4GVVA

Crystal structure of de novo design serine hydrolase osh55.27, northeast structural genomics consortium (nesg) target or246
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
165
Chain Sequence
ARIRDVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTALGAWVGGLPAEAVFRVMFEEIKKAPDTLEVTGVHGTEKSAEAGRRATLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords De novo design serine hydrolase
publication title Northeast Structural Genomics Consortium Target OR246
rcsb
molecule tags De novo protein
total genus 55
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4gvvA00
4GVVA 1ZR5A 3H8EA 3KR5A 3VFQA 2BFRA 4ETJA 3EWOA 3EWPA 5CBMA 4ZX9A 3T8WA 4ZY1A 1BPMA 4UMLA 3Q71A 4ZY0A 4K0CA 4IQYA 3IIDA 5HOLA 3V2BA 3ETIA 3KZWA 3GQEA 1TY8A 2L8RA 3EKEA 3H8FA 4D86A 5CB3A 4ZYQA 3EW5A 4JVVA 3PEIA 4KSIA 1NJRA 3EWRA 2DX6A 4ZX8A 3EJGA 1ZR3A 4J5QA 3H8GA 3V45A 2FXKA 3IIFA 5CB5A 3GPQA 2BFQA 4KYBA 1SPVA 3EWQA 5FSXA 1LAPA 3SIGA 4ZI6A 3JRUA 3KQZA 2VRIA 1BLLE 4J5SA 2X47A 1HJZA 2J9AA 4GVWA 3GPOA 5E3BA 3IJ3A 1TXZA 5D8NA 4JCAA 4ZY2A 4X2TA 5FSUA 4K3NA 2EEEA 4JGKA 4R76A 2EWBA 4JLLA 1LAMA 3JZTA 5HIHA 2AFCA 3EJFA 2ACFA 3SIJA 4J5RA 4J4ZA 5FSZA 5FSYA 5FSVA 4ABLA 2FAVA 4ETKA 4TU0A 3KQXA 4ABKA 1VHUA 1GYTA 2LGRA 5DUSA 1YD9A 3Q6ZA 1LCPA 3GPGA 3SIHA 4R6TA 2FG1A 5AILA 1LANA 4GUAA 4ESSA 2XD7A 3GQOA 3KR4A 3SIIA 1BPNA 4R7MA 5CMSA
chains in the Genus database with same CATH superfamily
4GVVA 1ZR5A 3H8EA 3KR5A 3VFQA 2BFRA 4ETJA 3EWOA 3EWPA 5CBMA 4ZX9A 3T8WA 4ZY1A 1BPMA 4UMLA 3Q71A 4ZY0A 4K0CA 2WCTA 4IQYA 3IIDA 5HOLA 3V2BA 3ETIA 3KZWA 3GQEA 1TY8A 2L8RA 3EKEA 3H8FA 4D86A 5CB3A 4ZYQA 3EW5A 4JVVA 3PEIA 4KSIA 1NJRA 3EWRA 2JZDA 2DX6A 4ZX8A 3EJGA 1ZR3A 4J5QA 3H8GA 3V45A 2W2GA 2FXKA 3IIFA 5CB5A 3GPQA 2BFQA 4KYBA 1SPVA 3EWQA 5FSXA 1LAPA 3SIGA 4ZI6A 3JRUA 3KQZA 2JZFA 2VRIA 1BLLE 4J5SA 2KQVA 2X47A 1HJZA 2J9AA 4GVWA 3GPOA 5E3BA 3IJ3A 1TXZA 5D8NA 4JCAA 4ZY2A 4X2TA 5FSUA 4K3NA 2EEEA 4JGKA 2JZEA 4R76A 2EWBA 4JLLA 1LAMA 3JZTA 2RNKA 5HIHA 2AFCA 3EJFA 2ACFA 3SIJA 4J5RA 4J4ZA 5FSZA 5FSYA 5FSVA 4ABLA 2FAVA 4ETKA 4TU0A 3KQXA 4ABKA 1VHUA 1GYTA 2LGRA 5DUSA 1YD9A 3Q6ZA 1LCPA 3GPGA 3SIHA 4R6TA 2FG1A 5AILA 1LANA 4GUAA 4ESSA 2XD7A 3GQOA 3KR4A 3SIIA 1BPNA 4R7MA 5CMSA
