4GVUA

Lyngbyastatin 7-porcine pancreatic elastase co-crystal structure
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title Potent elastase inhibitors from cyanobacteria: structural basis and mechanisms mediating cytoprotective and anti-inflammatory effects in bronchial epithelial cells.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 62
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gvuA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4gvuA01
1OYTH 4FUFA 1EZSC 4CRCA 1LCYA 1RD3B 3DHKH 3LOXA 1YGCH 2XC0A 2WV4A 3S7KB 3RXIA 4MG3A 1O2XA 1LPKB 4DG4A 1C1VH 1H4WA 4JMYA 4OS4A 4K1SA 4Y8YA 1HAXB 2ASUB 3Q3KA 3ODFA 4AOQA 5EG4A 1UVTH 3QZRA 1LHGH 2QF0A 3P8OA 1GBJA 3U1IB 2R3UA 3PWBA 1VITH 2P3UB 1TWXB 1LKBA 1OS8A 1EPTA 1BITA 1CSOE 1NROH 4KELA 2Y7XA 2ZFPH 4KTSA 1C5RA 3KN2A 5JBAS 1OP2A 3SV6A 2V3OH 1FY5A 2FX4A 4ZHMU 2Y81A 2GT8A 1UK4A 2XNIA 3EA8A 3FFGA 5C20A 1PQ7A 2VVVA 4NG9H 4I8KA 1FPHH 1P2KA 3LPRA 4JCNA 4YOIA 2TPIZ 4ZKSU 3QWCH 2F9PA 3ZZ7A 3VEQB 3EA9A 2VIQA 3PLBA 1QR3E 2QA9E 1NFXA 2H6MA 3TH3H 3V0XA 1C5WB 1L1GA 4NFFA 1QFKH 1C5LH 1Y3WA 2Q6DA 3S69A 4E06H 4MNWA 2QY0B 2AGEX 1LMWB 3FP7E 1AY6H 2G00A 3SN8A 1IHTH 3F1SB 2Z9LA 4NIYA 1G30B 4ZAEA 1MBMA 1ELVA 1O35A 4Q7YA 5E2OA 4XBBA 5TCAA 1OWHA 1SL3A 2HNTE 2GT7A 2FDAA 3SU1A 1P09A 1A46H 2HNTC 5T6GA 2ZG0H 3TK5A 1Z8RA 3SNAA 1SB1H 3RXFA 3EAJA 1KIGH 3LH1A 1MD8A 1RS0A 3HATH 3TNTA 1SLXB 1TRMA 3KQBA 1QA0A 3RXVA 7KMEH 2CV3A 4ZXXH 3SHCH 2FOGA 3T25A 1T7CA 2Z6BD 3SI3H 1XM1A 2GCHF 4DGJA 4MNXA 5GCHF 5E8EH 2FS8A 1DWDH 2F3CE 1OYQA 3RXMA 4B71A 2BVXH 1HCGA 3NCLA 2IN2A 1K1IA 5FXLA 4A1XA 1GHWH 1DVAH 4AYYB 4JK5A 2J34A 3VB5A 1A3BH 3R0FA 5FPSA 1FAXA 1DSTA 1FIWA 1TLDA 5ESTE 1SR5C 2VGCB 3K9XB 2P93A 5ABWA 1MTNB 4K8BA 2WUCA 1O5GH 3BEUA 2PKSB 3DFJA 7ESTE 2BY7X 3ESTA 2XC4A 3ZVBA 2K1QA 1GHVH 4FVDA 2XXLA 4ASHA 1AWHB 1GVZA 3SORA 2W7SA 1K21H 2OC7A 2W3KA 1IQMA 1UTLM 4VGCC 1Q3XA 1HPGA 1TBRH 3MO6A 3BEFB 3SU0A 2O8TA 3LIWA 4Y8XA 1P8VC 4Y7AA 2G4TA 1YPEH 4B2AA 1BBRH 2GKVE 2Y5GA 2YNBA 2BYAX 1NO9H 1XKAC 2YNAA 1N8OC 2A0QB 4U2WA 1MKWH 1BTZA 3Q3YA 3URDA 3A7XA 3SU5A 1V2LT 1QRXA 3BG4C 4JYUH 1D6RA 1W12U 3E1XB 1ZTKA 2GD4B 1L4ZA 1GBCA 1GDUA 1V2ST 5C3NA 2OQ5A 1C2FA 1KXCA 3F9GA 4K3JA 3BTGE 1LO6A 3WY8A 1MD7A 1G32B 1YBWA 2BDAA 3RXPA 4BAQB 2TBSA 1ANBA 2OXSA 2GZ7A 3ZZDA 4D7FA 2A31A 1G3EA 3PLPA 1BRCE 1C9PA 1TQ7B 4X6PA 3BG8A 3M5OA 1E35B 3TH2H 1C9TA 2OC0A 1HJ9A 1ZHRA 1NFUA 4FU7A 4NWKA 3SV7A 1VCQA 3UWJH 1AB9C 1EASA 3MH7A 1C4U2 2ULLA 2UWOA 4KTUA 1P3EA 2FOHA 3SJ9A 4UONA 1MH0A 1YCPH 1E0FD 3QLPH 1ELGA 4KGAA 1VITF 3MH6A 4I8GA 1YM0A 1AGJA 1GBEA 2C8XB 2ZTZA 1AIXH 4I32A 1CGHA 4Y0ZE 2BY5X 3S7HB 3ZZ4A 1TPPA 1O3CA 4A1TA 3CS0A 4KP0A 1O2PA 1ELTA 1EPTC 1Y3YA 1K22H 1VGCC 3U98H 3B9FH 1BMLA 4OS2A 1ETTH 4DIIH 5E0GA 2ZGJA 1ANEA 1LDTT 4IGDA 3ZZCA 2XWBI 4UEHH 1FY1A 2GGVB 1P11E 2J94A 2A2XH 4I8HA 3O8CA 2WPKS 3DT0H 1ZOMA 1SGYE 5A0BA 1ZMNA 1TALA 2UUFB 2P59A 2ZGBH 3LJOA 1TX7A 5EGMA 3GCHB 1O5AB 4UFEH 4NSVA 4JZDH 5CHAB 4WH8A 1CHOF 1UVOA 3SNBA 2DUCA 5EOKA 5JB8S 1W2KH 3EGKH 1XXDA 6ESTA 1GMHG 2G52A 1QCPA 2RG3A 2D2DA 2VWMA 3SHAH 1C2JA 2Y5FA 3UWIA 1TNHA 5GJ4B 1YPMH 1THSH 1TRYA 4FU8A 2Z9JA 1MAXA 3A84A 2FOFA 5F03A 2ZU5A 1TX8A 2R2MB 1GHBF 2AMDA 3LGUA 4AORA 3NZIA 3A8BA 1SGIB 4WVPE 1DANH 5AF9H 1THRH 1XXFA 1T8LA 3GY8A 4AFZA 4TPIZ 2H5CA 3H7TA 3BEIB 1MAYA 1FV9A 5DGJA 1GDNA 2ZDAH 3RM2H 3K65B 2VIDA 3QTVH 5JBCS 4YT6H 1TNGA 5LPEA 1MMJN 1UTPA 1QRZA 3PTBA 2QAAA 2KAIB 4I8JA 3S9BA 1CT0E 2VWLA 2PKAB 2GX4A 4AFUA 1KY9A 3SNCA 2BY6X 3TJUA 3U8OH 4QT8C 2A4QA 3M36A 4F4OC 5L6NH 1GBTA 1AHTH 3EQ0H 2FZZA 5E0HA 1XUFA 3TNSA 2B8OH 1O5CB 1A0LA 2UWPA 2HALA 1EXFA 2BD8A 2J2UA 5JDUB 4BAKB 1S83A 2QN5T 3FZDA 4YZUA 4YTAA 3W94A 1O2LA 1O2GH 2AFQB 5JBTA 2EC9H 3P95A 3P6ZB 1O2SA 3LC3A 1HIAA 2VGCC 3D23A 1DY9A 1HDTH 4DY7B 1J9CH 1BTUA 2PKSC 1ZJDA 3GY4A 4ABGA 2ZKSA 3TH4H 3UUZA 4FU9A 4MQAA 2VIVA 5H4IB 4ISNA 2BVSH 3BTFE 1C1QA 1WOFA 4AX9H 1A5IA 1ZPBA 1QA7A 4NFEA 2FYRA 1BHXF 2H2ZA 1QBNA 4E7RG 2CGAA 2ZFFH 1F0UA 1G3BA 3ZZBA 4OGXA 1HAYB 4FVBA 2BLQA 6CHAB 1BZXE 3Q77A 1DUAA 3MO9A 1VCWA 3A85A 1V2KT 5F8ZA 1E34B 3ATIA 1C5VA 2BD2A 3CENA 1OWIA 1ZZZA 1TMBH 3FZZA 2HNTF 1ZSJA 1TGTA 3RP2A 3RXJA 5AVDA 1OWKA 3LGYA 4UFFH 3MU1A 2PHBA 1LQDB 1J8AA 3M7UA 1GL0E 2BD9A 2OQUA 3R3GB 3MU8A 3ATKA 1C5NH 4U30A 2XC5A 1T8MA 1ELDE 4YLQH 1C2GA 3QK1A 5AFZH 2VNTA 1QRWA 2H5DA 2NU1E 1FQ3A 5C5OA 1WQSA 3P8GA 2OINA 1GI1A 2A2QH 4FUIA 1P2OA 3ZVCA 1N6YA 3ZZ6A 4ABJA 1GHYH 1FLEE 3EE0B 2NU2E 4HZHA 2XCFA 3A7TA 3RXRA 4NSYA 4K60A 5LGOA 3SU3A 2BZAA 1IQEA 1KDQB 1SFQB 2SFAA 2GCHG 1A7SA 2HVXA 1Y3UA 1C1MA 1ORFA 1A3EH 1S5SA 3UQOA 4BTIB 2P3TB 2AGIX 4U32A 4CRFA 1RIWB 3RXEA 1W0YH 2ZNKH 1YC0A 1CE5A 1TNKA 3VB6A 1WTHD 1BQYA 4B73A 1UJ1A 2ZU2A 3L6PA 1YF4A 4ABFA 2G4UA 4Q7ZA 1G3DA 4GHTA 5GPIB 1SQAA 1BBRK 2ZECA 5BRRE 9ESTA 3E16B 5C1XA 5HYOA 2BDHA 4CRAA 3A81A 4AB8A 1ZRBA 1W7XH 1Q31A 3U8RH 1ZPCA 1TGCA 3F68H 4THNH 2A1DB 4RKOB 3E0PB 3OU0A 2Y7ZA 4NIXA 3RU4D 1O3LA 2C8ZB 1O3AA 2J4IA 1SLUB 2SGPE 1C1OA 3GCHC 1K1LA 4WXIA 1MCTA 3NUMA 2XTTB 3ZV9A 4MPXA 1IQLA 1AI8H 4M7GA 1EX3A 4DURA 3ZZAA 1O3FA 4CBOA 2R2WU 