4GVXA

Crystal structure of a short chain dehydrogenase homolog (target efi-505321) from burkholderia multivorans, with bound nadp and l-fucose
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
258
structure length
258
Chain Sequence
MDLNLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPDGAFLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVNDGIGLDAGRDAFVASLERNLIHYYAMAHYCVPHLKATRGAIVNISSKTAVTGQGNTSGYCASKGAQLALTREWAVALREHGVRVNAVIPAEVMTPLYRNWIATFEDPEAKLAEIAAKVPLGRRFTTPDEIADTAVFLLSPRASHTTGEWLFVDGGYTHLDRALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Crystal structure of a short chain dehydrogenase homolog (target EFI-505321) from burkholderia multivorans, with bound NADP and L-fucose
rcsb
source organism Burkholderia multivorans
molecule tags Oxidoreductase
total genus 91
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gvxA00
1PZHA 1PJCA 1TXGA 4ZGWA 2POQX 5DBGA 4URFA 4GMFA 4RVFA 5FI3A 1PJ4A 2CFCA 4A0SA 3ONFA 3IJPA 4CQLA 3F4LA 2PTGA 4L75A 2GDZA 5TIIA 4J4TA 1GCOA 4DQXA 5IZ4A 1XEAA 3LU1A 2FN7A 1P33A 2I3GA 3D0OA 3DO5A 1I0ZA 1KEWA 3VH1A 1M66A 1DC6A 3JQGA 4XKJA 3TL2A 5JO0A 4FC7A 4CQMA 4E5KA 1YL5A 2P9EA 4W82A 4GSLA 1J6UA 3WTCA 2Z95A 2UYYA 5ER9A 1O9BA 4OHUA 1LSSA 1JN0A 1C0PA 4GWGA 3F5SA 4OYRA 1T26A 3GAZA 2AEJA 4R3NA 3NAQA 1E3SA 2CF5A 1EVYA 4IS3A 4ZQEA 3IAHA 3NRCA 1IZ9A 3D5TA 4A7PA 2PZLA 3BMQB 5L3ZA 2PKQO 4BO5A 2I3AA 1KERA 3DBVO 4GAEA 1LA2A 1TI7A 4EJ0A 5EQFA 2ZATA 5DOZA 3G79A 2B5WA 4AJEA 2VN8A 3HSKA 5JFOA 3QWBA 4FFLA 1ISJA 4RGBA 1WW8A 3W8FA 3KYCB 2JKVA 3WGZA 3SJ7A 4PLZA 4FC6A 1O89A 1PGOA 1A7AA 2B37A 2PD6A 3RAJA 3DEYX 1GR0A 3UH1A 3EC7A 3SVTA 3CIFA 3K96A 1DAOA 4G5HA 5JC8A 3GRPA 1H0KA 2Q2VA 3S2FA 5CDGA 3JD2A 4IGEA 5L51A 3CZRA 4RF4A 4R1SA 4ZA2A 1T1RA 1EUZA 3EZLA 3KLMX 4Q3DA 1ISFA 3F5QA 2DTXA 3DOOA 2AW5A 3NGLA 1PR3A 2AQKA 3B1FA 3OJEA 4R1UA 1HDGO 1I8TA 4YEDA 1ENPA 3WGQA 2Y68A 3E9MA 1FF9A 1QMGA 1UUFA 1DO8A 4MKZA 5G0SA 2OXIA 3JYPA 4PLYA 4IM7A 1YE3A 4FSHA 4O5OA 5G0UA 5KJ1A 1QV6A 3WQRA 1W4ZA 4HKTA 2GO1A 3TZCA 4EUFA 1IB6A 4Z0TA 3W6ZA 1SCUA 4CPDA 3DZHA 1HETA 1ONPA 1AUPA 3FBTA 1N7HA 1LEHA 2X9VA 2X58A 1EQUA 5JYDA 1EK6A 3RD5A 4P8RA 4IQGA 2PKRA 1E3WB 1L1FA 1VKNA 5IAAA 1P44A 2NU8A 2YZ7A 1E7RA 4A73A 2WD7B 4IJUA 3WIEA 2O48X 3UCFA 4DPLA 2IEBA 4CV1A 3E8XA 4JP3A 4CM9A 1AHHA 3QQPA 3C85A 5U9CA 2OORA 3HQ4O 1RJWA 2OO5A 1UH5A 1Y8RA 3K92A 3JYNA 1UXIA 3D4PA 4R69A 2EERA 1SOVA 3L4BA 1GQYA 4K1LA 4KUHA 3FI9A 5BNTA 3L0DA 5TSDA 1P45A 5L4LA 4MVJG 3VZRA 4GGOA 4JJFA 3OJOA 4CM7A 3MCVA 1EE9A 4YA6A 3VZQA 5ILOA 1ID1A 3RBXA 5L4NA 2CVOA 4CQLB 3M2PA 2Q4EA 2I6TA 3OQBA 3G3EA 2X1HA 3RROA 4IMRA 3LT4A 2B35A 1NQ5A 4CQMD 4N54A 4NBUA 3PK0A 3JQGB 2F00A 4Z0HO 2NTVA 3L6EA 3Q2KA 4NQZA 5L7YA 2JFHA 2OP1A 4PG8A 3D3WA 3PHIA 5DULA 2QG4A 2QX7A 3L6DA 4JNKA 1MV8A 3PJDA 4NMHA 1CF2O 4OKNA 1BDBA 1PL7A 3DZGA 4M55A 3VHRA 3ZH2A 3WWYA 4DREA 3EY4A 4EI2A 4U0KA 1A7KA 4JLWA 3IUPA 4I5DA 4OQZA 2AQIA 2CSUA 4BO6A 3FF4A 4L4XA 1T25A 2G17A 3TOZA 3FNGA 3R3SA 1R16A 3GOHA 4XDZA 4BO0A 2HJRA 2ZB3A 3UICA 5CDUA 4E2ZA 3QY9A 1Y5RA 4YT8A 5EMHA 4FB5A 4WCDA 2F1KA 4XGNA 2P9CA 1O5IA 2X8LA 3DFZA 3K2EA 4M1QA 3IC5A 4D46A 4DIBA 1WMAA 3WQSB 3L4BC 4YJGA 5THQA 4CV2A 4Q3EA 5EINA 1GADO 3I9NA 2EKQA 2GF2A 4KTTE 1NFFA 6LDHA 3PVZA 1E5QA 1WZIA 2WWRA 4XYGA 4E32A 3OECA 3QJ5A 3K2BA 3MJSA 4EW6A 3LZ6A 4DBVO 2ZYAA 3MOIA 3P7MA 3V1UA 4L4RA 3G17A 1Z7EA 5ES3A 2GN8A 4LMPA 2Z5LA 3I1JA 1WPQA 1PZGA 1SNYA 2EEZA 3LK7A 5IDWA 3E1KA 3H6KA 3DOJA 2EV9A 5GY7A 4EBFA 1QYCA 4BNTA 5A9SA 2DAPA 3AI3A 1EFKA 4Y9DA 1U3WA 2QQ5A 3MWDB 2ZB8A 3E6AA 3O26A 3ZWAA 5F21A 2O2YA 1UDAA 3LC7O 4JBHA 1Z6ZA 1GUYA 3HZZA 2O7SA 4WLVA 3DC2A 3VDRA 4W4TA 3AFMA 5B4UA 3MJVA 1FK8A 1PGPA 1O6ZA 3I3OA 3AI2A 1HXHA 4YQZA 4TWRA 4DUPA 4RVGA 1PR9A 1F14A 2A92A 3F47A 4CM6A 4NBTA 5IDXA 4Z9FA 1HDRA 3L4SO 1WVGA 1NHGA 3VPFA 3ZWBA 2ZCUA 4BNMA 4CM9D 5CDYA 2UAGA 1XCBA 5GZ6A 2Q4BA 2VWPA 1GZ4A 3PJGA 1LLCA 4H15A 1M6WA 5JO9A 4Z3KA 2FHSA 4R3WA 1NVMB 3DZBA 2X7HA 3E18A 4WCFC 5C7OO 1Y8RB 1ZMTA 1Y7TA 3TFOA 1GDHA 2WM3A 5CAEA 4RPGA 2CZCA 2O3SA 3H2SA 5AQ1A 5BQFA 4J0FA 4IDCA 4HP8A 2RAFA 3GDOA 1TA4A 2NV6A 4EITA 5A06A 4GPD1 2OFPA 2R6JA 5H81A 5F1KA 1I01A 4FIZA 2WD8A 4BKOA 3C1OA 1PQUA 2H9IA 1XELA 1NAIA 3M2TA 4MIOA 4BGIA 4RZHA 1MLDA 2NADA 1XHLA 2ZTMA 2GR9A 1GYQA 3H9UA 1EUCA 1MC4A 4Y6PA 1I3LA 3DDNA 4QFDA 4YRBA 2P9GA 5I9MA 3D3WB 4Y98A 2AEMA 3WDSA 1R12A 1U4OA 4MVJI 3MWEB 1PJLA 4YR9A 1YB1A 3PRJA 3INGA 4I9UA 1CQJA 4N18A 4DC1A 2X0NA 3IQDB 4TKLA 5IF3A 3R1IA 2P5UA 1HDXA 4E5MA 1KEPA 3DHYA 1FDTA 4JBGA 4MPDA 5KJ6A 3WOHA 2VYNA 3GMSA 5JMWA 4OMUA 1R0SA 2J8ZA 4XQEA 4ZICA 3TDKA 1HZJA 2PGLA 3VPXA 2A4KA 2Y1GA 3ZNNA 3LDHA 4XB1A 1BHSA 3P19A 2DUWA 1GQ2A 3K73O 1M2WA 4AJ2A 4PGFA 4WCFB 4U6QA 5KTKA 1IPEA 3WGGA 1HRDA 4GKBA 1KETA 1JVSA 1YOVA 5JBIA 2IDZA 1BG6A 3O38A 2PR2A 4P38A 1VLLA 1ISGA 3QLJA 3BXXA 4RVDA 3JQCA 2O3UA 3W8EA 4BNFA 2HSDA 4CMCA 4LGVA 3ORFA 4D45A 2EWMA 1SZJG 2PH3A 2I67A 4FDAA 4E3ZA 5A9SB 2NVWA 2V6MA 3TSCA 3KO8A 1UP6A 1IUKA 1VE9A 3QVSA 4MIEA 1IHYA 4YAIA 5AXDA 1BWSA 4YVFA 1W0CA 2DQ4A 5DBIA 1KYQA 5KVCA 4L73A 1DRUA 3RVDA 1NQAO 4BS9A 4NI5A 1ZFNA 4XYLA 1GUFA 4WOKA 2BKAA 