4GWOA

Crystal structure of ligand binding domain of lysr family member,cysb in complex with sulfate from salmonella typhimurium lt2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ligand binding domain of LysR family member,CysB in complex with sulfate from Salmonella typhimurium LT2
rcsb
source organism Salmonella typhimurium
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator CysB
total genus 72
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gwoA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gwoA02
1OIBA 1N0TA 1RYOA 1MQIA 3A09A 2I0BA 1MXWA 1P1QA 4FECA 2DWIA 4QSEA 5EYFA 5L8DA 1DSNA 3UK4A 2DE3A 2YJPA 3N26A 3VV5A 2I4BA 1B7HA 1TFAA 1SW5A 3DELB 3FJ7A 5I2KA 3H6VA 4BDMA 1Y20A 3C33A 3MZ1A 4P0IA 3UIFA 3FIRA 5FHOA 1O63A 4NF6B 2Q88A 3K6UA 1FQFA 1MPDA 5BUUA 3BBRA 2HQ0A 3MVXA 3TCGA 4YZZA 3OELA 4PFWA 3TTKA 3ONMA 2UVGA 1N04A 1B3LA 3H03A 3K0VA 1MXUA 2H9BA 2THIA 3OD7A 3I3VA 1B4ZA 1NL5A 5I58A 3KN3A 3CVGA 3GZGA 2GHAA 2I4CA 3PPQA 2QJEA 2NVUB 2Z22A 1QVSA 3PMXA 1FQBA 4U4SA 1A54A 4X48A 3K6XA 1NH7A 3PPOA 1TFDA 1MY0A 1P1WA 1VR5A 3DP8A 2OLBA 2VP1A 1PB9A 3KN8A 4IO4A 3T22A 3ZSFA 2IA4A 4XXUA 1B40A 3JV9A 4G68A 4QHQA 4ZDMA 4RK9A 5IAIA 3S4UA 1FTMA 2DOJA 3OMBA 1SDXA 4OERA 3RLFE 4FIMA 4R73A 3B6TA 1IQ7A 4GIZA 3GBBA 2XXQA 2Y7PA 3MW0A 4OEVA 4EF1A 2I3VA 2OJTA 4HW8A 5KZTA 4U21A 4KHZE 4G68C 3FVGA 3JYRA 2QMXA 3KFMA 4POWA 4L17A 2O7UA 2Q2CA 3KBRA 3HV1A 4NF8A 4YKIA 1F9BA 1S9TA 1SQYA 3G3JA 3SEVA 4WEDA 3CIJA 1LAXA 4EQ9A 2B3BA 1Y1MA 1D4NA 2UVJA 1P1UA 1MQGA 2HAVA 3FGSA 3JZJA 3PUZE 4G77A 4F39A 1EU8A 5CMCA 2F36A 1OVBA 2V93A 2PVUA 3BFTA 4LONB 3QIMA 4GWOA 3KGCA 2GFEA 3C34A 3IOTA 2O69A 3H4ZA 4HTGA 4YKKA 3TTNA 1EZOA 5K2XA 3AXFA 3TCFA 1BTJA 5DVFA 1DMBA 4R9GA 1WODA 3VLWA 3FVOA 4JB7A 4GOTA 2GHBA 3U93A 4F29A 1B4HA 4Z0IA 4EXLA 3T9XB 4YKJA 3VVEA 4QF9A 5CBRA 2HEUA 1B3HA 2VOZA 3CG1A 3PPNA 1MH4A 2REJA 2PMSA 1JEVA 2VHAA 1JW1A 4QFKA 4F3PA 2RF1A 1B3EA 3KJTA 3RPWA 3G3HA 3EQ1A 4YICA 3U8QA 4RPNA 1ZJLA 1OLAA 2QSXA 4F18A 5AA3A 1PBQA 4NF6A 3WAFA 1VFEA 2R6GE 1DPEA 1MY3A 4H1XA 4KI0E 3MP8A 2YPNA 4WKMA 2QS1A 3SETA 3ZS6A 2F35A 1O7TA 4ELRA 4EQBA 3RUMA 4YMAA 1ZIUA 2B3FA 1SI1A 1JVYA 3QSLA 4G4PA 1IXIA 2V3QA 3MWBA 1P1NA 4I62A 2XX9A 4XKQA 4ZEKA 2FA7A 2OWTA 5FTIA 1JW5A 4Q8RA 4F3BA 1OLCA 1POY1 1LFIA 3Q28A 4IO3A 4FATA 1B5IA 1XS5A 3V89B 4BDLA 1MQHA 4Z7EA 5A5XA 2XXWA 1QKAA 2O68A 2O6AA 2XXTA 3EPEA 3HCQA 1LB9A 3Q27A 4NF4B 4R2FA 1CE2A 2RC7A 1O64A 1Y3NA 3K01A 4ZEFA 4BDQA 3OEMA 1LSTA 1FQDA 3KZGA 2H25A 1H43A 1FTLA 4IGTA 1FQAA 2Z8FA 3S9MC 1B58A 1UQWA 4OTEA 4PFUA 4GXSB 1YTVA 2XX7A 5I59B 2DVCA 3C35A 1D9YA 1SD3A 2Z8EA 3SEUA 3O29A 4BDOA 1ATGA 3FV1A 5B70A 3KEIA 3U72A 3SEXA 2Y84A 2KLFA 4ELQA 3UN6A 1N84A 2DQVA 2DXRA 2NXOA 2ONRA 4EDPA 3H7MA 1XVXA 4KCCA 1XOCA 3L6HA 4RPOA 1A55A 2YLNA 2D21A 5TPAB 1MY2A 3H3GA 5B7DA 2FYIA 1NNTA 3K6VA 1Y3PA 3FXUA 4P11A 5AA4B 1TXFA 3OOAA 2D3IA 1VE4A 4KR5A 1ZTYA 4NWDA 1FQCA 3FXRA 4GF8A 2V84A 5JTYB 3IOVA 4I1DA 5DTBA 1BIYA 3MVYA 3C36A 3ILTB 2P0SA 3BKIB 1P99A 1Q1KA 2ZMBA 2A5TB 1QKBA 3IOWA 4H8JA 4RYAA 3TTMA 3D4CA 5CM6A 1I6AA 1IXHA 3A3CA 3DM0A 2O1MA 4JWOA 1XHYA 4BDRA 1AIVA 3LSFB 1NNPA 3H6UA 3IB2A 1H76A 4NWCA 3PD9A 5FHNA 2Q9TA 1MQJA 4LZ7A 1B5HA 2ALUA 3P7IA 5CBSA 5L9MA 3T66A 3N5LA 1GTKA 3FATA 4XIGQ 1FW0A 1YAEA 3G7WA 3MZ9A 1PB8A 3Q25A 4OXVA 3SEWA 3TPAA 1B0LA 3HSTA 4TLLB 1BLFA 4PFYA 3IR1A 3E4RA 3U92A 5AE4A 2A5SA 4PP0A 4LVQA 4LQ5A 1LBBA 1URDA 3OO6A 4LUBA 4OFOA 2UVHA 1B1HA 4OFLA 5H8FA 5KCJB 1HSJA 1IEJA 2O7IA 1YCJA 1MG1A 2HAUA 4IB2A 5HBCA 2XX8A 1PC3A 1I6QA 3O66A 1QUJA 4YB5A 2HFBA 3U94A 2V3UA 1OQGA 2NWJA 4X9TA 4THIA 3SDFA 3ODBA 5H8HA 1UIVA 3OO7A 4H5GA 1WDNA 3E3KA 3OSRA 1GV8A 2F7AA 3K1MA 3W9WA 4C0RA 5HM4B 5L9SA 1B3GA 2RCAA 1JVXA 4GVOA 1NNKA 3M3FA 5IKBA 4R6HA 1NNFA 3T96B 3S9NC 1T0KA 1WVJA 1H45A 4DCYA 3QUJA 3C4MA 1RKMA 4HS7A 2QL3A 4RJZA 3TQWA 3VFJA 3O2AA 5FHMA 4JWYA 3KG2A 3F11A 2XHDA 4NF5A 1GGGA 1MH3A 4ISUA 5A5XB 4I9DA 2OWSA 1N3XA 4XKPA 3MPKA 3N6UA 1TWYA 4NTLA 4IO7A 3FV2A 1UTBB 1M5FA 4R2BA 3FVKA 3PPPA 4ECFA 2HZKA 4JDFA 4KPTA 4F31B 3LSWA 5LOMA 2DP8A 2ZXTA 3BFUA 4R74A 1J1NA 2D5WA 2AL5A 3MVZA 3QAXA 5DYHA 2ZNTA 3W9VA 5CC2A 5I56B 1LAFE 1IITA 4DZ1A 2NUVA 2DE4A 1LCFA 3MAMA 5I59A 1SVXB 1ANFA 4ZS9A 3RT6B 1SI0A 4N6PA 2ONSA 1GR2A 3LC8A 4DXUA 2I3WA 3CFZA 3OXNA 1A8EA 3TQLA 1EZ9A 4X1DA 3R7XA 3UGWA 3MQ9A 1N3WA 4G8MA 2NOOA 4YB6A 3TEPA 3PUVE 1OMPA 3T9UA 3SESA 5I2NB 1R6ZA 4XKRA 2XXUA 4YKPA 1B3FA 4FJPA 4RXLA 3E9XA 2XD2A 3TTLA 2OBGA 3QUFA 4GL8A 4FAJA 2AL4A 2A5TA 5BWJA 3SERA 3K6WA 3LBSA 3CSGA 5H8QA 2QMWA 4ZE8A 1A8FA 2XXYA 3PPRA 1USYE 4OEUA 4QSCA 5CMBA 3PUYE 5JTYA 4Q30B 3KSXA 2Q89A 5AA2D 1MXVA 4EUOA 3K1PA 2REGA 3T9VA 4DE8A 2G93A 1B05A 4FEDA 5AA2B 1NMUA 4KCDA 5ELVA 3I5OA 1VFDA 3RT8A 4ESXA 4F22A 5J1DA 1PB7A 3K02A 2AIXA 3MVWA 1SYIA 4FE8A 4OENA 1DTGA 2UVIA 3PU5A 3T93B 1MPBA 4GLIA 4OYVA 4EQ7A 1PDAA 4M1VA 4ZZEA 1HSLA 5CRYA 1B5JA 3C32A 1MDP1 2X7QA 1R9LA 2W7YA 4GFRA 3G3KA 1SYHA 2ZNUA 1DTZA 3PMVA 2UYEA 5H8QB 3TYHA 3IJOB 1JW4A 2ANJA 3T9HB 2DWJA 2UXAA 3M3LA 3MC2A 1Y3QA 3FJGA 3M3KA 2HXWA 4IGRA 1LAGE 4O3AA 4UA8A 4WXJA 3S2VA 4F2OA 5I57A 4H0WA 1LBCA 1IUDA 3D4GA 1LB8A 2VD3A 2ZYNA 3MBPA 4ESWA 2O1LA 1US5A 1FTKA 2F34A 3FD3A 3MJNA 1I69A 2VD2A 4IO2A 4MF3A 4ELPA 