1SOTA 3RXOA 1O3EA 8LPRA 1N1LA 1BRAA 4B76A 5GWZA 4O3UA 1HYLA 3IG6B 3RMNH 1P2IA 4WF8A 2F91A 1S6HA 3ZVFA 1GI2A 2TGDA 4UD9H 3T62A 4UFGH 4Z6AH 5EXLA 2ZTXA 1EKBB 5T3HA 1SOZA 1ZSLA 1ARBA 3VB7A 4A6LA 4B2BA 3ENSB 1YCPK 1ANDA 4HTCH 2BZ6H 4ESTE 1HAHH 2ZU4A 1BTYA 3BTHE 1O3MA 4NWLA 2H9EH 4ZHLU 1GBBA 1XUIA 1BTXA 4X1PU 1TGBA 1GJBB 3BIVH 1O2RA 1Z8IB 4O03A 4O97A 3B23B 1EB1H 3GY3A 1L1NA 1SGFA 1E38B 1K9OE 1RGQA 2BB4A 3ATWA 4AGJA 5K0HA 1FONA 1GMCF 2RA3A 3I78A 1TGSZ 1GJCB 2R3YA 5L30H 1SG8B 3M35A 3UPEA 5LH8A 1C5UA 3HGPA 1GJ6A 1GI6A 1TE0A 1ZTJA 1OSSA 2GP9B 3KGPA 3SBKA 2SNWA 1Y5AT 1BTPA 2WUBA 2FESH 2O8LA 3IITA 1QL8A 5A8ZA 1GJ5H 1GHXH 2G51A 1WU1A 3M37A 2RA0A 5PTPA 3GDVA 1BB0B 2A45B 1TA2A 1TBQH 5TJXA 1O2UA 1WCZA 3UREA 1HAOH 4FUGA 4I33A 1GBLA 1IQGA 2F9NA 1D4PB 2CF8H 3HKIB 4CREA 4NZLA 5T6FA 2FODA 1O3PB 2C8YB 1O2OA 3PMAB 1LHDH 3E0NB 1AZ8A 1C1RA 1GDQA 4NA7A 3BTQE 1MTWA 4X1NU 1CHOG 2EEKA 1X7AC 6LPRA 1YPGH 3RU4E 1GBDA 1P04A 1UTNA 3LONA 1AFQB 5DJ7A 1GJAB 3LDXH 1QIXB 2VIPA 3MOCA 5A8XA 1PPEE 2ZHQH 2EA3A 1O33A 3OY6U 2CF9H 4NA9H 6CHAC 2FOAA 1NM6A 4K69A 3RXBA 5T6DA 1GMDF 5FX6A 2OD3B 3JZ2B 1O31A 1BMNH 3M3SA 1KLIH 1GHBG 5DP3A 3G01A 3W95A 3M5NA 1BTWA 2A5AA 3M7TA 3QN7A 4DIHH 2W7UA 4X1SU 1K1PA 5GDSH 6GCHG 1NRQH 4ABIA 1EZXC 1F0SA 2PSYA 3AASA 4X8SH 5FPTA 1V2NT 5A09A 1NY22 1PPHE 1TMUH 2P8OC 1O34A 1O3JA 4IN1A 3ZYEA 1SHYA 1HRTH 3AW0A 4I31A 4Q2KA 3ZVEA 1T31A 2UWLA 1O5DH 8GCHF 3AAUA 3LGTA 4MTBA 3SJIA 1CA0B 1L1JA 1ZHPA 1UTKA 1INCA 1BMMH 2P95A 1HXFH 1QY6A 1P02A 1VCPA 5L2ZH 2B0FA 1DXPA 2ZO3H 3SGQE 2Z94A 1LPGB 1QB6A 2OC1A 2QXHA 3EYDA 2I6SA 1ACBE 1Z8GA 1AKSB 1ETSH 2BQWB 1GVLA 3SGAE 4AN7A 2ZU1A 2QC2A 5EQSA 3T2NA 1PPZA 1P12E 3AW1A 4H4FA 3A88A 1AVWA 3P92A 3OYPA 3RMMH 3E90B 2QIQA 3DD2H 1JIRA 1ZGVA 3A89A 2HRVA 1H8IH 1P06A 1TOCB 3ATMA 1IQKA 1H9HE 3PWCA 1Y8TA 3FANA 3I77A 4WY3A 5F8XA 1TX6A 4UDWH 2UUJB 4B74A 3QTOH 1RFNA 4ISHH 4CR9A 2HLCA 3ZVAA 3T27A 1YLCA 1MCVA 1JRSA 2AGGX 1AVGH 2G8TA 1S84A 3M61U 1TONA 1O2JA 1O3GA 4DT7B 2HPPH 1PQAA 3NWUA 2TGAA 2GDDA 3UIRA 1SGQE 1V3XA 3KHVA 4LK4A 3U9AH 3F9FA 3LU9B 2C8WB 3UTUH 3SUEA 4D8NA 1L2EA 3PLKA 1GI7B 2ZFQH 1Y59T 1CT4E 1H1BA 3JZ1B 4TWYA 4NIVA 2P94A 1GHZA 4H6SB 1UTMA 1P2QA 5A0CA 3F6UH 1W14U 4JZIA 4CHAB 5JBBS 4PROA 1QBVH 1OX1A 4HI3A 4MNYA 3HKJB 5HM9A 5DK1A 4ABAA 1GCTB 2D1JA 1BA8B 2XRCA 2AMQA 1CBWB 1HJAB 1LVOA 1AE8H 1PPCE 1SVPA 1ELCA 4GCHF 4NCYA 2Q6GA 4BAHB 4XBCA 2CHAC 3FVFB 3RXTA 4X8UH 2FLBH 2BM2A 3D62A 3GCTF 1XKBC 2ZHWH 4CRGA 2FX6A 3CS7A 1Z1JA 3GISB 3A83A 1TAWA 2SGQE 4CH8B 3A7ZA 3TIUA 4ABEA 2ZHFH 1D3PB 4X8VH 2JETB 1GI5A 2PFEA 1NESE 4ABHA 1ZSKA 3MU4A 1DDJA 4I8LA 2A4OA 3SJ8A 4WJG2 1ZRKA 3M3TA 1F5RA 2FI5E 1ELFA 1MU8B 3P8NA 1DWCH 1FY4A 5HGGA 4ZKNU 2THFB 4YESB 1BCUH 1UHBB 4O9VA 3U69H 3VB4A 1CT2E 1CU1A 5I25A 1T4VH 1G2MA 1P03A 1Y3VA 1DLEA 1W3CA 2J9NA 1V2UT 4LXBH 1P57B 4DOQA 1W10U 3SUFA 3A7YA 2BMGB 4FUDA 3RC6A 4A5TS 1S82A 2F9UA 1LVBA 1OXGA 1TNIA 2B7DH 4H6TA 4RKJB 5TCCA 5IDKA 1CO7E 1SBWA 2ZDVH 4D7GA 3GDSA 4X6OA 2ZQ1A 1M9UA 2C93B 1O3HA 1O5EH 4IW4E 3A7WA 1Q2WA 1UHBA 2PUQH 4CBNA 3SUDA 1WSSH 1LQEA 1G2LA 1Z7KA 5IYTA 3HK3B 1ID5H 3S9CA 2ZU3A 1ZTLA 1MZAA 4AFQA 3BTWE 4XSKU 1H9IE 2IPHA 1GBHA 4KKDA 4YLUA 1FI8A 1OPHB 4MVNA 1N6XA 2BY8X 3L33A 1SPJA 3MHWU 1KTSB 2C90B 1HAGE 1GVKB 5FHTA 5HXFA 1GMCG 4AB9A 3PMJA 4WMEA 3ZZ9A 4OS1A 1GI0A 4OGYA 1NRRH 3RUOA 3TLOA 3RXSA 3SQHE 3TGIE 1C5MD 2SNVA 3LT3A 1GHAF 2J38A 3VB3A 3MNXA 1D3QB 1ABJH 2A7CA 4K1EA 1CGIE 4X8TH 5GXPA 3RC5A 1WBGB 3PYHA 1TNLA 2Z9GA 5J4SA 2ALPA 3ZZ3A 1O32A 1MTNC 4Z0KA 2WPJS 8KME2 2AIQA 1O39A 2Y82A 3V13A 2KAIA 1YPLH 1MKXH 2C3SA 1MQ6A 1VR1H 1Y5UT 1SLWB 2PKAA 2BLWA 1NU7B 1F0TA 3PTNA 5LPFA 1JMOH 1FJSA 3E91A 4H42U 2A5IA 2XCNA 3ZZ5A 4CH2B 3GYMA 1F2SE 4DCDA 2TIOA 1IQHA 1MZDA 2PGBB 2XBWA 5HM2A 2BLVA 2QCYA 3H7OA 5F6MA 2BQ7B 2ZGHA 1SGCA 4ISIH 1L4DA 4FUBA 1KXEA 1SGDE 2FOCA 4FUCA 3KCGH 3RXDA 2OUAA 2ZHEH 1GWAA 2BD7A 3EDXB 4A92A 2AIPA 2ZDKA 1GGDB 3Q3XA 3I29A 5A0AE 1O3DA 3N7OA 3FP6E 1O38A 4IN2A 3SQEE 4E7NA 5HMAA 2BOKA 1UO6A 1EJAA 4XBDA 1RXPA 2FMJA 2FP7B 1DICA 1GMDG 2BY9X 2FS9A 2XYAA 1GI4A 1FN8A 2R9PA 1WAYB 2ZHDA 4K5ZA 4BNRA 5I46H 3C1KA 2VVUA 2ZCLP 3OTJE 2Z7FE 1NRPH 1EZUC 3LGWA 1SC8U 3BTEE 2SGEE 1SMFE 3VXFH 3SU4A 1LVYA 1F5LA 1C1UH 2FOEA 1V2MT 2OBQA 4GLYA 1UMAH 4R8TB 3GCNA 2Z3EA 1LTOA 2PLXA 1HAVB 3SW2B 5DP7A 4J1YA 1F7ZA 4YT7H 1FZZA 2F9OA 9LPRA 2BD4A 1LHEH 3RXCA 2O8UA 1CBWC 2PUXB 5GCHG 5K7RA 2ZCKP 5AFYH 3O8DA 1MTUA 3SU2A 2V3HH 3PO1B 2VVCA 4MPWA 2W26A 1A5HA 2STAE 1C5XB 3O8BA 1V2JT 2RCEA 2JKHA 2FI3E 4OS6A 1DY8A 3BTDE 3RMLH 1HAIH 1XUKA 4B75A 5L2YH 2CMYA 5ESBA 2EI7A 2ZGXH 2R0KA 7LPRA 2IOTA 1ANCA 2XBYA 2ZPQA 1ARCA 3MFJA 3T5FH 4XDEA 4Y6DA 2D26C 1O3NA 3GCOA 3MH4A 2XBVA 3ODDA 1TIOA 1KDQA 1C2LA 4ISOA 1UCYH 5GIBA 5EU8A 4X2VA 1SQTA 5CHAC 3ITIA 1NFWA 1A61H 4Y79A 2ZWLH 1MQ5A 1MTVA 1V6DA 1W7GH 4AYVB 4BANB 3MU0A 4WH6A 1LPZB 1N8OB 4MNVA 1C5TA 3SNEA 3BF6H 1O2MA 3PB1E 1W13U 2R0LA 4MDSA 2V6NA 2Q6FA 3FP8E 3SZNA 2ANMH 1XUJA 1EJNA 3BG4B 2VIWA 3MTYA 1CA8B 3MU5A 3E6PH 3A80A 1TFXA 1DITH 5J4QA 3TJOA 1EAUA 1AWFH 2VWNA 1EOLA 4GAWA 5C5NA 2NU0E 1V2OT 4MLFB 1BRUP 4HFPB 