4RVSA 4O59O 1CRWG 5JAZA 4QUKA 1UR5A 2PGJA 3V2HA 4U8GA 3TJRA 5B4TA 4NR0A 2EXXA 3COSA 2JCVA 1CERA 1TVEA 5B1YA 4F45A 2JAPA 5GMOA 4BO8A 4IJVA 3ZU4A 3F3SA 3GFGA 3H3FA 1KEUA 4D3DA 3UKOA 2FSSA 4INAA 3GNQA 4R9SA 3NT2A 2D3TA 4LVCA 5JMPA 1PU2A 1NPYA 3ZN2A 4ZQBA 4R51A 1IULA 2QHXA 2NQ8A 4OXNA 3MTGA 2X9NA 3TN7A 5ENVA 3AY6A 5I8ZA 3RI3A 3U4DA 3ZW9A 5T64A 4KMSA 3AW9A 1B26A 4FQ8A 3UGKA 1N92A 2D1YA 4DVJA 5U4QA 2CMDA 2HMSA 1SC6A 1Y8QA 2UVDA 4WE3A 3LVFO 4WLNA 4R54A 1F17A 1X14A 4B8WA 1XIVA 3G1TA 5FI5A 1VL0A 3RUEA 3ZWYA 1A71A 3KUXA 4PN3A 3JQ6A 1CYDA 1Y6JA 1MGOA 2FRDA 1NM5A 4FFMA 4TQGA 4ZQGA 5AVOA 2FSVA 4BB5A 4OM8A 4YAGA 3H5RA 4LMRA 1GAEO 4Q3BA 1J49A 3K30A 4B4WA 3RASA 3AUUA 2W98A 2VTDA 3F9IA 3VAZA 1E7MA 3FPCA 1V0JA 2FMUA 2X23A 4DMLA 4UREA 4AJ4A 1C0LA 4BQPA 3GDGA 3GG2A 4LSWA 4CUJA 1MUUA 1YGYA 2VYND 2H6EA 3DR3A 4CLRA 1PX0A 1PTJA 1DPGA 4F6LA 1HDCA 2DBQA 5DN9A 2V6FA 4IS2A 1TT5A 4IZHA 1JQBA 4W6ZA 4BNXA 1Y9EA 2G5CA 1T4BA 4GX5A 1ZSYA 4IQ8A 4J9VA 1BSVA 3OJ0A 2BMAA 3ZU3A 1YOVB 5G0TA 1IPFA 4XGKA 2HAEA 5LCXA 5A3JA 3S2IA 4XR4A 3WJ7A 3GDFA 2XXBA 4MVJA 1EVJA 1LDEA 1E1MA 2Q50A 1Z73A 4L4SA 4ND1A 2RBEA 4PLHA 2WTBA 1F8GA 4GI2A 5JC1A 1X13A 1E5LA 3HG7A 2P91A 1TT7A 4NG5A 4AFNA 3WG9A 1VRWA 3D7LA 4DQUA 1C14A 4QFCA 3GAFA 4HFJA 2VT2A 3ONDA 1LTHR 5IJZA 3S1LA 1A72A 2HK9A 4DA9A 5DCUA 3CKYA 3H3JA 1Z7BA 3KZVA 4JGBA 3KSZO 2X86A 4ZN6A 1MXFA 4J6FA 1HDZA 1PGQA 3C8MA 3PZBA 4MVJP 4MOWA 3GZ4A 2XOXA 2YDXA 3D5QA 2W2LA 3GUYA 1E6EA 3CINA 2P4HX 3HNPA 4IUYA 3TL3A 1EBFA 1MB4A 2AG5A 3VPSA 2P5YA 3PTZA 1B8PA 2EW8A 3PYLA 3GN1A 2AHRA 2GSDA 4UVHA 3E5MA 4R1NA 4LVUA 3L9XA 3RFVA 2I99A 4IIVA 4ND2A 4BNLA 3SEFA 2I76A 2VRCD 1M76A 1HE5A 1GZ6A 4E33A 4NZ9A 4PRKA 3A9WA 1Y1PA 4JP2A 2JAHA 1GL3A 3HDYA 4GX1A 1U8FO 4IY1A 4II2A 5DCYA 3WYCA 5KCZA 5TJ9A 4ZRNA 1Q0QA 2BGLA 4NPCA 1Y8QB 4EUHA 1HF3A 3ZHXA 4CLOB 5HRUA 1AE1A 2X6TA 1LC3A 1P1IA 3AWDA 4ZHSA 3NGXA 3NX4A 1OZAA 3AOGA 2BLLA 1CEQA 3UFXA 3VKUA 1PJ2A 2NLOA 3V1TC 4DLLA 1W8DA 3MJEA 2IE0A 2ZQZA 2AEFA 2VHWA 4WUVA 1T2DA 1ZXBA 4J1SA 4IDEA 1NAHA 4W7IA 4A5OA 4B8ZA 1LDYA 4B3IA 1YJQA 2YHUA 1D8AA 1YWGO 3FN4A 3GA0A 1GFSA 3W4KA 4OIMA 2CY0A 2GERA 5TT1A 2QYSA 1ZUD1 3WLFA 4J4BA 4M8SA 2DC1A 4RLSA 4JJIA 3ZW8A 2E4AA 3BA1A 3C3XA 3EVNA 3FPLA 2QYTA 2GLXA 2WYWA 4E2XA 4E5PA 5ITWA 1M6HA 4ALLA 4XCVA 4D42A 1WLYA 1N8KA 1ZVMA 3KHUA 1KVUA 4RQUA 4DIFA 3WMXA 4B7UA 3ZV6A 3PHJA 1A5ZA 1F12A 3P2OA 1RKXA 1TT5B 3WX0A 4CUZA 3JD4A 1N7GA 5G4LA 3RQSA 3WYBA 3I52A 1AXEA 4CLHA 1QV7A 1YKFA 2CNBA 4I08A 1X7GA 4EYEA 1N2SA 1DJQA 4MVJD 1U7HA 1YJ8A 5IN4A 4MP3A 1Z82A 3GVHA 1A9YA 4FFNA 1GEGA 1V3TA 2NM0A 5T57A 3U3XA 4WPGA 8LDHA 3O03A 1FDWA 4PCVA 1CJCA 4BIIA 4Q3NA 5DT9A 2HK7A 4RF5A 4BO3A 3DBRB 1IOLA 4ILKA 4ZQFA 5FF9A 4J49A 1Q1NA 2OUIA 2XPCA 3K5PA 1B16A 1KVRA 1LLQA 3KXDA 3LF2A 4CM4A 2GASA 3HFGA 3WNVA 4XZ3A 5JNLA 1EVIA 3HN2A 3L07A 1UXHA 3FTPA 4A26A 4K6CA 4HWKA 1DRVA 1V9LA 2I66A 4H3VA 4XB2A 4U7WA 2PNFA 2V7PA 2VHZA 4TZTA 4AJLA 4OXKA 3UUWA 1I2CA 3Q11A 1X1EA 1Z74A 4EJMA 3VVBA 5T5QA 4PIVA 4R01A 3ETEA 4HNHA 2HDHA 4A27A 3F1KA 3PJEA 2C2YA 2FY8A 4TVOA 5C7IO 1PZEA 3Q6IA 1BVUA 1JAXA 3DBLA 5BNFA 3U9LA 4I9HA 1E6WA 3VZPA 8ADHA 5K6AA 2Q2QA 3KYBA 3PFFA 1NX6A 3QWFA 1KVSA 3S2EA 1EMDA 3VKVA 4BNYA 1ZZEA 3ZWOA 1UXGA 4YRDA 3UN1A 2X5KO 1JVBA 3CSDA 2NUAA 3CXRA 4J1NA 2D59A 1V3VA 3WMWA 4EEXA 3CZMA 4J9UE 1U9JA 1TLTA 3LF1A 3H2ZA 2BD0A 4AJNA 2C7GA 2BRUA 5KKAA 1YL7A 3A1NA 3ONEA 5IDYA 2A94A 3OQ6A 1Y5MA 1P1KA 3UW3A 1QRRA 3UCXA 3OJLA 1D3AA 4DQVA 2QIOA 2PFGA 3I9LA 4KTVE 2FR0A 3E03A 3M1AA 1EUDA 4TRRA 1SMKA 4XJSA 4G65A 1ULSA 1DFIA 1V6AA 2ZTUA 4DPMA 5ICSA 1SO8A 3RWBA 1LLUA 5I7VA 2O3JA 2HMTA 1B7GO 3ITKA 4CV0A 3GF4A 4CM1A 4ND3A 2Q1SA 4HX5A 3IKTA 1B3BA 3RSHA 3M6IA 2RIRA 4UVGA 3WTBA 1DIHA 4J7CA 1IHXA 3ADPA 2WDZA 2Y0EA 5EL0A 2X4GA 2Y99A 1UP7A 2Z1NA 1N9GB 4YWJA 2Y1OA 1I30A 1DC4A 3EDMA 1P0FA 4PG7A 5K6AC 4ZRMA 5LDHA 5JLAA 1DRWA 4OAQA 1ZMOA 4XWYA 3C24A 1LQUA 1A27A 3I6IA 1L7DA 4I8XA 4OO3A 4UEJA 4BL5A 2WYVA 5HA5A 3H4VA 3PIDA 3ZU5A 2GUGA 4ALMA 1YDEA 1UXKA 2YDYA 2NU6A 1QYDA 2LDXA 4O0LA 3JQ9C 1LNQA 2C0CA 1X15A 4CR8A 1YBVA 1X7DA 2GCGA 2C07A 3U49A 2HRBA 2VNSA 3S8MA 1Y9AA 4HFNA 2BH9A 1ZK3A 4CMBA 5JSFA 3C7DB 5I7EA 3GEDA 1P1FA 4UVIA 1U4SA 4S1VA 1E1LA 4CM4B 1DB3A 3OMLA 3IL2A 3B20A 4AJJA 3MJ4A 5CDSA 3WNQA 5C7LO 1ZKMA 1RWBA 1P9LA 3BYZA 4B3HA 5KKCA 4NU5A 4LSMA 4GLOA 2WJPA 1DHRA 3A4VA 2VZ9A 4DLBA 5ILGA 4YT2A 1LRLA 4XGIA 1UAGA 2X5JO 4IJWA 1T2AA 4XIJA 5AYVA 2VT3A 1NFRA 3KM0A 3RKUA 3HWRA 1CWUA 2I5PO 5EQDA 2QRKA 9LDBA 2ZB4A 2JFFA 1XDWA 3AUTA 3QRWA 4O63O 4D3FA 3PHHA 5A5EA 2Y67A 4JROA 1QG6A 2RHCA 3ZGYA 2V6GA 4JQCA 3B1JA 1UZMA 3GGGA 3U4HA 1MFZA 3QIVA 3DBLB 3EAGA 3MZ0A 3MTJA 1ADGA 5COQA 4W99A 4U0JA 4HUJA 4CLXA 1QP8A 3GVCA 4L8VA 2GNAA 4L9RA 5ITVA 1WNTA 4PVCA 4WCFA 5C3MA 4WKGA 1Y81A 1PZFA 4I5FA 4NBWA 2X0RA 1XLTA 2PY6A 1GZ3A 1H94A 3ZWWA 3JD3A 4EDFA 3KTDA 4I1IA 2IZ0A 1GQQA 3DONA 2OP0A 2YHIA 1T1SA 4WLEA 1V35A 1U3UA 3SXPA 1C3VA 4Y6SA 1EDOA 5MGBA 2B4RO 3V8BA 1J5PA 2P2SA 3BMOA 5F5LA 1U2DA 3Q0EA 3OFSA 3ZNOA 4YTEA 3H8VA 3Q3CA 3TWOA 3ZCXA 1EVZA 3D4OA 5KJEA 3JQAA 3W6UA 4GX2A 2DLDA 3LC2O 1UJMA 1EDZA 1U28A 2O50A 5AOVA 5TQVA 4BKQA 3ETGA 4XYMA 3AI1A 