3PGFA 2DYXA 2DXYA 2DS9A 1EH3A 5I2KB 1MS7A 2XXVA 4KQPA 5ISUA 3FXQA 1MXZA 4FORA 1IXGA 4H65A 3TTRA 3V8XB 1SW1A 4F3SA 2GRVA 5CMKA 4BDNA 3M8UA 1B9JA 4O3BA 5DT6A 4QFPA 4U22A 2ABHA 1VSOA 2UYFA 3G3GA 1TT1A 4AB6A 4E0WA 2X7PA 3C9HA 3KJ7A 4F2QA 1EZPA 1Q35A 2DWAA 2QS2A 2I0CA 1FTOA 3O6GA 4OETA 5H8NA 3TELA 2F97A 3EHSA 5I58B 4NF8B 3ECRA 3GXAA 1Y9UA 4U1ZA 4ELOA 1AL3A 2F78A 2X26A 1QULA 1XC1A 4O3CA 4OHNA 4AQ4A 2I49A 4G8HA 1B46A 3K4UA 3IOUA 4YU0A 5F7VA 1B32A 2ZYKA 4ZEIA 3V5AA 3N6TA 4JXIA 2PX1A 1N76A 3S9LC 3L6GA 5I57B 3G3IA 4H67A 1QJMA 3N94A 2PT2A 1LFHA 3W15C 1D9VA 1PBPA 1JNFA 1QUIA 2RC9A 3IL1B 3IORA 1B0HA 4U4XA 4XTCQ 5DVIA 2DSFA 2P1SA 1AH5A 1BP5A 1B2HA 1MRPA 2VGQA 3FASA 3LR1A 3LUYA 4LQ2A 1Z7ME 2RKMA 2F5XA 3O6IA 4OVJA 1MM6A 3U1OA 2HCAA 3H06B 4HCWA 5DEXB 4MH5A 5F1QA 3KOSA 2F6PA 3FZVA 2QPQA 2M8CA 4BLAA 4DXCA 1XT8A 4GRKA 4LZ8A 4EXKA 1B1XA 5HPQA 4N07A 1B7UA 3EN3A 2XD3A 1URGA 5AA2A 3FUZA 1LLSA 1M5BA 4P0GA 2CMOA 3K00A 3K1NA 4RA1A 1BKAA 4OWDA 3HHGA 4KFQA 5EHMA 4DXBA 4H8IA 1ZMGA 4IO5A 4KYEA 4R6KA 2XXRA 3RY3A 3H6WA 2R9JA 4OQOA 3UP9A 2O51A 2XXHA 3HO7A 4I8CA 2G29A 4MBPA 4DIGA 4YAHX 1HSEA 5KDTA 3PUXE 2BJJX 1JETA 2IEEA 2I6EA 2ZNSA 5H8HB 3IO4A 1CB6A 1QUKA 3TAJA 3ZKLA 4KD5A 3E13X 3MUQA 3TMGA 1NKXA 1Y4TA 3FJMA 2E1SA 1IZ1A 4M4GA 4NMYA 2RINA 4ONYA 4RNSA 4ZZAA 1KWHA 5CI5A 2CZLA 1N7XA 3RTWB 1M5DA 1M5EA 1MXYA 5DVJA 2H4IA 1LAHE 3CG3A 4G68B 4QFLA 4HCYA 4XKNA 5ITPA 3B6WA 3I6VA 3WAEA 2AYSA 4K3FA 2F7BA 3O97A 4F1UA 4OFJA 5I84A 2ZYMA 1H44A 2XXIA 3GLBA 1I6BA 3Q29A 4ZEDA 2ZYOA 3DLNA 2Q8JA 1UTBA 3IB1A 4NEDA 3IAZA 4PFTA 2B65A 1US4A 1B7ZA 1FQEA 1S50A 4GQOA 2I58A 2Y7KA 3V83A 3IK6B 3KSJA 1IXCA 2Q2AA 3ILUB 1RYXA 4DDDA 2LAOA 4OZ9A 4ND9A 4NF5B 4PETA 1R1NA 2F8DA 1UIUA 4LP2B 4ZEBA 3GBAA 2QS3A 3RTFB 3G3FA 1LFGA 4ZE9A 3MPLA 3UA8A 2F6GA 3KOTA 4JBZA 1S7YA 1A7LA 3QYTA 2R71A 1USYH 4Q0CA 4U23A 4POXA 3Q26A 4U1OA 5EHSA 3O9PA 4R72A 1MY1A 5H8SA 1AOVA 5ICTA 4Q5TA 1A99A 3VLVA 4F1VA 1NFTA 5H8FB 3QK6A 4QRZA 5TU0A 5TP9A 2DE2A 3TKDA 4LATA 2Z23A 1ZBMA 5CMMA 4QSDA 5JEIA 4G8NA 1SBPA 1ZKBA 4GD5A 4IO6A 3THIA 4GXAA 4MFIA 2XXXA 2QS4A 3TDJA 5I56A 2P2AA 1UTHB 1Y1ZA 1QW0A 2PYYA 1ZU0A 4KYSA 4RK2A 4DCXA 2V25A 4WEPA 1IIWA 4MLVA 1A40A 1SW2A 3UORA 2H5YA 3OO8A 2DVZA 1URSA 2OZZA 4OESA 1GVCA 1H3DA 3VLUA 5KDTB 2Y7IA 2OCUA 1B6HA 3HN0A 1FTJA 4KYDA 4R9FA 3RGYA 3VVFA 4F1YA 1LCTA 1MM7A 2FNCA 2PT1A 4R75A 2ONKE 4N13A 5K2YA 3RQTA 3TCHA 3H6TA 3OSQA 4GL0A 5AA1A 1P1OA 3PV0E 1JQFA 5JK4A 1MPCA 3VXBA 3DP4A 3B7DA 3R6UA 1B51A 1SW4A 3A3UA 3MP1A 3SKPA 4EF2A 4F3GA 5I2NA 4H6DA 1FCKA 3B6QA 1DPPA 1II5A 1YPNA 2H98A 2O84X 1ZLQA 2WKYA 3LSLA 4QFOA 4UACA 3PMWA 1OQHA 3CSBA 3RNNA 5M2VA 3HHFA 3R26A 4PE5B 3HPIA 1OVTA 3IX1A 3O6HA 4NE4A 3RN8A 1MXXA 2RCBA 1UTHA 3VXCA 1MDQA 2V3TA 5ITOA 3C31A 1ELJA 1PEBA 2OK2A 3CFLA 4JSOA 4C1TA 3TZAA 4IY5A 1N7WA 2E0SA 2I48A 2PBWA 4R6YA 4QFNA 4E0XA 5FTHA 5TPAA 1LGBC 3ZKKA 2ESNA 3CI8A 1POTA 3O28A 1NH8A 3IO6A 1MY4A 4PQJA 3VE1B 4C1UA 3DP6A 4MLQA 3MZBA 3IB0A 1L5TA 3TFLA 4TLMB 3VVDA 3IJXB 4AB5A 3EF7A 1XVYA 5ICQA 2Y7WA 3PUWE 2GH9A 3EHUA 3KN7A 4JWXA 5TP9B 5L9OA 3USDA 5H8NB 4DLDA 3OO9A 1M5CA 4LZ5A 3TUSA 3FVNA 3CRBA 4IY6A 4OMBA 4TOZA 4RY1A 2XXPA 4U2RA 3K2DA 3S9EA 4ZECA 4TQUQ 1R9QA 2HZLA 3LSXA 3MP6A 2DWHA 3CFXA 4YB7A 2Y7RA 3PD8A 4FEBA 3OEKA 3OENA 4H5FA 2H99A 2Z8DA 4LA9A 2F7CA 4X1BA 4F19A 4NF4A 5AA4A 3VDFA 1JEUA 1Y4CA 2QRYA 3TODA 1D3KA 4JSDA 3SEYA 3EHTA 1AMFA 3QXMA 4YMBA 5KCJA 1Z7NE 1B52A 5DEXA 3CR9A 1MQDA 2RC8A 1DOTA 4G2ZA
chains in the Genus database with same CATH superfamily
3A09A 2I0BA 1MXWA 3UK4A 2DE3A 2YJPA 3N26A 2I4BA 3DELB 1Y20A 3MZ1A 5FHOA 1O63A 2XWVA 3IFCA 3MVXA 1INPA 4PFIA 2UVGA 3K0VA 3I3VA 5I58A 3GZGA 2NVUB 1FQBA 3ZSFA 2OLBA 4P3LA 1PB9A 4XFEA 3JV9A 4PDHA 4G68A 4RK9A 1IMEA 5IZ3B 3B6TA 2Y7PA 3U65A 4U21A 4KHZE 2KQZA 3G3JA 1NV2A 3CIJA 2HAVA 4O7IA 4GWOA 2GFEA 4HTGA 4YKKA 3H4ZA 1EZOA 5K2XA 3AXFA 1FBDA 3VLWA 1B4HA 4Z0IA 3VVEA 1IMDA 1MH4A 3FXBA 1JEVA 2VHAA 3D1RA 2RF1A 1B3EA 3T1BA 3G3HA 1ZJLA 4NF6A 2R6GE 4KI0E 1IXIA 1P1NA 1NUYA 2XX9A 4I62A 4XKQA 1IMFA 1POY1 1B5IA 4BDLA 4Z7EA 1MQHA 5A5XA 5IGAA 2O6AA 4GWXA 3EPEA 4IR8A 4R2FA 1CE2A 1EYKA 2RC7A 5DW8A 3LUZA 4PF8A 4BDQA 3OEMA 1H43A 1NUWA 2Z8FA 4GXSB 3FV1A 4ELQA 5EQAA 1N84A 2DQVA 2DXRA 2ONRA 4PC9A 4FBPA 4KCCA 3TUSA 5TPAB 3H3GA 1FPLA 1NNTA 4P11A 3OOAA 4NWDA 5JTYB 1BIYA 5T3JA 3MVYA 2P0SA 3BKIB 1Q1KA 5CM6A 1FTAA 2XWKA 2MKZA 1XHYA 1VDWA 4BDRA 4NWCA 2ALUA 3P7IA 4XIGQ 1PB8A 5KDTA 1B0LA 3HSTA 4JVDA 1BLFA 1NUXA 1URDA 4LUBA 4OFOA 2UVHA 1B1HA 4MAGA 5HBCA 2XX8A 1PC3A 4X9TA 3ODBA 3OO7A 1WDNA 4C0RA 5HM4B 3QUJA 2QL3A 3F11A 4ISUA 5A5XB 3MPKA 3N6UA 4I40A 5FBPA 4NTLA 2Q74A 1NV3A 4JDFA 4F31B 3LSWA 4R74A 3MVZA 5CC2A 3W9VA 1ANFA 2GQ1A 1SI0A 3CFZA 1A8EA 1EZ9A 3R7XA 3MQ9A 4G8MA 5KZTA 3TTLA 3TEPA 4GL8A 4FAJA 4ZE8A 3PPRA 4OEUA 4NN3A 3ROJA 1MXVA 1B05A 4FEDA 4KCDA 1PB7A 3T93B 4GLIA 4EQ7A 1PDAA 4ZZEA 4GWZA 1B5JA 4GFRA 2X7QA 1SYHA 1DTZA 3PMVA 3IJOB 2ANJA 3M3LA 3MC2A 1Y3QA 4UA8A 1K9ZA 2VD3A 4OA4A 4ESWA 1US5A 1FTKA 2Q8MA 2DYXA 2GRVA 3M8UA 4O3BA 4F2QA 4H45A 1NV0A 2F97A 5I58B 4NF8B 1Y9UA 4U1ZA 2XWOA 2I49A 5F7VA 2PX1A 5IZZA 4H67A 3N94A 1PBPA 1FBHA 1BP5A 4LQ2A 2WYPA 2RKMA 4OVJA 5F1QA 2QFLA 2F6PA 3FZVA 2QPQA 4BLAA 1XT8A 4RA1A 1BKAA 4PE3A 4DXBA 