3B 1ZSJA 1KLIH 1SLXB 1XX9A 1SLWB 1AVXA 2GKVE 1EAXA 1O2HA 1AFQB 2FS9A 2BZAA 1MZAA 3T27A 3GY6A 1C1TA 5GCHF 4AYVB 2TBSA 1OS8A 2OC1A 1C1OA 1ZRBA 2YNBA 1O2GH 1MBQA 2TGTA 1GBTA 1OXGA 1Z6EA 4NIWA 3ZV8A 1C4U2 5EQSA 1GPZA 1QTFA 2Z3DA 1GG6B 1WUNH 1XXDA 1CO7E 2BD3A 1ANEA 2FOFA 2JH5D 4Y8ZA 5FPSA 4CBNA 2WUBA 1XXFA 3VEQB 4NIVA 5GPIB 1EJMA 1GHAF 1DWDH 2FOCA 1IQEA 3BTKE 1ZR0A 3AAUA 2A7CA 2VINA 3GY7A 5EGMA 1E0FD 1NRRH 2OLGA 4AOQA 1HJ8A 3UTUH 3P70B 1YLDA 2O8UA 4AZ2B 1LKAA 1EAUA 3LJJA 2ZTZA 5H4IB 1YC0A 1D3TB 5HM9A 2TIOA 3U1JB 4LXBH 1QQ4A 1ZLRA 3E16B 2WPHS 1GJ6A 2J4IA 2ZQ1A 1UK3A 1V2PT 2UUYA 3UNRA 2Z6BD 5F6MA 2D2DA 3E6PH 4WMFA 1GG6C 1BBRK 1SFQB 2W7SA 2AIQA 2VVUA 1INCA 1FNIA 4FUHA 2GV7A 2OXSA 2BY8X 3B8JA 5TCAA 2G5VA 3SJOA 1IHTH 1O3FA 2ODPA 4IN1A 2SFAA 4NIXA 1P02A 3LH3A 1AZZA 1SGNE 1DWCH 1A3BH 2OQUA 4K2YA 2R9PA 2Y7XA 1AWFH 1SOTA 4THNH 2GVFA 1Y59T 1KXDA 1G37A 4ABGA 2CJIA 4J2YB 1QRXA 4TPIZ 1CQQA 3ZVGA 2ZZUH 3DD2H 3E90B 2XXLA 1CGHA 1KXBA 5DP9A 2JETB 2ZECA 2P3FH 2SNVA 1SHYA 2QXIA 1GL1A 1MUEB 1DS2E 1Y8TA 1HFDA 5F8XA 2ZHFH 4FUFA 3TJNA 4I8JA 4TWWA 4MNWA 1ID5H 3QZRA 2GCTB 1W0YH 3V7TA 4CBOA 1E38B 2JKHA 4DCDA 1TNJA 5FAHA 1C2DA 1SVPA 1T4VH 2G55A 3L3TA 4WF8A 1F5KU 2BY7X 3BEIB 9LPRA 8LPRA 2A7HA 4Y11E 1L1NA 1VITF 1QBOA 4JK6A 3RC5A 3UY9A 1SQTA 2H1UA 1MTSA 4JZEH 3SU3A 3MTYA 4ZKRU 2SNWA 2Z9GA 2FZZA 2ZTYA 1ORFA 1MAXA 1O2QA 3VB4A 2JETC 2IJOB 1AU8A 2BVXH 4FVBA 1TBRH 1EB2A 2P3UB 4ABAA 1D3PB 1DWBH 2K1QA 4K8BA 1THRH 1HXFH 1Q31A 2A1DB 3STJA 5C1UA 2GCTC 8GCHG 3ATMA 4WJG2 4NA7A 2BVSH 3GICB 1O2TA 2B7DH 4ISIH 4OS7A 3GY5A 1FQ3A 1UTMA 4CRGA 1ZPCA 4LZ1H 1OWEA 1C5LH 5LPEA 3BG8A 1UO6A 1TRMA 4H42U 1TBQH 2W7UA 3DUXH 1YLCA 3SQEE 4X1RU 1SMFE 2FMJA 3VXFH 1BMAA 4YTAA 1C2MA 4X1PU 1AQ7A 1G2LA 3I29A 4UE7H 2QXGA 1K1NA 2FI4E 1C2LA 1ZGVA 3BEFB 4X2XA 3TJUA 5DJ7A 1FI8A 2LPRA 3EDXB 1DITH 1RJXB 4YOJA 2BMGB 1CHGA 3LGTA 4X1QU 2R2WU 1NTPA 2STBE 3QWCH 3RMOH 3NK8A 1ZMNA 1FV9A 1XMNB 4E06H 2J2UA 1GMCF 4NWLA 3TLOA 1Y3UA 1IQHA 5FBIA 1UVTH 4ISLA 3MH4A 2QIQA 1Z1JA 5EXNA 1TMTH 2BD9A 1TGCA 2OBOA 5DP4A 4UFGH 2GZ9A 1HAVB 4WY3A 2WV4A 2NWNA 2ZGHA 3QO6A 2PW8H 1ANDA 2BD5A 5TJXA 4IW4E 1G36A 5F8TA 1ZJKA 3RXPA 2SGFE 4YLQH 3A89A 1CT4E 2D26C 1HXEH 3W94A 1TOCB 2XRCA 2P59A 5EU8A 1MQ6A 3M7UA 5B6OA 1ZHRA 2A31A 3LGUA 4CRAA 3E0PB 4DIIH 1BBRH 1E35B 1YPKH 1DUEA 3O8CA 1K2I1 1TA6A 3BTGE 3OYPA 1JBUH 1WCZA 1NZQH 1WBGB 2Y80A 5GXPA 1ETTH 1RD3B 2ZDMA 1ELTA 1GHVH 1NT1A 2ZC9H 3F6UH 1C2EA 3K6YA 4XOJA 4XDEA 1C2KA 2C8XB 1IHSH 3PO1B 4GHQA 1O2KA 1S0RA 1O2MA 2PKAA 1C5PA 4FU7A 1V2TT 1W2KH 1C1WH 1D6WA 3LC3A 1O2XA 1Y5BT 4K5ZA 4XSKU 1EX3A 1GMHF 1H1BA 4X1NU 1ELDE 2BDIA 4Q7YA 4O97A 3EA8A 1YP9A 4ZROA 1YCPM 1NESE 3BTHE 1H8IH 3UR6A 1GI6A 4CH8B 2LNCA 1GDUA 1TALA 1KTTB 2PUQH 1N6XA 2GMTC 4SGBE 3KEEA 3NZIA 2F9UA 2A4QA 3PWBA 4CRFA 1FAXA 1N8OB 3RU4E 1PPCE 4AFZA 1DVAH 4JZIA 5T3HA 4WVPE 3JZ1B 3LKWA 1S81A 1Z6JH 4X2YA 4AFSA 5A8XA 1P11E 1V2UT 1EXFA 5JB8S 1QQUA 4Y6DA 3LGWA 1GMCG 3PO1C 4LOYH 4YLUA 4CRCA 1FXYA 2BLVA 1SPJA 1GHZA 4OS1A 1NRPH 4BANB 1C5ZB 4X8TH 3E8LA 1AVWA 2FYQA 3PTBA 4K69A 3GY3A 1YPHE 1X7AC 1O3IA 1TBZH 2EI6A 3SJKA 1QL7A 2Y81A 1CT2E 3ODFA 4ABHA 3ZVAA 4X8SH 1A1RA 2Z9JA 4PROA 2QV1A 3MFJA 1DWEH 1FAKH 2PKSB 3QN7A 1AY6H 1C5XB 2FM2A 1P3CA 1V2OT 3SGBE 3RXOA 1C2HA 1ESBA 1N8OC 2EC9H 1NROH 3P8GA 1JIMA 1A4WH 3FP7E 1NRNH 2ZGBH 1QB9A 1UK2A 4HI3A 2SGAA 1JRSA 2QC2A 5BRRE 1LTOA 2G4UA 1SOZA 2UWLA 5PTPA 2AS9A 1GI9B 4X6NA 3BF6H 2BLWA 1MBMA 1C1QA 1TWXB 2BXUH 3ZYDA 2DUCA 2KAIB 1SL3A 3PWCA 4ZHMU 4CHAB 4AB8A 2FOAA 5LGOA 2OC7A 2O8TA 2A5AA 5L6NH 1YPMH 2BQ6B 2PKSC 4OS5A 1PPEE 1C5YB 1EKBB 3EE0B 4KTSA 3VGCC 3A7VA 3ZZ6A 1CGIE 3VB6A 2WPJS 1FN8A 1CT0E 3RMLH 1FLEE 2ZHWH 4FUIA 1N1LA 4YM9A 3K2UA 1FUJA 3S69A 3PMHB 2HWLB 2ZDLA 1T8LA 4AG1A 1TGNA 1WU1A 3PV4A 1F7ZA 3PLPA 4X6PA 1NU9A 2A32A 2G51A 2GDDA 2NU2E 1SBWA 3M7TA 3SU2A 1O2WA 1BTYA 2PHBA 3RP2A 3P8FA 3LPRA 1HJ9A 3SHAH 1GBCA 1SGFA 2FYRA 1C5QA 1P06A 1UTJA 1DY9A 1BOQA 3URCA 3EA9A 2AFQB 4IBLH 3RM2H 1LPKB 1XM1A 4JZ1A 1HUTH 2QA9E 2VIDA 4DGJA 3EA7A 2JH0D 1O2PA 3E3TA 1A0JA 1BMLA 1U6QA 3F9GA 1A46H 3DFLA 4JYUH 1P0SH 1VJ9U 1FIWA 5CHAC 1HYLA 1SG8B 4GPGA 4ASHA 5C1YA 1K1IA 1GVLA 4F49A 5E2PA 3M5MA 7GCHF 1BA8B 1CA8B 2Z9IA 2ZGJA 1ZJDA 3RXIA 2VGCB 2Z9LA 2P8OB 1O35A 1BMNH 1H9IE 2FDAA 4U32A 1J9CH 4DW2U 2J9NA 4A1VA 5L30H 3RLYH 1DSTA 1HAOH 1DSUA 1G3EA 1Z8JB 2OUAA 4YOGA 4ZXYH 2RA0A 3BEUA 2ZDKA 5TCCA 1FY1A 1P2QA 1ZTKA 4JYTA 4ZHAA 5FX5A 1LVOA 4K8YA 1YGCH 3W95A 6LPRA 4IS5A 1O37A 2FWWA 3SI3H 3U69H 5C1XA 1RS0A 1W8BH 3A8DA 3MNSA 4INLA 1GI5A 2BDCA 2GD4B 2NU3E 5IYTA 4ABFA 1O36A 4WXIA 5K7RA 3A87A 1MKWH 4D7GA 5A0CA 2PGQB 1Y3YA 2WYGA 5HYOA 3FP8E 4NA9H 1ZMLA 3BV9B 3U9AH 2VWMA 4MLFB 3TK5A 3AAVA 5FX6A 