4GWOA

Crystal structure of ligand binding domain of lysr family member,cysb in complex with sulfate from salmonella typhimurium lt2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator CysB
publication title Crystal structure of ligand binding domain of LysR family member,CysB in complex with sulfate from Salmonella typhimurium LT2
rcsb
source organism Salmonella typhimurium
molecule tags Gene regulation
total genus 72
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gwoA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gwoA02
1YAEA 3CFLA 3OSRA 1AMFA 2RKMA 4LATA 2RC8A 4LONB 1R6ZA 5LOMA 4EQBA 4KCDA 3IOTA 1QUJA 2Y7RA 1FQDA 3IB2A 2OBGA 1LSTA 1LAHE 4GL8A 4FEBA 4G4PA 3H06B 3UA8A 1POY1 1LBBA 3G7WA 2UVHA 4JB7A 3FZVA 2XXWA 2ZNUA 1GVCA 2QL3A 3HHGA 1EZOA 3TZAA 4H5FA 3IORA 2NWJA 3PMXA 4F1UA 2VD3A 4F3SA 5K2YA 1UIUA 2DS9A 4GXAA 4OERA 2XXUA 2F34A 3G3KA 2Z23A 4GD5A 2R9JA 5AA2D 1B40A 1OQGA 3S2VA 4TLMB 5CBRA 3MPLA 5KCJA 3DELB 4I9DA 3FXQA 1P1UA 5AA2A 1FTOA 3TELA 3KGCA 4R73A 1ZIUA 1SW2A 3DP8A 5H8SA 2Q89A 2A5TA 4MH5A 3V8XB 3G3HA 1Q35A 4XXUA 3TTNA 4HCWA 4DDDA 3H6VA 4F3PA 2F36A 3SEYA 2I4CA 3BBRA 3K2DA 4EDPA 1DMBA 5KZTA 3FV1A 2VP1A 4DXCA 4HW8A 2OK2A 1DTZA 2V3TA 3MZBA 4R6KA 2XXXA 4JXIA 5A5XB 3R6UA 3KFMA 3UN6A 3U94A 3OOAA 4NF4B 4YKPA 4ISUA 3KN7A 1J1NA 1B3EA 3H7MA 4YB6A 3FJGA 1UTBA 4I62A 1MQDA 2ONKE 3MAMA 4QRZA 5CC2A 4IO2A 1D9YA 5H8QB 1SYIA 4F29A 1SW4A 1LLSA 1WVJA 2O7UA 2Y7KA 3K4UA 1ZU0A 2DWJA 4MBPA 3PMVA 3ILTB 2XXIA 3GBBA 4XTCQ 3N26A 4NF5B 3MVXA 5EHMA 2GHAA 4OEVA 4LZ5A 4O3AA 5TU0A 3THIA 4R2BA 3SEXA 4ESWA 1B5HA 2UYEA 4DIGA 1P99A 5L9MA 3IOWA 4OYVA 1Y4TA 4N07A 1B2HA 4DXUA 5AA1A 2Q9TA 4HS7A 3MC2A 5I57A 4LZ8A 3IB0A 4ELOA 3FD3A 3E3KA 2B65A 2B3BA 5J1DA 4M4GA 4R2FA 2XXHA 1I6BA 5K2XA 3TCFA 2QS3A 1HSLA 1N0TA 4NTLA 1SVXB 4F18A 1US4A 3OENA 3HSTA 3TPAA 1M5FA 3C35A 3KJTA 1BP5A 2HEUA 3CSGA 1A99A 5F1QA 1UIVA 3IB1A 3CSBA 4TOZA 2CMOA 3T9VA 2XXRA 1Y1ZA 1B5IA 4H5GA 5L9OA 3PV0E 2HZLA 2NUVA 4MLQA 1JEVA 3VLUA 3LUYA 5EYFA 1NFTA 4LQ2A 1N04A 4JWOA 5KCJB 2I0CA 1UTHA 1IITA 5AA2B 4HCYA 4LUBA 3KG2A 4RXLA 1IQ7A 4FE8A 1SDXA 1URGA 1EU8A 2Y7WA 3ONMA 2H99A 2A5TB 2F78A 5B7DA 4PFWA 1D4NA 3CFXA 4WXJA 1OIBA 2RINA 1MQHA 3U92A 3EQ1A 4C1UA 3M3KA 3K1NA 3USDA 1MRPA 4FJPA 3TEPA 1Y9UA 3MJNA 4ZEBA 3KSXA 2GRVA 3N6TA 3V89B 2E1SA 3HCQA 2LAOA 4XKPA 3GZGA 2P0SA 2O1MA 4KD5A 1PBPA 3PUVE 4U4SA 1FW0A 1A55A 3FATA 2OCUA 3U8QA 2ZNTA 1H43A 4ZDMA 3IX1A 2GFEA 1NNTA 4MLVA 3T9UA 1BKAA 3PPRA 3RNNA 4UACA 3FIRA 2O84X 5JEIA 4F1VA 5ICQA 5H8HA 2RCBA 4FATA 1P1OA 1HSJA 2REGA 5IKBA 4OZ9A 3KZGA 1P1QA 1A40A 1B4ZA 1OLAA 4IO3A 1JVYA 4FORA 1PB8A 4FEDA 4GF8A 4AB6A 3MP1A 1PC3A 5B70A 4C1TA 4QSCA 4GIZA 1B9JA 5I57B 1KWHA 4E0XA 4KFQA 2XXTA 5BUUA 3I5OA 3TFLA 1RYXA 2PT1A 3M3LA 5CMMA 3IK6B 1MY4A 3PUZE 4IO5A 4G77A 5I2NB 3O6IA 3OO9A 4PQJA 3TTLA 2Y7IA 3KOSA 2UVGA 4MFIA 1Y3PA 2PMSA 1N3WA 1B7ZA 4JWXA 1LAXA 4G68A 2CZLA 4BDQA 5AA3A 2DE4A 1JW5A 1IXGA 1QULA 1USYH 1Z7ME 3CRBA 3T9XB 5CMBA 3PD9A 3JV9A 1LGBC 2PYYA 1MY0A 2XXQA 2F97A 4H8JA 2R6GE 2THIA 3TQWA 1MS7A 1L5TA 1CB6A 3FGSA 1LAGE 1UTHB 4WKMA 1H45A 1TFAA 4G68C 3H6TA 2OWTA 3FXUA 2O6AA 3ODBA 1OVTA 2ANJA 4X1BA 4U22A 2FA7A 3T66A 4OENA 4M1VA 1N3XA 3IJOB 4IO6A 3KN3A 1SW5A 3IO4A 4YB7A 2YLNA 2HXWA 1FTMA 3H03A 5FTHA 4OWDA 5H8NB 2F6PA 4P0GA 3HV1A 4ELPA 5I2KA 3B7DA 1US5A 4G8HA 3TUSA 4I1DA 4EQ7A 5CMCA 4R75A 4H65A 3BFTA 5JTYB 1JNFA 1MH4A 5FHOA 2AYSA 4DCXA 3CIJA 3HO7A 2ZNSA 1MY3A 4I8CA 2DYXA 4F39A 1LFHA 1O64A 1QVSA 1Y4CA 1II5A 2DP8A 3R7XA 3A3UA 3S4UA 4GRKA 1MQIA 3B6WA 5JK4A 3FASA 1MG1A 3C9HA 4MF3A 3QXMA 3G3IA 4ZEFA 3E9XA 2R71A 3O66A 1URSA 4QFPA 3PGFA 4PE5B 2RCAA 5H8HB 1NH8A 2OWSA 5DEXA 1B46A 3IO6A 4UA8A 3RGYA 3ZS6A 1GV8A 3O6GA 4YMBA 4NWCA 5AA4A 5KDTA 2DVCA 2RF1A 4YKKA 3RQTA 2ZMBA 3PPPA 5FTIA 1CE2A 2ABHA 1N76A 2Z8DA 3TCGA 3FVOA 5CM6A 1QW0A 3V5AA 3G3FA 4IO4A 4TQUQ 3UORA 1MY2A 4G8MA 5M2VA 4L17A 4H6DA 4IO7A 1VSOA 1N7WA 3MQ9A 4EF1A 5H8FA 4QFKA 2XX8A 1IZ1A 3RN8A 2QJEA 1P1NA 4G68B 2VOZA 1B3GA 4THIA 1NMUA 3K02A 3U93A 3I6VA 4BDNA 3HN0A 2XXPA 2WKYA 3F11A 4KYEA 4R6HA 2V93A 2ONSA 1SI0A 3TTRA 3SEUA 5BWJA 1MXUA 3PPOA 3LBSA 1MPCA 3UK4A 4ZZEA 3OEMA 3D4CA 4QFOA 2IA4A 2ZXTA 3IOVA 1IUDA 1OLCA 3DM0A 3MP6A 3TAJA 3VE1B 3FVKA 4G2ZA 1UQWA 3PD8A 1DPEA 4Q8RA 4FECA 3G3GA 1Q1KA 4RY1A 5L8DA 1OQHA 1JEUA 4JDFA 3C33A 3I3VA 4FAJA 4RA1A 1MM7A 5I2KB 3S9NC 3O29A 4GQOA 3VVFA 2PT2A 3JYRA 4BDMA 4POWA 5I56A 1VFEA 4K3FA 2Z8EA 4RYAA 1N84A 3OEKA 1H44A 4IGRA 3VXBA 3IOUA 2NVUB 1BTJA 1EZPA 3KBRA 4QHQA 2H25A 5I2NA 2Y84A 4PFUA 1M5BA 1LAFE 4OFLA 1I6AA 3KSJA 1DSNA 1ZLQA 1USYE 2HFBA 3HHFA 3ZSFA 4ELRA 3TODA 1EZ9A 4YICA 3OELA 5DEXB 4QFNA 1FQBA 3KEIA 4KHZE 1H3DA 1R9LA 3BKIB 1XS5A 1B52A 2PX1A 1B1HA 4OQOA 4F31B 4OTEA 2ZYNA 5AA4B 2V84A 3W9WA 5KDTB 2F6GA 1JW4A 3R26A 3O28A 4H8IA 3PUXE 2G29A 3WAFA 1IXIA 3EF7A 3IR1A 4R6YA 3QUFA 1QUIA 3TCHA 1A8FA 3TQLA 1LB9A 2XD2A 4LA9A 4ZE9A 5H8FB 4ELQA 4PP0A 2W7YA 5ELVA 2Q2CA 2HAUA 4Q5TA 3TTMA 4DLDA 4LZ7A 3T9HB 3MVYA 5H8NA 3S9EA 1RKMA 1S9TA 1LCFA 4F3BA 2UXAA 1FCKA 3FVGA 1TFDA 4GL0A 4H1XA 2ONRA 4OEUA 2HAVA 4ONYA 2DSFA 1NNPA 3EHSA 3W9VA 1A8EA 1PBQA 5JTYA 1MY1A 2ESNA 3ILUB 3E4RA 4GVOA 4ECFA 1NNKA 4BDLA 3MBPA 1HSEA 1T0KA 1QUKA 1QKBA 1OMPA 4YKJA 1SQYA 4GOTA 4NF6A 1B3HA 4YKIA 1BIYA 4X9TA 4F2OA 1Y1MA 2FYIA 3VVEA 3K1MA 2UVIA 1R1NA 4ZS9A 3O6HA 4R9FA 3CG1A 1R9QA 1LFGA 4OFOA 1B6HA 4U1OA 2A5SA 3RT6B 1M5DA 5DT6A 3A09A 2QS4A 4IY6A 4AQ4A 2NOOA 3SERA 2HQ0A 3SDFA 3FXRA 5TP9A 3KN8A 2X26A 2UVJA 1JW1A 4IY5A 4P11A 4P0IA 1A54A 3O9PA 5I56B 4U1ZA 2P1SA 1OVBA 3Q27A 4ZE8A 2DE2A 3K00A 1F9BA 3SEVA 1H76A 2XXVA 3CFZA 3CG3A 5DYHA 4BDOA 3TYHA 1TXFA 2I0BA 2I3VA 3T96B 4X1DA 1A7LA 2AL5A 5EHSA 3K1PA 5DTBA 3SETA 4RK2A 3B6QA 1M5EA 3ZKLA 5HPQA 2QS2A 1O63A 4JSDA 3TKDA 2M8CA 1PEBA 1MPBA 5FHNA 4BDRA 3RLFE 3EPEA 3GLBA 1NKXA 3LR1A 4POXA 4KI0E 2HCAA 1XVYA 3VLVA 1PB7A 2B3FA 2DWIA 1DTGA 4PFTA 4RJZA 4IGTA 1LCTA 4KYDA 4NEDA 1B3FA 3GBAA 4F2QA 1NL5A 1AL3A 1ZMGA 3LSFB 5I59A 2QRYA 5F7VA 1QJMA 2DE3A 1D9VA 3P7IA 4KR5A 4DXBA 3C34A 1WODA 1B7UA 2Z22A 4ZEDA 3K01A 1B0LA 2XXYA 1B05A 4WEPA 5HM4B 1FTLA 1VR5A 4Z0IA 4OESA 1MXWA 2YPNA 1FTKA 4NWDA 4RPNA 4DCYA 3CI8A 2F8DA 2XX7A 3DLNA 5DVFA 1AOVA 3MW0A 3IAZA 3LSWA 3M3FA 1DPPA 3FVNA 4NF6B 3G3JA 4HTGA 3S9LC 1SBPA 3MUQA 2FNCA 4X48A 1POTA 4O3BA 5CRYA 2QS1A 2XD3A 3C4MA 1AIVA 2PBWA 3OO8A 2GHBA 5TPAB 5TP9B 2ZYMA 2X7PA 3H6UA 4YU0A 4GFRA 2O69A 4XKRA 3MVZA 3KOTA 3RTWB 2DVZA 3RTFB 3ZKKA 5HBCA 2XX9A 2G93A 4H0WA 1SI1A 3MVWA 4F19A 3L6GA 1XT8A 3QK6A 3C31A 4PETA 4KCCA 4GWOA 2Q8JA 1B3LA 1BLFA 3O2AA 3RT8A 4OXVA 2GH9A 2DXYA 4XKNA 2QPQA 2I49A 4U4XA 4U23A 3B6TA 1AH5A 2ZYKA 2YJPA 5I58A 5I84A 3Q25A 5CMKA 4KPTA 4GXSB 2DWHA 5CI5A 4DE8A 4ZEIA 3BFUA 3H4ZA 2OJTA 3PPNA 3RPWA 3N94A 2VHAA 3VDFA 4G8NA 1N7XA 4N6PA 2P2AA 1S7YA 2F35A 1EH3A 4C0RA 4QF9A 3K6XA 1MQJA 1FQEA 2PVUA 2I4BA 4Q0CA 3QIMA 3OD7A 1MDQA 2V3QA 1NH7A 2D3IA 4NMYA 1FQCA 1VE4A 1JQFA 2REJA 3D4GA 5I59B 1QKAA 3VFJA 3T22A 5ITPA 1XC1A 3VVDA 2F7BA 3DP6A 1FTJA 2O1LA 3TTKA 2Y7PA 1LB8A 3S9MC 4F3GA 4NF8A 1GGGA 3SKPA 1WDNA 3RUMA 1MPDA 2BJJX 1O7TA 4QFLA 1GR2A 4JWYA 4RPOA 1P1WA 3ECRA 3PUYE 5CBSA 3O97A 1I69A 2Z8FA 3Q28A 3RY3A 1B58A 3AXFA 2ALUA 4YAHX 5L9SA 2F5XA 2DOJA 3U72A 4YZZA 1Y3QA 2V25A 4YMAA 1XVXA 2H9BA 3MZ1A 3QSLA 4EQ9A 4LVQA 3VV5A 3OSQA 2D21A 3CR9A 1URDA 3CVGA 2Q2AA 1XHYA 4LP2B 1ZKBA 3IJXB 2O68A 3QAXA 1D3KA 1JETA 1TT1A 4JSOA 3LSLA 3OO6A 3OMBA 1DOTA 2I48A 3SEWA 4OHNA 5ISUA 4OMBA 1YTVA 2RC9A 4OFJA 1MXXA 2H98A 4RNSA 1TWYA 2AIXA 4IB2A 1B4HA 1ZTYA 3V83A 1S50A 3FJMA 2I3WA 3A3CA 2RC7A 1Z7NE 4NE4A 3C32A 4QSEA 2D5WA 2O51A 3QUJA 1RYOA 3MWBA 2F7CA 5AE4A 2OLBA 2I58A 4DZ1A 4QSDA 4KYSA 4EXKA 3E13X 2ZYOA 4LQ5A 1MH3A 5I58B 2UYFA 4R72A 2X7QA 1M5CA 3PPQA 1MXZA 1ELJA 3WAEA 4ZZAA 1UTBB 1B7HA 3TDJA 5DVJA 1B5JA 2DQVA 5DVIA 3LSXA 3PU5A 1XOCA 3K6WA 1PB9A 4ZECA 3K6UA 3Q26A 3DP4A 3N6UA 2QMXA 3VXCA 3EHUA 1MXYA 1JVXA 4ZEKA 5TPAA 2OZZA 3H6WA 3K0VA 2KLFA 4OVJA 1Y20A 1SYHA 1I6QA 4U21A 2DXRA 3EHTA 2H4IA 3JZJA 4AB5A 1LBCA 4NF8B 3VLWA 2HZKA 4U2RA 2E0SA 4N13A 3EN3A 3PUWE 4Z7EA 3SESA 1ZJLA 1MM6A 4FIMA 3W15C 4F22A 1B51A 3L6HA 2NXOA 1MQGA 4BLAA 3Q29A 5FHMA 3HPIA 3UIFA 2QSXA 3N5LA 4WEDA 1MDP1 3C36A 4TLLB 2O7IA 2I6EA 1ATGA 1MXVA 3M8UA 1SD3A 3QYTA 3OO7A 4E0WA 4GLIA 3IL1B 4XKQA 4R9GA 4KQPA 1B32A 1FQAA 1YPNA 1IIWA 3MZ9A 1GTKA 3K6VA 5A5XA 1LFIA 3FV2A 1VFDA 4F1YA 1IXHA 4OETA 2DWAA 4NF4A 4YB5A 3FJ7A 1PDAA 4EUOA 3H3GA 4RK9A 3T93B 2V3UA 5ICTA 3MPKA 2F7AA 3UP9A 4H67A 4ND9A 4O3CA 2AL4A 3UGWA 5H8QA 1FQFA 3MP8A 4JBZA 4Q30B 4ESXA 2Q88A 2H5YA 3LC8A 1ZBMA 3KJ7A 4NF5A 3U1OA 4XIGQ 3TMGA 1YCJA 1B0HA 4PFYA 5ITOA 4R74A 3FUZA 1B1XA 2VD2A 1NNFA 1IXCA 2XHDA 4EF2A 2IEEA 2VGQA 3OXNA 1Y3NA 3PMWA 4EXLA 2QMWA 5IAIA 1ANFA 1IEJA 3GXAA 1SW1A