3UP9A 2O51A 2G29A 3EKIA 2I6EA 3IO4A 1QUKA 3TAJA 4KD5A 3E13X 3TMGA 1IMAA 1Y4TA 2E1SA 1IZ1A 4ONYA 5CI5A 2CZLA 1N7XA 1M5EA 2H4IA 3IFAA 4G68B 4HCYA 1KA1A 4OFJA 5I84A 2XXIA 3Q29A 3IAZA 1S50A 4GQOA 2I58A 2Y7KA 3V83A 4OZ9A 4O8MA 5H8FA 1LFGA 3KOTA 3O9PA 1NV6A 5ICTA 4Q5TA 1A99A 5IZ1A 3VLVA 5H8FB 5TU0A 3TKDA 5CMMA 4G8NA 4GX3A 4GXAA 3TDJA 1Y1ZA 1IIWA 2H5YA 3OO8A 2OZZA 4N8YA 1B6HA 3HN0A 4MCOA 1LCTA 4P56A 2PT1A 3RQTA 1SW4A 4PGPA 1YPNA 3PMWA 2OX3A 3RNNA 3R26A 3IX1A 3RN8A 2RCBA 1PEBA 2E0SA 1G0IA 4NAPA 3ZKKA 3VE1B 3DP6A 3IB0A 4TLMB 4NX1A 1XVYA 4JWXA 2KR0A 4RY1A 4U2RA 5ET6A 2HZLA 3LSXA 4YB7A 4F19A 3OENA 2H99A 1JEUA 1Y4CA 3TODA 3SEYA 3EHTA 5KCJA 5DEXA 1B52A 2B4MA 4YB5A 2RC8A 4G61A 1OIBA 4FECA 1P1QA 1DSNA 1B7HA 2PFYA 1SW5A 4BDMA 3C33A 3UIFA 5ET7A 4P47A 3K6UA 2HQ0A 4N17A 4PFWA 4NG7A 1B3LA 3H03A 1MXUA 2THIA 4O94A 1G0HA 2B4LA 1QVSA 3PMXA 4U4SA 1A54A 3PPOA 1VR5A 4XXUA 4QHQA 3S4UA 4FIMA 4R73A 1IQ7A 3MW0A 4EF1A 4HW8A 4G68C 3KFMA 4L17A 2Q2CA 3KBRA 1F9BA 4NGUA 1SQYA 4WEDA 2F3BA 1LAXA 2B3BA 4GWYA 1P1UA 4PF6A 1MQGA 2WEFA 3FGSA 3PUZE 2F36A 2V93A 2PVUA 4LONB 3KGCA 3C34A 3IOTA 4N15A 4MNCA 1BTJA 4JB7A 4EXLA 4YKJA 4P9KA 3RPWA 3EQ1A 4RPNA 1OLAA 1QGXA 2QSXA 1PBQA 3WAFA 4H1XA 3MP8A 4WKMA 4ELRA 1O7TA 2ZZWA 4JVCA 2B3FA 4OVPA 4I3EA 4ZEKA 1JW5A 3Q28A 4IO3A 1XS5A 2XXTA 3HCQA 3Q27A 4NF4B 4ZEFA 3LV0A 1B58A 1UQWA 4PFUA 1YTVA 2XX7A 5I59B 2DVCA 4GBWA 4BDOA 1ATGA 5B70A 3SEXA 2KLFA 3UN6A 2NXOA 3H7MA 1MY2A 5B7DA 2FYIA 3K6VA 5AA4B 1VE4A 1ZTYA 3A29A 2V84A 3BIGA 1FBGA 3C36A 2XA5A 2A5TB 3DM0A 4I3YA 3LSFB 1NNPA 1H76A 2Q9TA 1MQJA 1B5HA 3T66A 3TPAA 3SEWA 2L5VA 4PFYA 2FIXA 2A5SA 3MYUA 1LBBA 4OFLA 3CHGA 5KCJB 1IEJA 3B8BA 3O66A 3U94A 2HFBA 1OQGA 4H5GA 3W9WA 1FRPA 3S9NC 3M3FA 4R6HA 1T0KA 3C4MA 4RJZA 5FHMA 4JWYA 2XHDA 4I9DA 1M5FA 3FVKA 2AL5A 4AS4A 5I59A 2XXKA 4N6PA 4PBHA 4MEVA 3SESA 2XXUA 4FJPA 2OBGA 2AL4A 3SERA 1A8FA 3PUYE 4QBAA 4N8GA 1FPGA 3K1PA 4DE8A 5AA2B 1NMUA 4F22A 3I5OA 3MVWA 1SYIA 4FE8A 2UVIA 4XF5A 1HSLA 5CRYA 3C32A 1R9LA 4HE1A 3V89B 2DWJA 5H8NA 3FJGA 4WXJA 3KC0A 1DBZA 1FPJA 1LBCA 3MBPA 4IO2A 4HE2A 2DS9A 4KQPA 4FORA 5CMKA 3NOHA 4F3SA 1SW1A 1B9JA 2ABHA 3GYYA 1TT1A 3KJ7A 1EZPA 2I0CA 4OETA 3TELA 4OHNA 1EYIA 4AQ4A 1FPKA 1B46A 3K4UA 3IOUA 4NQ8A 1B32A 1N76A 3L6GA 3G3IA 3W15C 1JNFA 1QUIA 1B0HA 4U4XA 2DSFA 3LR1A 1B2HA 3U1OA 1LBZA 4HCWA 4LZ8A 4EXKA 1B1XA 4N07A 2XD3A 1JP4A 1DK4A 1LLSA 2CMOA 3HHGA 5EHMA 1ZMGA 4KYEA 2XXRA 2R9JA 2XXHA 3HO7A 4I8CA 4DIGA 4YAHX 3PUXE 1JETA 2ZNSA 5H8HB 1CB6A 2FIEA 3FJMA 4M4GA 4NMYA 3RTWB 4QFLA 4XKNA 3WAEA 4K3FA 2F7BA 2QVRA 1H44A 4N91A 2ZYOA 4NEDA 4PFTA 3ISPA 1FQEA 2ZZXA 3KSJA 1IXCA 4PTKA 3ILUB 1RYXA 2LAOA 4ND9A 2F8DA 1UIUA 2QS3A 4ZE9A 4Q0CA 1A7LA 3E79A 1USYH 4GWSA 3Q26A 4R72A 1NFTA 5TP9A 4LATA 1ZBMA 1FSAA 5I56A 4MFIA 2QS4A 2PYYA 4RK2A 4KYSA 2V25A 4MLVA 1A40A 4OESA 3VLUA 5ET5A 1FTJA 1FPDA 4KYDA 4OANA 4R9FA 3RGYA 4F1YA 3TCHA 1DCUA 4GL0A 1JQFA 5JK4A 1CNQA 4F3GA 1FCKA 3B6QA 2O84X 4QFOA 2WKYA 3LSLA 1OQHA 5M2VA 4PE5B 5IM2A 2CEXA 2V3TA 5ITOA 3C31A 4JSOA 3TZAA 2I48A 4R6YA 5I7IA 5TPAA 3O28A 1MY4A 1SPIA 3T0JA 3VVDA 3IJXB 3EF7A 5ICQA 3KN7A 5TP9B 3USDA 3FVNA 4IY6A 3K2DA 4TQUQ 2XWIA 4X1BA 4LA9A 2F7CA 1AWBA 3VDFA 4JSDA 1D9QA 1Z7NE 4N6KA 5EHSA 1DOTA 4YICA 2Y5LA 1MQIA 4QSEA 2OWZA 1FJ6A 3FJ7A 3H6VA 4NF6B 1FQFA 1MPDA 5BUUA 3BBRA 3TCGA 4YZZA 1FPBA 3OELA 2R8TA 3TTKA 4P8BA 1N04A 3RPLA 4MMPA 3KN3A 3PPQA 2QJEA 2Z22A 4O7MA 3K6XA 1NH7A 1TFDA 1MY0A 1P1WA 3DP8A 3T22A 2VP1A 1LBVA 2IA4A 1B40A 1FTMA 2DOJA 1SDXA 4OERA 3RLFE 3GBBA 4OEVA 2I3VA 2OJTA 3JYRA 2WBBA 4POWA 1FBCA 3SEVA 1NV1A 4EQ9A 2UVJA 4F39A 1EU8A 2V4CA 1OVBA 2O69A 3TCFA 5DVFA 1DMBA 4R9GA 4GOTA 2GHBA 3U93A 3T9XB 1FBEA 2HEUA 1B3HA 2VOZA 1XI6A 3PPNA 4PAIA 2REJA 3RPLB 1KA0A 5AA3A 5IZ3A 1VFEA 1MY3A 2YPNA 3SETA 2QS1A 3ZS6A 4EQBA 3QSLA 2CZIA 4G4PA 2V3QA 3MWBA 2FA7A 3KBZA 5FTIA 4Q8RA 4F3BA 1LFIA 1RDZA 2XXWA 1QKAA 1LB9A 3K01A 1Y3NA 1FQDA 2H25A 4GX6A 4PFRA 2JJKA 4OTEA 1FPFA 3SEUA 3O29A 1LEVA 2Y84A 3HFUA 4EDPA 4RPOA 3L6HA 1A55A 2YLNA 2D21A 4MNPA 1Y3PA 3FXUA 2D3IA 3FXRA 4GF8A 4I1DA 1YYZA 3ILTB 2ZMBA 4RYAA 1QKBA 4H8JA 3TTMA 3D4CA 3A3CA 4JWOA 4NF0A 1EYJA 3H6UA 5FHNA 3IB2A 3PD9A 5EYHA 5L9MA 3N5LA 3G7WA 3Q25A 4OXVA 3IR1A 3E4RA 4PP0A 4LVQA 2O7IA 4IB2A 2HAUA 4THIA 5H8HA 1UIVA 3E3KA 3OSRA 1GV8A 2F7AA 3K1MA 2RCAA 3T96B 1WVJA 1H45A 3PTYA 4DCYA 4HS7A 3TQWA 3O2AA 4NF5A 1GGGA 2OWSA 1N3XA 3FV2A 4R2BA 3PPPA 4ECFA 2HZKA 5DYHA 1J1NA 2D5WA 4DZ1A 1IITA 4F3PA 4ZS9A 3TQLA 1N3WA 2NOOA 4YB6A 3PUVE 1OMPA 4YKPA 1B3FA 4RXLA 3E9XA 2XD2A 3QUFA 3KC1A 5BWJA 3K6WA 3LBSA 4PAKA 3CSGA 2XXYA 5F24A 2HPGA 2VT5A 5JTYA 4QXDA 5AA2D 3T9VA 2REGA 3RT8A 4ESXA 1VFDA 5J1DA 3K02A 4OENA 1DTGA 3PU5A 1MPBA 4M1VA 3G3KA 2ZNUA 5H8QB 3TYHA 2P3NA 3T9HB 2UXAA 4F2OA 5I57A 1IUDA 2ZYNA 1LBYA 2F34A 1I69A 4MF3A 3PGFA 2XXVA 5ISUA 1MXZA 3V8XB 4BDNA 2PFZA 1VSOA 2UYFA 4AB6A 2X7PA 3C9HA 2QS2A 3O6GA 4MNIA 3EHSA 4ELOA 4O3CA 1QULA 2PCRA 4G8HA 4ZEIA 4JXIA 5I57B 1LFHA 2PT2A 1IMCA 1D9VA 3IORA 4XTCQ 1YZ0A 2P1SA 1AH5A 1MRPA 5EQ9A 2VGQA 2Q8JA 2QVUA 1Z7ME 1MM6A 3H06B 5DEXB 4MH5A 3KOSA 2M8CA 4DXCA 4HXVA 5HPQA 2VPNA 2QVVA 5AE4A 4IO5A 4R6KA 4MBPA 2IEEA 3MUQA 1NKXA 3S9LC 2RINA 4RNSA 1M5DA 5ITPA 2FVZA 3B6WA 2FHYA 4F1UA 2ZYMA 5ET8A 4GBVA 4ZEDA 1UTBA 