4GVVA

Crystal structure of de novo design serine hydrolase osh55.27, northeast structural genomics consortium (nesg) target or246
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
165
structure length
165
Chain Sequence
ARIRDVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTALGAWVGGLPAEAVFRVMFEEIKKAPDTLEVTGVHGTEKSAEAGRRATLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target OR246
rcsb
molecule tags De novo protein
molecule keywords De novo design serine hydrolase
total genus 55
structure length 165
sequence length 165
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4gvvA00
3EJFA 1LCPA 3EJGA 4R7MA 2XD7A 4IQYA 3Q6ZA 3EWOA 1GYTA 5HIHA 2EWBA 1VHUA 3ETIA 3KR4A 3SIHA 3KQXA 4ZX9A 3V2BA 4UMLA 3GPOA 2J9AA 5DUSA 5FSYA 4ZYQA 4ZY1A 3H8EA 4JLLA 3GPQA 3SIGA 5CBMA 3Q71A 1LANA 2EEEA 3JZTA 3T8WA 1LAPA 4ETKA 5AILA 1TXZA 1LAMA 3EWPA 2X47A 3SIJA 4J5SA 4ZX8A 2FAVA 4KSIA 2LGRA 5CMSA 3IIDA 4ABLA 1ZR3A 4ESSA 3EKEA 4GVWA 2VRIA 4ETJA 3PEIA 5FSUA 3IIFA 3IJ3A 5FSXA 5CB5A 4J4ZA 4R76A 4X2TA 4ZY0A 3GQOA 3KR5A 4JGKA 2FG1A 2FXKA 5FSZA 3H8GA 4GVVA 5CB3A 4J5QA 2L8RA 3VFQA 4JCAA 3KQZA 1BPMA 4TU0A 4JVVA 4K3NA 4GUAA 3V45A 3GQEA 2AFCA 4KYBA 2DX6A 4R6TA 1SPVA 4D86A 5FSVA 3EW5A 1HJZA 5E3BA 5D8NA 1YD9A 3JRUA 1BLLE 3GPGA 1BPNA 4ZY2A 2BFRA 3SIIA 3EWRA 1TY8A 2BFQA 3H8FA 1NJRA 3KZWA 1ZR5A 5HOLA 3EWQA 4K0CA 4ZI6A 2ACFA 4ABKA 4J5RA
chains in the Genus database with same CATH superfamily
2JZEA 3EJFA 1LCPA 3EJGA 4R7MA 2XD7A 4IQYA 3Q6ZA 3EWOA 1GYTA 5HIHA 2EWBA 1VHUA 3ETIA 3KR4A 3SIHA 3KQXA 4ZX9A 3V2BA 4UMLA 2RNKA 3GPOA 2J9AA 5DUSA 5FSYA 4ZYQA 4ZY1A 3H8EA 4JLLA 3GPQA 3SIGA 5CBMA 3Q71A 1LANA 2EEEA 3JZTA 3T8WA 1LAPA 4ETKA 5AILA 1TXZA 1LAMA 3EWPA 2X47A 3SIJA 4J5SA 4ZX8A 2FAVA 4KSIA 2KQVA 2LGRA 5CMSA 3IIDA 2W2GA 4ABLA 1ZR3A 4ESSA 3EKEA 4GVWA 2VRIA 4ETJA 3PEIA 2JZDA 5FSUA 3IIFA 3IJ3A 5FSXA 5CB5A 4J4ZA 2WCTA 4R76A 4X2TA 4ZY0A 3GQOA 3KR5A 4JGKA 2FG1A 2FXKA 5FSZA 3H8GA 4GVVA 5CB3A 4J5QA 2L8RA 3VFQA 4JCAA 3KQZA 1BPMA 4TU0A 4JVVA 4K3NA 4GUAA 3V45A 3GQEA 2AFCA 4KYBA 2DX6A 4R6TA 1SPVA 4D86A 5FSVA 3EW5A 1HJZA 5E3BA 5D8NA 1YD9A 3JRUA 1BLLE 3GPGA 1BPNA 4ZY2A 2BFRA 3SIIA 3EWRA 1TY8A 2BFQA 3H8FA 1NJRA 3KZWA 1ZR5A 5HOLA 3EWQA 4K0CA 2JZFA 4ZI6A 2ACFA 4ABKA 4J5RA