chains in the Genus database with same CATH superfamily
1YAEA 3CFLA 3OSRA 2XXKA 1AMFA 2RKMA 4LATA 2RC8A 4LONB 1R6ZA 5LOMA 4EQBA 4KCDA 2VPNA 3IOTA 1QUJA 2Y7RA 1FQDA 1IMAA 3IB2A 2OBGA 1LSTA 1LAHE 4GL8A 4FEBA 4G4PA 3H06B 3UA8A 1POY1 1LBBA 3G7WA 2UVHA 4JB7A 3FZVA 2XXWA 2ZNUA 1GVCA 3MYUA 5J16A 2QL3A 3HHGA 1EZOA 3TZAA 2ZZWA 4N81A 1IMCA 4H5FA 3IORA 2NWJA 3PMXA 2XWOA 4F1UA 2VD3A 1NV2A 2CEYA 4F3SA 5K2YA 2WYKA 4OERA 1UIUA 2DS9A 4GXAA 2XXUA 2F34A 3G3KA 2Z23A 4GD5A 1DCUA 2R9JA 5AA2D 1B40A 1OQGA 3S2VA 5I7IA 4TLMB 5CBRA 5IZ3A 3MPLA 5KCJA 3DELB 4I9DA 3FXQA 1P1UA 5AA2A 1FTOA 3TELA 4OVTA 3KGCA 4R73A 1ZIUA 1SW2A 3DP8A 5H8SA 1LBXA 2Q89A 2A5TA 4MH5A 3V8XB 3LUZA 3G3HA 1Q35A 4XXUA 5LDZA 4HE2A 3TTNA 4NN3A 4HCWA 4DDDA 3H6VA 4F3PA 1FPKA 2F36A 3SEYA 2I4CA 3BBRA 3K2DA 4EDPA 1DMBA 5KZTA 3RPLA 4GBVA 3FV1A 4PBQA 2VP1A 4DXCA 4HW8A 2OK2A 1DTZA 2QVVA 2V3TA 4XFEA 3MZBA 4XEQA 4R6KA 2XXXA 4JXIA 5A5XB 3R6UA 3KFMA 3UN6A 3U94A 3OOAA 4NF4B 4YKPA 4ISUA 3KN7A 1J1NA 4G61A 1B3EA 3H7MA 4YB6A 3FJGA 1UTBA 4I62A 1MQDA 2ONKE 4GX4A 3MAMA 4QRZA 5CC2A 4IO2A 1D9YA 2FBPA 5H8QB 1K9YA 5FBPA 4NQ8A 1SYIA 4F29A 1SW4A 1LLSA 1WVJA 2O7UA 2Y7KA 3K4UA 1ZU0A 2DWJA 4MBPA 3PMVA 3ILTB 2XXIA 3GBBA 4XTCQ 3N26A 4NF5B 4NGUA 3MVXA 5EHMA 3MSTA 2GHAA 4OEVA 4LZ5A 2XWKA 2B4LA 4O3AA 5TU0A 3THIA 4R2BA 5F24A 3SEXA 4ESWA 1B5HA 4JVDA 2CZIA 4HE1A 2UYEA 4GX6A 4DIGA 1P99A 5L9MA 3IOWA 4OYVA 1Y4TA 4N07A 1B2HA 4DXUA 4PBHA 5AA1A 4GWZA 2Q9TA 1FPEA 3A29A 4HS7A 3MC2A 5I57A 4LZ8A 3IB0A 4ELOA 3FD3A 3E3KA 1VDWA 2B65A 2B3BA 4PCDA 5J1DA 2P3NA 4M4GA 4R2FA 2XXHA 1I6BA 5K2XA 3TCFA 2QS3A 1HSLA 1N0TA 4NTLA 1SVXB 4F18A 1US4A 3OENA 3HSTA 3TPAA 1M5FA 3C35A 3KJTA 1BP5A 2HEUA 3CSGA 4MIJA 1A99A 5F1QA 1UIVA 3IB1A 3CSBA 4TOZA 2CMOA 1G0IA 3T9VA 2XXRA 1Y1ZA 1B5IA 4H5GA 5L9OA 3PV0E 3SZPA 2HZLA 2NUVA 4MLQA 1JEVA 3VLUA 4P1EA 3LUYA 5EYFA 1NFTA 4LQ2A 1N04A 4JWOA 5KCJB 2PFYA 2I0CA 1UTHA 1IITA 5AA2B 4HCYA 4P3LA 4LUBA 3KG2A 3LV0A 4RXLA 1IQ7A 4FE8A 1SDXA 1URGA 1EU8A 2Y7WA 3ONMA 2H99A 2A5TB 2F78A 1LEVA 5B7DA 4PFWA 3T1BA 1D4NA 3CFXA 3CHGA 4N6DA 4WXJA 2HXRA 1OIBA 2RINA 1MQHA 3U92A 3EQ1A 4C1UA 3M3KA 1FBGA 3K1NA 1FBHA 3USDA 1MRPA 4FJPA 3TEPA 1Y9UA 3MJNA 4ZEBA 2F3DA 3KSXA 2GRVA 3N6TA 3V89B 2E1SA 3HCQA 2XWVA 2LAOA 4XKPA 4GWWA 3GZGA 2P0SA 2O1MA 2WBDA 4KD5A 4N4UA 4OVQA 1PBPA 3PUVE 4U4SA 1FW0A 1A55A 3FATA 2OCUA 3U8QA 2ZNTA 1H43A 4ZDMA 3IX1A 2GFEA 1NNTA 2B4MA 4MLVA 3T9UA 4H45A 1BKAA 4GWXA 3PPRA 3RNNA 4UACA 1QGXA 3FIRA 2BJIA 2XA5A 2O84X 5JEIA 4F1VA 5ICQA 1YXIA 5H8HA 2RCBA 4FATA 1P1OA 3NOHA 1HSJA 1YZ0A 2REGA 5IKBA 4OZ9A 3KZGA 1P1QA 1A40A 1B4ZA 1OLAA 4IO3A 1JVYA 4FORA 1PB8A 4FEDA 4GF8A 4AB6A 4NAPA 3MP1A 2WBBA 1PC3A 5B70A 4C1TA 2DDKA 4O94A 4QSCA 1XI6A 4GIZA 1B9JA 5I57B 1KWHA 4E0XA 4MAGA 4KFQA 2XXTA 5BUUA 3I5OA 3TFLA 4O8MA 1INPA 1RYXA 2PT1A 3M3LA 5CMMA 3IK6B 1MY4A 3PUZE 4IO5A 4G77A 5I2NB 2WYPA 3O6IA 1NV0A 3OO9A 4PQJA 3TTLA 2Y7IA 3KOSA 2UVGA 4MFIA 1Y3PA 2PMSA 1N3WA 1B7ZA 4JWXA 1LAXA 4G68A 2CZLA 4BDQA 5AA3A 1NV7A 2DE4A 1JW5A 1IXGA 1QULA 1USYH 1Z7ME 1FPGA 1NV5A 3CRBA 3T9XB 5CMBA 3PD9A 3JV9A 1LGBC 2PYYA 1MY0A 2XXQA 2F97A 4H8JA 2R6GE 2THIA 4MHFA 3TQWA 1MS7A 1RDXA 1L5TA 1CB6A 1IMFA 3FGSA 4FBPA 1LAGE 1UTHB 4WKMA 1H45A 1TFAA 4G68C 3H6TA 2OWTA 2P3VA 3FXUA 1RDYA 2O6AA 3ODBA 1NUXA 1OVTA 2ANJA 4X1BA 4U22A 2FA7A 3T66A 4MNIA 4OENA 4M1VA 1N3XA 3IJOB 4IO6A 3KN3A 1NUZA 1SW5A 3IO4A 4YB7A 2YLNA 2HXWA 1FTMA 2JJKA 4JVIA 3H03A 5FTHA 4OWDA 5H8NB 2F6PA 4P0GA 3HV1A 4ELPA 5I2KA 2KR0A 3B7DA 1US5A 4G8HA 3TUSA 4I1DA 4EQ7A 5CMCA 4R75A 4H65A 3BFTA 5JTYB 1JNFA 1MH4A 5FHOA 2AYSA 4P56A 4DCXA 3CIJA 3HO7A 2ZNSA 1MY3A 4I8CA 2DYXA 4F39A 1LFHA 1O64A 1QVSA 1Y4CA 1II5A 2DP8A 3R7XA 3A3UA 3S4UA 4GRKA 1MQIA 3B6WA 5JK4A 4UABA 3FASA 1MG1A 3C9HA 4MF3A 3QXMA 1FPIA 3G3IA 4ZEFA 3E9XA 2R71A 3O66A 1URSA 4QFPA 1DBZA 3PGFA 4PE5B 2RCAA 5H8HB 1NH8A 2OWSA 5DEXA 1B46A 3IO6A 2ZZVA 4UA8A 5I3SA 3RGYA 3ZS6A 2CZKA 1GV8A 3O6GA 2QFLA 2CEXA 4YMBA 4AS5A 4NWCA 5AA4A 5ET5A 1FRPA 5KDTA 2DVCA 2RF1A 1EYJA 4YKKA 3RQTA 2ZMBA 4PAKA 3PPPA 5FTIA 1CE2A 4OVSA 2ABHA 1N76A 1NV3A 2Z8DA 3TCGA 3FVOA 5CM6A 1QW0A 3V5AA 3G3FA 4IO4A 5EQ8A 4TQUQ 3UORA 4PTKA 1MY2A 4G8MA 5M2VA 4L17A 4H6DA 4IO7A 1VSOA 1N7WA 3MQ9A 4EF1A 1FPLA 5H8FA 4QFKA 2XX8A 1IZ1A 3RN8A 2QJEA 1P1NA 4G68B 2VOZA 1B3GA 4THIA 1NMUA 3K02A 3U93A 3I6VA 4BDNA 3HN0A 2XXPA 3IFCA 2WKYA 3F11A 2V4CA 4KYEA 4PDDA 4R6HA 5EQ7A 2V93A 1IMDA 1FBDA 2ONSA 1SI0A 3TTRA 3FBPA 3SEUA 5BWJA 1LBVA 3B8BA 1MXUA 3PPOA 3LBSA 4NG7A 1MPCA 3UK4A 4ZZEA 3OEMA 3D4CA 4QFOA 2IA4A 3RYDA 2ZXTA 3IOVA 1IUDA 1OLCA 4P8BA 3DM0A 3MP6A 3TAJA 3VE1B 3FVKA 4G2ZA 1UQWA 3PD8A 1DPEA 4Q8RA 4FECA 3G3GA 2WX9A 1Q1KA 4RY1A 5L8DA 1OQHA 1JEUA 4JDFA 2VPOA 3C33A 3I3VA 4FAJA 4RA1A 1MM7A 5I2KB 3S9NC 3O29A 4GQOA 3VVFA 2PT2A 3JYRA 4BDMA 4POWA 5I56A 1VFEA 4K3FA 2Z8EA 4RYAA 1N84A 5IGAA 3OEKA 1H44A 4GWYA 4IGRA 3VXBA 3IOUA 2NVUB 1LBZA 5EQAA 1BTJA 1EZPA 3KBRA 4O7IA 4QHQA 2H25A 5I2NA 2Y84A 4PFUA 1M5BA 1LAFE 4DI4B 4OFLA 4PF6A 5EYHA 1I6AA 3KSJA 1DSNA 1ZLQA 2FHYA 1USYE 2HFBA 1NI9A 4DI3D 1NUWA 3HHFA 3ZSFA 4ELRA 3GYYA 3BIGA 3TODA 1EZ9A 4YICA 3OELA 5DEXB 4QFNA 1FQBA 3KEIA 4KHZE 1H3DA 1R9LA 5IM2A 3BKIB 1XS5A 1B52A 4MNCA 2PX1A 1B1HA 4OQOA 4F31B 4OTEA 2ZYNA 5AA4B 2V84A 3U65A 3W9WA 5KDTB 2F6GA 1JW4A 3R26A 3O28A 4H8IA 3PUXE 2G29A 4HXVA 3WAFA 1IXIA 3EF7A 3IR1A 4R6YA 3QUFA 2QVUA 5ET8A 1QUIA 3TCHA 1A8FA 1D9QA 4PFIA 3TQLA 1LB9A 2XD2A 4LA9A 4ZE9A 4MX6A 5H8FB 4ELQA 4PP0A 2W7YA 5ELVA 2Q2CA 2HAUA 4Q5TA 3TTMA 4DLDA 4LZ7A 3T9HB 3MVYA 5H8NA 3S9EA 1RKMA 1S9TA 1LCFA 4F3BA 2UXAA 1FCKA 3FVGA 1TFDA 4GL0A 4H1XA 2ONRA 4OEUA 2HAVA 4ONYA 2DSFA 1NNPA 3EHSA 3W9VA 1A8EA 1PBQA 5JTYA 1MY1A 2ESNA 3ILUB 3E4RA 4GVOA 5A5LA 4ECFA 1NNKA 4BDLA 3MBPA 1HSEA 1T0KA 1QUKA 1QKBA 1OMPA 4YKJA 1SQYA 4GOTA 4NF6A 1B3HA 4YKIA 1NV6A 1BIYA 1FPBA 4X9TA 4F2OA 1Y1MA 4MNPA 2FYIA 3VVEA 3K1MA 2UVIA 1R1NA 4ZS9A 1NV1A 3O6HA 4R9FA 3CG1A 1R9QA 1LFGA 4OFOA 1B6HA 4U1OA 2A5SA 2F3BA 3RT6B 1M5DA 2GQ1A 5DT6A 3A09A 1FTAA 2QS4A 1JP4A 4IY6A 4AQ4A 2NOOA 3SERA 2HQ0A 3SDFA 3FXRA 5TP9A 3KN8A 2X26A 2UVJA 1JW1A 4IY5A 1FBCA 4P11A 4P0IA 1A54A 3O9PA 2Y5LA 5I56B 4U1ZA 2P1SA 1OVBA 3Q27A 4ZE8A 2DE2A 3K00A 4IR8A 2CZHA 1F9BA 3SEVA 1H76A 2XXVA 3CFZA 3CG3A 5DYHA 4BDOA 3TYHA 1TXFA 2I0BA 2I3VA 3T96B 1DK4A 4X1DA 4PGPA 4X8RA 1LBYA 2PCRA 3T0JA 1A7LA 2QVRA 2AL5A 5EHSA 3K1PA 5DTBA 2FVZA 1NUYA 5I5PA 3SETA 4RK2A 3B6QA 1M5EA 3ZKLA 5HPQA 2QS2A 1O63A 4JSDA 3TKDA 2MKZA 2M8CA 1PEBA 1MPBA 5FHNA 4BDRA 3RLFE 4P9KA 3EPEA 3GLBA 3EKIA 4OVPA 1NKXA 3LR1A 4POXA 4KI0E 2HCAA 1XVYA 3VLVA 1PB7A 2B3FA 2DWIA 1DTGA 4PFTA 4RJZA 4IGTA 4PE3A 1LCTA 4KYDA 4NEDA 1B3FA 3GBAA 4F2QA 1NL5A 1AL3A 1ZMGA 1AWBA 3LSFB 5I59A 1YYZA 2QRYA 5F7VA 1QJMA 2DE3A 1D9VA 2R8TA 3P7IA 4KR5A 4DXBA 3C34A 1WODA 4PC9A 1B7UA 2Z22A 4ZEDA 3K01A 5IZZA 1B0LA 4GX3A 2XXYA 1B05A 4WEPA 5HM4B 1FTLA 1VR5A 4Z0IA 4OESA 1MXWA 2YPNA 4PAFA 1FTKA 4NWDA 4RPNA 3KBZA 4DCYA 3CI8A 2F8DA 2XX7A 3DLNA 5DVFA 1AOVA 3MW0A 3IAZA 2VT5A 3LSWA 3M3FA 1DPPA 3FVNA 4NF6B 3G3JA 4HTGA 3S9LC 1SBPA 3MUQA 2KQZA 2FNCA 4PAIA 4X48A 4MCOA 1POTA 4N8YA 4O3BA 5CRYA 2QS1A 2XD3A 3C4MA 1AIVA 2PBWA 3OO8A 2GHBA 5TPAB 1CNQA 5TP9B 2ZYMA 2X7PA 4GWSA 3H6UA 4YU0A 2L5VA 4GFRA 2O69A 4XKRA 5EQ9A 3MVZA 3KOTA 3RTWB 2DVZA 3RTFB 3ZKKA 5HBCA 2XX9A 5EYGA 2G93A 4H0WA 1SI1A 3MVWA 4F19A 3L6GA 1XT8A 4XF5A 3QK6A 3C31A 4PETA 4KCCA 4GWOA 2Q8JA 1B3LA 1FPFA 1BLFA 3O2AA 3RT8A 4OXVA 2GH9A 2DXYA 4XKNA 2QPQA 2I49A 4U4XA 4U23A 3B6TA 1AH5A 2ZYKA 1FPJA 2YJPA 3B50A 5I58A 5I84A 3Q25A 5CMKA 2FIXA 1FJ9A 2OX3A 4KPTA 4GXSB 2DWHA 5CI5A 4DE8A 4ZEIA 3BFUA 3H4ZA 2OJTA 3PPNA 3RPWA 3N94A 2VHAA 3VDFA 4G8NA 1N7XA 4N6PA 2P2AA 1S7YA 2F35A 1EH3A 4C0RA 4QF9A 4MMPA 3K6XA 3PTYA 4PFBA 1MQJA 1FQEA 2PVUA 2I4BA 4Q0CA 3QIMA 2Y5KA 5ET6A 3OD7A 1MDQA 2V3QA 1NH7A 2D3IA 4NMYA 1FJ6A 1FQCA 1VE4A 2FIEA 1JQFA 4H46A 2REJA 3D4GA 1RDZA 5I59B 1QKAA 3VFJA 3T22A 5ITPA 1NV4A 3KC0A 1XC1A 3VVDA 2F7BA 2HHMA 1G0HA 1SPIA 1IMEA 3DP6A 1FTJA 4QXDA 2O1LA 2ZZXA 3TTKA 2Y7PA 1LB8A 1FBFA 3S9MC 4F3GA 4NF8A 1GGGA 