3IB1A 4P1EA 1US4A 1B7ZA 4DDDA 1NV4A 4PETA 4GWWA 4ZEBA 3RTFB 4U23A 2F6GA 1S7YA 2R71A 4POXA 4U1OA 5LTCA 5H8SA 1AOVA 3E78A 2DE2A 4IO6A 4X8RA 3THIA 2XXXA 1UTHB 1QW0A 1ZU0A 4AS5A 4DCXA 4WEPA 1YXIA 4PBQA 1SW2A 1URSA 1GVCA 1H3DA 5KDTB 2OCUA 2FNCA 4R75A 5K2YA 3H6TA 1P1OA 3PV0E 1MPCA 3DP4A 4EF2A 1DPPA 1ZLQA 3HHFA 3O6HA 4NE4A 1MXXA 1UTHA 3VXCA 1MDQA 4OVTA 2OK2A 3CFLA 4C1TA 4IY5A 2PBWA 3CI8A 3IO6A 4PQJA 4C1UA 4MLQA 3MZBA 2Y7WA 3PUWE 2GH9A 3EHUA 5L9OA 4DLDA 3OO9A 5J16A 4H46A 3MP6A 2DWHA 2Y7RA 3PD8A 4PDDA 4FEBA 3OEKA 2Z8DA 4NF4A 5AA4A 5A5LA 1D3KA 1AMFA 4YMBA 1NUZA 1FJ9A 3CR9A 4G2ZA 1N0TA 1RYOA 5CBSA 2DWIA 5EYFA 1LBWA 3VV5A 1TFAA 5I2KA 5I5PA 4P0IA 3FIRA 2Q88A 2ZZVA 4HE0A 3ONMA 2H9BA 3OD7A 1B4ZA 1NL5A 3CVGA 2GHAA 2I4CA 4X48A 3KN8A 4IO4A 4ZDMA 5IAIA 3BIHA 3OMBA 4GIZA 2XXQA 2FBPA 3FVGA 2QMXA 2O7UA 3HV1A 4MHFA 4NF8A 4YKIA 1S9TA 1Y1MA 1D4NA 4G77A 3JZJA 4UABA 5CMCA 3BFTA 3QIMA 3TTNA 1WODA 3FVOA 4F29A 4QF9A 5CBRA 2F3DA 1IMBA 3CG1A 2PMSA 1JW1A 4QFKA 4P1LA 3KJTA 3U8QA 4F18A 4DI3D 4PGNA 1DPEA 3FBPA 2WX9A 1KZ8A 4YMAA 2F35A 3RUMA 1ZIUA 1SI1A 1JVYA 1FBFA 2OWTA 1OLCA 4FATA 2O68A 3B50A 1O64A 1LSTA 3KZGA 2HHMA 1FTLA 4IGTA 1FQAA 3S9MC 2WYKA 3C35A 1D9YA 1SD3A 2Z8EA 3KEIA 3U72A 1FPIA 1XVXA 1XOCA 1NV5A 4KXPA 1TXFA 5ESYA 4KR5A 1FQCA 2DDKA 4LN5A 3IOVA 5DTBA 1P99A 3IOWA 1I6AA 1IXHA 2O1MA 1LBXA 1AIVA 4LZ7A 5EYGA 1GTKA 3FATA 1FW0A 1YAEA 3MZ9A 4TLLB 3U92A 4LQ5A 3OO6A 1HSJA 1YCJA 1MG1A 1I6QA 1QUJA 2V3UA 2NWJA 3SDFA 1RDXA 1B3GA 5IKBA 1JVXA 4GVOA 1NNKA 1NNFA 1RKMA 3VFJA 3KG2A 4N81A 1MH3A 4XKPA 1TWYA 4IO7A 1UTBB 4KPTA 5LOMA 2DP8A 2WBDA 2ZXTA 3BFUA 5I56B 3QAXA 2ZNTA 1LAFE 2NUVA 2DE4A 1LCFA 3MAMA 4N4UA 3RT6B 1SVXB 4DXUA 2ONSA 1GR2A 3LC8A 2I3WA 3OXNA 4X1DA 5EQ7A 3UGWA 4PCDA 4NHBA 3T9UA 5I2NB 1R6ZA 4XKRA 4JVIA 2A5TA 5H8QA 2QMWA 1USYE 4QSCA 5CMBA 2BJIA 4Q30B 3KSXA 2Q89A 4EUOA 2G93A 5ELVA 4XEQA 2AIXA 4GWUA 3QMFA 4OYVA 1FPEA 1MDP1 1NI9A 2W7YA 2UYEA 1JW4A 4O3AA 4IGRA 3M3KA 2HXWA 1LAGE 3S2VA 4H0WA 3D4GA 1LB8A 4MIJA 4OVRA 2O1LA 4ELPA 3FD3A 3MJNA 4X04A 2VD2A 2DXYA 5I2KB 1EH3A 1MS7A 3FXQA 4H65A 1IXGA 3TTRA 5DT6A 5LDZA 4QFPA 4U22A 3G3GA 4E0WA 1Q35A 2DWAA 1FTOA 4GX4A 3SZPA 3ECRA 3GXAA 1AL3A 2F78A 2X26A 1XC1A 4DI4B 4YU0A 2ZYKA 3V5AA 3N6TA 2Y5KA 1QJMA 2RC9A 3IL1B 1NV7A 5DVIA 3LUYA 3FASA 3O6IA 2F5XA 2HCAA 4GRKA 4MJOA 1B7UA 3EN3A 1URGA 5AA2A 3FUZA 1M5BA 4P0GA 3K00A 3K1NA 4OWDA 4KFQA 3RY3A 4H8IA 3H6WA 4OQOA 4OVQA 1HSEA 3MSTA 2BJJX 3ZKLA 4ZZAA 1KWHA 1K9YA 1MXYA 5DVJA 1LAHE 3CG3A 3I6VA 2AYSA 3O97A 3GLBA 1I6BA 3RYDA 3DLNA 4OVSA 2B65A 3IK6B 2Q2AA 1Q9DA 4NF5B 1R1NA 4LP2B 3GBAA 3G3FA 4N6DA 3MPLA 3UA8A 4JBZA 3QYTA 5L8DA 1MY1A 4MX6A 4F1VA 1FBPA 3QK6A 4QRZA 2Z23A 4QSDA 5JEIA 1SBPA 1ZKBA 4GD5A 2P2AA 1BK4A 3UORA 2DVZA 2Y7IA 3VVFA 1MM7A 2CEYA 2ONKE 4N13A 3OSQA 5AA1A 4PAFA 3VXBA 3B7DA 3R6UA 1B51A 3A3UA 5I2NA 3MP1A 3SKPA 5L9SA 4H6DA 1II5A 2H98A 4UACA 3CSBA 3HPIA 1OVTA 2P3VA 5EQ8A 1ELJA 1N7WA 4QFNA 1RDYA 4E0XA 5FTHA 1LGBC 2ESNA 1POTA 4PFBA 1NH8A 3TFLA 1L5TA 4AB5A 2CZHA 2CZKA 5I3SA 5H8NB 1M5CA 4LZ5A 3CRBA 2VPOA 4OMBA 4TOZA 2XXPA 3S9EA 4ZECA 1R9QA 3CFXA 4H5FA 2QRYA 3QXMA 1MQDA 2HXRA
chains in the Genus database with same CATH topology
1OIBA 1N0TA 1RYOA 1MQIA 3A09A 2I0BA 1MXWA 1P1QA 4FECA 2DWIA 4QSEA 5EYFA 5L8DA 1DSNA 3UK4A 2DE3A 2YJPA 3N26A 3VV5A 2I4BA 1B7HA 1TFAA 1SW5A 3DELB 3FJ7A 5I2KA 3H6VA 4BDMA 1Y20A 3C33A 3MZ1A 4P0IA 3UIFA 3FIRA 5FHOA 1O63A 4NF6B 2Q88A 3K6UA 1FQFA 1MPDA 5BUUA 3BBRA 2HQ0A 3MVXA 3TCGA 4YZZA 3OELA 4PFWA 3TTKA 3ONMA 2UVGA 1N04A 1B3LA 3H03A 3K0VA 1MXUA 2H9BA 2THIA 3OD7A 3I3VA 1B4ZA 1NL5A 5I58A 3KN3A 3CVGA 3GZGA 2GHAA 2I4CA 3PPQA 2QJEA 2NVUB 2Z22A 1QVSA 3PMXA 1FQBA 4U4SA 1A54A 4X48A 3K6XA 1NH7A 3PPOA 1TFDA 1MY0A 1P1WA 1VR5A 3DP8A 2OLBA 2VP1A 1PB9A 3KN8A 4IO4A 3T22A 3ZSFA 2IA4A 4XXUA 1B40A 3JV9A 4G68A 4QHQA 4ZDMA 4RK9A 5IAIA 3S4UA 1FTMA 2DOJA 3OMBA 1SDXA 4OERA 3RLFE 4FIMA 4R73A 3B6TA 1IQ7A 4GIZA 3GBBA 2XXQA 2Y7PA 3MW0A 4OEVA 4EF1A 2I3VA 2OJTA 4HW8A 5KZTA 4U21A 4KHZE 4G68C 3FVGA 3JYRA 2QMXA 3KFMA 4POWA 4L17A 2O7UA 2Q2CA 3KBRA 3HV1A 4NF8A 4YKIA 1F9BA 1S9TA 1SQYA 3G3JA 3SEVA 4WEDA 3CIJA 1LAXA 4EQ9A 2B3BA 1Y1MA 1D4NA 2UVJA 1P1UA 1MQGA 2HAVA 3FGSA 3JZJA 3PUZE 4G77A 4F39A 1EU8A 5CMCA 2F36A 1OVBA 2V93A 2PVUA 3BFTA 4LONB 3QIMA 4GWOA 3KGCA 2GFEA 3C34A 3IOTA 2O69A 3H4ZA 4HTGA 4YKKA 3TTNA 1EZOA 5K2XA 3AXFA 3TCFA 1BTJA 5DVFA 1DMBA 4R9GA 1WODA 3VLWA 3FVOA 4JB7A 4GOTA 2GHBA 3U93A 4F29A 1B4HA 4Z0IA 4EXLA 3T9XB 4YKJA 3VVEA 4QF9A 5CBRA 2HEUA 1B3HA 2VOZA 3CG1A 3PPNA 1MH4A 2REJA 2PMSA 1JEVA 2VHAA 1JW1A 4QFKA 4F3PA 2RF1A 1B3EA 3KJTA 3RPWA 3G3HA 3EQ1A 4YICA 3U8QA 4RPNA 1ZJLA 1OLAA 2QSXA 4F18A 5AA3A 1PBQA 4NF6A 3WAFA 1VFEA 2R6GE 1DPEA 1MY3A 4H1XA 4KI0E 3MP8A 2YPNA 4WKMA 2QS1A 3SETA 3ZS6A 2F35A 1O7TA 4ELRA 4EQBA 3RUMA 4YMAA 1ZIUA 2B3FA 1SI1A 1JVYA 3QSLA 4G4PA 1IXIA 2V3QA 3MWBA 1P1NA 4I62A 2XX9A 4XKQA 4ZEKA 2FA7A 2OWTA 5FTIA 1JW5A 4Q8RA 4F3BA 1OLCA 1POY1 1LFIA 3Q28A 4IO3A 4FATA 1B5IA 1XS5A 3V89B 4BDLA 1MQHA 4Z7EA 5A5XA 2XXWA 1QKAA 2O68A 2O6AA 2XXTA 3EPEA 3HCQA 1LB9A 3Q27A 4NF4B 4R2FA 1CE2A 2RC7A 1O64A 1Y3NA 3K01A 4ZEFA 4BDQA 3OEMA 1LSTA 1FQDA 3KZGA 2H25A 1H43A 1FTLA 4IGTA 1FQAA 2Z8FA 3S9MC 1B58A 1UQWA 4OTEA 4PFUA 4GXSB 1YTVA 2XX7A 5I59B 