4GVXA

Crystal structure of a short chain dehydrogenase homolog (target efi-505321) from burkholderia multivorans, with bound nadp and l-fucose
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
258
structure length
258
Chain Sequence
b'MDLNLQDKVVIVTGGASGIGGAISMRLAEERAIPVVFARHAPDGAFLDALAQRQPRATYLPVELQDDAQCRDAVAQTIATFGRLDGLVNNAGVNDGIGLDAGRDAFVASLERNLIHYYAMAHYCVPHLKATRGAIVNISSKTAVTGQGNTSGYCASKGAQLALTREWAVALREHGVRVNAVIPAEVMTPLYRNWIATFEDPEAKLAEIAAKVPLGRRFTTPDEIADTAVFLLSPRASHTTGEWLFVDGGYTHLDRALV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
molecule tags Oxidoreductase
source organism Burkholderia multivorans
publication title Crystal structure of a short chain dehydrogenase homolog (target EFI-505321) from burkholderia multivorans, with bound NADP and L-fucose
rcsb
total genus 91
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gvxA00
1M75A 1SOWA 4DMMA 1BW9B 3HG7A 5C7OO 2Q99A 3TWOA 2JAHA 4HUJA 5U4QA 3DHEA 3SLGA 2FN7A 1YO6A 3MJSA 3GZ4A 2PGLA 1ONPA 2Q3EA 2VNSA 3WTCA 1FMCA 4H16A 3I9LA 5ILGA 1LDMA 1ADBA 3OETA 3ASVA 4LW8A 2PH5A 3RC9A 3AM4A 3DZBA 3MEQA 3E8XA 2NM0A 4E5MA 1LSSA 1LRJA 3DZGA 3JQFC 4M8SA 1QV6A 2AG5A 4YA6A 2QYTA 3ORFA 3KB6A 1I33A 4I5FA 5KJ6A 5CPBA 1ULSA 3TZCA 1OOEA 1LTHR 1R4NB 3UOGA 2X0JA 2EIHA 3ZNOA 4DREA 3CXRA 1XU9A 2YHIA 3KSZO 1VL6A 5COBA 4D0RA 5HTOA 2BI7A 1A27A 1QMGA 1LRKA 2UYYA 1EVZA 5JYDA 2C5AA 5L4NA 1UZNA 5JAMA 4XQCA 5BSHA 1MC5A 2IXBA 3LT4A 1TVEA 1H5QA 2RBEA 1BVUA 4TSKA 1GYPA 5H82A 3G1TA 5JBIA 1B16A 2O3QA 1QRRA 1NPTO 2NVBA 5TIIA 2EWMA 3FCOA 1UXIA 1BDBA 2UUOA 4ILKA 4FSHA 2O4UX 3GQVA 1JWBB 3AM3A 4WPGA 3X2EA 3JD0A 3H9QA 4EJMA 3HHPA 3ZNNA 4D45A 3RJ5A 4ZHSA 3T4XA 1KETA 4P4NA 2ZJ0A 3VPSA 2GZ3A 1UJMA 2O3TA 1GZ4A 2V6FA 1PIWA 3PI7A 5G4KA 4KMSA 2JFGA 4FFNA 1PWXA 4B3IA 1Y9EA 3MJCA 4WNIA 4A26A 2NQ8A 2HMUA 3GNTA 3JSAA 4XIJA 3ROPA 1N7HA 3DOJA 5TQVA 3GZNA 3FPLA 3GA0A 3GG2A 3VDQA 5K6AC 1GQ2A 1XQ6A 1Z73A 3V8BA 4NDNE 1R12A 4DXHA 3CMCO 3RKRA 1QYCA 3JQ7B 3K31A 4M55A 1MP0A 5JC1A 1XELA 2A94A 5FFFA 1J49A 2PD6A 3K2BA 3IKTA 4IDDA 3LF2A 1MB4A 2XXJA 3UN1A 2WJPA 4WASA 1T2AA 1F8FA 1H6BA 2Y1DA 1HXHA 3QVOA 4AJ1A 2YQ4A 4B4WA 5CDGA 2FWMX 1SMKA 2FZEA 3JQBA 3OHSX 5KVCA 2Q45A 3WX0A 1NPYA 1AE1A 3C24A 1KBZA 3FTNA 3KOUA 4OHUA 1Y1PA 4S3MA 5CDYA 1QXSA 1V3VA 1QLJA 1W4ZA 4BO0A 1V3UA 3C1OA 3JQ6A 3NDRA 1Q0HA 4TWRA 4MOWA 1EVIA 5THKA 3JYNA 4B8WA 2Y68A 4HXYA 1IL0A 4YYZA 4GKBA 3W4KA 4NK5A 4HFNA 4JP3A 4E4YA 4QFDA 3GZNB 1ISFA 3L9XA 2UAGA 1KVSA 2X6TA 1EQUA 1E7RA 1JKFA 3DOOA 3ENNA 4Q3DA 1B8VA 4TRRA 4W99A 1OI7A 1DB3A 1B7GO 3H4VA 2Y66A 4MVJI 2PZJA 5BSEA 2RH4A 1BSVA 1I3KA 1N2SA 1P0FA 3LYLA 2YFHA 1ADFA 3BHJA 4NZ9A 1ZNQO 4G81A 4HV4A 5BNIA 3GC6A 1NVMB 4M1QA 3B70A 1E1KA 1K5HA 3E82A 1GYRA 4NU5A 2PR2A 1ISHA 2OP0A 3E9QA 5ILOA 3L9WA 3W6UA 4JQCA 4Q3NA 3LSYA 4FR5A 2WYVA 4R1SA 4TMFA 2BI8A 1NBOA 4J9UE 2CVQA 5DCUA 4XDYA 1U1IA 4LCEA 5C3MA 5BNTA 2BFMA 2QQ5A 3ROQA 3KETA 4KDFA 3ZV3A 5DCWA 3WIEA 1CEQA 2HLPA 4ZQGA 2GO1A 4NBUA 3VAZA 1KERA 4BO6A 1E7WA 3GMDA 4ALKA 4HBGA 3QW2A 1GZ6A 1U5CA 3AFNA 1DC6A 2ZB7A 1CRWG 4O5OA 4M89A 4OYRA 3VPHA 2G5CA 5IAAA 5CEEA 4JX8A 1BHSA 4NPCA 5A1TA 4KUGA 3U4HA 5A03A 1MG0A 4N5NA 1DPGA 4EDFA 4C7JA 3B20A 3HB5X 3LC2O 4EI2A 3ETDA 3VPGA 2JHFA 4GI2A 5BNFA 5TC4A 1E6EA 1QORA 3OM9A 1LA2A 2OBNA 2XPCA 3JQ8A 1HLPA 4MVJD 1NVTA 1C0KA 5JS6A 4Z3KA 3S2FA 5IFLA 3VH4A 5HS4A 3FR7A 2EXXA 4Q9NA 1RKXA 1E6WA 1GUZA 4D46A 3MOIA 1I32A 5KWEA 4OH1A 4P4GA 3M6IA 1H6DA 2X7HA 3BTUA 3O9ZA 2GPTA 3H9JA 3WYCA 3ZW9A 2GF2A 2A9FA 3JQCA 2VT3A 4YTEA 4J91A 4RVUA 1ML3A 4JJFA 4WCDA 3C7AA 4GQAA 3DTYA 1HE3A 4QQRA 4QSMA 3A06A 4R1TA 3GMSA 3W6ZA 2J5QA 5C7LO 1OBFO 3CUKA 1D1TA 2B36A 2PZKA 4EITA 5IJZA 2WDZA 3NGXA 2Q4EA 3GHHA 2ZTUA 4I9UA 4TRJA 3E9MA 2JCVA 4CV3A 1OFGA 4IBOA 3FBGA 3LDHA 1IHXA 1PX0A 3BMCA 4HADA 1F17A 5K6AA 3KEOA 4YQZA 4EUEA 1ZSNA 3BMNA 4JBIA 4YB8A 1YDWA 1DIBA 2VN8A 4RORA 2DTEA 1FDWA 1HDGO 2F1KA 5KKCA 4OXYA 5L9AA 4MIOA 2NV6A 1I10A 1PL8A 5IZ4A 1I2BA 4GKVA 4IDCA 4DLLA 3C8MA 4YRDA 5CAEA 1LSOA 4D3DA 1HL3A 3KSDO 4K9DA 2CDAA 1C1XA 4CM9A 1I8TA 3GEGA 1DDOA 3ONEA 1YQGA 5F21A 3A9WA 4L4RA 5CDSA 4XB1A 2B69A 2PGJA 2GD1O 3WJ7A 3Q6IA 3VKVA 3EW7A 3L6EA 1KC3A 5FYDA 4YJHB 3JTMA 3VVBA 2R00C 3UXYA 4CLHA 1PJTA 2QIOA 2EP7A 3SJ7A 3CZMA 2O3JA 1TT7A 1TT5B 1TT5A 1HWYA 4HKTA 4KUEA 4R1NA 2OL4A 3CEAA 5F3RA 4NBRA 4MVJH 3C7CB 3ZWBA 1U2DA 4DQXA 2CDBA 4ITUA 1E7MA 2Y05A 2ZYAA 4UEOA 4GX5A 2ZJ1A 3PTZA 3PRJA 4WOKA 5ENVA 3GY0A 4Q3CA 3EDMA 2X58A 3HWRA 3O8QA 1HTBA 1E5QA 3DFUA 3QVTA 3UGKA 1SEPA 2E6UX 3GEDA 5A9SB 7MDHA 4BUCA 1H94A 3BTOA 3DOCA 5ER6A 3W8DA 3VZPA 4BNJA 1DRVA 2NU9A 4GWKA 4Z9YA 1I5RA 4YT4A 5JY1A 4WLOA 1DJNA 2D4AA 5U9CA 3Q11A 5I8ZA 3WSVA 2I76A 2VWPA 4MDHA 1AGNA 4E12A 4IJWA 2VHWA 3A1NA 3WWZA 4R5HA 5DDIP 3SXPA 3GUCA 4JNKA 1P0CA 1MXFA 3BA1A 1AHIA 2GZ1A 5G0WA 3WTBA 4BNHA 1U4OA 4PG8A 2V7PA 4CR6A 4JJGA 4U8GA 1UXJA 2QRJA 3DAGA 5TJHA 4PZDA 5CEFA 1NFQA 3N74A 2EGHA 4DYVA 4MIEA 5DCYA 1H9BA 3FNFA 4QFCA 3KYDA 1JKIA 1NWCA 5TT1A 3DAPA 4DIBA 3H7AA 2VWQA 2P5YA 2EKPA 2ET6A 1YGYA 4YAKA 2YUTA 3I3OA 1PJCA 1Y5MA 5JPIA 1XR3A 5DBGA 5AQ1A 2VZ8A 1B8PA 4QO8A 1UZLA 3ONFA 1DFGA 3PJGA 5L51A 2HU2A 