1JIMA 2PSXA 4SGAE 3TJVA 3VGCB 1SHHB 1O2IA 1TBZH 2Z3DA 2DE8A 2B9LA 3P8FA 1FPCH 1PJPA 2WYGA 2ZEBA 2PR3A 3TITA 1BTHH 5C2ZA 2HOBA 1O2KA 1QL7A 3ATLA 1K1MA 4K2YA 2BLOA 5CMXH 2Q1JA 1AU8A 2PW8H 1DM4B 2FLRH 3QO6A 1O37A 3AVZA 3A8AA 1AB9B 2STBE 3T28A 1IQIA 1T8OA 4X2WA 1VITG 1GBAA 1YKTA 4GCHG 1EP6A 2SGAA 5C67A 5DP4A 1NN6A 1YLDA 2FTLE 2Z9IA 4IMZA 1KLTA 4DVAU 3VXEH 4Y0YE 3GCTG 4U01A 1B0EA 1GJDB 1T4UH 3A86A 3MWIU 4GHQA 1THPB 2GCTB 1UVPA 1C5QA 4WXVA 2TGPZ 1EPTB 2BQ6B 2V35A 1Z8JB 1DX5M 1GL1A 1KSNA 1C1WH 1C5PA 3GY7A 4K8YA 1O2TA 2BD3A 4A7IB 1WQVH 4BXSA 4GPGA 2SGDE 2XWAA 2HWLB 2WYJA 1GI8B 1MUEB 1NC6A 1DFPA 4AGKA 1O2NA 5JPMH 5DPAA 1P2NA 1T32A 1W8BH 3K6ZA 7GCHF 1P9SA 2ZFTA 4YM9A 2OP9A 2QGRA 2FM2A 3QDZB 4LOYH 3AAVA 2W3IA 4GVUA 2H9TH 5FCKA 1DUEA 3TGKE 1EATA 3KIDU 1EAIA 1HB0B 1L0ZA 1DE7H 1EQ9A 3E3TA 1KYNA 1UK2A 1Z1IA 2CJIA 2SGFE 4X6MA 1GGDC 1EZQA 1G3CA 1JWTA 3UNRA 1TABE 1C1TA 1BUIA 1VZQH 3Q00A 1ZMLA 1V2VT 1P3CA 2Z3CA 1EP5A 4JYVH 3URCA 2G5VA 1NTPA 1O36A 1SQOA 4MPVA 1EB2A 1Z71A 3SOSA 4FUHA 1GI3A 3UFAA 1BDAA 3Q76A 5FAHA 3BSQA 3QUMP 1FIZA 3NK8A 1O2QA 2PV9B 2BDIA 1SGEE 2FPZA 4WMDA 3O8RA 2ZFRH 1TYNA 3UQVA 3LGIA 4X0WU 1AQ7A 4OS7A 1O2VA 1K1JA 1O3KA 1A0JA 1AZZA 4X1RU 2VH0A 3RXAA 3GY2A 2ZFSA 2GZ9A 3F9HA 4SGBE 1O2HA 2GV7A 4YO9A 3P17H 2EI6A 2PTCE 2ZDNA 1HJ8A 1AVXA 1D3DB 3LH3A 4INHA 3UNSA 2Y80A 2YOLA 1DS2E 1F5KU 3GYLB 4FXGH 4JZFH 2ZIQH 1AMHA 2BXTH 4ZKRU 1S81A 3BV9B 1ETRH 1BMAA 2C4FH 1MKXK 2ODYB 1QBOA 2ODQA 4ZROA 1GHAG 3ELAH 1NS3A 1RIWC 3PO1C 2FI4E 1C5OH 3OSYA 4OS5A 1J16A 2Z9KA 1BJVA 1A0HB 1XX9A 4BXWA 5EQRA 4LZ1H 1GJ8B 2ESTE 2FO9A 2BVRH 1C1NA 1Y5BT 2EI8A 3EA7A 4Q80A 2VJ1A 4ZHAA 2VIOA 1K1OA 2FTMA 4JZ1A 4BTTB 5EPYA 1TPOA 4BOHA 2NWNA 3RXQA 4RN6A 4XE4A 3M5LA 4INKA 4FUEA 3MI4A 1DLKB 3RU4T 3PMHB 3SU6A 1V2TT 4BAMB 1QTFA 3GY5A 2BHGA 1MBQA 1GI9B 3DA9B 1Y3XA 1U6QA 3RXGA 1E37B 1F92A 1C5ZB 2BDGA 1EAWA 1OKXA 1XVOA 4CRBA 1P10A 3RM0H 1XMNB 4BTUB 1AKSA 2PWXA 1MTSA 2FXRA 4XFQA 1IAUA 1FXYA 2QXJA 5A2MH 5E2PA 3TU7H 1YCPM 3MNSA 1CGJE 1O2YA 2PGQB 1DT2A 1HV7A 1O0DH 1QGFA 1BT7A 4UFDH 5EQQA 3MH5A 2Y5HA 2Y6TA 1GJ4H 1B0FA 4D9QA 3NXPA 5B6OA 1LKAA 3OX7U 1ELEE 1YPHE 2FYQA 1YPHC 3TJNA 4TY6A 4IC5A 1EUFA 4AG2A 1V2RT 3VGCC 5DG6A 1AD8H 1G37A 2UUYA 1UVUH 1S0QA 1RTLA 2ODPA 3DUXH 4NZQA 1C5SA 1MU6B 4NIWA 4ZXYH 1Z6EA 1W0ZU 1JRTA 3ZYDA 1GJ7B 5SGAE 2A7JA 4IC6A 5EXNA 3NPSA 4AG1A 4X2YA 2P3FH 4LZ4B 1SGRE 1TPAE 1UTJA 4FUJA 2BDCA 2AS9A 1QJ6B 1OWDA 3KQCA 1XUHA 2ILNA 1P2JA 4X2XA 1NPMA 2M5TA 3MYWA 3RLYH 3V3MA 4DJZB 4AFSA 1QJ1B 2WPLS 2QXGA 2PTNA 3SUGA 2GCTC 1A1RA 1UCYK 1O5BB 3LJJA 2QYIA 4JYTA 1QL9A 3RXHA 1DWBH 3QGJA 3BN9A 2CXVA 1HFDA 1O2ZA 1NRSH 3S9AA 2NU3E 1SGTA 2ZDLA 1FN6A 1O30A 1PPBH 3UR6A 2D8WA 2ZGCA 4IBLH 3BTKE 2GVFA 3H5CB 4TY7A 3S0NA 5FX5A 2GZ8A 3ZZ8A 1SGFG 1EOJA 1IQJA 1NT1A 3T26A 1D6WA 2F9BH 2UUKB 3RMOH 2AMPA 4NA8A 1DWEH 3TVJB 3T29A 2ALVA 2FIRH 1AFQC 3UR9A 2P16A 3HPTB 1GJ9B 5FCRA 1BRBE 3KL6A 1QJ7B 3D49H 1HLTH 1JOUB 5JYIA 1SGPE 1GBIA 1SLVB 1HBTH 1TNJA 3KNXA 3VFEA 5C1UA 3CP7A 1C2IA 3SGBE 2FEQH 3SV2H 3KEEA 3MNBA 3STJA 3GOVB 3STIA 4X1QU 1SFIA 4Y7BA 2BDBA 1ELAA 2HPQH 2ZF0H 1CVWH 5JB9S 3BTTE 2LPRA 1DXWA 4Y11E 3GY6A 1AFEH 1FY3A 2VB0A 2VH6A 4R0IA 1GBMA 3TK6A 2DE9A 2NU4E 1LHFH 1A5GH 1JBUH 2J95A 2ANYA 3HGNA 6GCHF 1KXBA 2FOMB 3UY9A 1SGNE 2BOHB 2B5TB 1FNIA 1HNEE 2GMTB 1GG6B 4MPUA 1HIAB 1KXDA 1QNJA 3PMBB 2A4GA 4ISLA 1HAZB 1FMGA 1ABIH 1CA0C 1O3OA 1NU9A 4B1TA 2RDLA 1XUGA 2O8WA 4TWWA 1UCYE 1PQ8A 1WYKA 4ZH8A 1PQ5A 2ANKH 4A1VA 4CRDA 4CR5A 1DOJA 1P05A 3KF2A 3SJOA 1P2MA 5DP6A 5EODA 3PM3A 1QURH 1RRKA 4D9RA 1IQFA 4HGCA 1KXAA 1RTKA 2I6QA 3LGVA 3KQDA 5FPYA 2A7HA 4ZMAH 1YPKH 1QB9A 2H1UA 1AO5A 3LKWA 1OWEA 1ESTA 3C27B 2O8MA 4BAOB 3PV4A 4YOJA 1CHGA 1H8DH 5DO4H 2WINI 1HXEH 1T8NA 2G5NA 1BJUA 1P0SH 4KTCA 3BTME 5G4BA 1BOQA 1K2I1 3MNCA 3ZVDA 2ANWA 7GCHG 3P70B 1AE5A 1TRNA 3GDUA 2WPHS 1C2KA 4D76A 1GBKA 3RC4A 1CQQA 1PYTD 1FDPA 4ZUHA 3SI4H 1B5GH 2WPMS 1PPFE 2A5KA 3FAOA 4B2CA 5DP9A 5ETXA 1YPJH 3TGJE 4IS5A 3M7QA 1C1PA 1J17T 1E36B 1UVSH 2JH5D 1UTQA 1VJAU 1BHXB 2ZI2H 1VJ9U 1OWJA 1LHCH 2LNCA 1O3BA 1QQUA 1G36A 3VPKA 4UE7H 2GDEH 1TPSA 4J2YB 3UOPA 4E05H 3A7VA 3ZVGA 1FY8E 1AN1E 5AHGH 3RDZA 3RXKA 4CHAC 4DW2U 2J92A 2O9QA 2OC8A 2BDYA 2BXUH 1TQ0B 3ZV8A 2ZPRA 2VU8E 1GPZA 2OLGA 3SO3A 5DKMA 1TB6H 3A87A 3NKKA 1EAXA 4X6NA 3SJKA 1UTOA 1GCDA 4GUXA 1GCTC 3OY5U 2ZC9H 3U1JB 1C4Y2 1ESBA 2P8OB 3M5MA 1H9LB 1HJAC 1PPGE 1K1NA 8GCHG 4I7YH 5C1YA 1KTTB 5EPNA 3LC5A 3K2UA 5A8YA 1TOMH 1IHSH 1TA6A 1F0RA 1HGTH 1NZQH 3UOUA 2GTBA 1KXFA 1UK3A 1FAKH 1RJXB 1ESAA 4F49A 4Y10E 1ZHMA 1C5YB 2A32A 1S6FA 2ZDMA 2GV6A 2ZP0H 1QQ4A 2AH4X 3MO3A 1EJMA 2JETC 4ABBA 1TMTH 5CE1A 1HAVA 1IQNA 2AEIH 1V2WT 2FWWA 3SV8A 2ZCHP 3DFLA 4ZKOU 1B7XB 2TRMA 3KQEA 2ZA5A 5F8TA 2FOBA 3UNQA 2BX4A 3QZQA 1YYY1 2A4RA 5BPEA 3E8LA 5EXMA 1P01A 2ZTYA 1MKWK 1TGNA 4VGCB 1RTFB 1LVMA 1HAPH 4IMQA 1ZYOA 3SNDA 5EW1H 3RXUA 3M3VA 4Q7XA 5DP8A 1HUTH 3F9EA 1W11U 1XVMA 2ZPSA 2H9HA 2IJOB 1O2WA 3TPIZ 4K1TA 1O3IA 1GMHF 1V2QT 2JH6D 2HGTH 1ZMJA 1ZLRA 2QV1A 4NGAH 1NFYA 1ZJKA 4AZ2B 1AUTC 1OP8A 2XBXA 3MMGA 1PYTC 5DP5A 1GBFA 2QF3A 1OOKB 5LPRA 1C4V2 1WUNH 1NRNH 1K28D 2F9VA 2W5EA 3V7TA 1QHRB 1OP0A 3QGNB 4TPYA 1A4WH 1WV7H 5E0JA 1D9IA 1G9IE 1DSUA 1C2HA 4WWYA 3HK6B 3GICB 3U8TH 4INLA 2ZQ2A 1BIOA 2G81E 1DPOA 4WMFA 3TK9A 1ZGIA 8ESTE 3IWMA 4ABDA 2F83A 2AERH 1WTGH 2BD5A 3B8JA 4JK6A 4RSPA 2QXIA 1J14A 5EW2H 5FBIA 4TYDA 1S85A 2BX3A 1P9UA 3PROA 3BIUH 1D3TB 3RXLA 1ELBA 2CN0H 3QX5H 1ZR0A 3A8CA 2OBOA 2BTCE 1QB1A 1SI5H 1YP9A 5FBEA 2GMTC 1GG6C 4O3TA 3A82A 2VWOA 4Y76A 1A2CH 2CHAB 1Z6JH 2XW9A 1C1SA 2OTVA 1C2MA 1C2DA 4GSOA 2G55A 3V12A 1S0RA 1KLJH 1FUJA 1PFXC 3RLWH 4JZEH 2WPIS 2TGTA 1VGCB 2V0BA 4Y8ZA 1ZPZA 3D65E 1J15A 4XOJA 2WV5A 3SV9A 1SSXA 2VINA 4YOGA 2ZZUH 2OCVB 1C2EA 2JH0D 3A8DA 3L3TA 3K6YA 1O5FH 4Y71A 1V2PT 1IOEA 1AUJA 1BBRE 1JXPA 2AYWA