2DVCA 3C35A 1D9YA 1SD3A 2Z8EA 3SEUA 3O29A 4BDOA 1ATGA 3FV1A 5B70A 3KEIA 3U72A 3SEXA 2Y84A 2KLFA 4ELQA 3UN6A 1N84A 2DQVA 2DXRA 2NXOA 2ONRA 4EDPA 3H7MA 1XVXA 4KCCA 1XOCA 3L6HA 4RPOA 1A55A 2YLNA 2D21A 5TPAB 1MY2A 3H3GA 5B7DA 2FYIA 1NNTA 3K6VA 1Y3PA 3FXUA 4P11A 5AA4B 1TXFA 3OOAA 2D3IA 1VE4A 4KR5A 1ZTYA 4NWDA 1FQCA 3FXRA 4GF8A 2V84A 5JTYB 3IOVA 4I1DA 5DTBA 1BIYA 3MVYA 3C36A 3ILTB 2P0SA 3BKIB 1P99A 1Q1KA 2ZMBA 2A5TB 1QKBA 3IOWA 4H8JA 4RYAA 3TTMA 3D4CA 5CM6A 1I6AA 1IXHA 3A3CA 3DM0A 2O1MA 4JWOA 1XHYA 4BDRA 1AIVA 3LSFB 1NNPA 3H6UA 3IB2A 1H76A 4NWCA 3PD9A 5FHNA 2Q9TA 1MQJA 4LZ7A 1B5HA 2ALUA 3P7IA 5CBSA 5L9MA 3T66A 3N5LA 1GTKA 3FATA 4XIGQ 1FW0A 1YAEA 3G7WA 3MZ9A 1PB8A 3Q25A 4OXVA 3SEWA 3TPAA 1B0LA 3HSTA 4TLLB 1BLFA 4PFYA 3IR1A 3E4RA 3U92A 5AE4A 2A5SA 4PP0A 4LVQA 4LQ5A 1LBBA 1URDA 3OO6A 4LUBA 4OFOA 2UVHA 1B1HA 4OFLA 5H8FA 5KCJB 1HSJA 1IEJA 2O7IA 1YCJA 1MG1A 2HAUA 4IB2A 5HBCA 2XX8A 1PC3A 1I6QA 3O66A 1QUJA 4YB5A 2HFBA 3U94A 2V3UA 1OQGA 2NWJA 4X9TA 4THIA 3SDFA 3ODBA 5H8HA 1UIVA 3OO7A 4H5GA 1WDNA 3E3KA 3OSRA 1GV8A 2F7AA 3K1MA 3W9WA 4C0RA 5HM4B 5L9SA 1B3GA 2RCAA 1JVXA 4GVOA 1NNKA 3M3FA 5IKBA 4R6HA 1NNFA 3T96B 3S9NC 1T0KA 1WVJA 1H45A 4DCYA 3QUJA 3C4MA 1RKMA 4HS7A 2QL3A 4RJZA 3TQWA 3VFJA 3O2AA 5FHMA 4JWYA 3KG2A 3F11A 2XHDA 4NF5A 1GGGA 1MH3A 4ISUA 5A5XB 4I9DA 2OWSA 1N3XA 4XKPA 3MPKA 3N6UA 1TWYA 4NTLA 4IO7A 3FV2A 1UTBB 1M5FA 4R2BA 3FVKA 3PPPA 4ECFA 2HZKA 4JDFA 4KPTA 4F31B 3LSWA 5LOMA 2DP8A 2ZXTA 3BFUA 4R74A 1J1NA 2D5WA 2AL5A 3MVZA 3QAXA 5DYHA 2ZNTA 3W9VA 5CC2A 5I56B 1LAFE 1IITA 4DZ1A 2NUVA 2DE4A 1LCFA 3MAMA 5I59A 1SVXB 1ANFA 4ZS9A 3RT6B 1SI0A 4N6PA 2ONSA 1GR2A 3LC8A 4DXUA 2I3WA 3CFZA 3OXNA 1A8EA 3TQLA 1EZ9A 4X1DA 3R7XA 3UGWA 3MQ9A 1N3WA 4G8MA 2NOOA 4YB6A 3TEPA 3PUVE 1OMPA 3T9UA 3SESA 5I2NB 1R6ZA 4XKRA 2XXUA 4YKPA 1B3FA 4FJPA 4RXLA 3E9XA 2XD2A 3TTLA 2OBGA 3QUFA 4GL8A 4FAJA 2AL4A 2A5TA 5BWJA 3SERA 3K6WA 3LBSA 3CSGA 5H8QA 2QMWA 4ZE8A 1A8FA 2XXYA 3PPRA 1USYE 4OEUA 4QSCA 5CMBA 3PUYE 5JTYA 4Q30B 3KSXA 2Q89A 5AA2D 1MXVA 4EUOA 3K1PA 2REGA 3T9VA 4DE8A 2G93A 1B05A 4FEDA 5AA2B 1NMUA 4KCDA 5ELVA 3I5OA 1VFDA 3RT8A 4ESXA 4F22A 5J1DA 1PB7A 3K02A 2AIXA 3MVWA 1SYIA 4FE8A 4OENA 1DTGA 2UVIA 3PU5A 3T93B 1MPBA 4GLIA 4OYVA 4EQ7A 1PDAA 4M1VA 4ZZEA 1HSLA 5CRYA 1B5JA 3C32A 1MDP1 2X7QA 1R9LA 2W7YA 4GFRA 3G3KA 1SYHA 2ZNUA 1DTZA 3PMVA 2UYEA 5H8QB 3TYHA 3IJOB 1JW4A 2ANJA 3T9HB 2DWJA 2UXAA 3M3LA 3MC2A 1Y3QA 3FJGA 3M3KA 2HXWA 4IGRA 1LAGE 4O3AA 4UA8A 4WXJA 3S2VA 4F2OA 5I57A 4H0WA 1LBCA 1IUDA 3D4GA 1LB8A 2VD3A 2ZYNA 3MBPA 4ESWA 2O1LA 1US5A 1FTKA 2F34A 3FD3A 3MJNA 1I69A 2VD2A 4IO2A 4MF3A 4ELPA 3PGFA 2DYXA 2DXYA 2DS9A 1EH3A 5I2KB 1MS7A 2XXVA 4KQPA 5ISUA 3FXQA 1MXZA 4FORA 1IXGA 4H65A 3TTRA 3V8XB 1SW1A 4F3SA 2GRVA 5CMKA 4BDNA 3M8UA 1B9JA 4O3BA 5DT6A 4QFPA 4U22A 2ABHA 1VSOA 2UYFA 3G3GA 1TT1A 4AB6A 4E0WA 2X7PA 3C9HA 3KJ7A 4F2QA 1EZPA 1Q35A 2DWAA 2QS2A 2I0CA 1FTOA 3O6GA 4OETA 5H8NA 3TELA 2F97A 3EHSA 5I58B 4NF8B 3ECRA 3GXAA 1Y9UA 4U1ZA 4ELOA 1AL3A 2F78A 2X26A 1QULA 1XC1A 4O3CA 4OHNA 4AQ4A 2I49A 4G8HA 1B46A 3K4UA 3IOUA 4YU0A 5F7VA 1B32A 2ZYKA 4ZEIA 3V5AA 3N6TA 4JXIA 2PX1A 1N76A 3S9LC 3L6GA 5I57B 3G3IA 4H67A 1QJMA 3N94A 2PT2A 1LFHA 3W15C 1D9VA 1PBPA 1JNFA 1QUIA 2RC9A 3IL1B 3IORA 1B0HA 4U4XA 4XTCQ 5DVIA 2DSFA 2P1SA 1AH5A 1BP5A 1B2HA 1MRPA 2VGQA 3FASA 3LR1A 3LUYA 4LQ2A 1Z7ME 2RKMA 2F5XA 3O6IA 4OVJA 1MM6A 3U1OA 2HCAA 3H06B 4HCWA 5DEXB 4MH5A 5F1QA 3KOSA 2F6PA 3FZVA 2QPQA 2M8CA 4BLAA 4DXCA 1XT8A 4GRKA 4LZ8A 4EXKA 1B1XA 5HPQA 4N07A 1B7UA 3EN3A 2XD3A 1URGA 5AA2A 3FUZA 1LLSA 1M5BA 4P0GA 2CMOA 3K00A 3K1NA 4RA1A 1BKAA 4OWDA 3HHGA 4KFQA 5EHMA 4DXBA 4H8IA 1ZMGA 4IO5A 4KYEA 4R6KA 2XXRA 3RY3A 3H6WA 2R9JA 4OQOA 3UP9A 2O51A 2XXHA 3HO7A 4I8CA 2G29A 4MBPA 4DIGA 4YAHX 1HSEA 5KDTA 3PUXE 2BJJX 1JETA 2IEEA 2I6EA 2ZNSA 5H8HB 3IO4A 1CB6A 1QUKA 3TAJA 3ZKLA 4KD5A 3E13X 3MUQA 3TMGA 1NKXA 1Y4TA 3FJMA 2E1SA 1IZ1A 4M4GA 4NMYA 2RINA 4ONYA 4RNSA 4ZZAA 1KWHA 5CI5A 2CZLA 1N7XA 3RTWB 1M5DA 1M5EA 1MXYA 5DVJA 2H4IA 1LAHE 3CG3A 4G68B 4QFLA 4HCYA 4XKNA 5ITPA 3B6WA 3I6VA 3WAEA 2AYSA 4K3FA 2F7BA 3O97A 4F1UA 4OFJA 5I84A 2ZYMA 1H44A 2XXIA 3GLBA 1I6BA 3Q29A 4ZEDA 2ZYOA 3DLNA 2Q8JA 1UTBA 3IB1A 4NEDA 3IAZA 4PFTA 2B65A 1US4A 1B7ZA 1FQEA 1S50A 4GQOA 2I58A 2Y7KA 3V83A 3IK6B 3KSJA 1IXCA 2Q2AA 3ILUB 1RYXA 4DDDA 2LAOA 4OZ9A 4ND9A 4NF5B 4PETA 1R1NA 2F8DA 1UIUA 4LP2B 4ZEBA 3GBAA 2QS3A 3RTFB 3G3FA 1LFGA 4ZE9A 3MPLA 3UA8A 2F6GA 3KOTA 4JBZA 1S7YA 1A7LA 3QYTA 2R71A 1USYH 4Q0CA 4U23A 4POXA 3Q26A 4U1OA 5EHSA 3O9PA 4R72A 1MY1A 5H8SA 1AOVA 5ICTA 4Q5TA 1A99A 3VLVA 4F1VA 1NFTA 5H8FB 3QK6A 4QRZA 5TU0A 5TP9A 2DE2A 3TKDA 4LATA 2Z23A 1ZBMA 5CMMA 4QSDA 5JEIA 4G8NA 1SBPA 1ZKBA 4GD5A 4IO6A 3THIA 4GXAA 4MFIA 2XXXA 2QS4A 3TDJA 5I56A 2P2AA 1UTHB 1Y1ZA 1QW0A 2PYYA 1ZU0A 4KYSA 4RK2A 4DCXA 2V25A 4WEPA 1IIWA 4MLVA 1A40A 1SW2A 3UORA 2H5YA 3OO8A 2DVZA 1URSA 2OZZA 4OESA 1GVCA 1H3DA 3VLUA 5KDTB 2Y7IA 2OCUA 1B6HA 3HN0A 1FTJA 4KYDA 4R9FA 3RGYA 3VVFA 4F1YA 1LCTA 1MM7A 2FNCA 2PT1A 4R75A 2ONKE 4N13A 5K2YA 3RQTA 3TCHA 3H6TA 3OSQA 4GL0A 5AA1A 1P1OA 3PV0E 1JQFA 5JK4A 1MPCA 3VXBA 3DP4A 3B7DA 3R6UA 1B51A 1SW4A 3A3UA 3MP1A 3SKPA 4EF2A 4F3GA 5I2NA 4H6DA 1FCKA 3B6QA 1DPPA 1II5A 1YPNA 2H98A 2O84X 1ZLQA 2WKYA 