3JD0A 4HADA 4MO2A 1KEVA 1CDOA 2YFQA 4XYEA 3KB6A 4IPTA 3ZV4A 2PLAA 2G82A 2YQ5A 3DOCA 4TKMA 3SLKA 3FWZA 3EW7A 4MIYA 3FWNA 4LCEA 4YB8A 5L7TA 1WDKA 4YRAA 3E48A 2DFDA 5A04A 1JW9B 2ZTLA 1GEEA 3EK2A 3KYDA 4YAKA 3GRKA 3FCOA 1SOWA 3H9QA 3DFUA 3WSVA 3X2FA 1NPTO 3KSDO 5HWSA 3UOGA 4GLLA 3BMNA 1NBOA 2ZK7A 3FHLA 2VNAA 3QWHA 1E7SA 4W7HA 5JCJA 5JYEA 5LDGA 4NBVA 4A10A 1XGKA 1DIBA 3HDQA 2B4QA 5A9TA 1HL3A 2AG8A 5U1PA 2ZB7A 3G0OA 3E82A 4HNGA 2CDBA 3MJTA 3GG9A 3GEMA 5T67A 2BGKA 4PLCA 3ANMA 3FBGA 5BT9A 4KDFA 4RF3A 4ONEA 1DC5A 4GKVA 4PLVA 3U4CA 2ZTVA 4FGSA 4BNVA 1JWBB 6ADHA 5AXCA 2RH4A 2VWHA 5B4VA 4XA8A 3ZV3A 3W4IA 2PD3A 1LDMA 1YL6A 2O3RA 4FOSA 1B8VA 1DOHA 3ZHZA 4D43A 5B37A 3EHEA 2YV1A 4J16A 1HT0A 5IN5A 2J5QA 3VH3A 1R0KA 4BGEA 5TT0A 5KJFA 2HUNA 1EBUA 1DIRA 1VL6A 4OL9A 4NU6A 1B3RA 3GLQA 4WOJA 5CPBA 5HS6A 1BRMA 5CEEA 2YFHA 1MG5A 5DZSA 1OC4A 4Q3CA 4F6CA 3GUCA 2FZEA 3C1AA 5DF1A 1ZBQA 2D4AA 4BVAA 4MVJE 3ZWXA 2AE2A 4LK3A 1N1GA 1RYDA 4J0EA 2J3JA 3QVTA 2C29D 4DYVA 2RH8A 2CUKA 3JYLA 3GY0A 2QRLA 3SLGA 3PWZA 4ZVVA 1ZCJA 4ALJA 2O23A 1OC2A 5G4KA 4BQRA 3BZUA 3NDIA 1YDWA 4ND4A 3RFXA 5A5FA 4YYZA 2BI7A 3PDJA 2Y93A 2WYUA 5HTOA 2G0TA 3MJCA 4KQXA 4PFJA 3ZU2A 3U5TA 2AMFA 4I5EA 4NH4A 1ZEJA 2YHIB 1Q7BA 2B5VA 3WICA 1CIVA 1KVQA 2C7VA 3PWSA 3DTTA 2NTNA 5F3RA 5TJHA 1C1XA 1YRLA 4FN4A 2JHFA 1T2FA 3UXYA 3ZWNA 2Y1DA 3RUCA 3OA2A 1K5HA 4RPKA 3BMOB 1PS0A 2DPGA 2CDCA 1NASA 3RU9A 1DAPA 4BNJA 3JQAD 4FD3A 4Z3DA 1PIWA 4N5MA 1X7HA 2UDPA 3GK3A 4L76A 3JQAB 4ID9A 2AA3A 4M86A 2ILTA 2AXQA 2C20A 1E3IA 1KY4A 2IYPA 4JK3A 5TX7A 3GZNB 4BNKA 2CF6A 2YW9A 2JHGA 2DU8A 1HZZA 2JD0A 4PG5A 1VKOA 2EW2A 2PZMA 5EJ2A 3T7CA 2BF7A 2I65A 3RU7A 1EQ2A 3M1LA 1KC3A 2Q3EA 1MP0A 3H9GA 4JX8A 4IGFA 3KOUA 4IMPA 1MC5A 4IXTA 4A03A 5KVVA 4P4GA 1HWYA 1SBYA 3ICPA 4PLTA 3VPGA 1MG0A 2D8AA 2NU7A 2J5RA 5DCWA 4N5LA 5JE8A 4B4UA 4CM3A 5A03A 3KYDB 7ADHA 3QV1A 4LISA 5COBA 3TFQA 5JCJD 4J1TA 1RM3A 3BMNB 1YB4A 5L95A 4WECA 1HSOA 2HKIA 3PZRA 4BNWA 3RC1A 3TZHA 5CFZA 1I3KA 3U62A 1LRKA 4MP6A 5BSEA 4P4NA 3BHJA 3FTNA 5KVSA 3D1LA 4AJOA 1P77A 2B36A 5CEFA 1TEHA 1BW9A 1R4MA 4CLOA 1YXMA 1BGVA 4EZBA 3VH2A 3E5RA 2JL1A 2FR1A 3H5AA 4FS3A 1BTOA 2Q2WA 4UAGA 3RUDA 3NV9A 1NXQA 2R00C 3B1KA 1YQDA 4J7UA 5MDHA 3PIIA 5TF4A 1UP4A 4KUGA 5C37A 3GH3A 1QORA 1P31A 4KDEA 3RFTA 1GU7A 3CE6A 3L9WA 1BDMA 1Z75A 4L0QA 4CM8A 1K6XA 4NDNE 5KVQA 1P1RA 4CV3A 4KP7A 3FR8A 3T4EA 1E0DA 1ARZA 3INRA 1VI2A 2IEDA 2QW8A 1QYXA 3IUSA 4AJIA 4AVYA 2QRJA 5I8WA 3R0IA 3PHGA 4RQTA 4UUNA 1ZJZA 3IIEA 1ISMA 1KC1A 5LC1A 4HXYA 2E49A 2HRZA 2JFGA 5EPOA 4NJOA 4CM5A 5BR7A 3VVCA 1A4IA 4KUEA 2Y1CA 4BV9A 2W2KA 2PKQP 1VM6A 1H2HA 4R68A 3TRIA 5G4KB 2BFOA 4D0RA 2OBNA 2NSDA 4XJTA 5JS6A 3VDQA 1ZK1A 5HBRA 3ROKA 5TC4A 1J0XO 4D44A 2WEKA 4TRNA 3BTOA 4BV8A 4DL9A 1R6DA 4E2YA 1WWKA 3PYMA 2NVBA 1JKFA 1HKUA 4IIUA 3EZYA 1C1XB 2O3QA 4C4OA 4FFPA 3X2EA 2VCYA 3E9NA 3HN7A 4FJ2A 3ZHBA 4DTIA 3GGPA 2Y1FA 3ULKA 2VUSA 4PZEA 1GCUA 3LYLA 3DBRA 5DP1A 2I9PA 1NR7A 1DLIA 4W9NA 2DT5A 5FFFA 3GPDG 4FPXA 3E9QA 4RV9A 1PL6A 1IY8A 4M54A 4ALKA 4KOAA 4GH5A 3DAFA 4EJ6A 3DWFA 3FSRA 2TMDA 5GZ3A 3WGTA 4M87A 5L9AA 5CHEA 4BO2A 2D5CA 4GSKA 4XQCA 4IBOA 4R41A 4UVDA 1N5DA 1NPDA 3ROPA 3L77A 1BVRA 3NEPX 3KEQA 4OGWA 4B7XA 3PI7A 4XIYA 1C1DB 4XEHA 1X0VA 1KS9A 4WASA 5JAMA 3RJ9A 4E13A 4FFRA 5KOIA 1XU9A 1B8UA 1ZJYA 4RF2A 1EE2A 1H9BA 1O0SA 5THKA 3SX2A 3R6DA 3RUFA 1PSDA 3OP4A 5H82A 3JV7A 2VYVA 4ZU3A 3I6QA 3BTVA 1VJ1A 4FBGA 3HDJA 4XRRA 2CD9A 1YBMA 3A06A 5K0ZA 1AN9A 1IE3A 3WYEA 3IMFA 3RBZA 4AG3A 2BI8A 3V2UA 3STHA 3S55A 4BNNA 1WAMA 3BHIA 1BW9B 2GN4A 4NHEA 1R4MB 1SB8A 4BKRA 4PZCA 3KSUA 4S3MA 1EZ4A 3OA0A 4J1QA 2NVUA 4JJGA 4W9NC 2CVZA 2SCUA 5EIOA 1EK5A 1HTBA 2D5AA 1P1JA 2FR8A 1R15A 2Y05A 3A14A 1RM5A 4MP8A 3OJFA 3B6ZA 2DBRA 5G0WA 4B3JA 4B4OA 3QVWA 3PPIA 2HO5A 1DFGA 4OH1A 3AU8A 4YAJA 1ZH8A 5CPFA 3TZ6A 3GC6A 5JAIA 1I33A 3JQBC 4MVJH 4CM8B 2IRWA 4NFSA 5KIAA 2FWMX 4NIMA 4TROA 5CG1A 1JA9A 3G1UA 4IQ0A 3JYOA 2EGHA 3BAZA 4RDHA 2OBYA 4D41A 4RORA 1GD1O 1WP4A 2Q1TA 4RZIA 4QT0A 3IS3A 4DGSA 3GVXA 4WLFA 5J23A 4HV4A 4BB6A 3BHMA 3WS7A 2J3KA 1O95A 2E48A 3F4BA 1IYZA 1DC3A 2ZYDA 4UEOA 3BMCB 4RVUA 3IDSA 4G81A 2JD1A 1ZSVA 2W2KB 3GHHA 1DJNA 2VHVA 4CJXA 4FFOA 1N9GA 3PQDA 3O8QA 3WIDA 5L4SA 2OZPA 4WLOA 3GQVA 4BNGA 1FXSA 1ENOA 4IXWA 1E7WA 2C2XA 3DZKA 3QVXA 3ICCA 2QZZA 3ZV5A 4NK5A 3KETA 4YACA 4CL8A 4FOOA 4H16A 4BO9A 4IINA 1ULUA 2A35A 3Q2IA 3C7AA 5TS3A 4BHTA 3ZWPA 1QSGA 2EJVA 3H65A 4YT5A 2UV8A 2VTEA 1R4NB 2ET6A 3NUGA 3WJAA 4ZJUA 1XKQA 1LBEA 1YB5A 1MXHA 3WWZA 3NKLA 3UHAA 5JXWA 4R16A 4E30A 2FPGA 3VTZA 4XR9A 4Z6KA 2PZJA 5B12A 1NP3A 3KV3O 1EFLA 1H6CA 2NWQA 4ND5A 4AL4A 1T2EA 4R5MA 4E6PA 1NFQA 1Q0LA 3LT1A 2W2LD 4J7XA 3NTOA 3O4RA 2ZJ1A 4RLHA 4XQGA 3GVPA 1ADCA 2HCTA 4R9RA 4ALNA 2PZKA 3ZNPA 3WGYA 3TZKA 1GY8A 1U7TA 3BTSA 1LSUA 4C7KA 1ISIA 3PP8A 1P1HA 1AHIA 1D4FA 1NR1A 3I4CA 5HM8A 5ICMA 1LXCA 3P5SA 3EUWA 2VZ8A 3UF0A 3PDUA 4I9NA 2VYVD 1B14A 3GR6A 2EP5A 4R1TA 4XX0A 3BIOA 4D0SA 2JCYA 2HK8A 1YQXA 4GBJA 2FP4A 4MKXA 4WNIA 5K9ZA 3W4JA 4R4JA 4N5NA 4Z0PA 2NNLD 4CMAA 2C5AA 4PG6A 5FWNA 4TMFA 3SJUA 3CMMA 5L53A 3H9EO 4BO7A 2O4CA 1GV1A 3JQ7A 2VHXA 2J5KA 1GPDG 2XAAA 