chains in the Genus database with same CATH topology
3EJFA 1LCPA 3EJGA 4R7MA 2XD7A 4IQYA 3Q6ZA 3EWOA 1GYTA 5HIHA 2EWBA 1VHUA 3ETIA 3KR4A 3SIHA 3KQXA 4ZX9A 3V2BA 4UMLA 3GPOA 2J9AA 5DUSA 5FSYA 4ZYQA 4ZY1A 3H8EA 4JLLA 3GPQA 3SIGA 5CBMA 3Q71A 1LANA 2EEEA 3JZTA 3T8WA 1LAPA 4ETKA 5AILA 1TXZA 1LAMA 3EWPA 2X47A 3SIJA 4J5SA 4ZX8A 2FAVA 4KSIA 2LGRA 5CMSA 3IIDA 4ABLA 1ZR3A 4ESSA 3EKEA 4GVWA 2VRIA 4ETJA 3PEIA 5FSUA 3IIFA 3IJ3A 5FSXA 5CB5A 4J4ZA 4R76A 4X2TA 4ZY0A 3GQOA 3KR5A 4JGKA 2FG1A 2FXKA 5FSZA 3H8GA 4GVVA 5CB3A 4J5QA 2L8RA 3VFQA 4JCAA 3KQZA 1BPMA 4TU0A 4JVVA 4K3NA 4GUAA 3V45A 3GQEA 2AFCA 4KYBA 2DX6A 4R6TA 1SPVA 4D86A 5FSVA 3EW5A 1HJZA 5E3BA 5D8NA 1YD9A 3JRUA 1BLLE 3GPGA 1BPNA 4ZY2A 2BFRA 3SIIA 3EWRA 1TY8A 2BFQA 3H8FA 1NJRA 3KZWA 1ZR5A 5HOLA 3EWQA 4K0CA 4ZI6A 2ACFA 4ABKA 4J5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJF A;  1LCP A;  3EJG A;  4R7M A;  2XD7 A;  4IQY A;  3Q6Z A;  3EWO A;  1GYT A;  5HIH A;  2EWB A;  1VHU A;  3ETI A;  3KR4 A;  3SIH A;  3KQX A;  4ZX9 A;  3V2B A;  4UML A;  3GPO A;  2J9A A;  5DUS A;  5FSY A;  4ZYQ A;  4ZY1 A;  3H8E A;  4JLL A;  3GPQ A;  3SIG A;  5CBM A;  3Q71 A;  1LAN A;  2EEE A;  3JZT A;  3T8W A;  1LAP A;  4ETK A;  5AIL A;  1TXZ A;  1LAM A;  3EWP A;  2X47 A;  3SIJ A;  4J5S A;  4ZX8 A;  2FAV A;  4KSI A;  2LGR A;  5CMS A;  3IID A;  4ABL A;  1ZR3 A;  4ESS A;  3EKE A;  4GVW A;  2VRI A;  4ETJ A;  3PEI A;  5FSU A;  3IIF A;  3IJ3 A;  5FSX A;  5CB5 A;  4J4Z A;  4R76 A;  4X2T A;  4ZY0 A;  3GQO A;  3KR5 A;  4JGK A;  2FG1 A;  2FXK A;  5FSZ A;  3H8G A;  4GVV A;  5CB3 A;  4J5Q A;  2L8R A;  3VFQ A;  4JCA A;  3KQZ A;  1BPM A;  4TU0 A;  4JVV A;  4K3N A;  4GUA A;  3V45 A;  3GQE A;  2AFC A;  4KYB A;  2DX6 A;  4R6T A;  1SPV A;  4D86 A;  5FSV A;  3EW5 A;  1HJZ A;  5E3B A;  5D8N A;  1YD9 A;  3JRU A;  1BLL E;  3GPG A;  1BPN A;  4ZY2 A;  2BFR A;  3SII A;  3EWR A;  1TY8 A;  2BFQ A;  3H8F A;  1NJR A;  3KZW A;  1ZR5 A;  5HOL A;  3EWQ A;  4K0C A;  4ZI6 A;  2ACF A;  4ABK A;  4J5R A; 
#chains in the Genus database with same CATH topology
