4GW6A

Hiv-1 integrase catalytic core domain complexed with allosteric inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
144
Chain Sequence
DCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The A128T Resistance Mutation Reveals Aberrant Protein Multimerization as the Primary Mechanism of Action of Allosteric HIV-1 Integrase Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Gag-Pol polyprotein
total genus 49
structure length 144
sequence length 155
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4gw6A00
4CFBA 3OYFA 1SV5A 2ETJA 3ZSQA 3OYDA 3RTVA 4PUOA 4DQSA 3NF7A 2PZSA 4EZ9A 1BI4A 1U4BA 4E7IA 3ASMA 2AJQA 4ID1A 4W5RA 2OPPA 4FLTA 1RT4A 1QQCA 3CG7A 3OYBA 3DOLA 3AVIA 4N56A 3NCIA 3HO1A 4CGGA 4J2DA 4BDZA 4M42A 3OYMA 4Z4IA 4CJKA 1VSLA 1EETA 1N5YA 1IKXA 4IFVA 1S1WA 1QSLA 2HVHA 4DQIA 4FJHA 3MECA 5DK5A 2G8VA 4W5NA 2IDOA 1B9FA 2IS3A 3CFRA 1C0MA 4BE0A 4E0DA 1S9GA 4KAZA 4BDYA 4IG0A 4FJLA 4K8XA 3KTQA 3QEWA 4AHUA 3VQBA 4KKOA 4Q5VA 1LAVA 1VRTA 3KK1A 3K57A 4DQRA 3NF9A 4OJRA 4DSIA 3AO5A 3ZT1A 2DFEA 3IAYA 1JLBA 2F8SA 4Z4CA 4YNQA 3SNNA 3DLBA 4C8MA 3OJSA 1WNSA 1L3SA 4HUEA 4CIEA 3FFIA 1WSIA 4KI6A 4ID5A 4JRQA 1LWFA 3T19A 1BGXT 3OYGA 1QE1A 1ZBIA 3HVTA 4M3ZA 5K14A 4CEEA 4CJ4A 3OY9A 3RR8A 4I2PA 4L8RB 4ELTA 2P5OA 4KTQA 2HW3A 2HHXA 2E6LA 3VQPA 3LWLA 3ZT4A 1KLMA 1YVUA 3VQ9A 2G8FA 4FJNA 3S3OA 1XHZA 1KCFA 1NOYA 4H4OA 1HPZA 4DSLA 4F4KA 4M3XA 4W5TA 4FJ9A 3TI0A 4KO0A 3A2FA 2OPRA 4CJSA 3SQ1A 2FBVA 1U45A 3F9KA 4CK3A 4Z4GA 4LD0A 3QEVA 3SQ4A 2ZQBA 3VQ4A 4CGFA 2HNDA 1RBRA 4AHVA 3JYTA 4I9LA 4ELUA 2YKMA 4HVJA 5JS1A 1RT7A 2HHUA 3RRHA 5HROA 1WSFA 3KD1E 3PX0A 3SJJA 3HVRA 1T7PA 3SUPA 1QTMA 4M41A 3RMDA 1IO2A 1LWEA 4CGDA 3HP9A 1RDCA 3HSTB 4B8AB 2XHBA 2XO7A 3TAMA 5C25A 3HL8A 3NH1A 3SUNA 4KPYA 3ZSRA 1S1VA 4BACA 1L3TA 1RTHA 2P1JA 1RBUA 4CHZA 3AVCA 1TK5A 4N5SA 1NJXA 3SUQA 4BE1A 1ZBLA 1U47A 4O5BA 1BQMA 4RG8A 1LAWA 1TKTA 3RRGA 3QO9A 3QNNA 1D8YA 1NK7A 3JSMA 3LP0A 2Z1GA 1CXQA 1BI4B 5FDLA 2HHVA 1GOBA 3O3GA 2XY5A 1U04A 4B9TA 3MXIA 1L3UA 3AA2A 1HQEA 1JKHA 1HYVA 4RW8A 5CYMA 2X78A 3AO4A 4JRPA 4CJQA 3KK2A 2RKIA 3LPUA 4B8CA 1RBVA 1KRPA 4RW6A 3PX4A 3AO1A 4FJ8A 3LAKA 3O3HA 4OKEA 4FM0A 2I5JA 1L5UA 3TARA 4TSXA 3TR8A 3LZIA 1NK0A 2F8TA 1EX4A 2YNGA 2Z1HA 4CHNA 2OA8A 2GUIA 3KK3A 4JS5A 1HYSA 1S6PA 1DTTA 3AA3A 4CFAA 3VQ7A 1RT3A 1HQUA 2GV9A 3BDPA 3HYFA 1CZBA 3V9ZA 1HNVA 4CK1A 3UIQA 4KV8A 4FZYA 1C0UA 2HMIA 2YNIA 4OKJA 4FM1A 2VWKA 4DU4A 4GMJB 2YV0X 1SL1A 4OLAA 1DLOA 4CGIA 1XC9A 1EP4A 1RBSA 3HM9A 1JLQA 1VSKA 4CESA 1N6QA 3EYZA 4Y1CA 1KSPA 4UQGA 5KGXA 3QETA 3QEPA 1D9DA 1RCHA 3CM5A 2O4GA 3PY8A 3VQDA 3L2QA 4PQUA 4GVMA 4JLHA 4FLVA 4DTPA 1Q9XA 1ASUA 3G10A 4FVMA 1K6YA 1T03A 3RMCA 3OYKA 4FLUA 3ITHA 3QIPA 4CIFA 2Z1JA 4CHYA 4ZTFA 4RW9A 4BE2A 3S9HA 2F96A 4E7KA 3AV9A 4E7LA 5J2PA 4RW7A 1S1TA 4C8KA 3V9WA 4OLBA 2X6NA 1LW0A 1UOCA 5T7BA 2IC3A 1CLQA 4BWMA 4CEOA 2NUBA 2HHSA 2A1SA 4N41A 1LW2A 4CHOA 1X9MA 1NKCA 3OYLA 1SL2A 5D3GA 1KVAA 5CY4A 3EZ5A 3K5LA 3TAPA 4N76A 4CJTA 1ASVA 1WSHA 4Q0BA 4CE9A 3ZSWA 1S1UA 4E7HA 4AHTA 1IKWA 3C6TA 1VK0A 4LH4A 5KTQA 2P51A 2D5RA 1RT2A 1GOCA 5HRPA 4KFBA 4DFKA 2Z1IA 1D9FA 1BCMA 4KHYA 1TL3A 4FM2A 4CJ5A 3SZ2A 4KHQA 1A5XA 1HYZA 4E7JA 4ZHRA 3OS2A 2BGGA 4QOZB 4C8LA 5JS2A 3SUOA 2FC0A 1WSJA 1X1PA 2ATQA 3C95A 1IKVA 4H4MA 5I3UA 4F2SA 1RDBA 5FROA 1HRHA 3L8BA 3MEGA 3NF6A 1CXUA 3TAEA 2VG7A 4OGCA 4J2EA 3OYCA 3LALA 3MXJA 1KVCA 1LWCA 3SYZA 3TAFA 4KREA 2D0CA 3DYAA 3ZT0A 4FLWA 1C1CA 3QINA 2KW4A 5CZ2A 1DTQA 4FYDA 1VSFA 1ITGA 2X74A 4DSJA 3KLHA 3B6PA 4AILC 3C6UA 1JLFA 3O4NA 2E6MA 4AHRA 1NK4A 3DLHA 3TAGA 1U48A 3K5MA 1VRUA 3DOKA 4NCGA 3ZSZA 1BHLA 4DF8A 2QKKA 2DFFA 4Z4HA 4OPKA 4MQ3A 3VQAA 4KHSA 2DY4A 3VQCA 4M3TA 2QKBA 1RTJA 2KTQA 2OPSA 3DRPA 3NGYA 2VG6A 1UAXA 4HUGA 3V4IA 4W5OA 3OYAA 1UWBA 1C0TA 4IG3A 2RN2A 5HRSA 2OZSA 5SZTA 3HK2A 1JLAA 3OJUA 1XHXA 3ISNC 3NBPA 5J2QA 3QERA 1IH7A 1J5OA 2BDPA 2KFNA 4EP4A 3NE6A 1NJZA 4QAGA 4O4GA 2PYJA 3NH0A 4FJ7A 3OVNA 3VQQA 2KFZA 4KRFA 3QIOA 4CJPA 3LDSA 4FZZA 3AVMA 4B08A 3V6DA 3RMAA 4CK2A 3AVJA 1RT1A 1XI1A 2LSNA 3S3MA 1RTDA 2YHAA 3VQ5A 1S6QA 3P5JA 5EU7A 1HNIA 5C24A 3VN5A 3EY1A 4DG1A 3V1RA 3LWMA 4DS5A 3KLIA 3KLEA 3WNFA 1WSGA 1IKYA 2HHWA 1RTIA 5DMRA 1KVBA 3C94A 3F73A 2YNHA 4LSLA 3K2PA 3CFPA 4HUFA 1VSDA 3TWHA 1L3VA 1CZ9A 5KRTA 2X6SA 5KRSA 3L2RA 2Q3SA 1TV6A 2B4JA 5HBMA 4C8NA 3V1QA 4CIGA 4OKKA 3NHGA 1R0AA 4LY7A 3L2UA 1F21A 3DLGA 1B9DA 2PYLA 1KFSA 3M8PA 2KQ2A 5E41A 4B9SA 1RBTA 4KTZA 3OS1A 1NJYA 4FJ5A 4Z0UA 3O4QA 3AVFA 4AHCA 4CJUA 4DQQA 4YFUA 4DU3A 1NK9A 3MEEA 4OGEA 4FLZA 1SKRA 3NF8A 4OPJA 3B6OA 2RF2A 5FRMA 4CHQA 3M8SA 4DSFA 4QCLA 2VG5A 3BGRA 4PA1A 1Z26A 4KHNA 1WSEA 4CF1A 3KLGA 1S1XA 1FKOA 4AHSA 2BE2A 2FBYA 1BQNA 3IS9A 4NYFA 3K5NA 2G8HA 5HRRA 4KB1A 3ZSVA 3O3FA 3AVGA 3ZCMA 1SKSA 4ELVA 1KFDA 2JLEA 2YNFA 4CJFA 2OYQA 1JXEA 4F8RA 4BDPA 3AVAA 2D0AA 1TKZA 1BIZA 1QHTA 2IGIA 5HP1A 4CF2A 4IKFA 1J54A 4CEBA 1YTUA 3KJVA 1JLEA 2KZZA 1RNHA 2XY6A 3HXMA 1UA1A 3SV4A 4R5PA 3U3YA 2G8IA 1TAUA 4B9UA 3L2VA 1FK9A 3THVA 5I42A 1RT5A 1JL2A 1KLNA 5J2NA 3DLRA 2FBTA 3DRSA 1SL0A 1U49A 3ZSOA 3OYEA 4M3RA 1XWLA 4DSKA 1WN7A 1A5WA 4CEFA 3H08A 1W9HA 1J53A 4CJEA 2A1RA 3KIOA 4LH5A 1HJRA 4KHWA 4FW1A 1D5AA 4CGHA 4CGJA 2QK9A 4FW2A 3ZT2A 4DFPA 3CYMA 2YHBA 3M8QA 4E1MA 3V9UA 3AA4A 3PV8A 4N47A 3S3NA 4AH9A 4O44A 1T05A 4DS4A 1BL3A 4F3TA 1C6VA 1JL1A 3TABA 3KKRA 4E19A 4LSNA 1VSIA 4DF4A 5FRNA 3RWUA 3VQ6A 3LAMA 3I0SA 1FKPA 5J2MA 5J1EA 3OS0A 4DQPA 3CFOA 1ZYQA 4CJRA 1T8EA 4FJIA 1QSYA 3CQ8A 3V81A 3IG1A 4RW4A 4DU1A 1X9SA 1QSSA 4FK0A 1W0HA 1TGOA 3DM2A 1TVRA 3CM6A 3QEIA 3MXMA 1NKBA 2IAJA 5KGWA 3ZSXA 3LZJA 1RDDA 3MEDA 1VSHA 5SWMA 4CERA 3LP3A 3PUFA 3OYJA 4FCYA 2P5GA 4CCHA 4FJGA 3V9SA 4I2QA 3WNHA 1REVA 3T1AA 3PO5A 1I3AA 2XRIA 3T3FA 3G0ZA 1BISA 1Z25A 4BWJA 3SPZA 2OPQA 4CECA 5HLFA 4M3WA 3PX6A 1ASWA 4FLYA 4DTSA 1EKEA 3LP1A 4B9VA 4FXDA 2ITGA 3HPOA 3P83D 5C42A 4F3OA 4J2BA 2E4LA 4CJWA 3SCXA 4FJJA 4IBNA 3P1GA 4E3SA 4CEAA 3DLEA 3K58A 1RDAA 4WE1A 3WNEA 4GW6A 3SQ2A 1TKDA 1VSJA 3AO2A 3NDKA 3KD5E 4FK4A 3AVBA 3QEXA 2KZMA 4CFDA 1BCOA 3AO3A 3U3GA 1RILA 3RR7A 4HCCA 3L2WA 1O1WA 4O0JA 4KI4A 3I8DA 3ZT3A 2D0BA 4OVLA 2HNZA 1JXBA 2QXFA 3SPYA 2B5JA 4FK2A 2DTUA 3OYIA 3NFAA 1X9WA 4CF8A 4B3OA 4CFCA 1RT6A 1C1BA 3NGZA 1S9EA 4HTUA 4EP5A 1TAQA 2G8KA 4CEZA 4MFBA 3KLFA 4DFMA 2YKNA 1ZBHA 3ZSYA 3K5OA 3TAQA 4DSEA 1Q8IA 3ALYA 4CF0A 5HRNA 4C8OA 4CHPA 3NGIA 3HPGA 3WNGA 2Y1IA 1NK5A 4NCAA 3VA3A 5KI6A 3AVKA 3TANA 1FXXA 4M3UA 3L3UA 2DFHA 3HJFA 1HMVA 2R7YA 4M3YA 4B9LA 4Z4EA 4Z4FA 4HHTA 1I39A 4IFYA 2IOCA 3IRXA 4DLEA 1NJWA 1ZBFA 3OYNA 3HT3A 1YTAA 4FJMA 4O55A 4CJ3A 3OYHA 1SUQA 2VWJA 4J2AA 4PY5A 3PO4A 4B9MA 1JLCA 3QNOA 4KHUA 4O0IA 2Y1JA 1TKXA 4JS4A 3AVNA 4ZTJA 3SI6A 2HVIA 1J9AA 4ICLA 4CEDA 3V1OA 4IDKA 3DLKA 4M45A 4EZ6A 3NAEA 3LP2A 1JLGA 2XY8A 4KTWA 4H8KA 3SV3A 4E1NA 3QESA 1G15A 1NK8A 4FJKA 2GBZA 1B92A 3KKSA 1VSEA 1UA0A 2W42A 3AVHA 3DI6A 4CF9A 3V9XA 4DTXA 4DTUA 3QLHA 1EXQA 2JGUA 2OZMA 1WAFA 4F2RA 4HCBA 1SKWA 5CYQA 1WAJA 2EHGA 4DTNA 1VSMA 4DTOA 4NCBA 3E01A 3MAQA 4DMNA 3M8RA 4CEQA 2EX3A 3VQ8A 4FLXA 1A5VA 1KTQA 4I7FA 4G1QA 5CZ1A 2HB5A 3LPTA 4DWIA 3I0RA 2G8UA 4DTMA 4KB0A 2ZD1A 2ZE2A 4DFJA 1NOZA 2HNYA 1GOAA 2HHTA 3RMBA 1TK8A 2BANA 2B6AA 1IG9A 3HP6A 2PY5A 1BIUA 3SQ0A 2FBXA 3NH2A 4DTJA 4NYNA 1NK6A 4W5QA 2HHQA 3DRRA 3K59A 3VA0A 4PWDA 1Q9YA 2O4IA 4XIUA 1YT3A 1TL1A 2WONA 3AVLA 3ULDA 2XY7A 1NKEA 1ZBUA 4CJVA 4DLGA 2WOMA 1MU2A 3HPHA 4FJXA 1S5JA 1WLJA 4Y1DA 4CJLA 1Y97A 1TK0A 4FZXC 3L3VA 4K8ZA 4B9NA 1C1AA 3AA5X 3D0PA 3U6FA 1QS4A 3D45A 3DMJA 4E89A 1LV5A 4I9QA 3LANA 2G8WA 2RPIA 3VQEA 4DTRA
chains in the Genus database with same CATH superfamily