chains in the Genus database with same CATH topology
4GVVA 1ZR5A 3H8EA 3KR5A 3VFQA 2BFRA 4ETJA 3EWOA 3EWPA 5CBMA 4ZX9A 3T8WA 4ZY1A 1BPMA 4UMLA 3Q71A 4ZY0A 4K0CA 4IQYA 3IIDA 5HOLA 3V2BA 3ETIA 3KZWA 3GQEA 1TY8A 2L8RA 3EKEA 3H8FA 4D86A 5CB3A 4ZYQA 3EW5A 4JVVA 3PEIA 4KSIA 1NJRA 3EWRA 2DX6A 4ZX8A 3EJGA 1ZR3A 4J5QA 3H8GA 3V45A 2FXKA 3IIFA 5CB5A 3GPQA 2BFQA 4KYBA 1SPVA 3EWQA 5FSXA 1LAPA 3SIGA 4ZI6A 3JRUA 3KQZA 2VRIA 1BLLE 4J5SA 2X47A 1HJZA 2J9AA 4GVWA 3GPOA 5E3BA 3IJ3A 1TXZA 5D8NA 4JCAA 4ZY2A 4X2TA 5FSUA 4K3NA 2EEEA 4JGKA 4R76A 2EWBA 4JLLA 1LAMA 3JZTA 5HIHA 2AFCA 3EJFA 2ACFA 3SIJA 4J5RA 4J4ZA 5FSZA 5FSYA 5FSVA 4ABLA 2FAVA 4ETKA 4TU0A 3KQXA 4ABKA 1VHUA 1GYTA 2LGRA 5DUSA 1YD9A 3Q6ZA 1LCPA 3GPGA 3SIHA 4R6TA 2FG1A 5AILA 1LANA 4GUAA 4ESSA 2XD7A 3GQOA 3KR4A 3SIIA 1BPNA 4R7MA 5CMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GVV A;  1ZR5 A;  3H8E A;  3KR5 A;  3VFQ A;  2BFR A;  4ETJ A;  3EWO A;  3EWP A;  5CBM A;  4ZX9 A;  3T8W A;  4ZY1 A;  1BPM A;  4UML A;  3Q71 A;  4ZY0 A;  4K0C A;  4IQY A;  3IID A;  5HOL A;  3V2B A;  3ETI A;  3KZW A;  3GQE A;  1TY8 A;  2L8R A;  3EKE A;  3H8F A;  4D86 A;  5CB3 A;  4ZYQ A;  3EW5 A;  4JVV A;  3PEI A;  4KSI A;  1NJR A;  3EWR A;  2DX6 A;  4ZX8 A;  3EJG A;  1ZR3 A;  4J5Q A;  3H8G A;  3V45 A;  2FXK A;  3IIF A;  5CB5 A;  3GPQ A;  2BFQ A;  4KYB A;  1SPV A;  3EWQ A;  5FSX A;  1LAP A;  3SIG A;  4ZI6 A;  3JRU A;  3KQZ A;  2VRI A;  1BLL E;  4J5S A;  2X47 A;  1HJZ A;  2J9A A;  4GVW A;  3GPO A;  5E3B A;  3IJ3 A;  1TXZ A;  5D8N A;  4JCA A;  4ZY2 A;  4X2T A;  5FSU A;  4K3N A;  2EEE A;  4JGK A;  4R76 A;  2EWB A;  4JLL A;  1LAM A;  3JZT A;  5HIH A;  2AFC A;  3EJF A;  2ACF A;  3SIJ A;  4J5R A;  4J4Z A;  5FSZ A;  5FSY A;  5FSV A;  4ABL A;  2FAV A;  4ETK A;  4TU0 A;  3KQX A;  4ABK A;  1VHU A;  1GYT A;  2LGR A;  5DUS A;  1YD9 A;  3Q6Z A;  1LCP A;  3GPG A;  3SIH A;  4R6T A;  2FG1 A;  5AIL A;  1LAN A;  4GUA A;  4ESS A;  2XD7 A;  3GQO A;  3KR4 A;  3SII A;  1BPN A;  4R7M A;  5CMS A; 
#chains in the Genus database with same CATH topology