chains in the Genus database with same CATH superfamily
1OYTH 4FUFA 1EZSC 4CRCA 1LCYA 1RD3B 3DHKH 3LOXA 1YGCH 2XC0A 2WV4A 3S7KB 3RXIA 4MG3A 1O2XA 1LPKB 4DG4A 1C1VH 1H4WA 4JMYA 4OS4A 4K1SA 4Y8YA 1HAXB 1S6LA 2ASUB 3Q3KA 3ODFA 4AOQA 5EG4A 1UVTH 3QZRA 1LHGH 2QF0A 3P8OA 1GBJA 3U1IB 2R3UA 3PWBA 1VITH 2P3UB 1TWXB 1LKBA 1OS8A 1EPTA 1BITA 1CSOE 1NROH 4KELA 2Y7XA 2ZFPH 4KTSA 1C5RA 3KN2A 5JBAS 1OP2A 3SV6A 2V3OH 1FY5A 2FX4A 4ZHMU 2Y81A 2GT8A 1UK4A 2XNIA 3EA8A 3FFGA 5C20A 1PQ7A 2VVVA 4NG9H 4I8KA 1FPHH 1P2KA 3LPRA 4JCNA 4YOIA 2TPIZ 4ZKSU 3QWCH 2F9PA 3ZZ7A 3VEQB 3EA9A 2VIQA 4B6EA 3PLBA 1QR3E 2QA9E 1NFXA 2H6MA 3TH3H 3V0XA 1C5WB 1L1GA 4NFFA 1QFKH 1C5LH 1Y3WA 2Q6DA 3S69A 4E06H 4MNWA 2QY0B 2AGEX 1LMWB 3FP7E 1AY6H 2G00A 3SN8A 1IHTH 3F1SB 2Z9LA 4NIYA 1G30B 4ZAEA 1MBMA 1ELVA 1O35A 4Q7YA 5E2OA 4XBBA 5TCAA 3UB0A 1OWHA 1SL3A 2HNTE 2GT7A 2FDAA 3SU1A 1P09A 1A46H 2HNTC 5T6GA 2ZG0H 3TK5A 1Z8RA 2QF4A 3SNAA 1SB1H 3RXFA 3EAJA 1KIGH 3LH1A 1MD8A 1RS0A 3HATH 3TNTA 1SLXB 1TRMA 3KQBA 1QA0A 3RXVA 7KMEH 2CV3A 4ZXXH 3SHCH 2FOGA 3T25A 1T7CA 2Z6BD 3SI3H 1XM1A 2GCHF 4DGJA 4MNXA 5GCHF 1QZ8A 5E8EH 2FS8A 1DWDH 2F3CE 1OYQA 3RXMA 4B71A 2BVXH 1HCGA 3NCLA 2IN2A 1K1IA 5FXLA 2W6JD 4A1XA 1GHWH 1DVAH 4AYYB 4JK5A 2J34A 1NBMD 3VB5A 1A3BH 3R0FA 5FPSA 1FAXA 1DSTA 1FIWA 1TLDA 5ESTE 1SR5C 2VGCB 3K9XB 2P93A 5ABWA 4FETA 1MTNB 4K8BA 2WUCA 1O5GH 3BEUA 2PKSB 3DFJA 7ESTE 2BY7X 3ESTA 2XC4A 3ZVBA 2K1QA 1GHVH 4FVDA 2XXLA 4ASHA 1AWHB 1GVZA 3SORA 2W7SA 1K21H 3FOAA 2OC7A 2W3KA 1IQMA 1UTLM 4VGCC 1Q3XA 1HPGA 1TBRH 3MO6A 3BEFB 3SU0A 2O8TA 3LIWA 4Y8XA 1P8VC 2V7QD 4Y7AA 2G4TA 1YPEH 4B2AA 1BBRH 2GKVE 2Y5GA 2YNBA 2BYAX 1NO9H 1XKAC 2YNAA 1N8OC 2A0QB 4U2WA 1MKWH 1BTZA 3Q3YA 3URDA 3A7XA 3SU5A 1V2LT 1QRXA 3BG4C 4JYUH 1D6RA 1W12U 3E1XB 2V3MA 1ZTKA 2GD4B 1L4ZA 1GBCA 1GDUA 1V2ST 5C3NA 2OQ5A 1C2FA 1KXCA 3F9GA 4K3JA 3BTGE 1LO6A 3WY8A 1MD7A 1G32B 1YBWA 2BDAA 3RXPA 4BAQB 2TBSA 1ANBA 2OXSA 2GZ7A 3ZZDA 4D7FA 2A31A 1G3EA 3PLPA 1BRCE 1C9PA 1TQ7B 4X6PA 3BG8A 3M5OA 1E35B 3TH2H 1C9TA 2OC0A 1K0HA 1HJ9A 1ZHRA 1NFUA 4FU7A 4NWKA 3SV7A 1VCQA 3UWJH 1AB9C 1EASA 3MH7A 1C4U2 2ULLA 2KM0A 2UWOA 4KTUA 1P3EA 2FOHA 3SJ9A 4UONA 1MH0A 1YCPH 1E0FD 5B6LA 3QLPH 1ELGA 2GJGA 4KGAA 1VITF 3MH6A 4I8GA 1YM0A 1AGJA 3CNRA 1GBEA 2C8XB 2ZTZA 1AIXH 2J98B 4I32A 1CGHA 4Y0ZE 2BY5X 3S7HB 3ZZ4A 1TPPA 1O3CA 4A1TA 3CS0A 4KP0A 1O2PA 1ELTA 1EPTC 1Y3YA 1K22H 1VGCC 2WV9A 3U98H 3B9FH 1BMLA 4OS2A 1ETTH 4DIIH 5E0GA 2ZGJA 1ANEA 1LDTT 4IGDA 3ZZCA 2XWBI 4UEHH 1FY1A 2GGVB 1P11E 2IPQX 2J94A 2A2XH 4I8HA 3O8CA 1NBME 2WPKS 3DT0H 1ZOMA 1SGYE 2F4LA 5A0BA 3OFND 1ZMNA 3FO8D 1TALA 2UUFB 2P59A 2ZGBH 3LJOA 1TX7A 5EGMA 3GCHB 1O5AB 4UFEH 4NSVA 4JZDH 5CHAB 4WH8A 1CHOF 4XD7D 1UVOA 5DSFA 3SNBA 2DUCA 5EOKA 5JB8S 1W2KH 3EGKH 1XXDA 6ESTA 1GMHG 2G52A 1QCPA 2RG3A 2KX4A 2D2DA 2VWMA 3SHAH 1C2JA 2Y5FA 3UWIA 1TNHA 5GJ4B 1YPMH 1THSH 1TRYA 4FU8A 2Z9JA 3UAIC 1MAXA 3A84A 2FOFA 5F03A 2ZU5A 1TX8A 2R2MB 1GHBF 2AMDA 3LGUA 4AORA 3NZIA 3A8BA 1SGIB 4Q4LA 4WVPE 1DANH 5AF9H 1THRH 3DSGA 1XXFA 1T8LA 3GY8A 4AFZA 4TPIZ 2H5CA 3H7TA 3BEIB 1MAYA 1FV9A 3F2GA 5DGJA 1GDNA 2ZDAH 3RM2H 3K65B 2VIDA 3QTVH 5JBCS 4YT6H 1TNGA 1E79D 5LPEA 1MMJN 1UTPA 1QRZA 3PTBA 2QAAA 2KAIB 4I8JA 3S9BA 4ACBA 1CT0E 2VWLA 2PKAB 2GX4A 4AFUA 1KY9A 3SNCA 2BY6X 3TJUA 3FKSD 3U8OH 4QT8C 2A4QA 3M36A 4F4OC 5L6NH 1GBTA 1AHTH 3EQ0H 2FZZA 5E0HA 1XUFA 3TNSA 2B8OH 1O5CB 1A0LA 2UWPA 2HALA 1EXFA 2BD8A 2J2UA 5JDUB 4BAKB 1S83A 2QN5T 3FZDA 4YZUA 4YTAA 3W94A 1O2LA 1O2GH 2AFQB 5JBTA 2EC9H 3P95A 3P6ZB 1O2SA 3LC3A 1HIAA 2VGCC 3D23A 1DY9A 1HDTH 4DY7B 1J9CH 1BTUA 2PKSC 1ZJDA 3GY4A 4ABGA 2ZKSA 3TH4H 3UUZA 4FU9A 4MQAA 2VIVA 5H4IB 4ISNA 2BVSH 3BTFE 1C1QA 1WOFA 4AX9H 1A5IA 1ZPBA 1QA7A 4NFEA 2FYRA 1BHXF 4F48B 2H2ZA 1QBNA 4E7RG 2CGAA 2ZFFH 1F0UA 1G3BA 3ZZBA 4OGXA 1HAYB 4FVBA 2BLQA 2JDID 6CHAB 1BZXE 3Q77A 1DUAA 3MO9A 1VCWA 3A85A 1V2KT 5F8ZA 1E34B 3ATIA 1C5VA 2BD2A 3CENA 1OWIA 1ZZZA 1TMBH 3FZZA 2HNTF 1ZSJA 1TGTA 3RP2A 3RXJA 5AVDA 1OWKA 3LGYA 4UFFH 3MU1A 2PHBA 1LQDB 1J8AA 3M7UA 1GL0E 2BD9A 2OQUA 3R3GB 3MU8A 3ATKA 1C5NH 4U30A 2XC5A 1T8MA 1ELDE 4YLQH 3N7DA 3OEHD 1C2GA 3QK1A 5AFZH 2VNTA 1QRWA 2H5DA 2NU1E 1FQ3A 5C5OA 1WQSA 3P8GA 2OINA 1GI1A 2A2QH 4FUIA 1P2OA 3SZEA 3ZVCA 1N6YA 1MABB 3ZZ6A 4ABJA 1GHYH 1FLEE 3EE0B 2NU2E 4HZHA 2XCFA 3A7TA 3RXRA 4NSYA 4K60A 5LGOA 3SU3A 2BZAA 1IQEA 1KDQB 1SFQB 2SFAA 2GCHG 