3LSLA 4QFOA 4UACA 3PMWA 1OQHA 3CSBA 3RNNA 5M2VA 3HHFA 3R26A 4PE5B 3HPIA 1OVTA 3IX1A 3O6HA 4NE4A 3RN8A 1MXXA 2RCBA 1UTHA 3VXCA 1MDQA 2V3TA 5ITOA 3C31A 1ELJA 1PEBA 2OK2A 3CFLA 4JSOA 4C1TA 3TZAA 4IY5A 1N7WA 2E0SA 2I48A 2PBWA 4R6YA 4QFNA 4E0XA 5FTHA 5TPAA 1LGBC 3ZKKA 2ESNA 3CI8A 1POTA 3O28A 1NH8A 3IO6A 1MY4A 4PQJA 3VE1B 4C1UA 3DP6A 4MLQA 3MZBA 3IB0A 1L5TA 3TFLA 4TLMB 3VVDA 3IJXB 4AB5A 3EF7A 1XVYA 5ICQA 2Y7WA 3PUWE 2GH9A 3EHUA 3KN7A 4JWXA 5TP9B 5L9OA 3USDA 5H8NB 4DLDA 3OO9A 1M5CA 4LZ5A 3TUSA 3FVNA 3CRBA 4IY6A 4OMBA 4TOZA 4RY1A 2XXPA 4U2RA 3K2DA 3S9EA 4ZECA 4TQUQ 1R9QA 2HZLA 3LSXA 3MP6A 2DWHA 3CFXA 4YB7A 2Y7RA 3PD8A 4FEBA 3OEKA 3OENA 4H5FA 2H99A 2Z8DA 4LA9A 2F7CA 4X1BA 4F19A 4NF4A 5AA4A 3VDFA 1JEUA 1Y4CA 2QRYA 3TODA 1D3KA 4JSDA 3SEYA 3EHTA 1AMFA 3QXMA 4YMBA 5KCJA 1Z7NE 1B52A 5DEXA 3CR9A 1MQDA 2RC8A 1DOTA 4G2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OIB A;  1N0T A;  1RYO A;  1MQI A;  3A09 A;  2I0B A;  1MXW A;  1P1Q A;  4FEC A;  2DWI A;  4QSE A;  5EYF A;  5L8D A;  1DSN A;  3UK4 A;  2DE3 A;  2YJP A;  3N26 A;  3VV5 A;  2I4B A;  1B7H A;  1TFA A;  1SW5 A;  3DEL B;  3FJ7 A;  5I2K A;  3H6V A;  4BDM A;  1Y20 A;  3C33 A;  3MZ1 A;  4P0I A;  3UIF A;  3FIR A;  5FHO A;  1O63 A;  4NF6 B;  2Q88 A;  3K6U A;  1FQF A;  1MPD A;  5BUU A;  3BBR A;  2HQ0 A;  3MVX A;  3TCG A;  4YZZ A;  3OEL A;  4PFW A;  3TTK A;  3ONM A;  2UVG A;  1N04 A;  1B3L A;  3H03 A;  3K0V A;  1MXU A;  2H9B A;  2THI A;  3OD7 A;  3I3V A;  1B4Z A;  1NL5 A;  5I58 A;  3KN3 A;  3CVG A;  3GZG A;  2GHA A;  2I4C A;  3PPQ A;  2QJE A;  2NVU B;  2Z22 A;  1QVS A;  3PMX A;  1FQB A;  4U4S A;  1A54 A;  4X48 A;  3K6X A;  1NH7 A;  3PPO A;  1TFD A;  1MY0 A;  1P1W A;  1VR5 A;  3DP8 A;  2OLB A;  2VP1 A;  1PB9 A;  3KN8 A;  4IO4 A;  3T22 A;  3ZSF A;  2IA4 A;  4XXU A;  1B40 A;  3JV9 A;  4G68 A;  4QHQ A;  4ZDM A;  4RK9 A;  5IAI A;  3S4U A;  1FTM A;  2DOJ A;  3OMB A;  1SDX A;  4OER A;  3RLF E;  4FIM A;  4R73 A;  3B6T A;  1IQ7 A;  4GIZ A;  3GBB A;  2XXQ A;  2Y7P A;  3MW0 A;  4OEV A;  4EF1 A;  2I3V A;  2OJT A;  4HW8 A;  5KZT A;  4U21 A;  4KHZ E;  4G68 C;  3FVG A;  3JYR A;  2QMX A;  3KFM A;  4POW A;  4L17 A;  2O7U A;  2Q2C A;  3KBR A;  3HV1 A;  4NF8 A;  4YKI A;  1F9B A;  1S9T A;  1SQY A;  3G3J A;  3SEV A;  4WED A;  3CIJ A;  1LAX A;  4EQ9 A;  2B3B A;  1Y1M A;  1D4N A;  2UVJ A;  1P1U A;  1MQG A;  2HAV A;  3FGS A;  3JZJ A;  3PUZ E;  4G77 A;  4F39 A;  1EU8 A;  5CMC A;  2F36 A;  1OVB A;  2V93 A;  2PVU A;  3BFT A;  4LON B;  3QIM A;  4GWO A;  3KGC A;  2GFE A;  3C34 A;  3IOT A;  2O69 A;  3H4Z A;  4HTG A;  4YKK A;  3TTN A;  1EZO A;  5K2X A;  3AXF A;  3TCF A;  1BTJ A;  5DVF A;  1DMB A;  4R9G A;  1WOD A;  3VLW A;  3FVO A;  4JB7 A;  4GOT A;  2GHB A;  3U93 A;  4F29 A;  1B4H A;  4Z0I A;  4EXL A;  3T9X B;  4YKJ A;  3VVE A;  4QF9 A;  5CBR A;  2HEU A;  1B3H A;  2VOZ A;  3CG1 A;  3PPN A;  1MH4 A;  2REJ A;  2PMS A;  1JEV A;  2VHA A;  1JW1 A;  4QFK A;  4F3P A;  2RF1 A;  1B3E A;  3KJT A;  3RPW A;  3G3H A;  3EQ1 A;  4YIC A;  3U8Q A;  4RPN A;  1ZJL A;  1OLA A;  2QSX A;  4F18 A;  5AA3 A;  1PBQ A;  4NF6 A;  3WAF A;  1VFE A;  2R6G E;  1DPE A;  1MY3 A;  4H1X A;  4KI0 E;  3MP8 A;  2YPN A;  4WKM A;  2QS1 A;  3SET A;  3ZS6 A;  2F35 A;  1O7T A;  4ELR A;  4EQB A;  3RUM A;  4YMA A;  1ZIU A;  2B3F A;  1SI1 A;  1JVY A;  3QSL A;  4G4P A;  1IXI A;  2V3Q A;  3MWB A;  1P1N A;  4I62 A;  2XX9 A;  4XKQ A;  4ZEK A;  2FA7 A;  2OWT A;  5FTI A;  1JW5 A;  4Q8R A;  4F3B A;  1OLC A;  1POY 1;  1LFI A;  3Q28 A;  4IO3 A;  4FAT A;  1B5I A;  1XS5 A;  3V89 B;  4BDL A;  1MQH A;  4Z7E A;  5A5X A;  2XXW A;  1QKA A;  2O68 A;  2O6A A;  2XXT A;  3EPE A;  3HCQ A;  1LB9 A;  3Q27 A;  4NF4 B;  4R2F A;  1CE2 A;  2RC7 A;  1O64 A;  1Y3N A;  3K01 A;  4ZEF A;  4BDQ A;  3OEM A;  1LST A;  1FQD A;  3KZG A;  2H25 A;  1H43 A;  1FTL A;  4IGT A;  1FQA A;  2Z8F A;  3S9M C;  1B58 A;  1UQW A;  4OTE A;  4PFU A;  4GXS B;  1YTV A;  2XX7 A;  5I59 B;  2DVC A;  3C35 A;  1D9Y A;  1SD3 A;  2Z8E A;  3SEU A;  3O29 A;  4BDO A;  1ATG A;  3FV1 A;  5B70 A;  3KEI A;  3U72 A;  3SEX A;  2Y84 A;  2KLF A;  4ELQ A;  3UN6 A;  1N84 A;  2DQV A;  2DXR A;  2NXO A;  2ONR A;  4EDP A;  3H7M A;  1XVX A;  4KCC A;  1XOC A;  3L6H A;  4RPO A;  1A55 A;  2YLN A;  2D21 A;  5TPA B;  1MY2 A;  3H3G A;  5B7D A;  2FYI A;  1NNT A;  3K6V A;  1Y3P A;  3FXU A;  4P11 A;  5AA4 B;  1TXF A;  3OOA A;  2D3I A;  1VE4 A;  4KR5 A;  1ZTY A;  4NWD A;  1FQC A;  3FXR A;  4GF8 A;  2V84 A;  5JTY B;  3IOV A;  4I1D A;  5DTB A;  1BIY A;  3MVY A;  3C36 A;  3ILT B;  2P0S A;  3BKI B;  1P99 A;  1Q1K A;  2ZMB A;  2A5T B;  1QKB A;  3IOW A;  4H8J A;  4RYA A;  3TTM A;  3D4C A;  5CM6 A;  1I6A A;  1IXH A;  3A3C A;  3DM0 A;  2O1M A;  4JWO A;  1XHY A;  4BDR A;  1AIV A;  3LSF B;  1NNP A;  3H6U A;  3IB2 A;  1H76 A;  4NWC A;  3PD9 A;  5FHN A;  2Q9T A;  1MQJ A;  4LZ7 A;  1B5H A;  2ALU A;  3P7I A;  5CBS A;  5L9M A;  3T66 A;  3N5L A;  1GTK A;  3FAT A;  4XIG Q;  1FW0 A;  1YAE A;  3G7W A;  3MZ9 A;  1PB8 A;  3Q25 A;  4OXV A;  3SEW A;  3TPA A;  1B0L A;  3HST A;  4TLL B;  1BLF A;  4PFY A;  3IR1 A;  3E4R A;  3U92 A;  5AE4 A;  2A5S A;  4PP0 A;  4LVQ A;  4LQ5 A;  1LBB A;  1URD A;  3OO6 A;  