5GAEP 3OYFA 3OYDA 2PZSA 4DKWA 3ASMA 2OPPA 1MDUB 4B3RK 3OYBA 1DEJA 1QVGM 3NCIA 4CGGA 4M42A 1VQNN 3MN6A 3EKSA 2BTFA 2CGKA 4DQIA 4FJHA 3MECA 3DJCA 3C65A 2IS3A 4BE0A 4IG0A 4K8XA 4X64K 2QTDA 3QEWA 4AHUA 3ENOA 3NF9A 1NWKA 2DFEA 3IAYA 3DLBA 1NG9A 1WNSA 2F4VK 5KQ8A 1LWFA 1BGXT 1T6CA 1QE1A 1ZBIA 3HVTA 1P8ZA 5K14A 3OY9A 4C1NI 4H5TA 2HW3A 2HHXA 4KTQA 3VQPA 5BREA 1X3NA 3ZT4A 1YVUA 4BRKA 4PKHA 2G8FA 4JN4A 4FJ9A 3NVMA 4KO0A 3SQ1A 1RBRA 3DLLL 2D0OA 4I9LA 4ELUA 2YKMA 3O9SA 4HVJA 1RT7A 3JAMO 2NRZA 5JS1A 2HF4A 5DM6L 5HROA 4GNIA 4MDBA 1T7PA 3JS6A 3SUPA 3CJAA 4CGDA 1RDCA 3HSTB 4Y0WA 5LL6Z 3ZSRA 1S1VA 2H3GX 3SAHA 1GLLO 4N5SA 4BE1A 4H0PA 2NNWA 3UKUB 1D8YA 2UUAK 3LP0A 1CXQA 2XY5A 3MXIA 1HYVA 1Q18A 4PKGA 4NXMK 4JK8A 3AO4A 4CJQA 4NO7A 3ULEA 1SS6A 3AO1A 3O3HA 4OKEA 5M1OA 4HTLA 2I5JA 2W6LA 1L5UA 4TSXA 3TR8A 5LJVA 3QFUA 4JK7A 2YNGA 4IZ9A 1NGFA 3AA3A 4CFAA 3VQ7A 1D4XA 2GV9A 3P31A 3BDPA 3NVKA 1CZBA 4RCHA 3ID6A 4CK1A 3UIQA 4FZYA 1C0UA 4OKJA 3ZX0A 1SL1A 4DU4A 2NRWA 4JI7K 1JLQA 1TYQA 2FF6A 4Y1CA 3TSQA 4YY3K 2FF3B 4GVMA 1Q9XA 1JCFA 3CC7N 1ASUA 4AF1A 3G10A 1K6YA 3BY5A 3QIPA 4RW9A 2QWLA 3HSCA 4E7KA 4E7LA 3FZHA 4CD1A 4C8KA 2X6NA 3SBGA 3CC2N 1Y64A 5TKYA 1LW2A 2ZM6K 1Q81O 4BR9A 4N76A 4IFEA 2Q0UA 5KTQA 4LH4A 3KWGA 1N33K 1N32K 4KHYA 1TL3A 1T44A 2BGGA 4C8LA 1QZ6A 2YX6A 4FOIA 1IKVA 5I3UA 1QQNA 3MEGA 5EOYA 5AQYA 4OGCA 4J2EA 3MXJA 4KREA 5GADP 3ZT0A 1C1CA 2HOEA 5CZ2A 2JWLA 1VSFA 4DSJA 3KLHA 3B6PA 4AILC 3C6UA 3DLHA 3SBTA 3M6GA 4EIAA 3TAGA 1U48A 3K5MA 4NCGA 1S22A 2QKKA 4DF8A 4Z4HA 1N34K 5F1XA 4KHSA 3GE1A 1RTJA 1YIJN 2QXLA 4HUGA 1UAXA 2W40A 4IG3A 3DXMB 4IOXA 3OJUA 5J2QA 1J5OA 4O4GA 4KRFA 3RSEB 2KHOA 3AVMA 3RMAA 2QEXN 1VQKN 1YAGA 2ZJQL 2LSNA 1JJ2M 3VQ5A 5EU7A 3VN5A 4DG1A 3V1RA 3LWMA 4I6MA 3C6AA 1XMQK 1WSGA 2HHWA 3KZBA 2YNHA 4FWKA 4HUFA 3TWHA 1L3VA 2YJEA 5FPDA 3CCVN 4A5AA 3L2RA 4BR4A 3V1QA 1SAZA 3L2UA 1F21A 1B9DA 4DUYK 1KFSA 2KQ2A 2DY4A 2O8BB 1QQMA 1M90O 3AVFA 4WFAL 4DQQA 4DU3A 4YFUA 4LFBK 4B3TK 4OGEA 4FLZA 1SKRA 3B6OA 2RF2A 5AZIA 4CHQA 3BGRA 4PA1A 1Z26A 3AGKA 5AR0A 4KHNA 4CF1A 1FKOA 2UUBK 3MDQA 4JI1K 4KB1A 3AAQA 4FL9A 3AVGA 3QICA 4ELVA 1KFDA 4CJFA 2YNFA 4BRLA 2D0AA 1NGEA 1TKZA 2IGIA 1J54A 2P9LA 1JLEA 1RNHA 4B9UA 3HBTA 1RT5A 3O80A 3EEQA 1YUWA 3BUZB 3DLRA 3DRSA 1T3VA 3OYEA 4XEIA 1A5WA 2ZGYA 1TUYA 3J7ZO 3F2KA 4KHWA 3ZT2A 2QWRA 4E1MA 3PV8A 1IBLK 3J81O 4YOVA 1KC8O 5HL7L 1BL3A 3I33A 1C6VA 3TABA 4B1WB 1VSIA 4BRNA 2IVOA 3R6MA 1BA0A 3LAMA 5TKWA 3I0SA 2HSTA 1FKPA 5J1EA 3LL3A 5M1KA 4V19S 2F9TA 1J6ZA 2FSJA 3O08A 2HHHK 4PL8A 3VGMA 1NGJA 3HOTA 3DM2A 3CM6A 5KGWA 3ZSXA 1ZBSA 3LP3A 2ZWHA 2D1KA 3PO5A 3EN9A 1BISA 4BWJA 3SK3A 1ASWA 5AJ3K 4YHHK 5C42A 4F3OA 3TSUA 2QWOA 5AQJA 3CCUN 3DLEA 3K58A 4WE1A 3WNEA 4BREA 3SQ2A 1TKDA 3CQXA 4EHUA 4JKGB 3TTDA 4CFDA 1BCOA 5GAHP 3AO3A 1RILA 3GL1A 4M7XA 3I8DA 2D0BA 5C2FA 1JXBA 4JAXA 3SMPA 1BOTO 1C1BA 1TAQA 4DFMA 3K5OA 4DSEA 1YJ9N 1QHAA 5IT9O 1Q8IA 3ZX3A 4CHPA 3NGIA 3HPGA 3CPWM 1NK5A 3VF2A 5FPEA 1FXXA 3HJFA 2GUPA 2R7YA 3BZCA 4Z4EA 4HHTA 3MWPA 2IOCA 4DLEA 2O8CA 1NM1A 3HT3A 1YTAA 4FJMA 4O55A 1S3XA 3OYHA 4PY5A 1SQKA 3QDKA 4BRPA 4O0IA 3AVNA 4LF8K 3A5LC 4BR5A 3J7YP 4M45A 3THXA 1ATSA 3NAEA 4FWMA 1JLGA 4I6MB 1BWFO 1UA0A 3R9PA 4BY9C 3JXUA 4PKIA 2J4RA 1WAFA 1VSMA 4NCBA 3E01A 2CGLA 4CEQA 3VQ8A 4FLXA 1IBMK 3QMLA 4I7FA 1GLCG 2HB5A 3LPTA 3HTVA 3I0RA 3OHRA 4DTMA 2ZD1A 3N4QA 3RVCA 1TK8A 3HP6A 2PY5A 3SQ0A 4NYNA 4O8UA 4W5QA 2A3ZA 4PWDA 3PIOL 2O4IA 5EVZA 1HKGA 3ULDA 2XY7A 3J7AP 3IFRA 4CJVA 4BGBA 2WOMA 4IOAL 4FZXC 3MMVA 4GVEA 4DV5K 2E2QA 3D45A 3LANA 5ADXH 3VQEA 3H46O 1SV5A 2ETJA 4PUOA 3RTVA 4DQSA 1U4BA 3H3OB 4X65K 3THWB 4W5RA 1RT4A 3CG7A 4H0VB 3G25A 4N56A 3VETA 4J2DA 3K9JA 3CQYA 3OYMA 1VSLA 1EETA 1QVFM 1IKXA 4IFVA 2HVHA 1QSLA 4XH1A 3GBTA 4W5NA 2JWKA 3CFRA 1C0MA 4KAZA 1NGAA 5M1PA 4KKOA 4Q5VA 1GLFO 1VRTA 4ISEA 1S72N 4DSIA 3ZT1A 3K9KA 2F8SA 4RWTA 3OTOK 1WSIA 4JRQA 4K41A 2EWSA 3RR8A 3HZ6A 4JHDB 4ELTA 3R1XA 2NRHA 1KLMA 3LDNA 3LDLA 1WBDA 3S3OA 1XHZA 1KCFA 3CXCM 4F4KA 2HVIA 1W97L 4W5TA 3A2FA 2OPRA 3G4SN 4EHTA 4NLCA 4LD0A 3FZFA 1HJOA 2HNDA 1OH7A 1WSFA 3VEYA 5AQRA 3SJJA 3D2EB 3MN9A 1HX1A 4K43A 1XNRK 3CCLN 3NH1A 4KPYA 2KKZA 4BACA 2P1JA 1ZBLA 4BC4A 3RRGA 2ASOA 4BC2A 3K0SA 4FWPA 3CJBA 1KXPA 2HHVA 1GOBA 4JKGA 4B9TA 1U04A 1NLVA 3AA2A 1JKHA 4RW8A 1E4FT 5CYMA 4JRPA 4CZMA 3KK2A 2V7ZA 3LPUA 4AQYK 4FM0A 4U67L 4B3SK 3P39A 1EX4A 2YJFA 4CZFA 5AQWA 4CHNA 5M1FA 3KK3A 5LMUK 4JS5A 3A5MC 1S6PA 1DTTA 1RT3A 3FZKA 5AQZA 4WFBL 2HMIA 2DPNA 2VWKA 4GMJB 2YV0X 2PFUA 1DLOA 4CGIA 4DV2K 2A42A 3EYZA 4DV0K 4UQGA 3QEPA 3CM5A 3LDPA 3PY8A 3VQDA 3L2QA 3BF1A 3U9ZA 4JLHA 2ASMA 2VGNA 2YCHA 1VQ8N 3OYKA 4FLUA 3EE8A 1WOQA 1ESVA 2QWPA 4CHYA 3S9HA 3CJ7A 5J2PA 5JVGL 1XQSC 1GLEG 2UUCK 4OLBA 1UOCA 5T7BA 1BUPA 3O9TA 1CLQA 4LF4K 5D3GA 1X9MA 3OYLA 4DUZK 4ILJA 3K5LA 4FWLA 1WSHA 4DV1K 3FE1A 1S1UA 4E7HA 4AHTA 1IKWA 3C6TA 2P51A 2QWMA 4DFKA 3VESA 3F5TA 4KHQA 1XC3A 5JS2A 1X1PA 2ATQA 1V4TA 3NF6A 3EZWA 3OYCA 4NB4A 1KVCA 2D0CA 2KW4A 4IEIA 4FYDA 4KH6A 1JLFA 1RFQA 2E6MA 4AHRA 3CIPA 4GV6A 3DOKA 3MN7A 1BHLA 4OPAA 1WUAA 2KLAA 3THYB 3VQCA 4M3TA 3HOSA 5H1SQ 2VG6A 3V4IA 1UWBA 5HRSA 2FSKA 5SZTA 1TYQB 4QS9A 3HK2A 3NBPA 4C1NK 1IH7A 3UKUA 1NJZA 4O5FA 4FJ7A 3OVNA 3VQQA 2KFZA 3EO3A 3QIOA 4FZZA 3O1BA 3V6DA 4CK2A 3AVJA 2VCPA 3S3MA 1S6QA 5AQIA 5C24A 1HNIA 4AM7A 3EY1A 4DS5A 3KLIA 3CJ9A 2I7PA 3WNFA 4MDAA 3C94A 4LSLA 1VSDA 2GX9A 2Q3SA 2B4JA 4C8NA 4BRCA 1R0AA 1LCUA 3VPZA 4B1UB 1HLUA 3M8PA 5E41A 1RBTA 4FJ5A 5EX5A 3OS1A 4Z0UA 4AHCA 3MEEA 3G6EN 3W3DA 4DSFA 3M3ZA 5C12A 1WSEA 1S1XA 4AHSA 1X3MA 2HBMA 1IBKK 4NYFA 1H1VA 3D2EA 3ZCMA 2DTUA 2OYQA 3CERA 4F8RA 5AQMA 4BDPA 1BIZA 1QHTA 1WBBA 4IKFA 4CEBA 4EFHA 1YTUA 1HKBA 3HXMA 1UA1A 3SV4A 2G8IA 1TAUA 5ELZA 1YXQA 4GV9A 3DAWA 3ENHA 4DB3A 2P9UA 1U49A 3ZSOA 4M3RA 4PHTX 1NJIO 4CEFA 3H08A 2NRRA 1J53A 2HBKA 4LH5A 1KAXA 4CGJA 2QK9A 4DFPA 3CYMA 1I94K 3BZKA 2ZF5O 4N47A 3VMFB 3MK6A 4JD2A 4H5RA 4CZEA 3KKRA 4E19A 3Q7CA 5AQQA 4DF4A 3RWUA 3VQ6A 1KAZA 3SJHA 1VAZA 2E5LK 3CFOA 5MLCQ 1T8EA 4IDHA 4DU1A 4FK0A 2ZGZA 3CCSN 4IEEA 1DT9A 5LJWA 1W0HA 1TVRA 3LZJA 3BP8A 3CCEN 1MA9B 1RDDA 1C0GA 1K8KA 4BG9A 2P9NB 4FJGA 3V9SA 3WNHA 1REVA 4NXNK 1SZ2A 4M3WA 4CECA 4DR6K 3PX6A 3CMEN 4WQ5C 2ITGA 2Q1NA 1ZXOA 1M1KO 1XUPO 1QZ5A 3J8AA 3FGUA 3CCQN 3OBWA 2WBNA 3T7ZA 3OW2M 5JLFA 2P9LB 2WC9A 1YJNN 4WFNL 3AVBA 3VTHA 5BN8A 3U3GA 3RR7A 4LF6K 3GG4A 3L2WA 1O1WA 2P9KB 2HNZA 3EE9A 1RGIA 3SPYA 2B5JA 3NFAA 1X9WA 1RT6A 3E66A 3NGZA 2FLOA 5KPTA 4EP5A 4LC9B 4X66K 1ILYA 4FVUA 3ZSYA 4BROA 1Q82O 2A41A 4WCEL 3WNGA 4NCAA 3ZEUA 2CH6A 3PLAA 3TANA 4H5VA 3THYA 2DFHA 2AP1A 5JMVA 2A6AA 4FWSA 4Z4FA 1I39A 3UE5A 3IRXA 4CI6A 3PIPL 3OYNA 3IMXA 4CJ3A 5IWAK 1SUQA 2VWJA 4J2AA 3PO4A 5ADXA 4B9MA 4DV3K 4KHUA 3BF3A 2Y1JA 1TKXA 2E2PA 4IDKA 3DLKA 4EZ6A 3CI5A 4FPBA 3P38A 3MN5A 2QWNA 5HOOA 4H8KA 4FJKA 2GBZA 1VSEA 3PSFA 4CZKA 2W42A 1NNEA 3QLHA 2JGUA 3ATVA 4HCBA 5CYQA 4DTOA 5BR8K 2E20A 3TU5A 3U4LA 1KTQA 3DXMA 2G8UA 2GWKA 1NOZA 1GOAA 3C7NB 2B6AA 1IG9A 1HKCA 3CCRN 4A62A 3NH2A 3KWIA 2HHQA 3FZMA 3VA0A 4WQ4C 1Q9YA 1RDUA 1NKEA 1JCEA 3FLCO 4DLGA 1VQMN 3ID8A 4Y1DA 4WF9L 1NBWA 1OKJA 4K8ZA 4B9NA 3D0PA 3U6FA 1QS4A 3ENBA 3T69A 1LV5A 2G8WA 3ZSQA 3EL2A 1BA1A 1U2VA 4DR5K 1VQ4N 4EZ9A 1BI4A 3H6EA 2HBLA 3I56N 4ID1A 1XMOK 1Z6RA 2NRVA 4FWQA 3HO1A 4WYBA 4DR2K 2VQEK 2Q97A 4DQ8A 4Z4IA 4CJKA 5I9EB 4JKEA 1S1WA 5AZJB 2QWQA 4Z94A 2G8VA 1O13A 1B9FA 4FSVA 1P90A 1S9GA 4FJLA 2OCEA 3VF6A 3K57A 2NLXA 4DQRA 1OH5A 2HF3A 2GTDA 3MCAB 4Z4CA 4YNQA 4C8MA 1L3SA 4HUEA 1OVQA 3FFIA 4ID5A 5GINA 3T19A 3WT0A 5BPNA 4B3MK 2HBJA 4CW7B 4I2PA 4L8RB 2P5OA 4BGAA 3ATUA 1X9JA 3O9UA 3VQ9A 4M63C 4FJNA 1NOYA 4H4OA 1HPZA 4ILGB 4CJSA 4LF5K 2FBVA 1U45A 4CK3A 3CJ1A 3D2FB 3QEVA 2ZQBA 4CGFA 3IKMA 5F2RA 3HVRA 1QTMA 4M41A 1IO2A 1LWEA 3CJCA 4FWOA 2XHBA 1CZAN 2OANA 4K25A 4CZGA 3TAMA 5C25A 3HL8A 3SUNA 4CD3A 1L3TA 2E8AA 1RTHA 1TK5A 4BG8A 3SAFA 1BQMA 4RG8A 1LAWA 1TKTA 1VQLN 3QNNA 1NK7A 3O4WA 2Z1GA 5FDLA 4DHYA 3O3GA 2IVPA 1L3UA 3SMSA 1HQEA 1EQYA 2V7YA 1YHQN 2RKIA 1KRPA 4RW6A 3PX4A 4FJ8A 4GKJK 3LAKA 3AGRA 4H0TB 3TARA 1KD1O 4A2AA 2F8TA 4IO9L 3TTFA 4CZJA 4JKDA 2GUIA 2OA8A 3SLCA 1Z05A 3O9QA 5E26A 1HQUA 3HYFA 2WFBA 3ZETA 2E1YA 4CZLA 4KV8A 4B9QA 3O1WA 1XC9A 1EP4A 4AM6A 1KSPA 1OH6A 5KGXA 3QETA 1D9DA 1RCHA 2O4GA 4DR3K 4FWRA 5EXWA 5EY4A 2QA4N 4JNEA 4DTPA 4H03B 1T03A 1ZC6A 3RMCA 4B1YB 4CIFA 2Z1JA 2F96A 4BC5A 1GLJO 4B1VA 2IC3A 2UYTA 3Q7BA 2NUBA 2HHSA 2A1SA 4N41A 2PBDA 4CHOA 1NKCA 1SL2A 1KVAA 5CY4A 3TAPA 5BR9A 3VGKA 4CJTA 3ZSWA 1NGDA 2D5RA 5M1NA 1GOCA 5HRPA 4KFBA 1YI2N 2Z1IA 3CPEA 3B8AX 1BCMA 5B8HA 3SZ2A 1HYZA 3E1YA 2P9SB 1T6DA 4E7JA 2Q0RA 3QBWA 4QOZB 2O8CB 3SUOA 2FC0A 1WSJA 2UXBK 4H4MA 1Q86O 3MX2A 4F2SA 5FROA 1HRHA 3S41A 5AQNA 4KBOA 1CXUA 2VG7A 3LALA 4JI2K 1LWCA 3TAFA 2O8EA 4FLWA 3QINA 1DTQA 4K0KK 1ITGA 2X74A 1K73O 1NK4A 4YDUC 3HM8A 3ZSZA 1VRUA 4OPKA 4MQ3A 3C0BA 3M5RA 2QKBA 2OPSA 3NGYA 2OZSA 1C0TA 5GAGP 3VOVA 3H3NO 1JLAA 3QBXA 3ISNC 5AQTA 2KFNA 4EP4A 4QAGA 3VGLA 4B08A 5BN9A 3EKUA 4JK9A 4BQLA 1MWKA 4YOWA 3KLEA 2CGJA 2VQFK 1RTIA 5DMRA 4JI3K 3F73A 3K2PA 5KRTA 1TV6A 5HBMA 4IJNA 2Q31A 1K8KB 5AQKA 4LY7A 3MCPA 2PYLA 3LDOA 4DV6K 1K9MO 4KTZA 1NJYA 4CJUA 4MO4A 4PL7A 5FRMA 2QI2A 2VG5A 4CVNE 2FBYA 5FPNA 3IS9A 3WXKA 5CHIA 2G8HA 5HRRA 3O3FA 1NGCA 4J8FA 4DR7K 4IWVA 3KJVA 3E9OA 4YORA 2XY6A 3U3YA 3L2VA 1FK9A 4LF9K 5I42A 3VEOA 1JL2A 4QS7A 5J2NA 1BU6O 5E84A 4DSKA 1Q7YO 1W9HA 4CJEA 2O8DB 4FW1A 4BR2A 4CGHA 4FWNA 2YHBA 3M8QA 5BPMA 4BRAA 3V9UA 1T05A 4AH9A 4O44A 4BRDA 4F3TA 1HNZK 1JL1A 2P9PA 4LSNA 5FRNA 4DV4K 3LDQA 3DXKA 5J2MA 3OS0A 2FSNA 1ZYQA 5BRFA 3SAGA 4FJIA 5C2DA 2WTUA 1QSYA 2P9IA 3V81A 5AQLA 3VF4A 2ASPA 1XNQK 1X9SA 1N36K 3ZYYX 1TGOA 1R59O 3MXMA 2IAJA 5FPMA 4DCHA 1VSHA 4CERA 4IJAA 3OYJA 1I3AA 3G0ZA 4BRGA 1Z25A 4H0XB 3SPZA 1JCGA 4UY8O 1EKEA 4B9VA 4JI0K 5AFUA 2E2OA 3HPOA 2ZJRL 5CR4A 3AARA 5AQHA 3SCXA 4JHDA 4E3SA 4WQ4A 1RDAA 4GW6A 1VSJA 3NDKA 3OA9A 2P9SA 2KZMA 4MO5A 4HCCA 4HWIA 4O0JA 4KI4A 4OVLA 3CC4N 4CFCA 3T1HK 1S9EA 1U2VB 4HTUA 2G8KA 2VYPA 4ILHA 3WXIA 4MFBA 1IV0A 3M1FA 3TAQA 4JD2B 4KHPK 4CF0A 4CBXA 5HRNA 2CH5A 4C8OA 2Y1IA 1VHXA 5KI6A 3AVKA 2OTJN 1K8AO 1HMVA 4M3YA 3AAPA 4JKCA 3A5OC 2YI1A 3LM2A 1JLCA 1DGKN 4CZHA 1HNXK 4H0OA 4GY2B 2I7NA 