1PGOA 4UREA 5F5LA 3UFXA 2GR9A 5TNXA 2QX7A 5AXCA 1PZHA 4HY3A 1VL0A 4FFOA 1PU2A 1OZAA 2WD7B 3GEMA 3PLNA 4EW6A 2VQ3A 5DULA 3AI2A 2C7VA 4W9NA 3OF2A 5JDIC 3RASA 3D3WA 4IZHA 4BO9A 2PD4A 1JN0A 3ROKA 2DBVO 2PH3A 4IDAA 3WSWA 1P9LA 1WZIA 1OC2A 4E6PA 1DAPA 3C3XA 4JIGA 5EQDA 5LCXA 5ER9A 1GEEA 3E6AA 3AY3A 5G4LA 3QLJA 1R16A 2E48A 3HE3A 1WLYA 1IY8A 3IL2A 4CLEA 3VPXA 1JKJA 1YOVB 2EHDA 2PKRA 3ZWOA 4A0SA 3QY9A 1AN9A 8LDHA 3GUYA 2YHUA 4XYBA 1Q7CA 2YHIB 3F46A 1FK8A 3ANMA 1SBYA 2CVZA 5T57A 1GDHA 1LEHA 1N7GA 1XIVA 4IJKA 1RWBA 3H2ZA 3FNGA 1WMAA 1O89A 1ORRA 2UVDA 3WIDA 1C0IA 1YBMA 2DQ4A 1PJSA 1BXGB 3PJFA 1Y6JA 3PWKA 3W8EA 5BQFA 3OMLA 4JCOA 4KWHA 3UVEA 3AU8A 1NFFA 4MP3A 2IODA 3BHMA 4TZTA 9LDBA 4KUHA 3ZWYA 3BTSA 1ZMOA 2W2LA 1GZ3A 3I52A 1OMOA 4ZN6A 1ZZEA 2X9NA 3E03A 2AEFA 5T6BA 3INGA 1YDEA 4J4HA 4FC7A 3UUWA 3NT5A 1FDSA 4BQPA 1KY4A 4QXMA 1SB9A 3MJTA 4PFJA 4IXTA 4RZHA 4W6ZA 1NWHA 3JYOA 4ZU3A 4FDAA 3ZGYA 2C59A 4O59O 2BFPA 4ZA2A 4EEXA 5GZ1A 1CERA 3JCZA 4D43A 4XYMA 1IZ0A 4U0JA 1BW9A 4J1NA 1WVGA 5EINA 3MWEB 4GL4A 1BXZA 3WFJA 2HRZA 3UW3A 4NMHA 4NG5A 3GDOA 3P7MA 3SX2A 1CJCA 4RVHA 1ISGA 1JA9A 2C2YA 4YT2A 1I0ZA 4NIMA 1PS8A 2JD0A 5FI3A 4NQZA 4CR7A 2JFFA 2YDYA 3VH1A 4W7HA 2DUWA 3M1AA 3HDJA 4YBZA 3WQQA 4RL6A 1HDYA 2G82A 3H9GA 4YDRA 3IAHA 3VZQA 4RGBA 1LI4A 1U4SA 4G65A 4W7IA 1NP3A 4CV2A 4M54A 3H3FA 2C5EA 1DC3A 3C85A 4IIUA 1E7QA 2Z1NA 4U6QA 1PJ2A 4H7PA 1TEHA 4UVIA 2W4QA 1CF2O 3I4FA 4KZPA 4ND2A 4RDIA 5F5NA 3G17A 3DBLA 2AG8A 4J2HA 4NHEA 4E0BA 5EESA 4EUHA 1HF3A 5G0VA 5JNLA 4D41A 3NDIA 4L76A 4RPHA 4ALJA 3KTDA 2O7SA 4U0KA 2NLOA 3I9MA 4EEZA 1A7KA 4PLCA 4ZD6A 2P4HX 4BMSA 4XYEA 1DSSG 4LVCA 1I3MA 3PQEA 3U4IA 3WNVA 1HRDA 5AYVA 4D0SA 1XWFA 2Y1FA 4FFLA 3ZNPA 1DBVO 1ENYA 1XLTA 4AJJA 3RUIA 2V6BA 3ZWWA 2NUAA 4N7RA 3QWFA 1NR1A 4ALIA 4ZVVA 2ZTMA 5EQFA 2GN8A 5TS3A 3PDJA 2NACA 2DTXA 3WFIA 4K26A 1QP8A 4IGFA 3JQBC 3H8VA 5A3JA 4BHTA 3O26A 3H9UA 3MTGA 3U4CA 3IP3A 3B1FA 3Q2IA 4DYDA 2H9IA 2PGDA 1GQYA 4NFSA 1NYTA 4CMEA 2X0NA 1P1KA 2IYPA 3JQ9A 3R1IA 3KUXA 1U9JA 3OJLA 2OUIA 2NWQA 1KEUA 4DBZA 3NKLA 4Z0TA 1D3AA 3AUTA 4RF3A 3TPCA 4R01A 1EUDA 2F00A 3KYCB 4MIYA 1N9GB 4FJ0A 1SNYA 1JW9B 3OSUA 4GX2A 4Y98A 1GL3A 1NHWA 5A02A 5A5EA 4XGIA 4CMBA 4GBJA 3RBXA 1SCUA 1P45A 2J6IA 1WP4A 1V6AA 3ENKA 3IIEA 1Z45A 4YQYA 3NUGA 3IDSA 1LDYA 2P91A 4W82A 3S2EA 4E5KA 4LISA 4J90A 3RUAA 1PS0A 4UULA 3CMMA 5I9LA 4OKIA 4CODB 2FZWA 1CWUA 3GAZA 3BTVA 3IOYA 3DBLB 3F5QA 2Q1UA 1AHHA 5DBFA 5IXYA 4JJIA 1AXEA 2RCYA 1PGQA 2A4KA 3VOSA 4IQ8A 1C1DB 1IZ9A 4MP8A 4Y8VA 3SC6A 4TKLA 1GUFA 3ZCXA 5JSFA 3TDKA 1EVYA 5JE8A 1Y8RB 1J6UA 1LQUA 1R37A 2VTDA 4AJIA 3DL2A 3D7LA 2C82A 1QLHA 3D3EA 1A4UA 3O8QB 2QYSA 5A9RA 2HMTA 3QJ5A 5U1PA 4CL3A 4BO8A 3NYWA 2YYYA 1X1EA 1R0LA 4IDEA 1ZK4A 5EMHA 1EUCA 1KEVA 4LK3A 3ZDFA 4J3FA 2DAPA 4GGOA 4NBVA 5HRUA 4KTTE 2C0CA 1E3EA 3WGGA 3B1KA 4XDZA 3GGOA 2PKQO 3PXXA 4XCVA 4L8VA 1ZK0A 3D4OA 3WQRA 2NU7A 3LC1O 2G76A 1V0JA 5B4TA 3ZHZA 1IUKA 1CDOA 3JQGA 1P33A 2GNAA 1TA4A 3WYBA 2O2YA 4E21A 1DXYA 2I6TA 3BIOA 4C7KA 5A04A 2CZCA 1BWSA 2BF7A 4E33A 3U3XA 4XR4A 2CF5A 3QRWA 1W0CA 5KTKA 4RQUA 2IDZA 3VHRA 2JCXA 3RUEA 2Y1CA 2GN6A 2VZ0A 4IM7A 1U3TA 1JAYA 3ZW8A 3W4JA 1LLDA 2AE1A 2VZ9A 4PLHA 3TL3A 4ALMA 2PK3A 3ADPA 3ETEA 4FJ1A 2D3TA 3CSDA 3DQPA 4QECA 5MGBA 1KVRA 3O4RA 2Y99A 3UCEA 2X23A 4RF2A 4GAEA 3DHYA 2YW9A 3AU9A 4B79A 3FR8A 3V2UA 3GVHA 4XD2A 5DP2A 1QSGA 4PRKA 2VUTA 4JBGA 3PVZA 2Y0EA 3E1KA 1I3LA 4GVLA 3OH8A 4AJOA 2X0RA 4BV8A 1I2ZA 1X7GA 1LDGA 6LDHA 1WAMA 5IZCA 1LXCA 3JYQA 4NK4A 2HDHA 1XHLA 2P5UA 3PFFA 3K5PA 1QYDA 2BELA 3FNEA 3K8ZA 4XZ3A 2B4QA 1IPFA 1M66A 1H2HA 1A4IA 1BDMA 3B1JA 3D4PA 4F6CA 5B1YA 5B4VA 2RAFA 1E92A 3RFTA 3IMFA 3PWZA 3NAQA 5G0TA 1M6WA 2OP1A 4YJGA 3W4IA 1N5DA 3I5MA 3KYDB 4NJMB 1YXMA 2J8ZA 4XWYA 1R0SA 2PZLA 1N92A 2C54A 4UEJA 5ES3A 4K1LA 3WGOA 4D7AA 5ICMA 3B6ZA 2UV8A 4CLRB 5KCZA 3FPCA 1NR7A 4DPMA 7ADHA 5AXBA 1NQAO 1RYDA 3R6DA 5EIOA 3EMKA 3SEFA 4JLWA 1IOLA 5KVSA 4YAGA 4IY1A 5CEJA 4CQLA 3P5SA 1E1MA 5AVOA 1B3RA 5LDGA 2O3UA 1GY8A 4L9RA 1HDRA 1S7CA 3GT0A 4QEDA 2P9EA 4GPD1 3SJUA 2RHRA 4ND1A 3AUSA 2CSUA 4IQ0A 4B7UA 1D8AA 4YACA 4PCVA 1MUUA 3TSCA 4AJHA 4LGVA 1AXGA 4TKMA 3BMOB 4YEDA 1K0UA 1DAOA 3DONA 4NH4A 4EZBA 3TF5A 3QE3A 2IZ1A 2PKQP 3V2HA 1YB4A 4HNHA 5A9TA 2NU6A 2Y1EA 2IEBA 4YR9A 3JD2A 2D1YA 2Q50A 3DZKA 1FXSA 4BMVA 3NX4A 3PLRA 3CE6A 1ENPA 3D5TA 2YDXA 3TZ6A 3Q0EA 2HJRA 5G4KB 2J3KA 4Y6RA 4OAQA 5L95A 5KVQA 4QX6A 4FFMA 4IDGA 2NU8A 1JQBA 4FFRA 3RBVA 3KXDA 3JQAB 4RLHA 2Y67A 1RM4A 4YAJA 1PQPA 2FMUA 1UDAA 3IQDB 3M2TA 1VI2A 1CYDA 4DC1A 4RPGA 1L7DA 2C29D 4IGEA 4KP7A 3DAFA 3WGZA 3U9LA 1K89A 1QR6A 1ENOA 2AEJA 2VCYA 3GDGA 1UDBA 1V8BA 3ADOA 3EVNA 4R41A 1HE5A 4Y6SA 1O9BA 3VTFA 2DLDA 2B83A 1P1JA 3EUWA 1ONOA 3OJEA 4MKXA 5CFZA 4F3YA 4BL5A 2DC1A 2VNAA 3NJ4A 1QYXA 4ID9A 2I66A 1TLTA 4UAGA 1FF9A 4ONEA 1WDKA 2BH9A 2DFVA 4IDFA 1U3VA 2HO5A 2YV3A 1EZ4A 2HK8A 3PK0A 5L4LA 1E3IA 4HP8A 3PJDA 1YL7A 4NBWA 4X54A 5EJ2A 3S55A 3OP4A 1ZKMA 4R69A 1FDVA 3HFSA 3K30A 2ZYGA 1ZXLA 4FGSA 1ZUD1 5KIAA 4BNXA 4DIOA 1ZW1A 1FDTA 2CNBA 1EE2A 4J4TA 4MVJE 1KVQA 3PQFA 1X7HA 4LSWA 1E1NA 1B15A 1ISMA 1N9GA 2E37A 1K6IA 5AOVA 3OFSA 2HJSA 