1A7SA 2HVXA 1Y3UA 1C1MA 1ORFA 1A3EH 1S5SA 3UQOA 4BTIB 2P3TB 2AGIX 4U32A 4CRFA 1RIWB 3RXEA 1W0YH 2ZNKH 1YC0A 1CE5A 1TNKA 3VB6A 1WTHD 1BQYA 4B73A 1UJ1A 2ZU2A 3L6PA 1YF4A 4ABFA 2G4UA 4Q7ZA 1G3DA 4GHTA 5GPIB 1SQAA 1BBRK 2ZECA 5BRRE 9ESTA 3E16B 5C1XA 5HYOA 2BDHA 4CRAA 3A81A 4AB8A 1ZRBA 1W7XH 1Q31A 3U8RH 1ZPCA 1TGCA 3F68H 4THNH 2A1DB 4RKOB 1W0KD 3E0PB 3OU0A 2Y7ZA 4NIXA 3RU4D 1O3LA 2C8ZB 1O3AA 2J4IA 1SLUB 2SGPE 1C1OA 3GCHC 1K1LA 4WXIA 1MCTA 3NUMA 2XTTB 3ZV9A 4MPXA 1IQLA 1AI8H 4M7GA 1EX3A 4DURA 3ZZAA 1O3FA 4OM9A 4CBOA 2R2WU 1SOTA 3RXOA 1O3EA 8LPRA 1N1LA 1BRAA 4B76A 5GWZA 4O3UA 1HYLA 3IG6B 3RMNH 1P2IA 4WF8A 2F91A 1S6HA 3ZVFA 1GI2A 2KCAA 2TGDA 2KCOA 4UD9H 4UFGH 3T62A 4Z6AH 5EXLA 2ZTXA 1EKBB 5T3HA 1SOZA 1ZSLA 1ARBA 4TT3D 3VB7A 4A6LA 4B2BA 3ENSB 1YCPK 1ANDA 4HTCH 2BZ6H 4ESTE 1HAHH 2ZU4A 1BTYA 3BTHE 1O3MA 4NWLA 2H9EH 4ZHLU 1GBBA 1XUIA 1BTXA 4X1PU 1TGBA 1GJBB 2LP6A 1O2RA 3BIVH 1Z8IB 4O03A 4O97A 5DN6D 3B23B 1EB1H 3GY3A 1L1NA 1SGFA 1E38B 1K9OE 1RGQA 2BB4A 3ATWA 4AGJA 5K0HA 1FONA 1GMCF 2RA3A 3I78A 1TGSZ 1GJCB 1YLNA 2R3YA 5L30H 1SG8B 3M35A 3UPEA 5LH8A 1C5UA 3HGPA 1GJ6A 1GI6A 1TE0A 1ZTJA 1OSSA 2GP9B 2XOKD 3U28C 3KGPA 3SBKA 2SNWA 1Y5AT 3NRLA 1BTPA 2WUBA 2FESH 2O8LA 3IITA 1QL8A 5A8ZA 1GJ5H 1GHXH 2G51A 1WU1A 3M37A 2RA0A 5PTPA 3GDVA 1BB0B 2A45B 1TA2A 1TBQH 5TJXA 1O2UA 1WCZA 3UREA 1HAOH 2EY4C 4FUGA 4I33A 1GBLA 1IQGA 2F9NA 1D4PB 2CF8H 3HKIB 4CREA 4NZLA 5T6FA 2FODA 2L6OA 1O3PB 2C8YB 1O2OA 5C0TA 3PMAB 1LHDH 3E0NB 1AZ8A 1C1RA 1GDQA 4NA7A 3BTQE 1MTWA 4X1NU 1CHOG 2EEKA 1X7AC 6LPRA 1YPGH 3RU4E 5GNDA 1GBDA 1P04A 1UTNA 3LONA 1AFQB 5DJ7A 1GJAB 3H09A 3LDXH 1QIXB 2VIPA 3MOCA 5A8XA 1PPEE 2ZHQH 2EA3A 1O33A 3OY6U 2CF9H 4NA9H 6CHAC 3ZIAD 2FOAA 1NM6A 4K69A 3RXBA 5T6DA 1GMDF 5FX6A 2OD3B 3JZ2B 1O31A 1BMNH 4M9FA 3M3SA 3N99A 1KLIH 1GHBG 5DP3A 3G01A 3W95A 3M5NA 1BTWA 2A5AA 3M7TA 3QN7A 4DIHH 2W7UA 4X1SU 1K1PA 5GDSH 6GCHG 1NRQH 4ABIA 1EZXC 1F0SA 2PSYA 3AASA 4X8SH 2L74A 1V2NT 5FPTA 5A09A 5EIYA 1NY22 4B6FA 1PPHE 1TMUH 2P8OC 1O34A 1O3JA 4IN1A 3ZYEA 1SHYA 1HRTH 3AW0A 4I31A 4Q2KA 3ZVEA 1T31A 2UWLA 1O5DH 8GCHF 3AAUA 3LGTA 4MTBA 3SJIA 1CA0B 1L1JA 1ZHPA 1UTKA 1INCA 3DSPA 1BMMH 2P95A 1HXFH 1QY6A 1P02A 1VCPA 2AHME 5L2ZH 2B0FA 1DXPA 2ZO3H 3SGQE 2Z94A 1LPGB 1QB6A 2OC1A 2QXHA 3EYDA 2I6SA 1ACBE 1Z8GA 1AKSB 1ETSH 1H8HD 2BQWB 1GVLA 2WHXA 3SGAE 4AN7A 2ZU1A 5KEDA 2QC2A 5EQSA 3T2NA 1PPZA 4AC9A 1P12E 3AW1A 4H4FA 3A88A 1AVWA 3P92A 3OYPA 3RMMH 3E90B 2QIQA 3DD2H 1JIRA 1ZGVA 3A89A 2HRVA 1H8IH 1P06A 1TOCB 3ATMA 1IQKA 1H9HE 3PWCA 1Y8TA 3FANA 3I77A 4WY3A 5F8XA 4Z1MD 1TX6A 4UDWH 2UUJB 4B74A 3QTOH 1RFNA 4ISHH 4CR9A 2HLCA 3ZVAA 3T27A 1YLCA 1MCVA 1JRSA 2AGGX 1AVGH 2G8TA 1S84A 3M61U 1TONA 1O2JA 1O3GA 4DT7B 2HPPH 1PQAA 3NWUA 2TGAA 2GDDA 3UIRA 1SGQE 1V3XA 3KHVA 4LK4A 3U9AH 3F9FA 2KCYA 3LU9B 2C8WB 3UTUH 3SUEA 4D8NA 1L2EA 3PLKA 1GI7B 2ZFQH 5KGOA 1Y59T 1CT4E 1H1BA 3JZ1B 4TWYA 4NIVA 2P94A 4RT0A 1GHZA 4H6SB 1UTMA 1P2QA 4ZCNA 5A0CA 3F6UH 1W14U 4JZIA 4CHAB 2EQNA 5JBBS 4YXWD 4PROA 1QBVH 1OX1A 4HI3A 4MNYA 3HKJB 5HM9A 5DK1A 4ABAA 1GCTB 2D1JA 1BA8B 2XRCA 2AMQA 1CBWB 1HJAB 1LVOA 1AE8H 1PPCE 1SVPA 1ELCA 4GCHF 4NCYA 2Q6GA 4BAHB 4XBCA 2CHAC 3FVFB 3RXTA 4X8UH 4P02A 2FLBH 2BM2A 3D62A 3GCTF 1XKBC 2ZHWH 4CRGA 2FX6A 3CS7A 3AK5A 1Z1JA 3GISB 3A83A 1TAWA 2SGQE 4CH8B 3A7ZA 3TIUA 4ABEA 2ZHFH 1D3PB 4X8VH 4RI0A 2JETB 1GI5A 2PFEA 1NESE 4ABHA 1ZSKA 3MU4A 1DDJA 4I8LA 2A4OA 3SJ8A 4WJG2 1ZRKA 3M3TA 1F5RA 2FI5E 1ELFA 1MU8B 3P8NA 1DWCH 1FY4A 5HKKD 5HGGA 4ZKNU 2THFB 4YESB 1BCUH 1UHBB 4O9VA 3U69H 3VB4A 1CT2E 3WWBA 1CU1A 5I25A 1T4VH 1G2MA 1P03A 1Y3VA 2J98A 1DLEA 1W3CA 2J9NA 1V2UT 4LXBH 1P57B 3F2HA 4DOQA 1W10U 3SUFA 3A7YA 2BMGB 4FUDA 3RC6A 4A5TS 1S82A 2F9UA 3F0OA 1LVBA 1OXGA 1TNIA 2B7DH 4H6TA 4RKJB 5TCCA 5IDKA 1CO7E 1SBWA 2ZDVH 4D7GA 3GDSA 4X6OA 2ZQ1A 1M9UA 2C93B 1O3HA 1O5EH 4IW4E 3A7WA 1Q2WA 1UHBA 1WDIA 2PUQH 4CBNA 3SUDA 1WSSH 1LQEA 1G2LA 1Z7KA 5IYTA 3HK3B 1ID5H 3S9CA 2ZU3A 1ZTLA 1MZAA 4AFQA 3BTWE 4XSKU 1H9IE 2IPHA 1GBHA 2YMSB 4KKDA 4YLUA 1FI8A 1OPHB 4MVNA 1N6XA 2BY8X 3L33A 1SPJA 3MHWU 1KTSB 2C90B 1HAGE 1GVKB 5FHTA 5HXFA 1GMCG 4AB9A 3PMJA 4WMEA 3ZZ9A 4F55A 4OS1A 1GI0A 4OGYA 1NRRH 3RUOA 3TLOA 3RXSA 3SQHE 3TGIE 1C5MD 2SNVA 3LT3A 1GHAF 2J38A 3VB3A 3MNXA 1D3QB 3PV5A 1ABJH 2A7CA 4K1EA 1CGIE 4X8TH 5GXPA 3RC5A 1WBGB 3PYHA 1TNLA 2Z9GA 5J4SA 2ALPA 3ZZ3A 1O32A 3OTPA 1MTNC 4Z0KA 2WPJS 2W6ID 8KME2 2AIQA 1O39A 2Y82A 3V13A 2KAIA 1YPLH 1MKXH 2C3SA 1MQ6A 1VR1H 1Y5UT 1SLWB 2PKAA 2BLWA 1NU7B 1F0TA 3PTNA 5LPFA 3F2FA 1JMOH 1FJSA 3E91A 4H42U 2A5IA 2XCNA 3ZZ5A 4CH2B 3GYMA 1F2SE 4DCDA 2TIOA 1IQHA 1MZDA 2PGBB 4ASUD 2XBWA 5HM2A 2BLVA 2QCYA 3H7OA 5F6MA 2BQ7B 2ZGHA 1SGCA 4ISIH 1L4DA 4RT1A 4FUBA 1KXEA 1SGDE 2FOCA 4FUCA 3KCGH 3RXDA 2OUAA 2ZHEH 1GWAA 2BD7A 3EDXB 4A92A 2AIPA 2ZDKA 1GGDB 2KR7A 3Q3XA 3I29A 5A0AE 1O3DA 3N7OA 5HIYA 3FP6E 1O38A 4IN2A 3SQEE 3OE7D 4E7NA 5HMAA 2BOKA 1UO6A 1EJAA 4XBDA 1RXPA 2FMJA 2FP7B 1DICA 1GMDG 2BY9X 2FS9A 2XYAA 1GI4A 1FN8A 2R9PA 1WAYB 2ZHDA 4K5ZA 4BNRA 5I46H 3C1KA 2VVUA 2ZCLP 3OTJE 2Z7FE 1NRPH 1EZUC 3LGWA 1SC8U 3BTEE 2SGEE 1SMFE 3VXFH 3SU4A 1LVYA 