4ZTJA 3SI6A 3HI0A 1J9AA 4ICLA 1QQOA 4CEDA 3H1QA 4JKBA 1EO1A 5BRDA 1MWMA 3LP2A 1YJWN 2XY8A 4KTWA 4B1XB 1NK8A 5AQPA 1NGIA 1B92A 1BG3A 5C10A 3AVHA 3V9XA 4CF9A 1ATNA 4DTXA 4DTUA 1EXQA 3BEXA 2OZMA 4F2RA 1WAJA 1YF5L 2EHGA 4JKHA 3MAQA 2YHXA 3F9MA 1OH8A 2EX3A 1A5VA 4DWIA 4DFJA 3I55N 2UU9K 2HNYA 3KK7A 2FBXA 2UXCK 3L4QA 4KH5A 2VWBA 4XIUA 3VENA 1TL1A 1YT3A 2P9KA 3AVLA 4JKAA 4LFCK 2GELA 4JI4K 4FJXA 5AQXA 1MU2A 3HPHA 1WLJA 4CJLA 1Y97A 4R79A 1W7AA 2YHWA 3AA5X 4M7YA 1OVYA 2F7TA 3IDHA 4DTRA 4CFBA 3A8YA 2NRXA 4BRIA 3NF7A 4E7IA 2AJQA 5FLXO 4FLTA 2E88A 1QQCA 3KVGA 3O6WA 3DOLA 3AVIA 4FO0A 4BDZA 3MWTA 1HR0K 1N5YA 3FR0A 5DK5A 3CHWA 1E3MA 2NRTA 4K42A 2IDOA 2Q2RA 2QM1A 4JYAK 4E0DA 4BDYA 3KTQA 3VQBA 2P9PB 1LAVA 3KK1A 3WQTA 4OJRA 3AO5A 1G99A 1JLBA 1FJGK 4DR1K 3SNNA 3OJSA 3ULEB 4CIEA 2NZTA 3D7EO 3WQUA 4KI6A 5JLHA 4YOTA 3OYGA 2IVNA 4M3ZA 4IXCA 4CEEA 4CJ4A 1NGBA 2P9IB 2E6LA 5A2QO 3ZEUB 3LWLA 5LMNK 4DSLA 4M3XA 3TI0A 3U9DA 4H0YB 3F9KA 4Z4GA 3SQ4A 3VQ4A 4AHVA 2E2NA 3JYTA 1N8RO 2HHUA 1LOTB 3RRHA 3KD1E 3PX0A 2RE2A 1VQPN 4A5BA 3RMDA 4BRMA 3HP9A 4B8AB 5AQVA 2XO7A 4EAHD 1RBUA 4CHZA 3AVCA 1NJXA 3SUQA 4A2BA 1U47A 4KH4A 4O5BA 2HMPA 5JICA 5KPZA 3QO9A 1HUXA 3C6HA 3JSMA 5LY3A 2O8FB 4BRHA 1BI4B 3CD6N 2BUPA 4YDUA 1J5EK 2X78A 1VQON 2P9NA 4B8CA 1RBVA 4GV3A 3DWLA 3C7NA 2Q36A 5AZJA 4MLEA 4LFAK 3LZIA 4YOYA 1NK0A 2Z1HA 1HYSA 1NMNA 3W0LA 4JI5K 4JI8K 3V9ZA 1HNVA 4C23A 2YNIA 4CBWA 4FM1A 4OLAA 1IJJA 1RBSA 3HM9A 1N6QA 1VSKA 4CESA 3J80O 3VEZA 4BC3A 1U6ZA 4JEPA 4CJ7A 1WB9A 4GKKK 4PQUA 1RDWX 1HPMA 4QS8A 5C15A 4FLVA 4FVMA 1BDGA 2OTLN 3ITHA 4ZTFA 4OX9K 4BE2A 2V52B 3AV9A 4RW7A 1S1TA 4F9OA 3V9WA 1GLDG 3GOIA 1LW0A 2VGMA 5BPLA 4BWMA 4CEOA 3A5NC 3PSIA 3MX5A 3CCJN 4U7BA 3EZ5A 4B1ZA 4Q0BA 1ASVA 1NU0A 4BR7A 4CE9A 3CMAN 1VK0A 2UXDK 1RT2A 2FXUA 3E9LA 1D9FA 3N4PA 3HRGA 4L3QA 4FM2A 4CJ5A 2O8BA 1A5XA 4DR4K 4ZHRA 3OS2A 4BVOA 4G9ZA 5AZIB 3THWA 3C95A 1V4SA 3U8XA 1RDBA 3L8BA 4BRFA 3FFKB 3TAEA 3ZLJA 1KAYA 3SYZA 3DYAA 3VEWA 2QW9A 3CF5L 3UKRB 2V51B 3O4NA 3O9RA 2W6KA 1YVNA 2DFFA 3L6QA 3VQAA 2KTQA 3DRPA 2PAVA 4W5OA 3OYAA 3L4IA 2RN2A 4IOCL 3R3LA 5GIPA 1XHXA 1E4GT 3QERA 2BDPA 3NE6A 2PYJA 3UKRA 1GLAG 3NH0A 4CJPA 3LDSA 3AY9A 3A0IX 4BVPA 4E1JA 1RT1A 1XI1A 1RTDA 2YHAA 4FOEA 3P5JA 3ZX2A 1IKYA 4H5WA 1KVBA 3CFPA 3OBYA 1CZ9A 3G71N 2X6SA 5KRSA 2ITMA 4CIGA 4OKKA 3NHGA 4X62K 3E9PA 4JV5K 3KHYA 2O8EB 3DLGA 4JI6K 4B9SA 3O4QA 1EWRA 1NK9A 2A5XA 3D6RA 3NF8A 4OPJA 4CZIA 3M8SA 4QCLA 3VEVA 3KLGA 5BRHA 2BE2A 1BQNA 4OO1J 4DV7K 4YOXA 3K5NA 3WEEB 3ZSVA 1SKSA 2JLEA 4MLHA 1JXEA 1NGHA 3AVAA 5HP1A 4CF2A 1W2BM 2F9WA 1VQ9N 2KZZA 4R5PA 3THVA 1KLNA 2W41A 2FBTA 1SL0A 5DM7L 2O8FA 3R8EA 1XWLA 1WN7A 4XH4A 3THXB 2A1RA 5AQFA 3KIOA 4BQZA 1HJRA 1D5AA 1HNWK 4FW2A 3D2FA 3S3NA 3AA4A 5AQGA 3WUHA 4DS4A 2D0PA 3RSEA 3I8BA 3LM9A 1IG8A 3H1VX 4RTFD 4DQPA 4ISFA 4CJRA 5AQSA 3CQ8A 3IG1A 4RW4A 3L0QA 1QSSA 4XH5A 3QEIA 1ATRA 5GIOA 1NKBA 1YITN 3MEDA 5SWMA 3QFPA 3PUFA 4FCYA 2P5GA 4CCHA 4BRQA 1TUUA 4I2QA 3T1AA 2AA4A 3H45C 2XRIA 3T3FA 5HLFA 2OPQA 3VEXA 4H5NA 5AFUH 3LP1A 4FLYA 4YOUA 4DTSA 3QB0A 4FXDA 3CETA 3P83D 5M1QA 4J2BA 4OPHA 1C0FA 3T1YK 2E4LA 4CJWA 4WQ5A 4FJJA 2O8DA 4IBNA 3P1GA 3P4IA 4CEAA 3WXLA 3AO2A 3KD5E 3IUCA 4FK4A 3QEXA 5CE3A 2IIRA 3VERA 2D4WA 1EWQA 3ZT3A 4IO8A 2QXFA 4NLBA 2GEMA 4FK2A 3OYIA 4CF8A 2A40A 4B3OA 1FW6A 1BO5O 1VQ5N 3NMUA 1VQ6N 4CEZA 3KLFA 2YKNA 1ZBHA 3ALYA 4A59A 3VA3A 4CBUA 4M3UA 3L3UA 5AQOA 3DXKB 4B9LA 3TTCA 4IFYA 3CCMN 4LF7K 1NJWA 1ZBFA 4O8KA 3QNOA 2WUSA 4JS4A 5JVHL 3ZETB 3V1OA 3VTIA 1KQSM 3QESA 3SV3A 4E1NA 1G15A 3UB5A 1VQ7N 4FPAA 3KKSA 3FZLA 3DI6A 4A57A 5F0XA 1SKWA 1NMDA 2ZJPL 4DTNA 5KPRA 3WXJA 4ISGA 1DKGD 4DMNA 5C0YA 3O8MA 3M8RA 4G1QA 5CZ1A 2E1ZA 4KB0A 5AQUA 2ZE2A 2HHTA 3RMBA 3O5BA 1GLBG 3TSPA 2BANA 2GWJA 5KQDA 1BIUA 1NK6A 2P9UB 4DTJA 3DRRA 2BH1A 3WXMB 3K59A 2RHKA 4JKFA 2WONA 2YHYA 4A61A 1ZBUA 1S5JA 1TK0A 3L3VA 3TPQA 1C1AA 1NGGA 4BR0A 3DMJA 3WEEA 4E89A 4I9QA 2RPIA 3GDQA
chains in the Genus database with same CATH topology
4CFBA 3OYFA 1SV5A 2ETJA 3ZSQA 3OYDA 3RTVA 4PUOA 4DQSA 3NF7A 2PZSA 4EZ9A 1BI4A 1U4BA 4E7IA 3ASMA 2AJQA 4ID1A 4W5RA 2OPPA 4FLTA 1RT4A 1QQCA 3CG7A 3OYBA 3DOLA 3AVIA 4N56A 3NCIA 3HO1A 4CGGA 4J2DA 4BDZA 4M42A 3OYMA 4Z4IA 4CJKA 1VSLA 1EETA 1N5YA 1IKXA 4IFVA 1S1WA 1QSLA 2HVHA 4DQIA 4FJHA 3MECA 5DK5A 2G8VA 4W5NA 2IDOA 1B9FA 2IS3A 3CFRA 1C0MA 4BE0A 4E0DA 1S9GA 4KAZA 4BDYA 4IG0A 4FJLA 4K8XA 3KTQA 3QEWA 4AHUA 3VQBA 4KKOA 4Q5VA 1LAVA 1VRTA 3KK1A 3K57A 4DQRA 3NF9A 4OJRA 4DSIA 3AO5A 3ZT1A 2DFEA 3IAYA 1JLBA 2F8SA 4Z4CA 4YNQA 3SNNA 3DLBA 4C8MA 3OJSA 1WNSA 1L3SA 4HUEA 4CIEA 3FFIA 1WSIA 4KI6A 4ID5A 4JRQA 1LWFA 3T19A 1BGXT 3OYGA 1QE1A 1ZBIA 3HVTA 4M3ZA 5K14A 4CEEA 4CJ4A 3OY9A 3RR8A 4I2PA 4L8RB 4ELTA 2P5OA 4KTQA 2HW3A 2HHXA 2E6LA 3VQPA 3LWLA 3ZT4A 1KLMA 1YVUA 3VQ9A 2G8FA 4FJNA 3S3OA 1XHZA 1KCFA 1NOYA 4H4OA 1HPZA 4DSLA 4F4KA 4M3XA 4W5TA 4FJ9A 3TI0A 4KO0A 3A2FA 2OPRA 4CJSA 3SQ1A 2FBVA 1U45A 3F9KA 4CK3A 4Z4GA 4LD0A 3QEVA 3SQ4A 2ZQBA 3VQ4A 4CGFA 2HNDA 1RBRA 4AHVA 3JYTA 4I9LA 4ELUA 2YKMA 4HVJA 5JS1A 1RT7A 2HHUA 3RRHA 5HROA 1WSFA 3KD1E 3PX0A 3SJJA 3HVRA 1T7PA 3SUPA 1QTMA 4M41A 3RMDA 1IO2A 1LWEA 4CGDA 3HP9A 1RDCA 3HSTB 4B8AB 2XHBA 2XO7A 3TAMA 5C25A 3HL8A 3NH1A 3SUNA 4KPYA 3ZSRA 1S1VA 4BACA 1L3TA 1RTHA 2P1JA 1RBUA 4CHZA 3AVCA 1TK5A 4N5SA 1NJXA 3SUQA 4BE1A 1ZBLA 1U47A 4O5BA 1BQMA 4RG8A 1LAWA 1TKTA 3RRGA 3QO9A 3QNNA 1D8YA 1NK7A 3JSMA 3LP0A 2Z1GA 1CXQA 1BI4B 5FDLA 2HHVA 1GOBA 3O3GA 2XY5A 1U04A 4B9TA 3MXIA 1L3UA 3AA2A 1HQEA 1JKHA 1HYVA 4RW8A 5CYMA 2X78A 3AO4A 4JRPA 4CJQA 3KK2A 2RKIA 3LPUA 4B8CA 1RBVA 1KRPA 4RW6A 3PX4A 3AO1A 4FJ8A 3LAKA 3O3HA 4OKEA 4FM0A 2I5JA 1L5UA 3TARA 4TSXA 3TR8A 3LZIA 1NK0A 2F8TA 1EX4A 2YNGA 2Z1HA 4CHNA 2OA8A 2GUIA 3KK3A 4JS5A 1HYSA 1S6PA 1DTTA 3AA3A 4CFAA 3VQ7A 1RT3A 1HQUA 2GV9A 3BDPA 3HYFA 1CZBA 3V9ZA 1HNVA 4CK1A 3UIQA 4KV8A 4FZYA 1C0UA 2HMIA 2YNIA 4OKJA 4FM1A 2VWKA 4DU4A 4GMJB 2YV0X 1SL1A 4OLAA 1DLOA 4CGIA 1XC9A 1EP4A 1RBSA 3HM9A 1JLQA 1VSKA 4CESA 1N6QA 3EYZA 4Y1CA 1KSPA 4UQGA 5KGXA 3QETA 3QEPA 1D9DA 1RCHA 3CM5A 2O4GA 3PY8A 3VQDA 3L2QA 4PQUA 4GVMA 4JLHA 4FLVA 4DTPA 1Q9XA 1ASUA 3G10A 4FVMA 1K6YA 1T03A 3RMCA 3OYKA 4FLUA 3ITHA 3QIPA 4CIFA 2Z1JA 4CHYA 4ZTFA 4RW9A 4BE2A 3S9HA 2F96A 4E7KA 3AV9A 4E7LA 5J2PA 4RW7A 1S1TA 4C8KA 3V9WA 4OLBA 2X6NA 1LW0A 1UOCA 5T7BA 2IC3A 1CLQA 4BWMA 4CEOA 2NUBA 2HHSA 2A1SA 4N41A 1LW2A 4CHOA 1X9MA 1NKCA 3OYLA 1SL2A 5D3GA 1KVAA 5CY4A 3EZ5A 3K5LA 3TAPA 4N76A 4CJTA 1ASVA 1WSHA 4Q0BA 4CE9A 3ZSWA 1S1UA 4E7HA 4AHTA 1IKWA 3C6TA 1VK0A 4LH4A 5KTQA 2P51A 2D5RA 1RT2A 1GOCA 5HRPA 4KFBA 4DFKA 2Z1IA 1D9FA 1BCMA 4KHYA 1TL3A 4FM2A 4CJ5A 3SZ2A 4KHQA 1A5XA 1HYZA 4E7JA 4ZHRA 3OS2A 2BGGA 4QOZB 4C8LA 5JS2A 3SUOA 2FC0A 1WSJA 1X1PA 2ATQA 3C95A 1IKVA 4H4MA 5I3UA 4F2SA 1RDBA 5FROA 1HRHA 3L8BA 3MEGA 3NF6A 1CXUA 3TAEA 2VG7A 4OGCA 4J2EA 3OYCA 3LALA 3MXJA 1KVCA 1LWCA 3SYZA 3TAFA 4KREA 2D0CA 3DYAA 3ZT0A 4FLWA 1C1CA 3QINA 2KW4A 5CZ2A 1DTQA 4FYDA 1VSFA 1ITGA 2X74A 4DSJA 3KLHA 3B6PA 4AILC 3C6UA 1JLFA 3O4NA 2E6MA 4AHRA 1NK4A 3DLHA 3TAGA 1U48A 3K5MA 1VRUA 3DOKA 4NCGA 3ZSZA 1BHLA 4DF8A 2QKKA 2DFFA 4Z4HA 4OPKA 4MQ3A 3VQAA 4KHSA 2DY4A 3VQCA 4M3TA 2QKBA 1RTJA 2KTQA 2OPSA 3DRPA 3NGYA 2VG6A 1UAXA 4HUGA 3V4IA 4W5OA 3OYAA 1UWBA 1C0TA 4IG3A 2RN2A 5HRSA 2OZSA 5SZTA 3HK2A 1JLAA 3OJUA 1XHXA 3ISNC 3NBPA 5J2QA 3QERA 1IH7A 1J5OA 2BDPA 2KFNA 4EP4A 3NE6A 1NJZA 4QAGA 4O4GA 2PYJA 3NH0A 4FJ7A 3OVNA 3VQQA 2KFZA 4KRFA 3QIOA 4CJPA 3LDSA 4FZZA 3AVMA 4B08A 3V6DA 3RMAA 4CK2A 3AVJA 1RT1A 1XI1A 2LSNA 3S3MA 1RTDA 2YHAA 3VQ5A 1S6QA 3P5JA 5EU7A 1HNIA 5C24A 3VN5A 3EY1A 4DG1A 3V1RA 3LWMA 4DS5A 3KLIA 3KLEA 3WNFA 1WSGA 1IKYA 2HHWA 1RTIA 5DMRA 1KVBA 3C94A 3F73A 2YNHA 4LSLA 3K2PA 3CFPA 4HUFA 1VSDA 3TWHA 1L3VA 1CZ9A 5KRTA 2X6SA 5KRSA 3L2RA 2Q3SA 1TV6A 2B4JA 5HBMA 4C8NA 3V1QA 4CIGA 4OKKA 3NHGA 1R0AA 4LY7A 3L2UA 1F21A 3DLGA 1B9DA 2PYLA 1KFSA 3M8PA 2KQ2A 5E41A 4B9SA 1RBTA 4KTZA 3OS1A 1NJYA 4FJ5A 4Z0UA 3O4QA 3AVFA 4AHCA 4CJUA 4DQQA 4YFUA 4DU3A 1NK9A 3MEEA 4OGEA 4FLZA 1SKRA 3NF8A 4OPJA 3B6OA 2RF2A 5FRMA 4CHQA 3M8SA 4DSFA 4QCLA 2VG5A 3BGRA 4PA1A 1Z26A 4KHNA 1WSEA 4CF1A 3KLGA 1S1XA 1FKOA 4AHSA 2BE2A 2FBYA 1BQNA 3IS9A 4NYFA 3K5NA 2G8HA 5HRRA 4KB1A 3ZSVA 3O3FA 3AVGA 3ZCMA 1SKSA 4ELVA 1KFDA 2JLEA 2YNFA 4CJFA 2OYQA 1JXEA 4F8RA 4BDPA 3AVAA 2D0AA 1TKZA 1BIZA 1QHTA 2IGIA 5HP1A 4CF2A 4IKFA 1J54A 4CEBA 1YTUA 3KJVA 1JLEA 2KZZA 1RNHA 2XY6A 3HXMA 1UA1A 3SV4A 4R5PA 3U3YA 2G8IA 1TAUA 4B9UA 3L2VA 1FK9A 3THVA 5I42A 1RT5A 1JL2A 1KLNA 5J2NA 3DLRA 2FBTA 3DRSA 1SL0A 1U49A 3ZSOA 3OYEA 4M3RA 1XWLA 4DSKA 1WN7A 1A5WA 4CEFA 3H08A 1W9HA 1J53A 4CJEA 2A1RA 3KIOA 4LH5A 1HJRA 4KHWA 4FW1A 1D5AA 4CGHA 4CGJA 2QK9A 4FW2A 3ZT2A 4DFPA 3CYMA 2YHBA 3M8QA 4E1MA 3V9UA 3AA4A 3PV8A 4N47A 3S3NA 4AH9A 4O44A 1T05A 4DS4A 1BL3A 4F3TA 1C6VA 1JL1A 3TABA 3KKRA 4E19A 4LSNA 1VSIA 4DF4A 5FRNA 3RWUA 3VQ6A 3LAMA 3I0SA 1FKPA 5J2MA 5J1EA 3OS0A 4DQPA 3CFOA 1ZYQA 4CJRA 1T8EA 4FJIA 