4RPLA 4ZQEA 5TT0A 1T26A 3JV7A 4A7PA 4JN6B 1N1GA 3MJVA 1IPEA 1AUPA 3QHAA 4J9VA 2E82A 1KY5A 4RDHA 4B7CA 4PVCA 2C20A 3Q2KA 1EQ2A 3PFWO 4HFMA 3RC7A 5CHEA 3I1JA 4BNLA 1HDCA 2QW8A 3RQSA 4R16A 4WCFA 1U3WA 3WGIA 3GN1A 3DBRA 1WDMA 4ZQBA 4YAIA 1BMDA 4EUFA 2DM6A 5G0UA 4CLDA 5AXAA 3GVPA 3ZWVA 2ZKLA 4RCVA 1DJQA 2GCGA 3ONDA 4GH5A 4BNIA 2D5CA 4XQEA 1T4DA 3HN7A 4KDEA 1PTJA 1PZFA 4L73A 1HYHA 4ND5A 2AXQA 1Q1NA 1MX3A 1DFHA 2Z95A 3SC4A 2X0IA 1SPXA 4GSLA 4PLPA 1NFRA 4J0FA 1HE2A 2X4GA 1KEWA 1ZJYA 3HUDA 1JDJA 4ALLA 1GV1A 5CP8A 4GX0A 2NVWA 5IG2A 3NEPX 3DBHB 3ULKA 5A06A 3FRJA 1HYGA 1RJWA 2HMVA 3IKVA 4YJFB 3U0BA 4F46A 2EJWA 4TZKA 1ONNA 2DPHA 1RM3A 2PLAA 4FJ2A 1HDXA 1Y8QB 4LMPA 3VTZA 3ZWNA 4A73A 4M49A 3UF0A 2FY8A 3L4BA 1B3BA 5HM8A 1X13A 1UZMA 3ZWXA 3PHGA 3GH3A 4NBTA 4FPXA 2X5OA 2X9GA 4WKGA 3QWAA 4II2A 3RC1A 5F1PA 2NQTA 3Q3CA 1ZO8A 2RHCA 3BZUA 3PIIA 1V9LA 2Q1TA 4PG4A 2PTGA 3ZH2A 4U7WA 5IN4A 1U7TA 1Q2XA 3PJEA 3RI3A 4N5MA 1T1SA 2VRCD 2FR0A 3PIDA 4N18A 3GGPA 5A05A 2DBRA 3KZVA 3OA0A 1ZVMA 4AJNA 3GVXA 3AUAA 3LLVA 4F45A 5KJCA 4AG3A 3NGLA 3DC2A 3S1LA 3BMQB 3SBOA 4DPLA 4IDBA 3VZRA 4GLLA 2VYVD 4XA8A 1IYZA 1MFPA 2VOJA 2I5PO 1GV0A 2X22A 1E3WB 3E5MA 3I9NA 1EK6A 1UUFA 3P19A 3KO8A 4I1IA 2WE7A 2CDCA 4BO7A 1A72A 3H9EO 2OMEA 4II3A 4I8XA 4OXKA 1Y5RA 4P22A 2AMFA 4TRNA 4CMKA 3F9IA 1A9ZA 4IXWA 2Q2VA 1SZJG 2CMDA 2ZB3A 4BB5A 2GN4A 4IINA 2EG9A 5DP1A 1ZH8A 3QIVA 4J43A 4R1UA 3NV9A 2Q2QA 3HJAA 4I5GA 3D0OA 4TQGA 2EJVA 3MWDB 1IULA 2GRAA 5JCJA 2OOSA 3WMXA 3PZBA 4WJZA 5K9ZA 3ZWPA 4HFJA 1B14A 1PL7A 2I3GA 5EN4A 3VC7A 2JKVA 3W1VA 4BNFA 2W90A 3KYCA 5L7TA 1EMDA 3NTRA 1TXGA 4J7CA 1JVSA 1NHGA 4BNGA 3K92A 2AHRA 3EGOA 3OQ1A 1VSVA 2CUKA 4CM8B 4G2NA 3V1UA 1HSZA 2VUUA 3MJ4A 1WNTA 4B3HA 2JL1A 1UH5A 3QWBA 4DBVO 1HLDA 4I08A 1XYGA 4AJ2A 4YRBA 2YQ5A 2IRWA 3EZYA 5L3ZA 1ZK2A 1A5ZA 1A7AA 2D2IA 3DEYX 4B4UA 2NVUA 3WB9A 4KQWA 3F47A 3GNSA 1PSDA 1BRMA 4CPDA 3D64A 4UVGA 3AI3A 1C1XB 1O95A 1ZCJA 2YFQA 1M2WA 3E18A 5I7SA 1HSOA 5L45A 2FSVA 1IE3A 4N5LA 5C5IA 2EW8A 3DZFA 3Q9UA 1LUAA 2BFOA 2HKIA 3JYPA 1XCBA 2Q46A 3CPSA 2CFCA 1LBEA 3GHYA 1MA0A 2B0JA 2DKNA 3I4CA 4KTVE 3MCVA 4BKUA 3CINA 3H65A 3S2GA 1R0KA 4AVYA 1H6CA 2ZK7A 1HDOA 1EVJA 1YJ8A 4B4OA 4CJXA 1LRLA 4BO1A 3AY7A 1LQTA 1LDBA 2ZATA 1NM5A 1P1HA 1E3WA 2ZB4A 4PVDA 5TRTA 3OECA 1PR9A 4NR0A 1KVTA 3EAGA 2VT2A 3NDJA 4CLRA 1O8CA 2J5KA 1HDZA 5KNLA 1WDLA 3VPFA 4IUYA 1ZSVA 4WLNA 4TVOA 1SEVA 4HNGA 1K6XA 3CIFA 5T5QA 1YE3A 4BNZA 3C7DB 3QSGA 1PGJA 3PGXA 4P38A 4QUKA 1PGPA 4OQYA 2IYOA 4MINA 3D4NA 1VLLA 4Q3EA 5H83A 1R15A 3FI9A 1VM6A 1WW8A 1H93A 2A35A 1UXKA 3INTA 4XRGA 3QVWA 1E0DA 4BNYA 4C4OA 1YBVA 2O48X 3I9KA 4BKRA 3OQBA 3UAGA 2I65A 2O4CA 2D5AA 3K6JA 3VDRA 5KOIA 4IZIA 4CMAA 2GUGA 4DMLA 5HWSA 1PL6A 1WMBA 4XIYA 4XJSA 5DBIA 1NQ5A 4MJLA 3V1TC 3NJ8A 4BNUA 1J4AA 4MVJM 4CM8A 1EK5A 4YJHA 3MJEA 1T4BA 3FNHA 5THQA 2E49A 3AWDA 1GYQA 2D0IA 3T7CA 5I7VA 3WGYA 3UKOA 4R9RA 3R3JA 4Y6PA 3O03A 4CM1A 4OSPA 3IC5A 4DA9A 3TZKA 3DBHA 2NADA 1VSUA 1C0LA 1H0KA 5EPOA 1ZSYA 4URFA 1HKUA 2E4AA 3KVOA 4R4JA 2NTVA 5FWNA 5TX7A 1DOHA 2RH8A 5JW6A 4INAA 4Y67A 4PLWA 5L7YA 3OJOA 4UVEA 3I6QA 3R0IA 4LRTB 4S1VA 2HSDA 3L4SO 1RYEA 3FHLA 3VVCA 4RV9A 3WXBA 4Z0HO 4RPKA 1YQXA 2Y93A 1PJQA 3ZWAA 5DNAA 3H2SA 4J0EA 4L0QA 2VYND 3RD5A 1I30A 3JQGB 3PHLA 1UXHA 3DBRB 3AI1A 4LSMA 5KVVA 5IZCC 3PWSA 1EFLA 1M67A 1YB5A 2PWZA 2EP5A 1LC0A 1DIGA 2PY6A 2QG4A 3ICCA 5G0SA 1HT0A 4CV1A 1DC4A 1VL8A 4WEQA 3I9JA 2X1HA 5G2OA 1K3TA 3ON5A 2ZIZA 4YJGB 4MKRA 4ROSA 3QWIA 5JY6A 5L53A 2Y0DA 4HFRA 1BXKA 1EUZA 1ZMTA 5JAQA 3AOEC 3U4DA 4AFNA 1P31A 2WTBA 4WECA 3L6DA 3U09A 1H6AA 2OFPA 3KRTA 3PHIA 4UUMA 1GR0A 4XYGA 4WNCA 3GPIA 1E3SA 4WCFC 4A10A 2VOEA 5T67A 3ZWMA 1C3VA 2W98A 1B2LA 4CQMA 1YH3A 3RCBA 1NX6A 1T2FA 4OO3A 1VJ0A 3D1LA 4M87A 2EKLA 2FP4A 6ADHA 4ZICA 2EGGA 1CETA 1IHYA 3KHUA 3GGGA 2DBQA 2JFHA 4J1TA 2P9GA 3V1YA 2DVMA 1EDOA 3MOGA 2HCTA 5HS6A 2EW2A 3FBTA 3KLPX 4OKNA 4EYEA 3AY6A 4J2OA 5I7EA 4CM6A 1DC5A 4PZEA 1N8KA 1YBAA 3KYBA 4PRLA 1Q7BA 2BLLA 1PGNA 1YOVA 5F1OA 5JFOA 1UP7A 2HAEA 1E7SA 4PLZA 3WJAA 2C07A 3H5AA 4CM4A 4JXKA 3MTJA 9LDTA 1LX6A 2W2KB 2WYWA 4XX0A 4HX5A 4ZRNA 1XGKA 2I9PA 1NTOA 4RPJA 1T24A 4ZGWA 1IB6A 3EVTA 4CMHA 3GVCA 1OAAA 2VRBA 3P2OA 1X15A 2P68A 2V6GA 3WGQA 1HETA 1PEDA 3ITDA 2ZCUA 4RZIA 3D5QA 4R68A 3LT1A 5C7IO 3ZNQA 1GTMA 4RO0A 3V5NA 3FD8A 3UH1A 1E3JA 3TZQA 1SAYA 5IDWA 1EBFA 1T2EA 4Q3AA 3HZZA 2O23A 1EDZA 3JQAA 4CUKA 4CL8A 2WEKA 3DMTA 5A4DA 4M86A 2FRDA 2DPGA 2CD9A 4L4SA 4NI5A 3OQ6A 1MFZA 1LDNA 3RVDA 1DHRA 2JD1A 1P44A 2IEDA 3BAZA 3RFXA 3GPDG 3DWFA 4ND3A 4J1SA 2DUUA 3ETGA 4FOSA 3TOXA 4WGGA 2Y1OA 1HZJA 3PYMA 3AUUA 4CMJA 4RVGA 4XR9A 3VH2A 3O38A 3CZRA 3T7EA 4BS9A 1X0XA 1W6UA 2I99A 2AA3A 8ADHA 1NPDA 1S6YA 2BGKA 1FJHA 1YJQA 1K6JA 2I67A 3BMOA 1LC3A 2DT5A 2JAPA 1E5LA 2CF6A 3KBOA 4PLVA 4PG6A 2BHLA 2W2LD 4GMFA 2PA3A 4RLSA 3EC7A 4UVDA 3RUFA 4BMNA 2BD0A 4JGBA 2G17A 1K2WA 1Z82A 2NTNA 3F5SA 3SVTA 3AW9A 4E3ZA 4BNTA 3Q9NA 4CUZA 3PHHA 4I5EA 3HN2A 4W9NC 3F1KA 1JWAB 4PLTA 1WXDA 4DGSA 1M76A 4BB6A 3RBZA 4P8RA 3ROMA 3HB4X 4E2WA 2Q4BA 3WLEA 3H6KA 2BRUA 3KEQA 3OBBA 4CM3A 2WWRA 3DMYA 4O63O 5HBRA 4K6FA 1OC4A 3DZHA 3X2FA 1DIAA 