4X8UH 1S6HA 1K1MA 2P8OC 3SNDA 1D9IA 1ZZZA 1Z8RA 1O5BB 1TLDA 3ZVDA 4CR9A 3SNCA 3F68H 1OKXA 1G9IE 5EPYA 2GDEH 1GJ8B 5AHGH 1YPGH 3ZVFA 1ZTJA 1J16A 1Z8IB 3A7WA 4O3UA 1NFYA 1O2YA 1L1GA 2PSYA 2OTVA 1YPHC 1UTPA 1GBIA 2SGEE 3M5LA 4VGCC 3DHKH 1GBKA 2ZU3A 6CHAB 2V6NA 2AGIX 2BYAX 1CA0B 1MTWA 4E7NA 1BZXE 4B2CA 3SGAE 2TGPZ 2ZA5A 2BY6X 1O3BA 2PR3A 3MWIU 1T8OA 1YBWA 4Y0ZE 3D23A 3ZVCA 4AFUA 1QA7A 1LMWB 3A8AA 1GI3A 4QT8C 1MTUA 2R3UA 1KY9A 1GI8B 1XUKA 1SC8U 4I8KA 2ZFQH 4DY7B 2ANYA 2QXJA 3ODDA 2PGBB 1EQ9A 4JYVH 4B75A 3UWJH 3RXQA 4IC5A 1CE5A 1TPAE 2ZFPH 3U8OH 1C1SA 4Y8XA 7GCHG 2VJ1A 2VWOA 2QF0A 3E0NB 4IMQA 4KP0A 1HAVA 1QL9A 2ZTXA 2FOGA 4D76A 6ESTA 1S85A 1UHBA 3UIRA 5DPAA 2F9PA 2QCYA 1F0SA 2W3IA 1Z7KA 3BTME 3SU1A 2ANKH 4Z6AH 2HALA 6CHAC 4K1EA 2A0QB 1CA0C 3BIVH 1ARBA 3D62A 4R8TB 4GVUA 4FUEA 1C5TA 3Q3YA 4Q7XA 1AB9B 1L0ZA 2HVXA 3P8NA 3FZDA 3ZVEA 3KQDA 1P01A 1IQNA 3RXHA 1KYNA 1FMGA 1O3OA 2PTCE 1O5DH 1TA2A 3BG4C 4NSYA 4ABDA 1ZHMA 4B2BA 3ATWA 1YCPK 2F9BH 2ZCKP 1UCYK 3A8BA 3NCLA 1WAYB 3A7YA 4ABEA 2A2XH 3E91A 2HNTF 4OS4A 1TFXA 3T62A 4UDWH 4FUDA 3N7OA 3GY4A 1GBHA 3GCTF 1GBDA 1TNLA 1YPEH 4INKA 2BY9X 2XW9A 2BD2A 1WQSA 1T7CA 3LIWA 3MU5A 1AGJA 1JXPA 8KME2 1AB9C 1YF4A 2TGDA 5A09A 3T28A 5AFYH 2SGDE 1P09A 2O8LA 1ELBA 4AFQA 1GDNA 1O2OA 1MQ5A 1GHYH 1XKAC 2G00A 5I46H 4NCYA 2BHGA 4D8NA 3ZZ3A 1O31A 2B9LA 5DP5A 1V2MT 1EJNA 3T2NA 1O3JA 4IGDA 1J14A 1MD8A 1ESTA 5FXLA 3UNQA 2QAAA 1BQYA 3KIDU 4YESB 1RTKA 2ANMH 4O03A 3R3GB 1BTWA 3UOUA 2IOTA 1OWJA 1NN6A 1QIXB 2F9NA 3UWIA 1BDAA 2Q6GA 2BM2A 2Y5FA 2OP9A 2NU4E 1GBFA 1Y5AT 1GHBF 3RXEA 1MTNC 4TPYA 1ZHPA 1DICA 1FJSA 5GCHG 3OY6U 3KL6A 1LHCH 4UFFH 1O3GA 4CREA 1V2WT 2IN2A 2EI7A 1QR3E 1XKBC 5C2ZA 2BDYA 1K9OE 1QJ1B 2P93A 1G3CA 3M5NA 1YM0A 3VPKA 3HK6B 1FN6A 2CN0H 1GJCB 1MTVA 1O3LA 1EPTB 1Z1IA 2BB4A 3MU4A 1S5SA 2C8ZB 3UREA 1MU8B 1GHAG 1T31A 3FAOA 2XTTB 1UTNA 3RXAA 2CHAB 7KMEH 3Q3XA 1LQEA 1G2MA 2I6SA 2B8OH 4BXWA 2ZFSA 2ZPQA 5HM2A 9ESTA 3FANA 2GP9B 5T6GA 1RTLA 1LHEH 2GT8A 1SGYE 5FPTA 2KAIA 3SNEA 2O9QA 3ZV9A 3HPTB 3GCOA 1C2JA 1NY22 1WYKA 1RTFB 2EEKA 3TPIZ 2GZ8A 1DE7H 1LCYA 4MNXA 3GCTG 5AFZH 1SFIA 1ZGIA 2H6MA 4FUCA 1F0RA 2CXVA 2GTBA 3KN2A 2ULLA 3P6ZB 3BTFE 1LVBA 2VNTA 1QCPA 2ZWLH 4XBBA 3A81A 4X8VH 1GCDA 2QF3A 1O3MA 3SUDA 1EPTC 1C5WB 1ZSLA 4MPUA 2VIOA 4Z0KA 2J34A 1JMOH 1BHXF 1FZZA 1ELGA 1GWAA 2CHAC 2FTLE 3MU1A 5E0JA 1QA0A 2ZP0H 2P94A 2ZU2A 1EAIA 3FZZA 5C5OA 1ZSKA 1DPOA 3SUEA 1SI5H 2P95A 1AIXH 4I8LA 1P8VC 1HJAC 4Y71A 2V3HH 1YCPH 3A83A 2IPHA 1PQ8A 1UCYH 1V2JT 1C9PA 1HCGA 1AN1E 3LONA 1GJ4H 3HATH 2PUXB 2R0KA 1B7XB 3RU4D 2FOMB 1UHBB 3A7ZA 1JWTA 1SQAA 1SB1H 1HPGA 1MKXK 2Z7FE 3D49H 1WV7H 3KNXA 2ZDAH 3PMBB 3LOXA 3P92A 5JPMH 1J15A 1O3NA 1VITG 2O8MA 3HK3B 4NZLA 1L4ZA 1BTHH 2P3TB 4OS2A 1SGPE 2ZQ2A 5SGAE 2Y6TA 3JZ2B 2GMTB 1QNJA 1DXWA 4GUXA 2ZFRH 1OP8A 2VVCA 3UFAA 5A8ZA 1NS3A 3KQEA 4Y7AA 2A45B 1CBWB 4AYYB 5EG4A 1HAGE 1ELFA 3AW0A 3VFEA 4DJZB 1V2RT 2BOKA 2BLOA 4DURA 2AMPA 4I33A 4DG4A 1GVKB 4A1TA 5F8ZA 4GHTA 1KTSB 1TYNA 2ZGCA 3F9EA 4Y79A 1TGBA 4B71A 1ZTLA 2AMDA 4B74A 2C90B 3K9XB 5GIBA 3ZYEA 2C8WB 1Z8GA 3B9FH 3Q3KA 3S7HB 1C2IA 2OINA 1ZOMA 1C1MA 3MU8A 1C5SA 2BDGA 5J4SA 2OCVB 3SV6A 2H9TH 5DO4H 3TIUA 3TGJE 4Y8YA 1VJAU 1OWIA 4D7FA 3V12A 2F91A 2OBQA 3ZZ8A 2ZHQH 3D65E 3O8BA 3OTJE 4I31A 1ZYOA 2ZGXH 3UUZA 1F92A 1FIZA 1CHOF 1T32A 1GBMA 1IQFA 4H6SB 1CBWC 2BXTH 1GBEA 2VIPA 4YO9A 3QK1A 5DP6A 2VU8E 4O9VA 4CR5A 2ZNKH 4OS6A 1E36B 3NPSA 1O2NA 1HIAB 3GYMA 3SI4H 1UJ1A 1PQ5A 1W10U 1GHXH 1HNEE 1C4V2 4DT7B 4B73A 1AUJA 1F2SE 1N6YA 2FO9A 4DIHH 4GAWA 1ELVA 1HV7A 1KSNA 1QRWA 1HAIH 1T8NA 1ANBA 3LGYA 2XWAA 4AGKA 1QY6A 1P9UA 2AMQA 3SV8A 3MH6A 2F83A 2OC0A 1UVOA 3VGCB 1S83A 1IAUA 3ZZ4A 1DXPA 1H4WA 2ZF0H 2ZPSA 2M5TA 4BOHA 5A2MH 1LDTT 4D9RA 5FCKA 3RUOA 3VB7A 3BTTE 1TNIA 2BD4A 4KTUA 1G32B 2BOHB 1VCPA 1K1JA 3CP7A 3MH7A 3UOPA 1P3EA 4MPXA 5E0GA 4IC6A 1ACBE 1V3XA 4RKJB 2GV6A 1C1PA 4Q80A 5EXLA 3TGIE 1K1OA 4A92A 3SV2H 2ZFTA 2C3SA 1G3BA 1P2KA 3LDXH 3L33A 1KXEA 1QJ7B 1CU1A 3URDA 2WPKS 3CENA 1HRTH 1HB0B 3U8TH 3MO9A 2J95A 4ABJA 3QLPH 1TX6A 4MVNA 2FX4A 1B0EA 2QXHA 1AE5A 1SGQE 2R0LA 4K3JA 4A6LA 1LVYA 1TRYA 2Z94A 2XC4A 3RLWH 1O5GH 1BTZA 4KGAA 2NU1E 1HLTH 1GMHG 3A7XA 1AI8H 3S9CA 4XFQA 4K1SA 5CHAB 2ZEBA 4Y76A 1CGJE 1W7XH 1GI4A 1SR5C 2FOEA 5J4QA 3TH3H 1P2IA 1O2LA 1SGTA 4TYDA 3QGNB 1SHHB 1SLUB 2A7JA 2FX6A 5JBTA 4SGAE 1EZUC 1MKXH 3NUMA 4NWKA 1W11U 3MO6A 3LT3A 2BQ7B 1W7GH 4XE4A 3SV7A 1O2VA 1MH0A 1GCTC 2ASUB 2ZCHP 3HKIB 1IQIA 8ESTE 3OX7U 2H9EH 3M3VA 2WINI 4Y0YE 3ITIA 1EAWA 1BITA 5DP8A 5CE1A 1BT7A 2ZDNA 1PPBH 5HGGA 4NIYA 1P9SA 4NSVA 1L2EA 1HBTH 2FESH 1S0QA 2H5CA 1KLJH 1O2ZA 3R0FA 1AO5A 4D9QA 3A80A 2ZU4A 4GCHF 2ZHEH 3RXUA 1YPLH 3QGJA 2ZIQH 