1QSYA 3CQ8A 3V81A 3IG1A 4RW4A 4DU1A 1X9SA 1QSSA 4FK0A 1W0HA 1TGOA 3DM2A 1TVRA 3CM6A 3QEIA 3MXMA 1NKBA 2IAJA 5KGWA 3ZSXA 3LZJA 1RDDA 3MEDA 1VSHA 5SWMA 4CERA 3LP3A 3PUFA 3OYJA 4FCYA 2P5GA 4CCHA 4FJGA 3V9SA 4I2QA 3WNHA 1REVA 3T1AA 3PO5A 1I3AA 2XRIA 3T3FA 3G0ZA 1BISA 1Z25A 4BWJA 3SPZA 2OPQA 4CECA 5HLFA 4M3WA 3PX6A 1ASWA 4FLYA 4DTSA 1EKEA 3LP1A 4B9VA 4FXDA 2ITGA 3HPOA 3P83D 5C42A 4F3OA 4J2BA 2E4LA 4CJWA 3SCXA 4FJJA 4IBNA 3P1GA 4E3SA 4CEAA 3DLEA 3K58A 1RDAA 4WE1A 3WNEA 4GW6A 3SQ2A 1TKDA 1VSJA 3AO2A 3NDKA 3KD5E 4FK4A 3AVBA 3QEXA 2KZMA 4CFDA 1BCOA 3AO3A 3U3GA 1RILA 3RR7A 4HCCA 3L2WA 1O1WA 4O0JA 4KI4A 3I8DA 3ZT3A 2D0BA 4OVLA 2HNZA 1JXBA 2QXFA 3SPYA 2B5JA 4FK2A 2DTUA 3OYIA 3NFAA 1X9WA 4CF8A 4B3OA 4CFCA 1RT6A 1C1BA 3NGZA 1S9EA 4HTUA 4EP5A 1TAQA 2G8KA 4CEZA 4MFBA 3KLFA 4DFMA 2YKNA 1ZBHA 3ZSYA 3K5OA 3TAQA 4DSEA 1Q8IA 3ALYA 4CF0A 5HRNA 4C8OA 4CHPA 3NGIA 3HPGA 3WNGA 2Y1IA 1NK5A 4NCAA 3VA3A 5KI6A 3AVKA 3TANA 1FXXA 4M3UA 3L3UA 2DFHA 3HJFA 1HMVA 2R7YA 4M3YA 4B9LA 4Z4EA 4Z4FA 4HHTA 1I39A 4IFYA 2IOCA 3IRXA 4DLEA 1NJWA 1ZBFA 3OYNA 3HT3A 1YTAA 4FJMA 4O55A 4CJ3A 3OYHA 1SUQA 2VWJA 4J2AA 4PY5A 3PO4A 4B9MA 1JLCA 3QNOA 4KHUA 4O0IA 2Y1JA 1TKXA 4JS4A 3AVNA 4ZTJA 3SI6A 2HVIA 1J9AA 4ICLA 4CEDA 3V1OA 4IDKA 3DLKA 4M45A 4EZ6A 3NAEA 3LP2A 1JLGA 2XY8A 4KTWA 4H8KA 3SV3A 4E1NA 3QESA 1G15A 1NK8A 4FJKA 2GBZA 1B92A 3KKSA 1VSEA 1UA0A 2W42A 3AVHA 3DI6A 4CF9A 3V9XA 4DTXA 4DTUA 3QLHA 1EXQA 2JGUA 2OZMA 1WAFA 4F2RA 4HCBA 1SKWA 5CYQA 1WAJA 2EHGA 4DTNA 1VSMA 4DTOA 4NCBA 3E01A 3MAQA 4DMNA 3M8RA 4CEQA 2EX3A 3VQ8A 4FLXA 1A5VA 1KTQA 4I7FA 4G1QA 5CZ1A 2HB5A 3LPTA 4DWIA 3I0RA 2G8UA 4DTMA 4KB0A 2ZD1A 2ZE2A 4DFJA 1NOZA 2HNYA 1GOAA 2HHTA 3RMBA 1TK8A 2BANA 2B6AA 1IG9A 3HP6A 2PY5A 1BIUA 3SQ0A 2FBXA 3NH2A 4DTJA 4NYNA 1NK6A 4W5QA 2HHQA 3DRRA 3K59A 3VA0A 4PWDA 1Q9YA 2O4IA 4XIUA 1YT3A 1TL1A 2WONA 3AVLA 3ULDA 2XY7A 1NKEA 1ZBUA 4CJVA 4DLGA 2WOMA 1MU2A 3HPHA 4FJXA 1S5JA 1WLJA 4Y1DA 4CJLA 1Y97A 1TK0A 4FZXC 3L3VA 4K8ZA 4B9NA 1C1AA 3AA5X 3D0PA 3U6FA 1QS4A 3D45A 3DMJA 4E89A 1LV5A 4I9QA 3LANA 2G8WA 2RPIA 3VQEA 4DTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFB A;  3OYF A;  1SV5 A;  2ETJ A;  3ZSQ A;  3OYD A;  3RTV A;  4PUO A;  4DQS A;  3NF7 A;  2PZS A;  4EZ9 A;  1BI4 A;  1U4B A;  4E7I A;  3ASM A;  2AJQ A;  4ID1 A;  4W5R A;  2OPP A;  4FLT A;  1RT4 A;  1QQC A;  3CG7 A;  3OYB A;  3DOL A;  3AVI A;  4N56 A;  3NCI A;  3HO1 A;  4CGG A;  4J2D A;  4BDZ A;  4M42 A;  3OYM A;  4Z4I A;  4CJK A;  1VSL A;  1EET A;  1N5Y A;  1IKX A;  4IFV A;  1S1W A;  1QSL A;  2HVH A;  4DQI A;  4FJH A;  3MEC A;  5DK5 A;  2G8V A;  4W5N A;  2IDO A;  1B9F A;  2IS3 A;  3CFR A;  1C0M A;  4BE0 A;  4E0D A;  1S9G A;  4KAZ A;  4BDY A;  4IG0 A;  4FJL A;  4K8X A;  3KTQ A;  3QEW A;  4AHU A;  3VQB A;  4KKO A;  4Q5V A;  1LAV A;  1VRT A;  3KK1 A;  3K57 A;  4DQR A;  3NF9 A;  4OJR A;  4DSI A;  3AO5 A;  3ZT1 A;  2DFE A;  3IAY A;  1JLB A;  2F8S A;  4Z4C A;  4YNQ A;  3SNN A;  3DLB A;  4C8M A;  3OJS A;  1WNS A;  1L3S A;  4HUE A;  4CIE A;  3FFI A;  1WSI A;  4KI6 A;  4ID5 A;  4JRQ A;  1LWF A;  3T19 A;  1BGX T;  3OYG A;  1QE1 A;  1ZBI A;  3HVT A;  4M3Z A;  5K14 A;  4CEE A;  4CJ4 A;  3OY9 A;  3RR8 A;  4I2P A;  4L8R B;  4ELT A;  2P5O A;  4KTQ A;  2HW3 A;  2HHX A;  2E6L A;  3VQP A;  3LWL A;  3ZT4 A;  1KLM A;  1YVU A;  3VQ9 A;  2G8F A;  4FJN A;  3S3O A;  1XHZ A;  1KCF A;  1NOY A;  4H4O A;  1HPZ A;  4DSL A;  4F4K A;  4M3X A;  4W5T A;  4FJ9 A;  3TI0 A;  4KO0 A;  3A2F A;  2OPR A;  4CJS A;  3SQ1 A;  2FBV A;  1U45 A;  3F9K A;  4CK3 A;  4Z4G A;  4LD0 A;  3QEV A;  3SQ4 A;  2ZQB A;  3VQ4 A;  4CGF A;  2HND A;  1RBR A;  4AHV A;  3JYT A;  4I9L A;  4ELU A;  2YKM A;  4HVJ A;  5JS1 A;  1RT7 A;  2HHU A;  3RRH A;  5HRO A;  1WSF A;  3KD1 E;  3PX0 A;  3SJJ A;  3HVR A;  1T7P A;  3SUP A;  1QTM A;  4M41 A;  3RMD A;  1IO2 A;  1LWE A;  4CGD A;  3HP9 A;  1RDC A;  3HST B;  4B8A B;  2XHB A;  2XO7 A;  3TAM A;  5C25 A;  3HL8 A;  3NH1 A;  3SUN A;  4KPY A;  3ZSR A;  1S1V A;  4BAC A;  1L3T A;  1RTH A;  2P1J A;  1RBU A;  4CHZ A;  3AVC A;  1TK5 A;  4N5S A;  1NJX A;  3SUQ A;  4BE1 A;  1ZBL A;  1U47 A;  4O5B A;  1BQM A;  4RG8 A;  1LAW A;  1TKT A;  3RRG A;  3QO9 A;  3QNN A;  1D8Y A;  1NK7 A;  3JSM A;  3LP0 A;  2Z1G A;  1CXQ A;  1BI4 B;  5FDL A;  2HHV A;  1GOB A;  3O3G A;  2XY5 A;  1U04 A;  4B9T A;  3MXI A;  1L3U A;  3AA2 A;  1HQE A;  1JKH A;  1HYV A;  4RW8 A;  5CYM A;  2X78 A;  3AO4 A;  4JRP A;  4CJQ A;  3KK2 A;  2RKI A;  3LPU A;  4B8C A;  1RBV A;  1KRP A;  4RW6 A;  3PX4 A;  3AO1 A;  4FJ8 A;  3LAK A;  3O3H A;  4OKE A;  4FM0 A;  2I5J A;  1L5U A;  3TAR A;  4TSX A;  3TR8 A;  3LZI A;  1NK0 A;  2F8T A;  1EX4 A;  2YNG A;  2Z1H A;  4CHN A;  2OA8 A;  2GUI A;  3KK3 A;  4JS5 A;  1HYS A;  1S6P A;  1DTT A;  3AA3 A;  4CFA A;  3VQ7 A;  1RT3 A;  1HQU A;  2GV9 A;  3BDP A;  3HYF A;  1CZB A;  3V9Z A;  1HNV A;  4CK1 A;  3UIQ A;  4KV8 A;  4FZY A;  1C0U A;  2HMI A;  2YNI A;  4OKJ A;  4FM1 A;  2VWK A;  4DU4 A;  4GMJ B;  2YV0 X;  1SL1 A;  4OLA A;  1DLO A;  4CGI A;  1XC9 A;  1EP4 A;  1RBS A;  3HM9 A;  1JLQ A;  1VSK A;  4CES A;  1N6Q A;  3EYZ A;  4Y1C A;  1KSP A;  4UQG A;  5KGX A;  3QET A;  3QEP A;  1D9D A;  1RCH A;  3CM5 A;  2O4G A;  3PY8 A;  3VQD A;  3L2Q A;  4PQU A;  4GVM A;  4JLH A;  4FLV A;  4DTP A;  1Q9X A;  1ASU A;  3G10 A;  4FVM A;  1K6Y A;  1T03 A;  3RMC A;  3OYK A;  4FLU A;  3ITH A;  3QIP A;  4CIF A;  2Z1J A;  4CHY A;  4ZTF A;  4RW9 A;  4BE2 A;  3S9H A;  2F96 A;  4E7K A;  3AV9 A;  4E7L A;  5J2P A;  4RW7 A;  1S1T A;  4C8K A;  3V9W A;  4OLB A;  2X6N A;  1LW0 A;  1UOC A;  5T7B A;  2IC3 A;  1CLQ A;  4BWM A;  4CEO A;  2NUB A;  2HHS A;  2A1S A;  4N41 A;  1LW2 A;  4CHO A;  1X9M A;  1NKC A;  3OYL A;  1SL2 A;  5D3G A;  1KVA A;  5CY4 A;  3EZ5 A;  3K5L A;  3TAP A;  4N76 A;  4CJT A;  1ASV A;  1WSH A;  4Q0B A;  4CE9 A;  3ZSW A;  1S1U A;  4E7H A;  4AHT A;  1IKW A;  3C6T A;  1VK0 A;  4LH4 A;  5KTQ A;  2P51 A;  2D5R A;  1RT2 A;  1GOC A;  5HRP A;  4KFB A;  4DFK A;  2Z1I A;  1D9F A;  1BCM A;  4KHY A;  1TL3 A;  4FM2 A;  4CJ5 A;  3SZ2 A;  4KHQ A;  1A5X A;  1HYZ A;  4E7J A;  4ZHR A;  3OS2 A;  2BGG A;  4QOZ B;  4C8L A;  5JS2 A;  3SUO A;  2FC0 A;  1WSJ A;  1X1P A;  2ATQ A;  3C95 A;  1IKV A;  4H4M A;  5I3U A;  4F2S A;  1RDB A;  5FRO A;  1HRH A;  3L8B A;  3MEG A;  3NF6 A;  1CXU A;  3TAE A;  2VG7 A;  4OGC A;  4J2E A;  3OYC A;  3LAL A;  3MXJ A;  1KVC A;  1LWC A;  3SYZ A;  3TAF A;  4KRE A;  2D0C A;  3DYA A;  3ZT0 A;  4FLW A;  1C1C A;  3QIN A;  2KW4 A;  5CZ2 A;  1DTQ A;  4FYD A;  1VSF A;  1ITG A;  2X74 A;  4DSJ A;  3KLH A;  3B6P A;  4AIL C;  3C6U A;  1JLF A;  3O4N A;  2E6M A;  4AHR A;  1NK4 A;  3DLH A;  3TAG A;  1U48 A;  3K5M A;  1VRU A;  3DOK A;  4NCG A;  3ZSZ A;  1BHL A;  4DF8 A;  2QKK A;  2DFF A;  4Z4H A;  4OPK A;  4MQ3 A;  3VQA A;  4KHS A;  2DY4 A;  3VQC A;  4M3T A;  2QKB A;  1RTJ A;  2KTQ A;  2OPS A;  3DRP A;  3NGY A;  2VG6 A;  1UAX A;  4HUG A;  3V4I A;  4W5O A;  3OYA A;  1UWB A;  1C0T A;  4IG3 A;  2RN2 A;  5HRS A;  2OZS A;  5SZT A;  3HK2 A;  1JLA A;  3OJU A;  1XHX A;  3ISN C;  3NBP A;  5J2Q A;  3QER A;  1IH7 A;  1J5O A;  2BDP A;  2KFN A;  4EP4 A;  3NE6 A;  1NJZ A;  4QAG A;  4O4G A;  2PYJ A;  3NH0 A;  4FJ7 A;  3OVN A;  3VQQ A;  2KFZ A;  4KRF A;  3QIO A;  4CJP A;  3LDS A;  4FZZ A;  3AVM A;  4B08 A;  3V6D A;  3RMA A;  4CK2 A;  3AVJ A;  1RT1 A;  1XI1 A;  2LSN A;  3S3M A;  1RTD A;  2YHA A;  3VQ5 A;  1S6Q A;  3P5J A;  5EU7 A;  1HNI A;  5C24 A;  3VN5 A;  3EY1 A;  4DG1 A;  3V1R A;  3LWM A;  4DS5 A;  3KLI A;  3KLE A;  3WNF A;  1WSG A;  1IKY A;  2HHW A;  1RTI A;  5DMR A;  1KVB A;  3C94 A;  3F73 A;  2YNH A;  4LSL A;  3K2P A;  3CFP A;  4HUF A;  1VSD A;  3TWH A;  1L3V A;  1CZ9 A;  5KRT A;  2X6S A;  5KRS A;  3L2R A;  2Q3S A;  1TV6 A;  2B4J A;  5HBM A;  4C8N A;  3V1Q A;  4CIG A;  4OKK A;  3NHG A;  1R0A A;  4LY7 A;  3L2U A;  1F21 A;  3DLG A;  1B9D A;  2PYL A;  1KFS A;  3M8P A;  2KQ2 A;  5E41 A;  4B9S A;  1RBT A;  4KTZ A;  3OS1 A;  1NJY A;  4FJ5 A;  4Z0U A;  3O4Q A;  3AVF A;  4AHC A;  4CJU A;  4DQQ A;  4YFU A;  4DU3 A;  1NK9 A;  3MEE A;  4OGE A;  4FLZ A;  1SKR A;  3NF8 A;  4OPJ A;  3B6O A;  2RF2 A;  5FRM A;  4CHQ A;  3M8S A;  4DSF A;  4QCL A;  2VG5 A;  3BGR A;  4PA1 A;  1Z26 A;  4KHN A;  1WSE A;  4CF1 A;  3KLG A;  1S1X A;  1FKO A;  4AHS A;  2BE2 A;  2FBY A;  1BQN A;  3IS9 A;  4NYF A;  3K5N A;  2G8H A;  5HRR A;  4KB1 A;  3ZSV A;  3O3F A;  3AVG A;  3ZCM A;  1SKS A;  4ELV A;  1KFD A;  2JLE A;  2YNF A;  4CJF A;  2OYQ A;  1JXE A;  4F8R A;  4BDP A;  3AVA A;  2D0A A;  1TKZ A;  1BIZ A;  1QHT A;  2IGI A;  5HP1 A;  4CF2 A;  4IKF A;  1J54 A;  4CEB A;  1YTU A;  3KJV A;  1JLE A;  2KZZ A;  1RNH A;  2XY6 A;  3HXM A;  1UA1 A;  3SV4 A;  4R5P A;  3U3Y A;  2G8I A;  1TAU A;  4B9U A;  3L2V A;  1FK9 A;  3THV A;  5I42 A;  1RT5 A;  1JL2 A;  1KLN A;  5J2N A;  3DLR A;  2FBT A;  3DRS A;  1SL0 