4J2OA 3ZWCA 3DBHA 4WEQA 3HDHA 1HYEA 5DP2A 1B2LA 3PLRA 2NVUB 3TZQA 4HFRA 4X54A 1AGNA 1JTVA 2E82A 1JWAB 4XD2A 3JQ9A 1WXDA 4HBGA 3SC6A 3JCZA 4DIOA 1CETA 3PGXA 2GN9A 4B4VA 3WBFA 3A28A 2Z1MA 3UAGA 3CEAA 2BFMA 2HMWA 4Q39A 4J91A 1QR6A 2IZZA 4K6FA 1WDLA 5A1TA 1RM4A 1FDVA 3AOEA 1B0AA 4JXKA 4YPOA 4IDFA 1BXKA 3I5MA 2Q99A 4U5QA 4QECA 3QP9A 3PYXA 1AXGA 2OL4A 3UCEA 3RC7A 4WJZA 2FPIA 3H9JA 4QSMA 3I9OA 4DRYA 4QEDA 4BNIA 2FPPA 3GPIA 2AQHA 4RO0A 4I5GA 3TF5A 2V6BA 3ENKA 2Q1UA 4OOFA 1FDUA 1X0XA 1LDBA 2DFVA 4J4HA 1S6YA 5TNXA 5KJCA 2YV2A 1A9ZA 4TRMA 4BMVA 1T2CA 4KZPA 3O8QB 4YJHA 2PV7A 3ON5A 3ENNA 1H9AA 4PLPA 3DMTA 3LT0A 2QZ9A 3OEWA 4AJHA 2YJZA 1NVGA 1F06A 1LU9A 4NBRA 4FCCA 2HU2A 4PLFA 4YJDA 2AQ8A 3CUKA 2DM6A 4LRSB 4OSPA 3OF2A 3KBOA 2ZYGA 4DMMA 4CLDA 2CDAA 2DTEA 1GTMA 4J90A 4OJNA 4WGGA 3LLVA 4QXMA 2TMGA 3QWIA 3VOSA 3U09A 1O8CA 2D2IA 3EYWA 1JAYA 3FD8A 3HJAA 1L7EA 1H6DA 2ZJ0A 2JCXA 1LJ8A 4FR5A 4YXFA 5A9RA 1I36A 1QYWA 2UUOA 3VTFA 3I4FA 4BGVA 3AOEC 5IXSA 1JLLA 2IODA 2Q1WA 5F1OA 4Z9YA 3OIDA 1U1IA 1LSJA 3LLSA 5EN4A 3C7CB 3MEQA 3WBBA 3AY3A 3TNLA 2NQTA 2ZQYA 3BTUA 1ENYA 1R0LA 2PH5A 3ZZNA 2H5LA 2DVMA 2EKLA 1ZNQO 3I9MA 4PG4A 3FR7A 2HMUA 3JTMA 4DC0A 5BSGA 2W8ZA 1V3UA 3PXXA 2GYYA 2Y0DA 3VH4A 4CQMB 4J43A 3DMTC 4XYBA 1Q2XA 3WR5A 3ZWVA 3DZIA 2BHLA 3FRJA 1M67A 1VJ0A 1PQPA 2YY7A 1I2ZA 4TSKA 4CMEA 2UUPA 1I32A 1W6UA 1C0IA 3ANNA 5KNLA 1E77A 3ABIA 1LX6A 3JQ7B 1TB4A 4M89A 1UAYA 3DBHB 1E6UA 4UULA 4BO1A 4A2CA 2DKNA 1KBZA 2H1SA 3MOGA 4R5HA 1ENZA 2G76A 5TLSA 5CEJA 4PRLA 1G0NA 1B15A 4U6SA 3Q9NA 2EGGA 4MKRA 1H2BA 1DBVO 5JDCA 2Y1EA 3ANLA 2IXAA 3HB4X 4CMKA 4B79A 1U5CA 1XU7A 3NDRA 1DIGA 4KQWA 3IP1A 1ML3A 3OH8A 4E5NA 1RM0A 4II3A 3GNTA 4CL3A 1QXSA 4UUOA 1U3VA 1E1KA 4BO4A 2BFPA 4TVBA 4PLWA 3GZNA 1NTOA 2D0IA 3NTQA 1G1AA 4RPLA 3ETDA 4O6VA 3CMCO 4K28A 3PFWO 1XQ6A 4ZD6A 3F46A 1V8BA 3IOYA 4NFYA 4JCOA 3P2YA 5JPIA 3CPSA 5COAA 4YJHB 5DNAA 4AJ1A 4ALIA 3I83A 3VPHA 4CMEC 3JSAA 1UDCA 3K6JA 1HEUA 3W1VA 3OICA 4ZQHA 2E6UX 4O1MA 4J2HA 1VSVA 1ZIDA 1K6IA 2OGUA 4JBIA 3ZWMA 4IDDA 2RCYA 1MFPA 1JU9A 1XA0A 4Z9XA 1M75A 3GVIA 4YQYA 2FZWA 4WK6A 4BMNA 1PJBA 1CQIA 5JDCC 4TZKA 1SAYA 4B7CA 5I9NA 3KLPX 3UVEA 1SEVA 3AFNA 2PK3A 1LC0A 1U3TA 1K0UA 4AJKA 1VC2A 1X1TA 3IP3A 1OI7A 3WFJA 1Q7GA 3R3JA 5HS4A 1I3MA 1PJQA 4CMGA 3H7AA 4Y67A 2CVQA 2FOIA 2B4TO 3TPCA 2DBZA 4Y8VA 3WGHA 2A9FA 4BNUA 5GZ1A 4UUMA 3ZI0A 1HLDA 1MA0A 1ZO8A 1ZEMA 1SB9A 4AICA 4XQ9A 1U8XX 4ESOA 1U5AA 3DTYA 1LDNA 3AM4A 1XR3A 3Q9UA 4MVJF 5FEUA 3F6YA 4NK4A 2NU9A 4QO7A 1HSZA 1YS4A 3GGOA 2AE1A 3OSUA 1U2GA 3K8ZA 1PJ3A 3RKRA 5JCXA 4IDBA 1SEPA 3NDJA 2G1UA 3ZNQA 1T4DA 4BKPA 5I7SA 3ST7A 1D1TA 2JJYA 3JQ8A 1DFHA 5FYDA 3T4XA 1XQ1A 3DXFA 3OHSX 4HY3A 1NQOA 1NYTA 1YQGA 1PEDA 2GD1O 4C7JA 1HDYA 1K3TA 4DWVA 3SBOA 4KWHA 5I9LA 3PJFA 4CMJA 3DMYA 5L45A 3D4NA 3IJRA 2X0IA 2PWZA 4RPHA 3OIGA 4DXHA 4EUEA 3DL2A 2PD4A 3QHAA 3K9QO 4Y6RA 5T8KA 3DAPA 1F8FA 1SPXA 5IZCA 1ORRA 4F3YA 1YO6A 3N58A 3WB9A 2GPTA 1QYVA 3OQ1A 4CUKA 1OFGA 1PWXA 4IJKA 3ROMA 5ER6A 4BUCA 4YJFA 2YV3A 4WLUA 1LRJA 2RHRA 4MINA 4QQRA 1KOLA 4IDAA 1GUZA 3DB2A 4YJGB 4QX6A 1XG5A 1QLJA 3GHYA 1ZK2A 5EESA 3ADOA 1HYGA 3GEGA 3O9ZA 4DBZA 4GQAA 1I24A 2R00A 3JD1A 5JAQA 2HJSA 3RUHA 3ASVA 3OBBA 1GV0A 1YVEI 2IYOA 3QSGA 1ZSNA 3AUSA 3AJRA 3NTRA 2VOEA 5ENDA 5IG2A 1K89A 2YYYA 1FDSA 3EMKA 3RJ5A 2C82A 1A4UA 3NT5A 1PWZA 2WE7A 2ZCVA 2VQ3A 1LI4A 2H63A 5C5IA 4D7AA 3D3EA 4LW8A 5TGDA 3ASUA 2GZ3A 3GT0A 2VRBA 1C1DA 4TRJA 3W8DA 3AY7A 3WGIA 5KWEA 1ZXLA 4CMIA 2HMVA 3WGOA 1MX3A 1I10A 1N1EA 1BXGA 2VHYA 1PGJA 5TRTA 5L40A 2W4QA 1LLDA 2O3TA 4GVXA 2GZ2A 3QE3A 4CR6A 4YBZA 3DHNA 4XRGA 1UDBA 2YQ4A 5T8KC 1QLHA 5IZCC 4RJTA 3EVTA 4F46A 2NTJA 4DYDA 1OAAA 2W90A 5JW6A 3HB5X 3PQEA 4FJ1A 5AXBA 1XSEA 4UEKA 2DPHA 2VZ0A 1YONA 2J3HA 3T7EA 1D1SA 1PQWA 3WFIA 1VPDA 1JDJA 2C54A 1PJSA 1LDGA 2GN6A 1JKJA 3LT2A 3OM9A 1E3LA 1GPJA 2O2SA 3B70A 1G0OA 4E12A 4UUPA 2VRCA 2X22A 3KRTA 1PGNA 3FNEA 3WSWA 1ONOA 5DOVA 3EGOA 1HLPA 1HE4A 1KVTA 2X0JA 3D64A 5CP8A 1IL0A 3ZHYA 3PLNA 2OHXA 4BNZA 3AM5A 1QKIA 4HFMA 4LCJA 3WLEA 4FGWA 3RC9A 3AM3A 3K31A 4L74A 1UXJA 3FNHA 4K9DA 4DPKA 1PS9A 4CR7A 4J3FA 4PVDA 3GNSA 4D3SA 4LRTB 1LQTA 4BNHA 3AK4A 2DTDA 1H6AA 4NNJA 3JQ8B 3INTA 1VL8A 4UVEA 4ITUA 1P0CA 5IFLA 3V1YA 2J3IA 3BMCA 4E5YA 2XXJA 1E3JA 3JQEA 2EKPA 3HFSA 4BGUA 3CTMA 1NWHA 4YT4A 2DUUA 2IXBA 2Y66A 5EERA 3WXBA 4RCVA 1D7OA 2EJWA 3NYWA 1WDMA 3F1LA 1J4AA 1R66A 3JQFA 4PZDA 3FNFA 4OSOA 2Y0CA 2E37A 1E1NA 1OOEA 1ADFA 1S7CA 3PWKA 1ZK4A 4YJFB 1G6KA 1DEHA 1PS8A 1R4NA 3DAGA 2VWGA 1LSOA 1T24A 1I5RA 5JDIA 4K26A 3PHLA 1DHTA 1KIFA 4EEZA 2J6IA 1PL8A 2GGSA 4NJMA 5CDTA 1XYGA 1DDOA 1DXYA 3RBVA 3CH6A 4RL6A 3LC1O 2WE8A 4ROSA 1WMBA 3Q1LA 4OQYA 1NNUA 1BXZA 2HQ1A 4WEOA 5DDIP 1E7YA 1W73A 1OMOA 3TQHA 1DLJA 5BSHA 1BMDA 3JQBA 1NVTA 2C5EA 3QWAA 3N74A 4GVLA 3I9JA 3GN2A 3NJ8A 2Q49A 1Q7CA 1UZNA 3LQFA 1P74A 1NHWA 2EF1A 1PJTA 4KWIA 1DSSG 3V2GA 3RIHA 3LSYA 3ZDFA 4CMIB 2HLPA 3PEFA 4GL4A 3GMDA 1K2WA 5G0VA 2VUUA 2WSBA 1BXGB 1RYEA 1C0KA 3RUAA 3VZSA 4E0BA 4OOEA 3ROQA 4M49A 1YH3A 1XWFA 2JD2A 1YBAA 3HADA 1HE2A 3HUDA 4QTZA 4WNCA 1DIAA 4Q3AA 2ZKLA 1KY5A 1NQTA 2P68A 1ZK0A 4GX0A 4GWKA 1OBFO 5F5NA 