4GWDA

Crystal structure of the mn2+2,zn2+-human arginase i-abh complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
313
structure length
313
Chain Sequence
b'SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Structure and function of non-native metal clusters in human arginase I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 113
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2012-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4gwdA00
4Q3VA 3M1RA 3SL0A 4RHIA 1TBLA 1ZPEA 2RLAA 3KV2A 4HZEA 4HWWA 3SKKA 2EF5A 1P8QA 4RHLA 3RLAA 5HJ9A 4ITYA 3THHA 4RHJA 4GSZA 1T4PA 4RLAA 3NIPA 3MMRA 1TBHA 2EF4A 3MJLA 5CEVA 4RHQA 4Q3RA 1HQGA 1P8OA 1D3VA 4IXVA 3NIOA 3CEVA 3E8ZA 4MYFA 3SL1A 2A0MA 1P8MA 3E9BA 1P8PA 3E6KA 1T4TA 4GSMA 4IE1A 4Q3UA 1P8SA 1PQ3A 3DJ8A 1HQFA 4G3HA 1GQ7A 4IU0A 1P8RA 3THJA 2PHOA 1P8NA 3F80A 4I06A 5HJAA 4Q41A 4Q40A 2AEBA 1WOHA 4RHMA 3TH7A 4GWDA 2CEVA 1T4RA 4IU1A 4IU4A 1T5GA 3TF3A 4MYKA 2EIVA 3GN0A 1CEVA 4Q3SA 1R1OA 4Q3TA 4RHKA 3E6VA 1T4SA 4MYLA 4GSVA 5RLAA 4IE2A 4DZ4A 1WVBA 1RLAA 2PHAA 3MFWA 4IXUA 1XFKA 4IU5A 4GWCA 1TBJA 1HQHA 4Q3RC 4MYNA 1WOIA 3PZLA 4Q3QA 4MXRA 4Q42A 3LP7A 3MFVA 4FCKA 1T5FA 4FCIA 1ZPGA 1TA1A 3NIQA 1GQ6A 2ZAVA 1WOGA 1HQ5A 1WVAA 4CEVA 3LP4A 1HQXA 2PLLA 4HXQA 4IE3A 3E8QA 3GMZA 3LHLA 4Q3PA 3SJTA 3THEA
chains in the Genus database with same CATH superfamily
5EFGA 5G0IA 4Q3VA 5THUA 3M1RA 5G1BA 5G11A 3SL0A 4RHIA 1TBLA 5D1CA 3MZ4A 3Q9FA 3EZTA 2VQJA 1ZPEA 1VKGA 2RLAA 3C0ZA 4RN1A 3KV2A 4HZEA 4RN0A 4HWWA 3SKKA 3MZ3A 2EF5A 1P8QA 4RHLA 5DC8A 3RLAA 5HJ9A 5G17A 2VQOA 4A69A 5FCWA 2VCGA 5EF7A 4BKXB 3EW8A 5EEIA 4ITYA 4QA5A 4ZUMA 3THHA 4RHJA 4GSZA 1T4PA 4RLAA 3NIPA 3MMRA 5EFNA 1TBHA 5G0YA 2EF4A 3MJLA 4ZUOA 4RHQA 3ZNRA 4Q3RA 5CEVA 1T69A 1HQGA 1P8OA 1D3VA 4IXVA 3NIOA 3CEVA 3E8ZA 4MYFA 3SL1A 2A0MA 4BZ8A 5DC6A 1P8MA 3E9BA 5EEMA 4BZ7A 1P8PA 3E6KA 5EEKA 1T4TA 5A2SA 2VQMA 4ZUQA 4GSMA 4IE1A 3F06A 4Q3UA 1P8SA 1PQ3A 3DJ8A 1HQFA 3C0YA 1GQ7A 4G3HA 5ICNB 4QA7A 5IWGA 4IU0A 5D1BA 1P8RA 3THJA 4CBTA 2PHOA 1P8NA 3F0RA 3F80A 4I06A 4BZ9A 4QA3A 5HJAA 3MENA 4Q41A 3Q9CA 3Q9EA 4Q40A 2AEBA 1WOHA 4LY1A 4RHMA 2VQQA 5JI5A 4QA1A 3C10A 4RN2A 3TH7A 4GWDA 4BZ6A 3EWFA 4CBYA 2CEVA 1T4RA 4IU1A 4IU4A 5EFBD 5G10A 5G0JA 