A;  1U49 A;  3ZSO A;  3OYE A;  4M3R A;  1XWL A;  4DSK A;  1WN7 A;  1A5W A;  4CEF A;  3H08 A;  1W9H A;  1J53 A;  4CJE A;  2A1R A;  3KIO A;  4LH5 A;  1HJR A;  4KHW A;  4FW1 A;  1D5A A;  4CGH A;  4CGJ A;  2QK9 A;  4FW2 A;  3ZT2 A;  4DFP A;  3CYM A;  2YHB A;  3M8Q A;  4E1M A;  3V9U A;  3AA4 A;  3PV8 A;  4N47 A;  3S3N A;  4AH9 A;  4O44 A;  1T05 A;  4DS4 A;  1BL3 A;  4F3T A;  1C6V A;  1JL1 A;  3TAB A;  3KKR A;  4E19 A;  4LSN A;  1VSI A;  4DF4 A;  5FRN A;  3RWU A;  3VQ6 A;  3LAM A;  3I0S A;  1FKP A;  5J2M A;  5J1E A;  3OS0 A;  4DQP A;  3CFO A;  1ZYQ A;  4CJR A;  1T8E A;  4FJI A;  1QSY A;  3CQ8 A;  3V81 A;  3IG1 A;  4RW4 A;  4DU1 A;  1X9S A;  1QSS A;  4FK0 A;  1W0H A;  1TGO A;  3DM2 A;  1TVR A;  3CM6 A;  3QEI A;  3MXM A;  1NKB A;  2IAJ A;  5KGW A;  3ZSX A;  3LZJ A;  1RDD A;  3MED A;  1VSH A;  5SWM A;  4CER A;  3LP3 A;  3PUF A;  3OYJ A;  4FCY A;  2P5G A;  4CCH A;  4FJG A;  3V9S A;  4I2Q A;  3WNH A;  1REV A;  3T1A A;  3PO5 A;  1I3A A;  2XRI A;  3T3F A;  3G0Z A;  1BIS A;  1Z25 A;  4BWJ A;  3SPZ A;  2OPQ A;  4CEC A;  5HLF A;  4M3W A;  3PX6 A;  1ASW A;  4FLY A;  4DTS A;  1EKE A;  3LP1 A;  4B9V A;  4FXD A;  2ITG A;  3HPO A;  3P83 D;  5C42 A;  4F3O A;  4J2B A;  2E4L A;  4CJW A;  3SCX A;  4FJJ A;  4IBN A;  3P1G A;  4E3S A;  4CEA A;  3DLE A;  3K58 A;  1RDA A;  4WE1 A;  3WNE A;  4GW6 A;  3SQ2 A;  1TKD A;  1VSJ A;  3AO2 A;  3NDK A;  3KD5 E;  4FK4 A;  3AVB A;  3QEX A;  2KZM A;  4CFD A;  1BCO A;  3AO3 A;  3U3G A;  1RIL A;  3RR7 A;  4HCC A;  3L2W A;  1O1W A;  4O0J A;  4KI4 A;  3I8D A;  3ZT3 A;  2D0B A;  4OVL A;  2HNZ A;  1JXB A;  2QXF A;  3SPY A;  2B5J A;  4FK2 A;  2DTU A;  3OYI A;  3NFA A;  1X9W A;  4CF8 A;  4B3O A;  4CFC A;  1RT6 A;  1C1B A;  3NGZ A;  1S9E A;  4HTU A;  4EP5 A;  1TAQ A;  2G8K A;  4CEZ A;  4MFB A;  3KLF A;  4DFM A;  2YKN A;  1ZBH A;  3ZSY A;  3K5O A;  3TAQ A;  4DSE A;  1Q8I A;  3ALY A;  4CF0 A;  5HRN A;  4C8O A;  4CHP A;  3NGI A;  3HPG A;  3WNG A;  2Y1I A;  1NK5 A;  4NCA A;  3VA3 A;  5KI6 A;  3AVK A;  3TAN A;  1FXX A;  4M3U A;  3L3U A;  2DFH A;  3HJF A;  1HMV A;  2R7Y A;  4M3Y A;  4B9L A;  4Z4E A;  4Z4F A;  4HHT A;  1I39 A;  4IFY A;  2IOC A;  3IRX A;  4DLE A;  1NJW A;  1ZBF A;  3OYN A;  3HT3 A;  1YTA A;  4FJM A;  4O55 A;  4CJ3 A;  3OYH A;  1SUQ A;  2VWJ A;  4J2A A;  4PY5 A;  3PO4 A;  4B9M A;  1JLC A;  3QNO A;  4KHU A;  4O0I A;  2Y1J A;  1TKX A;  4JS4 A;  3AVN A;  4ZTJ A;  3SI6 A;  2HVI A;  1J9A A;  4ICL A;  4CED A;  3V1O A;  4IDK A;  3DLK A;  4M45 A;  4EZ6 A;  3NAE A;  3LP2 A;  1JLG A;  2XY8 A;  4KTW A;  4H8K A;  3SV3 A;  4E1N A;  3QES A;  1G15 A;  1NK8 A;  4FJK A;  2GBZ A;  1B92 A;  3KKS A;  1VSE A;  1UA0 A;  2W42 A;  3AVH A;  3DI6 A;  4CF9 A;  3V9X A;  4DTX A;  4DTU A;  3QLH A;  1EXQ A;  2JGU A;  2OZM A;  1WAF A;  4F2R A;  4HCB A;  1SKW A;  5CYQ A;  1WAJ A;  2EHG A;  4DTN A;  1VSM A;  4DTO A;  4NCB A;  3E01 A;  3MAQ A;  4DMN A;  3M8R A;  4CEQ A;  2EX3 A;  3VQ8 A;  4FLX A;  1A5V A;  1KTQ A;  4I7F A;  4G1Q A;  5CZ1 A;  2HB5 A;  3LPT A;  4DWI A;  3I0R A;  2G8U A;  4DTM A;  4KB0 A;  2ZD1 A;  2ZE2 A;  4DFJ A;  1NOZ A;  2HNY A;  1GOA A;  2HHT A;  3RMB A;  1TK8 A;  2BAN A;  2B6A A;  1IG9 A;  3HP6 A;  2PY5 A;  1BIU A;  3SQ0 A;  2FBX A;  3NH2 A;  4DTJ A;  4NYN A;  1NK6 A;  4W5Q A;  2HHQ A;  3DRR A;  3K59 A;  3VA0 A;  4PWD A;  1Q9Y A;  2O4I A;  4XIU A;  1YT3 A;  1TL1 A;  2WON A;  3AVL A;  3ULD A;  2XY7 A;  1NKE A;  1ZBU A;  4CJV A;  4DLG A;  2WOM A;  1MU2 A;  3HPH A;  4FJX A;  1S5J A;  1WLJ A;  4Y1D A;  4CJL A;  1Y97 A;  1TK0 A;  4FZX C;  3L3V A;  4K8Z A;  4B9N A;  1C1A A;  3AA5 X;  3D0P A;  3U6F A;  1QS4 A;  3D45 A;  3DMJ A;  4E89 A;  1LV5 A;  4I9Q A;  3LAN A;  2G8W A;  2RPI A;  3VQE A;  4DTR A; 
#chains in the Genus database with same CATH topology
 5GAE P;  3OYF A;  3OYD A;  2PZS A;  4DKW A;  3ASM A;  2OPP A;  1MDU B;  4B3R K;  3OYB A;  1DEJ A;  1QVG M;  3NCI A;  4CGG A;  4M42 A;  1VQN N;  3MN6 A;  3EKS A;  2BTF A;  2CGK A;  4DQI A;  4FJH A;  3MEC A;  3DJC A;  3C65 A;  2IS3 A;  4BE0 A;  4IG0 A;  4K8X A;  4X64 K;  2QTD A;  3QEW A;  4AHU A;  3ENO A;  3NF9 A;  1NWK A;  2DFE A;  3IAY A;  3DLB A;  1NG9 A;  1WNS A;  2F4V K;  5KQ8 A;  1LWF A;  1BGX T;  1T6C A;  1QE1 A;  1ZBI A;  3HVT A;  1P8Z A;  5K14 A;  3OY9 A;  4C1N I;  4H5T A;  2HW3 A;  2HHX A;  4KTQ A;  3VQP A;  5BRE A;  1X3N A;  3ZT4 A;  1YVU A;  4BRK A;  4PKH A;  2G8F A;  4JN4 A;  4FJ9 A;  3NVM A;  4KO0 A;  3SQ1 A;  1RBR A;  3DLL L;  2D0O A;  4I9L A;  4ELU A;  2YKM A;  3O9S A;  4HVJ A;  1RT7 A;  3JAM O;  2NRZ A;  5JS1 A;  2HF4 A;  5DM6 L;  5HRO A;  4GNI A;  4MDB A;  1T7P A;  3JS6 A;  3SUP A;  3CJA A;  4CGD A;  1RDC A;  3HST B;  4Y0W A;  5LL6 Z;  3ZSR A;  1S1V A;  2H3G X;  3SAH A;  1GLL O;  4N5S A;  4BE1 A;  4H0P A;  2NNW A;  3UKU B;  1D8Y A;  2UUA K;  3LP0 A;  1CXQ A;  2XY5 A;  3MXI A;  1HYV A;  1Q18 A;  4PKG A;  4NXM K;  4JK8 A;  3AO4 A;  4CJQ A;  4NO7 A;  3ULE A;  1SS6 A;  3AO1 A;  3O3H A;  4OKE A;  5M1O A;  4HTL A;  2I5J A;  2W6L A;  1L5U A;  4TSX A;  3TR8 A;  5LJV A;  3QFU A;  4JK7 A;  2YNG A;  4IZ9 A;  1NGF A;  3AA3 A;  4CFA A;  3VQ7 A;  1D4X A;  2GV9 A;  3P31 A;  3BDP A;  3NVK A;  1CZB A;  4RCH A;  3ID6 A;  4CK1 A;  3UIQ A;  4FZY A;  1C0U A;  4OKJ A;  3ZX0 A;  1SL1 A;  4DU4 A;  2NRW A;  4JI7 K;  1JLQ A;  1TYQ A;  2FF6 A;  4Y1C A;  3TSQ A;  4YY3 K;  2FF3 B;  4GVM A;  1Q9X A;  1JCF A;  3CC7 N;  1ASU A;  4AF1 A;  3G10 A;  1K6Y A;  3BY5 A;  3QIP A;  4RW9 A;  2QWL A;  3HSC A;  4E7K A;  4E7L A;  3FZH A;  4CD1 A;  4C8K A;  2X6N A;  3SBG A;  3CC2 N;  1Y64 A;  5TKY A;  1LW2 A;  2ZM6 K;  1Q81 O;  4BR9 A;  4N76 A;  4IFE A;  2Q0U A;  5KTQ A;  4LH4 A;  3KWG A;  1N33 K;  1N32 K;  4KHY A;  1TL3 A;  1T44 A;  2BGG A;  4C8L A;  1QZ6 A;  2YX6 A;  4FOI A;  1IKV A;  5I3U A;  1QQN A;  3MEG A;  5EOY A;  5AQY A;  4OGC A;  4J2E A;  3MXJ A;  4KRE A;  5GAD P;  3ZT0 A;  1C1C A;  2HOE A;  5CZ2 A;  2JWL A;  1VSF A;  4DSJ A;  3KLH A;  3B6P A;  4AIL C;  3C6U A;  3DLH A;  3SBT A;  3M6G A;  4EIA A;  3TAG A;  1U48 A;  3K5M A;  4NCG A;  1S22 A;  2QKK A;  4DF8 A;  4Z4H A;  1N34 K;  5F1X A;  4KHS A;  3GE1 A;  1RTJ A;  1YIJ N;  2QXL A;  4HUG A;  1UAX A;  2W40 A;  4IG3 A;  3DXM B;  4IOX A;  3OJU A;  5J2Q A;  1J5O A;  4O4G A;  4KRF A;  3RSE B;  2KHO A;  3AVM A;  3RMA A;  2QEX N;  1VQK N;  1YAG A;  2ZJQ L;  2LSN A;  1JJ2 M;  3VQ5 A;  5EU7 A;  3VN5 A;  4DG1 A;  3V1R A;  3LWM A;  4I6M A;  3C6A A;  1XMQ K;  1WSG A;  2HHW A;  3KZB A;  2YNH A;  4FWK A;  4HUF A;  3TWH A;  1L3V A;  2YJE A;  5FPD A;  3CCV N;  4A5A A;  3L2R A;  4BR4 A;  3V1Q A;  1SAZ A;  3L2U A;  1F21 A;  1B9D A;  4DUY K;  1KFS A;  2KQ2 A;  2DY4 A;  2O8B B;  1QQM A;  1M90 O;  3AVF A;  4WFA L;  4DQQ A;  4DU3 A;  4YFU A;  4LFB K;  4B3T K;  4OGE A;  4FLZ A;  1SKR A;  3B6O A;  2RF2 A;  5AZI A;  4CHQ A;  3BGR A;  4PA1 A;  1Z26 A;  3AGK A;  5AR0 A;  4KHN A;  4CF1 A;  1FKO A;  2UUB K;  3MDQ A;  4JI1 K;  4KB1 A;  3AAQ A;  4FL9 A;  3AVG A;  3QIC A;  4ELV A;  1KFD A;  4CJF A;  2YNF A;  4BRL A;  2D0A A;  1NGE A;  1TKZ A;  2IGI A;  1J54 A;  2P9L A;  1JLE A;  1RNH A;  4B9U A;  3HBT A;  1RT5 A;  3O80 A;  3EEQ A;  1YUW A;  3BUZ B;  3DLR A;  3DRS A;  1T3V A;  3OYE A;  4XEI A;  1A5W A;  2ZGY A;  1TUY A;  3J7Z O;  3F2K A;  4KHW A;  3ZT2 A;  2QWR A;  4E1M A;  3PV8 A;  1IBL K;  3J81 O;  4YOV A;  1KC8 O;  5HL7 L;  1BL3 A;  3I33 A;  1C6V A;  3TAB A;  4B1W B;  1VSI A;  4BRN A;  2IVO A;  3R6M A;  1BA0 A;  3LAM A;  5TKW A;  3I0S A;  2HST A;  1FKP A;  5J1E A;  3LL3 A;  5M1K A;  4V19 S;  2F9T A;  1J6Z A;  2FSJ A;  3O08 A;  2HHH K;  4PL8 A;  3VGM A;  1NGJ A;  3HOT A;  3DM2 A;  3CM6 A;  5KGW A;  3ZSX A;  1ZBS A;  3LP3 A;  2ZWH A;  2D1K A;  3PO5 A;  3EN9 A;  1BIS A;  4BWJ A;  3SK3 A;  1ASW A;  5AJ3 K;  4YHH K;  5C42 A;  4F3O A;  3TSU A;  2QWO A;  5AQJ A;  3CCU N;  3DLE A;  3K58 A;  4WE1 A;  3WNE A;  4BRE A;  3SQ2 A;  1TKD A;  3CQX A;  4EHU A;  4JKG B;  3TTD A;  4CFD A;  1BCO A;  5GAH P;  3AO3 A;  1RIL A;  3GL1 A;  4M7X A;  3I8D A;  2D0B A;  5C2F A;  1JXB A;  4JAX A;  3SMP A;  1BOT O;  1C1B A;  1TAQ A;  4DFM A;  3K5O A;  4DSE A;  1YJ9 N;  1QHA A;  5IT9 O;  1Q8I A;  3ZX3 A;  4CHP A;  3NGI A;  3HPG A;  3CPW M;  1NK5 A;  3VF2 A;  5FPE A;  1FXX A;  3HJF A;  2GUP A;  2R7Y A;  3BZC A;  4Z4E A;  4HHT A;  3MWP A;  2IOC A;  4DLE A;  2O8C A;  1NM1 A;  3HT3 A;  1YTA A;  4FJM A;  4O55 A;  1S3X A;  3OYH A;  4PY5 A;  1SQK A;  3QDK A;  4BRP A;  4O0I A;  3AVN A;  4LF8 K;  3A5L C;  4BR5 A;  3J7Y P;  4M45 A;  3THX A;  1ATS A;  3NAE A;  4FWM A;  1JLG A;  4I6M B;  1BWF O;  1UA0 A;  3R9P A;  4BY9 C;  3JXU A;  4PKI A;  2J4R A;  1WAF A;  1VSM A;  4NCB A;  3E01 A;  2CGL A;  4CEQ A;  3VQ8 A;  4FLX A;  1IBM K;  3QML A;  4I7F A;  1GLC G;  2HB5 A;  3LPT A;  3HTV A;  3I0R A;  3OHR A;  4DTM A;  2ZD1 A;  3N4Q A;  3RVC A;  1TK8 A;  3HP6 A;  2PY5 A;  3SQ0 