2EV9A 3A14A 4EJ0A 4BNNA 4IMRA 4G5HA 1MGOA 2HMWA 4U6SA 2HQ1A 2QHXA 2AQIA 1U8FO 1VC2A 1U28A 3EY4A 3UCFA 3BYZA 3ZV4A 3L07A 4NJOA 5JDIA 3GN2A 1H2BA 2Y1GA 1XG5A 2R6JA 4B4VA 2ZYDA 2OZPA 2JCYA 4RF4A 4FCCA 3QVSA 4BVAA 5T64A 1DLJA 3W8FA 1ZIDA 2QRLA 5TF4A 4A5OA 1KYQA 3JD3A 1GQQA 1P74A 2B35A 2OO5A 3ANNA 3FTPA 4UEKA 3UCXA 3ZU2A 4LRSB 4L75A 5COAA 4ZQFA 4YAEA 1DFIA 1R6DA 1TB4A 3H3JA 4MP6A 1UXGA 4CLOB 5A3VA 3G0OA 1I36A 2ZTVA 4WLFA 2BGLA 3RROA 2FR8A 2I3AA 2JD2A 1HYEA 5I7FA 4CM4B 4GWGA 5KJFA 2QZZA 5I8WA 3F3SA 1QV7A 1DIRA 1Q0QA 3GLQA 1T2CA 1DIHA 1KOLA 2J3IA 4BGIA 4J7XA 3GR6A 1LLUA 3N58A 4YJDA 3LVFO 4AICA 1U5AA 1EE9A 3WDSA 1D4FA 1WWKA 3K73O 4L74A 4PLFA 4ALNA 1LSUA 4R9SA 2XXBA 4JK3A 5GMOA 3TNLA 4H15A 4MVJP 1GD1O 5CDUA 4DQVA 2O7QA 1R4MA 1WPQA 1XU7A 3DB2A 1Z74A 3QA9A 4YT5A 3ZI0A 2ZB8A 5ADHA 3JD1A 3I9OA 4FD3A 3NTOA 4PLGA 4J49A 3RSHA 1J0XO 2B4RO 2AEMA 3L4BC 3BMQA 3F4LA 3WYEA 3OJ0A 4D44A 5JXWA 4AJLA 1B8UA 2D59A 3QQPA 3ZV5A 4W4TA 4NJMA 2J5RA 2Z5LA 4RJTA 3ABIA 4LN1A 2VHVA 1PQUA 1NASA 4PGFA 5ENDA 1I3NA 5K0ZA 1W73A 3HADA 4E5YA 3LZ6A 4I9HA 2X8LA 1DRWA 4TRMA 1KS9A 4GX1A 4WLEA 2VWGA 4CM9D 1BTOA 5JDCA 2V6MA 4FS3A 3DMTC 4YWJA 5IDQA 1F14A 2Z1MA 1UAGA 1EEHA 3GFBA 3AM5A 4UUPA 1ZK3A 5IN5A 3OIFA 4AL4A 4R51A 3CKYA 4CUJA 1VJTA 5JMWA 4OMUA 2EF1A 4RVFA 5CG2A 4CMGA 1C1DA 2OHXA 3RAJA 1V35A 3LT2A 1ZFNA 2GLXA 3AJRA 3Q1LA 4OXNA 1A9YA 1VRWA 3ZN2A 4B8ZA 3N7UA 3WICA 2GSDA 3GDFA 2YV2A 3LK7A 1U7HA 2Y0CA 2HRBA 1WZEA 3GAFA 1XEAA 4FN4A 5I9NA 4BNVA 3TFOA 5EERA 3LLSA 4Z0PA 3ITKA 4TROA 1ZEJA 3HFGA 2FHSA 3INRA 3PQDA 3PZRA 4BO2A 5A5FA 3L6OO 5JDCC 2XOXA 3TL2A 4JBHA 3LU1A 3JD4A 3FN4A 4CLOA 1M6HA 3ZHBA 2FOIA 3ZHYA 5ITVA 2R2GA 2VTEA 3C1AA 4BKPA 4DPKA 1GADO 4R3NA 1I24A 1GPDG 1J5PA 1HEUA 4XQ9A 4YPOA 4D3FA 4CMIB 3WG9A 3GRPA 3STHA 1D1SA 2WD7A 4WCFB 3ZHXA 2VHYA 1X7DA 4HWKA 3KLMX 4J7UA 3WBBA 1GUYA 1LU9A 1SB8A 1Z7EA 2GASA 4Y9DA 5DT9A 4XQGA 2VRCA 2X5KO 5EL0A 5DOZA 2D8AA 4OM8A 4OIMA 4PG7A 1RPNA 2UUPA 3RUDA 2OXIA 3TZHA 4CM7A 4P4LA 5IXSA 2ZQYA 3WR5A 1O6ZA 2VUSA 3FF4A 3GF4A 4MVJF 4FGWA 4E13A 2NNLD 3RU9A 4Z9FA 1XQ1A 3RU7A 3H5RA 3UICA 5ITWA 4WE3A 3SLKA 5L7WA 4GGPA 3BXXA 4MVJA 2BGMA 3LQFA 4FBGA 3DTTA 2XF8A 1Y9AA 1DHTA 4IJVA 1CIVA 3HNPA 5CG1A 3RFVA 4RVDA 3ZU3A 3DO5A 3OIGA 4E30A 2SCUA 2ZQZA 1NXQA 1RM0A 2J3HA 1YKFA 4EGFA 4PN3A 1PZEA 2Q49A 3JQFA 1PWZA 3HDYA 2O3SA 3M1LA 1YQDA 4Q3BA 1G1AA 1ADCA 3QVXA 3UHAA 1O0SA 5FEUA 4K28A 3IP1A 2FR1A 2X9VA 2VHZA 3EYWA 1YL5A 1ISIA 5COQA 4E31A 3RUCA 1T25A 1QG6A 4KQXA 5TSDA 5L4SA 1NVGA 1ZBQA 5L40A 4O0LA 1YRLA 2EEZA 2QZ9A 3GRKA 2B5VA 2LDBA 3AK4A 3JQ7A 1UR5A 5DZSA 3E9NA 4K6CA 4DUPA 3TOZA 4F6LA 1JTVA 3NRCA 1VKOA 3OEYA 1DLIA 4WLVA 3JQ9C 5IDYA 4BO5A 1A71A 5HA5A 2GZ2A 1MC4A 1LJ8A 3OJFA 2AW5A 2HK9A 3IUPA 4FIZA 1PR3A 2TMDA 1ARZA 1E6UA 3K2EA 5KJEA 1GPJA 2WD8A 2G1UA 2IE0A 2NVUB 1NAHA 3OEWA 4OOFA 2O3RA 1HZZA 2C2XA 2X86A 1YB1A 4QO7A 4CR8A 1PZGA 2BMAA 4UUOA 3JQ8B 3MZ0A 3PEFA 3BHIA 3F1LA 4DVJA 4BO4A 4B7XA 4IS2A 2DTDA 1DRUA 5TGDA 4CMIA 1LDEA 5FF9A 4B3JA 4IIVA 3TN7A 2Q2WA 4XGNA 4CM5A 1JVBA 1N1EA 2C7GA 1XKQA 4XKJA 4GMGA 4OGWA 4BGEA 3K96A 4DQUA 4YT8A 2AE2A 4ZQHA 1C14A 4CV0A 1P1RA 4BV9A 2W2KA 2WSBA 3COSA 2BKAA 1Q0LA 5DF1A 4UUNA 4DIFA 5J23A 1Q7GA 3DFZA 3L0DA 4J1QA 4YVFA 2OBYA 4RQTA 4PIVA 1P77A 3AOEA 1F8GA 1I2CA 5BT9A 4OQZA 3RWBA 4FB5A 3DZIA 4CLXA 2EKQA 3BMNB 3TRIA 1UAYA 4FOOA 4D42A 1R4NA 3PPIA 4EBFA 5B4UA 1SOVA 4XB2A 1ZJZA 1U8XX 1X1TA 1XSEA 3F6YA 1XA0A 2LDXA 4Z9XA 2DU8A 1BVRA 3FSRA 5AXDA 3VZSA 3WLFA 1MG5A 5JO0A 3RUHA 2CY0A 1P1IA 3GOHA 4RF5A 5B37A 4R3WA 1TI7A 3PYXA 3RKUA 3L77A 3PDUA 3RC2A 1LLQA 2HUNA 2HMSA 3ZU5A 3G49A 4FW8A 2ZTLA 1G6KA 1P1FA 4MKZA 4PLYA 3HDQA 4DTIA 1PJLA 2FPPA 3I83A 2GERA 3ZZNA 2PZMA 5H81A 3WBFA 5BSFA 3PYLA 1Y7TA 1PJ4A 4EJ6A 3RIHA 5KKAA 4FC6A 1F12A 4JP2A 2RIRA 4ND4A 3ASUA 2GDZA 3PHJA 1UP6A 4XEHA 1EBUA 3AFMA 1EFKA 2PD3A 1KIFA 1E77A 2WE8A 3DHNA 3WOHA 1ZEMA 3DR3A 3WGTA 3OA2A 3ST7A 1BGVA 3E48A 3PP8A 4L4XA 4ZJUA 2DBZA 2GYYA 4TVBA 1Z75A 3LT0A 1H9AA 1HE4A 1PQWA 2FSSA 1Y8QA 3VH3A 4J4BA 3KM0A 4R5MA 2POQX 1X14A 4Z6KA 3JQEA 1LLCA 1I01A 1BXGA 1NAIA 1FDUA 2PNFA 4BIIA 4WOJA 1YL6A 2HK7A 4ZRMA 4AJPA 1ULUA 1CQIA 4XRRA 1VPDA 2IXAA 1LNQA 4PG5A 5I9MA 3WGHA 1CQJA 4E2YA 3FWZA 4WUVA 3F4BA 1T2DA 2W8ZA 3A4VA 4A03A 5IDXA 4CQMD 4NU6A 1PS9A 1V3TA 2P9CA 1QKIA 4IQGA 4U5QA 3U62A 2BFAA 2GN9A 4J6FA 2V65A 4OL9A 4WK6A 1VKNA 2FPGA 4BO3A 1ZXBA 4AJKA 1Z6ZA 5KJ1A 1E1LA 2G0TA 1ID1A 3G3EA 1D7OA 2ILTA 3CH6A 3I23A 3S8MA 3OICA 3H5NA 1GU7A 5BSGA 1GEGA 4KOAA 2NTJA 1KC1A 2AQ8A 4JROA 4KWIA 3D3WB 4WLUA 1B26A 1NQOA 2VYVA 3U5TA 4J16A 3DXFA 5JMPA 1B0AA 2DFDA 1NNUA 2H5LA 3GK3A 3EK2A 4IMPA 4ESOA 2EERA 3IJRA 5TLSA 1RM5A 4GLOA 3LF1A 2P4QA 1ENZA 3M2PA 1U3UA 1T1RA 3K9QO 2OGUA 4UVHA 4CMEC 3IJPA 4D3SA 3WQSB 1MV8A 2VYNA 1F0YA 1YVEI 2XAAA 3HSKA 4MVJG 4N54A 2YZ7A 4XGKA 4AJEA 1DO8A 3JQDA 3HQ4O 1VJ1A 3EHEA 5CPFA 3U49A 4NFYA 4E5NA 1UP4A 5C37A 1R66A 4BOYA 5MDHA 1P3DA 2O50A 1W8DA 4R54A 2B37A 3PGJA 5LDHA 3QP9A 1F06A 1VE9A 1C0PA 3V2GA 5GZ3A 2H6EA 2WM3A 2X5JO 3I6IA 1Y8RA 5LC1A 1XDWA 1GAEO 5FI5A 3NT4A 3G1UA 1U2GA 3WNQA 2R00A 3S2IA 1QYWA 4GSKA 5T8KA 4DRYA 5TJ9A 3BMCB 5T8KC 3DBVO 2QRKA 1O5IA 2B4TO 