3SKPA 1WDNA 3RUMA 1MPDA 2BJJX 1O7TA 4QFLA 1GR2A 4JWYA 5LTCA 4RPOA 1P1WA 3ECRA 3PUYE 5CBSA 3O97A 1I69A 2Z8FA 3Q28A 3RY3A 1B58A 3AXFA 2ALUA 4YAHX 5L9SA 2F5XA 2DOJA 3U72A 4YZZA 1Y3QA 2V25A 4YMAA 4KXPA 5IZ1A 1XVXA 4PDHA 4PGNA 2H9BA 3MZ1A 5ET7A 3QSLA 4EQ9A 3HFUA 4LVQA 3VV5A 3OSQA 2D21A 3CR9A 1URDA 3CVGA 2Q2AA 1XHYA 2XWIA 3ISPA 4LP2B 1ZKBA 3IJXB 2O68A 3QAXA 1D3KA 1JETA 1TT1A 4JSOA 3LSLA 3OO6A 3OMBA 1DOTA 2I48A 3SEWA 4OHNA 5ISUA 2HPGA 4OMBA 1YTVA 2RC9A 1K9ZA 4OFJA 1MXXA 2H98A 1EYKA 4RNSA 1TWYA 5IZ3B 2AIXA 4X04A 4N8GA 4PF8A 4IB2A 1B4HA 1ZTYA 2OWZA 3V83A 1S50A 3FJMA 2I3WA 4N6KA 3A3CA 2RC7A 1Z7NE 4NE4A 3C32A 4QSEA 2D5WA 4OANA 2O51A 1LBWA 3QUJA 1RYOA 3MWBA 4NF0A 2F7CA 4OA4A 5AE4A 2OLBA 2I58A 4DZ1A 2PFZA 4QSDA 4KYSA 4NHBA 4EXKA 3E13X 2ZYOA 3RPLB 4LQ5A 1MH3A 5I58B 4I3YA 5DW8A 2UYFA 4R72A 2X7QA 4HE0A 1M5CA 3PPQA 1MXZA 1ELJA 4N17A 3WAEA 4ZZAA 1UTBB 1B7HA 3TDJA 3E79A 5DVJA 5T3JA 1FPDA 1B5JA 1Q9DA 3D1RA 2DQVA 5DVIA 4AS4A 3LSXA 3PU5A 1XOCA 3K6WA 4GWUA 1PB9A 3IFAA 4ZECA 3FXBA 3K6UA 3Q26A 1FSAA 3DP4A 3N6UA 2QMXA 3VXCA 3EHUA 3E78A 1MXYA 1JVXA 4ZEKA 4LN5A 4NX1A 2OZZA 3H6WA 5TPAA 2Q8MA 3QMFA 3K0VA 2KLFA 4OVJA 1Y20A 1SYHA 1I6QA 1KA0A 2WEFA 4MJOA 4U21A 2DXRA 3EHTA 4N15A 2H4IA 3JZJA 4AB5A 1LBCA 4NF8B 3VLWA 2HZKA 4U2RA 2E0SA 4N13A 3EN3A 3PUWE 4Z7EA 3SESA 1ZJLA 1MM6A 4FIMA 3W15C 4F22A 1B51A 3L6HA 1EYIA 2NXOA 1MQGA 4BLAA 3Q29A 5FHMA 3HPIA 3UIFA 2QSXA 3N5LA 4WEDA 1MDP1 3C36A 4TLLB 2O7IA 4MEVA 2I6EA 1ATGA 1MXVA 3M8UA 1SD3A 1KZ8A 3QYTA 3OO7A 1FBEA 1FBPA 1KA1A 4E0WA 2Q74A 4GLIA 3IL1B 4XKQA 4GBWA 4R9GA 4PFRA 4QBAA 4KQPA 4P1LA 1B32A 1FQAA 1YPNA 1IIWA 3MZ9A 1GTKA 3K6VA 5A5XA 1LFIA 3FV2A 1VFDA 4F1YA 1IXHA 5ESYA 4OETA 2DWAA 4NF4A 4YB5A 4N91A 3FJ7A 1BK4A 1PDAA 4EUOA 3H3GA 4RK9A 3T93B 2V3UA 5ICTA 3KC1A 3MPKA 2F7AA 3UP9A 4H67A 4ND9A 4O3CA 2AL4A 3UGWA 5H8QA 1FQFA 3MP8A 4JBZA 4Q30B 4O7MA 4ESXA 2Q88A 2H5YA 3LC8A 1ZBMA 3KJ7A 4NF5A 3U1OA 4XIGQ 3TMGA 1YCJA 1B0HA 4PFYA 5ITOA 4R74A 3BIHA 3FUZA 1B1XA 2VD2A 1NNFA 4JVCA 1IXCA 4I3EA 2XHDA 4EF2A 4P47A 2IEEA 2VGQA 3OXNA 4I40A 3ROJA 1Y3NA 3PMWA 4EXLA 2QMWA 5IAIA 1ANFA 1IEJA 3GXAA 1IMBA 1SW1A 4OVRA
chains in the Genus database with same CATH topology
1YAEA 3CFLA 3OSRA 1AMFA 2RKMA 4LATA 2RC8A 4LONB 1R6ZA 5LOMA 4EQBA 4KCDA 3IOTA 1QUJA 2Y7RA 1FQDA 3IB2A 2OBGA 1LSTA 1LAHE 4GL8A 4FEBA 4G4PA 3H06B 3UA8A 1POY1 1LBBA 3G7WA 2UVHA 4JB7A 3FZVA 2XXWA 2ZNUA 1GVCA 2QL3A 3HHGA 1EZOA 3TZAA 4H5FA 3IORA 2NWJA 3PMXA 4F1UA 2VD3A 4F3SA 5K2YA 1UIUA 2DS9A 4GXAA 4OERA 2XXUA 2F34A 3G3KA 2Z23A 4GD5A 2R9JA 5AA2D 1B40A 1OQGA 3S2VA 4TLMB 5CBRA 3MPLA 5KCJA 3DELB 4I9DA 3FXQA 1P1UA 5AA2A 1FTOA 3TELA 3KGCA 4R73A 1ZIUA 1SW2A 3DP8A 5H8SA 2Q89A 2A5TA 4MH5A 3V8XB 3G3HA 1Q35A 4XXUA 3TTNA 4HCWA 4DDDA 3H6VA 4F3PA 2F36A 3SEYA 2I4CA 3BBRA 3K2DA 4EDPA 1DMBA 5KZTA 3FV1A 2VP1A 4DXCA 4HW8A 2OK2A 1DTZA 2V3TA 3MZBA 4R6KA 2XXXA 4JXIA 5A5XB 3R6UA 3KFMA 3UN6A 3U94A 3OOAA 4NF4B 4YKPA 4ISUA 3KN7A 1J1NA 1B3EA 3H7MA 4YB6A 3FJGA 1UTBA 4I62A 1MQDA 2ONKE 3MAMA 4QRZA 5CC2A 4IO2A 1D9YA 5H8QB 1SYIA 4F29A 1SW4A 1LLSA 1WVJA 2O7UA 2Y7KA 3K4UA 1ZU0A 2DWJA 4MBPA 3PMVA 3ILTB 2XXIA 3GBBA 4XTCQ 3N26A 4NF5B 3MVXA 5EHMA 2GHAA 4OEVA 4LZ5A 4O3AA 5TU0A 3THIA 4R2BA 3SEXA 4ESWA 1B5HA 2UYEA 4DIGA 1P99A 5L9MA 3IOWA 4OYVA 1Y4TA 4N07A 1B2HA 4DXUA 5AA1A 2Q9TA 4HS7A 3MC2A 5I57A 4LZ8A 3IB0A 4ELOA 3FD3A 3E3KA 2B65A 2B3BA 5J1DA 4M4GA 4R2FA 2XXHA 1I6BA 5K2XA 3TCFA 2QS3A 1HSLA 1N0TA 4NTLA 1SVXB 4F18A 1US4A 3OENA 3HSTA 3TPAA 1M5FA 3C35A 3KJTA 1BP5A 2HEUA 3CSGA 1A99A 5F1QA 1UIVA 3IB1A 3CSBA 4TOZA 2CMOA 3T9VA 2XXRA 1Y1ZA 1B5IA 4H5GA 5L9OA 3PV0E 2HZLA 2NUVA 4MLQA 1JEVA 3VLUA 3LUYA 5EYFA 1NFTA 4LQ2A 1N04A 4JWOA 5KCJB 2I0CA 1UTHA 1IITA 5AA2B 4HCYA 4LUBA 3KG2A 4RXLA 1IQ7A 4FE8A 1SDXA 1URGA 1EU8A 2Y7WA 3ONMA 2H99A 2A5TB 2F78A 5B7DA 4PFWA 1D4NA 3CFXA 4WXJA 1OIBA 2RINA 1MQHA 3U92A 3EQ1A 4C1UA 3M3KA 3K1NA 3USDA 1MRPA 4FJPA 3TEPA 1Y9UA 3MJNA 4ZEBA 3KSXA 2GRVA 3N6TA 3V89B 2E1SA 3HCQA 2LAOA 4XKPA 3GZGA 2P0SA 2O1MA 4KD5A 1PBPA 3PUVE 4U4SA 1FW0A 1A55A 3FATA 2OCUA 3U8QA 2ZNTA 1H43A 4ZDMA 3IX1A 2GFEA 1NNTA 4MLVA 3T9UA 1BKAA 3PPRA 3RNNA 4UACA 3FIRA 2O84X 5JEIA 4F1VA 5ICQA 5H8HA 2RCBA 4FATA 1P1OA 1HSJA 2REGA 5IKBA 4OZ9A 3KZGA 1P1QA 1A40A 1B4ZA 1OLAA 4IO3A 1JVYA 4FORA 1PB8A 4FEDA 4GF8A 4AB6A 3MP1A 1PC3A 5B70A 4C1TA 4QSCA 4GIZA 1B9JA 5I57B 1KWHA 4E0XA 4KFQA 2XXTA 5BUUA 3I5OA 3TFLA 1RYXA 2PT1A 3M3LA 5CMMA 3IK6B 1MY4A 3PUZE 4IO5A 4G77A 5I2NB 3O6IA 3OO9A 4PQJA 3TTLA 2Y7IA 3KOSA 2UVGA 4MFIA 1Y3PA 2PMSA 1N3WA 1B7ZA 4JWXA 1LAXA 4G68A 2CZLA 4BDQA 5AA3A 2DE4A 1JW5A 1IXGA 1QULA 1USYH 1Z7ME 3CRBA 3T9XB 5CMBA 3PD9A 3JV9A 1LGBC 2PYYA 1MY0A 2XXQA 2F97A 4H8JA 2R6GE 2THIA 3TQWA 1MS7A 1L5TA 1CB6A 3FGSA 1LAGE 1UTHB 4WKMA 1H45A 1TFAA 4G68C 3H6TA 2OWTA 3FXUA 2O6AA 3ODBA 1OVTA 2ANJA 4X1BA 4U22A 2FA7A 3T66A 4OENA 4M1VA 1N3XA 3IJOB 4IO6A 3KN3A 1SW5A 3IO4A 4YB7A 2YLNA 2HXWA 1FTMA 3H03A 5FTHA 4OWDA 5H8NB 2F6PA 4P0GA 3HV1A 4ELPA 5I2KA 3B7DA 1US5A 4G8HA 3TUSA 4I1DA 4EQ7A 5CMCA 4R75A 4H65A 3BFTA 5JTYB 1JNFA 1MH4A 5FHOA 2AYSA 4DCXA 3CIJA 3HO7A 2ZNSA 1MY3A 4I8CA 2DYXA 4F39A 1LFHA 1O64A 1QVSA 1Y4CA 1II5A 2DP8A 3R7XA 3A3UA 3S4UA 4GRKA 1MQIA 3B6WA 5JK4A 3FASA 1MG1A 3C9HA 4MF3A 3QXMA 3G3IA 4ZEFA 3E9XA 2R71A 3O66A 1URSA 4QFPA 3PGFA 4PE5B 2RCAA 5H8HB 1NH8A 2OWSA 5DEXA 1B46A 3IO6A 4UA8A 3RGYA 3ZS6A 1GV8A 3O6GA 4YMBA 4NWCA 5AA4A 5KDTA 2DVCA 2RF1A 4YKKA 3RQTA 2ZMBA 3PPPA 5FTIA 1CE2A 2ABHA 1N76A 2Z8DA 3TCGA 3FVOA 5CM6A 1QW0A 3V5AA 3G3FA 4IO4A 4TQUQ 3UORA 1MY2A 4G8MA 5M2VA 4L17A 4H6DA 4IO7A 1VSOA 1N7WA 3MQ9A 4EF1A 5H8FA 4QFKA 2XX8A 1IZ1A 3RN8A 2QJEA 1P1NA 4G68B 2VOZA 1B3GA 4THIA 1NMUA 3K02A 3U93A 3I6VA 4BDNA 3HN0A 2XXPA 2WKYA 3F11A 4KYEA 4R6HA 2V93A 2ONSA 1SI0A 3TTRA 3SEUA 5BWJA 1MXUA 3PPOA 3LBSA 1MPCA 3UK4A 4ZZEA 3OEMA 3D4CA 4QFOA 2IA4A 2ZXTA 3IOVA 1IUDA 1OLCA 3DM0A 3MP6A 3TAJA 3VE1B 3FVKA 4G2ZA 1UQWA 3PD8A 1DPEA 4Q8RA 4FECA 3G3GA 1Q1KA 4RY1A 5L8DA 1OQHA 1JEUA 4JDFA 3C33A 3I3VA 4FAJA 4RA1A 1MM7A 5I2KB 3S9NC 3O29A 4GQOA 3VVFA 2PT2A 3JYRA 4BDMA 4POWA 5I56A 1VFEA 4K3FA 2Z8EA 4RYAA 1N84A 3OEKA 1H44A 4IGRA 3VXBA 3IOUA 2NVUB 1BTJA 1EZPA 3KBRA 4QHQA 2H25A 5I2NA 2Y84A 4PFUA 1M5BA 1LAFE 4OFLA 1I6AA 3KSJA 1DSNA 1ZLQA 1USYE 2HFBA 3HHFA 3ZSFA 4ELRA 3TODA 1EZ9A 4YICA 3OELA 5DEXB 4QFNA 1FQBA 3KEIA 4KHZE 1H3DA 1R9LA 3BKIB 1XS5A 1B52A 2PX1A 1B1HA 4OQOA 4F31B 4OTEA 2ZYNA 5AA4B 2V84A 3W9WA 5KDTB 2F6GA 1JW4A 3R26A 3O28A 4H8IA 3PUXE 2G29A 3WAFA 1IXIA 3EF7A 3IR1A 4R6YA 3QUFA 1QUIA 3TCHA 1A8FA 3TQLA 1LB9A 2XD2A 4LA9A 4ZE9A 5H8FB 4ELQA 4PP0A 2W7YA 5ELVA 2Q2CA 2HAUA 4Q5TA 3TTMA 4DLDA 4LZ7A 3T9HB 3MVYA 5H8NA 3S9EA 1RKMA 1S9TA 1LCFA 4F3BA 2UXAA 1FCKA 3FVGA 1TFDA 4GL0A 4H1XA 2ONRA 4OEUA 2HAVA 4ONYA 2DSFA 1NNPA 3EHSA 3W9VA 1A8EA 1PBQA 5JTYA 1MY1A 2ESNA 3ILUB 3E4RA 4GVOA 4ECFA 1NNKA 4BDLA 3MBPA 1HSEA 1T0KA 1QUKA 1QKBA 1OMPA 4YKJA 1SQYA 4GOTA 4NF6A 1B3HA 4YKIA 1BIYA 4X9TA 4F2OA 1Y1MA 2FYIA 3VVEA 3K1MA 2UVIA 1R1NA 4ZS9A 3O6HA 4R9FA 3CG1A 1R9QA 1LFGA 4OFOA 1B6HA 4U1OA 2A5SA 3RT6B 1M5DA 5DT6A 3A09A 2QS4A 4IY6A 4AQ4A 2NOOA 3SERA 2HQ0A 3SDFA 3FXRA 5TP9A 3KN8A 2X26A 2UVJA 1JW1A 4IY5A 4P11A 4P0IA 1A54A 3O9PA 5I56B 4U1ZA 2P1SA 1OVBA 3Q27A 4ZE8A 2DE2A 3K00A 1F9BA 3SEVA 1H76A 2XXVA 3CFZA 3CG3A 5DYHA 4BDOA 3TYHA 1TXFA 2I0BA 2I3VA 3T96B 4X1DA 1A7LA 2AL5A 5EHSA 3K1PA 5DTBA 3SETA 4RK2A 3B6QA 1M5EA 3ZKLA 5HPQA 2QS2A 1O63A 4JSDA 3TKDA 2M8CA 1PEBA 1MPBA 5FHNA 4BDRA 3RLFE 3EPEA 3GLBA 1NKXA 3LR1A 4POXA 4KI0E 2HCAA 1XVYA 3VLVA 1PB7A 2B3FA 2DWIA 1DTGA 4PFTA 4RJZA 4IGTA 1LCTA 4KYDA 4NEDA 1B3FA 3GBAA 4F2QA 1NL5A 1AL3A 1ZMGA 3LSFB 5I59A 2QRYA 5F7VA 1QJMA 2DE3A 1D9VA 3P7IA 4KR5A 4DXBA 3C34A 1WODA 1B7UA 2Z22A 4ZEDA 3K01A 1B0LA 2XXYA 1B05A 4WEPA 5HM4B 1FTLA 1VR5A 4Z0IA 4OESA 1MXWA 2YPNA 1FTKA 4NWDA 4RPNA 4DCYA 3CI8A 2F8DA 2XX7A 3DLNA 5DVFA 1AOVA 3MW0A 3IAZA 3LSWA 3M3FA 1DPPA 3FVNA 4NF6B 3G3JA 4HTGA 3S9LC 1SBPA 3MUQA 2FNCA 4X48A 1POTA 4O3BA 5CRYA 2QS1A 2XD3A 3C4MA 1AIVA 2PBWA 3OO8A 2GHBA 5TPAB 5TP9B 2ZYMA 2X7PA 3H6UA 4YU0A 4GFRA 2O69A 4XKRA 3MVZA 3KOTA 3RTWB 2DVZA 3RTFB 3ZKKA 5HBCA 2XX9A 2G93A 4H0WA 1SI1A 3MVWA 4F19A 3L6GA 1XT8A 3QK6A 3C31A 4PETA 4KCCA 4GWOA 2Q8JA 1B3LA 1BLFA 3O2AA 3RT8A 4OXVA 2GH9A 2DXYA 4XKNA 2QPQA 2I49A 4U4XA 4U23A 3B6TA 1AH5A 2ZYKA 2YJPA 5I58A 5I84A 3Q25A 5CMKA 4KPTA 4GXSB 2DWHA 5CI5A 4DE8A 4ZEIA 3BFUA 3H4ZA 2OJTA 3PPNA 3RPWA 