A;  4NYN A;  4O8U A;  4W5Q A;  2A3Z A;  4PWD A;  3PIO L;  2O4I A;  5EVZ A;  1HKG A;  3ULD A;  2XY7 A;  3J7A P;  3IFR A;  4CJV A;  4BGB A;  2WOM A;  4IOA L;  4FZX C;  3MMV A;  4GVE A;  4DV5 K;  2E2Q A;  3D45 A;  3LAN A;  5ADX H;  3VQE A;  3H46 O;  1SV5 A;  2ETJ A;  4PUO A;  3RTV A;  4DQS A;  1U4B A;  3H3O B;  4X65 K;  3THW B;  4W5R A;  1RT4 A;  3CG7 A;  4H0V B;  3G25 A;  4N56 A;  3VET A;  4J2D A;  3K9J A;  3CQY A;  3OYM A;  1VSL A;  1EET A;  1QVF M;  1IKX A;  4IFV A;  2HVH A;  1QSL A;  4XH1 A;  3GBT A;  4W5N A;  2JWK A;  3CFR A;  1C0M A;  4KAZ A;  1NGA A;  5M1P A;  4KKO A;  4Q5V A;  1GLF O;  1VRT A;  4ISE A;  1S72 N;  4DSI A;  3ZT1 A;  3K9K A;  2F8S A;  4RWT A;  3OTO K;  1WSI A;  4JRQ A;  4K41 A;  2EWS A;  3RR8 A;  3HZ6 A;  4JHD B;  4ELT A;  3R1X A;  2NRH A;  1KLM A;  3LDN A;  3LDL A;  1WBD A;  3S3O A;  1XHZ A;  1KCF A;  3CXC M;  4F4K A;  2HVI A;  1W97 L;  4W5T A;  3A2F A;  2OPR A;  3G4S N;  4EHT A;  4NLC A;  4LD0 A;  3FZF A;  1HJO A;  2HND A;  1OH7 A;  1WSF A;  3VEY A;  5AQR A;  3SJJ A;  3D2E B;  3MN9 A;  1HX1 A;  4K43 A;  1XNR K;  3CCL N;  3NH1 A;  4KPY A;  2KKZ A;  4BAC A;  2P1J A;  1ZBL A;  4BC4 A;  3RRG A;  2ASO A;  4BC2 A;  3K0S A;  4FWP A;  3CJB A;  1KXP A;  2HHV A;  1GOB A;  4JKG A;  4B9T A;  1U04 A;  1NLV A;  3AA2 A;  1JKH A;  4RW8 A;  1E4F T;  5CYM A;  4JRP A;  4CZM A;  3KK2 A;  2V7Z A;  3LPU A;  4AQY K;  4FM0 A;  4U67 L;  4B3S K;  3P39 A;  1EX4 A;  2YJF A;  4CZF A;  5AQW A;  4CHN A;  5M1F A;  3KK3 A;  5LMU K;  4JS5 A;  3A5M C;  1S6P A;  1DTT A;  1RT3 A;  3FZK A;  5AQZ A;  4WFB L;  2HMI A;  2DPN A;  2VWK A;  4GMJ B;  2YV0 X;  2PFU A;  1DLO A;  4CGI A;  4DV2 K;  2A42 A;  3EYZ A;  4DV0 K;  4UQG A;  3QEP A;  3CM5 A;  3LDP A;  3PY8 A;  3VQD A;  3L2Q A;  3BF1 A;  3U9Z A;  4JLH A;  2ASM A;  2VGN A;  2YCH A;  1VQ8 N;  3OYK A;  4FLU A;  3EE8 A;  1WOQ A;  1ESV A;  2QWP A;  4CHY A;  3S9H A;  3CJ7 A;  5J2P A;  5JVG L;  1XQS C;  1GLE G;  2UUC K;  4OLB A;  1UOC A;  5T7B A;  1BUP A;  3O9T A;  1CLQ A;  4LF4 K;  5D3G A;  1X9M A;  3OYL A;  4DUZ K;  4ILJ A;  3K5L A;  4FWL A;  1WSH A;  4DV1 K;  3FE1 A;  1S1U A;  4E7H A;  4AHT A;  1IKW A;  3C6T A;  2P51 A;  2QWM A;  4DFK A;  3VES A;  3F5T A;  4KHQ A;  1XC3 A;  5JS2 A;  1X1P A;  2ATQ A;  1V4T A;  3NF6 A;  3EZW A;  3OYC A;  4NB4 A;  1KVC A;  2D0C A;  2KW4 A;  4IEI A;  4FYD A;  4KH6 A;  1JLF A;  1RFQ A;  2E6M A;  4AHR A;  3CIP A;  4GV6 A;  3DOK A;  3MN7 A;  1BHL A;  4OPA A;  1WUA A;  2KLA A;  3THY B;  3VQC A;  4M3T A;  3HOS A;  5H1S Q;  2VG6 A;  3V4I A;  1UWB A;  5HRS A;  2FSK A;  5SZT A;  1TYQ B;  4QS9 A;  3HK2 A;  3NBP A;  4C1N K;  1IH7 A;  3UKU A;  1NJZ A;  4O5F A;  4FJ7 A;  3OVN A;  3VQQ A;  2KFZ A;  3EO3 A;  3QIO A;  4FZZ A;  3O1B A;  3V6D A;  4CK2 A;  3AVJ A;  2VCP A;  3S3M A;  1S6Q A;  5AQI A;  5C24 A;  1HNI A;  4AM7 A;  3EY1 A;  4DS5 A;  3KLI A;  3CJ9 A;  2I7P A;  3WNF A;  4MDA A;  3C94 A;  4LSL A;  1VSD A;  2GX9 A;  2Q3S A;  2B4J A;  4C8N A;  4BRC A;  1R0A A;  1LCU A;  3VPZ A;  4B1U B;  1HLU A;  3M8P A;  5E41 A;  1RBT A;  4FJ5 A;  5EX5 A;  3OS1 A;  4Z0U A;  4AHC A;  3MEE A;  3G6E N;  3W3D A;  4DSF A;  3M3Z A;  5C12 A;  1WSE A;  1S1X A;  4AHS A;  1X3M A;  2HBM A;  1IBK K;  4NYF A;  1H1V A;  3D2E A;  3ZCM A;  2DTU A;  2OYQ A;  3CER A;  4F8R A;  5AQM A;  4BDP A;  1BIZ A;  1QHT A;  1WBB A;  4IKF A;  4CEB A;  4EFH A;  1YTU A;  1HKB A;  3HXM A;  1UA1 A;  3SV4 A;  2G8I A;  1TAU A;  5ELZ A;  1YXQ A;  4GV9 A;  3DAW A;  3ENH A;  4DB3 A;  2P9U A;  1U49 A;  3ZSO A;  4M3R A;  4PHT X;  1NJI O;  4CEF A;  3H08 A;  2NRR A;  1J53 A;  2HBK A;  4LH5 A;  1KAX A;  4CGJ A;  2QK9 A;  4DFP A;  3CYM A;  1I94 K;  3BZK A;  2ZF5 O;  4N47 A;  3VMF B;  3MK6 A;  4JD2 A;  4H5R A;  4CZE A;  3KKR A;  4E19 A;  3Q7C A;  5AQQ A;  4DF4 A;  3RWU A;  3VQ6 A;  1KAZ A;  3SJH A;  1VAZ A;  2E5L K;  3CFO A;  5MLC Q;  1T8E A;  4IDH A;  4DU1 A;  4FK0 A;  2ZGZ A;  3CCS N;  4IEE A;  1DT9 A;  5LJW A;  1W0H A;  1TVR A;  3LZJ A;  3BP8 A;  3CCE N;  1MA9 B;  1RDD A;  1C0G A;  1K8K A;  4BG9 A;  2P9N B;  4FJG A;  3V9S A;  3WNH A;  1REV A;  4NXN K;  1SZ2 A;  4M3W A;  4CEC A;  4DR6 K;  3PX6 A;  3CME N;  4WQ5 C;  2ITG A;  2Q1N A;  1ZXO A;  1M1K O;  1XUP O;  1QZ5 A;  3J8A A;  3FGU A;  3CCQ N;  3OBW A;  2WBN A;  3T7Z A;  3OW2 M;  5JLF A;  2P9L B;  2WC9 A;  1YJN N;  4WFN L;  3AVB A;  3VTH A;  5BN8 A;  3U3G A;  3RR7 A;  4LF6 K;  3GG4 A;  3L2W A;  1O1W A;  2P9K B;  2HNZ A;  3EE9 A;  1RGI A;  3SPY A;  2B5J A;  3NFA A;  1X9W A;  1RT6 A;  3E66 A;  3NGZ A;  2FLO A;  5KPT A;  4EP5 A;  4LC9 B;  4X66 K;  1ILY A;  4FVU A;  3ZSY A;  4BRO A;  1Q82 O;  2A41 A;  4WCE L;  3WNG A;  4NCA A;  3ZEU A;  2CH6 A;  3PLA A;  3TAN A;  4H5V A;  3THY A;  2DFH A;  2AP1 A;  5JMV A;  2A6A A;  4FWS A;  4Z4F A;  1I39 A;  3UE5 A;  3IRX A;  4CI6 A;  3PIP L;  3OYN A;  3IMX A;  4CJ3 A;  5IWA K;  1SUQ A;  2VWJ A;  4J2A A;  3PO4 A;  5ADX A;  4B9M A;  4DV3 K;  4KHU A;  3BF3 A;  2Y1J A;  1TKX A;  2E2P A;  4IDK A;  3DLK A;  4EZ6 A;  3CI5 A;  4FPB A;  3P38 A;  3MN5 A;  2QWN A;  5HOO A;  4H8K A;  4FJK A;  2GBZ A;  1VSE A;  3PSF A;  4CZK A;  2W42 A;  1NNE A;  3QLH A;  2JGU A;  3ATV A;  4HCB A;  5CYQ A;  4DTO A;  5BR8 K;  2E20 A;  3TU5 A;  3U4L A;  1KTQ A;  3DXM A;  2G8U A;  2GWK A;  1NOZ A;  1GOA A;  3C7N B;  2B6A A;  1IG9 A;  1HKC A;  3CCR N;  4A62 A;  3NH2 A;  3KWI A;  2HHQ A;  3FZM A;  3VA0 A;  4WQ4 C;  1Q9Y A;  1RDU A;  1NKE A;  1JCE A;  3FLC O;  4DLG A;  1VQM N;  3ID8 A;  4Y1D A;  4WF9 L;  1NBW A;  1OKJ A;  4K8Z A;  4B9N A;  3D0P A;  3U6F A;  1QS4 A;  3ENB A;  3T69 A;  1LV5 A;  2G8W A;  3ZSQ A;  3EL2 A;  1BA1 A;  1U2V A;  4DR5 K;  1VQ4 N;  4EZ9 A;  1BI4 A;  3H6E A;  2HBL A;  3I56 N;  4ID1 A;  1XMO K;  1Z6R A;  2NRV A;  4FWQ A;  3HO1 A;  4WYB A;  4DR2 K;  2VQE K;  2Q97 A;  4DQ8 A;  4Z4I A;  4CJK A;  5I9E B;  4JKE A;  1S1W A;  5AZJ B;  2QWQ A;  4Z94 A;  2G8V A;  1O13 A;  1B9F A;  4FSV A;  1P90 A;  1S9G A;  4FJL A;  2OCE A;  3VF6 A;  3K57 A;  2NLX A;  4DQR A;  1OH5 A;  2HF3 A;  2GTD A;  3MCA B;  4Z4C A;  4YNQ A;  4C8M A;  1L3S A;  4HUE A;  1OVQ A;  3FFI A;  4ID5 A;  5GIN A;  3T19 A;  3WT0 A;  5BPN A;  4B3M K;  2HBJ A;  4CW7 B;  4I2P A;  4L8R B;  2P5O A;  4BGA A;  3ATU A;  1X9J A;  3O9U A;  3VQ9 A;  4M63 C;  4FJN A;  1NOY A;  4H4O A;  1HPZ A;  4ILG B;  4CJS A;  4LF5 K;  2FBV A;  1U45 A;  4CK3 A;  3CJ1 A;  3D2F B;  3QEV A;  2ZQB A;  4CGF A;  3IKM A;  5F2R A;  3HVR A;  1QTM A;  4M41 A;  1IO2 A;  1LWE A;  3CJC A;  4FWO A;  2XHB A;  1CZA N;  2OAN A;  4K25 A;  4CZG A;  3TAM A;  5C25 A;  3HL8 A;  3SUN A;  4CD3 A;  1L3T A;  2E8A A;  1RTH A;  1TK5 A;  4BG8 A;  3SAF A;  1BQM A;  4RG8 A;  1LAW A;  1TKT A;  1VQL N;  3QNN A;  1NK7 A;  3O4W A;  2Z1G A;  5FDL A;  4DHY A;  3O3G A;  2IVP A;  1L3U A;  3SMS A;  1HQE A;  1EQY A;  2V7Y A;  1YHQ N;  2RKI A;  1KRP A;  4RW6 A;  3PX4 A;  4FJ8 A;  4GKJ K;  3LAK A;  3AGR A;  4H0T B;  3TAR A;  1KD1 O;  4A2A A;  2F8T A;  4IO9 L;  3TTF A;  4CZJ A;  4JKD A;  2GUI A;  2OA8 A;  3SLC A;  1Z05 A;  3O9Q A;  5E26 A;  1HQU A;  3HYF A;  2WFB A;  3ZET A;  2E1Y A;  4CZL A;  4KV8 A;  4B9Q A;  3O1W A;  1XC9 A;  1EP4 A;  4AM6 A;  1KSP A;  1OH6 A;  5KGX A;  3QET A;  1D9D A;  1RCH A;  2O4G A;  4DR3 K;  4FWR A;  5EXW A;  5EY4 A;  2QA4 N;  4JNE A;  4DTP A;  4H03 B;  1T03 A;  1ZC6 A;  3RMC A;  4B1Y B;  4CIF A;  2Z1J A;  2F96 A;  4BC5 A;  1GLJ O;  4B1V A;  2IC3 A;  2UYT A;  3Q7B A;  2NUB A;  2HHS A;  2A1S A;  4N41 A;  2PBD A;  4CHO A;  1NKC A;  1SL2 A;  1KVA A;  5CY4 A;  3TAP A;  5BR9 A;  3VGK A;  4CJT A;  3ZSW A;  1NGD A;  2D5R A;  5M1N A;  1GOC A;  5HRP A;  4KFB A;  1YI2 N;  2Z1I A;  3CPE A;  3B8A X;  1BCM A;  5B8H A;  3SZ2 A;  1HYZ A;  3E1Y A;  2P9S B;  1T6D A;  4E7J A;  2Q0R A;  3QBW A;  4QOZ B;  2O8C B;  3SUO A;  2FC0 A;  1WSJ A;  2UXB K;  4H4M A;  1Q86 O;  3MX2 A;  4F2S A;  5FRO A;  1HRH A;  3S41 A;  5AQN A;  4KBO A;  1CXU A;  2VG7 A;  3LAL A;  4JI2 K;  1LWC A;  3TAF A;  2O8E A;  4FLW A;  3QIN A;  1DTQ A;  4K0K K;  1ITG A;  2X74 A;  1K73 O;  1NK4 A;  4YDU C;  3HM8 A;  3ZSZ A;  1VRU A;  4OPK A;  4MQ3 A;  3C0B A;  3M5R A;  2QKB A;  2OPS A;  3NGY A;  2OZS A;  1C0T A;  5GAG P;  3VOV A;  3H3N O;  1JLA A;  3QBX A;  3ISN C;  5AQT A;  2KFN A;  4EP4 A;  4QAG A;  3VGL A;  4B08 A;  5BN9 A;  3EKU A;  4JK9 A;  4BQL A;  1MWK A;  4YOW A;  3KLE A;  2CGJ A;  2VQF K;  1RTI A;  5DMR A;  4JI3 K;  3F73 A;  3K2P A;  5KRT A;  1TV6 A;  5HBM A;  4IJN A;  2Q31 A;  1K8K B;  5AQK A;  4LY7 A;  3MCP A;  2PYL A;  3LDO A;  4DV6 K;  1K9M O;  4KTZ A;  1NJY A;  4CJU A;  4MO4 A;  4PL7 A;  5FRM A;  2QI2 A;  2VG5 A;  4CVN E;  2FBY A;  5FPN A;  3IS9 A;  3WXK A;  5CHI A;  2G8H A;  5HRR A;  3O3F A;  1NGC A;  4J8F A;  4DR7 K;  4IWV A;  3KJV A;  3E9O A;  4YOR A;  2XY6 A;  3U3Y A;  3L2V A;  1FK9 A;  4LF9 K;  5I42 A;  3VEO A;  1JL2 A;  4QS7 A;  5J2N