4LUB A;  4OFO A;  2UVH A;  1B1H A;  4OFL A;  5H8F A;  5KCJ B;  1HSJ A;  1IEJ A;  2O7I A;  1YCJ A;  1MG1 A;  2HAU A;  4IB2 A;  5HBC A;  2XX8 A;  1PC3 A;  1I6Q A;  3O66 A;  1QUJ A;  4YB5 A;  2HFB A;  3U94 A;  2V3U A;  1OQG A;  2NWJ A;  4X9T A;  4THI A;  3SDF A;  3ODB A;  5H8H A;  1UIV A;  3OO7 A;  4H5G A;  1WDN A;  3E3K A;  3OSR A;  1GV8 A;  2F7A A;  3K1M A;  3W9W A;  4C0R A;  5HM4 B;  5L9S A;  1B3G A;  2RCA A;  1JVX A;  4GVO A;  1NNK A;  3M3F A;  5IKB A;  4R6H A;  1NNF A;  3T96 B;  3S9N C;  1T0K A;  1WVJ A;  1H45 A;  4DCY A;  3QUJ A;  3C4M A;  1RKM A;  4HS7 A;  2QL3 A;  4RJZ A;  3TQW A;  3VFJ A;  3O2A A;  5FHM A;  4JWY A;  3KG2 A;  3F11 A;  2XHD A;  4NF5 A;  1GGG A;  1MH3 A;  4ISU A;  5A5X B;  4I9D A;  2OWS A;  1N3X A;  4XKP A;  3MPK A;  3N6U A;  1TWY A;  4NTL A;  4IO7 A;  3FV2 A;  1UTB B;  1M5F A;  4R2B A;  3FVK A;  3PPP A;  4ECF A;  2HZK A;  4JDF A;  4KPT A;  4F31 B;  3LSW A;  5LOM A;  2DP8 A;  2ZXT A;  3BFU A;  4R74 A;  1J1N A;  2D5W A;  2AL5 A;  3MVZ A;  3QAX A;  5DYH A;  2ZNT A;  3W9V A;  5CC2 A;  5I56 B;  1LAF E;  1IIT A;  4DZ1 A;  2NUV A;  2DE4 A;  1LCF A;  3MAM A;  5I59 A;  1SVX B;  1ANF A;  4ZS9 A;  3RT6 B;  1SI0 A;  4N6P A;  2ONS A;  1GR2 A;  3LC8 A;  4DXU A;  2I3W A;  3CFZ A;  3OXN A;  1A8E A;  3TQL A;  1EZ9 A;  4X1D A;  3R7X A;  3UGW A;  3MQ9 A;  1N3W A;  4G8M A;  2NOO A;  4YB6 A;  3TEP A;  3PUV E;  1OMP A;  3T9U A;  3SES A;  5I2N B;  1R6Z A;  4XKR A;  2XXU A;  4YKP A;  1B3F A;  4FJP A;  4RXL A;  3E9X A;  2XD2 A;  3TTL A;  2OBG A;  3QUF A;  4GL8 A;  4FAJ A;  2AL4 A;  2A5T A;  5BWJ A;  3SER A;  3K6W A;  3LBS A;  3CSG A;  5H8Q A;  2QMW A;  4ZE8 A;  1A8F A;  2XXY A;  3PPR A;  1USY E;  4OEU A;  4QSC A;  5CMB A;  3PUY E;  5JTY A;  4Q30 B;  3KSX A;  2Q89 A;  5AA2 D;  1MXV A;  4EUO A;  3K1P A;  2REG A;  3T9V A;  4DE8 A;  2G93 A;  1B05 A;  4FED A;  5AA2 B;  1NMU A;  4KCD A;  5ELV A;  3I5O A;  1VFD A;  3RT8 A;  4ESX A;  4F22 A;  5J1D A;  1PB7 A;  3K02 A;  2AIX A;  3MVW A;  1SYI A;  4FE8 A;  4OEN A;  1DTG A;  2UVI A;  3PU5 A;  3T93 B;  1MPB A;  4GLI A;  4OYV A;  4EQ7 A;  1PDA A;  4M1V A;  4ZZE A;  1HSL A;  5CRY A;  1B5J A;  3C32 A;  1MDP 1;  2X7Q A;  1R9L A;  2W7Y A;  4GFR A;  3G3K A;  1SYH A;  2ZNU A;  1DTZ A;  3PMV A;  2UYE A;  5H8Q B;  3TYH A;  3IJO B;  1JW4 A;  2ANJ A;  3T9H B;  2DWJ A;  2UXA A;  3M3L A;  3MC2 A;  1Y3Q A;  3FJG A;  3M3K A;  2HXW A;  4IGR A;  1LAG E;  4O3A A;  4UA8 A;  4WXJ A;  3S2V A;  4F2O A;  5I57 A;  4H0W A;  1LBC A;  1IUD A;  3D4G A;  1LB8 A;  2VD3 A;  2ZYN A;  3MBP A;  4ESW A;  2O1L A;  1US5 A;  1FTK A;  2F34 A;  3FD3 A;  3MJN A;  1I69 A;  2VD2 A;  4IO2 A;  4MF3 A;  4ELP A;  3PGF A;  2DYX A;  2DXY A;  2DS9 A;  1EH3 A;  5I2K B;  1MS7 A;  2XXV A;  4KQP A;  5ISU A;  3FXQ A;  1MXZ A;  4FOR A;  1IXG A;  4H65 A;  3TTR A;  3V8X B;  1SW1 A;  4F3S A;  2GRV A;  5CMK A;  4BDN A;  3M8U A;  1B9J A;  4O3B A;  5DT6 A;  4QFP A;  4U22 A;  2ABH A;  1VSO A;  2UYF A;  3G3G A;  1TT1 A;  4AB6 A;  4E0W A;  2X7P A;  3C9H A;  3KJ7 A;  4F2Q A;  1EZP A;  1Q35 A;  2DWA A;  2QS2 A;  2I0C A;  1FTO A;  3O6G A;  4OET A;  5H8N A;  3TEL A;  2F97 A;  3EHS A;  5I58 B;  4NF8 B;  3ECR A;  3GXA A;  1Y9U A;  4U1Z A;  4ELO A;  1AL3 A;  2F78 A;  2X26 A;  1QUL A;  1XC1 A;  4O3C A;  4OHN A;  4AQ4 A;  2I49 A;  4G8H A;  1B46 A;  3K4U A;  3IOU A;  4YU0 A;  5F7V A;  1B32 A;  2ZYK A;  4ZEI A;  3V5A A;  3N6T A;  4JXI A;  2PX1 A;  1N76 A;  3S9L C;  3L6G A;  5I57 B;  3G3I A;  4H67 A;  1QJM A;  3N94 A;  2PT2 A;  1LFH A;  3W15 C;  1D9V A;  1PBP A;  1JNF A;  1QUI A;  2RC9 A;  3IL1 B;  3IOR A;  1B0H A;  4U4X A;  4XTC Q;  5DVI A;  2DSF A;  2P1S A;  1AH5 A;  1BP5 A;  1B2H A;  1MRP A;  2VGQ A;  3FAS A;  3LR1 A;  3LUY A;  4LQ2 A;  1Z7M E;  2RKM A;  2F5X A;  3O6I A;  4OVJ A;  1MM6 A;  3U1O A;  2HCA A;  3H06 B;  4HCW A;  5DEX B;  4MH5 A;  5F1Q A;  3KOS A;  2F6P A;  3FZV A;  2QPQ A;  2M8C A;  4BLA A;  4DXC A;  1XT8 A;  4GRK A;  4LZ8 A;  4EXK A;  1B1X A;  5HPQ A;  4N07 A;  1B7U A;  3EN3 A;  2XD3 A;  1URG A;  5AA2 A;  3FUZ A;  1LLS A;  1M5B A;  4P0G A;  2CMO A;  3K00 A;  3K1N A;  4RA1 A;  1BKA A;  4OWD A;  3HHG A;  4KFQ A;  5EHM A;  4DXB A;  4H8I A;  1ZMG A;  4IO5 A;  4KYE A;  4R6K A;  2XXR A;  3RY3 A;  3H6W A;  2R9J A;  4OQO A;  3UP9 A;  2O51 A;  2XXH A;  3HO7 A;  4I8C A;  2G29 A;  4MBP A;  4DIG A;  4YAH X;  1HSE A;  5KDT A;  3PUX E;  2BJJ X;  1JET A;  2IEE A;  2I6E A;  2ZNS A;  5H8H B;  3IO4 A;  1CB6 A;  1QUK A;  3TAJ A;  3ZKL A;  4KD5 A;  3E13 X;  3MUQ A;  3TMG A;  1NKX A;  1Y4T A;  3FJM A;  2E1S A;  1IZ1 A;  4M4G A;  4NMY A;  2RIN A;  4ONY A;  4RNS A;  4ZZA A;  1KWH A;  5CI5 A;  2CZL A;  1N7X A;  3RTW B;  1M5D A;  1M5E A;  1MXY A;  5DVJ A;  2H4I A;  1LAH E;  3CG3 A;  4G68 B;  4QFL A;  4HCY A;  4XKN A;  5ITP A;  3B6W A;  3I6V A;  3WAE A;  2AYS A;  4K3F A;  2F7B A;  3O97 A;  4F1U A;  4OFJ A;  5I84 A;  2ZYM A;  1H44 A;  2XXI A;  3GLB A;  1I6B A;  3Q29 A;  4ZED A;  2ZYO A;  3DLN A;  2Q8J A;  1UTB A;  3IB1 A;  4NED A;  3IAZ A;  4PFT A;  2B65 A;  1US4 A;  1B7Z A;  1FQE A;  1S50 A;  4GQO A;  2I58 A;  2Y7K A;  3V83 A;  3IK6 B;  3KSJ A;  1IXC A;  2Q2A A;  3ILU B;  1RYX A;  4DDD A;  2LAO A;  4OZ9 