 2JZE A;  3EJF A;  1LCP A;  3EJG A;  4R7M A;  2XD7 A;  4IQY A;  3Q6Z A;  3EWO A;  1GYT A;  5HIH A;  2EWB A;  1VHU A;  3ETI A;  3KR4 A;  3SIH A;  3KQX A;  4ZX9 A;  3V2B A;  4UML A;  2RNK A;  3GPO A;  2J9A A;  5DUS A;  5FSY A;  4ZYQ A;  4ZY1 A;  3H8E A;  4JLL A;  3GPQ A;  3SIG A;  5CBM A;  3Q71 A;  1LAN A;  2EEE A;  3JZT A;  3T8W A;  1LAP A;  4ETK A;  5AIL A;  1TXZ A;  1LAM A;  3EWP A;  2X47 A;  3SIJ A;  4J5S A;  4ZX8 A;  2FAV A;  4KSI A;  2KQV A;  2LGR A;  5CMS A;  3IID A;  2W2G A;  4ABL A;  1ZR3 A;  4ESS A;  3EKE A;  4GVW A;  2VRI A;  4ETJ A;  3PEI A;  2JZD A;  5FSU A;  3IIF A;  3IJ3 A;  5FSX A;  5CB5 A;  4J4Z A;  2WCT A;  4R76 A;  4X2T A;  4ZY0 A;  3GQO A;  3KR5 A;  4JGK A;  2FG1 A;  2FXK A;  5FSZ A;  3H8G A;  4GVV A;  5CB3 A;  4J5Q A;  2L8R A;  3VFQ A;  4JCA A;  3KQZ A;  1BPM A;  4TU0 A;  4JVV A;  4K3N A;  4GUA A;  3V45 A;  3GQE A;  2AFC A;  4KYB A;  2DX6 A;  4R6T A;  1SPV A;  4D86 A;  5FSV A;  3EW5 A;  1HJZ A;  5E3B A;  5D8N A;  1YD9 A;  3JRU A;  1BLL E;  3GPG A;  1BPN A;  4ZY2 A;  2BFR A;  3SII A;  3EWR A;  1TY8 A;  2BFQ A;  3H8F A;  1NJR A;  3KZW A;  1ZR5 A;  5HOL A;  3EWQ A;  4K0C A;  2JZF A;  4ZI6 A;  2ACF A;  4ABK A;  4J5R A; 
#chains in the Genus database with same CATH homology
 3EJF A;  1LCP A;  3EJG A;  4R7M A;  2XD7 A;  4IQY A;  3Q6Z A;  3EWO A;  1GYT A;  5HIH A;  2EWB A;  1VHU A;  3ETI A;  3KR4 A;  3SIH A;  3KQX A;  4ZX9 A;  3V2B A;  4UML A;  3GPO A;  2J9A A;  5DUS A;  5FSY A;  4ZYQ A;  4ZY1 A;  3H8E A;  4JLL A;  3GPQ A;  3SIG A;  5CBM A;  3Q71 A;  1LAN A;  2EEE A;  3JZT A;  3T8W A;  1LAP A;  4ETK A;  5AIL A;  1TXZ A;  1LAM A;  3EWP A;  2X47 A;  3SIJ A;  4J5S A;  4ZX8 A;  2FAV A;  4KSI A;  2LGR A;  5CMS A;  3IID A;  4ABL A;  1ZR3 A;  4ESS A;  3EKE A;  4GVW A;  2VRI A;  4ETJ A;  3PEI A;  5FSU A;  3IIF A;  3IJ3 A;  5FSX A;  5CB5 A;  4J4Z A;  4R76 A;  4X2T A;  4ZY0 A;  3GQO A;  3KR5 A;  4JGK A;  2FG1 A;  2FXK A;  5FSZ A;  3H8G A;  4GVV A;  5CB3 A;  4J5Q A;  2L8R A;  3VFQ A;  4JCA A;  3KQZ A;  1BPM A;  4TU0 A;  4JVV A;  4K3N A;  4GUA A;  3V45 A;  3GQE A;  2AFC A;  4KYB A;  2DX6 A;  4R6T A;  1SPV A;  4D86 A;  5FSV A;  3EW5 A;  1HJZ A;  5E3B A;  5D8N A;  1YD9 A;  3JRU A;  1BLL E;  3GPG A;  1BPN A;  4ZY2 A;  2BFR A;  3SII A;  3EWR A;  1TY8 A;  2BFQ A;  3H8F A;  1NJR A;  3KZW A;  1ZR5 A;  5HOL A;  3EWQ A;  4K0C A;  4ZI6 A;  2ACF A;  4ABK A;  4J5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...