1F5LA 1C1UH 2FOEA 1V2MT 2OBQA 4GLYA 1UMAH 4R8TB 2QE7D 3GCNA 2Z3EA 1LTOA 2PLXA 1HAVB 3SW2B 5DP7A 3GS9A 4J1YA 1F7ZA 4YT7H 1FZZA 3F0PA 2F9OA 9LPRA 2VBCA 2BD4A 1LHEH 1SQRA 3RXCA 2O8UA 4TSFD 1CBWC 2PUXB 5GCHG 5K7RA 2M2AA 2ZCKP 5AFYH 3O8DA 1MTUA 3SU2A 2V3HH 3PO1B 2VVCA 4MPWA 2W26A 1A5HA 2STAE 1C5XB 3O8BA 1V2JT 2RCEA 5T1VA 2JKHA 1EFRD 2FI3E 4OS6A 3OEED 1DY8A 2IJD1 3BTDE 3RMLH 1HAIH 1XUKA 4B75A 5L2YH 2CMYA 5ESBA 2EI7A 2ZGXH 2R0KA 7LPRA 2IOTA 1ANCA 2XBYA 2ZPQA 1ARCA 3MFJA 2F43B 3T5FH 4XDEA 4Y6DA 2D26C 1O3NA 3GCOA 3MH4A 2XBVA 3ODDA 1TIOA 1KDQA 1C2LA 4ISOA 3DSOA 1UCYH 5GIBA 5EU8A 4X2VA 1SQTA 5CHAC 3ITIA 1NFWA 1A61H 4Y79A 2ZWLH 1MQ5A 1MTVA 1V6DA 1W7GH 2OK5A 4AYVB 4BANB 3MU0A 2KCPA 4WH6A 1LPZB 1N8OB 3PV2A 4MNVA 1C5TA 3SNEA 2WZQA 3BF6H 2JIZD 1O2MA 3PB1E 1W13U 2R0LA 4MDSA 2V6NA 2Q6FA 3FP8E 3SZNA 2ANMH 1XUJA 1EJNA 3F3BA 3BG4B 2VIWA 3MTYA 4HG6A 1CA8B 3MU5A 3E6PH 3A80A 1TFXA 1DITH 5J4QA 3TJOA 1EAUA 1AWFH 2VWNA 1EOLA 4GAWA 5C5NA 2NU0E 1V2OT 4MLFB 1BRUP 4HFPB 1JIMA 2PSXA 4SGAE 3TJVA 3VGCB 1SHHB 1O2IA 1TBZH 2Z3DA 2DE8A 2B9LA 3P8FA 1FPCH 1PJPA 2WYGA 2ZEBA 2PR3A 3TITA 1BTHH 5C2ZA 3OAAD 2HOBA 1O2KA 1QL7A 3ATLA 1K1MA 4K2YA 2BLOA 5CMXH 2Q1JA 1AU8A 2PW8H 1DM4B 2FLRH 3QO6A 3DCLA 1O37A 3AVZA 3A8AA 1AB9B 2STBE 3T28A 1IQIA 3W1EA 1T8OA 4X2WA 1VITG 1GBAA 2HVYB 1YKTA 4GCHG 1EP6A 2SGAA 1COWD 5C67A 2XNDD 5DP4A 1NN6A 1YLDA 2FTLE 2Z9IA 4IMZA 1KLTA 4DVAU 3VXEH 4Y0YE 3GCTG 4U01A 1B0EA 1GJDB 1T4UH 3A86A 3MWIU 4GHQA 1THPB 2GCTB 1UVPA 1C5QA 4WXVA 2TGPZ 1EPTB 2BQ6B 2V35A 1Z8JB 1DX5M 1GL1A 1KSNA 1C1WH 1C5PA 3GY7A 4K8YA 1O2TA 2BD3A 4A7IB 1WQVH 4BXSA 4GPGA 2SGDE 2XWAA 2HWLB 2WYJA 3SYJA 1GI8B 1MUEB 1NC6A 1DFPA 4AGKA 1O2NA 5JPMH 5DPAA 1P2NA 1T32A 1W8BH 3K6ZA 7GCHF 1P9SA 2ZFTA 4YM9A 2OP9A 2QGRA 2FM2A 5EJLA 3QDZB 3PRBA 3AAVA 2W3IA 4GVUA 2H9TH 4LOYH 4DT4A 5FCKA 1DUEA 3TGKE 1EATA 3KIDU 1EAIA 2CK3D 1HB0B 1L0ZA 1DE7H 1EQ9A 3E3TA 1KYNA 1UK2A 1Z1IA 2CJIA 2SGFE 4X6MA 1GGDC 1EZQA 1G3CA 1JWTA 3UNRA 1TABE 1C1TA 1BUIA 1VZQH 3Q00A 1ZMLA 1V2VT 1P3CA 2Z3CA 1EP5A 4JYVH 3URCA 1SKYE 2G5VA 1NTPA 1O36A 1SQOA 4MPVA 1EB2A 1Z71A 3SOSA 4FUHA 1GI3A 3UFAA 1BDAA 3Q76A 5C94A 5FAHA 3BSQA 3QUMP 1FIZA 3NK8A 1O2QA 2PV9B 2BDIA 1SGEE 2FPZA 4WMDA 3O8RA 2ZFRH 1TYNA 3UQVA 3LGIA 4X0WU 1AQ7A 4OS7A 1O2VA 1K1JA 1O3KA 1A0JA 1AZZA 4X1RU 2VH0A 3RXAA 2K0QA 3GY2A 2ZFSA 2GZ9A 3F9HA 4SGBE 1O2HA 2GV7A 4YO9A 3P17H 2EI6A 2PTCE 2ZDNA 1HJ8A 1AVXA 1D3DB 3LH3A 4INHA 3UNSA 2Y80A 2YOLA 1DS2E 2HLDD 1F5KU 3GYLB 4FXGH 4JZFH 2ZIQH 1AMHA 2BXTH 4ZKRU 1S81A 3BV9B 1ETRH 1BMAA 2C4FH 1MKXK 2ODYB 1QBOA 2ODQA 4ZROA 1GHAG 1KMHB 3ELAH 1NS3A 1RIWC 3PO1C 2FI4E 1C5OH 3OSYA 4OS5A 1J16A 2Z9KA 1BJVA 1A0HB 1XX9A 4BXWA 5EQRA 4LZ1H 1GJ8B 2ESTE 2FO9A 2PP6A 2BVRH 1C1NA 1Y5BT 2EI8A 3EA7A 4Q80A 2VJ1A 4ZHAA 2VIOA 1K1OA 2FTMA 4JZ1A 4BTTB 5EPYA 1TPOA 4BOHA 2NWNA 3RXQA 4RN6A 4XE4A 3KYFA 3M5LA 4INKA 4FUEA 3MI4A 1DLKB 3RU4T 3PMHB 3SU6A 1V2TT 4BAMB 1QTFA 3GY5A 2BHGA 1MBQA 1GI9B 3DA9B 1Y3XA 1U6QA 3RXGA 1E37B 1F92A 1C5ZB 2BDGA 1EAWA 1OKXA 5EJ1A 2WSSD 1XVOA 4CRBA 1P10A 3RM0H 1XMNB 4BTUB 1AKSA 2PWXA 1MTSA 2FXRA 4XFQA 1IAUA 4I86A 1FXYA 2QXJA 5A2MH 5E2PA 3TU7H 3WW7A 1YCPM 3MNSA 5CDFE 1CGJE 1O2YA 2PGQB 1OHHD 1DT2A 1HV7A 1O0DH 1QGFA 1BT7A 4UFDH 5EQQA 3MH5A 2Y5HA 2Y6TA 1GJ4H 1B0FA 4D9QA 3NXPA 5B6OA 1LKAA 3OX7U 5IK2D 1ELEE 1YPHE 2FYQA 3VG8A 1YPHC 3TJNA 4TY6A 4IC5A 1EUFA 4AG2A 1V2RT 3VGCC 5DG6A 1AD8H 1G37A 2UUYA 1UVUH 1S0QA 1RTLA 2ODPA 3DUXH 4NZQA 1C5SA 1MU6B 4NIWA 4ZXYH 1Z6EA 1W0ZU 1JRTA 4FOUC 3ZYDA 1GJ7B 5SGAE 2A7JA 4IC6A 5EXNA 3NPSA 4AG1A 4X2YA 2P3FH 4LZ4B 1SGRE 1TPAE 1UTJA 4FUJA 2BDCA 2AS9A 1QJ6B 1OWDA 3KQCA 1XUHA 2ILNA 2K8IA 1P2JA 4X2XA 1NPMA 2M5TA 3MYWA 3RLYH 3V3MA 4DJZB 4AFSA 1QJ1B 2WPLS 2QXGA 2PTNA 3SUGA 2GCTC 1A1RA 1UCYK 1O5BB 3LJJA 2QYIA 4JYTA 1QL9A 3RXHA 1DWBH 3QGJA 3BN9A 2CXVA 1HFDA 1O2ZA 1NRSH 3S9AA 2NU3E 1SGTA 2ZDLA 1FN6A 2J5UA 1O30A 1PPBH 3UR6A 2D8WA 2ZGCA 4IBLH 3BTKE 2GVFA 3H5CB 4TY7A 3S0NA 5FX5A 2GZ8A 3ZZ8A 1SGFG 1EOJA 1IQJA 5KECA 1NT1A 3T26A 1D6WA 2F9BH 2UUKB 3RMOH 2AMPA 4NA8A 1DWEH 3TVJB 3T29A 2ALVA 2FIRH 1AFQC 3UR9A 2P16A 3HPTB 1GJ9B 5FCRA 1BRBE 3KL6A 1QJ7B 3D49H 1HLTH 1JOUB 1FX0B 5JYIA 1SGPE 1GBIA 1SLVB 5CHBA 1HBTH 1TNJA 3KNXA 3VFEA 5C1UA 1VKYA 1E1RD 3CP7A 1C2IA 3SGBE 2FEQH 3KYGA 3SV2H 3KEEA 3MNBA 3STJA 3GOVB 3STIA 4X1QU 1SFIA 4Y7BA 2BDBA 1ELAA 2HPQH 2ZF0H 1CVWH 5JB9S 3BTTE 2LPRA 1DXWA 4Y11E 3GY6A 1AFEH 1FY3A 2VB0A 2VH6A 4R0IA 1GBMA 3TK6A 2DE9A 2NU4E 3MQKC 1LHFH 1A5GH 1JBUH 2J95A 5HIZA 2ANYA 3HGNA 6GCHF 1KXBA 2FOMB 3UY9A 1SGNE 1E1QD 2BOHB 2B5TB 1FNIA 1HNEE 2GMTB 1GG6B 2RDEA 4MPUA 1HIAB 1KXDA 1QNJA 3PMBB 2A4GA 4ISLA 1HAZB 1FMGA 1ABIH 1CA0C 1O3OA 1NU9A 4B1TA 2RDLA 5C0UA 1XUGA 2O8WA 2JJ1D 4TWWA 1UCYE 2QF5A 1PQ8A 1WYKA 4ZH8A 1PQ5A 2ANKH 4A1VA 4CRDA 4CR5A 1DOJA 1P05A 3KF2A 3SJOA 1P2MA 5DP6A 5EODA 3PM3A 1QURH 1RRKA 4D9RA 1IQFA 4HGCA 1KXAA 1RTKA 2I6QA 3LGVA 3KQDA 5FPYA 2A7HA 4ZMAH 2KFWA 1YPKH 1QB9A 2H1UA 1AO5A 3LKWA 1OWEA 1ESTA 3C27B 2O8MA 4BAOB 3PV4A 4YOJA 1CHGA 1H8DH 5DO4H 2WINI 1HXEH 1T8NA 2G5NA 1BJUA 1P0SH 4KTCA 1YY3A 3BTME 5G4BA 1BOQA 1K2I1 3MNCA 3ZVDA 