2G5NA 4UEHH 1TQ7B 2G4TA 3PROA 4MTBA 2V35A 3PLBA 1P10A 3UQOA 1YKTA 5DKMA 3OY5U 1GJ9B 1FPHH 1TPOA 2C4FH 2ZO3H 1EZSC 1OWKA 5FHTA 3C1KA 2VB0A 1GJAB 4BAMB 1UVPA 3RC6A 1P2NA 1ABJH 3ZZCA 4WMEA 5EQQA 4UD9H 2H2ZA 1XUIA 3A85A 3O8DA 4GLYA 2ZDVH 2WV5A 3SUGA 2HPPH 4OGYA 2VH6A 2A4GA 3TK6A 4JK5A 1THPB 3SOSA 1L4DA 1O5CB 2UWOA 1W0ZU 2GT7A 4VGCB 2ZFFH 3AW1A 1WTHD 5DK1A 4U30A 1EPTA 1BRUP 1OX1A 2FPZA 3RXRA 1VZQH 3RMNH 4BTTB 3UR9A 1P2MA 1CSOE 3OSYA 3SU6A 1PPHE 1C5UA 4ABIA 1NRSH 1E34B 1PJPA 2XWBI 3BTEE 2ESTE 5DP3A 1TMBH 1TX7A 4NA8A 2Z3EA 3SQHE 1LPGB 1AWHB 5LPFA 1Q3XA 1FY4A 2QGRA 2FIRH 3QZQA 3T25A 3UPEA 5I25A 1TNHA 1MZDA 1BTUA 4WH6A 5EXMA 2Y5GA 3MNXA 1V2NT 5FBEA 2VIWA 1TPPA 2CF9H 3SUFA 1PQAA 2J92A 1D3QB 1F5RA 3SN8A 4AORA 4U01A 4TY7A 1B5GH 3GCNA 1AZ8A 2ODQA 1RGQA 3P8OA 3KQCA 2ZHDA 3MH5A 1DLKB 1P57B 2ODYB 1UTQA 1RFNA 1A5HA 1UK4A 1W14U 2A4OA 3M7QA 3T29A 2EI8A 1KIGH 3A86A 3F9HA 1ELEE 3NKKA 1SGCA 1O5FH 3BG4B 1V2VT 3RC4A 2AH4X 1KDQA 1VGCB 4ABBA 2DE8A 2BQWB 4ZHLU 1QURH 4GCHG 5EPNA 1MD7A 1T8MA 4BNRA 1HAPH 1OWDA 5EODA 1OYTH 3LC5A 1NPMA 2BZ6H 1GGDC 3BTWE 2BLQA 5G4BA 3SNAA 5ETXA 1GDQA 3TITA 1BRBE 4YT6H 4RN6A 3EQ0H 5JDUB 3LU9B 4U2WA 3KGPA 2XBWA 4BAKB 1EUFA 1KLTA 1OSSA 5C67A 2CGAA 4B1TA 5FCRA 1A0HB 3LGIA 5AVDA 1TAWA 3PLKA 1TIOA 2P16A 2XBYA 2Q6DA 1PYTC 2WPIS 3SZNA 3RXVA 3CS7A 2BX4A 4Y10E 4E05H 1S82A 1C1UH 1VGCC 2D8WA 2RDLA 1QL8A 1VR1H 1NO9H 1J17T 1GVZA 2W3KA 2QYIA 3RXBA 1BRCE 2HLCA 2AYWA 3MMGA 1TRNA 1HAYB 1O32A 5A0AE 1Y5UT 3SBKA 2CV3A 3OU0A 3SW2B 1HAHH 2BD8A 2H9HA 3UQVA 2FLBH 5K0HA 1BCUH 1D6RA 1TMUH 1C1RA 1LPZB 1WTGH 1O3CA 5BPEA 1TABE 1VITH 2XYAA 4CRBA 1DLEA 3RXLA 2D1JA 1TGTA 4FU9A 1THSH 2W5EA 4KTCA 5LH8A 1W3CA 3M61U 1P03A 1IQMA 2ZG0H 1G30B 1MTNB 1Y3WA 2F3CE 4WH8A 1C9TA 3BSQA 2Q1JA 4AN7A 1TX8A 1OWHA 1HAXB 5T6FA 3LGVA 1AFQC 3A82A 1MCVA 8GCHF 1DY8A 1GMDF 1GJ5H 1K1LA 1MU6B 3TVJB 4UFDH 4HFPB 4Y7BA 5JYIA 1O38A 4B76A 1ZMJA 1ELAA 1LO6A 3FFGA 3SJIA 1EZQA 1TNKA 3EGKH 2FODA 2VVVA 1TOMH 3FP6E 2HOBA 4MG3A 1Q2WA 3HGNA 1TE0A 3A84A 3ZZ7A 1J8AA 3MNBA 4JZDH 4UONA 1HIAA 2ALPA 3QTVH 2C93B 5JBBS 3U98H 1O2IA 3RDZA 3RXJA 1RXPA 7LPRA 2HNTE 1JOUB 3QUMP 5EW2H 3PMJA 2THFB 3SJ9A 1LHGH 1HDTH 2V3OH 1W12U 4YZUA 3VXEH 3K6ZA 3M3TA 1O3DA 4X6OA 1C2FA 4MQAA 3ELAH 3E1XB 1IQKA 4FUGA 3O8RA 1GBAA 1GI7B 2HRVA 1A5GH 1GL0E 1K1PA 1GJBB 1TPSA 2BTCE 1FONA 2FI5E 4I32A 2FXRA 4MNVA 1NFUA 1KXFA 1ZPBA 2BVRH 5E2OA 1C5OH 1XUGA 1C1NA 3GY8A 4TWYA 3TU7H 3HGPA 1SGDE 1VCWA 2WPMS 4FUBA 4Q2KA 3S9BA 1DX5M 2ZPRA 1H8DH 1B0FA 2PV9B 2BDBA 4OGXA 4FUJA 5ESBA 1BRAA 3IWMA 1HJAB 3ZZAA 1DT2A 2A5KA 1O3AA 3TNSA 1RIWB 1O30A 3RM0H 1XUFA 1ZRKA 2QN5T 5GWZA 3RMMH 4NFEA 3ZVBA 5L2ZH 1QRZA 3SGQE 1C5RA 4IMZA 1FY8E 2UUFB 3SU0A 1K22H 1EP6A 1GMDG 2FTMA 3H7OA 3K65B 4CRDA 2ALVA 1A7SA 1C5MD 1PPZA 3RXCA 1QB6A 1EASA 1UVSH 4KELA 2PFEA 5DP7A 3ZZ5A 1V2LT 2G52A 2VWLA 4AB9A 1QFKH 1DOJA 2VH0A 1KDQB 3RXFA 4ISNA 5ESTE 2B5TB 4YT7H 3DT0H 1O33A 4BTIB 1D3DB 3I78A 1O3PB 3QTOH 2FEQH 4ZKNU 1A3EH 5JBCS 2GZ7A 1C4Y2 1EATA 2SGQE 2FLRH 2HGTH 1RIWC 2J94A 2H5DA 3TGKE 1GHBG 4K1TA 2I6QA 3TJVA 3SV9A 1OYQA 2ZCLP 1LHDH 1QBVH 1AKSB 3BTQE 3MO3A 3GDVA 1E37B 1BIOA 3PYHA 1SSXA 1HAZB 4I8HA 4RKOB 1T4UH 4YOIA 2QY0B 3VB3A 4FU8A 3LJOA 1BUIA 3BTDE 2SGPE 4X2WA 6GCHF 1A61H 2O8WA 1WOFA 3I77A 3GY2A 3RU4T 1XVOA 3M37A 1L1JA 4ZKOU 1AVGH 2AGGX 1SGEE 4HGCA 1PQ7A 4AX9H 1KXAA 4X0WU 1Z71A 3GDSA 3MU0A 1PPFE 3S9AA 1DFPA 4MDSA 2GCHF 5T6DA 2ZI2H 1S84A
chains in the Genus database with same CATH superfamily
3MNCA 1VCQA 3SNBA 2FI3E 3Q00A 4KKDA 2ZKSA 3MOCA 2EY4C 2XCNA 1O5EH 4DVAU 3AVZA 1KMHB 1BTXA 1LVMA 1TB6H 2FS8A 3ATIA 1AHTH 3TK9A 3ENSB 1AMHA 3TH4H 3GCHB 2EA3A 2YMSB 3FVFB 3NWUA 4OM9A 3SU5A 1SGIB 1O0DH 3M35A 5HMAA 2YOLA 2R3YA 4B6FA 2V0BA 2J38A 2A2QH 1OP0A 2Y5HA 3V3MA 4I7YH 3WWBA 5CMXH 4MNYA 1O3HA 4A7IB 3KF2A 1AD8H 4J1YA 2HNTC 5FPYA 4X2VA 4BAQB 2J97A 2XC5A 3P95A 3F2FA 1NFWA 1ABIH 1AFEH 1V2KT 1M9UA 1OP2A 1AE8H 2PWXA 5HKKD 3PMAB 3SHCH 2PTNA 3BN9A 1PYTD 1TQ0B 2AEIH 3QDZB 2AERH 4K60A 3GISB 5CHBA 2QF5A 3KCGH 1ETSH 5DGJA 5E8EH 1JRTA 4CH2B 1O2JA 3GCHC 2YMSC 3S7KB 2PLXA 3MI4A 1K21H 1O2RA 2K0QA 3V0XA 1GI2A 3H09A 2TGAA 4JCNA 1IQJA 4INHA 1MKWK 3RXKA 1GBLA 3F9FA 4AGJA 1ZPZA 2BDAA 2AIPA 4NGAH 3KHVA 1MMJN 3PB1E 2JH6D 4AG2A 1QJ6B 2GGVB 4LZ4B 3GDUA 3RXTA 3BIUH 3EYDA 1NFXA 3SJ8A 1ETRH 1UW7A 2WPLS 1BTPA 4A5TS 6GCHG 2RG3A 1A2CH 2UUKB 4LK4A 3A88A 1SLVB 1TONA 1Y3XA 1UVUH 3GYLB 2WUCA 4HZHA 1DANH 1V2QT 2KCOA 4MPWA 4UFEH 3ESTA 4WXVA 4X1SU 1QB1A 1XUJA 1GHWH 2Q6FA 2R2MB 1MCTA 2WYJA 2C8YB 1XVMA 1YY3A 4NZQA 2L6OA 3H7TA 1TGSZ 1EB1H 3A7TA 4GSOA 2PSXA 1GCTB 5A0BA 1UTKA 1P05A 1S6FA 4F4OC 4AC9A 1NC6A 2GCHG 4JMYA 1PPGE 2G81E 1UCYE 1OOKB 4E7RG 3RXGA 1KXCA 4ZMAH 1F0TA 