2TMGA 3FWNA 1ZK1A 3NT2A 4DL9A 1JAXA 4E5PA 4E32A 4OOEA 4WEOA 4O6VA 4D79A 4CQLB 5GZ6A 4DWVA 4MPDA 1Y81A 1QYVA 2H1SA 3IUSA 4PZCA 2NSDA 1GFSA 5JC8A 1PJ3A 3HDHA 2J3JA 4NFHA 4CQMB 5JCXA 3TQHA 1JU9A 3KV3O 3DDNA 2B5WA 4IPTA 2CVOA 4QT0A 3NTQA 5A9SA 1KEPA 4BGUA 2VHXA 3WMWA 1G0OA 3LC7O 4DC0A 4DLBA 4BQRA 3GVIA 1ADGA 1MLDA 4BGVA 1YS4A 2FPIA 3QWHA 1ISJA 4YCAA 5F1KA 4E2XA 2IZ0A 4BKQA 5BR7A 3DZJA 4I9NA 4LVUA 2Q1SA 1YWGO 5DOVA 3ZV6A 3G79A 4QTZA 3TJRA 3RJ9A 1O94A 4NNJA 1MXHA 2UDPA 3IS3A 1E3LA 3ANLA 1R4MB 2VWHA 2JJYA 4XJTA 4LMRA 3ICPA 3GG9A 1GCUA 4YJFA 1X0VA 4BNKA 1DEHA 1Z7BA 2O2SA 1GCOA 3VKUA 2H63A 4OJNA 4O1MA 4I5DA 4A2CA 3EZLA 1YONA 4AJ4A 2P2SA 2Q1WA 2IZZA 2YJZA 2ZCVA 1SC6A 5ICSA 2WYUA 4MO2A 1NQTA 4LCJA 4OSOA 3JYLA 5JAIA 4H3VA 3KSUA 3R3SA 5GY7A 5JYEA 4YRAA 4E2ZA 3CTMA 2AQHA 4FQ8A 3A28A 2PV7A 5B12A 3TFQA 2GGSA 3P2YA 3C1TA 4BNWA 3JQAD 3WWYA 5IF3A 1L7EA 1PJBA 1L1FA 1SO8A 3E5RA 3OIDA 4XYLA 3QV1A 4IS3A 5JAZA 2WMDA 5JLAA 1UDCA 1JLLA 2YY7A 3AOGA 3ZU4A 4FFPA 4A27A 4GVXA 3WS7A 3GNQA 4Q39A 4IJUA 2YV1A 4BKOA 4BNMA 1LSJA 2AQKA 3GFGA 3T4EA 4CMCA 5CDTA 1E7YA 4DLAA 4RVSA 1KVUA 2OORA 1BG6A 4Z3DA 3ZWCA 4YXFA 2A92A 5JO9A 5JCJD 2JHGA 2PFGA 5DN9A 1G0NA
chains in the Genus database with same CATH superfamily
2MYTA 2FMKA 5C5CA 2CLSA 2GILA 3TMAA 1BW9B 1XOIA 4JI2B 1LZLA 3HG7A 4J0QA 2QVYX 2Q99A 2ZE7A 3RIGA 1XPJA 5U4QA 2O8BB 3DHEA 1COZA 1YO6A 4UOEA 2FPPB 4M21A 4ZGBA 3GZ4A 2C9CA 1SQFA 1ZH6A 3DPUA 2AVNA 1E64A 1RYMA 3F7MA 1K66A 3LDGA 1G5PA 3CHYA 2VNSA 1LPSA 2IKQA 3P20A 4U2BA 4KR9A 3PXBA 5DWDA 5SV2A 2IYYA 4LZOA 5ILGA 1JG7A 3I9LA 1G6HA 5DTIA 1KYIA 3ASVA 4BBPA 2PH5A 4ZVOA 1VTKA 2GK3A 1RBZA 5FAXA 3AM4A 3M7IA 2NZVG 3QOYA 1HMYA 1T4CA 3U7JA 4H18A 1XFAA 2J9ZB 1FYEA 4BE4A 5E7QA 1JLRA 3X43A 4BFVA 1B6TA 4ZCRA 2E21A 5CPBA 4MV7A 3DTVD 4TYYA 1EGAA 1O5TA 1OOEA 5JPCA 1R4NB 5AW3A 2X0JA 2EIHA 2PZEA 3ZNOA 1AQJA 3CLUD 4AG6A 4KR3A 4N8EA 3LC0A 2X2OA 1NRJB 5DX8A 1WPGA 1XU9A 1VL6A 1P3Y1 4Z8YA 1QQTA 4TM7A 2JLCA 4E13A 1XQVA 4MUHA 3TKAA 1QMGA 3S4YA 3E58A 5JYDA 2C5AA 1JDVA 4HWTA 3T52A 5L4NA 1UZNA 4L72A 3NP9A 1M0EA 2XX3A 4XQCA 1W5TA 3NBFA 4W1QA 5C32A 2IXBA 1Z28A 1ZGBA 2EX4A 2MU1A 4P0PB 4YPVA 4NFLA 1IUNA 4NECA 2VHUA 4AN1A 1BVUA 4TSKA 2WIKA 5JVDB 2Z57A 2Q5EA 4NPAA 1XAJA 2NVBA 1EWKA 2EWMA 1C7IA 3EXIA 4MTLA 5FFMA 2OFOA 2C8JA 1W36D 1OW3B 1UXIA 2ZANA 4A0RA 2O4UX 2HBRA 4WPGA 5F2NA 4EJMA 2BM8A 1JU3A 4O4HA 3ROEA 1QX3A 4R8KA 4Q1FA 1L5LA 5B30A 4FE4A 1AGRA 4LI0A 2ZJ0A 1E2DA 2DHQA 1DU4A 1UJMA 3O7MA 4PHHA 2O3TA 4X85A 3T5AA 3IQXA 2IHYA 1PIWA 3M8KA 3PI7A 4XUDA 1XZQA 4KMSA 1UIRA 4B6PA 1OPRA 4FFNA 3ER9A 2HPVA 1R8SA 3MJCA 4WNIA 1ZJJA 2GD2A 1Z8DA 3RVQA 4BP1A 3PDIA 2G70A 3I61A 4AO8A 1XZNA 1N36B 3AQIA 4XIJA 3DOJA 1MD9A 3OC6A 4LGYA 2VHCA 1O87A 3FPLA 1XZIA 3GA0A 1ZN9A 3GJSA 3NCTA 4KDCA 4B7ZA 4ATNA 2ZLBA 3A9RA 1NLUA 4ZMRA 1Z6AA 3BXOA 3RKRA 4CTKA 3MRSA 2ZSIA 4FGZA 3K31A 4M55A 2IYQA 1KYVA 4P33A 1Y3BE 2AZMA 3EFEA 4BN4A 2A94A 1AV6A 1IBMB 3ID6C 3K2BA 3KJZA 1ND5A 1O97D 3BIJA 2NMVA 1PCXA 2XXJA 3LF2A 3UJ6A 3FDZB 3UN1A 5KOYA 3TLJA 3L7LA 2PMBA 2F67A 2XCLA 1E9EA 1F8FA 1K3UB 4IIXA 4KVGA 1H6BA 4E70A 4KIJA 4DN6A 1HXHA 3R0XA 2YQ4A 1NUUA 5IU6A 3SFVA 3EMDA 3GMIA 3KAJA 4XUGB 1R50A 1AE1A 1KBZA 1Y8CA 2FP4B 3FTNA 3LPDA 3O4GA 4AKGA 2IOQA 1V2HE 2AR0A 2CKDA 3KLOA 4S3MA 1QXSA 4HAOA 4X92A 4J29A 4BO0A 1V3UA 4C6TA 2BFFB 1PR6A 3JQ6A 3VR6D 1P2SA 5AUQA 2CL7X 2E4YA 1U2TA 2K2QB 2WHYA 2YMLA 1OSNA 4G07A 1DO2A 1KAMA 4QU5A 1GXSB 4NYIR 2NU9B 1NQVA 3THSA 1RXUA 2VSOA 3BGSA 4A2PA 1IL0A 1AOXA 4RJIA 2KYRA 1XRSB 2WFLA 3NQ41 4IR7A 3W4KA 2RDMA 4GR5A 4TLAA 3PQ8A 2EVWX 4MQMA 2X0KA 1QV9A 2VEOA 3GZNB 4GMKA 4F4HA 3K7EA 4G85A 5F12A 3K8YA 2PZBA 3ENNA 1EQUA 5ALHA 2HU7A 4W99A 5ALFA 2Y2VA 2HXSA 1ZPDA 2PO7A 3HBMA 1B7GO 3H4VA 2CXXA 4MVJI 1TRKA 4S1WA 1QRDA 1NUQA 3A9CA 1VE1A 3A9SA 3IAXA 3LL4A 4G84A 1XROA 4AMGA 5BOSB 1R88A 1P0FA 2DOKA 1TD1A 3OOWA 5FT9A 2X42A 3BHJA 1NI5A 1RYFA 4JHLA 4C6HA 3HYTA 4LYGA 1R64A 3DL4A 4FKBA 4M7RA 5EE9A 3KJFA 3HKDB 4HV4A 1NVMB 4TN5A 1K5HA 1VE6A 3PVSA 1GYRA 3EQ9A 2PR2A 4NU5A 1K7EB 1RHMA 2DF8A 1KE2A 2ZDGA 4HQFA 1GLVA 3UT5A 5F9HA 3W6UA 2RCNA 4KI7A 4X00A 2OD2A 1Y4ZA 4EG0A 2PXHA 4FR5A 4EH1A 4QUJA 1QH9A 1FB5A 1NBOA 2G1AA 2P35A 3IOCA 4RPCA 2CVQA 5DCUA 1Y63A 4XDYA 2B3TA 1EI9A 4ARUA 2J0UB 3L7BA 2L18A 5JAPA 1HA3A 3P2EA 3ZV3A 3WIEA 3NHMA 3Q12A 1CEQA 2R62A 5KDLA 4LJSA 2G0AA 3JZAA 4ZQGA 2C96A 1P7WA 1UBRS 3HCEA 3M33A 4NBUA 3U81A 4KQJA 1MTOA 5JFTA 3RHZA 1KERA 4BO6A 2A8YA 4ALKA 2QTNA 1E60A 4D3ZA 4HBGA 1PUXA 1XTRA 1U5CA 1CQJB 2ZB7A 4WNYA 1CRWG 4O5OA 1Z0UA 1NZJA 4OYRA 4YV0A 2B8JA 3VPHA 1U2SA 2IF2A 3VHXB 5IT9A 4IFTA 2ZUWA 4YDQA 5IAAA 1RKUA 1U3GA 3O0TA 3DE3X 3NP7A 5CEEA 4I8DA 4D56A 4NPCA 4ER0A 1F3OA 3ZDXB 3IA7A 1N7IA 3VNUA 3ORHA 1MG0A 1BX1A 3ZHCA 4L78A 1K9SA 4V1CI 3WLJA 3G23A 4EDFA 1OLSA 1YC5A 4C7JA 1J9ZA 4GL2A 4XLLA 4RK0A 4XIGS 3QPAA 2QLJA 4CNBA 2CDNA 1AB6A 5C34B 3C2QA 2JG3A 2CT8A 2EJCA 1NBWB 1PZNA 3BZWA 2EZTA 2WA2A 4J0GA 3L8DA 1LA2A 1EM8A 2C4MA 3OP1A 3F3YA 3W2TA 1IBRA 1NVTA 1CUXA 3S2FA 5IFLA 1L8QA 2VCHA 4PHGA 3VH4A 1YS1X 3IHLA 4L6CA 4BP8A 3FR7A 1POWA 2ADOA 3II6X 4PM4A 3S27A 3JWEA 3MBOA 3CX4A 5G40A 1VI6A 4LOKA 3B3AA 