1T5GA 5EFJD 3ZNSA 5G1CA 3TF3A 4MYKA 2EIVA 3GN0A 1CEVA 1T64A 5DC5A 4Q3SA 1R1OA 2GH6A 5THTA 4Q3TA 4RHKA 5DC7A 3E6VA 1T4SA 1C3RA 4GSVA 4MYLA 4ZUPA 4QA6A 5RLAA 4BZ5A 4IE2A 4DZ4A 1WVBA 1RLAA 2PHAA 3MFWA 1W22A 4IXUA 1XFKA 4ZURA 4CQFA 4IU5A 3MAXA 4GWCA 1TBJA 4ZUNA 1HQHA 4Q3RC 4MYNA 1WOIA 3PZLA 5D1DA 4Q3QA 5G1AA 5G3WA 4LXZA 2VQWG 4MXRA 5G0HA 4Q42A 3LP7A 3MFVA 4QA2A 4FCKA 5EENA 5EEFA 5FUEA 5G13A 5THVA 1T5FA 1ZZ0A 2VQVA 1ZZ1A 4FCIA 3SFHA 5LI3A 1C3SA 1T67A 1ZPGA 1TA1A 3NIQA 1GQ6A 2ZAVA 3F07A 1WOGA 1HQ5A 4QA0A 5THSA 1WVAA 5IX0A 4CEVA 5EF8A 3LP4A 5EFHA 5G0GA 2V5WA 2V5XA 5BWZA 1HQXA 1C3PA 4QA4A 3MZ6A 2PLLA 3Q9BA 3MZ7A 3EZPA 4HXQA 4IE3A 3E8QA 3GMZA 3SFFA 3LHLA 5G0XA 5G12A 3RQDA 4Q3PA 3SJTA 5EFKB 3THEA 1ZZ3A
chains in the Genus database with same CATH topology
4Q3VA 3M1RA 3SL0A 4RHIA 1TBLA 1ZPEA 2RLAA 3KV2A 4HZEA 4HWWA 3SKKA 2EF5A 1P8QA 4RHLA 3RLAA 5HJ9A 4ITYA 3THHA 4RHJA 4GSZA 1T4PA 4RLAA 3NIPA 3MMRA 1TBHA 2EF4A 3MJLA 5CEVA 4RHQA 4Q3RA 1HQGA 1P8OA 1D3VA 4IXVA 3NIOA 3CEVA 3E8ZA 4MYFA 3SL1A 2A0MA 1P8MA 3E9BA 1P8PA 3E6KA 1T4TA 4GSMA 4IE1A 4Q3UA 1P8SA 1PQ3A 3DJ8A 1HQFA 4G3HA 1GQ7A 4IU0A 1P8RA 3THJA 2PHOA 1P8NA 3F80A 4I06A 5HJAA 4Q41A 4Q40A 2AEBA 1WOHA 4RHMA 3TH7A 4GWDA 2CEVA 1T4RA 4IU1A 4IU4A 1T5GA 3TF3A 4MYKA 2EIVA 3GN0A 1CEVA 4Q3SA 1R1OA 4Q3TA 4RHKA 3E6VA 1T4SA 4MYLA 4GSVA 5RLAA 4IE2A 4DZ4A 1WVBA 1RLAA 2PHAA 3MFWA 4IXUA 1XFKA 4IU5A 4GWCA 1TBJA 1HQHA 4Q3RC 4MYNA 1WOIA 3PZLA 4Q3QA 4MXRA 4Q42A 3LP7A 3MFVA 4FCKA 1T5FA 4FCIA 1ZPGA 1TA1A 3NIQA 1GQ6A 2ZAVA 1WOGA 1HQ5A 1WVAA 4CEVA 3LP4A 1HQXA 2PLLA 4HXQA 4IE3A 3E8QA 3GMZA 3LHLA 4Q3PA 3SJTA 3THEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q3V A;  3M1R A;  3SL0 A;  4RHI A;  1TBL A;  1ZPE A;  2RLA A;  3KV2 A;  4HZE A;  4HWW A;  3SKK A;  2EF5 A;  1P8Q A;  4RHL A;  3RLA A;  5HJ9 A;  4ITY A;  3THH A;  4RHJ A;  4GSZ A;  1T4P A;  4RLA A;  3NIP A;  3MMR A;  1TBH A;  2EF4 A;  3MJL A;  5CEV A;  4RHQ A;  4Q3R A;  1HQG A;  1P8O A;  1D3V A;  4IXV A;  3NIO A;  3CEV A;  3E8Z A;  4MYF A;  3SL1 A;  2A0M A;  1P8M A;  3E9B A;  1P8P A;  3E6K A;  1T4T A;  4GSM A;  4IE1 A;  4Q3U A;  1P8S A;  1PQ3 A;  3DJ8 A;  1HQF A;  4G3H A;  1GQ7 A;  4IU0 A;  1P8R A;  3THJ A;  2PHO A;  1P8N A;  3F80 A;  4I06 