2Z9KA 3EE7A 4XBCA 1O2SA 1K28D 2XBVA 2YNAA 4H4FA 2Z3CA 1PFXC 3A8CA 1NU7B 5GJ4B 1EFRD 1UTLM 3B23B 3V13A 1A5IA 1O2UA 1UTOA 1BB0B 1TNGA 5EOKA 4YXWD 1EOJA 1BHXB 1BJUA 4ISHH 5C20A 3ATKA 2FOBA 2BX3A 1P04A 4XBDA 1P2JA 1NRQH 1BJVA 2BD7A 4M7GA 1YPJH 1BBRE 1CHOG 1SKYE 7ESTE 3L6PA 3KQBA 1ELCA 2W26A 1DM4B 3PM3A 1FY3A 1H8HD 2GJGA 3S0NA 3EAJA 1QBNA 3SO3A 2AGEX 1A0LA 1BMMH 4IN2A 3ZZ9A 3DFJA 2ANWA 4X6MA 2A5IA 3N7EA 4DOQA 3AASA 4H6TA 4TY6A 4BTUB 5C5NA 2UUJB 1GJ7B 2CMYA 3CS0A 3LH1A 4ZXXH 4A1XA 3Q76A 2CF8H 1C2GA 4BAHB 5JBAS 2XC0A 3SORA 1O3KA 2ZU5A 2BY5X 3F1SB 1SGRE 1NM6A 4CHAC 1IQGA 4Q4LA 5LPRA 4RSPA 2UWPA 3GS9A 1LHFH 2F9OA 4MPVA 1BMFD 5JB9S 1GBJA 2XBXA 4WWYA 1QHRB 2VWNA 1IOEA 1C5VA 1ANCA 5EW1H 1O5AB 3ZZBA 2RCEA 3IITA 3ZZDA 1MAYA 1W13U 3T26A 5ABWA 3MHWU 1O3EA 5E0HA 1OPHB 1FPCH 3NXPA 1Y3VA 3U8RH 5HXFA 1P12E 2FP7B 1G3DA 3IG6B 4NG9H 1GBBA 4ZKSU 4R0IA 2TRMA 5HIZA 2OQ5A 1ESAA 2STAE 3ATLA 3M36A 1GI1A 2G8TA 3H5CB 4ZAEA 3VB5A 1UMAH 3U1IB 2FOHA 2VIQA 4BAOB 3HKJB 3TJOA 5A8YA 1FY5A 1F5LA 1QGFA 4ESTE 4ISOA 1IQLA 3PTNA 4BXSA 1S6LA 2NU0E 3RXSA 3STIA 4ZUHA 2XCFA 1HGTH 3WY8A 1XUHA 1C5NH 1GGDB 1DUAA 2OC8A 2PKAB 2HPQH 1EOLA 3TH2H 1V2ST 3T5FH 1FDPA 2TPIZ 1P2OA 2DE9A 4HTCH 3C27B 3Q77A 5IDKA 4ZH8A 5F03A 2VGCC 1H9HE 1DDJA 2A4RA 1AUTC 4Q7ZA 4NFFA 2RDEA 2BDHA 3MYWA 2ZU1A 3DA9B 1LKBA 3GOVB 3M3SA 5GDSH 3TNTA 1WSSH 1SQOA 1EP5A 2F9VA 3SU4A 1V6DA 2Y7ZA 5DG6A 2ILNA 1O34A 2Y82A 1CVWH 2XNIA 1LQDB 3F3BA 1YYY1 5AF9H 1D4PB 1JIRA 4FVDA 1RRKA 4I8GA 4O3TA 2VIVA 3G01A 4WMDA 1GI0A 1F0UA 1C1VH 2RA3A 3PRDA 1SGFG 5EQRA 5C3NA 1EJAA 2B0FA 3RXDA 1GJDB 4B2AA 1H9LB 1WQVH 5L2YH 2GX4A 3M5OA 4JZFH 4FXGH 3QX5H 1EZXC 3UNSA 3RXMA 1O39A 1ARCA 1AKSA 3P17H 2OD3B 1ZSJA 1KLIH 1SLXB 1XX9A 1SLWB 1AVXA 2GKVE 1EAXA 1O2HA 1AFQB 2FS9A 2BZAA 1MZAA 3T27A 3GY6A 1C1TA 5GCHF 4AYVB 2TBSA 5FL7D 1OS8A 2OC1A 1C1OA 1ZRBA 2YNBA 1O2GH 1MBQA 2TGTA 1GBTA 1OXGA 1Z6EA 4NIWA 3ZV8A 1C4U2 5EQSA 1GPZA 5CDFE 1QTFA 1NBMD 2Z3DA 2F43B 1GG6B 1WUNH 1XXDA 1CO7E 2BD3A 1ANEA 2FOFA 2JH5D 4Y8ZA 5FPSA 4CBNA 2WUBA 1XXFA 3VEQB 4NIVA 5GPIB 1EJMA 1GHAF 1DWDH 2FOCA 1IQEA 3BTKE 1ZR0A 3AAUA 2A7CA 2VINA 3GY7A 5EGMA 2YMSD 1E0FD 1NRRH 2OLGA 4AOQA 1HJ8A 3UTUH 3FKSD 3P70B 1YLDA 2KCYA 2O8UA 4AZ2B 1LKAA 4ACAA 1EAUA 3LJJA 2ZTZA 5H4IB 1YC0A 1D3TB 5HM9A 2TIOA 3U1JB 4LXBH 1QQ4A 3PV5A 1ZLRA 3E16B 3FO8D 2WPHS 1GJ6A 2J4IA 2ZQ1A 1UK3A 1V2PT 2UUYA 3UNRA 2Z6BD 5F6MA 2D2DA 3E6PH 4WMFA 1GG6C 1BBRK 1SFQB 2W7SA 2AIQA 2VVUA 1INCA 1FNIA 4FUHA 2GV7A 2OXSA 2BY8X 3B8JA 5TCAA 2G5VA 3SJOA 1IHTH 1O3FA 2ODPA 4IN1A 2SFAA 4NIXA 1P02A 3LH3A 1AZZA 1SGNE 1DWCH 1A3BH 2OQUA 4K2YA 2R9PA 2Y7XA 1AWFH 1SOTA 4THNH 2GVFA 1Y59T 1KXDA 1G37A 4ABGA 2CJIA 4J2YB 1QRXA 4TPIZ 1CQQA 3ZVGA 2ZZUH 3DD2H 3E90B 1FX0B 2XXLA 1CGHA 1KXBA 5DP9A 2JETB 2ZECA 5DN6D 2P3FH 2SNVA 1SHYA 2QXIA 1GL1A 1MUEB 1DS2E 1Y8TA 1HFDA 5F8XA 2ZHFH 4FUFA 3TJNA 4I8JA 4TWWA 4MNWA 1ID5H 3QZRA 5EJ1A 2GCTB 1W0YH 3V7TA 4CBOA 1E38B 2JKHA 4DCDA 1TNJA 5FAHA 1C2DA 1SVPA 1T4VH 2G55A 3L3TA 4WF8A 1F5KU 3PRBA 2BY7X 3BEIB 9LPRA 8LPRA 2A7HA 4Y11E 1L1NA 1VITF 1QBOA 3KYFA 4JK6A 3RC5A 3WWFA 3UY9A 1SQTA 2H1UA 1MTSA 4DT4A 4JZEH 4P00A 3SU3A 3MTYA 4ZKRU 2SNWA 2Z9GA 2FZZA 2ZTYA 1ORFA 1MAXA 1O2QA 3VB4A 2JETC 2IJOB 1AU8A 2BVXH 4FVBA 1TBRH 1EB2A 2F4LA 2P3UB 4ABAA 1D3PB 1DWBH 2K1QA 4K8BA 1THRH 1HXFH 1Q31A 2A1DB 3STJA 2J5UA 5C1UA 2GCTC 8GCHG 3ATMA 4WJG2 4NA7A 2BVSH 3GICB 1O2TA 2B7DH 4ISIH 4OS7A 3GY5A 1FQ3A 1UTMA 4CRGA 1ZPCA 4LZ1H 1OWEA 1C5LH 5LPEA 3BG8A 1UO6A 1TRMA 4H42U 1TBQH 2W7UA 3DUXH 1COWD 1YLCA 3SQEE 4X1RU 1SMFE 2FMJA 2V3MA 3VXFH 3F0PA 4Q63A 1BMAA 4RT0A 4YTAA 1C2MA 4X1PU 1AQ7A 1G2LA 3I29A 4UE7H 2QXGA 1K1NA 2FI4E 1C2LA 1ZGVA 3BEFB 4X2XA 3TJUA 5DJ7A 4F55A 1FI8A 2LPRA 3EDXB 1DITH 1RJXB 4YOJA 2BMGB 1CHGA 3LGTA 4X1QU 2R2WU 1NTPA 2STBE 3QWCH 3RMOH 3NK8A 1ZMNA 1FV9A 1XMNB 4E06H 2J2UA 1GMCF 4NWLA 3TLOA 1Y3UA 1IQHA 5FBIA 1UVTH 4ISLA 3MH4A 2QIQA 1Z1JA 5EXNA 1TMTH 2BD9A 1TGCA 2OBOA 5DP4A 4UFGH 2GZ9A 1HAVB 4WY3A 2WV4A 2NWNA 2ZGHA 3QO6A 2PW8H 1ANDA 2BD5A 5TJXA 4IW4E 1G36A 5F8TA 1ZJKA 3RXPA 2SGFE 4YLQH 1W0JD 3A89A 1CT4E 2D26C 2KCPA 1HXEH 3W94A 1TOCB 2XRCA 2P59A 5EU8A 1MQ6A 3M7UA 5B6OA 1ZHRA 4Z1MD 2A31A 3LGUA 4CRAA 3E0PB 4DIIH 1BBRH 1E35B 1YPKH 1DUEA 3O8CA 1K2I1 1TA6A 3BTGE 3OYPA 2KFWA 1JBUH 1WCZA 1NZQH 1WBGB 2WPDD 2Y80A 5GXPA 1ETTH 1RD3B 2ZDMA 1ELTA 1GHVH 1NT1A 2ZC9H 3F6UH 2M2AA 1C2EA 3K6YA 4XOJA 4XDEA 1C2KA 2C8XB 1IHSH 3PO1B 4GHQA 1O2KA 3OEHD 1S0RA 1O2MA 2PKAA 1C5PA 4FU7A 1V2TT 1W2KH 1C1WH 1D6WA 3LC3A 1O2XA 1Y5BT 4K5ZA 4XSKU 1EX3A 1GMHF 1H1BA 4X1NU 1ELDE 2BDIA 4Q7YA 4O97A 3EA8A 1YP9A 4ZROA 1YCPM 1NESE 3BTHE 1H8IH 3UR6A 1GI6A 4CH8B 2LNCA 1GDUA 1TALA 1KTTB 2PUQH 1N6XA 2GMTC 4SGBE 3KEEA 3NZIA 2F9UA 