2BONA 1H6DA 2PLNA 2PO5A 3H2GA 2GPTA 2H51A 3ILSA 3KB1A 3LOQA 4RJ2A 3TD9A 5DLYA 2PJZA 2VT3A 4G5XA 4DV5B 4J91A 2PQ6A 4GQAA 3KWJA 4X6XA 4BLQA 4QLBA 4Z4GA 3AB3A 4LWPA 1WG8A 2VYFA 4RKQA 2B36A 2DUJA 1DMRA 1UFVA 1YDFA 2MJLA 2PZKA 4A23A 5HPYB 4MI9A 3OLCX 2ZTUA 1Z37A 1MQ8B 4WVFA 2COKA 3LY5A 1U2QA 4TRJA 5D3KA 1A8HA 1DL5A 2DZDA 1IATA 2JCVA 4REQA 5E6RA 1OFGA 1QG0A 1FMFA 1CJVC 2W6NA 4PPYA 3R3XA 1IHXA 3W34A 4G0VA 5B5SA 4HADA 1F17A 4EENA 3KEOA 1KJ8A 1ZSNA 1MABB 1RZ3A 1Y3AA 3C3CA 1N5OX 3IX7A 3V7WA 1F0PA 2E55A 1XWWA 3SQNA 5L9AA 4HQLA 3KQWA 4Q18A 1VPVA 1J24A 1I10A 2BBSA 3PNYA 4ISBA 2E7ZA 2JIQA 5FA8A 5IZ4A 1TZ2A 3HB9A 3QENA 4GKVA 4IDCA 1VRVA 1ZWKA 3ZCPA 4YRDA 4MUMA 3EFBA 3JYHA 3K71B 3TBFA 4XGRA 2CDAA 2QLMA 4PBRA 4UPVA 3O84A 1BHJA 1ODIA 1P81A 1NZFA 3BE8A 1DDOA 4PANA 1CZUA 3MRVA 3V80A 1TYEB 1RLJA 1KXJA 2B69A 1OXVA 3IBGA 1S3SA 2JFVA 1US8B 3WJ7A 2EU8A 4ACAA 3H4IA 4RS4A 3VKVA 3EW7A 3PNPA 5FYDA 3PRKE 4YJHB 1TCUA 2ADFA 4D92A 2IHKA 3VVBA 4CQJA 3O8OA 3LYUA 4D74A 3P1JA 2WJJA 1R5JA 2IEIA 5SY4A 3HNRA 3FPEA 3NTXA 1KH2A 4YV2A 2QB5A 1TT5A 4HKTA 5FBVB 1RAGA 2CFRA 3HKDA 4R2IA 3CEAA 2FW8A 3NBUA 1TEZA 1KRWA 1N34B 2QR5A 1U2DA 2V3WA 1OBCA 1RKBA 1SBTA 13PKA 1Q50A 4KGZA 2I91A 1G8MA 4HI0E 2ZYAA 4UEOA 1CR0A 4PYLA 1GGNA 2FPIB 2KW5A 2OVFA 3FFBA 2F8LA 3PTZA 4URYR 1NURA 5E6SA 2FEWB 5ENVA 2PX4A 3S99A 4E4TA 4DV7B 4OAOA 4JUDX 3X1XA 4XUEA 3HWRA 1S2DA 1YCDA 5TARA 2HV9A 3DFUA 2JGRA 2TSYB 3IR7A 3V7YA 3PGA1 4UNSA 4LF5B 1YVDA 1SEPA 3GEDA 4BFZA 4UOZA 2CJWB 7MDHA 4TS9A 5LR6A 3LGXA 4O4IB 4L0MA 3DOCA 5ER6A 5BURA 1F7UA 4WZAA 4GWKA 5FPQA 4JXXA 3WL5A 1E9AA 1PWYE 3EODA 2PRJA 3WL3A 4EA8A 5TQ2B 2QT9A 4KZKA 5AHKA 1E6KA 1CQIB 2D4AA 1QCDA 2OQ2A 5I8ZA 3WSVA 4FHGA 3VOBA 2W2OA 3F6PA 3OZGA 3SHOA 1CNEA 1LKZA 4DMFA 4IJWA 2YBEA 4RHEA 1EHCA 3OEEA 2RI6A 4K88A 1J23A 1Q17A 2GETA 5KWJA 4EJFA 3BA1A 4MYUA 3KWMA 3LP5A 2ZJ4A 3EGCA 3IIIA 4TXLA 5LMNB 3QE2A 1DCKA 4PG8A 2QSJA 4CR6A 4DIEA 3E5NA 4DAOA 5LJIA 4CDNA 4XTCS 1DWUA 4MGIR 1JJVA 5TJHA 4LMBA 5CEFA 4FOLA 1DDGA 1VPEA 1X2BA 1ZD1A 2B4KA 2DKOA 2EGHA 4MEAA 4ZVRA 5H1YA 1FRNA 2XVAA 3C4QA 3KYDA 1PQYA 3OQJA 5FNZA 5LBUA 2A33A 2Q1XA 3RGWS 2P5YA 3B82A 2EKPA 5L3QA 2QT0A 4U5XA 5KNCH 2VDWA 3B6IA 3I3OA 1QTQA 1V7CA 1EJ0A 1KMNA 2RJ3A 2LIVA 2O0JA 2V7VA 4U8HA 2WZDA 2R84A 2VZ8A 1UKYA 1HLFA 5JTTA 2OO5C 3SJZA 4ZI7F 5K0JA 3PJGA 4B75A 5HKAA 4PYNA 3I72A 3BGOS 4IDQA 3G02A 4JYMA 2PG3A 1OLUA 1T1IA 2FN4A 4HY3A 4MSUA 3U9SA 1OZAA 4PCAA 3PLNA 4F3CA 3T1NA 2OCBA 2BEUA 4DUZB 4N0DA 1CY6A 1EZZA 2XB2A 2ONZA 3AI2A 3BOSA 5H9WA 3C1UA 5DYTA 1VDMA 1R0RE 3UOWA 1JVNA 2JBAB 3GRUA 3RBAA 8OHMA 2AS0A 4ER7A 2IH4A 2DBVO 3ZDBA 5BN1A 4IDAA 1LV8A 1P9LA 5TR9A 1ZU5A 4MWDA 3C3XA 5L3SB 3EZ9A 5JAUA 5LCXA 1P2FA 1GEEA 3DA8A 9LDBA 2VPWA 3I2GA 4GOJA 5AVTA 4JLUA 4UM5A 5CAEB 2FFJA 3VPXA 1JKJA 1X1DA 3DB1A 1COWD 1P62B 3U56A 1MU0A 1U7PA 3FDJA 4J0IA 721PA 4AY6A 2J31A 1FK8A 3ANMA 1SBYA 2CVZA 5EQTA 1XIVA 3SHQA 1RWBA 1P2BA 3FNGA 1WMAA 1O89A 1ORRA 1HRKA 4FT4A 3H1PA 4MDYA 5I4BA 1IQRA 3TIXB 1Y6JA 1T9KA 1PSWA 1T0IA 1JECA 5D6NA 3L6BA 3IUEA 3Q7PA 3WLPA 3NIBA 5A5GA 4TZTA 4Y2VA 3SYRA 3MPUA 4ZT7A 2P1RA 2ZBRA 1GUBA 1MB3A 3TTVA 4G36A 2Q7OE 2R6R1 2AEFA 1YDEA 3U3MA 4J4HA 3UUWA 2LUOA 2X3YA 3T1TA 5FPTA 4RA9B 3RYCA 4BQPA 1F4PA 4QXMA 1OYYA 1SB9A 3MJTA 4RK4A 4PFJA 4YCNA 3PQ4A 4KOEC 3MC1A 3ZGYA 1GA4A 2FSUA 3RIYA 4C2UA 2C59A 4HS9A 1C7RA 4Y9TA 2QXTA 1JL3A 1Z12A 2ZRDA 4ZA2A 3ZHRA 5FO1A 1DE0A 4OHMA 1M6VA 2UUCB 4TTJA 4XYMA 1SCBA 2YVKA 2FYTA 1BW9A 1SULA 1KL7A 4M36A 3VNVA 3WFJA 3TLXA 3V33A 3AEQB 3OT5A 2J7KA 4N47A 1T2UA 4NMHA 1I4OA 1QHGA 3P7MA 4NG5A 4G41A 2RGWA 3SX2A 4N3NA 1Q5PA 4RVHA 4IDPA 2C2YA 4BTVA 2QPOA 3AKCA 3H0EA 3I0ZA 1QWSA 4US2R 2BGTA 1G2QA 3BJMA 1G3MA 2IEGA 2A5DA 2HO4A 2YDYA 3O3MB 4W7HA 2DUWA 4CR7A 2R1TA 2I4RA 4B0PA 1RAIA 3TTWA 2G82A 2IHUA 4AXXA 2QUAA 1XB2A 3KQOA 4MCAA 4RGBA 3VYWA 4CCSA 4ZCIA 2AI2A 4DV3B 4QEKA 2J9XB 1TX4B 4M54A 1XZFA 2KM1A 2C5EA 3C85A 4IIUA 4V0KA 3UTDA 5A2GA 5I7UA 4FFSA 1WUIS 4D99A 5LL6P 4H7PA 3K6SB 1SZDA 1Q7RA 1T6XA 1BDJA 2BLNA 4RDIA 4TUYB 5FADA 4EY5A 5ED0A 3WI7A 2GCPA 4I3FA 2NNWB 4P7GA 4EUHA 4PPGA 1HF3A 4NAHA 5G0VA 4IYRA 2JGEA 5HQTA 4IX1A 3DCNA 2PGIA 1Z7GA 4E15A 1J33A 2O7SA 2H16A 2ES4A 4U0KA 4GOXA 1L5NA 3I9MA 1SXPA 2ACVA 3PUWA 1PR2A 4YALA 4F84A 1V1MA 5G3YA 3GJQA 2VIIA 5DW0A 1QCZA 1N2CB 3PQEA 3U4IA 3WNVA 5K3CA 5C18A 4KAJA 5AKIA 5F3DA 1XWFA 1W4BA 2GN2A 3WK4A 3KQHA 3O7WA 1XLTA 4RL4A 4QRIA 3DD1A 4U2DA 4AJJA 4F5EA 3ZWWA 3SE7A 2NUAA 4A8HA 4Q4JA 4ALIA 1EFRD 4BWVA 3FOFC 3PTLA 4JUFA 1HY3A 2DTXA 1YE5A 5AK3A 5DHAA 1OZHA 1RLMA 1USWA 2IPOA 5A71A 5A3JA 3H8VA 2Z2ZA 4BHTA 2HA7A 3O26A 1F3LA 4OQ4A 1HFJA 4OJKA 3U4CA 3U7GA 1UKBA 4MW6A 1WV1A 4GMDA 1QGZA 1RAFA 3DL0A 4IJ5A 1CRQA 4PO9A 4NFSA 4WBXC 5LXTB 3V4OA 3M3PA 4CMEA 3R1IA 5E1BA 1UBKS 1OVMA 1U9JA 4YCJA 1Z5WA 4NY1A 4Z3OA 3I5UA 5AW5A 1UBMS 5GP1A 4QJBA 2A84A 1KK3A 5H16A 4Z0TA 1ODCA 2FFBA 4R01A 3WZMA 5HW0A 2F00A 5A2QA 1LF0A 2PYZA 1KDPA 1N9GB 1SRRA 1VIDA 3JZFA 4LYHA 3OSUA 3SYNA 1U3CA 3IE0A 4L8FA 1NX9A 3UXMA 1VSBA 2VP9A 4P4SB 1AIPA 1PJ8A 2VDUE 4KQGA 4Q1BA 3ADDA 4XWKA 4KE9A 4ZHQB 5IJWA 1LDYA 2P91A 3WMGA 1AZSC 1L4LA 2MSCB 4J90A 4RH1A 1F60A 3CMMA 