4GVVA

Crystal structure of de novo design serine hydrolase osh55.27, northeast structural genomics consortium (nesg) target or246
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
165
Chain Sequence
ARIRDVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTALGAWVGGLPAEAVFRVMFEEIKKAPDTLEVTGVHGTEKSAEAGRRATLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target OR246
rcsb
molecule tags De novo protein
molecule keywords De novo design serine hydrolase
total genus 55
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4gvvA00
5FSUA 5CMSA 2VRIA 4ZYQA 4GVVA 2BFQA 1BPNA 1SPVA 3EKEA 5FSZA 4K0CA 3GPGA 4KYBA 1HJZA 2FXKA 4ZY1A 4ABKA 3EWOA 3KR5A 3H8FA 4J5RA 5CBMA 4KSIA 5E3BA 3IJ3A 4JVVA 3EJFA 3KZWA 4ZI6A 5FSVA 3EWPA 4ZX8A 4JLLA 3H8GA 4ZX9A 3SIHA 3EWQA 4ETKA 4GUAA 1LANA 4D86A 1LAPA 3EJGA 3JRUA 3GQEA 1NJRA 3V2BA 3T8WA 1TY8A 2AFCA 4TU0A 3EW5A 3KQZA 4R7MA 4ETJA 2X47A 4R6TA 2FG1A 1ZR5A 5CB3A 5CB5A 2FAVA 2J9AA 1LCPA 2XD7A 3KQXA 3H8EA 3EWRA 5D8NA 4IQYA 4GVWA 5AILA 2ACFA 4JGKA 3Q6ZA 4X2TA 2LGRA 4ZY2A 3Q71A 2EEEA 3ETIA 4ZY0A 4R76A 3GPOA 2EWBA 3VFQA 3GPQA 1BLLE 4J4ZA 2DX6A 3GQOA 3IIDA 5HOLA 2L8RA 1LAMA 1BPMA 3JZTA 3KR4A 4J5QA 5HIHA 3IIFA 3PEIA 1YD9A 1GYTA 3V45A 5DUSA 1VHUA 3SIJA 4J5SA 1ZR3A 4UMLA 4ESSA 1TXZA 5FSYA 4K3NA 3SIIA 4ABLA 3SIGA 2BFRA 4JCAA 5FSXA
chains in the Genus database with same CATH superfamily
5FSUA 5CMSA 2VRIA 4ZYQA 4GVVA 2WCTA 2BFQA 1BPNA 1SPVA 3EKEA 5FSZA 4K0CA 3GPGA 4KYBA 1HJZA 2RNKA 2FXKA 4ZY1A 4ABKA 3EWOA 3KR5A 3H8FA 4J5RA 5CBMA 4KSIA 5E3BA 3IJ3A 4JVVA 3EJFA 2JZDA 3KZWA 4ZI6A 5FSVA 3EWPA 4ZX8A 4JLLA 3H8GA 4ZX9A 3SIHA 2KQVA 3EWQA 4ETKA 4GUAA 1LANA 4D86A 1LAPA 2JZFA 3EJGA 3JRUA 3GQEA 1NJRA 3V2BA 3T8WA 1TY8A 2AFCA 2JZEA 4TU0A 3EW5A 3KQZA 4R7MA 4ETJA 2X47A 4R6TA 2FG1A 1ZR5A 5CB3A 5CB5A 2FAVA 2J9AA 1LCPA 2XD7A 3KQXA 3H8EA 3EWRA 5D8NA 4IQYA 4GVWA 5AILA 2ACFA 4JGKA 3Q6ZA 4X2TA 2LGRA 4ZY2A 3Q71A 2EEEA 3ETIA 4ZY0A 4R76A 3GPOA 2EWBA 3VFQA 3GPQA 1BLLE 4J4ZA 2DX6A 3GQOA 3IIDA 5HOLA 2L8RA 1LAMA 1BPMA 3JZTA 3KR4A 4J5QA 5HIHA 3IIFA 3PEIA 1YD9A 2W2GA 1GYTA 3V45A 5DUSA 1VHUA 3SIJA 4J5SA 1ZR3A 4UMLA 4ESSA 1TXZA 5FSYA 4K3NA 3SIIA 4ABLA 3SIGA 2BFRA 4JCAA 5FSXA
chains in the Genus database with same CATH topology