2A4QA 3PWBA 3DSOA 3W1EA 4CRFA 1FAXA 1N8OB 3RU4E 1PPCE 4AFZA 1DVAH 4JZIA 5T3HA 4WVPE 3JZ1B 3WW7A 3LKWA 1S81A 1Z6JH 4X2YA 4AFSA 5A8XA 1P11E 1YWUA 1V2UT 1EXFA 5JB8S 1QQUA 4Y6DA 3LGWA 1GMCG 3PO1C 4LOYH 4YLUA 4CRCA 1FXYA 2BLVA 1SPJA 1GHZA 2WHXA 4OS1A 1NRPH 4BANB 1C5ZB 4X8TH 3E8LA 1AVWA 2FYQA 3PTBA 4K69A 3GY3A 1YPHE 1X7AC 1O3IA 1TBZH 2EI6A 3SJKA 1QL7A 2Y81A 1CT2E 3ODFA 4ABHA 3ZVAA 4X8SH 1A1RA 2Z9JA 4PROA 2QV1A 3MFJA 1DWEH 1FAKH 2PKSB 3QN7A 1AY6H 1C5XB 2FM2A 1P3CA 1V2OT 2LP6A 3SGBE 3RXOA 1C2HA 1ESBA 1N8OC 2EC9H 1NROH 3P8GA 1JIMA 1A4WH 3FP7E 1NRNH 2ZGBH 1QB9A 1UK2A 4HI3A 2SGAA 1JRSA 2QC2A 5BRRE 1LTOA 2G4UA 1SOZA 3DCLA 2UWLA 5PTPA 2RFKC 2AS9A 1GI9B 4X6NA 3BF6H 2BLWA 3N99A 1MBMA 4RT1A 1C1QA 1TWXB 2BXUH 3ZYDA 4XD7D 2DUCA 2KAIB 1SL3A 3PWCA 4RI0A 4ZHMU 4CHAB 4TSFD 4AB8A 2FOAA 5LGOA 2OC7A 2O8TA 2A5AA 5L6NH 1YPMH 3SZEA 2BQ6B 2PKSC 4OS5A 1PPEE 1C5YB 1EKBB 3EE0B 4KTSA 3VGCC 3A7VA 3ZZ6A 1CGIE 3VB6A 2WPJS 1FN8A 1CT0E 3RMLH 1FLEE 2ZHWH 4FUIA 1N1LA 4YM9A 3K2UA 1FUJA 3S69A 3PMHB 2HWLB 2ZDLA 1T8LA 2V7QD 4AG1A 1TGNA 1WU1A 3PV4A 1F7ZA 3PLPA 4X6PA 1NU9A 5EJZA 2A32A 2G51A 2GDDA 2NU2E 1SBWA 3M7TA 3SU2A 1O2WA 1BTYA 2PHBA 3RP2A 3P8FA 3LPRA 1HJ9A 3SHAH 1GBCA 1SGFA 2FYRA 1C5QA 1P06A 1UTJA 1DY9A 1BOQA 3URCA 3EA9A 2AFQB 4IBLH 3RM2H 1LPKB 1XM1A 4JZ1A 1HUTH 2QA9E 2VIDA 2AHME 4DGJA 2JDID 2JH0D 3EA7A 1O2PA 3E3TA 1A0JA 1BMLA 1U6QA 3F9GA 1A46H 3DFLA 4JYUH 1P0SH 1VJ9U 1FIWA 5CHAC 1HYLA 1SG8B 4GPGA 4ASHA 5C1YA 1K1IA 1GVLA 4F49A 5E2PA 3M5MA 7GCHF 1BA8B 1CA8B 2Z9IA 2ZGJA 1ZJDA 3RXIA 2VGCB 2Z9LA 2P8OB 1O35A 1BMNH 1H9IE 5KEDA 2FDAA 4U32A 3MQKC 1J9CH 4DW2U 2J9NA 4A1VA 5L30H 3RLYH 1DSTA 1HAOH 1DSUA 1G3EA 1Z8JB 2OUAA 4YOGA 4ZXYH 2RA0A 3BEUA 2ZDKA 5TCCA 1FY1A 1P2QA 1ZTKA 4JYTA 4ZHAA 5FX5A 1LVOA 4K8YA 1YGCH 3W95A 6LPRA 4IS5A 1O37A 2FWWA 3SI3H 3U69H 5C1XA 1RS0A 1W8BH 3A8DA 3MNSA 4INLA 1GI5A 2BDCA 2GD4B 2NU3E 5IYTA 4ABFA 1O36A 4WXIA 5K7RA 3A87A 1MKWH 4D7GA 5A0CA 2PGQB 1Y3YA 2WYGA 5HYOA 3FP8E 4NA9H 1ZMLA 3BV9B 3U9AH 2VWMA 4MLFB 3TK5A 3AAVA 5FX6A 4X8UH 1S6HA 1K1MA 2P8OC 3SNDA 1D9IA 1ZZZA 1Z8RA 1O5BB 1TLDA 3ZVDA 4CR9A 3SNCA 3F68H 1OKXA 1G9IE 5EPYA 2GDEH 1GJ8B 5AHGH 1YPGH 3ZVFA 1ZTJA 1J16A 1Z8IB 3A7WA 4O3UA 1NFYA 1O2YA 1L1GA 2PSYA 1YPHC 2OTVA 1UTPA 1GBIA 2SGEE 3M5LA 4VGCC 3DHKH 1GBKA 2ZU3A 6CHAB 2V6NA 2AGIX 2BYAX 1CA0B 1MTWA 4E7NA 1BZXE 4XRNA 4B2CA 3SGAE 2TGPZ 2ZA5A 2BY6X 1O3BA 2PR3A 3MWIU 1T8OA 1YBWA 4Y0ZE 3D23A 3ZVCA 4AFUA 1QA7A 1LMWB 3A8AA 1GI3A 4QT8C 1MTUA 2R3UA 1KY9A 1GI8B 1XUKA 1SC8U 4I8KA 2ZFQH 4DY7B 2ANYA 2QXJA 3ODDA 3F2HA 2PGBB 1EQ9A 4JYVH 4B75A 3UWJH 3RXQA 4IC5A 1CE5A 1TPAE 2ZFPH 3U8OH 1C1SA 4Y8XA 7GCHG 2VJ1A 2VWOA 2QF0A 3E0NB 4IMQA 4KP0A 1HAVA 1QL9A 2ZTXA 2FOGA 4D76A 6ESTA 1S85A 1UHBA 3UIRA 5DPAA 2F9PA 2QCYA 1F0SA 2W3IA 1Z7KA 3BTME 3SU1A 2ANKH 4Z6AH 2HALA 6CHAC 4K1EA 2A0QB 1CA0C 3BIVH 1ARBA 3D62A 4R8TB 4GVUA 4FUEA 1C5TA 3Q3YA 4Q7XA 1AB9B 5C94A 1L0ZA 2HVXA 3P8NA 3FZDA 3ZVEA 3KQDA 1P01A 1IQNA 3RXHA 1KYNA 1FMGA 1O3OA 2PTCE 1O5DH 1TA2A 3BG4C 4NSYA 4ABDA 1ZHMA 4B2BA 3ATWA 1YCPK 2F9BH 2ZCKP 1UCYK 3A8BA 3NCLA 1WAYB 3A7YA 4ABEA 2A2XH 5B6LA 3E91A 2HNTF 2KZ4A 4OS4A 1TFXA 3T62A 4UDWH 4FUDA 3N7OA 3GY4A 1GBHA 3GCTF 3KYGA 1GBDA 1TNLA 1YPEH 4INKA 2BY9X 2XW9A 2BD2A 1WQSA 1T7CA 5DSFA 3LIWA 3MU5A 2K8IA 1AGJA 1JXPA 8KME2 1AB9C 1YF4A 2TGDA 5A09A 3T28A 5AFYH 2SGDE 1P09A 2O8LA 1ELBA 4AFQA 1GDNA 1O2OA 1MQ5A 1GHYH 1XKAC 2G00A 5I46H 4NCYA 2BHGA 4D8NA 3ZZ3A 1O31A 2B9LA 5DP5A 1V2MT 1EJNA 3T2NA 1O3JA 4IGDA 1J14A 1MD8A 1ESTA 5FXLA 3UNQA 2QAAA 1BQYA 3KIDU 4YESB 1RTKA 2ANMH 4O03A 3R3GB 1BTWA 3UOUA 2IOTA 1OWJA 1NN6A 1QIXB 2F9NA 3UWIA 1BDAA 2Q6GA 2BM2A 2Y5FA 2OP9A 2NU4E 1GBFA 1Y5AT 1GHBF 3RXEA 1MTNC 4TPYA 1ZHPA 1DICA 1FJSA 5GCHG 3OY6U 3KL6A 3UAIC 1LHCH 4UFFH 1O3GA 4CREA 1V2WT 2IN2A 2EI7A 1QR3E 1XKBC 5C2ZA 2BDYA 1K9OE 1QJ1B 2P93A 1G3CA 3M5NA 1YM0A 3VPKA 3HK6B 1FN6A 2CN0H 1GJCB 1MTVA 1O3LA 2JJ1D 1EPTB 1Z1IA 2BB4A 3MU4A 1S5SA 2C8ZB 3UREA 1MU8B 3OAAD 1GHAG 1T31A 3FAOA 2XTTB 1UTNA 3RXAA 2CHAB 7KMEH 3Q3XA 1LQEA 1G2MA 2I6SA 2B8OH 3PV2A 4BXWA 2ZFSA 2ZPQA 5HM2A 9ESTA 3FANA 2GP9B 5T6GA 1RTLA 3KQ5A 1LHEH 2GT8A 1SGYE 5FPTA 2KAIA 3SNEA 2O9QA 3ZV9A 3HPTB 3GCOA 1C2JA 1NY22 1WYKA 1RTFB 2EEKA 3TPIZ 2GZ8A 4I86A 1DE7H 1LCYA 4MNXA 3GCTG 5AFZH 1SFIA 1ZGIA 2H6MA 4FUCA 1F0RA 2CXVA 2GTBA 3KN2A 2ULLA 3P6ZB 3BTFE 1LVBA 2VNTA 1QCPA 2ZWLH 4XBBA 3A81A 4X8VH 1GCDA 2QF3A 1O3MA 3SUDA 1EPTC 1C5WB 1ZSLA 4MPUA 2VIOA 4Z0KA 5C0TA 2J34A 1JMOH 1BHXF 1FZZA 1ELGA 1GWAA 2CHAC 2FTLE 3MU1A 5E0JA 1QA0A 2ZP0H 2P94A 2ZU2A 1EAIA 2VBCA 3FZZA 5C5OA 1ZSKA 1DPOA 3SUEA 1SI5H 2P95A 1AIXH 4I8LA 1P8VC 1HJAC 4Y71A 2V3HH 1YCPH 3A83A 3FN8A 2IPHA 1PQ8A 1UCYH 1V2JT 1C9PA 1HCGA 1AN1E 3LONA 