A;  5HJA A;  4Q41 A;  4Q40 A;  2AEB A;  1WOH A;  4RHM A;  3TH7 A;  4GWD A;  2CEV A;  1T4R A;  4IU1 A;  4IU4 A;  1T5G A;  3TF3 A;  4MYK A;  2EIV A;  3GN0 A;  1CEV A;  4Q3S A;  1R1O A;  4Q3T A;  4RHK A;  3E6V A;  1T4S A;  4MYL A;  4GSV A;  5RLA A;  4IE2 A;  4DZ4 A;  1WVB A;  1RLA A;  2PHA A;  3MFW A;  4IXU A;  1XFK A;  4IU5 A;  4GWC A;  1TBJ A;  1HQH A;  4Q3R C;  4MYN A;  1WOI A;  3PZL A;  4Q3Q A;  4MXR A;  4Q42 A;  3LP7 A;  3MFV A;  4FCK A;  1T5F A;  4FCI A;  1ZPG A;  1TA1 A;  3NIQ A;  1GQ6 A;  2ZAV A;  1WOG A;  1HQ5 A;  1WVA A;  4CEV A;  3LP4 A;  1HQX A;  2PLL A;  4HXQ A;  4IE3 A;  3E8Q A;  3GMZ A;  3LHL A;  4Q3P A;  3SJT A;  3THE A; 
#chains in the Genus database with same CATH topology
 5EFG A;  5G0I A;  4Q3V A;  5THU A;  3M1R A;  5G1B A;  5G11 A;  3SL0 A;  4RHI A;  1TBL A;  5D1C A;  3MZ4 A;  3Q9F A;  3EZT A;  2VQJ A;  1ZPE A;  1VKG A;  2RLA A;  3C0Z A;  4RN1 A;  3KV2 A;  4HZE A;  4RN0 A;  4HWW A;  3SKK A;  3MZ3 A;  2EF5 A;  1P8Q A;  4RHL A;  5DC8 A;  3RLA A;  5HJ9 A;  5G17 A;  2VQO A;  4A69 A;  5FCW A;  2VCG A;  5EF7 A;  4BKX B;  3EW8 A;  5EEI A;  4ITY A;  4QA5 A;  4ZUM A;  3THH A;  4RHJ A;  4GSZ A;  1T4P A;  4RLA A;  3NIP A;  3MMR A;  5EFN A;  1TBH A;  5G0Y A;  2EF4 A;  3MJL A;  4ZUO A;  4RHQ A;  3ZNR A;  4Q3R A;  5CEV A;  1T69 A;  1HQG A;  1P8O A;  1D3V A;  4IXV A;  3NIO A;  3CEV A;  3E8Z A;  4MYF A;  3SL1 A;  2A0M A;  4BZ8 A;  5DC6 A;  1P8M A;  3E9B A;  5EEM A;  4BZ7 A;  1P8P A;  3E6K A;  5EEK A;  1T4T A;  5A2S A;  2VQM A;  4ZUQ A;  4GSM A;  4IE1 A;  3F06 A;  4Q3U A;  1P8S A;  1PQ3 A;  3DJ8 A;  1HQF A;  3C0Y A;  1GQ7 A;  4G3H A;  5ICN B;  4QA7 A;  5IWG A;  4IU0 A;  5D1B A;  1P8R A;  3THJ A;  4CBT A;  2PHO A;  1P8N A;  3F0R A;  3F80 A;  4I06 A;  4BZ9 A;  4QA3 A;  5HJA A;  3MEN A;  4Q41 A;  3Q9C A;  3Q9E A;  4Q40 A;  2AEB A;  1WOH A;  4LY1 A;  4RHM A;  2VQQ A;  5JI5 A;  4QA1 A;  3C10 A;  4RN2 A;  3TH7 A;  4GWD A;  4BZ6 A;  3EWF A;  4CBY A;  2CEV A;  1T4R A;  4IU1 A;  4IU4 A;  5EFB D;  5G10 A;  5G0J A;  1T5G A;  5EFJ D;  3ZNS A;  5G1C A;  3TF3 A;  4MYK A;  2EIV A;  3GN0 A;  1CEV A;  1T64 A;  5DC5 A;  4Q3S A;  1R1O A;  2GH6 A;  5THT A;  4Q3T A;  4RHK A;  5DC7 A;  3E6V A;  1T4S A;  1C3R A;  4GSV A;  4MYL