5FL7D 2ANWA 4P00A 7GCHG 3P70B 1AE5A 1TRNA 3GDUA 3WWFA 2WPHS 1C2KA 4D76A 1GBKA 3RC4A 1CQQA 1PYTD 1FDPA 4ZUHA 3SI4H 1B5GH 2WPMS 5F53A 1PPFE 2A5KA 3FAOA 3FN8A 4B2CA 5DP9A 5ETXA 1YPJH 3TGJE 4IS5A 3M7QA 1C1PA 1J17T 1E36B 1UVSH 2JH5D 3PRDA 1UTQA 1VJAU 1BHXB 2ZI2H 1VJ9U 1OWJA 1LHCH 2LNCA 1O3BA 1QQUA 1G36A 3VPKA 3EE7A 2YMSD 4UE7H 2GDEH 1TPSA 4J2YB 3UOPA 4E05H 3A7VA 3ZVGA 1FY8E 1AN1E 5AHGH 3RDZA 3RXKA 4CHAC 4DW2U 2J92A 2O9QA 2OC8A 2BDYA 2BXUH 1TQ0B 3ZV8A 2ZPRA 2VU8E 1GPZA 2OLGA 3SO3A 5DKMA 1TB6H 1UW7A 3A87A 3NKKA 1EAXA 3KQ5A 4X6NA 3SJKA 1UTOA 1GCDA 4GUXA 1GCTC 3OY5U 2ZC9H 3U1JB 1C4Y2 1ESBA 2P8OB 3M5MA 1H9LB 1HJAC 1PPGE 1K1NA 8GCHG 4I7YH 5C1YA 1KTTB 5EPNA 3LC5A 3K2UA 3N7EA 2KZ4A 5A8YA 1TOMH 1IHSH 1TA6A 1H8ED 1F0RA 1HGTH 1NZQH 3UOUA 2GTBA 1KXFA 1UK3A 5C17A 1FAKH 1RJXB 1ESAA 4F49A 4Y10E 1ZHMA 1C5YB 2A32A 1S6FA 2ZDMA 2GV6A 2ZP0H 1QQ4A 2AH4X 4ACAA 3MO3A 1EJMA 2JETC 4ABBA 1TMTH 5CE1A 1HAVA 1IQNA 2AEIH 1V2WT 2FWWA 3SV8A 4Q63A 2ZCHP 3DFLA 4ZKOU 1B7XB 2TRMA 3KQEA 2ZA5A 5F8TA 2FOBA 3UNQA 2BX4A 3QZQA 1YYY1 2A4RA 5BPEA 3E8LA 5EXMA 1P01A 2ZTYA 1MKWK 1TGNA 4VGCB 1RTFB 1LVMA 1HAPH 4IMQA 1ZYOA 3SNDA 5EW1H 3RXUA 3M3VA 4Q7XA 5DP8A 1HUTH 3F9EA 1W11U 1XVMA 2ZPSA 2H9HA 2IJOB 1O2WA 3TPIZ 4K1TA 1O3IA 1GMHF 1V2QT 2JH6D 2HGTH 1ZMJA 1ZLRA 2QV1A 4NGAH 1NFYA 1ZJKA 4AZ2B 1AUTC 1OP8A 2XBXA 3MMGA 1PYTC 5DP5A 1GBFA 2QF3A 1OOKB 5LPRA 1C4V2 1WUNH 1NRNH 1K28D 2F9VA 2W5EA 3V7TA 1QHRB 1OP0A 3QGNB 4TPYA 1A4WH 1WV7H 5E0JA 1D9IA 1G9IE 1DSUA 1C2HA 4WWYA 1WXRA 3HK6B 2WPDD 3GICB 3U8TH 4INLA 2ZQ2A 1BIOA 2G81E 1DPOA 4WMFA 3TK9A 1ZGIA 8ESTE 3IWMA 2YMSC 4ABDA 2F83A 2AERH 1WTGH 2BD5A 3B8JA 4JK6A 4RSPA 2QXIA 1J14A 1YWUA 1BMFD 5EW2H 1W0JD 2J97A 5FBIA 4TYDA 1S85A 2BX3A 1P9UA 3PROA 4XRNA 3BIUH 1D3TB 3RXLA 1ELBA 2CN0H 3QX5H 1ZR0A 3A8CA 2OBOA 2BTCE 1QB1A 1SI5H 1YP9A 5FBEA 2GMTC 1GG6C 4O3TA 3A82A 2VWOA 4Y76A 1A2CH 2CHAB 1Z6JH 2XW9A 1C1SA 2OTVA 1C2MA 1C2DA 2JJ2D 5EJZA 4GSOA 2G55A 3V12A 1S0RA 2RFKC 1KLJH 1FUJA 1PFXC 3RLWH 4JZEH 2WPIS 2TGTA 1VGCB 2V0BA 4Y8ZA 1ZPZA 3D65E 1J15A 4XOJA 2WV5A 3SV9A 1SSXA 2VINA 4YOGA 2ZZUH 2OCVB 1C2EA 2JH0D 3A8DA 3L3TA 3K6YA 1O5FH 4Y71A 1V2PT 2LELA 1IOEA 1AUJA 1BBRE 1JXPA 2AYWA
chains in the Genus database with same CATH topology
1OYTH 4FUFA 1EZSC 4CRCA 1LCYA 1RD3B 3DHKH 3LOXA 1YGCH 2XC0A 2WV4A 3S7KB 3RXIA 4MG3A 1O2XA 1LPKB 4DG4A 1C1VH 1H4WA 4JMYA 4OS4A 4K1SA 4Y8YA 1HAXB 2ASUB 3Q3KA 3ODFA 4AOQA 5EG4A 1UVTH 3QZRA 1LHGH 2QF0A 3P8OA 1GBJA 3U1IB 2R3UA 3PWBA 1VITH 2P3UB 1TWXB 1LKBA 1OS8A 1EPTA 1BITA 1CSOE 1NROH 4KELA 2Y7XA 2ZFPH 4KTSA 1C5RA 3KN2A 5JBAS 1OP2A 3SV6A 2V3OH 1FY5A 2FX4A 4ZHMU 2Y81A 2GT8A 1UK4A 2XNIA 3EA8A 3FFGA 5C20A 1PQ7A 2VVVA 4NG9H 4I8KA 1FPHH 1P2KA 3LPRA 4JCNA 4YOIA 2TPIZ 4ZKSU 3QWCH 2F9PA 3ZZ7A 3VEQB 3EA9A 2VIQA 3PLBA 1QR3E 2QA9E 1NFXA 2H6MA 3TH3H 3V0XA 1C5WB 1L1GA 4NFFA 1QFKH 1C5LH 1Y3WA 2Q6DA 3S69A 4E06H 4MNWA 2QY0B 2AGEX 1LMWB 3FP7E 1AY6H 2G00A 3SN8A 1IHTH 3F1SB 2Z9LA 4NIYA 1G30B 4ZAEA 1MBMA 1ELVA 1O35A 4Q7YA 5E2OA 4XBBA 5TCAA 1OWHA 1SL3A 2HNTE 2GT7A 2FDAA 3SU1A 1P09A 1A46H 2HNTC 5T6GA 2ZG0H 3TK5A 1Z8RA 3SNAA 1SB1H 3RXFA 3EAJA 1KIGH 3LH1A 1MD8A 1RS0A 3HATH 3TNTA 1SLXB 1TRMA 3KQBA 1QA0A 3RXVA 7KMEH 2CV3A 4ZXXH 3SHCH 2FOGA 3T25A 1T7CA 2Z6BD 3SI3H 1XM1A 2GCHF 4DGJA 4MNXA 5GCHF 5E8EH 2FS8A 1DWDH 2F3CE 1OYQA 3RXMA 4B71A 2BVXH 1HCGA 3NCLA 2IN2A 1K1IA 5FXLA 4A1XA 1GHWH 1DVAH 4AYYB 4JK5A 2J34A 3VB5A 1A3BH 3R0FA 5FPSA 1FAXA 1DSTA 1FIWA 1TLDA 5ESTE 1SR5C 2VGCB 3K9XB 2P93A 5ABWA 1MTNB 4K8BA 2WUCA 1O5GH 3BEUA 2PKSB 3DFJA 7ESTE 2BY7X 3ESTA 2XC4A 3ZVBA 2K1QA 1GHVH 4FVDA 2XXLA 4ASHA 1AWHB 1GVZA 3SORA 2W7SA 1K21H 2OC7A 2W3KA 1IQMA 1UTLM 4VGCC 1Q3XA 1HPGA 1TBRH 3MO6A 3BEFB 3SU0A 2O8TA 3LIWA 4Y8XA 1P8VC 4Y7AA 2G4TA 1YPEH 4B2AA 1BBRH 2GKVE 2Y5GA 2YNBA 2BYAX 1NO9H 1XKAC 2YNAA 1N8OC 2A0QB 4U2WA 1MKWH 1BTZA 3Q3YA 3URDA 3A7XA 3SU5A 1V2LT 1QRXA 3BG4C 4JYUH 1D6RA 1W12U 3E1XB 1ZTKA 2GD4B 1L4ZA 1GBCA 1GDUA 1V2ST 5C3NA 2OQ5A 1C2FA 1KXCA 3F9GA 4K3JA 3BTGE 1LO6A 3WY8A 1MD7A 1G32B 1YBWA 2BDAA 3RXPA 4BAQB 2TBSA 1ANBA 2OXSA 2GZ7A 3ZZDA 4D7FA 2A31A 1G3EA 3PLPA 1BRCE 1C9PA 1TQ7B 4X6PA 3BG8A 3M5OA 1E35B 3TH2H 1C9TA 2OC0A 1HJ9A 1ZHRA 1NFUA 4FU7A 4NWKA 3SV7A 1VCQA 3UWJH 1AB9C 1EASA 3MH7A 1C4U2 2ULLA 2UWOA 4KTUA 1P3EA 2FOHA 3SJ9A 4UONA 1MH0A 1YCPH 1E0FD 3QLPH 1ELGA 4KGAA 1VITF 3MH6A 4I8GA 1YM0A 1AGJA 1GBEA 2C8XB 2ZTZA 1AIXH 4I32A 1CGHA 4Y0ZE 2BY5X 3S7HB 3ZZ4A 1TPPA 1O3CA 4A1TA 3CS0A 4KP0A 1O2PA 1ELTA 1EPTC 1Y3YA 1K22H 1VGCC 3U98H 3B9FH 1BMLA 4OS2A 1ETTH 4DIIH 5E0GA 2ZGJA 1ANEA 1LDTT 4IGDA 3ZZCA 2XWBI 4UEHH 1FY1A 2GGVB 1P11E 2J94A 2A2XH 4I8HA 3O8CA 2WPKS 3DT0H 1ZOMA 1SGYE 5A0BA 1ZMNA 1TALA 2UUFB 2P59A 2ZGBH 3LJOA 1TX7A 5EGMA 3GCHB 1O5AB 4UFEH 4NSVA 4JZDH 5CHAB 4WH8A 1CHOF 1UVOA 3SNBA 2DUCA 5EOKA 5JB8S 1W2KH 3EGKH 1XXDA 6ESTA 1GMHG 2G52A 1QCPA 2RG3A 2D2DA 2VWMA 3SHAH 1C2JA 2Y5FA 3UWIA 1TNHA 5GJ4B 1YPMH 1THSH 1TRYA 4FU8A 2Z9JA 1MAXA 3A84A 2FOFA 5F03A 2ZU5A 1TX8A 2R2MB 1GHBF 2AMDA 3LGUA 4AORA 3NZIA 3A8BA 1SGIB 4WVPE 1DANH 5AF9H 1THRH 1XXFA 1T8LA 3GY8A 4AFZA 4TPIZ 2H5CA 3H7TA 3BEIB 1MAYA 1FV9A 