3N94A 2VHAA 3VDFA 4G8NA 1N7XA 4N6PA 2P2AA 1S7YA 2F35A 1EH3A 4C0RA 4QF9A 3K6XA 1MQJA 1FQEA 2PVUA 2I4BA 4Q0CA 3QIMA 3OD7A 1MDQA 2V3QA 1NH7A 2D3IA 4NMYA 1FQCA 1VE4A 1JQFA 2REJA 3D4GA 5I59B 1QKAA 3VFJA 3T22A 5ITPA 1XC1A 3VVDA 2F7BA 3DP6A 1FTJA 2O1LA 3TTKA 2Y7PA 1LB8A 3S9MC 4F3GA 4NF8A 1GGGA 3SKPA 1WDNA 3RUMA 1MPDA 2BJJX 1O7TA 4QFLA 1GR2A 4JWYA 4RPOA 1P1WA 3ECRA 3PUYE 5CBSA 3O97A 1I69A 2Z8FA 3Q28A 3RY3A 1B58A 3AXFA 2ALUA 4YAHX 5L9SA 2F5XA 2DOJA 3U72A 4YZZA 1Y3QA 2V25A 4YMAA 1XVXA 2H9BA 3MZ1A 3QSLA 4EQ9A 4LVQA 3VV5A 3OSQA 2D21A 3CR9A 1URDA 3CVGA 2Q2AA 1XHYA 4LP2B 1ZKBA 3IJXB 2O68A 3QAXA 1D3KA 1JETA 1TT1A 4JSOA 3LSLA 3OO6A 3OMBA 1DOTA 2I48A 3SEWA 4OHNA 5ISUA 4OMBA 1YTVA 2RC9A 4OFJA 1MXXA 2H98A 4RNSA 1TWYA 2AIXA 4IB2A 1B4HA 1ZTYA 3V83A 1S50A 3FJMA 2I3WA 3A3CA 2RC7A 1Z7NE 4NE4A 3C32A 4QSEA 2D5WA 2O51A 3QUJA 1RYOA 3MWBA 2F7CA 5AE4A 2OLBA 2I58A 4DZ1A 4QSDA 4KYSA 4EXKA 3E13X 2ZYOA 4LQ5A 1MH3A 5I58B 2UYFA 4R72A 2X7QA 1M5CA 3PPQA 1MXZA 1ELJA 3WAEA 4ZZAA 1UTBB 1B7HA 3TDJA 5DVJA 1B5JA 2DQVA 5DVIA 3LSXA 3PU5A 1XOCA 3K6WA 1PB9A 4ZECA 3K6UA 3Q26A 3DP4A 3N6UA 2QMXA 3VXCA 3EHUA 1MXYA 1JVXA 4ZEKA 5TPAA 2OZZA 3H6WA 3K0VA 2KLFA 4OVJA 1Y20A 1SYHA 1I6QA 4U21A 2DXRA 3EHTA 2H4IA 3JZJA 4AB5A 1LBCA 4NF8B 3VLWA 2HZKA 4U2RA 2E0SA 4N13A 3EN3A 3PUWE 4Z7EA 3SESA 1ZJLA 1MM6A 4FIMA 3W15C 4F22A 1B51A 3L6HA 2NXOA 1MQGA 4BLAA 3Q29A 5FHMA 3HPIA 3UIFA 2QSXA 3N5LA 4WEDA 1MDP1 3C36A 4TLLB 2O7IA 2I6EA 1ATGA 1MXVA 3M8UA 1SD3A 3QYTA 3OO7A 4E0WA 4GLIA 3IL1B 4XKQA 4R9GA 4KQPA 1B32A 1FQAA 1YPNA 1IIWA 3MZ9A 1GTKA 3K6VA 5A5XA 1LFIA 3FV2A 1VFDA 4F1YA 1IXHA 4OETA 2DWAA 4NF4A 4YB5A 3FJ7A 1PDAA 4EUOA 3H3GA 4RK9A 3T93B 2V3UA 5ICTA 3MPKA 2F7AA 3UP9A 4H67A 4ND9A 4O3CA 2AL4A 3UGWA 5H8QA 1FQFA 3MP8A 4JBZA 4Q30B 4ESXA 2Q88A 2H5YA 3LC8A 1ZBMA 3KJ7A 4NF5A 3U1OA 4XIGQ 3TMGA 1YCJA 1B0HA 4PFYA 5ITOA 4R74A 3FUZA 1B1XA 2VD2A 1NNFA 1IXCA 2XHDA 4EF2A 2IEEA 2VGQA 3OXNA 1Y3NA 3PMWA 4EXLA 2QMWA 5IAIA 1ANFA 1IEJA 3GXAA 1SW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAE A;  3CFL A;  3OSR A;  1AMF A;  2RKM A;  4LAT A;  2RC8 A;  4LON B;  1R6Z A;  5LOM A;  4EQB A;  4KCD A;  3IOT A;  1QUJ A;  2Y7R A;  1FQD A;  3IB2 A;  2OBG A;  1LST A;  1LAH E;  4GL8 A;  4FEB A;  4G4P A;  3H06 B;  3UA8 A;  1POY 1;  1LBB A;  3G7W A;  2UVH A;  4JB7 A;  3FZV A;  2XXW A;  2ZNU A;  1GVC A;  2QL3 A;  3HHG A;  1EZO A;  3TZA A;  4H5F A;  3IOR A;  2NWJ A;  3PMX A;  4F1U A;  2VD3 A;  4F3S A;  5K2Y A;  1UIU A;  2DS9 A;  4GXA A;  4OER A;  2XXU A;  2F34 A;  3G3K A;  2Z23 A;  4GD5 A;  2R9J A;  5AA2 D;  1B40 A;  1OQG A;  3S2V A;  4TLM B;  5CBR A;  3MPL A;  5KCJ A;  3DEL B;  4I9D A;  3FXQ A;  1P1U A;  5AA2 A;  1FTO A;  3TEL A;  3KGC A;  4R73 A;  1ZIU A;  1SW2 A;  3DP8 A;  5H8S A;  2Q89 A;  2A5T A;  4MH5 A;  3V8X B;  3G3H A;  1Q35 A;  4XXU A;  3TTN A;  4HCW A;  4DDD A;  3H6V A;  4F3P A;  2F36 A;  3SEY A;  2I4C A;  3BBR A;  3K2D A;  4EDP A;  1DMB A;  5KZT A;  3FV1 A;  2VP1 A;  4DXC A;  4HW8 A;  2OK2 A;  1DTZ A;  2V3T A;  3MZB A;  4R6K A;  2XXX A;  4JXI A;  5A5X B;  3R6U A;  3KFM A;  3UN6 A;  3U94 A;  3OOA A;  4NF4 B;  4YKP A;  4ISU A;  3KN7 A;  1J1N A;  1B3E A;  3H7M A;  4YB6 A;  3FJG A;  1UTB A;  4I62 A;  1MQD A;  2ONK E;  3MAM A;  4QRZ A;  5CC2 A;  4IO2 A;  1D9Y A;  5H8Q B;  1SYI A;  4F29 A;  1SW4 A;  1LLS A;  1WVJ A;  2O7U A;  2Y7K A;  3K4U A;  1ZU0 A;  2DWJ A;  4MBP A;  3PMV A;  3ILT B;  2XXI A;  3GBB A;  4XTC Q;  3N26 A;  4NF5 B;  3MVX A;  5EHM A;  2GHA A;  4OEV A;  4LZ5 A;  4O3A A;  5TU0 A;  3THI A;  4R2B A;  3SEX A;  4ESW A;  1B5H A;  2UYE A;  4DIG A;  1P99 A;  5L9M A;  3IOW A;  4OYV A;  1Y4T A;  4N07 A;  1B2H A;  4DXU A;  5AA1 A;  2Q9T A;  4HS7 A;  3MC2 A;  5I57 A;  4LZ8 A;  3IB0 A;  4ELO A;  3FD3 A;  3E3K A;  2B65 A;  2B3B A;  5J1D A;  4M4G A;  4R2F A;  2XXH A;  1I6B A;  5K2X A;  3TCF A;  2QS3 A;  1HSL A;  1N0T A;  4NTL A;  1SVX B;  4F18 A;  1US4 A;  3OEN A;  3HST A;  3TPA A;  1M5F A;  3C35 A;  3KJT A;  1BP5 A;  2HEU A;  3CSG A;  1A99 A;  5F1Q A;  1UIV A;  3IB1 A;  3CSB A;  4TOZ A;  2CMO A;  3T9V A;  2XXR A;  1Y1Z A;  1B5I A;  4H5G A;  5L9O A;  3PV0 E;  2HZL A;  2NUV A;  4MLQ A;  1JEV A;  3VLU A;  3LUY A;  5EYF A;  1NFT A;  4LQ2 A;  1N04 A;  4JWO A;  5KCJ B;  2I0C A;  1UTH A;  1IIT A;  5AA2 B;  4HCY A;  4LUB A;  3KG2 A;  4RXL A;  1IQ7 A;  4FE8 A;  1SDX A;  1URG A;  1EU8 A;  2Y7W A;  3ONM A;  2H99 A;  2A5T B;  2F78 A;  5B7D A;  4PFW A;  1D4N A;  3CFX A;  4WXJ A;  1OIB A;  2RIN A;  1MQH A;  3U92 A;  3EQ1 A;  4C1U A;  3M3K A;  3K1N A;  3USD A;  1MRP A;  4FJP A;  3TEP A;  1Y9U A;  3MJN A;  4ZEB A;  3KSX A;  2GRV A;  3N6T A;  3V89 B;  2E1S A;  3HCQ A;  2LAO A;  4XKP A;  3GZG A;  2P0S A;  2O1M A;  4KD5 A;  1PBP A;  3PUV E;  4U4S A;  1FW0 A;  1A55 A;  3FAT A;  2OCU A;  3U8Q A;  2ZNT A;  1H43 A;  4ZDM A;  3IX1 A;  2GFE A;  1NNT A;  4MLV A;  3T9U A;  1BKA A;  3PPR A;  3RNN A;  4UAC A;  3FIR A;  2O84 X;  5JEI A;  4F1V A;  5ICQ A;  5H8H A;  2RCB A;  4FAT A;  1P1O A;  1HSJ A;  2REG A;  5IKB A;  4OZ9 A;  3KZG A;  1P1Q A;  1A40 A;  1B4Z A;  1OLA A;  4IO3 A;  1JVY A;  4FOR A;  1PB8 A;  4FED A;  4GF8 A;  4AB6 A;  3MP1 A;  1PC3 A;  5B70 A;  4C1T A;  4QSC A;  4GIZ A;  1B9J A;  5I57 B;  1KWH A;  4E0X A;  4KFQ A;  2XXT A;  5BUU A;  3I5O A;  3TFL A;  1RYX A;  2PT1 A;  3M3L A;  5CMM A;  3IK6 B;  1MY4 A;  3PUZ E;  4IO5 A;  4G77 A;  5I2N B;  3O6I A;  3OO9 A;  4PQJ A;  3TTL A;  2Y7I A;  3KOS A;  2UVG A;  4MFI A;  1Y3P A;  2PMS A;  1N3W A;  1B7Z A;  4JWX A;  1LAX A;  4G68 A;  2CZL A;  4BDQ A;  5AA3 A;  2DE4 A;  1JW5 A;  1IXG A;  1QUL A;  1USY H;  1Z7M E;  3CRB A;  3T9X B;  5CMB A;  3PD9 A;  3JV9 A;  1LGB C;  2PYY A;  1MY0 A;  2XXQ A;  2F97 A;  4H8J A;  2R6G E;  2THI A;  3TQW A;  1MS7 A;  1L5T A;  1CB6 A;  3FGS A;  1LAG E;  1UTH B;  4WKM A;  1H45 A;  1TFA A;  4G68 C;  3H6T A;  2OWT A;  3FXU A;  2O6A A;  3ODB A;  1OVT A;  2ANJ A;  4X1B A;  4U22 A;  2FA7 A;  3T66 A;  4OEN A;  4M1V A;  1N3X A;  3IJO B;  4IO6 A;  3KN3 A;  1SW5 A;  3IO4 A;  4YB7 A;  2YLN A;  2HXW A;  1FTM A;  3H03 A;  5FTH A;  4OWD A;  5H8N B;  2F6P A;  4P0G A;  3HV1 A;  4ELP A;  5I2K A;  3B7D A;  1US5 A;  4G8H A;  3TUS A;  4I1D A;  4EQ7 A;  5CMC A;  4R75 A;  4H65 A;  3BFT A;  5JTY B;  1JNF A;  1MH4 A;  5FHO A;  2AYS A;  4DCX A;  3CIJ A;  3HO7 A;  2ZNS A;  1MY3 A;  4I8C A;  2DYX A;  4F39 A;  1LFH A;  1O64 A;  1QVS A;  1Y4C A;  1II5 A;  2DP8 A;  3R7X A;  3A3U A;  3S4U A;  4GRK A;  1MQI A;  3B6W A;  5JK4 A;  3FAS A;  1MG1 A;  3C9H A;  4MF3 A;  3QXM A;  3G3I A;  4ZEF A;  3E9X A;  2R71 A;  3O66 A;  1URS A;  4QFP A;  3PGF A;  4PE5 B;  2RCA A;  5H8H B;  1NH8 A;  2OWS A;  5DEX A;  1B46 A;  3IO6 A;  4UA8 A;  3RGY A;  3ZS6 A;  1GV8 A;  3O6G A;  4YMB A;  4NWC A;  5AA4 A;  5KDT A;  2DVC A;  2RF1 A;  4YKK A;  3RQT A;  2ZMB A;  3PPP A;  5FTI A;  1CE2 A;  2ABH A;  1N76 A;  2Z8D A;  3TCG A;  3FVO A;  5CM6 A;  1QW0 A;  3V5A A;  3G3F A;  4IO4 A;  4TQU Q;  3UOR A;  1MY2 A;  4G8M A;  5M2V A;  4L17 A;  4H6D A;  4IO7 A;  1VSO A;  1N7W A;  3MQ9 A;  4EF1 A;  5H8F A;  4QFK A;  2XX8 A;  1IZ1 A;  3RN8 A;  2QJE A;  1P1N A;  4G68 B;  2VOZ A;  1B3G A;  4THI A;  1NMU A;  3K02 A;  3U93 A;  3I6V A;  4BDN A;  3HN0 A;  2XXP A;  2WKY A;  3F11 A;  4KYE A;  4R6H A;  2V93 A;  2ONS A;  1SI0 A;  3TTR A;  3SEU A;  5BWJ A;  1MXU A;  3PPO A;  3LBS A;  1MPC A;  3UK4 A;  4ZZE A;  3OEM A;  3D4C A;  4QFO A;  2IA4 A;  2ZXT A;  3IOV A;  1IUD A;  1OLC A;  3DM0 A;  3MP6 A;  3TAJ A;  3VE1 B;  3FVK A;  4G2Z A;  1UQW A;  3PD8 A;  1DPE A;  4Q8R A;  4FEC A;  3G3G A;  1Q1K A;  4RY1 A;  5L8D A;  1OQH A;  1JEU A;  4JDF A;  3C33 A;  3I3V A;  4FAJ A;  4RA1 A;  1MM7 A;  5I2K B;  3S9N C;  3O29 A;  4GQO A;  3VVF A;  2PT2 A;  3JYR A;  4BDM A;  4POW A;  5I56 A;  1VFE A;  4K3F A;  2Z8E A;  4RYA A;  1N84 A;  3OEK A;  1H44 A;  4IGR A;  3VXB A;  3IOU A;  2NVU B;  1BTJ A;  1EZP A;  3KBR A;  4QHQ A;  2H25 A;  5I2N A;  2Y84 A;  4PFU A;  1M5B A;  1LAF E;  4OFL A;  1I6A A;  3KSJ A;  1DSN A;  1ZLQ A;  1USY E;  2HFB A;  3HHF A;  3ZSF A;  4ELR A;  3TOD A;  1EZ9 A;  4YIC A;  3OEL A;  5DEX B;  4QFN A;  1FQB A;  3KEI A;  4KHZ E;  1H3D A;  1R9L A;  3BKI B;  1XS5 A;  1B52 A;  2PX1 A;  1B1H A;  4OQO A;  4F31 B;  4OTE A;  2ZYN A;  5AA4 B;  2V84 A;  3W9W A;  5KDT B;  2F6G A;  1JW4 