5FSUA 5CMSA 2VRIA 4ZYQA 4GVVA 2BFQA 1BPNA 1SPVA 3EKEA 5FSZA 4K0CA 3GPGA 4KYBA 1HJZA 2FXKA 4ZY1A 4ABKA 3EWOA 3KR5A 3H8FA 4J5RA 5CBMA 4KSIA 5E3BA 3IJ3A 4JVVA 3EJFA 3KZWA 4ZI6A 5FSVA 3EWPA 4ZX8A 4JLLA 3H8GA 4ZX9A 3SIHA 3EWQA 4ETKA 4GUAA 1LANA 4D86A 1LAPA 3EJGA 3JRUA 3GQEA 1NJRA 3V2BA 3T8WA 1TY8A 2AFCA 4TU0A 3EW5A 3KQZA 4R7MA 4ETJA 2X47A 4R6TA 2FG1A 1ZR5A 5CB3A 5CB5A 2FAVA 2J9AA 1LCPA 2XD7A 3KQXA 3H8EA 3EWRA 5D8NA 4IQYA 4GVWA 5AILA 2ACFA 4JGKA 3Q6ZA 4X2TA 2LGRA 4ZY2A 3Q71A 2EEEA 3ETIA 4ZY0A 4R76A 3GPOA 2EWBA 3VFQA 3GPQA 1BLLE 4J4ZA 2DX6A 3GQOA 3IIDA 5HOLA 2L8RA 1LAMA 1BPMA 3JZTA 3KR4A 4J5QA 5HIHA 3IIFA 3PEIA 1YD9A 1GYTA 3V45A 5DUSA 1VHUA 3SIJA 4J5SA 1ZR3A 4UMLA 4ESSA 1TXZA 5FSYA 4K3NA 3SIIA 4ABLA 3SIGA 2BFRA 4JCAA 5FSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FSU A;  5CMS A;  2VRI A;  4ZYQ A;  4GVV A;  2BFQ A;  1BPN A;  1SPV A;  3EKE A;  5FSZ A;  4K0C A;  3GPG A;  4KYB A;  1HJZ A;  2FXK A;  4ZY1 A;  4ABK A;  3EWO A;  3KR5 A;  3H8F A;  4J5R A;  5CBM A;  4KSI A;  5E3B A;  3IJ3 A;  4JVV A;  3EJF A;  3KZW A;  4ZI6 A;  5FSV A;  3EWP A;  4ZX8 A;  4JLL A;  3H8G A;  4ZX9 A;  3SIH A;  3EWQ A;  4ETK A;  4GUA A;  1LAN A;  4D86 A;  1LAP A;  3EJG A;  3JRU A;  3GQE A;  1NJR A;  3V2B A;  3T8W A;  1TY8 A;  2AFC A;  4TU0 A;  3EW5 A;  3KQZ A;  4R7M A;  4ETJ A;  2X47 A;  4R6T A;  2FG1 A;  1ZR5 A;  5CB3 A;  5CB5 A;  2FAV A;  2J9A A;  1LCP A;  2XD7 A;  3KQX A;  3H8E A;  3EWR A;  5D8N A;  4IQY A;  4GVW A;  5AIL A;  2ACF A;  4JGK A;  3Q6Z A;  4X2T A;  2LGR A;  4ZY2 A;  3Q71 A;  2EEE A;  3ETI A;  4ZY0 A;  4R76 A;  3GPO A;  2EWB A;  3VFQ A;  3GPQ A;  1BLL E;  4J4Z A;  2DX6 A;  3GQO A;  3IID A;  5HOL A;  2L8R A;  1LAM A;  1BPM A;  3JZT A;  3KR4 A;  4J5Q A;  5HIH A;  3IIF A;  3PEI A;  1YD9 A;  1GYT A;  3V45 A;  5DUS A;  1VHU A;  3SIJ A;  4J5S A;  1ZR3 A;  4UML A;  4ESS A;  1TXZ A;  5FSY A;  4K3N A;  3SII A;  4ABL A;  3SIG A;  2BFR A;  4JCA A;  5FSX A; 
#chains in the Genus database with same CATH topology