1GJ4H 3HATH 2PUXB 2R0KA 1B7XB 3RU4D 2FOMB 1UHBB 3A7ZA 1JWTA 1SQAA 1SB1H 1HPGA 1MKXK 2Z7FE 3D49H 1WV7H 3KNXA 2ZDAH 3PMBB 3LOXA 3P92A 5JPMH 1J15A 1O3NA 1VITG 2O8MA 3HK3B 4NZLA 1L4ZA 1BTHH 2P3TB 4OS2A 2J98B 1SGPE 2ZQ2A 5SGAE 2Y6TA 3JZ2B 2GMTB 1QNJA 3AK5A 1DXWA 4GUXA 2ZFRH 3DSGA 1OP8A 2VVCA 3UFAA 5A8ZA 1NS3A 3KQEA 4Y7AA 2A45B 1CBWB 4AYYB 5EG4A 1HAGE 1ELFA 3AW0A 3VFEA 4DJZB 1V2RT 2BOKA 3CNRA 2BLOA 4DURA 2AMPA 4I33A 4DG4A 1GVKB 4A1TA 1YLNA 5F8ZA 4GHTA 1KTSB 1TYNA 2ZGCA 3F9EA 4Y79A 1TGBA 4B71A 1ZTLA 2AMDA 4B74A 2C90B 3K9XB 5GIBA 4TT3D 3ZYEA 2C8WB 1Z8GA 3B9FH 3N7DA 3Q3KA 1WDIA 3S7HB 1C2IA 2OINA 1ZOMA 1C1MA 3MU8A 1C5SA 3F2GA 2BDGA 5J4SA 2OCVB 2KX4A 3SV6A 2H9TH 5DO4H 3NRLA 3TIUA 4Y8YA 1VJAU 1OWIA 3OE7D 4D7FA 3V12A 3TGJE 2F91A 2OBQA 3ZZ8A 2ZHQH 3D65E 3O8BA 3OTJE 4I31A 1VKYA 5T1VA 1ZYOA 2ZGXH 3UUZA 1F92A 1FIZA 1CHOF 1T32A 2EQNA 1GBMA 1IQFA 4H6SB 5F53A 1CBWC 2BXTH 1GBEA 2VIPA 4YO9A 3QK1A 5DP6A 5C17A 2VU8E 4O9VA 4CR5A 2ZNKH 4OS6A 1E36B 3NPSA 1O2NA 1HIAB 3GYMA 3SI4H 3F0OA 1UJ1A 1PQ5A 1W10U 1GHXH 1HNEE 1C4V2 4DT7B 4B73A 1AUJA 1F2SE 1N6YA 2FO9A 4DIHH 4GAWA 1ELVA 1HV7A 1KSNA 1QRWA 1HAIH 1T8NA 1ANBA 3LGYA 2XWAA 4AGKA 1QY6A 1P9UA 2AMQA 3SV8A 3MH6A 2F83A 2OC0A 1UVOA 3VGCB 1S83A 1IAUA 3ZZ4A 1DXPA 1H4WA 2ZF0H 2ZPSA 2M5TA 4BOHA 5A2MH 1LDTT 4D9RA 5FCKA 3RUOA 3VB7A 3BTTE 1TNIA 2BD4A 4KTUA 1G32B 2BOHB 1VCPA 4HG6A 1K1JA 3CP7A 3MH7A 3UOPA 1P3EA 4MPXA 5E0GA 4IC6A 1ACBE 1V3XA 4ASUD 4RKJB 2GV6A 1C1PA 4Q80A 5KGOA 5EXLA 3TGIE 1K1OA 4A92A 3SV2H 2ZFTA 2C3SA 3OEED 1G3BA 1P2KA 3LDXH 3L33A 1KXEA 1QJ7B 1CU1A 3URDA 2WPKS 3CENA 1HRTH 1HB0B 3U8TH 3MO9A 3OFND 2J95A 4ABJA 3QLPH 1TX6A 4MVNA 2FX4A 3ZIAD 1B0EA 2QXHA 1AE5A 1SGQE 2R0LA 4K3JA 3VG8A 4A6LA 1LVYA 1TRYA 2Z94A 2XC4A 3RLWH 1O5GH 1BTZA 4KGAA 1HLTH 2NU1E 1GMHG 3A7XA 1AI8H 3S9CA 4XFQA 4K1SA 5CHAB 2ZEBA 4Y76A 1CGJE 1W7XH 2HVYB 1GI4A 4P02A 1SR5C 2FOEA 3UB0A 3TH3H 4M9FA 5J4QA 1P2IA 1O2LA 1SGTA 4TYDA 3QGNB 1SHHB 1SLUB 2A7JA 2FX6A 5JBTA 4SGAE 1EZUC 1MKXH 3NUMA 4NWKA 1W11U 2CK3D 3LT3A 2BQ7B 3MO6A 1W7GH 4XE4A 3SV7A 1E1RD 1O2VA 1MH0A 1GCTC 2ASUB 2ZCHP 3HKIB 1IQIA 2KR7A 8ESTE 3OX7U 2H9EH 3M3VA 2WINI 4Y0YE 3ITIA 1EAWA 1BITA 5DP8A 5CE1A 1BT7A 2ZDNA 1PPBH 5HGGA 4NIYA 1P9SA 4NSVA 1L2EA 1HBTH 2FESH 1S0QA 2H5CA 1KLJH 1O2ZA 3R0FA 1AO5A 4D9QA 3A80A 2ZU4A 4GCHF 2ZHEH 3RXUA 1YPLH 3QGJA 2ZIQH 2G5NA 4UEHH 1TQ7B 2G4TA 3PROA 4MTBA 2V35A 3PLBA 2PP6A 1P10A 3UQOA 1YKTA 5DKMA 3OY5U 1GJ9B 1FPHH 1TPOA 2C4FH 2ZO3H 1EZSC 1OWKA 5FHTA 3C1KA 2VB0A 1GJAB 4BAMB 1UVPA 2KCAA 3RC6A 1P2NA 1ABJH 3ZZCA 4WMEA 5EQQA 4UD9H 2H2ZA 1XUIA 3A85A 3O8DA 4GLYA 2ZDVH 2WV5A 3SUGA 2HPPH 4OGYA 2VH6A 2A4GA 3TK6A 4JK5A 1THPB 3SOSA 1L4DA 1O5CB 2UWOA 1K0HA 1W0ZU 2GT7A 4VGCB 2ZFFH 3AW1A 1WTHD 5DK1A 4U30A 1EPTA 1BRUP 1OX1A 2WV9A 2FPZA 2XNDD 3RXRA 1VZQH 3RMNH 4BTTB 3UR9A 1P2MA 1CSOE 3OSYA 3SU6A 3OTPA 1PPHE 1C5UA 4ABIA 1NRSH 1E34B 1PJPA 2XWBI 3BTEE 2ESTE 5DP3A 1TMBH 1TX7A 4NA8A 2Z3EA 3SQHE 1LPGB 1AWHB 1MABB 5LPFA 1Q3XA 2JIZD 1FY4A 2QGRA 2FIRH 3QZQA 3T25A 3UPEA 5I25A 1TNHA 1MZDA 1BTUA 4WH6A 5EXMA 2Y5GA 3MNXA 1V2NT 5KECA 5FBEA 2VIWA 1TPPA 2CF9H 3SUFA 1PQAA 2J92A 1D3QB 1F5RA 3SN8A 4AORA 4U01A 4TY7A 1B5GH 1H8ED 3GCNA 1AZ8A 2ODQA 1RGQA 3P8OA 3KQCA 2ZHDA 3MH5A 1DLKB 1P57B 2ODYB 1UTQA 1RFNA 1A5HA 1UK4A 1W14U 2A4OA 3M7QA 3T29A 2EI8A 1KIGH 3A86A 3F9HA 1ELEE 3NKKA 1SGCA 1O5FH 3BG4B 1E79D 1V2VT 4FETA 2AH4X 1KDQA 1VGCB 3RC4A 4ABBA 2DE8A 2BQWB 4ZHLU 1QURH 4GCHG 5EPNA 1E1QD 1MD7A 1T8MA 4BNRA 1HAPH 1OWDA 5EODA 1OYTH 3LC5A 1NPMA 2BZ6H 1GGDC 3BTWE 2BLQA 5G4BA 3SNAA 5ETXA 1GDQA 3TITA 1BRBE 4YT6H 4RN6A 3EQ0H 5JDUB 3LU9B 4U2WA 3KGPA 2XBWA 4BAKB 1EUFA 1KLTA 1OSSA 3SYJA 5C67A 2CGAA 3U28C 4B1TA 4FOUC 5FCRA 1A0HB 3LGIA 5AVDA 1TAWA 5GNDA 3PLKA 1TIOA 2P16A 2XBYA 2Q6DA 2J98A 1PYTC 2L74A 2WPIS 3SZNA 3RXVA 3CS7A 2BX4A 4Y10E 4E05H 1S82A 1C1UH 1OHHD 1VGCC 2D8WA 1QL8A 1VR1H 2RDLA 1NO9H 1J17T 1GVZA 2W3KA 2QYIA 3RXBA 1BRCE 2HLCA 2AYWA 3MMGA 1TRNA 1HAYB 1O32A 1W0KD 5A0AE 1Y5UT 3SBKA 2CV3A 3OU0A 3SW2B 1HAHH 2BD8A 2H9HA 3FOAA 3UQVA 2OK5A 2FLBH 5K0HA 1BCUH 1D6RA 1TMUH 1C1RA 1LPZB 1WTGH 5HIYA 1O3CA 5BPEA 1TABE 1VITH 2XYAA 4CRBA 1DLEA 3RXLA 2D1JA 1TGTA 4FU9A 1THSH 2W5EA 4KTCA 5LH8A 1WXRA 2HLDD 1W3CA 3M61U 1P03A 1IQMA 2ZG0H 1G30B 1MTNB 1Y3WA 2F3CE 4WH8A 1C9TA 3BSQA 2Q1JA 4AN7A 1TX8A 1OWHA 1HAXB 5T6FA 3LGVA 1AFQC 3A82A 1MCVA 8GCHF 1DY8A 1GMDF 1GJ5H 1K1LA 1MU6B 3DSPA 3TVJB 4UFDH 4HFPB 4Y7BA 5JYIA 1O38A 4B76A 1ZMJA 1ELAA 1LO6A 3FFGA 3SJIA 1QZ8A 1EZQA 1TNKA 3EGKH 2FODA 2VVVA 1TOMH 3FP6E 2HOBA 4MG3A 1Q2WA 2KM0A 3HGNA 1TE0A 3A84A 3ZZ7A 1J8AA 3MNBA 4JZDH 4UONA 1HIAA 5C0UA 2ALPA 3QTVH 2C93B 5JBBS 3U98H 1O2IA 3RDZA 3RXJA 4ACBA 2IJD1 1RXPA 7LPRA 2HNTE 1JOUB 