3QW2A 4EGFA 4E31A 1RPNA 3GFBA 3JQFC 3QVOA 3SC4A 4E2WA 4PLGA 1WZEA 1FMCA 1Q0HA 3HHPA 4BMSA 1E7QA 5IXYA 4JIGA 4FJ0A 5A05A 4E21A 2V65A 3BMQA 4NFHA 1H6BA 1H93A 1HYHA 5A3VA 5JDIC 5ADHA 1VJTA 5DBFA 3DZJA 4YDRA 4D79A 5A02A 3NT4A 1UZLA 2LDBA 1NWCA 1I3NA 2OOSA 1F0YA 2BGMA 2EG9A 4OXYA 3C1TA 4MVJM 3TOXA 5BNIA 3KYCA 5AXAA 3OETA 4RPJA 1GYRA 4DLAA 1FJHA 2P4QA 1HDOA 2PA3A 2BELA 2IZ1A 2BFAA 2VOJA 3I9KA 4GGPA 2EHDA 3WQQA 1E92A 4YCAA 1GYPA 4BKUA 1IZ0A 2EP7A 4YAEA 3OIFA 3RUIA 2R2GA 5T6BA 2WMDA 3I23A 1I2BA 4N7RA 1ZW1A 2VWQA 3IKVA 4CMHA 4H7PA 3G49A 4AJPA 2C59A 4G2NA 5BSFA 2YUTA 1K6JA 4BOYA 2O7QA 4P4LA 3AUAA 3QA9A 2GZ1A 3H5NA 4IDGA 5L7WA 2XF8A 4XDYA 3KVOA 3RCBA 2OMEA 3AU9A 5F1PA 4FW8A 5IDQA 4OKIA 4MJLA 3JQDA 3PGJA 3U0BA 4CODB 2ZIZA 5G2OA 1P3DA 3U4IA 1R37A 5I7FA 2O4UX 2NACA 3KEOA 3DHEA 3ITDA 3V5NA 3RC2A 1ADBA 3DQPA 4RVHA 2B69A 9LDTA 1HE3A 4CLRB 4IZIA 2B0JA 2X5OA 1E3WA 5H83A 1JKIA 5A4DA 2Q46A 2DBVO 2WD7A 3S2GA 4QO8A 1O94A 3HE3A 2PGDA 3L6OO 4CLEA 4E4YA 4GMGA 1Z45A 5JY6A 3OEYA 1E3EA 5JY1A 4RDIA 2GRAA 3PQFA 1ISHA 2X9GA 4NJMB 2EIHA 1VSUA 4P22A 7MDHA 1EEHA 4Q9NA 5CG2A 4MDHA 3NJ4A 1ONNA 1H5QA 3N7UA 3VC7A 4JN6B 2VUTA 3JYQA 4LN1A 1LUAA 2Q45A 3DZFA 2B83A
chains in the Genus database with same CATH superfamily
2Y9PB 1WF6A 1PTKA 1PJCA 1Y8AA 4BQNA 1JP7A 1XAGA 1XXLA 2POQX 3AONB 4URFA 5FI3A 2CFCA 4PAMA 3REQA 4A0SA 4L6AA 5C18A 1VPWA 1G8SA 2C58A 1Z4LA 3JWGA 2EGUA 2HQBA 3IHWA 4CCSA 4MQEB 5JZVA 2LXNA 5EP2A 1GCOA 4DQXA 1P61B 4MV3A 2QPLA 2FN7A 1FX0B 2I3GA 1YVRA 2VXOA 2Z4SA 4LQ4A 3RF7A 3WKEA 5JS8A 3VH1A 5KYXB 1M66A 2TMYA 2WHEA 1KYXA 1YI0A 2QAGA 3NHBA 5JO0A 1I7DA 1EWVA 2OC4A 2P9EA 3LXUX 4W82A 4LZLA 1B6RA 4FLEA 1QHNA 3V1MA 8ABPA 2FP3A 4RESA 1K7EB 4OHUA 1JN0A 4KU4A 1OILA 3OKFA 1YZVA 4OYRA 1T26A 4I50A 3O9VA 4R3NA 4UE3S 1ZKDA 1E3SA 4P7GA 1N7IA 1JILA 2PT5A 4HH0A 5JXGA 5KC9A 2WWHA 1IZ9A 2JJ1D 4Y2PA 1N6KA 2KI5A 3DLPX 4R40A 4I66A 1O94C 1WXQA 1YJBA 4CCAA 2X6RA 4EJSA 4FSDA 3SVLA 3UMMA 2XMSA 3D8UA 4KI7A 2ACEA 1TI7A 3FOWA 4EJ0A 3IBYA 3MM4A 4GPZA 5DOZA 2P11A 2B5WA 4V0NA 5LQMA 1ZJ4A 3EHDA 4OHCA 5DYNA 3QWBA 5EZ6B 5T3UA 1ISJA 2H4XA 5C5CA 5K0EA 3KYCB 2C1XA 4R84A 1NXSA 3KAQA 3WGZA 3NYIA 2Q8NA 3AILA 5TQ2A 4Z4HA 1W96A 2X9QA 1L9XA 3VX3A 1Z68A 3D43A 1DBPA 4EY8A 3CLVA 2B37A 4BN0A 1YHYA 2RARA 3PXAA 3P52A 2BN4A 3SVTA 2H9AA 3D7MA 1EZZA 2PLNA 3QMWA 2V03A 3LQQA 1LBSA 1WR8A 1DV1A 1M3SA 3S2FA 4NXNB 1J2RA 4IGEA 3IB6A 7AT1A 4CF7A 4KL8S 2BYTA 4PSDA 2X8WA 1XTUA 5L3RA 4GI1A 4IGIA 2WIAA 4ZA2A 1YF3A 1C3JA 3KLMX 4Q3DA 1ISFA 3F5QA 1MKYA 2DTXA 3B2QA 4EKDA 2QUJA 2CLKB 1UOPA 1DXHA 3LDFA 4KO4S 3WWOA 1Y5LA 2A3NA 4KREA 1NW6A 1OT5A 2HRQA 4L8WB 5B6IA 1P0QA 4F93B 1ZD1A 3INYA 4YEDA 1EIWA 1NVXQ 2MSDB 3D6AA 4TTIA 3RTBA 1RBZA 1WX1A 1JZSA 1TJNA 2PIAA 4UHJA 3JYPA 4PLYA 1E2PA 1X80A 1YE3A 2O57A 1OIVA 4O5OA 1UJBA 3QM1A 1MR3F 5KJ1A 3KKPA 1JUDA 1TTPB 5T41A 2PKWA 3BE5A 4HKTA 4RM3A 5CVVA 4ZAZA 3T41A 2NZJA 3TZCA 3WQRA 2WB2A 4AQYB 1NG9A 4CPDA 2K87A 1OU4A 1HETA 3F4KA 2X9VA 4FEEA 4PQEA 1SXQA 2ZB2A 2VPQA 1G5HA 2R6GA 3TUJC 3OLXA 1WVMA 3DVAA 3KSMA 3NQ41 1E3WB 2VAVA 2QUAA 2EBUA 4IQGA 4KJXA 1P44A 4LTDA 5TXGA 3F8TA 5JS2A 1CX9B 1BHQ1 1V4BA 2K4MA 2WD7B 4HUTA 3IEKA 1Y7IA 2P75A 4HGQA 5CM9C 4ZCQA 4KQKA 1M9NA 1WXIA 3SQDA 2PX5A 3NHZA 3M3DA 4AP5A 4IIJA 1K88A 2YV5A 1P0MA 3DR5A 4NQRA 4CM9A 3FM9A 1XALA 2GCOB 5U9CA 4AI6A 4F2WA 2XNDD 4LAFA 3EPKA 1RJWA 5JZBA 3JYNA 1J9ZA 3RRNA 3P2EA 3QKRA 1XQVA 1R5NA 2ODQA 3SHTA 1V26A 1YZGA 4TPKA 1W7AA 5K0SA 2WU1A 1U8ZA 1G38A 2B5OA 4GGOA 1U5BA 3SF8B 2RG7A 4HB3A 5KTRA 4CM7A 1EE9A 1OPXA 1OWOA 1KFEB 3CF4G 3CKKA 4N40A 4W1SA 1L1QA 4LQDA 1ZN7A 3FTFA 5ILOA 1XNRB 1K86A 4ZCPA 2Z58A 4RZSA 5ICFA 3W8RA 5DFAA 1F1JA 1I4LD 2YCBA 5BQPA 3O83A 3FTQA 4UHCA 1AUXA 3G3EA 1BHJA 2X1HA 4Y2UA 2RGYA 1L5KA 2YR0A 1H2AS 1K63A 2PZAA 3E23A 4K5QA 4Q1AA 4CQMD 3JQGB 1I3CA 4J0HA 3FGPA 2H4JA 3G2LA 3Q2KA 4NQZA 2IUUA 4BC0A 3A4IA 4ISCA 2WAAA 4PG8A 4PGHA 1WZNA 3P9NA 4LCBA 1YS9A 4MGYR 2HX1A 1W9MA 1GGFA 1CNMA 4BVFA 1CY7A 1HX7A 5D84A 4RIIA 4LHEA 2PYDA 2ZJAA 1P9OA 2NQ2C 3THWB 4HQ6A 3VHRA 4EI2A 4DDHA 4Q4AA 2O19A 1ISPA 3OLVA 4JLWA 3NIGB 1YUNA 2H4ZA 2WU4A 3DJFA 4OQZA 5EZYB 5CB6A 2FW6A 5ALTA 4MW4A 3EUFA 4KSBA 4L4XA 1IJEA 1U02A 3FNGA 2CWDA 3L7OA 2QN6A 3GOHA 3WHPA 2ZB3A 4L9SA 2A5FA 3QY9A 2AFIA 1NC3A 2J0UA 4I4LA 1QH8B 1E94E 1Y5RA 1OZHA 4HK4A 1Z6PA 3ZK8A 4ARSA 4YT8A 4BY9E 3QITA 4DCVA 2LUOA 4EL5A 2JCGA 4DIBA 2Z1DA 2VQ6A 3K2EA 4M1QA 4OYLA 4D92A 1H4QA 3KPUA 5E7QA 3L4BC 5B3JC 3SX4A 4F92B 5EINA 2Z6QA 1GADO 3PCXA 1SULA 1DQPA 3ETCA 3I9NA 2EKQA 4RETA 4U7PB 2N3ZA 3UEOA 1NFFA 4KZKA 2V6IA 4J7AA 4EB8A 4J2TA 3PVZA 4LGYA 5FEMA 4XWGA 4LY6A 4BYMA 3OECA 4E32A 4C7BA 4WQMA 3KQTA 3MJSA 4ZJYA 3NNDA 1W4CA 3B6EA 3VU1A 2EDCA 3CLSC 4Q4CA 5D3ZA 5F98A 1X74A 3MOIA 1L4LA 3A2MA 4TWJA 2C88A 3G23A 3QFRA 1DKQA 2PX3A 3UIEA 2A67A 3WRXA 1U0NA 3FLBA 1AQLA 3BC1A 1SC1A 4IZ6A 4R2KA 1SNYA 4OQPA 5LZ2A 3R8FA 5AKLA 1NVAA 1UOOA 1BMTA 2EV9A 4P7BA 4JLSA 3DS8A 2VJMA 2H3HA 2GM9A 1E79D 3AI3A 1E6KA 3ETNA 2G7ZA 2W2PA 3AV0B 1PV1A 3JQRA 4MUMA 5LYJB 2V4ZA 4H1TA 1W19A 3MWKA 5J5CA 2FUG6 1P8AA 3JAWB 1UDAA 3LC7O 2WHPB 4A0HA 4ARBA 5B6PA 1GPH1 2EZTA 3MAAC 3AFMA 2F64A 4PBRA 2DQZA 