4OKIA 1OE0A 1CWUA 3GAZA 3BTVA 2HCBA 3CRW1 2B2XA 2X8JB 3HABA 4B6JA 2C77A 1AHHA 3DEZA 5CDHA 3NOQA 3GFSA 4NHOA 3A9VA 2BTEA 4YUYA 3HXLA 2A4KA 3VOSA 1NN5A 2VRWA 1C1DB 1Z88A 3GP3A 1WMSA 4NONA 5IBPA 1DQPA 4ZAZA 4BEJA 6ABPA 5KAPA 2X2PA 3ZPXA 3ZCXA 2IYUA 2IY8A 2W0SA 3SGLA 5JNSA 3FWPA 3E27A 3I2IA 5AI4A 4ZCPA 4V3CA 1UMDB 5EEHA 2IU0A 1FJXA 2QRVA 3TQQA 2VTDA 2IYEA 3DL2A 3OZCA 4PTZA 2C94A 4MYCA 2XDWA 4Q66C 2FFRA 2R7AA 3A36A 3M89A 3JWPA 4QDOA 1AMNA 1XD2B 4HN2A 4IO1A 1NBME 2HMTA 2REQA 3B5IA 3B1XA 3QJ5A 1Q15A 5BQXA 2ZJ7A 3NYWA 3V4LA 3ZGLA 3F96A 2XCQA 1R0LA 4IDEA 3ZGNA 1FFCA 4EL5A 1XKLA 4EGJA 2GCIA 2G80A 5BV7A 4N5IX 1KORA 2ZM5A 4QYIB 2C0CA 2AV6A 5ALRA 1RP1A 5F9MA 2HI0A 5C4IA 5ENZA 1N77A 4MQEB 3M5CA 1U2RA 2FWAA 2GPSA 3PXXA 4JOBA 1KARA 1ZK0A 4U3JB 3QBDA 4FI3C 4XCVA 5CR9A 4JBYA 2GFHA 4M9UA 4D82A 1JHXA 1Z4NA 2AN9A 4LRXA 3ZHZA 3JQGA 4KDRA 3W5AA 2FGKA 1K68A 3EMVA 3GX1A 3LVRE 3QVJA 2I6TA 1U7OA 5B6IA 3EZ6A 4B32A 2AJLI 4YCCA 1TJNA 3N59A 2XUAA 2A5FA 4DGQA 1BWSA 4G0XA 2WZCA 1KMCA 1QTRA 2D4HA 3O6VA 3U3XA 3ZH9B 4IDOA 5CVTA 3QRWA 4YMVA 1GA6A 2Z5GA 1YA8A 4HDNA 2NU6B 4M0EA 3VHRA 1Z6GA 2PFSA 1E9SA 4I1UA 4X60A 4KXWA 4C5AA 4JFAA 2GN6A 3ZCUA 1UAAA 1U3TA 4MYSA 3W6OA 4RYDA 2HIGA 2FOXA 5AJHA 1RWOA 3LNTA 3HBFA 3ITEA 3SC2B 4KO2S 5TEWA 1UEJA 1J06A 1XDZA 2D3TA 2PUCA 3LRPA 1G9XA 3TLMA 4NSNA 5K3FB 1KVRA 1DS6A 1X9IA 4MS1B 4CU2A 2GHIA 2JFQA 3FKSD 2NW6A 1FOEB 4YCLA 2BFWA 4LOHA 5K4GA 2IS1A 3DHYA 1WBJB 5B7PA 5IVHA 1GIAA 3QUCA 4K0RA 4LXYA 5BXQC 4KRGA 4HDAA 2QX6A 3HWX1 1IY9A 3H8WA 1THZA 3IQFA 3R6GA 4PRKA 4RIFA 4L0CA 3PVZA 1SUIA 4ZVQA 5KX5B 5JZBA 2CZGA 3FZGA 4C7OB 3E4CA 3G13A 1QGUB 2IDMA 2Q2OA 2XSZD 5IZCA 1JDNA 1G5TA 1WAMA 6LDHA 5KNDH 5DNYB 3ENQA 1D2CA 3C6ZA 3WLLA 4Y3UA 1XHLA 2P5UA 2NTYC 3UFXB 3L6UA 4FXPA 1OF1A 1B41A 2CVPA 3K8ZA 4XZ3A 4CKXA 1CK4A 2C9OA 3DMGA 3F3MA 3BQ9A 2O8BA 4TMZA 2NVOA 2YXLA 4PZAA 1XTZA 1SXJA 1PFVA 1SKAA 3BSWA 1QQBA 1HE8B 5JZOA 2YJ3A 1M6WA 1QS0B 3DC7A 3KPUA 4OHFA 4IRUB 3S44A 3JWGA 1N5DA 4NJMB 4OJQA 1XF1A 3FVRA 5KMGB 2ZSAA 1R0SA 3NONA 1N92A 2C54A 1RVV1 1Q77A 1CZHA 2KBEA 4JU9A 2J9FA 3I0NA 3K53A 2CV0A 5ICMA 2J3DA 5K0GA 2BF4A 1L8LA 5CYPA 2ERXA 3V9AA 5KCZA 1T0HB 2VJPA 3SHFA 4NBSA 4DPMA 3COZA 2PLFA 2VTKA 1M0TA 5G3ZA 4Q1VA 2WMYA 3MRTA 5KVSA 1WR8A 4YAGA 1KYZA 1CKEA 1YJBA 1SC1A 2HTEA 4IY1A 3RVBA 5T3UA 2ZUTA 1QHEA 2O8FA 1DCTA 2NIPA 1S3GA 2C0PA 3PE3A 1EG2A 1Q6YA 4GZ6A 1GY8A 1SU4A 1ZN8A 1BEUB 3CUEF 3EY9A 2P11A 4L9RA 4ZVLA 4ZEOA 5HKBA 1Z34A 2I87A 5KOHA 4PO1A 4QEDA 2P9EA 4D81A 3R9XB 1MAAA 1JP7A 2E85A 3IKLA 2FXVA 5IEBA 5CB4F 3Q7RA 4HNAB 2W6ID 3ZE6A 2VH2A 4B7UA 1I4DD 3CXUA 4AJHA 3H9BA 1L7MA 3A9TA 4TKMA 5L3VA 4OX9Y 1KHHA 3BMOB 3I2JA 1XRNA 1AKMA 3PVCA 4L85A 5JI2E 4WZAE 1WZNA 1N32B 5ITZB 3I76A 4YMIA 5LQKA 3JU3A 4EZBA 3TF5A 2Q8PA 2NAFA 2P30A 3V2HA 1Y5NA 1VE5A 4HNHA 5FOUA 5A9TA 4I46A 3TAXA 5AJTA 2R8PA 4YR9A 4QVGA 1K92A 1WCYA 3FPKA 3IMCA 4NXMB 2IJGX 7AT1A 4PSUA 3H0KA 3AF4A 5CT8A 1NRWA 3DZKA 1FXSA 1HNNA 1F5SA 4QBGB 5G02A 3UJ7A 1AHNA 4R6XA 4BMVA 3GA7A 5JG7A 3UWDA 1CP3A 2YWBA 4R9VA 5M5BA 2NO5A 3O82A 4Z99A 2AFIB 5B64A 4Y1RB 5L95A 3G0IA 3GPCA 2LV8A 1RMYA 4BTLA 5I8PA 2W2TA 3SR4A 4FFRA 4Y6OA 1UADA 1NVVR 3KXDA 4HQRA 3JQAB 2DECA 2C78A 1GTVA 2IITA 1KAQA 2HL6A 2QVXX 2ZIVB 1UJ6A 3ANYB 2FMUA 3HR4A 4PNZA 5DNVA 3F0TA 3UG7A 4GI1A 4AX4A 1Q0TA 1A98A 1UDAA 1QRUA 1NXTA 2Q21A 4QXQA 4YP0A 4E33A 4IGEA 3C3AA 2XGJA 4D98A 3H2BA 1HT2E 3K15A 4QGAA 5ALLA 5GM2A 5KSPA 5JRJA 1FP4A 1MRZA 1K88A 2AEJA 2VCYA 1AQNA 4MRMA 3ADOA 3MQ4A 4X1KB 1HTTA 3EVNA 4R41A 3EF3A 4Y6SA 4F92B 2GBCA 4PV7A 2P27A 3MS7A 2B83A 4DJFC 1P1JA 3EUWA 3BWVA 4PYOA 4TT3A 3AR8A 3WWEA 4IP0A 1EVEA 1QQ5A 4MKXA 4D8XA 2UVPB 5B7QA 2XYVA 3L3BA 3H83A 1T5HX 1FF9A 1NE7A 5EMLA 5EIWA 4CCWA 2C3OA 2VP3A 2BH9A 4HQ6A 4UJ5A 4TV8B 2RB5A 2DFVA 4E6EA 5JAHA 1H3EA 3G7NA 2ZUEA 1KEEA 3SQWA 4I4LA 2WIDA 1EZ4A 3H6HA 4IZOA 3PK0A 3R5HA 2DULA 5CTJA 4Q4CA 1KY2A 4YFVA 1QAOA 3D3JA 1V39A 5IW8A 2XMQA 1RI4A 1QZUA 2JARA 3AP1A 5EZQA 1SHLA 4M37A 2Q9AA 4WH0A 4TV8A 3S55A 3OP4A 4EHAA 2WRZA 1X1RA 1N4DA 3DNMA 1ZR2A 3PUXA 2ICAA 5M34A 3MTDA 1M5TA 1ZUD1 4FGSA 4IFBA 3LK6A 4IG9A 5D01A 2CNBA 1PVVA 1OASA 4NESA 3WZ2A 1QH0A 2NUBA 2Z6VA 3NNDA 2EBWA 2X0EA 2AN1A 1SVUA 1QF6A 2WG2A 1E1NA 4EB6B 1KZ9A 4HBZA 4XWGA 3IP6A 2F9MA 5GGYA 4GYJA 2QQ0A 4D6PA 1AQUA 1LPBB 4DUGA 1K6IA 3ZE0B 3M9XA 2XUKA 3OFSA 3ILVA 1BU8A 5FBLB 1XLTC 4RPLA 3JRNA 4K5QA 5DFAA 2G5PA 2DT8A 3PSAA 4K46A 1AUPA 1D2AA 4PRYA 2O9JA 2CK3A 4B7CA 2ID9A 3ZTTA 3IKJA 1SUWA 2I1QA 3Q2KA 4QHYA 4UDYX 3M81A 1TIKA 2YHBA 3RC7A 2IH2A 5DCLA 1V8OA 4MW4A 3SYMA 1RQRA 1W2GA 4HUQA 1X9HA 2QW8A 4O2BA 3RQSA 3GN1A 3FY4A 3DBRA 6AT1A 3G9XA 1V7ZA 4YAIA 4FBMA 5J3JA 4EUFA 4NRDA 1FSGA 3T7TA 4R98A 4JZYA 3DMPA 2POCA 3MTIA 2KJQA 4BCCA 4IOJA 5HQ3A 4RTRA 1OH6A 4S24A 3HTXA 1DJQA 2DWCA 4B71A 2CLLB 1PSZA 4GPAA 4HF7A 4R2HA 4GH5A 2VDKB 4BNIA 2D5CA 1FFXA 3PGKA 3GLGA 1EDDA 4IEIA 4M8LA 2IBTA 1PZFA 1ZDMA 3D02A 3FZQA 1O95D 1Y48E 5J2TA 3D0KA 2FQWA 2RK6A 1BWQA 1GA1A 1U99A 1Q1NA 2UYQA 4TVSA 4YMTA 1MX3A 2X0IA 4KXYA 1WXIA 2GTPA 2N3ZA 4B48A 1HE2A 2ZJOA 1KEWA 4HQ0A 2WAXA 1GT6A 3F8TA 3ILXA 3G8BA 3HWSA 4IIJF 4R31A 4Z86A 5FBQB 5ILQA 3BX1A 4FFDA 