3QUMP 5EW2H 3PMJA 2THFB 2W6JD 3SJ9A 1NBME 1LHGH 1HDTH 2V3OH 4F48B 1W12U 4YZUA 3VXEH 3K6ZA 3M3TA 1O3DA 4X6OA 1C2FA 4MQAA 3ELAH 3E1XB 1IQKA 4FUGA 3O8RA 1GBAA 1GI7B 2HRVA 1A5GH 1GL0E 2QE7D 1K1PA 5IK2D 1GJBB 1TPSA 2BTCE 1FONA 2FI5E 4I32A 2FXRA 4MNVA 1NFUA 5EIYA 1KXFA 1ZPBA 2BVRH 5E2OA 1C5OH 1XUGA 1C1NA 3GY8A 4TWYA 3TU7H 3HGPA 1SGDE 1VCWA 2WPMS 4FUBA 4Q2KA 3S9BA 1DX5M 2ZPRA 1H8DH 1B0FA 2PV9B 2WSSD 2JJ2D 2BDBA 4OGXA 4FUJA 2LELA 5ESBA 1BRAA 3IWMA 1HJAB 3ZZAA 1DT2A 2A5KA 1O3AA 3TNSA 1RIWB 1O30A 3RM0H 1XUFA 1ZRKA 2QN5T 5GWZA 3RMMH 4NFEA 3ZVBA 5L2ZH 1QRZA 3SGQE 1C5RA 4IMZA 1FY8E 2UUFB 3SU0A 1K22H 1EP6A 1GMDG 2FTMA 3H7OA 4B6EA 3K65B 4CRDA 2ALVA 1A7SA 1C5MD 1PPZA 3RXCA 1QB6A 1EASA 1UVSH 4KELA 2PFEA 5DP7A 3ZZ5A 1V2LT 2G52A 2VWLA 4AB9A 1QFKH 1DOJA 2VH0A 1KDQB 3RXFA 2WZQA 4ISNA 5ESTE 2B5TB 4YT7H 3DT0H 1O33A 4BTIB 1D3DB 3I78A 1O3PB 3QTOH 2FEQH 4ZKNU 1A3EH 5JBCS 2GZ7A 5EJLA 1C4Y2 1EATA 2SGQE 2FLRH 2IPQX 2HGTH 1RIWC 2J94A 2H5DA 3TGKE 1GHBG 4K1TA 2I6QA 3TJVA 2QF4A 3SV9A 2XOKD 1OYQA 2ZCLP 1LHDH 1QBVH 1AKSB 3BTQE 3MO3A 3GDVA 1E37B 1BIOA 3PYHA 1SSXA 1HAZB 4I8HA 4RKOB 1T4UH 4YOIA 2QY0B 3VB3A 4FU8A 3LJOA 1BUIA 3BTDE 4ZCNA 2SGPE 2W6ID 4X2WA 6GCHF 1A61H 2O8WA 1WOFA 3I77A 1SQRA 3GY2A 3RU4T 1XVOA 3M37A 1L1JA 4ZKOU 1AVGH 2AGGX 1SGEE 4HGCA 1PQ7A 4AX9H 1KXAA 4X0WU 1Z71A 3GDSA 3MU0A 1PPFE 3S9AA 1DFPA 4MDSA 2GCHF 5T6DA 2ZI2H 1S84A
chains in the Genus database with same CATH topology
3MNCA 1VCQA 3SNBA 2FI3E 3Q00A 4KKDA 2ZKSA 3MOCA 2XCNA 1O5EH 4DVAU 3AVZA 1BTXA 1LVMA 1TB6H 2FS8A 3ATIA 1AHTH 3TK9A 3ENSB 1AMHA 3TH4H 3GCHB 2EA3A 3FVFB 3NWUA 3SU5A 1SGIB 1O0DH 3M35A 5HMAA 2YOLA 2R3YA 2V0BA 2J38A 2A2QH 1OP0A 2Y5HA 3V3MA 4I7YH 5CMXH 4MNYA 1O3HA 4A7IB 3KF2A 1AD8H 4J1YA 2HNTC 5FPYA 4X2VA 4BAQB 2XC5A 3P95A 1NFWA 1ABIH 1AFEH 1V2KT 1M9UA 1OP2A 1AE8H 2PWXA 3PMAB 3SHCH 2PTNA 3BN9A 1PYTD 1TQ0B 2AEIH 3QDZB 2AERH 4K60A 3GISB 3KCGH 1ETSH 5DGJA 5E8EH 1JRTA 4CH2B 1O2JA 3GCHC 3S7KB 2PLXA 3MI4A 1K21H 1O2RA 3V0XA 1GI2A 2TGAA 4JCNA 1IQJA 4INHA 1MKWK 3RXKA 1GBLA 3F9FA 4AGJA 1ZPZA 2BDAA 2AIPA 4NGAH 3KHVA 1MMJN 3PB1E 2JH6D 4AG2A 1QJ6B 2GGVB 4LZ4B 3GDUA 3RXTA 3BIUH 3EYDA 1NFXA 3SJ8A 1ETRH 2WPLS 1BTPA 4A5TS 6GCHG 2RG3A 1A2CH 2UUKB 4LK4A 3A88A 1SLVB 1TONA 1Y3XA 1UVUH 3GYLB 2WUCA 4HZHA 1DANH 1V2QT 4MPWA 4UFEH 3ESTA 4WXVA 4X1SU 1QB1A 1XUJA 1GHWH 2Q6FA 2R2MB 1MCTA 2WYJA 2C8YB 1XVMA 4NZQA 3H7TA 1TGSZ 1EB1H 3A7TA 4GSOA 2PSXA 1GCTB 5A0BA 1UTKA 1P05A 1S6FA 4F4OC 1NC6A 2GCHG 4JMYA 1PPGE 2G81E 1UCYE 1OOKB 4E7RG 3RXGA 1KXCA 4ZMAH 1F0TA 2Z9KA 4XBCA 1O2SA 1K28D 2XBVA 2YNAA 4H4FA 2Z3CA 1PFXC 3A8CA 1NU7B 5GJ4B 1UTLM 3B23B 3V13A 1A5IA 1O2UA 1UTOA 1BB0B 1TNGA 5EOKA 1EOJA 1BHXB 1BJUA 4ISHH 5C20A 3ATKA 2FOBA 2BX3A 1P04A 4XBDA 1P2JA 1NRQH 1BJVA 2BD7A 4M7GA 1YPJH 1BBRE 1CHOG 7ESTE 3L6PA 3KQBA 1ELCA 2W26A 1DM4B 3PM3A 1FY3A 3S0NA 3EAJA 1QBNA 3SO3A 2AGEX 1A0LA 1BMMH 4IN2A 3ZZ9A 3DFJA 2ANWA 4X6MA 2A5IA 4DOQA 3AASA 4H6TA 4TY6A 4BTUB 5C5NA 2UUJB 1GJ7B 2CMYA 3CS0A 3LH1A 4ZXXH 4A1XA 3Q76A 2CF8H 1C2GA 4BAHB 5JBAS 2XC0A 3SORA 1O3KA 2ZU5A 2BY5X 3F1SB 1SGRE 1NM6A 4CHAC 1IQGA 5LPRA 4RSPA 2UWPA 1LHFH 2F9OA 4MPVA 5JB9S 1GBJA 2XBXA 4WWYA 1QHRB 2VWNA 1IOEA 1C5VA 1ANCA 5EW1H 1O5AB 3ZZBA 2RCEA 3IITA 3ZZDA 1MAYA 1W13U 3T26A 5ABWA 3MHWU 1O3EA 5E0HA 1OPHB 1FPCH 3NXPA 1Y3VA 3U8RH 5HXFA 1P12E 2FP7B 1G3DA 3IG6B 4NG9H 1GBBA 4ZKSU 4R0IA 2TRMA 2OQ5A 1ESAA 2STAE 3ATLA 3M36A 1GI1A 2G8TA 3H5CB 4ZAEA 3VB5A 1UMAH 3U1IB 2FOHA 2VIQA 4BAOB 3HKJB 3TJOA 5A8YA 1FY5A 1F5LA 1QGFA 4ESTE 4ISOA 1IQLA 3PTNA 4BXSA 2NU0E 3RXSA 3STIA 4ZUHA 2XCFA 1HGTH 3WY8A 1XUHA 1C5NH 1GGDB 1DUAA 2OC8A 2PKAB 2HPQH 1EOLA 3TH2H 1V2ST 3T5FH 1FDPA 2TPIZ 1P2OA 2DE9A 4HTCH 3C27B 3Q77A 5IDKA 4ZH8A 5F03A 2VGCC 1H9HE 1DDJA 2A4RA 1AUTC 4Q7ZA 4NFFA 2BDHA 3MYWA 2ZU1A 3DA9B 1LKBA 3GOVB 3M3SA 5GDSH 3TNTA 1WSSH 1SQOA 1EP5A 2F9VA 3SU4A 1V6DA 2Y7ZA 5DG6A 2ILNA 1O34A 2Y82A 1CVWH 2XNIA 1LQDB 1YYY1 5AF9H 1D4PB 1JIRA 4FVDA 1RRKA 4I8GA 4O3TA 2VIVA 3G01A 4WMDA 1GI0A 1F0UA 1C1VH 2RA3A 1SGFG 5EQRA 5C3NA 1EJAA 2B0FA 3RXDA 1GJDB 4B2AA 1H9LB 1WQVH 5L2YH 2GX4A 3M5OA 4JZFH 4FXGH 3QX5H 1EZXC 3UNSA 3RXMA 1O39A 1ARCA 1AKSA 3P17H 2OD3B 1ZSJA 1KLIH 1SLXB 1XX9A 1SLWB 1AVXA 2GKVE 1EAXA 1O2HA 1AFQB 2FS9A 2BZAA 1MZAA 3T27A 3GY6A 1C1TA 5GCHF 4AYVB 2TBSA 1OS8A 2OC1A 1C1OA 1ZRBA 2YNBA 1O2GH 1MBQA 2TGTA 1GBTA 1OXGA 1Z6EA 4NIWA 3ZV8A 1C4U2 5EQSA 1GPZA 1QTFA 2Z3DA 1GG6B 1WUNH 1XXDA 1CO7E 2BD3A 1ANEA 2FOFA 2JH5D 4Y8ZA 5FPSA 4CBNA 2WUBA 1XXFA 3VEQB 4NIVA 5GPIB 1EJMA 1GHAF 1DWDH 2FOCA 1IQEA 3BTKE 1ZR0A 3AAUA 2A7CA 2VINA 3GY7A 5EGMA 1E0FD 1NRRH 2OLGA 4AOQA 1HJ8A 3UTUH 3P70B 1YLDA 2O8UA 4AZ2B 1LKAA 1EAUA 3LJJA 2ZTZA 5H4IB 1YC0A 1D3TB 5HM9A 2TIOA 3U1JB 