A;  3R26 A;  3O28 A;  4H8I A;  3PUX E;  2G29 A;  3WAF A;  1IXI A;  3EF7 A;  3IR1 A;  4R6Y A;  3QUF A;  1QUI A;  3TCH A;  1A8F A;  3TQL A;  1LB9 A;  2XD2 A;  4LA9 A;  4ZE9 A;  5H8F B;  4ELQ A;  4PP0 A;  2W7Y A;  5ELV A;  2Q2C A;  2HAU A;  4Q5T A;  3TTM A;  4DLD A;  4LZ7 A;  3T9H B;  3MVY A;  5H8N A;  3S9E A;  1RKM A;  1S9T A;  1LCF A;  4F3B A;  2UXA A;  1FCK A;  3FVG A;  1TFD A;  4GL0 A;  4H1X A;  2ONR A;  4OEU A;  2HAV A;  4ONY A;  2DSF A;  1NNP A;  3EHS A;  3W9V A;  1A8E A;  1PBQ A;  5JTY A;  1MY1 A;  2ESN A;  3ILU B;  3E4R A;  4GVO A;  4ECF A;  1NNK A;  4BDL A;  3MBP A;  1HSE A;  1T0K A;  1QUK A;  1QKB A;  1OMP A;  4YKJ A;  1SQY A;  4GOT A;  4NF6 A;  1B3H A;  4YKI A;  1BIY A;  4X9T A;  4F2O A;  1Y1M A;  2FYI A;  3VVE A;  3K1M A;  2UVI A;  1R1N A;  4ZS9 A;  3O6H A;  4R9F A;  3CG1 A;  1R9Q A;  1LFG A;  4OFO A;  1B6H A;  4U1O A;  2A5S A;  3RT6 B;  1M5D A;  5DT6 A;  3A09 A;  2QS4 A;  4IY6 A;  4AQ4 A;  2NOO A;  3SER A;  2HQ0 A;  3SDF A;  3FXR A;  5TP9 A;  3KN8 A;  2X26 A;  2UVJ A;  1JW1 A;  4IY5 A;  4P11 A;  4P0I A;  1A54 A;  3O9P A;  5I56 B;  4U1Z A;  2P1S A;  1OVB A;  3Q27 A;  4ZE8 A;  2DE2 A;  3K00 A;  1F9B A;  3SEV A;  1H76 A;  2XXV A;  3CFZ A;  3CG3 A;  5DYH A;  4BDO A;  3TYH A;  1TXF A;  2I0B A;  2I3V A;  3T96 B;  4X1D A;  1A7L A;  2AL5 A;  5EHS A;  3K1P A;  5DTB A;  3SET A;  4RK2 A;  3B6Q A;  1M5E A;  3ZKL A;  5HPQ A;  2QS2 A;  1O63 A;  4JSD A;  3TKD A;  2M8C A;  1PEB A;  1MPB A;  5FHN A;  4BDR A;  3RLF E;  3EPE A;  3GLB A;  1NKX A;  3LR1 A;  4POX A;  4KI0 E;  2HCA A;  1XVY A;  3VLV A;  1PB7 A;  2B3F A;  2DWI A;  1DTG A;  4PFT A;  4RJZ A;  4IGT A;  1LCT A;  4KYD A;  4NED A;  1B3F A;  3GBA A;  4F2Q A;  1NL5 A;  1AL3 A;  1ZMG A;  3LSF B;  5I59 A;  2QRY A;  5F7V A;  1QJM A;  2DE3 A;  1D9V A;  3P7I A;  4KR5 A;  4DXB A;  3C34 A;  1WOD A;  1B7U A;  2Z22 A;  4ZED A;  3K01 A;  1B0L A;  2XXY A;  1B05 A;  4WEP A;  5HM4 B;  1FTL A;  1VR5 A;  4Z0I A;  4OES A;  1MXW A;  2YPN A;  1FTK A;  4NWD A;  4RPN A;  4DCY A;  3CI8 A;  2F8D A;  2XX7 A;  3DLN A;  5DVF A;  1AOV A;  3MW0 A;  3IAZ A;  3LSW A;  3M3F A;  1DPP A;  3FVN A;  4NF6 B;  3G3J A;  4HTG A;  3S9L C;  1SBP A;  3MUQ A;  2FNC A;  4X48 A;  1POT A;  4O3B A;  5CRY A;  2QS1 A;  2XD3 A;  3C4M A;  1AIV A;  2PBW A;  3OO8 A;  2GHB A;  5TPA B;  5TP9 B;  2ZYM A;  2X7P A;  3H6U A;  4YU0 A;  4GFR A;  2O69 A;  4XKR A;  3MVZ A;  3KOT A;  3RTW B;  2DVZ A;  3RTF B;  3ZKK A;  5HBC A;  2XX9 A;  2G93 A;  4H0W A;  1SI1 A;  3MVW A;  4F19 A;  3L6G A;  1XT8 A;  3QK6 A;  3C31 A;  4PET A;  4KCC A;  4GWO A;  2Q8J A;  1B3L A;  1BLF A;  3O2A A;  3RT8 A;  4OXV A;  2GH9 A;  2DXY A;  4XKN A;  2QPQ A;  2I49 A;  4U4X A;  4U23 A;  3B6T A;  1AH5 A;  2ZYK A;  2YJP A;  5I58 A;  5I84 A;  3Q25 A;  5CMK A;  4KPT A;  4GXS B;  2DWH A;  5CI5 A;  4DE8 A;  4ZEI A;  3BFU A;  3H4Z A;  2OJT A;  3PPN A;  3RPW A;  3N94 A;  2VHA A;  3VDF A;  4G8N A;  1N7X A;  4N6P A;  2P2A A;  1S7Y A;  2F35 A;  1EH3 A;  4C0R A;  4QF9 A;  3K6X A;  1MQJ A;  1FQE A;  2PVU A;  2I4B A;  4Q0C A;  3QIM A;  3OD7 A;  1MDQ A;  2V3Q A;  1NH7 A;  2D3I A;  4NMY A;  1FQC A;  1VE4 A;  1JQF A;  2REJ A;  3D4G A;  5I59 B;  1QKA A;  3VFJ A;  3T22 A;  5ITP A;  1XC1 A;  3VVD A;  2F7B A;  3DP6 A;  1FTJ A;  2O1L A;  3TTK A;  2Y7P A;  1LB8 A;  3S9M C;  4F3G A;  4NF8 A;  1GGG A;  3SKP A;  1WDN A;  3RUM A;  1MPD A;  2BJJ X;  1O7T A;  4QFL A;  1GR2 A;  4JWY A;  4RPO A;  1P1W A;  3ECR A;  3PUY E;  5CBS A;  3O97 A;  1I69 A;  2Z8F A;  3Q28 A;  3RY3 A;  1B58 A;  3AXF A;  2ALU A;  4YAH X;  5L9S A;  2F5X A;  2DOJ A;  3U72 A;  4YZZ A;  1Y3Q A;  2V25 A;  4YMA A;  1XVX A;  2H9B A;  3MZ1 A;  3QSL A;  4EQ9 A;  4LVQ A;  3VV5 A;  3OSQ A;  2D21 A;  3CR9 A;  1URD A;  3CVG A;  2Q2A A;  1XHY A;  4LP2 B;  1ZKB A;  3IJX B;  2O68 A;  3QAX A;  1D3K A;  1JET A;  1TT1 A;  4JSO A;  3LSL A;  3OO6 A;  3OMB A;  1DOT A;  2I48 A;  3SEW A;  4OHN A;  5ISU A;  4OMB A;  1YTV A;  2RC9 A;  4OFJ A;  1MXX A;  2H98 A;  4RNS A;  1TWY A;  2AIX A;  4IB2 A;  1B4H A;  1ZTY A;  3V83 A;  1S50 A;  3FJM A;  2I3W A;  3A3C A;  2RC7 A;  1Z7N E;  4NE4 A;  3C32 A;  4QSE A;  2D5W A;  2O51 A;  3QUJ A;  1RYO A;  3MWB A;  2F7C A;  5AE4 A;  2OLB A;  2I58 A;  4DZ1 A;  4QSD A;  4KYS A;  4EXK A;  3E13 X;  2ZYO A;  4LQ5 A;  1MH3 A;  5I58 B;  2UYF A;  4R72 A;  2X7Q A;  1M5C A;  3PPQ A;  1MXZ A;  1ELJ A;  3WAE A;  4ZZA A;  1UTB B;  1B7H A;  3TDJ A;  5DVJ A;  1B5J A;  2DQV A;  5DVI A;  3LSX A;  3PU5 A;  1XOC A;  3K6W A;  1PB9 A;  4ZEC A;  3K6U A;  3Q26 A;  3DP4 A;  3N6U A;  2QMX A;  3VXC A;  3EHU A;  1MXY A;  1JVX A;  4ZEK A;  5TPA A;  2OZZ A;  3H6W A;  3K0V A;  2KLF A;  4OVJ A;  1Y20 A;  1SYH A;  1I6Q A;  4U21 A;  2DXR A;  3EHT A;  2H4I A;  3JZJ A;  4AB5 A;  1LBC A;  4NF8 B;  3VLW A;  2HZK A;  4U2R A;  2E0S A;  4N13 A;  3EN3 A;  3PUW E;  4Z7E A;  3SES A;  1ZJL A;  1MM6 A;  4FIM A;  3W15 C;  4F22 A;  1B51 A;  3L6H A;  2NXO A;  1MQG A;  4BLA A;  3Q29 A;  5FHM A;  3HPI A;  3UIF A;  2QSX A;  3N5L A;  4WED A;  1MDP 1;  3C36 A;  4TLL B;  2O7I A;  2I6E A;  1ATG A;  1MXV A;  3M8U A;  1SD3 A;  3QYT A;  3OO7 A;  4E0W A;  4GLI A;  3IL1 B;  4XKQ A;  4R9G A;  4KQP A;  1B32 A;  1FQA A;  1YPN A;  1IIW A;  3MZ9 A;  1GTK A;  3K6V A;  5A5X A;  1LFI A;  3FV2 A;  1VFD A;  4F1Y A;  1IXH A;  4OET A;  2DWA A;  4NF4 A;  4YB5 A;  3FJ7 A;  1PDA A;  4EUO A;  3H3G A;  4RK9 A;  3T93 B;  2V3U A;  5ICT A;  3MPK A;  2F7A A;  3UP9 A;  4H67 A;  4ND9 A;  4O3C A;  2AL4 A;  3UGW A;  5H8Q A;  1FQF A;  3MP8 A;  4JBZ A;  4Q30 B;  4ESX A;  2Q88 A;  2H5Y A;  3LC8 A;  1ZBM A;  3KJ7 A;  4NF5 A;  3U1O A;  4XIG Q;  3TMG A;  1YCJ A;  1B0H A;  4PFY A;  5ITO A;  4R74 A;  3FUZ A;  1B1X A;  2VD2 A;  1NNF A;  1IXC A;  2XHD A;  4EF2 A;  2IEE A;  2VGQ A;  3OXN A;  1Y3N A;  3PMW A;  4EXL A;  2QMW A;  5IAI A;  1ANF A;  1IEJ A;  3GXA A;  1SW1 A; 
#chains in the Genus database with same CATH topology
 1YAE A;  3CFL A;  3OSR A;  2XXK A;  1AMF A;  2RKM A;  4LAT A;  2RC8 A;  4LON B;  1R6Z A;  5LOM A;  4EQB A;  4KCD A;  2VPN A;  3IOT A;  1QUJ A;  2Y7R A;  1FQD A;  1IMA A;  3IB2 A;  2OBG A;  1LST A;  1LAH E;  4GL8 A;  4FEB A;  4G4P A;  3H06 B;  3UA8 A;  1POY 1;  1LBB A;  3G7W A;  2UVH A;  4JB7 A;  3FZV A;  2XXW A;  2ZNU A;  1GVC A;  3MYU A;  5J16 A;  2QL3 A;  3HHG A;  1EZO A;  3TZA A;  2ZZW A;  4N81 A;  1IMC A;  4H5F A;  3IOR A;  2NWJ A;  3PMX A;  2XWO A;  4F1U A;  2VD3 A;  1NV2 A;  2CEY A;  4F3S A;  5K2Y A;  2WYK A;  4OER A;  1UIU A;  2DS9 A;  4GXA A;  2XXU A;  2F34 A;  3G3K A;  2Z23 A;  4GD5 A;  1DCU A;  2R9J A;  5AA2 D;  1B40 A;  1OQG A;  3S2V A;  5I7I A;  4TLM B;  5CBR A;  5IZ3 A;  3MPL A;  5KCJ A;  3DEL B;  4I9D A;  3FXQ A;  1P1U A;  5AA2 A;  1FTO A;  3TEL A;  4OVT A;  3KGC A;  4R73 A;  1ZIU A;  1SW2 A;  3DP8 A;  5H8S A;  1LBX A;  2Q89 A;  2A5T A;  4MH5 A;  3V8X B;  3LUZ A;  3G3H A;  1Q35 A;  4XXU A;  5LDZ A;  4HE2 A;  3TTN A;  4NN3 A;  4HCW A;  4DDD A;  3H6V A;  4F3P A;  1FPK A;  2F36 A;  3SEY A;  2I4C A;  3BBR A;  3K2D A;  4EDP A;  1DMB A;  5KZT A;  3RPL A;  4GBV A;  3FV1 A;  4PBQ A;  2VP1 A;  4DXC A;  4HW8 A;  2OK2 A;  1DTZ A;  2QVV A;  2V3T A;  4XFE A;  3MZB A;  4XEQ A;  4R6K A;  2XXX A;  4JXI A;  5A5X B;  3R6U A;  3KFM A;  3UN6 A;  3U94 A;  3OOA A;  4NF4 B;  4YKP A;  4ISU A;  3KN7 A;  1J1N A;  4G61 A;  1B3E A;  3H7M A;  4YB6 A;  3FJG A;  1UTB A;  4I62 A;  1MQD A;  2ONK E;  4GX4 A;  3MAM A;  4QRZ A;  5CC2 A;  4IO2 A;  1D9Y A;  2FBP A;  5H8Q B;  1K9Y A;  5FBP A;  4NQ8 A;  1SYI A;  4F29 A;  1SW4 A;  1LLS A;  1WVJ A;  2O7U A;  2Y7K A;  3K4U A;  1ZU0 A;  2DWJ A;  4MBP A;  3PMV A;  3ILT B;  2XXI A;  3GBB A;  4XTC Q;  3N26 A;  4NF5 B;  4NGU A;  3MVX A;  5EHM A;  3MST A;  2GHA A;  4OEV A;  4LZ5 A;  2XWK A;  2B4L A;  4O3A A;  5TU0 A;  3THI A;  4R2B A;  5F24 A;  3SEX A;  4ESW A;  1B5H A;  4JVD A;  2CZI A;  4HE1 A;  2UYE A;  4GX6 A;  4DIG A;  1P99 A;  5L9M A;  3IOW A;  4OYV A;  1Y4T A;  4N07 A;  1B2H A;  4DXU A;  4PBH A;  5AA1 A;  4GWZ A;  2Q9T A;  1FPE A;  3A29 A;  4HS7 A;  3MC2 A;  5I57 A;  4LZ8 A;  3IB0 A;  4ELO A;  3FD3 A;  3E3K A;  1VDW A;  2B65 A;  2B3B A;  4PCD A;  5J1D A;  2P3N A;  4M4G A;  4R2F A;  2XXH A;  1I6B A;  5K2X A;  3TCF A;  2QS3 A;  1HSL A;  1N0T A;  4NTL A;  1SVX B;  4F18 A;  1US4 A;  3OEN