A;  4ZUP A;  4QA6 A;  5RLA A;  4BZ5 A;  4IE2 A;  4DZ4 A;  1WVB A;  1RLA A;  2PHA A;  3MFW A;  1W22 A;  4IXU A;  1XFK A;  4ZUR A;  4CQF A;  4IU5 A;  3MAX A;  4GWC A;  1TBJ A;  4ZUN A;  1HQH A;  4Q3R C;  4MYN A;  1WOI A;  3PZL A;  5D1D A;  4Q3Q A;  5G1A A;  5G3W A;  4LXZ A;  2VQW G;  4MXR A;  5G0H A;  4Q42 A;  3LP7 A;  3MFV A;  4QA2 A;  4FCK A;  5EEN A;  5EEF A;  5FUE A;  5G13 A;  5THV A;  1T5F A;  1ZZ0 A;  2VQV A;  1ZZ1 A;  4FCI A;  3SFH A;  5LI3 A;  1C3S A;  1T67 A;  1ZPG A;  1TA1 A;  3NIQ A;  1GQ6 A;  2ZAV A;  3F07 A;  1WOG A;  1HQ5 A;  4QA0 A;  5THS A;  1WVA A;  5IX0 A;  4CEV A;  5EF8 A;  3LP4 A;  5EFH A;  5G0G A;  2V5W A;  2V5X A;  5BWZ A;  1HQX A;  1C3P A;  4QA4 A;  3MZ6 A;  2PLL A;  3Q9B A;  3MZ7 A;  3EZP A;  4HXQ A;  4IE3 A;  3E8Q A;  3GMZ A;  3SFF A;  3LHL A;  5G0X A;  5G12 A;  3RQD A;  4Q3P A;  3SJT A;  5EFK B;  3THE A;  1ZZ3 A; 
#chains in the Genus database with same CATH homology
 4Q3V A;  3M1R A;  3SL0 A;  4RHI A;  1TBL A;  1ZPE A;  2RLA A;  3KV2 A;  4HZE A;  4HWW A;  3SKK A;  2EF5 A;  1P8Q A;  4RHL A;  3RLA A;  5HJ9 A;  4ITY A;  3THH A;  4RHJ A;  4GSZ A;  1T4P A;  4RLA A;  3NIP A;  3MMR A;  1TBH A;  2EF4 A;  3MJL A;  5CEV A;  4RHQ A;  4Q3R A;  1HQG A;  1P8O A;  1D3V A;  4IXV A;  3NIO A;  3CEV A;  3E8Z A;  4MYF A;  3SL1 A;  2A0M A;  1P8M A;  3E9B A;  1P8P A;  3E6K A;  1T4T A;  4GSM A;  4IE1 A;  4Q3U A;  1P8S A;  1PQ3 A;  3DJ8 A;  1HQF A;  4G3H A;  1GQ7 A;  4IU0 A;  1P8R A;  3THJ A;  2PHO A;  1P8N A;  3F80 A;  4I06 A;  5HJA A;  4Q41 A;  4Q40 A;  2AEB A;  1WOH A;  4RHM A;  3TH7 A;  4GWD A;  2CEV A;  1T4R A;  4IU1 A;  4IU4 A;  1T5G A;  3TF3 A;  4MYK A;  2EIV A;  3GN0 A;  1CEV A;  4Q3S A;  1R1O A;  4Q3T A;  4RHK A;  3E6V A;  1T4S A;  4MYL A;  4GSV A;  5RLA A;  4IE2 A;  4DZ4 A;  1WVB A;  1RLA A;  2PHA A;  3MFW A;  4IXU A;  1XFK A;  4IU5 A;  4GWC A;  1TBJ A;  1HQH A;  4Q3R C;  4MYN A;  1WOI A;  3PZL A;  4Q3Q A;  4MXR A;  4Q42 A;  3LP7 A;  3MFV A;  4FCK A;  1T5F A;  4FCI A;  1ZPG A;  1TA1 A;  3NIQ A;  1GQ6 A;  2ZAV A;  1WOG A;  1HQ5 A;  1WVA A;  4CEV A;  3LP4 A;  1HQX A;  2PLL A;  4HXQ A;  4IE3 A;  3E8Q A;  3GMZ A;  3LHL A;  4Q3P A;  3SJT A;  3THE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...