A;  1BU6 O;  5E84 A;  4DSK A;  1Q7Y O;  1W9H A;  4CJE A;  2O8D B;  4FW1 A;  4BR2 A;  4CGH A;  4FWN A;  2YHB A;  3M8Q A;  5BPM A;  4BRA A;  3V9U A;  1T05 A;  4AH9 A;  4O44 A;  4BRD A;  4F3T A;  1HNZ K;  1JL1 A;  2P9P A;  4LSN A;  5FRN A;  4DV4 K;  3LDQ A;  3DXK A;  5J2M A;  3OS0 A;  2FSN A;  1ZYQ A;  5BRF A;  3SAG A;  4FJI A;  5C2D A;  2WTU A;  1QSY A;  2P9I A;  3V81 A;  5AQL A;  3VF4 A;  2ASP A;  1XNQ K;  1X9S A;  1N36 K;  3ZYY X;  1TGO A;  1R59 O;  3MXM A;  2IAJ A;  5FPM A;  4DCH A;  1VSH A;  4CER A;  4IJA A;  3OYJ A;  1I3A A;  3G0Z A;  4BRG A;  1Z25 A;  4H0X B;  3SPZ A;  1JCG A;  4UY8 O;  1EKE A;  4B9V A;  4JI0 K;  5AFU A;  2E2O A;  3HPO A;  2ZJR L;  5CR4 A;  3AAR A;  5AQH A;  3SCX A;  4JHD A;  4E3S A;  4WQ4 A;  1RDA A;  4GW6 A;  1VSJ A;  3NDK A;  3OA9 A;  2P9S A;  2KZM A;  4MO5 A;  4HCC A;  4HWI A;  4O0J A;  4KI4 A;  4OVL A;  3CC4 N;  4CFC A;  3T1H K;  1S9E A;  1U2V B;  4HTU A;  2G8K A;  2VYP A;  4ILH A;  3WXI A;  4MFB A;  1IV0 A;  3M1F A;  3TAQ A;  4JD2 B;  4KHP K;  4CF0 A;  4CBX A;  5HRN A;  2CH5 A;  4C8O A;  2Y1I A;  1VHX A;  5KI6 A;  3AVK A;  2OTJ N;  1K8A O;  1HMV A;  4M3Y A;  3AAP A;  4JKC A;  3A5O C;  2YI1 A;  3LM2 A;  1JLC A;  1DGK N;  4CZH A;  1HNX K;  4H0O A;  4GY2 B;  2I7N A;  4ZTJ A;  3SI6 A;  3HI0 A;  1J9A A;  4ICL A;  1QQO A;  4CED A;  3H1Q A;  4JKB A;  1EO1 A;  5BRD A;  1MWM A;  3LP2 A;  1YJW N;  2XY8 A;  4KTW A;  4B1X B;  1NK8 A;  5AQP A;  1NGI A;  1B92 A;  1BG3 A;  5C10 A;  3AVH A;  3V9X A;  4CF9 A;  1ATN A;  4DTX A;  4DTU A;  1EXQ A;  3BEX A;  2OZM A;  4F2R A;  1WAJ A;  1YF5 L;  2EHG A;  4JKH A;  3MAQ A;  2YHX A;  3F9M A;  1OH8 A;  2EX3 A;  1A5V A;  4DWI A;  4DFJ A;  3I55 N;  2UU9 K;  2HNY A;  3KK7 A;  2FBX A;  2UXC K;  3L4Q A;  4KH5 A;  2VWB A;  4XIU A;  3VEN A;  1TL1 A;  1YT3 A;  2P9K A;  3AVL A;  4JKA A;  4LFC K;  2GEL A;  4JI4 K;  4FJX A;  5AQX A;  1MU2 A;  3HPH A;  1WLJ A;  4CJL A;  1Y97 A;  4R79 A;  1W7A A;  2YHW A;  3AA5 X;  4M7Y A;  1OVY A;  2F7T A;  3IDH A;  4DTR A;  4CFB A;  3A8Y A;  2NRX A;  4BRI A;  3NF7 A;  4E7I A;  2AJQ A;  5FLX O;  4FLT A;  2E88 A;  1QQC A;  3KVG A;  3O6W A;  3DOL A;  3AVI A;  4FO0 A;  4BDZ A;  3MWT A;  1HR0 K;  1N5Y A;  3FR0 A;  5DK5 A;  3CHW A;  1E3M A;  2NRT A;  4K42 A;  2IDO A;  2Q2R A;  2QM1 A;  4JYA K;  4E0D A;  4BDY A;  3KTQ A;  3VQB A;  2P9P B;  1LAV A;  3KK1 A;  3WQT A;  4OJR A;  3AO5 A;  1G99 A;  1JLB A;  1FJG K;  4DR1 K;  3SNN A;  3OJS A;  3ULE B;  4CIE A;  2NZT A;  3D7E O;  3WQU A;  4KI6 A;  5JLH A;  4YOT A;  3OYG A;  2IVN A;  4M3Z A;  4IXC A;  4CEE A;  4CJ4 A;  1NGB A;  2P9I B;  2E6L A;  5A2Q O;  3ZEU B;  3LWL A;  5LMN K;  4DSL A;  4M3X A;  3TI0 A;  3U9D A;  4H0Y B;  3F9K A;  4Z4G A;  3SQ4 A;  3VQ4 A;  4AHV A;  2E2N A;  3JYT A;  1N8R O;  2HHU A;  1LOT B;  3RRH A;  3KD1 E;  3PX0 A;  2RE2 A;  1VQP N;  4A5B A;  3RMD A;  4BRM A;  3HP9 A;  4B8A B;  5AQV A;  2XO7 A;  4EAH D;  1RBU A;  4CHZ A;  3AVC A;  1NJX A;  3SUQ A;  4A2B A;  1U47 A;  4KH4 A;  4O5B A;  2HMP A;  5JIC A;  5KPZ A;  3QO9 A;  1HUX A;  3C6H A;  3JSM A;  5LY3 A;  2O8F B;  4BRH A;  1BI4 B;  3CD6 N;  2BUP A;  4YDU A;  1J5E K;  2X78 A;  1VQO N;  2P9N A;  4B8C A;  1RBV A;  4GV3 A;  3DWL A;  3C7N A;  2Q36 A;  5AZJ A;  4MLE A;  4LFA K;  3LZI A;  4YOY A;  1NK0 A;  2Z1H A;  1HYS A;  1NMN A;  3W0L A;  4JI5 K;  4JI8 K;  3V9Z A;  1HNV A;  4C23 A;  2YNI A;  4CBW A;  4FM1 A;  4OLA A;  1IJJ A;  1RBS A;  3HM9 A;  1N6Q A;  1VSK A;  4CES A;  3J80 O;  3VEZ A;  4BC3 A;  1U6Z A;  4JEP A;  4CJ7 A;  1WB9 A;  4GKK K;  4PQU A;  1RDW X;  1HPM A;  4QS8 A;  5C15 A;  4FLV A;  4FVM A;  1BDG A;  2OTL N;  3ITH A;  4ZTF A;  4OX9 K;  4BE2 A;  2V52 B;  3AV9 A;  4RW7 A;  1S1T A;  4F9O A;  3V9W A;  1GLD G;  3GOI A;  1LW0 A;  2VGM A;  5BPL A;  4BWM A;  4CEO A;  3A5N C;  3PSI A;  3MX5 A;  3CCJ N;  4U7B A;  3EZ5 A;  4B1Z A;  4Q0B A;  1ASV A;  1NU0 A;  4BR7 A;  4CE9 A;  3CMA N;  1VK0 A;  2UXD K;  1RT2 A;  2FXU A;  3E9L A;  1D9F A;  3N4P A;  3HRG A;  4L3Q A;  4FM2 A;  4CJ5 A;  2O8B A;  1A5X A;  4DR4 K;  4ZHR A;  3OS2 A;  4BVO A;  4G9Z A;  5AZI B;  3THW A;  3C95 A;  1V4S A;  3U8X A;  1RDB A;  3L8B A;  4BRF A;  3FFK B;  3TAE A;  3ZLJ A;  1KAY A;  3SYZ A;  3DYA A;  3VEW A;  2QW9 A;  3CF5 L;  3UKR B;  2V51 B;  3O4N A;  3O9R A;  2W6K A;  1YVN A;  2DFF A;  3L6Q A;  3VQA A;  2KTQ A;  3DRP A;  2PAV A;  4W5O A;  3OYA A;  3L4I A;  2RN2 A;  4IOC L;  3R3L A;  5GIP A;  1XHX A;  1E4G T;  3QER A;  2BDP A;  3NE6 A;  2PYJ A;  3UKR A;  1GLA G;  3NH0 A;  4CJP A;  3LDS A;  3AY9 A;  3A0I X;  4BVP A;  4E1J A;  1RT1 A;  1XI1 A;  1RTD A;  2YHA A;  4FOE A;  3P5J A;  3ZX2 A;  1IKY A;  4H5W A;  1KVB A;  3CFP A;  3OBY A;  1CZ9 A;  3G71 N;  2X6S A;  5KRS A;  2ITM A;  4CIG A;  4OKK A;  3NHG A;  4X62 K;  3E9P A;  4JV5 K;  3KHY A;  2O8E B;  3DLG A;  4JI6 K;  4B9S A;  3O4Q A;  1EWR A;  1NK9 A;  2A5X A;  3D6R A;  3NF8 A;  4OPJ A;  4CZI A;  3M8S A;  4QCL A;  3VEV A;  3KLG A;  5BRH A;  2BE2 A;  1BQN A;  4OO1 J;  4DV7 K;  4YOX A;  3K5N A;  3WEE B;  3ZSV A;  1SKS A;  2JLE A;  4MLH A;  1JXE A;  1NGH A;  3AVA A;  5HP1 A;  4CF2 A;  1W2B M;  2F9W A;  1VQ9 N;  2KZZ A;  4R5P A;  3THV A;  1KLN A;  2W41 A;  2FBT A;  1SL0 A;  5DM7 L;  2O8F A;  3R8E A;  1XWL A;  1WN7 A;  4XH4 A;  3THX B;  2A1R A;  5AQF A;  3KIO A;  4BQZ A;  1HJR A;  1D5A A;  1HNW K;  4FW2 A;  3D2F A;  3S3N A;  3AA4 A;  5AQG A;  3WUH A;  4DS4 A;  2D0P A;  3RSE A;  3I8B A;  3LM9 A;  1IG8 A;  3H1V X;  4RTF D;  4DQP A;  4ISF A;  4CJR A;  5AQS A;  3CQ8 A;  3IG1 A;  4RW4 A;  3L0Q A;  1QSS A;  4XH5 A;  3QEI A;  1ATR A;  5GIO A;  1NKB A;  1YIT N;  3MED A;  5SWM A;  3QFP A;  3PUF A;  4FCY A;  2P5G A;  4CCH A;  4BRQ A;  1TUU A;  4I2Q A;  3T1A A;  2AA4 A;  3H45 C;  2XRI A;  3T3F A;  5HLF A;  2OPQ A;  3VEX A;  4H5N A;  5AFU H;  3LP1 A;  4FLY A;  4YOU A;  4DTS A;  3QB0 A;  4FXD A;  3CET A;  3P83 D;  5M1Q A;  4J2B A;  4OPH A;  1C0F A;  3T1Y K;  2E4L A;  4CJW A;  4WQ5 A;  4FJJ A;  2O8D A;  4IBN A;  3P1G A;  3P4I A;  4CEA A;  3WXL A;  3AO2 A;  3KD5 E;  3IUC A;  4FK4 A;  3QEX A;  5CE3 A;  2IIR A;  3VER A;  2D4W A;  1EWQ A;  3ZT3 A;  4IO8 A;  2QXF A;  4NLB A;  2GEM A;  4FK2 A;  3OYI A;  4CF8 A;  2A40 A;  4B3O A;  1FW6 A;  1BO5 O;  1VQ5 N;  3NMU A;  1VQ6 N;  4CEZ A;  3KLF A;  2YKN A;  1ZBH A;  3ALY A;  4A59 A;  3VA3 A;  4CBU A;  4M3U A;  3L3U A;  5AQO A;  3DXK B;  4B9L A;  3TTC A;  4IFY A;  3CCM N;  4LF7 K;  1NJW A;  1ZBF A;  4O8K A;  3QNO A;  2WUS A;  4JS4 A;  5JVH L;  3ZET B;  3V1O A;  3VTI A;  1KQS M;  3QES A;  3SV3 A;  4E1N A;  1G15 A;  3UB5 A;  1VQ7 N;  4FPA A;  3KKS A;  3FZL A;  3DI6 A;  4A57 A;  5F0X A;  1SKW A;  1NMD A;  2ZJP L;  4DTN A;  5KPR A;  3WXJ A;  4ISG A;  1DKG D;  4DMN A;  5C0Y A;  3O8M A;  3M8R A;  4G1Q A;  5CZ1 A;  2E1Z A;  4KB0 A;  5AQU A;  2ZE2 A;  2HHT A;  3RMB A;  3O5B A;  1GLB G;  3TSP A;  2BAN A;  2GWJ A;  5KQD A;  1BIU A;  1NK6 A;  2P9U B;  4DTJ A;  3DRR A;  2BH1 A;  3WXM B;  3K59 A;  2RHK A;  4JKF A;  2WON A;  2YHY A;  4A61 A;  1ZBU A;  1S5J A;  1TK0 A;  3L3V A;  3TPQ A;  1C1A A;  1NGG A;  4BR0 A;  3DMJ A;  3WEE A;  4E89 A;  4I9Q A;  2RPI A;  3GDQ A; 
#chains in the Genus database with same CATH homology
 4CFB A;  3OYF A;  1SV5 A;  2ETJ A;  3ZSQ A;  3OYD A;  3RTV A;  4PUO A;  4DQS A;  3NF7 A;  2PZS A;  4EZ9 A;  1BI4 A;  1U4B A;  4E7I A;  3ASM A;  2AJQ A;  4ID1 A;  4W5R A;  2OPP A;  4FLT A;  1RT4 A;  1QQC A;  3CG7 A;  3OYB A;  3DOL A;  3AVI A;  4N56 A;  3NCI A;  3HO1 A;  4CGG A;  4J2D A;  4BDZ A;  4M42 A;  3OYM A;  4Z4I A;  4CJK A;  1VSL A;  1EET A;  1N5Y A;  1IKX A;  4IFV A;  1S1W A;  1QSL A;  2HVH A;  4DQI A;  4FJH A;  3MEC A;  5DK5 A;  2G8V A;  4W5N A;  2IDO A;  1B9F A;  2IS3 A;  3CFR A;  1C0M A;  4BE0 A;  4E0D A;  1S9G A;  4KAZ A;  4BDY A;  4IG0 A;  4FJL A;  4K8X A;  3KTQ A;  3QEW A;  4AHU A;  3VQB A;  4KKO A;  4Q5V A;  1LAV A;  1VRT A;  3KK1 A;  3K57 A;  4DQR A;  3NF9 A;  4OJR A;  4DSI A;  3AO5 A;  3ZT1 A;  2DFE A;  3IAY A;  1JLB A;  2F8S A;  4Z4C A;  4YNQ A;  3SNN A;  3DLB A;  4C8M A;  3OJS A;  1WNS A;  1L3S A;  4HUE A;  4CIE A;  3FFI A;  1WSI A;  4KI6 A;  4ID5 A;  4JRQ A;  1LWF A;  3T19 A;  1BGX T;  3OYG A;  1QE1 A;  1ZBI A;  3HVT A;  4M3Z A;  5K14 A;  4CEE A;  4CJ4 A;  3OY9 A;  3RR8 A;  4I2P A;  4L8R B;  4ELT A;  2P5O A;  4KTQ A;  2HW3 A;  2HHX A;  2E6L A;  3VQP A;  3LWL A;  3ZT4 A;  1KLM A;  1YVU A;  3VQ9 A;  2G8F A;  4FJN A;  3S3O A;  1XHZ A;  1KCF A;  1NOY A;  4H4O A;  1HPZ A;  4DSL A;  4F4K A;  4M3X A;  4W5T A;  4FJ9 A;  3TI0 A;  4KO0 A;  3A2F A;  2OPR A;  4CJS A;  3SQ1 A;  2FBV A;  1U45 A;  3F9K A;  4CK3 A;  4Z4G A;  4LD0 A;  3QEV A;  3SQ4 A;  2ZQB A;  3VQ4 A;  4CGF A;  2HND A;  1RBR A;  4AHV A;  3JYT A;  4I9L A;  4ELU A;  2YKM A;  4HVJ A;  5JS1 A;  1RT7 A;  2HHU A;  3RRH A;  5HRO A;  1WSF A;  3KD1 E;  3PX0 A;  3SJJ A;  3HVR A;  1T7P