A;  3HST A;  3TPA A;  1M5F A;  3C35 A;  3KJT A;  1BP5 A;  2HEU A;  3CSG A;  4MIJ A;  1A99 A;  5F1Q A;  1UIV A;  3IB1 A;  3CSB A;  4TOZ A;  2CMO A;  1G0I A;  3T9V A;  2XXR A;  1Y1Z A;  1B5I A;  4H5G A;  5L9O A;  3PV0 E;  3SZP A;  2HZL A;  2NUV A;  4MLQ A;  1JEV A;  3VLU A;  4P1E A;  3LUY A;  5EYF A;  1NFT A;  4LQ2 A;  1N04 A;  4JWO A;  5KCJ B;  2PFY A;  2I0C A;  1UTH A;  1IIT A;  5AA2 B;  4HCY A;  4P3L A;  4LUB A;  3KG2 A;  3LV0 A;  4RXL A;  1IQ7 A;  4FE8 A;  1SDX A;  1URG A;  1EU8 A;  2Y7W A;  3ONM A;  2H99 A;  2A5T B;  2F78 A;  1LEV A;  5B7D A;  4PFW A;  3T1B A;  1D4N A;  3CFX A;  3CHG A;  4N6D A;  4WXJ A;  2HXR A;  1OIB A;  2RIN A;  1MQH A;  3U92 A;  3EQ1 A;  4C1U A;  3M3K A;  1FBG A;  3K1N A;  1FBH A;  3USD A;  1MRP A;  4FJP A;  3TEP A;  1Y9U A;  3MJN A;  4ZEB A;  2F3D A;  3KSX A;  2GRV A;  3N6T A;  3V89 B;  2E1S A;  3HCQ A;  2XWV A;  2LAO A;  4XKP A;  4GWW A;  3GZG A;  2P0S A;  2O1M A;  2WBD A;  4KD5 A;  4N4U A;  4OVQ A;  1PBP A;  3PUV E;  4U4S A;  1FW0 A;  1A55 A;  3FAT A;  2OCU A;  3U8Q A;  2ZNT A;  1H43 A;  4ZDM A;  3IX1 A;  2GFE A;  1NNT A;  2B4M A;  4MLV A;  3T9U A;  4H45 A;  1BKA A;  4GWX A;  3PPR A;  3RNN A;  4UAC A;  1QGX A;  3FIR A;  2BJI A;  2XA5 A;  2O84 X;  5JEI A;  4F1V A;  5ICQ A;  1YXI A;  5H8H A;  2RCB A;  4FAT A;  1P1O A;  3NOH A;  1HSJ A;  1YZ0 A;  2REG A;  5IKB A;  4OZ9 A;  3KZG A;  1P1Q A;  1A40 A;  1B4Z A;  1OLA A;  4IO3 A;  1JVY A;  4FOR A;  1PB8 A;  4FED A;  4GF8 A;  4AB6 A;  4NAP A;  3MP1 A;  2WBB A;  1PC3 A;  5B70 A;  4C1T A;  2DDK A;  4O94 A;  4QSC A;  1XI6 A;  4GIZ A;  1B9J A;  5I57 B;  1KWH A;  4E0X A;  4MAG A;  4KFQ A;  2XXT A;  5BUU A;  3I5O A;  3TFL A;  4O8M A;  1INP A;  1RYX A;  2PT1 A;  3M3L A;  5CMM A;  3IK6 B;  1MY4 A;  3PUZ E;  4IO5 A;  4G77 A;  5I2N B;  2WYP A;  3O6I A;  1NV0 A;  3OO9 A;  4PQJ A;  3TTL A;  2Y7I A;  3KOS A;  2UVG A;  4MFI A;  1Y3P A;  2PMS A;  1N3W A;  1B7Z A;  4JWX A;  1LAX A;  4G68 A;  2CZL A;  4BDQ A;  5AA3 A;  1NV7 A;  2DE4 A;  1JW5 A;  1IXG A;  1QUL A;  1USY H;  1Z7M E;  1FPG A;  1NV5 A;  3CRB A;  3T9X B;  5CMB A;  3PD9 A;  3JV9 A;  1LGB C;  2PYY A;  1MY0 A;  2XXQ A;  2F97 A;  4H8J A;  2R6G E;  2THI A;  4MHF A;  3TQW A;  1MS7 A;  1RDX A;  1L5T A;  1CB6 A;  1IMF A;  3FGS A;  4FBP A;  1LAG E;  1UTH B;  4WKM A;  1H45 A;  1TFA A;  4G68 C;  3H6T A;  2OWT A;  2P3V A;  3FXU A;  1RDY A;  2O6A A;  3ODB A;  1NUX A;  1OVT A;  2ANJ A;  4X1B A;  4U22 A;  2FA7 A;  3T66 A;  4MNI A;  4OEN A;  4M1V A;  1N3X A;  3IJO B;  4IO6 A;  3KN3 A;  1NUZ A;  1SW5 A;  3IO4 A;  4YB7 A;  2YLN A;  2HXW A;  1FTM A;  2JJK A;  4JVI A;  3H03 A;  5FTH A;  4OWD A;  5H8N B;  2F6P A;  4P0G A;  3HV1 A;  4ELP A;  5I2K A;  2KR0 A;  3B7D A;  1US5 A;  4G8H A;  3TUS A;  4I1D A;  4EQ7 A;  5CMC A;  4R75 A;  4H65 A;  3BFT A;  5JTY B;  1JNF A;  1MH4 A;  5FHO A;  2AYS A;  4P56 A;  4DCX A;  3CIJ A;  3HO7 A;  2ZNS A;  1MY3 A;  4I8C A;  2DYX A;  4F39 A;  1LFH A;  1O64 A;  1QVS A;  1Y4C A;  1II5 A;  2DP8 A;  3R7X A;  3A3U A;  3S4U A;  4GRK A;  1MQI A;  3B6W A;  5JK4 A;  4UAB A;  3FAS A;  1MG1 A;  3C9H A;  4MF3 A;  3QXM A;  1FPI A;  3G3I A;  4ZEF A;  3E9X A;  2R71 A;  3O66 A;  1URS A;  4QFP A;  1DBZ A;  3PGF A;  4PE5 B;  2RCA A;  5H8H B;  1NH8 A;  2OWS A;  5DEX A;  1B46 A;  3IO6 A;  2ZZV A;  4UA8 A;  5I3S A;  3RGY A;  3ZS6 A;  2CZK A;  1GV8 A;  3O6G A;  2QFL A;  2CEX A;  4YMB A;  4AS5 A;  4NWC A;  5AA4 A;  5ET5 A;  1FRP A;  5KDT A;  2DVC A;  2RF1 A;  1EYJ A;  4YKK A;  3RQT A;  2ZMB A;  4PAK A;  3PPP A;  5FTI A;  1CE2 A;  4OVS A;  2ABH A;  1N76 A;  1NV3 A;  2Z8D A;  3TCG A;  3FVO A;  5CM6 A;  1QW0 A;  3V5A A;  3G3F A;  4IO4 A;  5EQ8 A;  4TQU Q;  3UOR A;  4PTK A;  1MY2 A;  4G8M A;  5M2V A;  4L17 A;  4H6D A;  4IO7 A;  1VSO A;  1N7W A;  3MQ9 A;  4EF1 A;  1FPL A;  5H8F A;  4QFK A;  2XX8 A;  1IZ1 A;  3RN8 A;  2QJE A;  1P1N A;  4G68 B;  2VOZ A;  1B3G A;  4THI A;  1NMU A;  3K02 A;  3U93 A;  3I6V A;  4BDN A;  3HN0 A;  2XXP A;  3IFC A;  2WKY A;  3F11 A;  2V4C A;  4KYE A;  4PDD A;  4R6H A;  5EQ7 A;  2V93 A;  1IMD A;  1FBD A;  2ONS A;  1SI0 A;  3TTR A;  3FBP A;  3SEU A;  5BWJ A;  1LBV A;  3B8B A;  1MXU A;  3PPO A;  3LBS A;  4NG7 A;  1MPC A;  3UK4 A;  4ZZE A;  3OEM A;  3D4C A;  4QFO A;  2IA4 A;  3RYD A;  2ZXT A;  3IOV A;  1IUD A;  1OLC A;  4P8B A;  3DM0 A;  3MP6 A;  3TAJ A;  3VE1 B;  3FVK A;  4G2Z A;  1UQW A;  3PD8 A;  1DPE A;  4Q8R A;  4FEC A;  3G3G A;  2WX9 A;  1Q1K A;  4RY1 A;  5L8D A;  1OQH A;  1JEU A;  4JDF A;  2VPO A;  3C33 A;  3I3V A;  4FAJ A;  4RA1 A;  1MM7 A;  5I2K B;  3S9N C;  3O29 A;  4GQO A;  3VVF A;  2PT2 A;  3JYR A;  4BDM A;  4POW A;  5I56 A;  1VFE A;  4K3F A;  2Z8E A;  4RYA A;  1N84 A;  5IGA A;  3OEK A;  1H44 A;  4GWY A;  4IGR A;  3VXB A;  3IOU A;  2NVU B;  1LBZ A;  5EQA A;  1BTJ A;  1EZP A;  3KBR A;  4O7I A;  4QHQ A;  2H25 A;  5I2N A;  2Y84 A;  4PFU A;  1M5B A;  1LAF E;  4DI4 B;  4OFL A;  4PF6 A;  5EYH A;  1I6A A;  3KSJ A;  1DSN A;  1ZLQ A;  2FHY A;  1USY E;  2HFB A;  1NI9 A;  4DI3 D;  1NUW A;  3HHF A;  3ZSF A;  4ELR A;  3GYY A;  3BIG A;  3TOD A;  1EZ9 A;  4YIC A;  3OEL A;  5DEX B;  4QFN A;  1FQB A;  3KEI A;  4KHZ E;  1H3D A;  1R9L A;  5IM2 A;  3BKI B;  1XS5 A;  1B52 A;  4MNC A;  2PX1 A;  1B1H A;  4OQO A;  4F31 B;  4OTE A;  2ZYN A;  5AA4 B;  2V84 A;  3U65 A;  3W9W A;  5KDT B;  2F6G A;  1JW4 A;  3R26 A;  3O28 A;  4H8I A;  3PUX E;  2G29 A;  4HXV A;  3WAF A;  1IXI A;  3EF7 A;  3IR1 A;  4R6Y A;  3QUF A;  2QVU A;  5ET8 A;  1QUI A;  3TCH A;  1A8F A;  1D9Q A;  4PFI A;  3TQL A;  1LB9 A;  2XD2 A;  4LA9 A;  4ZE9 A;  4MX6 A;  5H8F B;  4ELQ A;  4PP0 A;  2W7Y A;  5ELV A;  2Q2C A;  2HAU A;  4Q5T A;  3TTM A;  4DLD A;  4LZ7 A;  3T9H B;  3MVY A;  5H8N A;  3S9E A;  1RKM A;  1S9T A;  1LCF A;  4F3B A;  2UXA A;  1FCK A;  3FVG A;  1TFD A;  4GL0 A;  4H1X A;  2ONR A;  4OEU A;  2HAV A;  4ONY A;  2DSF A;  1NNP A;  3EHS A;  3W9V A;  1A8E A;  1PBQ A;  5JTY A;  1MY1 A;  2ESN A;  3ILU B;  3E4R A;  4GVO A;  5A5L A;  4ECF A;  1NNK A;  4BDL A;  3MBP A;  1HSE A;  1T0K A;  1QUK A;  1QKB A;  1OMP A;  4YKJ A;  1SQY A;  4GOT A;  4NF6 A;  1B3H A;  4YKI A;  1NV6 A;  1BIY A;  1FPB A;  4X9T A;  4F2O A;  1Y1M A;  4MNP A;  2FYI A;  3VVE A;  3K1M A;  2UVI A;  1R1N A;  4ZS9 A;  1NV1 A;  3O6H A;  4R9F A;  3CG1 A;  1R9Q A;  1LFG A;  4OFO A;  1B6H A;  4U1O A;  2A5S A;  2F3B A;  3RT6 B;  1M5D A;  2GQ1 A;  5DT6 A;  3A09 A;  1FTA A;  2QS4 A;  1JP4 A;  4IY6 A;  4AQ4 A;  2NOO A;  3SER A;  2HQ0 A;  3SDF A;  3FXR A;  5TP9 A;  3KN8 A;  2X26 A;  2UVJ A;  1JW1 A;  4IY5 A;  1FBC A;  4P11 A;  4P0I A;  1A54 A;  3O9P A;  2Y5L A;  5I56 B;  4U1Z A;  2P1S A;  1OVB A;  3Q27 A;  4ZE8 A;  2DE2 A;  3K00 A;  4IR8 A;  2CZH A;  1F9B A;  3SEV A;  1H76 A;  2XXV A;  3CFZ A;  3CG3 A;  5DYH A;  4BDO A;  3TYH A;  1TXF A;  2I0B A;  2I3V A;  3T96 B;  1DK4 A;  4X1D A;  4PGP A;  4X8R A;  1LBY A;  2PCR A;  3T0J A;  1A7L A;  2QVR A;  2AL5 A;  5EHS A;  3K1P A;  5DTB A;  2FVZ A;  1NUY A;  5I5P A;  3SET A;  4RK2 A;  3B6Q A;  1M5E A;  3ZKL A;  5HPQ A;  2QS2 A;  1O63 A;  4JSD A;  3TKD A;  2MKZ A;  2M8C A;  1PEB A;  1MPB A;  5FHN A;  4BDR A;  3RLF E;  4P9K A;  3EPE A;  3GLB A;  3EKI A;  4OVP A;  1NKX A;  3LR1 A;  4POX A;  4KI0 E;  2HCA A;  1XVY A;  3VLV A;  1PB7 A;  2B3F A;  2DWI A;  1DTG A;  4PFT A;  4RJZ A;  4IGT A;  4PE3 A;  1LCT A;  4KYD A;  4NED A;  1B3F A;  3GBA A;  4F2Q A;  1NL5 A;  1AL3 A;  1ZMG A;  1AWB A;  3LSF B;  5I59 A;  1YYZ A;  2QRY A;  5F7V A;  1QJM A;  2DE3 A;  1D9V A;  2R8T A;  3P7I A;  4KR5 A;  4DXB A;  3C34 A;  1WOD A;  4PC9 A;  1B7U A;  2Z22 A;  4ZED A;  3K01 A;  5IZZ A;  1B0L A;  4GX3 A;  2XXY A;  1B05 A;  4WEP A;  5HM4 B;  1FTL A;  1VR5 A;  4Z0I A;  4OES A;  1MXW A;  2YPN A;  4PAF A;  1FTK A;  4NWD A;  4RPN A;  3KBZ A;  4DCY A;  3CI8 A;  2F8D A;  2XX7 A;  3DLN A;  5DVF A;  1AOV A;  3MW0 A;  3IAZ A;  2VT5 A;  3LSW A;  3M3F A;  1DPP A;  3FVN A;  4NF6 B;  3G3J A;  4HTG A;  3S9L C;  1SBP A;  3MUQ A;  2KQZ A;  2FNC A;  4PAI A;  4X48 A;  4MCO A;  1POT A;  4N8Y A;  4O3B A;  5CRY A;  2QS1 A;  2XD3 A;  3C4M A;  1AIV A;  2PBW A;  3OO8 A;  2GHB A;  5TPA B;  1CNQ A;  5TP9 B;  2ZYM A;  2X7P A;  4GWS A;  3H6U A;  4YU0 A;  2L5V A;  4GFR A;  2O69 A;  4XKR A;  5EQ9 A;  3MVZ A;  3KOT A;  3RTW B;  2DVZ A;  3RTF B;  