3MJVA 1E66A 3PFNA 1Z8FA 4EHKA 1BEUB 3P4YA 4WW0A 4RAOA 5DWQA 4DUPA 5FDFA 1J24A 4GRAA 4RVGA 4XXHA 4AZ0B 3KD2A 2OAGA 1IBSA 2G09A 4RIGA 3F47A 3ZE8A 2IGBA 2PRYA 4BVJA 4Q05A 2HHJA 3SIPA 3THYB 4XI9A 1GLVA 2CL0X 2PX0A 3S5JA 1T36B 3OTWA 2VP3A 5EGNA 2UAGA 2F4VB 4YLYA 4D0NA 3GJ7A 1JDSA 4EFLA 5JSUA 3PF8A 4UC0A 1M6WA 4JVMA 4JC8A 4R3WA 3CVWA 1A9SA 1THZA 3R7LA 2X7HA 2WAXA 4EVQA 5C7OO 5ICGA 1VJ5A 5B2EA 4ESHA 2CNDA 2Q6TA 3KQYA 4CIYA 3JYHA 3S27A 3RTDA 4B71A 3RR2A 4J0FA 1KDOA 1JTEA 2VPTA 3BKXA 3L7YA 4OPMA 1RRGA 3GRZA 5HIIA 1KO4A 1RT9A 1W48A 3RIEA 4WFKA 5BR1A 1T5HX 2XTAA 2VHEA 4GPD1 2OFPA 2NZ8A 3ET5A 4YAFA 5ARDA 2PXXA 3T5AA 1TJYA 1I01A 2RHDA 4Y1EA 1A98A 4WESB 3X43A 2DX7A 2YVQA 3DPUA 5HILA 4AZ3B 2ZTMA 4QEZA 3C6XA 2JGRA 1I3LA 1MU0A 1W1IA 1R0CA 3AYXB 2P9GA 3GLKA 1RJ9B 3D3WB 1U28C 5I9MA 4GEKA 3AW8A 1QH0A 3ZIAA 3SWWA 4EG7A 1R12A 5T7BA 2VDMB 4NE2A 1VGQA 3IOEA 1TJPB 1C3OA 1Z83A 4J6EA 2C2KA 2OLEA 1M1XB 1K9VF 4FQ7A 4NZNA 5K0CA 3LO5A 3NHUA 1YB1A 1CUZA 3DAOA 2O8NA 3MD9A 1MVOA 1TJ3A 5KAMA 2IBMA 5AESA 1F2TB 1V5IA 3OEHD 4BXOA 2X0NA 3DM9B 3ZXIA 1VIMA 3R1IA 4ZO8A 2H1FA 2FWRA 4DGQA 4E5MA 1JEAA 2QQFA 4WZZA 1JHUA 3B6JA 1JDUA 4LC0A 3RSGA 4E09A 1GAWA 1GRCA 1Y3FE 1T1IA 5LA6A 4JBGA 1R6BX 3GMSA 2C96A 3WOHA 3PEYA 3C8ZA 4OMUA 4JUBA 5IJXA 2J8ZA 2Z2KA 1QK3A 4LBYA 4B3XA 5LOVB 2WFLB 2GHRA 4BMYA 3N9IA 1U2PA 2OUKA 4Q9DA 5FRDA 2GPWA 1FTYA 2A4KA 4WKBA 2GYVA 1AGRA 3E7WA 3P19A 4Q9AA 4UBNA 1H1LA 4QUHA 4Q19A 2JJQA 5DM4A 4AJ2A 4Y9TA 4FWIB 3W7VA 2MMGA 3O8NA 1REQB 1ZR2A 2J3DA 3I0ZA 1IPEA 1Y7HA 4HQRA 4W9RA 2R3SA 4UDNA 3WGGA 3I73A 2GZSA 3HA7A 5KYVA 1KETA 3M89A 1XEWY 2MDTA 4Q9IA 3CFYA 3LHKA 2PR2A 2NSYA 3TZEA 2VP2A 5B7QA 1W0KA 5HE8A 3AGQA 3VHLB 4WDQA 4NJEB 3V9PA 4LYDA 4Z1MD 1G8JA 4QPNA 3ZQ6A 2OB1A 1L1RA 2QXTA 4DM7A 2B8TA 2G06A 1VLJA 1C9MA 1ORWA 2Z8XA 3MFQA 4WUTA 4YO7A 1LWNA 3DVLA 4ZVTA 3FPSA 3TPZA 4E3ZA 5A9SB 2E5WA 2NVWA 1FSSA 1NYRA 2JDID 2XGMA 2Z9DA 2Q1XA 1CUXA 3OPMA 2UXBB 5JBNA 1UP6A 1IUKA 3ER6A 2AR9A 1X7XA 3RBAA 1SN7A 3KDSE 4HWTA 2DFKB 2VIIA 1BWSA 3N5KA 1W0CA 1SBTA 4AMVA 1GGEA 3N8KA 1EX6A 1L3CA 1S2IA 2ANCA 1UBMS 4L73A 4KMRA 5HIAA 4NI5A 1H1TA 1RIFA 1MABB 2JNWA 2XA2A 3S7TA 3T5MA 3ZD9A 4DNXA 3GJ0A 1GFIA 1W36C 2H07A 2G9NA 1XF1A 1AGXA 1JYSA 1TIPA 1FFCA 2J85A 3JZMA 2QTGA 4FONA 3RWMB 1AMUA 4MS4A 4LXGA 2FMIA 3NBAA 4MEBA 1N5MA 5TPWB 1VCIA 4LPKA 2ZJ5A 4NR0A 2IYRA 2EXXA 1CDDA 2P3SA 1E62A 1SIUA 3GRAA 1ZVQA 4QOJA 1YA6A 3IMEA 1U9IA 3EQ7A 4KAFA 1RLTA 3L5KA 4FILA 1A5SB 3PX3A 1K8QA 3SGLA 4D3DA 1EHIA 2JS7A 4INAA 4IIHA 1E1RD 4O2AB 1QZZA 1ZA2A 4LVCA 5JMPA 1MQ9A 1FTGA 4UTOA 5ITZB 3R3XA 4OI4A 4AO6A 4F21A 2XYGA 2NO0A 2YZMA 4AIIA 2ZUEA 4PZUA 3VUEA 1SKBA 4U2DA 5EXPA 3ZW9A 2B8EA 5J2UA 3A4LA 3A6EA 2J9RA 2PGIA 2D1YA 5FYQA 2JVJA 3WK7A 5FBQB 1KE2A 2OCPA 1Y8QA 2IYYA 3BCHA 3KJQA 4QBKA 3W04A 1M8GA 4YP7A 5B3KA 5A3RA 2O0JA 3H5VA 1JAIA 2IS2A 1H0SA 1BXRB 4YREA 4ZV4A 1GZ5A 3GEPA 1VL0A 1A71A 4C4AA 2YY6A 1C8BA 1LBIA 4FB4A 6AT1A 2AMLA 2G67A 2FRDA 4TV8B 3S29A 4A4DA 5FUBA 1XJ0A 2KSQA 5FOUA 4ZDJA 4LMRA 3CUEF 4Q3BA 3WMEA 2A7XA 2WIDA 1PEKE 4MCJA 2UUCB 4YJ2B 2P0YA 3DT6A 1DIOB 2HDWA 1SCIA 2H3EA 1QZ3A 1IDN1 2MSKA 1X7ZB 1TUGA 5KQLA 3HXKA 2XZPA 2ZRGA 4L9WA 4UREA 4AJ4A 3I61A 1RTTA 2GPBA 3BT7A 4AY4A 3B82A 2PE5A 1Z17A 3E4CA 2AUTA 4OD0A 2G8LA 1XP5A 4LTNA 2VYND 1NYQA 2QB5A 1KYZA 3K1ZA 5IWCA 5DISB 3WP1B 5J47A 1N78A 2NZUG 1PTJA 1CQXA 3ENVA 3BIFA 4X61A 5DHSA 3SPXA 1U8TA 2Q5FA 2XMPA 5THXA 2DBQA 2PA0A 3QMPA 2GJKA 2WUDA 5DN9A 4V0SA 1ZD4A 2V6FA 1TT5A 3CPEA 3O4VA 1JQBA 4W6ZA 5H7XA 4JYZA 4BNXA 6CHYA 4H0NA 1Y9EA 3V4VB 2B8WA 2X2FA 2PR7A 1O4WA 3HR8A 4KAAA 4IQ8A 5T4BA 4OJMX 5LKRA 1B76A 1GG8A 1IQRA 3ABOB 2BMAA 2KS6A 1IATA 5G0TA 1KTVA 4PX9A 3AG5A 5LCXA 1GILA 3IXQA 3KB2A 3KUDA 4PC6A 3S2IA 4MZXA 1FSZA 1GPBA 1X2EA 2ADMA 2IQIA 3BWVA 3L01A 3WJ7A 4BCCA 2K7FA 4AY2A 1L7MA 1LDEA 4L4SA 3O95A 3TXYA 3KQWA 3X1MA 1EGMB 5TGZA 3HG7A 3IEPA 2JI8A 1RW4A 1WSWA 1FDRA 3M3HA 4AFNA 3BSYA 3RYIA 4C9BA 2GKSA 1Q3HA 1KAEA 1MDFA 1U1CA 4DQUA 1T3TA 2MSEB 4OU4A 4QFCA 2Y3IA 1ZNWA 2C4HA 5IEBA 3LFUA 4HFJA 4BLPA 4ETNA 3P9YA 1GCGA 2WBLC 1HOXA 2DHQA 4G0PA 4LOLA 4TT3A 5KHAA 4PR0A 4M7PA 2C4MA 3OKAA 2HK9A 4G0OA 1RQPA 4I4CA 5CT8A 4NEGA 5DCUA 2H18A 2R79A 3CC8A 4JGBA 1Z6AA 3BJEA 3KSZO 4RACA 2ECKA 4J6FA 1XZNA 4UFPA 4KIGA 5HKKD 3H4TA 4F9FA 2XZLA 2E3JA 1F0PA 4MOWA 4AULA 1JBQA 2CJYA 3GZ4A 2C4UA 4FGZA 3DPIA 3GUYA 2NO9A 4UU0A 3WLQA 1OR8A 2P4HX 3IMKA 3HNPA 3G2IA 2H5EA 4IUYA 2C94A 1USVA 3TL3A 3VPSA 3QLUA 3T3IA 4KYTA 2QRNA 1RFGE 1IB0A 4MRAA 3HVHA 2AHRA 2CV2A 5NLLA 3AEKA 4LVUA 4K81B 3AIIA 1UK8A 1QP7A 3K0AB 4LZAA 4QNRA 3S6JA 2GPYA 1Y37A 2RHJA 3CX3A 2I7CA 1JU4A 1JHAA 1OFUA 2F9LA 2JFZA 4HGZA 3SEFA 5IHXA 1HE5A 1L4BA 3Q7TA 3REOA 2PMWB 4PRKA 1FLNA 5KNDH 3O1IC 1CS4C 4PQRA 2XEXA 4JL5A 4MDFA 2JBWA 3PRYA 1YHNA 1UJCA 2JAHA 4JKOA 4URYR 2WJWA 3ADCA 3LFTA 4XUCA 4G36A 4II2A 1LFDB 3IEVA 2NN3C 1QPBA 2YXNA 2J33A 2ZBDA 4UARA 4M0FA 4FHDA 4GZ6A 4JSRA 1Q0QA 4UUPA 4EUNA 1XMOB 1V16A 5CVEA 1T0HB 3VDNB 1PLKA 2CMGA 3UB4A 1SK9A 3VU9B 4RKRA 1A9OA 4F06A 2Z56A 3FLMA 4Q21A 1YMUA 4Y1GA 3NGXA 1UF9A 5FWYB 4P3XA 3UTCA 1ZISA 2IU4A 3W78A 1XD2A 3UFXA 1N3IA 1MJ5A 4QFBA 3OE1A 5B36A 4ASUD 