A;  3SUP A;  1QTM A;  4M41 A;  3RMD A;  1IO2 A;  1LWE A;  4CGD A;  3HP9 A;  1RDC A;  3HST B;  4B8A B;  2XHB A;  2XO7 A;  3TAM A;  5C25 A;  3HL8 A;  3NH1 A;  3SUN A;  4KPY A;  3ZSR A;  1S1V A;  4BAC A;  1L3T A;  1RTH A;  2P1J A;  1RBU A;  4CHZ A;  3AVC A;  1TK5 A;  4N5S A;  1NJX A;  3SUQ A;  4BE1 A;  1ZBL A;  1U47 A;  4O5B A;  1BQM A;  4RG8 A;  1LAW A;  1TKT A;  3RRG A;  3QO9 A;  3QNN A;  1D8Y A;  1NK7 A;  3JSM A;  3LP0 A;  2Z1G A;  1CXQ A;  1BI4 B;  5FDL A;  2HHV A;  1GOB A;  3O3G A;  2XY5 A;  1U04 A;  4B9T A;  3MXI A;  1L3U A;  3AA2 A;  1HQE A;  1JKH A;  1HYV A;  4RW8 A;  5CYM A;  2X78 A;  3AO4 A;  4JRP A;  4CJQ A;  3KK2 A;  2RKI A;  3LPU A;  4B8C A;  1RBV A;  1KRP A;  4RW6 A;  3PX4 A;  3AO1 A;  4FJ8 A;  3LAK A;  3O3H A;  4OKE A;  4FM0 A;  2I5J A;  1L5U A;  3TAR A;  4TSX A;  3TR8 A;  3LZI A;  1NK0 A;  2F8T A;  1EX4 A;  2YNG A;  2Z1H A;  4CHN A;  2OA8 A;  2GUI A;  3KK3 A;  4JS5 A;  1HYS A;  1S6P A;  1DTT A;  3AA3 A;  4CFA A;  3VQ7 A;  1RT3 A;  1HQU A;  2GV9 A;  3BDP A;  3HYF A;  1CZB A;  3V9Z A;  1HNV A;  4CK1 A;  3UIQ A;  4KV8 A;  4FZY A;  1C0U A;  2HMI A;  2YNI A;  4OKJ A;  4FM1 A;  2VWK A;  4DU4 A;  4GMJ B;  2YV0 X;  1SL1 A;  4OLA A;  1DLO A;  4CGI A;  1XC9 A;  1EP4 A;  1RBS A;  3HM9 A;  1JLQ A;  1VSK A;  4CES A;  1N6Q A;  3EYZ A;  4Y1C A;  1KSP A;  4UQG A;  5KGX A;  3QET A;  3QEP A;  1D9D A;  1RCH A;  3CM5 A;  2O4G A;  3PY8 A;  3VQD A;  3L2Q A;  4PQU A;  4GVM A;  4JLH A;  4FLV A;  4DTP A;  1Q9X A;  1ASU A;  3G10 A;  4FVM A;  1K6Y A;  1T03 A;  3RMC A;  3OYK A;  4FLU A;  3ITH A;  3QIP A;  4CIF A;  2Z1J A;  4CHY A;  4ZTF A;  4RW9 A;  4BE2 A;  3S9H A;  2F96 A;  4E7K A;  3AV9 A;  4E7L A;  5J2P A;  4RW7 A;  1S1T A;  4C8K A;  3V9W A;  4OLB A;  2X6N A;  1LW0 A;  1UOC A;  5T7B A;  2IC3 A;  1CLQ A;  4BWM A;  4CEO A;  2NUB A;  2HHS A;  2A1S A;  4N41 A;  1LW2 A;  4CHO A;  1X9M A;  1NKC A;  3OYL A;  1SL2 A;  5D3G A;  1KVA A;  5CY4 A;  3EZ5 A;  3K5L A;  3TAP A;  4N76 A;  4CJT A;  1ASV A;  1WSH A;  4Q0B A;  4CE9 A;  3ZSW A;  1S1U A;  4E7H A;  4AHT A;  1IKW A;  3C6T A;  1VK0 A;  4LH4 A;  5KTQ A;  2P51 A;  2D5R A;  1RT2 A;  1GOC A;  5HRP A;  4KFB A;  4DFK A;  2Z1I A;  1D9F A;  1BCM A;  4KHY A;  1TL3 A;  4FM2 A;  4CJ5 A;  3SZ2 A;  4KHQ A;  1A5X A;  1HYZ A;  4E7J A;  4ZHR A;  3OS2 A;  2BGG A;  4QOZ B;  4C8L A;  5JS2 A;  3SUO A;  2FC0 A;  1WSJ A;  1X1P A;  2ATQ A;  3C95 A;  1IKV A;  4H4M A;  5I3U A;  4F2S A;  1RDB A;  5FRO A;  1HRH A;  3L8B A;  3MEG A;  3NF6 A;  1CXU A;  3TAE A;  2VG7 A;  4OGC A;  4J2E A;  3OYC A;  3LAL A;  3MXJ A;  1KVC A;  1LWC A;  3SYZ A;  3TAF A;  4KRE A;  2D0C A;  3DYA A;  3ZT0 A;  4FLW A;  1C1C A;  3QIN A;  2KW4 A;  5CZ2 A;  1DTQ A;  4FYD A;  1VSF A;  1ITG A;  2X74 A;  4DSJ A;  3KLH A;  3B6P A;  4AIL C;  3C6U A;  1JLF A;  3O4N A;  2E6M A;  4AHR A;  1NK4 A;  3DLH A;  3TAG A;  1U48 A;  3K5M A;  1VRU A;  3DOK A;  4NCG A;  3ZSZ A;  1BHL A;  4DF8 A;  2QKK A;  2DFF A;  4Z4H A;  4OPK A;  4MQ3 A;  3VQA A;  4KHS A;  2DY4 A;  3VQC A;  4M3T A;  2QKB A;  1RTJ A;  2KTQ A;  2OPS A;  3DRP A;  3NGY A;  2VG6 A;  1UAX A;  4HUG A;  3V4I A;  4W5O A;  3OYA A;  1UWB A;  1C0T A;  4IG3 A;  2RN2 A;  5HRS A;  2OZS A;  5SZT A;  3HK2 A;  1JLA A;  3OJU A;  1XHX A;  3ISN C;  3NBP A;  5J2Q A;  3QER A;  1IH7 A;  1J5O A;  2BDP A;  2KFN A;  4EP4 A;  3NE6 A;  1NJZ A;  4QAG A;  4O4G A;  2PYJ A;  3NH0 A;  4FJ7 A;  3OVN A;  3VQQ A;  2KFZ A;  4KRF A;  3QIO A;  4CJP A;  3LDS A;  4FZZ A;  3AVM A;  4B08 A;  3V6D A;  3RMA A;  4CK2 A;  3AVJ A;  1RT1 A;  1XI1 A;  2LSN A;  3S3M A;  1RTD A;  2YHA A;  3VQ5 A;  1S6Q A;  3P5J A;  5EU7 A;  1HNI A;  5C24 A;  3VN5 A;  3EY1 A;  4DG1 A;  3V1R A;  3LWM A;  4DS5 A;  3KLI A;  3KLE A;  3WNF A;  1WSG A;  1IKY A;  2HHW A;  1RTI A;  5DMR A;  1KVB A;  3C94 A;  3F73 A;  2YNH A;  4LSL A;  3K2P A;  3CFP A;  4HUF A;  1VSD A;  3TWH A;  1L3V A;  1CZ9 A;  5KRT A;  2X6S A;  5KRS A;  3L2R A;  2Q3S A;  1TV6 A;  2B4J A;  5HBM A;  4C8N A;  3V1Q A;  4CIG A;  4OKK A;  3NHG A;  1R0A A;  4LY7 A;  3L2U A;  1F21 A;  3DLG A;  1B9D A;  2PYL A;  1KFS A;  3M8P A;  2KQ2 A;  5E41 A;  4B9S A;  1RBT A;  4KTZ A;  3OS1 A;  1NJY A;  4FJ5 A;  4Z0U A;  3O4Q A;  3AVF A;  4AHC A;  4CJU A;  4DQQ A;  4YFU A;  4DU3 A;  1NK9 A;  3MEE A;  4OGE A;  4FLZ A;  1SKR A;  3NF8 A;  4OPJ A;  3B6O A;  2RF2 A;  5FRM A;  4CHQ A;  3M8S A;  4DSF A;  4QCL A;  2VG5 A;  3BGR A;  4PA1 A;  1Z26 A;  4KHN A;  1WSE A;  4CF1 A;  3KLG A;  1S1X A;  1FKO A;  4AHS A;  2BE2 A;  2FBY A;  1BQN A;  3IS9 A;  4NYF A;  3K5N A;  2G8H A;  5HRR A;  4KB1 A;  3ZSV A;  3O3F A;  3AVG A;  3ZCM A;  1SKS A;  4ELV A;  1KFD A;  2JLE A;  2YNF A;  4CJF A;  2OYQ A;  1JXE A;  4F8R A;  4BDP A;  3AVA A;  2D0A A;  1TKZ A;  1BIZ A;  1QHT A;  2IGI A;  5HP1 A;  4CF2 A;  4IKF A;  1J54 A;  4CEB A;  1YTU A;  3KJV A;  1JLE A;  2KZZ A;  1RNH A;  2XY6 A;  3HXM A;  1UA1 A;  3SV4 A;  4R5P A;  3U3Y A;  2G8I A;  1TAU A;  4B9U A;  3L2V A;  1FK9 A;  3THV A;  5I42 A;  1RT5 A;  1JL2 A;  1KLN A;  5J2N A;  3DLR A;  2FBT A;  3DRS A;  1SL0 A;  1U49 A;  3ZSO A;  3OYE A;  4M3R A;  1XWL A;  4DSK A;  1WN7 A;  1A5W A;  4CEF A;  3H08 A;  1W9H A;  1J53 A;  4CJE A;  2A1R A;  3KIO A;  4LH5 A;  1HJR A;  4KHW A;  4FW1 A;  1D5A A;  4CGH A;  4CGJ A;  2QK9 A;  4FW2 A;  3ZT2 A;  4DFP A;  3CYM A;  2YHB A;  3M8Q A;  4E1M A;  3V9U A;  3AA4 A;  3PV8 A;  4N47 A;  3S3N A;  4AH9 A;  4O44 A;  1T05 A;  4DS4 A;  1BL3 A;  4F3T A;  1C6V A;  1JL1 A;  3TAB A;  3KKR A;  4E19 A;  4LSN A;  1VSI A;  4DF4 A;  5FRN A;  3RWU A;  3VQ6 A;  3LAM A;  3I0S A;  1FKP A;  5J2M A;  5J1E A;  3OS0 A;  4DQP A;  3CFO A;  1ZYQ A;  4CJR A;  1T8E A;  4FJI A;  1QSY A;  3CQ8 A;  3V81 A;  3IG1 A;  4RW4 A;  4DU1 A;  1X9S A;  1QSS A;  4FK0 A;  1W0H A;  1TGO A;  3DM2 A;  1TVR A;  3CM6 A;  3QEI A;  3MXM A;  1NKB A;  2IAJ A;  5KGW A;  3ZSX A;  3LZJ A;  1RDD A;  3MED A;  1VSH A;  5SWM A;  4CER A;  3LP3 A;  3PUF A;  3OYJ A;  4FCY A;  2P5G A;  4CCH A;  4FJG A;  3V9S A;  4I2Q A;  3WNH A;  1REV A;  3T1A A;  3PO5 A;  1I3A A;  2XRI A;  3T3F A;  3G0Z A;  1BIS A;  1Z25 A;  4BWJ A;  3SPZ A;  2OPQ A;  4CEC A;  5HLF A;  4M3W A;  3PX6 A;  1ASW A;  4FLY A;  4DTS A;  1EKE A;  3LP1 A;  4B9V A;  4FXD A;  2ITG A;  3HPO A;  3P83 D;  5C42 A;  4F3O A;  4J2B A;  2E4L A;  4CJW A;  3SCX A;  4FJJ A;  4IBN A;  3P1G A;  4E3S A;  4CEA A;  3DLE A;  3K58 A;  1RDA A;  4WE1 A;  3WNE A;  4GW6 A;  3SQ2 A;  1TKD A;  1VSJ A;  3AO2 A;  3NDK A;  3KD5 E;  4FK4 A;  3AVB A;  3QEX A;  2KZM A;  4CFD A;  1BCO A;  3AO3 A;  3U3G A;  1RIL A;  3RR7 A;  4HCC A;  3L2W A;  1O1W A;  4O0J A;  4KI4 A;  3I8D A;  3ZT3 A;  2D0B A;  4OVL A;  2HNZ A;  1JXB A;  2QXF A;  3SPY A;  2B5J A;  4FK2 A;  2DTU A;  3OYI A;  3NFA A;  1X9W A;  4CF8 A;  4B3O A;  4CFC A;  1RT6 A;  1C1B A;  3NGZ A;  1S9E A;  4HTU A;  4EP5 A;  1TAQ A;  2G8K A;  4CEZ A;  4MFB A;  3KLF A;  4DFM A;  2YKN A;  1ZBH A;  3ZSY A;  3K5O A;  3TAQ A;  4DSE A;  1Q8I A;  3ALY A;  4CF0 A;  5HRN A;  4C8O A;  4CHP A;  3NGI A;  3HPG A;  3WNG A;  2Y1I A;  1NK5 A;  4NCA A;  3VA3 A;  5KI6 A;  3AVK A;  3TAN A;  1FXX A;  4M3U A;  3L3U A;  2DFH A;  3HJF A;  1HMV A;  2R7Y A;  4M3Y A;  4B9L A;  4Z4E A;  4Z4F A;  4HHT A;  1I39 A;  4IFY A;  2IOC A;  3IRX A;  4DLE A;  1NJW A;  1ZBF A;  3OYN A;  3HT3 A;  1YTA A;  4FJM A;  4O55 A;  4CJ3 A;  3OYH A;  1SUQ A;  2VWJ A;  4J2A A;  4PY5 A;  3PO4 A;  4B9M A;  1JLC A;  3QNO A;  4KHU A;  4O0I A;  2Y1J A;  1TKX A;  4JS4 A;  3AVN A;  4ZTJ A;  3SI6 A;  2HVI A;  1J9A A;  4ICL A;  4CED A;  3V1O A;  4IDK A;  3DLK A;  4M45 A;  4EZ6 A;  3NAE A;  3LP2 A;  1JLG A;  2XY8 A;  4KTW A;  4H8K A;  3SV3 A;  4E1N A;  3QES A;  1G15 A;  1NK8 A;  4FJK A;  2GBZ A;  1B92 A;  3KKS A;  1VSE A;  1UA0 A;  2W42 A;  3AVH A;  3DI6 A;  4CF9 A;  3V9X A;  4DTX A;  4DTU A;  3QLH A;  1EXQ A;  2JGU A;  2OZM A;  1WAF A;  4F2R A;  4HCB A;  1SKW A;  5CYQ A;  1WAJ A;  2EHG A;  4DTN A;  1VSM A;  4DTO A;  4NCB A;  3E01 A;  3MAQ A;  4DMN A;  3M8R A;  4CEQ A;  2EX3 A;  3VQ8 A;  4FLX A;  1A5V A;  1KTQ A;  4I7F A;  4G1Q A;  5CZ1 A;  2HB5 A;  3LPT A;  4DWI A;  3I0R A;  2G8U A;  4DTM A;  4KB0 A;  2ZD1 A;  2ZE2 A;  4DFJ A;  1NOZ A;  2HNY A;  1GOA A;  2HHT A;  3RMB A;  1TK8 A;  2BAN A;  2B6A A;  1IG9 A;  3HP6 A;  2PY5 A;  1BIU A;  3SQ0 A;  2FBX A;  3NH2 A;  4DTJ A;  4NYN A;  1NK6 A;  4W5Q A;  2HHQ A;  3DRR A;  3K59 A;  3VA0 A;  4PWD A;  1Q9Y A;  2O4I A;  4XIU A;  1YT3 A;  1TL1 A;  2WON A;  3AVL A;  3ULD A;  2XY7 A;  1NKE A;  1ZBU A;  4CJV A;  4DLG A;  2WOM A;  1MU2 A;  3HPH A;  4FJX A;  1S5J A;  1WLJ A;  4Y1D A;  4CJL A;  1Y97 A;  1TK0 A;  4FZX C;  3L3V A;  4K8Z A;  4B9N A;  1C1A A;  3AA5 X;  3D0P A;  3U6F A;  1QS4 A;  3D45 A;  3DMJ A;  4E89 A;  1LV5 A;  4I9Q A;  3LAN A;  2G8W A;  2RPI A;  3VQE A;  4DTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...