 4GVV A;  1ZR5 A;  3H8E A;  3KR5 A;  3VFQ A;  2BFR A;  4ETJ A;  3EWO A;  3EWP A;  5CBM A;  4ZX9 A;  3T8W A;  4ZY1 A;  1BPM A;  4UML A;  3Q71 A;  4ZY0 A;  4K0C A;  2WCT A;  4IQY A;  3IID A;  5HOL A;  3V2B A;  3ETI A;  3KZW A;  3GQE A;  1TY8 A;  2L8R A;  3EKE A;  3H8F A;  4D86 A;  5CB3 A;  4ZYQ A;  3EW5 A;  4JVV A;  3PEI A;  4KSI A;  1NJR A;  3EWR A;  2JZD A;  2DX6 A;  4ZX8 A;  3EJG A;  1ZR3 A;  4J5Q A;  3H8G A;  3V45 A;  2W2G A;  2FXK A;  3IIF A;  5CB5 A;  3GPQ A;  2BFQ A;  4KYB A;  1SPV A;  3EWQ A;  5FSX A;  1LAP A;  3SIG A;  4ZI6 A;  3JRU A;  3KQZ A;  2JZF A;  2VRI A;  1BLL E;  4J5S A;  2KQV A;  2X47 A;  1HJZ A;  2J9A A;  4GVW A;  3GPO A;  5E3B A;  3IJ3 A;  1TXZ A;  5D8N A;  4JCA A;  4ZY2 A;  4X2T A;  5FSU A;  4K3N A;  2EEE A;  4JGK A;  2JZE A;  4R76 A;  2EWB A;  4JLL A;  1LAM A;  3JZT A;  2RNK A;  5HIH A;  2AFC A;  3EJF A;  2ACF A;  3SIJ A;  4J5R A;  4J4Z A;  5FSZ A;  5FSY A;  5FSV A;  4ABL A;  2FAV A;  4ETK A;  4TU0 A;  3KQX A;  4ABK A;  1VHU A;  1GYT A;  2LGR A;  5DUS A;  1YD9 A;  3Q6Z A;  1LCP A;  3GPG A;  3SIH A;  4R6T A;  2FG1 A;  5AIL A;  1LAN A;  4GUA A;  4ESS A;  2XD7 A;  3GQO A;  3KR4 A;  3SII A;  1BPN A;  4R7M A;  5CMS A; 
#chains in the Genus database with same CATH homology
 4GVV A;  1ZR5 A;  3H8E A;  3KR5 A;  3VFQ A;  2BFR A;  4ETJ A;  3EWO A;  3EWP A;  5CBM A;  4ZX9 A;  3T8W A;  4ZY1 A;  1BPM A;  4UML A;  3Q71 A;  4ZY0 A;  4K0C A;  4IQY A;  3IID A;  5HOL A;  3V2B A;  3ETI A;  3KZW A;  3GQE A;  1TY8 A;  2L8R A;  3EKE A;  3H8F A;  4D86 A;  5CB3 A;  4ZYQ A;  3EW5 A;  4JVV A;  3PEI A;  4KSI A;  1NJR A;  3EWR A;  2DX6 A;  4ZX8 A;  3EJG A;  1ZR3 A;  4J5Q A;  3H8G A;  3V45 A;  2FXK A;  3IIF A;  5CB5 A;  3GPQ A;  2BFQ A;  4KYB A;  1SPV A;  3EWQ A;  5FSX A;  1LAP A;  3SIG A;  4ZI6 A;  3JRU A;  3KQZ A;  2VRI A;  1BLL E;  4J5S A;  2X47 A;  1HJZ A;  2J9A A;  4GVW A;  3GPO A;  5E3B A;  3IJ3 A;  1TXZ A;  5D8N A;  4JCA A;  4ZY2 A;  4X2T A;  5FSU A;  4K3N A;  2EEE A;  4JGK A;  4R76 A;  2EWB A;  4JLL A;  1LAM A;  3JZT A;  5HIH A;  2AFC A;  3EJF A;  2ACF A;  3SIJ A;  4J5R A;  4J4Z A;  5FSZ A;  5FSY A;  5FSV A;  4ABL A;  2FAV A;  4ETK A;  4TU0 A;  3KQX A;  4ABK A;  1VHU A;  1GYT A;  2LGR A;  5DUS A;  1YD9 A;  3Q6Z A;  1LCP A;  3GPG A;  3SIH A;  4R6T A;  2FG1 A;  5AIL A;  1LAN A;  4GUA A;  4ESS A;  2XD7 A;  3GQO A;  3KR4 A;  3SII A;  1BPN A;  4R7M A;  5CMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...