5DGJA 1GDNA 2ZDAH 3RM2H 3K65B 2VIDA 3QTVH 5JBCS 4YT6H 1TNGA 5LPEA 1MMJN 1UTPA 1QRZA 3PTBA 2QAAA 2KAIB 4I8JA 3S9BA 1CT0E 2VWLA 2PKAB 2GX4A 4AFUA 1KY9A 3SNCA 2BY6X 3TJUA 3U8OH 4QT8C 2A4QA 3M36A 4F4OC 5L6NH 1GBTA 1AHTH 3EQ0H 2FZZA 5E0HA 1XUFA 3TNSA 2B8OH 1O5CB 1A0LA 2UWPA 2HALA 1EXFA 2BD8A 2J2UA 5JDUB 4BAKB 1S83A 2QN5T 3FZDA 4YZUA 4YTAA 3W94A 1O2LA 1O2GH 2AFQB 5JBTA 2EC9H 3P95A 3P6ZB 1O2SA 3LC3A 1HIAA 2VGCC 3D23A 1DY9A 1HDTH 4DY7B 1J9CH 1BTUA 2PKSC 1ZJDA 3GY4A 4ABGA 2ZKSA 3TH4H 3UUZA 4FU9A 4MQAA 2VIVA 5H4IB 4ISNA 2BVSH 3BTFE 1C1QA 1WOFA 4AX9H 1A5IA 1ZPBA 1QA7A 4NFEA 2FYRA 1BHXF 2H2ZA 1QBNA 4E7RG 2CGAA 2ZFFH 1F0UA 1G3BA 3ZZBA 4OGXA 1HAYB 4FVBA 2BLQA 6CHAB 1BZXE 3Q77A 1DUAA 3MO9A 1VCWA 3A85A 1V2KT 5F8ZA 1E34B 3ATIA 1C5VA 2BD2A 3CENA 1OWIA 1ZZZA 1TMBH 3FZZA 2HNTF 1ZSJA 1TGTA 3RP2A 3RXJA 5AVDA 1OWKA 3LGYA 4UFFH 3MU1A 2PHBA 1LQDB 1J8AA 3M7UA 1GL0E 2BD9A 2OQUA 3R3GB 3MU8A 3ATKA 1C5NH 4U30A 2XC5A 1T8MA 1ELDE 4YLQH 1C2GA 3QK1A 5AFZH 2VNTA 1QRWA 2H5DA 2NU1E 1FQ3A 5C5OA 1WQSA 3P8GA 2OINA 1GI1A 2A2QH 4FUIA 1P2OA 3ZVCA 1N6YA 3ZZ6A 4ABJA 1GHYH 1FLEE 3EE0B 2NU2E 4HZHA 2XCFA 3A7TA 3RXRA 4NSYA 4K60A 5LGOA 3SU3A 2BZAA 1IQEA 1KDQB 1SFQB 2SFAA 2GCHG 1A7SA 2HVXA 1Y3UA 1C1MA 1ORFA 1A3EH 1S5SA 3UQOA 4BTIB 2P3TB 2AGIX 4U32A 4CRFA 1RIWB 3RXEA 1W0YH 2ZNKH 1YC0A 1CE5A 1TNKA 3VB6A 1WTHD 1BQYA 4B73A 1UJ1A 2ZU2A 3L6PA 1YF4A 4ABFA 2G4UA 4Q7ZA 1G3DA 4GHTA 5GPIB 1SQAA 1BBRK 2ZECA 5BRRE 9ESTA 3E16B 5C1XA 5HYOA 2BDHA 4CRAA 3A81A 4AB8A 1ZRBA 1W7XH 1Q31A 3U8RH 1ZPCA 1TGCA 3F68H 4THNH 2A1DB 4RKOB 3E0PB 3OU0A 2Y7ZA 4NIXA 3RU4D 1O3LA 2C8ZB 1O3AA 2J4IA 1SLUB 2SGPE 1C1OA 3GCHC 1K1LA 4WXIA 1MCTA 3NUMA 2XTTB 3ZV9A 4MPXA 1IQLA 1AI8H 4M7GA 1EX3A 4DURA 3ZZAA 1O3FA 4CBOA 2R2WU 1SOTA 3RXOA 1O3EA 8LPRA 1N1LA 1BRAA 4B76A 5GWZA 4O3UA 1HYLA 3IG6B 3RMNH 1P2IA 4WF8A 2F91A 1S6HA 3ZVFA 1GI2A 2TGDA 4UD9H 3T62A 4UFGH 4Z6AH 5EXLA 2ZTXA 1EKBB 5T3HA 1SOZA 1ZSLA 1ARBA 3VB7A 4A6LA 4B2BA 3ENSB 1YCPK 1ANDA 4HTCH 2BZ6H 4ESTE 1HAHH 2ZU4A 1BTYA 3BTHE 1O3MA 4NWLA 2H9EH 4ZHLU 1GBBA 1XUIA 1BTXA 4X1PU 1TGBA 1GJBB 3BIVH 1O2RA 1Z8IB 4O03A 4O97A 3B23B 1EB1H 3GY3A 1L1NA 1SGFA 1E38B 1K9OE 1RGQA 2BB4A 3ATWA 4AGJA 5K0HA 1FONA 1GMCF 2RA3A 3I78A 1TGSZ 1GJCB 2R3YA 5L30H 1SG8B 3M35A 3UPEA 5LH8A 1C5UA 3HGPA 1GJ6A 1GI6A 1TE0A 1ZTJA 1OSSA 2GP9B 3KGPA 3SBKA 2SNWA 1Y5AT 1BTPA 2WUBA 2FESH 2O8LA 3IITA 1QL8A 5A8ZA 1GJ5H 1GHXH 2G51A 1WU1A 3M37A 2RA0A 5PTPA 3GDVA 1BB0B 2A45B 1TA2A 1TBQH 5TJXA 1O2UA 1WCZA 3UREA 1HAOH 4FUGA 4I33A 1GBLA 1IQGA 2F9NA 1D4PB 2CF8H 3HKIB 4CREA 4NZLA 5T6FA 2FODA 1O3PB 2C8YB 1O2OA 3PMAB 1LHDH 3E0NB 1AZ8A 1C1RA 1GDQA 4NA7A 3BTQE 1MTWA 4X1NU 1CHOG 2EEKA 1X7AC 6LPRA 1YPGH 3RU4E 1GBDA 1P04A 1UTNA 3LONA 1AFQB 5DJ7A 1GJAB 3LDXH 1QIXB 2VIPA 3MOCA 5A8XA 1PPEE 2ZHQH 2EA3A 1O33A 3OY6U 2CF9H 4NA9H 6CHAC 2FOAA 1NM6A 4K69A 3RXBA 5T6DA 1GMDF 5FX6A 2OD3B 3JZ2B 1O31A 1BMNH 3M3SA 1KLIH 1GHBG 5DP3A 3G01A 3W95A 3M5NA 1BTWA 2A5AA 3M7TA 3QN7A 4DIHH 2W7UA 4X1SU 1K1PA 5GDSH 6GCHG 1NRQH 4ABIA 1EZXC 1F0SA 2PSYA 3AASA 4X8SH 5FPTA 1V2NT 5A09A 1NY22 1PPHE 1TMUH 2P8OC 1O34A 1O3JA 4IN1A 3ZYEA 1SHYA 1HRTH 3AW0A 4I31A 4Q2KA 3ZVEA 1T31A 2UWLA 1O5DH 8GCHF 3AAUA 3LGTA 4MTBA 3SJIA 1CA0B 1L1JA 1ZHPA 1UTKA 1INCA 1BMMH 2P95A 1HXFH 1QY6A 1P02A 1VCPA 5L2ZH 2B0FA 1DXPA 2ZO3H 3SGQE 2Z94A 1LPGB 1QB6A 2OC1A 2QXHA 3EYDA 2I6SA 1ACBE 1Z8GA 1AKSB 1ETSH 2BQWB 1GVLA 3SGAE 4AN7A 2ZU1A 2QC2A 5EQSA 3T2NA 1PPZA 1P12E 3AW1A 4H4FA 3A88A 1AVWA 3P92A 3OYPA 3RMMH 3E90B 2QIQA 3DD2H 1JIRA 1ZGVA 3A89A 2HRVA 1H8IH 1P06A 1TOCB 3ATMA 1IQKA 1H9HE 3PWCA 1Y8TA 3FANA 3I77A 4WY3A 5F8XA 1TX6A 4UDWH 2UUJB 4B74A 3QTOH 1RFNA 4ISHH 4CR9A 2HLCA 3ZVAA 3T27A 1YLCA 1MCVA 1JRSA 2AGGX 1AVGH 2G8TA 1S84A 3M61U 1TONA 1O2JA 1O3GA 4DT7B 2HPPH 1PQAA 3NWUA 2TGAA 2GDDA 3UIRA 1SGQE 1V3XA 3KHVA 4LK4A 3U9AH 3F9FA 3LU9B 2C8WB 3UTUH 3SUEA 4D8NA 1L2EA 3PLKA 1GI7B 2ZFQH 1Y59T 1CT4E 1H1BA 3JZ1B 4TWYA 4NIVA 2P94A 1GHZA 4H6SB 1UTMA 1P2QA 5A0CA 3F6UH 1W14U 4JZIA 4CHAB 5JBBS 4PROA 1QBVH 1OX1A 4HI3A 4MNYA 3HKJB 5HM9A 5DK1A 4ABAA 1GCTB 2D1JA 1BA8B 2XRCA 2AMQA 1CBWB 1HJAB 1LVOA 1AE8H 1PPCE 1SVPA 1ELCA 4GCHF 4NCYA 2Q6GA 4BAHB 4XBCA 2CHAC 3FVFB 3RXTA 4X8UH 2FLBH 2BM2A 3D62A 3GCTF 1XKBC 2ZHWH 4CRGA 2FX6A 3CS7A 1Z1JA 3GISB 3A83A 1TAWA 2SGQE 4CH8B 3A7ZA 3TIUA 4ABEA 2ZHFH 1D3PB 4X8VH 2JETB 1GI5A 2PFEA 1NESE 4ABHA 1ZSKA 3MU4A 1DDJA 4I8LA 2A4OA 3SJ8A 4WJG2 1ZRKA 3M3TA 1F5RA 2FI5E 1ELFA 1MU8B 3P8NA 1DWCH 1FY4A 5HGGA 4ZKNU 2THFB 4YESB 1BCUH 1UHBB 4O9VA 3U69H 3VB4A 1CT2E 1CU1A 5I25A 1T4VH 1G2MA 1P03A 1Y3VA 1DLEA 1W3CA 2J9NA 1V2UT 4LXBH 1P57B 4DOQA 1W10U 3SUFA 3A7YA 2BMGB 4FUDA 3RC6A 4A5TS 1S82A 2F9UA 1LVBA 1OXGA 1TNIA 2B7DH 4H6TA 4RKJB 5TCCA 5IDKA 1CO7E 1SBWA 2ZDVH 4D7GA 3GDSA 4X6OA 2ZQ1A 1M9UA 2C93B 1O3HA 1O5EH 4IW4E 3A7WA 1Q2WA 1UHBA 2PUQH 4CBNA 3SUDA 1WSSH 1LQEA 1G2LA 1Z7KA 5IYTA 3HK3B 1ID5H 3S9CA 2ZU3A 1ZTLA 1MZAA 4AFQA 3BTWE 4XSKU 1H9IE 2IPHA 1GBHA 4KKDA 4YLUA 1FI8A 1OPHB 4MVNA 1N6XA 2BY8X 3L33A 1SPJA 3MHWU 1KTSB 2C90B 1HAGE 1GVKB 5FHTA 5HXFA 1GMCG 4AB9A 3PMJA 4WMEA 3ZZ9A 4OS1A 1GI0A 4OGYA 1NRRH 3RUOA