2O8BA 4TKZA 1YQWA 2I71A 2VAMA 4JJ4A 2A1TR 4OXRA 4WUVA 4LXIA 2C5FA 4DLZA 5FULA 1T2DA 4J1SA 1MO6A 1PNTA 1NAHA 1ZN9A 4B3IA 1QRTA 2YHUA 1O58A 2GBPA 1YJCA 3IIMA 3PPYA 3FJOA 4J0CA 2WABA 4PV7A 4AU1A 4OIMA 4LZWA 1QIGA 5TT1A 5ED0A 2QYSA 1JAHA 4M8SA 2BH2A 3IBCA 2FQWA 4DMGA 2JFNA 3TR5A 1QIJA 4GPBA 4JJIA 1W44A 1N6LA 3M4NA 4PO8A 2CLCX 3RWOA 3FOZA 2IEZA 5DEOA 3QEBZ 4QM7A 3BA1A 3EVNA 3FPLA 1QP0A 2GLXA 1M5UA 5JJ5A 2HNAA 1L5FA 1IQUA 2R68A 3OE7A 2WYWA 1HT3A 4WBXC 5HNKA 1JFTA 3SEAA 2QW1A 3NTXA 2R6ZA 4ALLA 1OXBB 2Z6UA 3IVAA 1NSYA 3NHAA 3MCZA 1N8KA 3VHXA 3H8SA 3II6X 2QUZA 2JRCA 3PHJA 4L15A 5DW0A 1QIMA 1TM2A 4NL4H 4Y1RA 1JHDA 1ZBDA 4ZU1X 5I7AA 4CUZA 1MAHA 3KB1A 3DDWA 3OZAA 1DG3A 3CX4A 2X7XA 4KSYA 4BFZA 4XJXA 2H92A 1VTKA 3K0EA 2GCOA 2CNBA 1IXYA 4E4TA 2QTVA 2XADA 3E4DA 2JLSA 1WEKA 2GZAA 1DJQA 4MVJD 2PEZA 1U7HA 4PYJA 2XB4A 4ZDIA 1OLXB 2J59A 1L4FA 2V3VA 1MAAA 5C5EA 4V38A 1A9YA 5JD6A 2PZEA 3IBFA 1GEGA 4NV3A 4WPGA 3Q7RA 1QIHA 3E3MA 3GUVA 5AKXA 8LDHA 2XBMA 3WI7A 2HEIA 3MELA 4PCVA 2WIBA 5B57C 4Q3NA 4YC7A 4NPAA 2HK7A 4JJKA 4YRKA 3R75A 4BO3A 1J25A 4ILKA 1RC8A 4UBIA 1QF6A 2RGNC 1BKDR 5DXFA 3RYHB 5IANA 2B8JA 5M3BA 1NVVR 1C8VB 1ZITA 2I2FA 2XPCA 3R0JA 4HG2A 1P5ZB 1WM1A 3BK2A 5DH9A 2HR1A 3LF2A 1MPTA 2X0KA 2ZYSA 2GBLA 2RBGA 4HATA 2EFEB 1EVIA 2IIBA 1DT3A 1UXHA 3FTPA 3I04A 4EB6A 1IXRC 3LRXA 4DV1B 1YQ9A 2JKZA 1V9LA 4YECA 2QE6A 4H3VA 4LF8B 3RFFA 2WRZA 3S2YA 3QLVC 5HW0A 2FF5A 1SWVA 2P3QA 2PNFA 2V7PA 4H0FA 3T9AA 4B35A 5GPBA 2FSUA 4AJLA 3M6XA 1NRWA 3QKWA 2V8BA 4XM1A 1PG5A 2XWJI 4JKYA 1I2CA 1T6YA 3Q11A 1FQOA 1MJFA 2IJGX 1Z74A 4PS1A 2GSWA 4XCXA 5A9TA 1Z5ZA 3VVBA 2PS9A 1U2ZA 3DT8A 4UM5A 5T5QA 1HUQA 4IDOA 4HMQA 3Q3GE 5AK0A 5EZYA 4CFZA 2ZFUA 4HNHA 4QKQA 3WKBA 4PSUA 4G0YA 4YMTA 2G40A 1ES9A 3PJEA 3K2QA 4V2IA 1MJHA 2ZWIA 1OPRA 2L19A 5K0GA 3PITA 3PNYA 5C7IO 4XWTA 4MICA 1BVUA 4WH0A 3U7EB 5BP7A 3GWGA 3CWQA 5EG5A 1GZVA 5EEHA 1FOEB 2J0VA 421PA 3IPCA 3R9XA 1QO0A 3LS2A 3S68A 5K6AA 2FLVA 2JI6A 3DE6X 3BSSA 5H68A 4JQOA 3Q4GA 2VLBA 2BM1A 2Q5LA 3MMZA 4BPRA 1FE8A 3ESCA 1NF8A 4MQ6A 2A9RA 4KBGA 3ZWOA 4EPXA 4S04A 4M60A 1ZJWA 5TY0A 1W46A 1N5RA 3EZGA 4HNSA 2ZVDA 4OFXA 4F7WA 3NP9A 3WMRA 4HAIA 3COWA 4FP9A 1JVBA 3RIMA 1WXFA 2NUAA 3CXRA 4J1NA 4EHHA 1VZ2A 1V3VA 4J9UE 1RAAA 1TLTA 2CHFA 3H05A 3OTGA 3TLJA 3H2ZA 4DLXA 4AJNA 2APJA 3A1NA 3HCDA 3ONEA 4URHA 5HIJA 3ZDQA 2A94A 1Y5MA 3E7FA 4G5FA 3RS2A 4AMZA 3UCXA 1TX4B 5IJAA 1A8PA 4RA9B 2ZJ6A 3ZX4A 2UVQA 3T7JA 2QIOA 1DL5A 1QLWA 2JI7A 4OHVA 3EVFA 2FR0A 1RYYA 2Q27A 2WWTA 3V8VA 4TRRA 1J97A 1GZDA 1FFXB 1ULSA 1V6AA 2V9PA 5ICSA 1JMYA 1FP4B 3RU2A 3ZLTA 4W5QA 3T3OA 2F8SA 5E7IA 16PKA 1V41E 2FCRA 1PJ8A 1RADA 1MENA 1RNLA 1WMSA 2IYVA 3R5KA 3ITKA 3AUJB 4CV0A 1EFVA 1YGPA 3GF4A 4CM1A 3EXEA 1LLFA 4R7ZA 4EECA 4HX5A 4X24A 1ZM9A 1BS1A 2SKDA 1PG2A 3FOAA 3RSHA 2HYDA 2FWIA 2OHOA 5CD9A 1ZH6A 5EJ4A 4UVGA 3C41J 1WULS 3TLKA 4IDQA 2WD9A 1VMAA 2Y0EA 3AF2A 4TN1A 4MHTA 2OSBA 3UUEA 1N9GB 1JYFA 3U3DA 1Y6QA 1P0FA 2Z4RA 4OBBA 1KH2A 2CXSA 2PLFA 4PG7A 4X90A 4ZRMA 4FYYA 1I5EA 5EMKA 4FOLA 4C4ZA 5BXYA 1DRWA 5LDHA 4OAQA 4OB7A 2ATXA 3BE8A 4KE9A 3I6IA 1A27A 1L7DA 3QSYA 5AVSA 5EKSA 4PHTA 2HBQA 3PIDA 4BBAA 4DMCA 3MXTA 1XZFA 5KBYA 3HKEA 1G3UA 1YA8A 4D8TA 1S7GA 1TCVA 4V3CA 2FZCA 4ZODA 3QBDA 2QRMA 1IHOA 3UWKA 1KSHA 1EWQA 1B6SA 4QATA 2V7QD 1NT4A 2LDXA 3CPJB 3C8HA 4JDPA 4TOIA 1KAOA 3ZIUA 4ZKDA 2GN2A 2BRUC 1X15A 3FDZB 4QPCA 2DUMA 1X7DA 2QU7A 4JSTA 3T8YA 4ROTA 2FOXA 1SELA 1YT5A 2J6HA 1ZM7A 2V1XA 5ECYA 3U49A 5CNMA 2EQ5A 4IW3B 5HKOA 3C7DB 4TTPA 1CV2A 1RTKA 5I7EA 5KZMB 1AU9A 3Q85A 4UVIA 1U4SA 4GXTA 1SIWA 4CM4B 1A4RA 3B20A 2DHCA 3IV6A 1V96A 4AJJA 4YV0A 3FUVA 4EBBA 3CZAA 4TTQA 5CDSA 1I6KA 2X1MA 5HF8A 2W6QA 1J33A 1RWBA 1P9LA 1NZJA 2NYRA 4GWLA 4ZQCB 3WDLA 4B3HA 4LSMA 3UC5A 3CKMA 1NVVQ 2SKEA 1AKUA 2DZDA 3T3MB 2YNMD 4E7OA 1ECJA 4IJWA 2VPPA 1G3RA 4FLMA 2V3CC 4JCCA 4BP9A 2DYKA 3RKUA 1M2VA 1T6XA 4JHXA 1A77A 1XHFA 2FG5A 2I5PO 2O6LA 2HTEA 1OLUB 2B4AA 2W5UA 2ZUBA 3A6GA 5AM3A 1KMNA 4JXZA 1ULBA 4ML3A 5F1YA 2J9FA 4NF2A 4EY7A 1AIPA 3W5DA 4D3FA 3AUTA 4O63O 3SZOA 2QLTA 4B6RA 2ZRIA 3ZGYA 2V6GA 4OGLA 5I4IA 1CG6A 1O54A 2D74A 3L8HA 1U6JA 3GGGA 1M1YA 3U40A 3U4HA 1N5IA 2WFLA 1MOSA 1Z2AA 3F74A 3MTJA 2BFBB 4YRPA 4W99A 2PQ0A 5CFQA 3PNLA 3FYTA 4HUJA 1JIKA 4L8VA 3EAQA 4LS3A 4IVPA 4RCZA 1EXDA 4D25A 2YXPX 3EASA 4LRWA 1ACJA 2W71A 3EY9A 1UBRS 3SC2A 1E4YA 2N1BA 3BFKA 4US0R 5D5HA 3KTDA 3ZWWA 4EDFA 3DOUA 1GQQA 2PKYX 1L4UA 1SU6A 4FW9A 4H7HA 4ED9A 2YHIA 3G5AA 4WLEA 4RHEA 2ECFA 3JZAA 4P2GA 2ETVA 3MS7A 3G2QA 4P3OA 1II0A 3TOVA 1RYZA 4MYCA 3SXUB 3GT4A 2IIQA 3T9EA 2QORA 4EZIA 4MLZA 1G42A 1YS6A 3QUBA 4YALA 4RZXA 2A9OA 4TLMB 2PT7A 2Q6OA 2XUJA 1OJLA 3AI7A 1POXA 4HDNA 4YHHB 1V8FA 1I4EB 2XCOA 3Q0EA 1KTIA 5ETJA 3Q7SA 1EA5A 1EVZA 2HF8A 2K7ZA 4GM0A 1CE8B 3HBFA 2M1XA 2H17A 2QDKA 1OGYA 2DLDA 3DAYA 3PU6A 3QU7A 1LJUA 1PW5A 4G1MB 4FQ5A 2ZVJA 3ZGVA 1Y8ZA 1EGHA 1ZCAA 1AA9A 2B0CA 1UL1X 3JD0A 4HADA 3KVRA 5IAKA 1T0UA 3KB6A 1OD6A 13PKA 4CKCA 1IONA 3ZV4A 4QG3A 2BKLA 3WB1A 1PSZA 4KGDA 2QN9A 3DOCA 3ME5A 1R74A 1OXSC 5EWLB 1H0RA 2RGCA 2WVGA 3ND6A 4NDAA 4P35A 1U0HC 4WY8A 5DHQA 2ZRMA 3ABQB 2IYTA 2XRMA 2Q4DA 5DSXA 4YRAA 