4ALLA 3MS2A 1Z3IX 2AK3A 3ZZUA 3MPOA 1WCV1 2RHJA 4UMDA 5CFQA 2AN4A 2PYDA 4WBSA 1U0GA 4ZOBA 4GQIA 2G07A 4FDTA 5HGJA 3L04A 3AR9A 3PKJA 6NULA 3DBHB 4TUYF 3ULKA 4A6XA 3FRJA 1HYGA 2QMEA 2VC2B 3OMWA 5K8IA 4PC7A 1DCMA 4LJ6A 1G63A 3NC1C 4F46A 1JEOA 2RGGA 1WRBA 2DPHA 1RM3A 2PLAA 3ETJA 3NVMB 4FJ2A 1R8YA 3QI2A 4BP3A 2BJHA 3D7SA 3CF4G 5CX4A 3UAWA 1M8PA 4Y2UA 2GHTA 3BD9A 3DH0A 4KK4A 2WJZB 2WKSA 1JPNA 3CJRA 4A73A 2G9ZA 2C4NA 2IP4A 1QONA 2BMEA 2EFGA 3L4BA 1OLUB 2ZYHA 3UATA 4C21A 4TKVA 4ZPXA 4RVCA 3MGGA 1Y1LA 5CA1A 5EIAA 2G1PA 5E0KB 1DI0A 2CLOB 1FP2A 4II2A 5F1PA 1SCNE 3BZUA 4G01B 3H2JA 1XD9A 2W4IA 4PG4A 2PTGA 2KI5A 4HDKA 4U7WA 4EF6A 1AXRA 4DRXA 1Q2XA 3PJEA 3RI3A 3UA3A 4M1EA 5GV8A 1SIWA 4BQFA 2F1JA 2AZ4A 3WL6A 3SXUB 4A6DA 1JYFA 3GGPA 4P80A 4PGMA 1XVTA 3LBNA 1ZVMA 2I29A 3OA0A 3AUAA 5A05A 2CB0A 2PH7A 1YQEA 4OFWA 5KJCA 4DADA 2IS6A 2P8JA 3PGMA 3ZK7A 4AULA 1F5NA 1LNZA 4WUTA 4OI2A 5J2UB 3VX3A 4JQSA 3BMQB 3NGMA 4B45A 4IDBA 4KC0A 5DPMA 4FUTA 5E3IA 1M2JA 2WYOA 2COUA 1MC8A 5A0TA 4GLLA 4TKUB 2I5PO 2P8SA 1GV0A 2AYYA 2X22A 3I9NA 4RC9A 1EK6A 1EU1A 1T1EA 2NZYA 2XDQB 3B3FA 5DTMA 3YASA 2WE7A 4BLWA 4DLWA 2R1VB 4F4FA 2QIPA 3H7IA 4FGKA 1RI3A 3VZDA 1BQ4A 4YMGA 4C03A 5CT4A 5AJWA 4II3A 3CRVA 1E61A 1VFPA 2IBMA 1NJ8A 3N2NA 2OQRA 3DLTA 3GDWA 4H35A 4E11A 3HN6A 2J41A 1Y9DA 2AWNA 2CMDA 3U19A 4BB5A 1E1YA 1UANA 2GN4A 3AVOA 3MM4A 2EG9A 4QHTA 2GDJA 1NLFA 4I3GA 4OLFA 4Y0NA 4J43A 4R1UA 1U9IC 3EB9A 5LM3A 1J8MF 3L7CA 5BSTA 2YMMA 3L06A 4LTDA 3GJTA 1QFYA 4MWBA 2TECE 3H17A 3I8OA 4TLCA 1Z4PX 4DNFA 4FZJA 4HFJA 4KV7A 1GQOA 4RTKA 1ACJA 2OZEA 1RI5A 4ENPA 4WDRA 1UBNA 3NALA 1MKYA 4B5LA 3LD9A 3F7NA 1YIAA 2AHRA 2HA6A 4U9IS 2CUKA 3STXA 1NIJA 2XZLA 4GICA 4WNAB 1HSZA 2ZSBA 3OU6A 3MJ4A 1TCVA 2ECFA 5BR8B 3R0VA 1IY0A 2Z0MA 2JL1A 4B3HA 3IEKA 4W5NA 1HLDA 2QZJA 1Q0SA 1AKQA 1WTAA 1G60A 2BUAA 5JHHB 2YHAA 2YUIA 1NATA 4EPVA 4TMVA 2IRWA 1VLHA 4O0MA 5L3ZA 2GBLA 1PUIA 1A7AA 2ALJA 1OZGA 2D2IA 2MINA 2NVUA 4RIHA 3WB9A 4B4UA 4DNQA 2R48A 4MGZR 1E94E 1CUEA 5CGQB 1A0OA 1OPXA 3R09A 4ESEA 3R5JA 2WUDA 1PSDA 4C43A 1BRMA 1M3SA 2JGMA 1XU4A 1U6IA 2FRXA 4CPDA 3V4FA 3ASYA 4KR0A 5EKXA 4H1WA 2R97A 2VSQA 1KK0A 1ZU4A 2FPLA 1EQAA 3AI3A 1PR5A 2WR8A 1O95A 4ZWNA 1K86A 4REOA 1CZNA 3E18A 5I7SA 5AK5A 5JEDA 4NS1A 3DVLA 4LXIA 5F9FA 2HA2A 3Q9UA 3DEFA 1LUAA 4LV5B 4CDGA 4Q47A 2G4CA 2V3VA 3TQOA 1L7AA 4F38A 2B8WA 2BT4A 5EVJA 1VIYA 3AFOA 1KO4A 3I4CA 2DKNA 3RVLA 1TL7C 1C4OA 5I7WA 4KTVE 4NVRA 4ZT5A 4Y9UA 3RIMA 4FYIA 1FPMA 4Q7KA 2OQVA 1R0KA 1JT2A 4GD3Q 2WVGA 5EGNA 2QMHA 1TF5A 3F4KA 2HDWA 4DEXA 2RGEA 3HL4A 4PPNA 3E2PA 2J7PD 4HEA1 4L9SA 1ZA2A 4B4OA 4CJXA 2ATCA 2X8AA 3I30X 2IX3A 2WSLA 3V6LA 1AKVA 1LDBA 3OCVA 1NM5A 3LQ4A 3N6VA 3VSBA 1E3WA 1H42A 1Q22A 2UXDB 4KYUA 5LZ4A 3IHKA 1YZTA 3DFFA 4TTTS 2OXCA 2W2VA 4ZJPA 2JJMA 1KVTA 2PSJA 3EAGA 3OFVA 5REQB 4ARZB 3EFHA 3HXTA 4K0KB 1WTCA 3DOFA 3KR0A 5BUSA 1P73A 1SD1A 2I4TA 3AHCA 1BQ3A 4IIJB 1QB7A 4WY8A 1SEVA 4FD2A 4HNGA 1K6XA 3NLLA 3KE8A 4IVRA 5T5QA 3TYXA 2QLLA 3L0CA 4BNZA 4CTMA 4LWZA 3QSGA 1ZM9A 1FXWA 1U8YA 1DV1A 2R96A 1W4LA 3BBLA 1H4TA 5JS8A 2IYOA 3H19A 4M76B 4MW0A 3SVZA 4UHKA 1QO0D 3TUIC 2JK0A 1Q74A 3FI9A 5BSWA 1NXOA 3FFAA 4MKFA 3INTA 3EISA 2IQIA 3LX6A 3N39C 4RJKA 4B80A 3QVWA 4OL0A 3TTUA 4XRGA 5MFPA 3I9KA 5KNDA 1HX7A 5REQA 3HXOA 3AB7A 1I13A 3OCWA 2D5AA 3C3DA 2PE5A 1OHHA 3QVKA 4Q9KA 3A4TA 4QUEA 5LOVA 4ZVSA 4LTMA 3TINA 2CZQA 2GUGA 3UPTA 4M1OA 4DMLA 2GO7A 1M74A 3SSNA 4BNUA 1BE0A 5BN3A 4FFVA 3W06A 4WERA 1EK5A 4U6NA 1JF8A 4F2DA 1T4BA 3JAKB 2ZQ5A 5JWHA 2WQZA 2YYZA 3FNHA 3UUEA 2CN1A 1R27A 1W30A 2RG7A 4RMHA 3AWDA 1GYQA 2D0IA 4GQBA 4MR7A 4GZ3A 3RTDA 5I7VA 1BCRA 2A0KA 4NL4H 4X6LA 3R3JA 4ZVKA 4CM1A 1QTIA 1UPAA 2A9PA 3H6GA 4P0QB 1ZUNA 3MCZA 3DBHA 4Y6QA 5DN6A 5DIZA 2YJ4A 1H0KA 2B8EA 5K3FA 5IHPA 3EEIA 4URFA 1KZHA 3ND7A 3ZOZA 2E4AA 3A1FA 2P78A 1RRCA 3OQPA 3CLTD 1EH5A 2ZJFA 4RIIA 4Y7CA 1FTQA 5GQSA 3GPLA 3CLSD 4P5EA 1W4AA 5P8WA 4AECA 1JA1A 1DOHA 3WQBA 3RM3A 3AC0A 1XZGA 3E9EA 4TXMA 3OG9A 3FSGA 1EYZA 2XB8A 1EGVB 3UTCA 2QTHA 4GBED 5I01A 1CUIA 2IXEA 3OJOA 1XNRB 2WIGA 4LRTB 2VP5A 2DJIA 3KZMA 1OI4A 3QHPA 5TQJA 1CU1A 1B42A 3PQ3A 4M8NE 4MI6A 1YQXA 3IELA 1IEQA 2VJYA 4RPKA 4UCFA 4A1FA 4B8WA 4ZO4A 1F6DA 1WB5A 1O2DA 3AQ4A 1IHPA 4A15A 4J0EA 4L0QA 4OMDA 4AC9A 3RWOA 3NV7A 1KFKB 1I30A 1BHQ1 2D7JA 2KLHA 4LPSA 3PA8A 3DO6A 1SVLA 3RD5A 3L05A 4EHFA 2JIZA 1UXHA 2IYRA 3AI1A 3DBRB 4LSMA 4MCJA 1HOXA 2CYAA 3PWSA 1EFLA 4MK4A 1YB5A 3LXUX 2ZM6B 2WV9A 4LE2A 5JSKA 4BC1A 3UJNA 5C8XA 5H68A 3GEEA 4CF5A 1VL8A 2VUIB 2H2FA 2X1HA 3TQIA 1L8AA 2Q5HA 4GOLD 5H4HA 1MX9A 1U94A 1ZGZA 3ON5A 2JI4A 5JHGB 1Z07A 2D54A 4WA7A 4E4RA 1N0IA 3RW9A 3NO4A 4LYEA 5L3QB 2V0CA 1EIWA 3V34A 5JAQA 3F5MA 2HWWA 5A62A 4XLTA 3VMFA 2WTBA 3IBCA 2OFPA 5LBTA 3MFQA 4Q4HA 3WHLA 3GPIA 3B8EA 1QK4A 1E3SA 4FSXA 2OM2A 1JG2A 4A10A 5ES4B 3AI7A 3OPYB 3DVQX 3U9TA 4YP7A 1C3VA 3NOVA 2W98A 1B2LA 2A67A 4HK4A 1ECPA 2Q0QA 3RCBA 4C6TB 1NX6A 4WSOA 4D9KA 2XCUA 3PFKA 1JLLB 4CG3A 3G9ZA 1RWWA 4DLUA 4QASA 3TIFA 4MB0A 4YQEA 2FP4A 5LP1A 1ORTA 2NSJA 3K0CA 5C2JB 2DWOA 3KHUA 4A36A 4ARAA 4U00A 1WM1A 5GJVC 2ZG6A 2GD0A 1U98A 2WM8A 4J1TA 1TU0A 3AIOA 5HK8A 5A7GA 2CLHB 1EDOA