 5FSU A;  5CMS A;  2VRI A;  4ZYQ A;  4GVV A;  2WCT A;  2BFQ A;  1BPN A;  1SPV A;  3EKE A;  5FSZ A;  4K0C A;  3GPG A;  4KYB A;  1HJZ A;  2RNK A;  2FXK A;  4ZY1 A;  4ABK A;  3EWO A;  3KR5 A;  3H8F A;  4J5R A;  5CBM A;  4KSI A;  5E3B A;  3IJ3 A;  4JVV A;  3EJF A;  2JZD A;  3KZW A;  4ZI6 A;  5FSV A;  3EWP A;  4ZX8 A;  4JLL A;  3H8G A;  4ZX9 A;  3SIH A;  2KQV A;  3EWQ A;  4ETK A;  4GUA A;  1LAN A;  4D86 A;  1LAP A;  2JZF A;  3EJG A;  3JRU A;  3GQE A;  1NJR A;  3V2B A;  3T8W A;  1TY8 A;  2AFC A;  2JZE A;  4TU0 A;  3EW5 A;  3KQZ A;  4R7M A;  4ETJ A;  2X47 A;  4R6T A;  2FG1 A;  1ZR5 A;  5CB3 A;  5CB5 A;  2FAV A;  2J9A A;  1LCP A;  2XD7 A;  3KQX A;  3H8E A;  3EWR A;  5D8N A;  4IQY A;  4GVW A;  5AIL A;  2ACF A;  4JGK A;  3Q6Z A;  4X2T A;  2LGR A;  4ZY2 A;  3Q71 A;  2EEE A;  3ETI A;  4ZY0 A;  4R76 A;  3GPO A;  2EWB A;  3VFQ A;  3GPQ A;  1BLL E;  4J4Z A;  2DX6 A;  3GQO A;  3IID A;  5HOL A;  2L8R A;  1LAM A;  1BPM A;  3JZT A;  3KR4 A;  4J5Q A;  5HIH A;  3IIF A;  3PEI A;  1YD9 A;  2W2G A;  1GYT A;  3V45 A;  5DUS A;  1VHU A;  3SIJ A;  4J5S A;  1ZR3 A;  4UML A;  4ESS A;  1TXZ A;  5FSY A;  4K3N A;  3SII A;  4ABL A;  3SIG A;  2BFR A;  4JCA A;  5FSX A; 
#chains in the Genus database with same CATH homology
 5FSU A;  5CMS A;  2VRI A;  4ZYQ A;  4GVV A;  2BFQ A;  1BPN A;  1SPV A;  3EKE A;  5FSZ A;  4K0C A;  3GPG A;  4KYB A;  1HJZ A;  2FXK A;  4ZY1 A;  4ABK A;  3EWO A;  3KR5 A;  3H8F A;  4J5R A;  5CBM A;  4KSI A;  5E3B A;  3IJ3 A;  4JVV A;  3EJF A;  3KZW A;  4ZI6 A;  5FSV A;  3EWP A;  4ZX8 A;  4JLL A;  3H8G A;  4ZX9 A;  3SIH A;  3EWQ A;  4ETK A;  4GUA A;  1LAN A;  4D86 A;  1LAP A;  3EJG A;  3JRU A;  3GQE A;  1NJR A;  3V2B A;  3T8W A;  1TY8 A;  2AFC A;  4TU0 A;  3EW5 A;  3KQZ A;  4R7M A;  4ETJ A;  2X47 A;  4R6T A;  2FG1 A;  1ZR5 A;  5CB3 A;  5CB5 A;  2FAV A;  2J9A A;  1LCP A;  2XD7 A;  3KQX A;  3H8E A;  3EWR A;  5D8N A;  4IQY A;  4GVW A;  5AIL A;  2ACF A;  4JGK A;  3Q6Z A;  4X2T A;  2LGR A;  4ZY2 A;  3Q71 A;  2EEE A;  3ETI A;  4ZY0 A;  4R76 A;  3GPO A;  2EWB A;  3VFQ A;  3GPQ A;  1BLL E;  4J4Z A;  2DX6 A;  3GQO A;  3IID A;  5HOL A;  2L8R A;  1LAM A;  1BPM A;  3JZT A;  3KR4 A;  4J5Q A;  5HIH A;  3IIF A;  3PEI A;  1YD9 A;  1GYT A;  3V45 A;  5DUS A;  1VHU A;  3SIJ A;  4J5S A;  1ZR3 A;  4UML A;  4ESS A;  1TXZ A;  5FSY A;  4K3N A;  3SII A;  4ABL A;  3SIG A;  2BFR A;  4JCA A;  5FSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...