3ZKK A;  5HBC A;  2XX9 A;  5EYG A;  2G93 A;  4H0W A;  1SI1 A;  3MVW A;  4F19 A;  3L6G A;  1XT8 A;  4XF5 A;  3QK6 A;  3C31 A;  4PET A;  4KCC A;  4GWO A;  2Q8J A;  1B3L A;  1FPF A;  1BLF A;  3O2A A;  3RT8 A;  4OXV A;  2GH9 A;  2DXY A;  4XKN A;  2QPQ A;  2I49 A;  4U4X A;  4U23 A;  3B6T A;  1AH5 A;  2ZYK A;  1FPJ A;  2YJP A;  3B50 A;  5I58 A;  5I84 A;  3Q25 A;  5CMK A;  2FIX A;  1FJ9 A;  2OX3 A;  4KPT A;  4GXS B;  2DWH A;  5CI5 A;  4DE8 A;  4ZEI A;  3BFU A;  3H4Z A;  2OJT A;  3PPN A;  3RPW A;  3N94 A;  2VHA A;  3VDF A;  4G8N A;  1N7X A;  4N6P A;  2P2A A;  1S7Y A;  2F35 A;  1EH3 A;  4C0R A;  4QF9 A;  4MMP A;  3K6X A;  3PTY A;  4PFB A;  1MQJ A;  1FQE A;  2PVU A;  2I4B A;  4Q0C A;  3QIM A;  2Y5K A;  5ET6 A;  3OD7 A;  1MDQ A;  2V3Q A;  1NH7 A;  2D3I A;  4NMY A;  1FJ6 A;  1FQC A;  1VE4 A;  2FIE A;  1JQF A;  4H46 A;  2REJ A;  3D4G A;  1RDZ A;  5I59 B;  1QKA A;  3VFJ A;  3T22 A;  5ITP A;  1NV4 A;  3KC0 A;  1XC1 A;  3VVD A;  2F7B A;  2HHM A;  1G0H A;  1SPI A;  1IME A;  3DP6 A;  1FTJ A;  4QXD A;  2O1L A;  2ZZX A;  3TTK A;  2Y7P A;  1LB8 A;  1FBF A;  3S9M C;  4F3G A;  4NF8 A;  1GGG A;  3SKP A;  1WDN A;  3RUM A;  1MPD A;  2BJJ X;  1O7T A;  4QFL A;  1GR2 A;  4JWY A;  5LTC A;  4RPO A;  1P1W A;  3ECR A;  3PUY E;  5CBS A;  3O97 A;  1I69 A;  2Z8F A;  3Q28 A;  3RY3 A;  1B58 A;  3AXF A;  2ALU A;  4YAH X;  5L9S A;  2F5X A;  2DOJ A;  3U72 A;  4YZZ A;  1Y3Q A;  2V25 A;  4YMA A;  4KXP A;  5IZ1 A;  1XVX A;  4PDH A;  4PGN A;  2H9B A;  3MZ1 A;  5ET7 A;  3QSL A;  4EQ9 A;  3HFU A;  4LVQ A;  3VV5 A;  3OSQ A;  2D21 A;  3CR9 A;  1URD A;  3CVG A;  2Q2A A;  1XHY A;  2XWI A;  3ISP A;  4LP2 B;  1ZKB A;  3IJX B;  2O68 A;  3QAX A;  1D3K A;  1JET A;  1TT1 A;  4JSO A;  3LSL A;  3OO6 A;  3OMB A;  1DOT A;  2I48 A;  3SEW A;  4OHN A;  5ISU A;  2HPG A;  4OMB A;  1YTV A;  2RC9 A;  1K9Z A;  4OFJ A;  1MXX A;  2H98 A;  1EYK A;  4RNS A;  1TWY A;  5IZ3 B;  2AIX A;  4X04 A;  4N8G A;  4PF8 A;  4IB2 A;  1B4H A;  1ZTY A;  2OWZ A;  3V83 A;  1S50 A;  3FJM A;  2I3W A;  4N6K A;  3A3C A;  2RC7 A;  1Z7N E;  4NE4 A;  3C32 A;  4QSE A;  2D5W A;  4OAN A;  2O51 A;  1LBW A;  3QUJ A;  1RYO A;  3MWB A;  4NF0 A;  2F7C A;  4OA4 A;  5AE4 A;  2OLB A;  2I58 A;  4DZ1 A;  2PFZ A;  4QSD A;  4KYS A;  4NHB A;  4EXK A;  3E13 X;  2ZYO A;  3RPL B;  4LQ5 A;  1MH3 A;  5I58 B;  4I3Y A;  5DW8 A;  2UYF A;  4R72 A;  2X7Q A;  4HE0 A;  1M5C A;  3PPQ A;  1MXZ A;  1ELJ A;  4N17 A;  3WAE A;  4ZZA A;  1UTB B;  1B7H A;  3TDJ A;  3E79 A;  5DVJ A;  5T3J A;  1FPD A;  1B5J A;  1Q9D A;  3D1R A;  2DQV A;  5DVI A;  4AS4 A;  3LSX A;  3PU5 A;  1XOC A;  3K6W A;  4GWU A;  1PB9 A;  3IFA A;  4ZEC A;  3FXB A;  3K6U A;  3Q26 A;  1FSA A;  3DP4 A;  3N6U A;  2QMX A;  3VXC A;  3EHU A;  3E78 A;  1MXY A;  1JVX A;  4ZEK A;  4LN5 A;  4NX1 A;  2OZZ A;  3H6W A;  5TPA A;  2Q8M A;  3QMF A;  3K0V A;  2KLF A;  4OVJ A;  1Y20 A;  1SYH A;  1I6Q A;  1KA0 A;  2WEF A;  4MJO A;  4U21 A;  2DXR A;  3EHT A;  4N15 A;  2H4I A;  3JZJ A;  4AB5 A;  1LBC A;  4NF8 B;  3VLW A;  2HZK A;  4U2R A;  2E0S A;  4N13 A;  3EN3 A;  3PUW E;  4Z7E A;  3SES A;  1ZJL A;  1MM6 A;  4FIM A;  3W15 C;  4F22 A;  1B51 A;  3L6H A;  1EYI A;  2NXO A;  1MQG A;  4BLA A;  3Q29 A;  5FHM A;  3HPI A;  3UIF A;  2QSX A;  3N5L A;  4WED A;  1MDP 1;  3C36 A;  4TLL B;  2O7I A;  4MEV A;  2I6E A;  1ATG A;  1MXV A;  3M8U A;  1SD3 A;  1KZ8 A;  3QYT A;  3OO7 A;  1FBE A;  1FBP A;  1KA1 A;  4E0W A;  2Q74 A;  4GLI A;  3IL1 B;  4XKQ A;  4GBW A;  4R9G A;  4PFR A;  4QBA A;  4KQP A;  4P1L A;  1B32 A;  1FQA A;  1YPN A;  1IIW A;  3MZ9 A;  1GTK A;  3K6V A;  5A5X A;  1LFI A;  3FV2 A;  1VFD A;  4F1Y A;  1IXH A;  5ESY A;  4OET A;  2DWA A;  4NF4 A;  4YB5 A;  4N91 A;  3FJ7 A;  1BK4 A;  1PDA A;  4EUO A;  3H3G A;  4RK9 A;  3T93 B;  2V3U A;  5ICT A;  3KC1 A;  3MPK A;  2F7A A;  3UP9 A;  4H67 A;  4ND9 A;  4O3C A;  2AL4 A;  3UGW A;  5H8Q A;  1FQF A;  3MP8 A;  4JBZ A;  4Q30 B;  4O7M A;  4ESX A;  2Q88 A;  2H5Y A;  3LC8 A;  1ZBM A;  3KJ7 A;  4NF5 A;  3U1O A;  4XIG Q;  3TMG A;  1YCJ A;  1B0H A;  4PFY A;  5ITO A;  4R74 A;  3BIH A;  3FUZ A;  1B1X A;  2VD2 A;  1NNF A;  4JVC A;  1IXC A;  4I3E A;  2XHD A;  4EF2 A;  4P47 A;  2IEE A;  2VGQ A;  3OXN A;  4I40 A;  3ROJ A;  1Y3N A;  3PMW A;  4EXL A;  2QMW A;  5IAI A;  1ANF A;  1IEJ A;  3GXA A;  1IMB A;  1SW1 A;  4OVR A; 
#chains in the Genus database with same CATH homology
 1YAE A;  3CFL A;  3OSR A;  1AMF A;  2RKM A;  4LAT A;  2RC8 A;  4LON B;  1R6Z A;  5LOM A;  4EQB A;  4KCD A;  3IOT A;  1QUJ A;  2Y7R A;  1FQD A;  3IB2 A;  2OBG A;  1LST A;  1LAH E;  4GL8 A;  4FEB A;  4G4P A;  3H06 B;  3UA8 A;  1POY 1;  1LBB A;  3G7W A;  2UVH A;  4JB7 A;  3FZV A;  2XXW A;  2ZNU A;  1GVC A;  2QL3 A;  3HHG A;  1EZO A;  3TZA A;  4H5F A;  3IOR A;  2NWJ A;  3PMX A;  4F1U A;  2VD3 A;  4F3S A;  5K2Y A;  1UIU A;  2DS9 A;  4GXA A;  4OER A;  2XXU A;  2F34 A;  3G3K A;  2Z23 A;  4GD5 A;  2R9J A;  5AA2 D;  1B40 A;  1OQG A;  3S2V A;  4TLM B;  5CBR A;  3MPL A;  5KCJ A;  3DEL B;  4I9D A;  3FXQ A;  1P1U A;  5AA2 A;  1FTO A;  3TEL A;  3KGC A;  4R73 A;  1ZIU A;  1SW2 A;  3DP8 A;  5H8S A;  2Q89 A;  2A5T A;  4MH5 A;  3V8X B;  3G3H A;  1Q35 A;  4XXU A;  3TTN A;  4HCW A;  4DDD A;  3H6V A;  4F3P A;  2F36 A;  3SEY A;  2I4C A;  3BBR A;  3K2D A;  4EDP A;  1DMB A;  5KZT A;  3FV1 A;  2VP1 A;  4DXC A;  4HW8 A;  2OK2 A;  1DTZ A;  2V3T A;  3MZB A;  4R6K A;  2XXX A;  4JXI A;  5A5X B;  3R6U A;  3KFM A;  3UN6 A;  3U94 A;  3OOA A;  4NF4 B;  4YKP A;  4ISU A;  3KN7 A;  1J1N A;  1B3E A;  3H7M A;  4YB6 A;  3FJG A;  1UTB A;  4I62 A;  1MQD A;  2ONK E;  3MAM A;  4QRZ A;  5CC2 A;  4IO2 A;  1D9Y A;  5H8Q B;  1SYI A;  4F29 A;  1SW4 A;  1LLS A;  1WVJ A;  2O7U A;  2Y7K A;  3K4U A;  1ZU0 A;  2DWJ A;  4MBP A;  3PMV A;  3ILT B;  2XXI A;  3GBB A;  4XTC Q;  3N26 A;  4NF5 B;  3MVX A;  5EHM A;  2GHA A;  4OEV A;  4LZ5 A;  4O3A A;  5TU0 A;  3THI A;  4R2B A;  3SEX A;  4ESW A;  1B5H A;  2UYE A;  4DIG A;  1P99 A;  5L9M A;  3IOW A;  4OYV A;  1Y4T A;  4N07 A;  1B2H A;  4DXU A;  5AA1 A;  2Q9T A;  4HS7 A;  3MC2 A;  5I57 A;  4LZ8 A;  3IB0 A;  4ELO A;  3FD3 A;  3E3K A;  2B65 A;  2B3B A;  5J1D A;  4M4G A;  4R2F A;  2XXH A;  1I6B A;  5K2X A;  3TCF A;  2QS3 A;  1HSL A;  1N0T A;  4NTL A;  1SVX B;  4F18 A;  1US4 A;  3OEN A;  3HST A;  3TPA A;  1M5F A;  3C35 A;  3KJT A;  1BP5 A;  2HEU A;  3CSG A;  1A99 A;  5F1Q A;  1UIV A;  3IB1 A;  3CSB A;  4TOZ A;  2CMO A;  3T9V A;  2XXR A;  1Y1Z A;  1B5I A;  4H5G A;  5L9O A;  3PV0 E;  2HZL A;  2NUV A;  4MLQ A;  1JEV A;  3VLU A;  3LUY A;  5EYF A;  1NFT A;  4LQ2 A;  1N04 A;  4JWO A;  5KCJ B;  2I0C A;  1UTH A;  1IIT A;  5AA2 B;  4HCY A;  4LUB A;  3KG2 A;  4RXL A;  1IQ7 A;  4FE8 A;  1SDX A;  1URG A;  1EU8 A;  2Y7W A;  3ONM A;  2H99 A;  2A5T B;  2F78 A;  5B7D A;  4PFW A;  1D4N A;  3CFX A;  4WXJ A;  1OIB A;  2RIN A;  1MQH A;  3U92 A;  3EQ1 A;  4C1U A;  3M3K A;  3K1N A;  3USD A;  1MRP A;  4FJP A;  3TEP A;  1Y9U A;  3MJN A;  4ZEB A;  3KSX A;  2GRV A;  3N6T A;  3V89 B;  2E1S A;  3HCQ A;  2LAO A;  4XKP A;  3GZG A;  2P0S A;  2O1M A;  4KD5 A;  1PBP A;  3PUV E;  4U4S A;  1FW0 A;  1A55 A;  3FAT A;  2OCU A;  3U8Q A;  2ZNT A;  1H43 A;  4ZDM A;  3IX1 A;  2GFE A;  1NNT A;  4MLV A;  3T9U A;  1BKA A;  3PPR A;  3RNN A;  4UAC A;  3FIR A;  2O84 X;  5JEI A;  4F1V A;  5ICQ A;  5H8H A;  2RCB A;  4FAT A;  1P1O A;  1HSJ A;  2REG A;  5IKB A;  4OZ9 A;  3KZG A;  1P1Q A;  1A40 A;  1B4Z A;  1OLA A;  4IO3 A;  1JVY A;  4FOR A;  1PB8 A;  4FED A;  4GF8 A;  4AB6 A;  3MP1 A;  1PC3 A;  5B70 A;  4C1T A;  4QSC A;  4GIZ A;  1B9J A;  5I57 B;  1KWH A;  4E0X A;  4KFQ A;  2XXT A;  5BUU A;  3I5O A;  3TFL A;  1RYX A;  2PT1 A;  3M3L A;  5CMM A;  3IK6 B;  1MY4 A;  3PUZ E;  4IO5 A;  4G77 A;  5I2N B;  3O6I A;  3OO9 A;  4PQJ A;  3TTL A;  2Y7I A;  3KOS A;  2UVG A;  4MFI A;  1Y3P A;  2PMS A;  1N3W A;  1B7Z A;  4JWX A;  1LAX A;  4G68 A;  2CZL A;  4BDQ A;  5AA3 A;  2DE4 A;  1JW5 A;  1IXG A;  1QUL A;  1USY H;  1Z7M E;  3CRB A;  3T9X B;  5CMB A;  3PD9 A;  3JV9 A;  1LGB C;  2PYY A;  1MY0 A;  2XXQ A;  2F97 A;  4H8J A;  2R6G E;  2THI A;  3TQW A;  1MS7 A;  1L5T A;  1CB6 A;  3FGS A;  1LAG E;  1UTH B;  4WKM A;  1H45 A;  1TFA A;  4G68 C;  3H6T A;  2OWT A;  3FXU A;  2O6A A;  3ODB A;  1OVT A;  2ANJ A;  4X1B A;  4U22 A;  