4LXBH 1QQ4A 1ZLRA 3E16B 2WPHS 1GJ6A 2J4IA 2ZQ1A 1UK3A 1V2PT 2UUYA 3UNRA 2Z6BD 5F6MA 2D2DA 3E6PH 4WMFA 1GG6C 1BBRK 1SFQB 2W7SA 2AIQA 2VVUA 1INCA 1FNIA 4FUHA 2GV7A 2OXSA 2BY8X 3B8JA 5TCAA 2G5VA 3SJOA 1IHTH 1O3FA 2ODPA 4IN1A 2SFAA 4NIXA 1P02A 3LH3A 1AZZA 1SGNE 1DWCH 1A3BH 2OQUA 4K2YA 2R9PA 2Y7XA 1AWFH 1SOTA 4THNH 2GVFA 1Y59T 1KXDA 1G37A 4ABGA 2CJIA 4J2YB 1QRXA 4TPIZ 1CQQA 3ZVGA 2ZZUH 3DD2H 3E90B 2XXLA 1CGHA 1KXBA 5DP9A 2JETB 2ZECA 2P3FH 2SNVA 1SHYA 2QXIA 1GL1A 1MUEB 1DS2E 1Y8TA 1HFDA 5F8XA 2ZHFH 4FUFA 3TJNA 4I8JA 4TWWA 4MNWA 1ID5H 3QZRA 2GCTB 1W0YH 3V7TA 4CBOA 1E38B 2JKHA 4DCDA 1TNJA 5FAHA 1C2DA 1SVPA 1T4VH 2G55A 3L3TA 4WF8A 1F5KU 2BY7X 3BEIB 9LPRA 8LPRA 2A7HA 4Y11E 1L1NA 1VITF 1QBOA 4JK6A 3RC5A 3UY9A 1SQTA 2H1UA 1MTSA 4JZEH 3SU3A 3MTYA 4ZKRU 2SNWA 2Z9GA 2FZZA 2ZTYA 1ORFA 1MAXA 1O2QA 3VB4A 2JETC 2IJOB 1AU8A 2BVXH 4FVBA 1TBRH 1EB2A 2P3UB 4ABAA 1D3PB 1DWBH 2K1QA 4K8BA 1THRH 1HXFH 1Q31A 2A1DB 3STJA 5C1UA 2GCTC 8GCHG 3ATMA 4WJG2 4NA7A 2BVSH 3GICB 1O2TA 2B7DH 4ISIH 4OS7A 3GY5A 1FQ3A 1UTMA 4CRGA 1ZPCA 4LZ1H 1OWEA 1C5LH 5LPEA 3BG8A 1UO6A 1TRMA 4H42U 1TBQH 2W7UA 3DUXH 1YLCA 3SQEE 4X1RU 1SMFE 2FMJA 3VXFH 1BMAA 4YTAA 1C2MA 4X1PU 1AQ7A 1G2LA 3I29A 4UE7H 2QXGA 1K1NA 2FI4E 1C2LA 1ZGVA 3BEFB 4X2XA 3TJUA 5DJ7A 1FI8A 2LPRA 3EDXB 1DITH 1RJXB 4YOJA 2BMGB 1CHGA 3LGTA 4X1QU 2R2WU 1NTPA 2STBE 3QWCH 3RMOH 3NK8A 1ZMNA 1FV9A 1XMNB 4E06H 2J2UA 1GMCF 4NWLA 3TLOA 1Y3UA 1IQHA 5FBIA 1UVTH 4ISLA 3MH4A 2QIQA 1Z1JA 5EXNA 1TMTH 2BD9A 1TGCA 2OBOA 5DP4A 4UFGH 2GZ9A 1HAVB 4WY3A 2WV4A 2NWNA 2ZGHA 3QO6A 2PW8H 1ANDA 2BD5A 5TJXA 4IW4E 1G36A 5F8TA 1ZJKA 3RXPA 2SGFE 4YLQH 3A89A 1CT4E 2D26C 1HXEH 3W94A 1TOCB 2XRCA 2P59A 5EU8A 1MQ6A 3M7UA 5B6OA 1ZHRA 2A31A 3LGUA 4CRAA 3E0PB 4DIIH 1BBRH 1E35B 1YPKH 1DUEA 3O8CA 1K2I1 1TA6A 3BTGE 3OYPA 1JBUH 1WCZA 1NZQH 1WBGB 2Y80A 5GXPA 1ETTH 1RD3B 2ZDMA 1ELTA 1GHVH 1NT1A 2ZC9H 3F6UH 1C2EA 3K6YA 4XOJA 4XDEA 1C2KA 2C8XB 1IHSH 3PO1B 4GHQA 1O2KA 1S0RA 1O2MA 2PKAA 1C5PA 4FU7A 1V2TT 1W2KH 1C1WH 1D6WA 3LC3A 1O2XA 1Y5BT 4K5ZA 4XSKU 1EX3A 1GMHF 1H1BA 4X1NU 1ELDE 2BDIA 4Q7YA 4O97A 3EA8A 1YP9A 4ZROA 1YCPM 1NESE 3BTHE 1H8IH 3UR6A 1GI6A 4CH8B 2LNCA 1GDUA 1TALA 1KTTB 2PUQH 1N6XA 2GMTC 4SGBE 3KEEA 3NZIA 2F9UA 2A4QA 3PWBA 4CRFA 1FAXA 1N8OB 3RU4E 1PPCE 4AFZA 1DVAH 4JZIA 5T3HA 4WVPE 3JZ1B 3LKWA 1S81A 1Z6JH 4X2YA 4AFSA 5A8XA 1P11E 1V2UT 1EXFA 5JB8S 1QQUA 4Y6DA 3LGWA 1GMCG 3PO1C 4LOYH 4YLUA 4CRCA 1FXYA 2BLVA 1SPJA 1GHZA 4OS1A 1NRPH 4BANB 1C5ZB 4X8TH 3E8LA 1AVWA 2FYQA 3PTBA 4K69A 3GY3A 1YPHE 1X7AC 1O3IA 1TBZH 2EI6A 3SJKA 1QL7A 2Y81A 1CT2E 3ODFA 4ABHA 3ZVAA 4X8SH 1A1RA 2Z9JA 4PROA 2QV1A 3MFJA 1DWEH 1FAKH 2PKSB 3QN7A 1AY6H 1C5XB 2FM2A 1P3CA 1V2OT 3SGBE 3RXOA 1C2HA 1ESBA 1N8OC 2EC9H 1NROH 3P8GA 1JIMA 1A4WH 3FP7E 1NRNH 2ZGBH 1QB9A 1UK2A 4HI3A 2SGAA 1JRSA 2QC2A 5BRRE 1LTOA 2G4UA 1SOZA 2UWLA 5PTPA 2AS9A 1GI9B 4X6NA 3BF6H 2BLWA 1MBMA 1C1QA 1TWXB 2BXUH 3ZYDA 2DUCA 2KAIB 1SL3A 3PWCA 4ZHMU 4CHAB 4AB8A 2FOAA 5LGOA 2OC7A 2O8TA 2A5AA 5L6NH 1YPMH 2BQ6B 2PKSC 4OS5A 1PPEE 1C5YB 1EKBB 3EE0B 4KTSA 3VGCC 3A7VA 3ZZ6A 1CGIE 3VB6A 2WPJS 1FN8A 1CT0E 3RMLH 1FLEE 2ZHWH 4FUIA 1N1LA 4YM9A 3K2UA 1FUJA 3S69A 3PMHB 2HWLB 2ZDLA 1T8LA 4AG1A 1TGNA 1WU1A 3PV4A 1F7ZA 3PLPA 4X6PA 1NU9A 2A32A 2G51A 2GDDA 2NU2E 1SBWA 3M7TA 3SU2A 1O2WA 1BTYA 2PHBA 3RP2A 3P8FA 3LPRA 1HJ9A 3SHAH 1GBCA 1SGFA 2FYRA 1C5QA 1P06A 1UTJA 1DY9A 1BOQA 3URCA 3EA9A 2AFQB 4IBLH 3RM2H 1LPKB 1XM1A 4JZ1A 1HUTH 2QA9E 2VIDA 4DGJA 3EA7A 2JH0D 1O2PA 3E3TA 1A0JA 1BMLA 1U6QA 3F9GA 1A46H 3DFLA 4JYUH 1P0SH 1VJ9U 1FIWA 5CHAC 1HYLA 1SG8B 4GPGA 4ASHA 5C1YA 1K1IA 1GVLA 4F49A 5E2PA 3M5MA 7GCHF 1BA8B 1CA8B 2Z9IA 2ZGJA 1ZJDA 3RXIA 2VGCB 2Z9LA 2P8OB 1O35A 1BMNH 1H9IE 2FDAA 4U32A 1J9CH 4DW2U 2J9NA 4A1VA 5L30H 3RLYH 1DSTA 1HAOH 1DSUA 1G3EA 1Z8JB 2OUAA 4YOGA 4ZXYH 2RA0A 3BEUA 2ZDKA 5TCCA 1FY1A 1P2QA 1ZTKA 4JYTA 4ZHAA 5FX5A 1LVOA 4K8YA 1YGCH 3W95A 6LPRA 4IS5A 1O37A 2FWWA 3SI3H 3U69H 5C1XA 1RS0A 1W8BH 3A8DA 3MNSA 4INLA 1GI5A 2BDCA 2GD4B 2NU3E 5IYTA 4ABFA 1O36A 4WXIA 5K7RA 3A87A 1MKWH 4D7GA 5A0CA 2PGQB 1Y3YA 2WYGA 5HYOA 3FP8E 4NA9H 1ZMLA 3BV9B 3U9AH 2VWMA 4MLFB 3TK5A 3AAVA 5FX6A 4X8UH 1S6HA 1K1MA 2P8OC 3SNDA 1D9IA 1ZZZA 1Z8RA 1O5BB 1TLDA 3ZVDA 4CR9A 3SNCA 3F68H 1OKXA 1G9IE 5EPYA 2GDEH 1GJ8B 5AHGH 1YPGH 3ZVFA 1ZTJA 1J16A 1Z8IB 3A7WA 4O3UA 1NFYA 1O2YA 1L1GA 2PSYA 2OTVA 1YPHC 1UTPA 1GBIA 2SGEE 3M5LA 4VGCC 3DHKH 1GBKA 2ZU3A 6CHAB 2V6NA 2AGIX 2BYAX 1CA0B 1MTWA 4E7NA 1BZXE 4B2CA 3SGAE 2TGPZ 2ZA5A 2BY6X 1O3BA 2PR3A 3MWIU 1T8OA 1YBWA 4Y0ZE 3D23A 3ZVCA 4AFUA 1QA7A 1LMWB 3A8AA 1GI3A 4QT8C 1MTUA 2R3UA 1KY9A 1GI8B 1XUKA 1SC8U 4I8KA 2ZFQH 4DY7B 2ANYA 2QXJA 3ODDA 2PGBB 1EQ9A 4JYVH 4B75A 3UWJH <