3E48A 5A04A 2E4YA 4TKUA 1VLQA 5B53A 1GXSB 1OBHA 3LHIA 4K9PA 4MI3A 4REOA 4U3JB 3RRXA 5C1DA 5E4YA 3KYDA 4YAKA 3GRKA 4LXHA 5CCDA 3D6UA 4KO1S 2Z2XA 4GLLA 1NBOA 3T38A 3UPDA 4YONB 4DRXB 2CDRA 3H1PA 2CXTA 2ZRAA 2A5DA 1V48A 4EYOA 4ZI7B 2P2NA 2R96A 5IJ9A 3MHPA 2AG8A 1MMFB 1Z6TA 2FPOA 2FWNA 1GPKA 3A1TA 5A7HA 3LWBA 3E82A 4RGQA 3MJTA 1RXSA 2A5JA 3GEMA 2OENG 3K5WA 3V6MA 1RCTE 2C77A 4R2JA 5BT9A 4KDFA 4RF3A 3WK9A 1U2DC 1WABA 4CF4A 1YAJA 1T0BA 3R77A 3O84A 1TADA 1MIHA 4HDRB 5AXCA 3ILSA 2RH4A 1XCJA 3LHFA 3W3AA 1YZFA 1AC5A 1WJGA 1YL6A 2GJAA 4FOSA 4MWZA 4Z86A 5LBTA 3ZHZA 4C4SA 4OHMA 4Q1FA 2HMYB 3VJMA 2GXAA 4FCTA 3TLXA 4P4UA 1HT0A 5IN5A 3WGJA 2J5QA 2I29A 1R0KA 3P5BA 1M2NA 3QU4A 4KO8A 4QTUB 3VH3A 4M22A 3CLRD 4A8TA 3C87A 4NCBA 1VL6A 5LXTB 2V9CA 4NU6A 2IH4A 1B3RA 3P2KA 3C6KA 3GT7A 5CPBA 4BDSA 1T8WA 3TIXB 4NOLA 3NWOA 4KPEC 1DBRA 4D82A 2IDJA 3KKZA 4F11A 4P3KA 3ZHVA 5IYZF 3K4QA 1IG0A 2R8YA 3G0HA 2VA9A 3N6XA 4H60A 3EXIA 4FHZA 3J80A 5GM1A 2W11A 4TLLB 2FZLA 2I4IA 2AE2A 2F2TA 2IOYA 1U3GA 5CB8A 5B1EA 1PYGA 4J0EA 2XZOA 1B74A 1HFEL 4DYVA 3JYLA 2FPRA 4RYDA 2AXNA 4KFCA 2QRLA 2Q7OE 3SLGA 1JGTA 4M0LA 3W2IA 2FEAA 2I3BA 3NATA 1XVLA 2DY1A 2CK3A 3W5VA 3RFXA 1YDWA 4TL8A 5A5FA 1ZD9A 4X65B 2Y93A 1N2CB 2IX9A 2RHLA 3N3AC 4N8SA 2HN9A 3AUKA 4M8IA 4EUSA 3E5NA 5REQA 3U5TA 3G2KA 3LUJA 1ZEJA 3K4PA 4NONA 2ZJ8A 4P7KA 1Q7BA 4Q4HB 3J81A 3BK1A 1CIVA 2ZJZA 4HL6A 4CKBB 3MRTA 5K5EA 3TSYA 3EH2A 4JMPA 2VDUE 1YRLA 4FN4A 3ZWNA 1F5SA 1LBQA 2C8KA 3E05A 4O4HF 4RLFA 5KWSA 1K5HA 1TIKA 4RPKA 3BMOB 3AEUB 1B0ZA 2EKDA 1DAPA 4AMGA 3JQAD 3X1KA 2AG1A 4N5MA 3IAUA 4J16C 4RWEA 2AZMA 2B1QA 3GK3A 4QGBA 3JQAB 4EGQA 2AXQA 4BMPB 3HA3A 2ZEJA 3GP3A 4M9CA 2C20A 4TMZA 3O8BA 2R1VA 1DWPA 4B4DA 2IYPA 3K0SA 3LL4A 4BNKA 4O1HA 1U7XA 1JG7A 3HR7A 5FNVF 1UT8A 1HZZA 1ZM2A 2JD0A 2PBLA 3JVIA 2PXAA 3CEJA 2EW2A 2Q29A 1X8KA 2I65A 2LPMA 5DLDA 2X0FA 2WAYA 3M1LA 1JIXA 1TYEB 1KC3A 1RXVA 2XUAA 4LJ4A 2F9MA 3H9GA 2IYXA 3ILVA 4JX8A 2J6CA 3WZ2A 3WFZA 4IGFA 2R5FA 2HO4A 1L7AA 4H4EA 1OZFA 3M8KA 1MC5A 2FFJA 1ESDA 3NC1C 4IMPA 4P6VF 4WKCA 4A03A 5B30A 1F7UA 3WB0A 4AT1A 1W4LA 3Q3JB 2VSFA 1IIBA 3ELYA 1DTWB 2O59A 7ADHA 3KKQA 3QV1A 3T3PB 3PCRB 5JTTA 4ZGBA 4GLBA 5COBA 1EXMA 4GR4A 3GXOA 5DTRA 3BMNB 2O1WA 4WECA 1MAVA 1QZTA 3EJ6A 5KYKA 2NP6A 3PZRA 4BNWA 1JH8A 5B2ZA 1GWNA 3RC1A 5KNBH 4KHPB 5DTEA 5CFZA 1FFAA 3U62A 3C97A 4MP6A 5CA1F 2LR0A 3ED1A 3F2IA 3D1LA 4GMXA 3EARA 5K0TA 4A82A 5JJCA 1UOQA 3KZOA 2IEAA 4MHOA 4XSGA 4HWPA 2IU3A 3LYHA 3G8AA 3B3GA 1JBKA 1RYFA 1R4MA 3REFA 1BGVA 3VH2A 3E5RA 4PU0A 1UDRA 4FS3A 1VXOA 3CLTC 3RUDA 1GT91 5A5GA 2R00C 1P2SA 4X8OA 5D3KA 4H3SA 3C48A 3D0QA 4J7UA 4QXOA 3ZIAD 5MDHA 4R2XA 1Y63A 3LY7A 1YRWA 5INTA 1TLLA 4L8FA 1NRXA 1P31A 1NN1A 1U9YA 1GU7A 1ZH2A 3CE6A 3ZDCA 1V6CA 1NNI1 1ONSA 2Q3FA 1BDMA 3GAMA 2OAP1 4NBSA 3F6RA 5LP6F 2HSZA 2OGSA 1QU2A 3MG9A 4S35A 1F2UB 4KLNA 3ZGXA 1P1RA 5EHZA 3LWDA 3FR8A 2YRXA 3GGJA 1E0DA 1ARZA 5IBRA 3SE7A 4DJDC 3AC0A 2QW8A 1NLMA 3IUSA 1BX0A 2Y1XA 2QRJA 3VX4A 3VYWA 4AJIA 4ERXA 5BYKA 5MF6A 2DWOA 2FMTA 4U2GA 3PHGA 1DO2A 1J39A 4YLGA 1E1QA 2I6XA 2VTKA 3HU3A 3Q41A 1VGVA 1Y0BA 4YCNA 1QQTA 3D3NA 2QYHA 2HRZA 5SY4A 4F8JA 2VEDA 4BFTA 1E20A 3PQCA 4YAOA 3ETLA 1G55A 4L3VA 2GNOA 2PBRA 3ZE0B 1Z26A 1A4IA 3P9CA 3EZNA 4KUEA 1DNPA 5B58T 2C8JA 1CUHA 4G5GA 2RG1A 1RZUA 3CVJA 4ZFNA 1QF9A 4R68A 1H2HA 3TRIA 2BFOA 2Z6AA 4XJTA 1EK0A 3VDQA 4F6RB 5TC4A 1DAHA 3I92A 3LMKA 4D44A 3HRIA 3KJFA 1CLEA 3BTOA 4KXNA 2QOEA 4L0CA 2AJCA 4MW5A 5E95A 1WOYA 2AJBA 1W0KD 5EMNA 5F51A 4XPZA 4ZEVA 5EC8A 2BBTA 2FN3A 2HTFA 2CHVA 1JSZA 3LCVB 3PUXA 3PYMA 4I50F 3UPTA 1MPXA 4UZEA 2F1IA 5MN5A 3ZWDA 1DC8A 2DGDA 1B0PA 2GHQA 2GBIA 1C1XB 2O3QA 3IKLA 4NBKA 4TS1A 4URZR 3A1WA 3B1XA 4NBNA 2OQVA 3GGDA 3X2EA 2FEXA 3E9NA 2VPYA 4FKMA 2ODPA 2FPXA 1Z2EA 4PZEA 1X19A 2I9PA 1NR7A 2W6ID 2CHQA 3K09A 3RYHA 4W9NA 2DT5A 2P1DA 3PEUA 2ZRNA 2ZBFA 1PL6A 2OQIA 1BQEA 1R3UA 1CZKA 2CN1A 3BDIA 3E9QA 3HJTA 4M54A 1UKCA 1SVOA 5KX5F 5CU7A 4A2PA 4LMBA 4KX3A 1J90A 1Z88A 2XSZA 1VPTA 4JT9A 4C5AA 1AURA 4OQQA 1T5IA 3DAFA 3DWFA 3FSRA 1M1ZA 1P9WA 2JGEA 2TMDA 3IKMB 5FL3A 3TB6A 4B1FA 1QCYA 5CHEA 4CDGA 4C3OB 1PHRA 1XDGA 4FCVA 4XQCA 3MJRA 1CJBA 3KBBA 2P8SA 4UVDA 1N5DA 2R1UA 3BM5A 3BL5A 3ROPA 2AT1A 4L6IA 3L77A 2JAWA 4OGWA 3WDKA 3K1AA 2E4WA 1FU4A 4MR9B 3L0YA 4G2TA 2YJGA 2YXBA 3M1IA 4XEHA 4AUMA 1C9NA 3HWX1 2AZXA 4RZUA 3E35A 5C51B 3RJ9A 2GI4A 4A0FA 1Y34E 2HD4A 4GYKA 5KOIA 2XTZA 1KJZA 4RF2A 3ICEA 1P81A 2V54A 3ELUA 3EVAA 1QFSA 2R1TB 3F7MA 4I36A 1KR5A 4IWYA 4L8YA 4POAA 3GJ3A 1P2BA 2GOYA 3OP4A 2REBA 3GJSA 2Y27A 3R3YA 3HU5A 4J0IA 4JYPA 4TT8A 3I6QA 1Z28A 4ZU3A 4AY3A 4D8VA 2VJLA 2CD9A 4HDMB 1LK5A 2QR5A 3AF5A 4LV6A 4GE3A 4M1SA 5AIBA 3A06A 1IE3A 3IMFA 4QEKA 2IE8A 4JR0A 4DLRA 3D8RA 4PZ0A 2AKYA 3SQMA 1LS1A 2H1WA 5H3CA 3C7KA 1CNFA 1CUUA 2R84A 3H6GA 4HGPA 1BW9B 4BRSA 1ZVJA 4MLPA 1GRNA 2OZLA 2RKOA 3B3FA 2QG9A 2FE1A 1TYZA 4S3MA 4CI0B 1EZ4A 2GVZC 2NVUA 2VH2A 3AF0A 2AOVA 4XIGS 2D5AA 3I2JA 1OAOC 1P1JA 1CVIA 2XUPA 2Y05A 5E1MA 1RM5A 3FWYA 1MO2A 4M1ZA 4A16A 4D5EA 5EJ5A 1DZ3A 1E5DA 3OO1A 5DIFA 4RH0A 3QH4A 2HO5A 1DFGA 1DAFA 2PWAA 1M74A 1PO7A 3CVOA 3GC6A 2R7KA 1J1IA 3X0DA 5B58C 2IRWA