2FA7 A;  3T66 A;  4OEN A;  4M1V A;  1N3X A;  3IJO B;  4IO6 A;  3KN3 A;  1SW5 A;  3IO4 A;  4YB7 A;  2YLN A;  2HXW A;  1FTM A;  3H03 A;  5FTH A;  4OWD A;  5H8N B;  2F6P A;  4P0G A;  3HV1 A;  4ELP A;  5I2K A;  3B7D A;  1US5 A;  4G8H A;  3TUS A;  4I1D A;  4EQ7 A;  5CMC A;  4R75 A;  4H65 A;  3BFT A;  5JTY B;  1JNF A;  1MH4 A;  5FHO A;  2AYS A;  4DCX A;  3CIJ A;  3HO7 A;  2ZNS A;  1MY3 A;  4I8C A;  2DYX A;  4F39 A;  1LFH A;  1O64 A;  1QVS A;  1Y4C A;  1II5 A;  2DP8 A;  3R7X A;  3A3U A;  3S4U A;  4GRK A;  1MQI A;  3B6W A;  5JK4 A;  3FAS A;  1MG1 A;  3C9H A;  4MF3 A;  3QXM A;  3G3I A;  4ZEF A;  3E9X A;  2R71 A;  3O66 A;  1URS A;  4QFP A;  3PGF A;  4PE5 B;  2RCA A;  5H8H B;  1NH8 A;  2OWS A;  5DEX A;  1B46 A;  3IO6 A;  4UA8 A;  3RGY A;  3ZS6 A;  1GV8 A;  3O6G A;  4YMB A;  4NWC A;  5AA4 A;  5KDT A;  2DVC A;  2RF1 A;  4YKK A;  3RQT A;  2ZMB A;  3PPP A;  5FTI A;  1CE2 A;  2ABH A;  1N76 A;  2Z8D A;  3TCG A;  3FVO A;  5CM6 A;  1QW0 A;  3V5A A;  3G3F A;  4IO4 A;  4TQU Q;  3UOR A;  1MY2 A;  4G8M A;  5M2V A;  4L17 A;  4H6D A;  4IO7 A;  1VSO A;  1N7W A;  3MQ9 A;  4EF1 A;  5H8F A;  4QFK A;  2XX8 A;  1IZ1 A;  3RN8 A;  2QJE A;  1P1N A;  4G68 B;  2VOZ A;  1B3G A;  4THI A;  1NMU A;  3K02 A;  3U93 A;  3I6V A;  4BDN A;  3HN0 A;  2XXP A;  2WKY A;  3F11 A;  4KYE A;  4R6H A;  2V93 A;  2ONS A;  1SI0 A;  3TTR A;  3SEU A;  5BWJ A;  1MXU A;  3PPO A;  3LBS A;  1MPC A;  3UK4 A;  4ZZE A;  3OEM A;  3D4C A;  4QFO A;  2IA4 A;  2ZXT A;  3IOV A;  1IUD A;  1OLC A;  3DM0 A;  3MP6 A;  3TAJ A;  3VE1 B;  3FVK A;  4G2Z A;  1UQW A;  3PD8 A;  1DPE A;  4Q8R A;  4FEC A;  3G3G A;  1Q1K A;  4RY1 A;  5L8D A;  1OQH A;  1JEU A;  4JDF A;  3C33 A;  3I3V A;  4FAJ A;  4RA1 A;  1MM7 A;  5I2K B;  3S9N C;  3O29 A;  4GQO A;  3VVF A;  2PT2 A;  3JYR A;  4BDM A;  4POW A;  5I56 A;  1VFE A;  4K3F A;  2Z8E A;  4RYA A;  1N84 A;  3OEK A;  1H44 A;  4IGR A;  3VXB A;  3IOU A;  2NVU B;  1BTJ A;  1EZP A;  3KBR A;  4QHQ A;  2H25 A;  5I2N A;  2Y84 A;  4PFU A;  1M5B A;  1LAF E;  4OFL A;  1I6A A;  3KSJ A;  1DSN A;  1ZLQ A;  1USY E;  2HFB A;  3HHF A;  3ZSF A;  4ELR A;  3TOD A;  1EZ9 A;  4YIC A;  3OEL A;  5DEX B;  4QFN A;  1FQB A;  3KEI A;  4KHZ E;  1H3D A;  1R9L A;  3BKI B;  1XS5 A;  1B52 A;  2PX1 A;  1B1H A;  4OQO A;  4F31 B;  4OTE A;  2ZYN A;  5AA4 B;  2V84 A;  3W9W A;  5KDT B;  2F6G A;  1JW4 A;  3R26 A;  3O28 A;  4H8I A;  3PUX E;  2G29 A;  3WAF A;  1IXI A;  3EF7 A;  3IR1 A;  4R6Y A;  3QUF A;  1QUI A;  3TCH A;  1A8F A;  3TQL A;  1LB9 A;  2XD2 A;  4LA9 A;  4ZE9 A;  5H8F B;  4ELQ A;  4PP0 A;  2W7Y A;  5ELV A;  2Q2C A;  2HAU A;  4Q5T A;  3TTM A;  4DLD A;  4LZ7 A;  3T9H B;  3MVY A;  5H8N A;  3S9E A;  1RKM A;  1S9T A;  1LCF A;  4F3B A;  2UXA A;  1FCK A;  3FVG A;  1TFD A;  4GL0 A;  4H1X A;  2ONR A;  4OEU A;  2HAV A;  4ONY A;  2DSF A;  1NNP A;  3EHS A;  3W9V A;  1A8E A;  1PBQ A;  5JTY A;  1MY1 A;  2ESN A;  3ILU B;  3E4R A;  4GVO A;  4ECF A;  1NNK A;  4BDL A;  3MBP A;  1HSE A;  1T0K A;  1QUK A;  1QKB A;  1OMP A;  4YKJ A;  1SQY A;  4GOT A;  4NF6 A;  1B3H A;  4YKI A;  1BIY A;  4X9T A;  4F2O A;  1Y1M A;  2FYI A;  3VVE A;  3K1M A;  2UVI A;  1R1N A;  4ZS9 A;  3O6H A;  4R9F A;  3CG1 A;  1R9Q A;  1LFG A;  4OFO A;  1B6H A;  4U1O A;  2A5S A;  3RT6 B;  1M5D A;  5DT6 A;  3A09 A;  2QS4 A;  4IY6 A;  4AQ4 A;  2NOO A;  3SER A;  2HQ0 A;  3SDF A;  3FXR A;  5TP9 A;  3KN8 A;  2X26 A;  2UVJ A;  1JW1 A;  4IY5 A;  4P11 A;  4P0I A;  1A54 A;  3O9P A;  5I56 B;  4U1Z A;  2P1S A;  1OVB A;  3Q27 A;  4ZE8 A;  2DE2 A;  3K00 A;  1F9B A;  3SEV A;  1H76 A;  2XXV A;  3CFZ A;  3CG3 A;  5DYH A;  4BDO A;  3TYH A;  1TXF A;  2I0B A;  2I3V A;  3T96 B;  4X1D A;  1A7L A;  2AL5 A;  5EHS A;  3K1P A;  5DTB A;  3SET A;  4RK2 A;  3B6Q A;  1M5E A;  3ZKL A;  5HPQ A;  2QS2 A;  1O63 A;  4JSD A;  3TKD A;  2M8C A;  1PEB A;  1MPB A;  5FHN A;  4BDR A;  3RLF E;  3EPE A;  3GLB A;  1NKX A;  3LR1 A;  4POX A;  4KI0 E;  2HCA A;  1XVY A;  3VLV A;  1PB7 A;  2B3F A;  2DWI A;  1DTG A;  4PFT A;  4RJZ A;  4IGT A;  1LCT A;  4KYD A;  4NED A;  1B3F A;  3GBA A;  4F2Q A;  1NL5 A;  1AL3 A;  1ZMG A;  3LSF B;  5I59 A;  2QRY A;  5F7V A;  1QJM A;  2DE3 A;  1D9V A;  3P7I A;  4KR5 A;  4DXB A;  3C34 A;  1WOD A;  1B7U A;  2Z22 A;  4ZED A;  3K01 A;  1B0L A;  2XXY A;  1B05 A;  4WEP A;  5HM4 B;  1FTL A;  1VR5 A;  4Z0I A;  4OES A;  1MXW A;  2YPN A;  1FTK A;  4NWD A;  4RPN A;  4DCY A;  3CI8 A;  2F8D A;  2XX7 A;  3DLN A;  5DVF A;  1AOV A;  3MW0 A;  3IAZ A;  3LSW A;  3M3F A;  1DPP A;  3FVN A;  4NF6 B;  3G3J A;  4HTG A;  3S9L C;  1SBP A;  3MUQ A;  2FNC A;  4X48 A;  1POT A;  4O3B A;  5CRY A;  2QS1 A;  2XD3 A;  3C4M A;  1AIV A;  2PBW A;  3OO8 A;  2GHB A;  5TPA B;  5TP9 B;  2ZYM A;  2X7P A;  3H6U A;  4YU0 A;  4GFR A;  2O69 A;  4XKR A;  3MVZ A;  3KOT A;  3RTW B;  2DVZ A;  3RTF B;  3ZKK A;  5HBC A;  2XX9 A;  2G93 A;  4H0W A;  1SI1 A;  3MVW A;  4F19 A;  3L6G A;  1XT8 A;  3QK6 A;  3C31 A;  4PET A;  4KCC A;  4GWO A;  2Q8J A;  1B3L A;  1BLF A;  3O2A A;  3RT8 A;  4OXV A;  2GH9 A;  2DXY A;  4XKN A;  2QPQ A;  2I49 A;  4U4X A;  4U23 A;  3B6T A;  1AH5 A;  2ZYK A;  2YJP A;  5I58 A;  5I84 A;  3Q25 A;  5CMK A;  4KPT A;  4GXS B;  2DWH A;  5CI5 A;  4DE8 A;  4ZEI A;  3BFU A;  3H4Z A;  2OJT A;  3PPN A;  3RPW A;  3N94 A;  2VHA A;  3VDF A;  4G8N A;  1N7X A;  4N6P A;  2P2A A;  1S7Y A;  2F35 A;  1EH3 A;  4C0R A;  4QF9 A;  3K6X A;  1MQJ A;  1FQE A;  2PVU A;  2I4B A;  4Q0C A;  3QIM A;  3OD7 A;  1MDQ A;  2V3Q A;  1NH7 A;  2D3I A;  4NMY A;  1FQC A;  1VE4 A;  1JQF A;  2REJ A;  3D4G A;  5I59 B;  1QKA A;  3VFJ A;  3T22 A;  5ITP A;  1XC1 A;  3VVD A;  2F7B A;  3DP6 A;  1FTJ A;  2O1L A;  3TTK A;  2Y7P A;  1LB8 A;  3S9M C;  4F3G A;  4NF8 A;  1GGG A;  3SKP A;  1WDN A;  3RUM A;  1MPD A;  2BJJ X;  1O7T A;  4QFL A;  1GR2 A;  4JWY A;  4RPO A;  1P1W A;  3ECR A;  3PUY E;  5CBS A;  3O97 A;  1I69 A;  2Z8F A;  3Q28 A;  3RY3 A;  1B58 A;  3AXF A;  2ALU A;  4YAH X;  5L9S A;  2F5X A;  2DOJ A;  3U72 A;  4YZZ A;  1Y3Q A;  2V25 A;  4YMA A;  1XVX A;  2H9B A;  3MZ1 A;  3QSL A;  4EQ9 A;  4LVQ A;  3VV5 A;  3OSQ A;  2D21 A;  3CR9 A;  1URD A;  3CVG A;  2Q2A A;  1XHY A;  4LP2 B;  1ZKB A;  3IJX B;  2O68 A;  3QAX A;  1D3K A;  1JET A;  1TT1 A;  4JSO A;  3LSL A;  3OO6 A;  3OMB A;  1DOT A;  2I48 A;  3SEW A;  4OHN A;  5ISU A;  4OMB A;  1YTV A;  2RC9 A;  4OFJ A;  1MXX A;  2H98 A;  4RNS A;  1TWY A;  2AIX A;  4IB2 A;  1B4H A;  1ZTY A;  3V83 A;  1S50 A;  3FJM A;  2I3W A;  3A3C A;  2RC7 A;  1Z7N E;  4NE4 A;  3C32 A;  4QSE A;  2D5W A;  2O51 A;  3QUJ A;  1RYO A;  3MWB A;  2F7C A;  5AE4 A;  2OLB A;  2I58 A;  4DZ1 A;  4QSD A;  4KYS A;  4EXK A;  3E13 X;  2ZYO A;  4LQ5 A;  1MH3 A;  5I58 B;  2UYF A;  4R72 A;  2X7Q A;  1M5C A;  3PPQ A;  1MXZ A;  1ELJ A;  3WAE A;  4ZZA A;  1UTB B;  1B7H A;  3TDJ A;  5DVJ A;  1B5J A;  2DQV A;  5DVI A;  3LSX A;  3PU5 A;  1XOC A;  3K6W A;  1PB9 A;  4ZEC A;  3K6U A;  3Q26 A;  3DP4 A;  3N6U A;  2QMX A;  3VXC A;  3EHU A;  1MXY A;  1JVX A;  4ZEK A;  5TPA A;  2OZZ A;  3H6W A;  3K0V A;  2KLF A;  4OVJ A;  1Y20 A;  1SYH A;  1I6Q A;  4U21 A;  2DXR A;  3EHT A;  2H4I A;  3JZJ A;  4AB5 A;  1LBC A;  4NF8 B;  3VLW A;  2HZK A;  4U2R A;  2E0S A;  4N13 A;  3EN3 A;  3PUW E;  4Z7E A;  3SES A;  1ZJL A;  1MM6 A;  4FIM A;  3W15 C;  4F22 A;  1B51 A;  3L6H A;  2NXO A;  1MQG A;  4BLA A;  3Q29 A;  5FHM A;  3HPI A;  3UIF A;  2QSX A;  3N5L A;  4WED A;  1MDP 1;  3C36 A;  4TLL B;  2O7I A;  2I6E A;  1ATG A;  1MXV A;  3M8U A;  1SD3 A;  3QYT A;  3OO7 A;  4E0W A;  4GLI A;  3IL1 B;  4XKQ A;  4R9G A;  4KQP A;  1B32 A;  1FQA A;  1YPN A;  1IIW A;  3MZ9 A;  1GTK A;  3K6V A;  5A5X A;  1LFI A;  3FV2 A;  1VFD A;  4F1Y A;  1IXH A;  4OET A;  2DWA A;  4NF4 A;  4YB5 A;  3FJ7 A;  1PDA A;  4EUO A;  3H3G A;  4RK9 A;  3T93 B;  2V3U A;  5ICT A;  3MPK A;  2F7A A;  3UP9 A;  4H67 A;  4ND9 A;  4O3C A;  2AL4 A;  3UGW A;  5H8Q A;  1FQF A;  3MP8 A;  4JBZ A;  4Q30 B;  4ESX A;  2Q88 A;  2H5Y A;  3LC8 A;  1ZBM A;  3KJ7 A;  4NF5 A;  3U1O A;  4XIG Q;  3TMG A;  1YCJ A;  1B0H A;  4PFY A;  5ITO A;  4R74 A;  3FUZ A;  1B1X A;  2VD2 A;  1NNF A;  1IXC A;  2XHD A;  4EF2 A;  2IEE A;  2VGQ A;  3OXN A;  1Y3N A;  3PMW A;  4EXL A;  2QMW A;  5IAI A;  1ANF A;  1IEJ A;  3GXA A;  1SW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...