A;  4ND9 A;  4NF5 B;  4PET A;  1R1N A;  2F8D A;  1UIU A;  4LP2 B;  4ZEB A;  3GBA A;  2QS3 A;  3RTF B;  3G3F A;  1LFG A;  4ZE9 A;  3MPL A;  3UA8 A;  2F6G A;  3KOT A;  4JBZ A;  1S7Y A;  1A7L A;  3QYT A;  2R71 A;  1USY H;  4Q0C A;  4U23 A;  4POX A;  3Q26 A;  4U1O A;  5EHS A;  3O9P A;  4R72 A;  1MY1 A;  5H8S A;  1AOV A;  5ICT A;  4Q5T A;  1A99 A;  3VLV A;  4F1V A;  1NFT A;  5H8F B;  3QK6 A;  4QRZ A;  5TU0 A;  5TP9 A;  2DE2 A;  3TKD A;  4LAT A;  2Z23 A;  1ZBM A;  5CMM A;  4QSD A;  5JEI A;  4G8N A;  1SBP A;  1ZKB A;  4GD5 A;  4IO6 A;  3THI A;  4GXA A;  4MFI A;  2XXX A;  2QS4 A;  3TDJ A;  5I56 A;  2P2A A;  1UTH B;  1Y1Z A;  1QW0 A;  2PYY A;  1ZU0 A;  4KYS A;  4RK2 A;  4DCX A;  2V25 A;  4WEP A;  1IIW A;  4MLV A;  1A40 A;  1SW2 A;  3UOR A;  2H5Y A;  3OO8 A;  2DVZ A;  1URS A;  2OZZ A;  4OES A;  1GVC A;  1H3D A;  3VLU A;  5KDT B;  2Y7I A;  2OCU A;  1B6H A;  3HN0 A;  1FTJ A;  4KYD A;  4R9F A;  3RGY A;  3VVF A;  4F1Y A;  1LCT A;  1MM7 A;  2FNC A;  2PT1 A;  4R75 A;  2ONK E;  4N13 A;  5K2Y A;  3RQT A;  3TCH A;  3H6T A;  3OSQ A;  4GL0 A;  5AA1 A;  1P1O A;  3PV0 E;  1JQF A;  5JK4 A;  1MPC A;  3VXB A;  3DP4 A;  3B7D A;  3R6U A;  1B51 A;  1SW4 A;  3A3U A;  3MP1 A;  3SKP A;  4EF2 A;  4F3G A;  5I2N A;  4H6D A;  1FCK A;  3B6Q A;  1DPP A;  1II5 A;  1YPN A;  2H98 A;  2O84 X;  1ZLQ A;  2WKY A;  3LSL A;  4QFO A;  4UAC A;  3PMW A;  1OQH A;  3CSB A;  3RNN A;  5M2V A;  3HHF A;  3R26 A;  4PE5 B;  3HPI A;  1OVT A;  3IX1 A;  3O6H A;  4NE4 A;  3RN8 A;  1MXX A;  2RCB A;  1UTH A;  3VXC A;  1MDQ A;  2V3T A;  5ITO A;  3C31 A;  1ELJ A;  1PEB A;  2OK2 A;  3CFL A;  4JSO A;  4C1T A;  3TZA A;  4IY5 A;  1N7W A;  2E0S A;  2I48 A;  2PBW A;  4R6Y A;  4QFN A;  4E0X A;  5FTH A;  5TPA A;  1LGB C;  3ZKK A;  2ESN A;  3CI8 A;  1POT A;  3O28 A;  1NH8 A;  3IO6 A;  1MY4 A;  4PQJ A;  3VE1 B;  4C1U A;  3DP6 A;  4MLQ A;  3MZB A;  3IB0 A;  1L5T A;  3TFL A;  4TLM B;  3VVD A;  3IJX B;  4AB5 A;  3EF7 A;  1XVY A;  5ICQ A;  2Y7W A;  3PUW E;  2GH9 A;  3EHU A;  3KN7 A;  4JWX A;  5TP9 B;  5L9O A;  3USD A;  5H8N B;  4DLD A;  3OO9 A;  1M5C A;  4LZ5 A;  3TUS A;  3FVN A;  3CRB A;  4IY6 A;  4OMB A;  4TOZ A;  4RY1 A;  2XXP A;  4U2R A;  3K2D A;  3S9E A;  4ZEC A;  4TQU Q;  1R9Q A;  2HZL A;  3LSX A;  3MP6 A;  2DWH A;  3CFX A;  4YB7 A;  2Y7R A;  3PD8 A;  4FEB A;  3OEK A;  3OEN A;  4H5F A;  2H99 A;  2Z8D A;  4LA9 A;  2F7C A;  4X1B A;  4F19 A;  4NF4 A;  5AA4 A;  3VDF A;  1JEU A;  1Y4C A;  2QRY A;  3TOD A;  1D3K A;  4JSD A;  3SEY A;  3EHT A;  1AMF A;  3QXM A;  4YMB A;  5KCJ A;  1Z7N E;  1B52 A;  5DEX A;  3CR9 A;  1MQD A;  2RC8 A;  1DOT A;  4G2Z A; 
#chains in the Genus database with same CATH topology
 3A09 A;  2I0B A;  1MXW A;  3UK4 A;  2DE3 A;  2YJP A;  3N26 A;  2I4B A;  3DEL B;  1Y20 A;  3MZ1 A;  5FHO A;  1O63 A;  2XWV A;  3IFC A;  3MVX A;  1INP A;  4PFI A;  2UVG A;  3K0V A;  3I3V A;  5I58 A;  3GZG A;  2NVU B;  1FQB A;  3ZSF A;  2OLB A;  4P3L A;  1PB9 A;  4XFE A;  3JV9 A;  4PDH A;  4G68 A;  4RK9 A;  1IME A;  5IZ3 B;  3B6T A;  2Y7P A;  3U65 A;  4U21 A;  4KHZ E;  2KQZ A;  3G3J A;  1NV2 A;  3CIJ A;  2HAV A;  4O7I A;  4GWO A;  2GFE A;  4HTG A;  4YKK A;  3H4Z A;  1EZO A;  5K2X A;  3AXF A;  1FBD A;  3VLW A;  1B4H A;  4Z0I A;  3VVE A;  1IMD A;  1MH4 A;  3FXB A;  1JEV A;  2VHA A;  3D1R A;  2RF1 A;  1B3E A;  3T1B A;  3G3H A;  1ZJL A;  4NF6 A;  2R6G E;  4KI0 E;  1IXI A;  1P1N A;  1NUY A;  2XX9 A;  4I62 A;  4XKQ A;  1IMF A;  1POY 1;  1B5I A;  4BDL A;  4Z7E A;  1MQH A;  5A5X A;  5IGA A;  2O6A A;  4GWX A;  3EPE A;  4IR8 A;  4R2F A;  1CE2 A;  1EYK A;  2RC7 A;  5DW8 A;  3LUZ A;  4PF8 A;  4BDQ A;  3OEM A;  1H43 A;  1NUW A;  2Z8F A;  4GXS B;  3FV1 A;  4ELQ A;  5EQA A;  1N84 A;  2DQV A;  2DXR A;  2ONR A;  4PC9 A;  4FBP A;  4KCC A;  3TUS A;  5TPA B;  3H3G A;  1FPL A;  1NNT A;  4P11 A;  3OOA A;  4NWD A;  5JTY B;  1BIY A;  5T3J A;  3MVY A;  2P0S A;  3BKI B;  1Q1K A;  5CM6 A;  1FTA A;  2XWK A;  2MKZ A;  1XHY A;  1VDW A;  4BDR A;  4NWC A;  2ALU A;  3P7I A;  4XIG Q;  1PB8 A;  5KDT A;  1B0L A;  3HST A;  4JVD A;  1BLF A;  1NUX A;  1URD A;  4LUB A;  4OFO A;  2UVH A;  1B1H A;  4MAG A;  5HBC A;  2XX8 A;  1PC3 A;  4X9T A;  3ODB A;  3OO7 A;  1WDN A;  4C0R A;  5HM4 B;  3QUJ A;  2QL3 A;  3F11 A;  4ISU A;  5A5X B;  3MPK A;  3N6U A;  4I40 A;  5FBP A;  4NTL A;  2Q74 A;  1NV3 A;  4JDF A;  4F31 B;  3LSW A;  4R74 A;  3MVZ A;  5CC2 A;  3W9V A;  1ANF A;  2GQ1 A;  1SI0 A;  3CFZ A;  1A8E A;  1EZ9 A;  3R7X A;  3MQ9 A;  4G8M A;  5KZT A;  3TTL A;  3TEP A;  4GL8 A;  4FAJ A;  4ZE8 A;  3PPR A;  4OEU A;  4NN3 A;  3ROJ A;  1MXV A;  1B05 A;  4FED A;  4KCD A;  1PB7 A;  3T93 B;  4GLI A;  4EQ7 A;  1PDA A;  4ZZE A;  4GWZ A;  1B5J A;  4GFR A;  2X7Q A;  1SYH A;  1DTZ A;  3PMV A;  3IJO B;  2ANJ A;  3M3L A;  3MC2 A;  1Y3Q A;  4UA8 A;  1K9Z A;  2VD3 A;  4OA4 A;  4ESW A;  1US5 A;  1FTK A;  2Q8M A;  2DYX A;  2GRV A;  3M8U A;  4O3B A;  4F2Q A;  4H45 A;  1NV0 A;  2F97 A;  5I58 B;  4NF8 B;  1Y9U A;  4U1Z A;  2XWO A;  2I49 A;  5F7V A;  2PX1 A;  5IZZ A;  4H67 A;  3N94 A;  1PBP A;  1FBH A;  1BP5 A;  4LQ2 A;  2WYP A;  2RKM A;  4OVJ A;  5F1Q A;  2QFL A;  2F6P A;  3FZV A;  2QPQ A;  4BLA A;  1XT8 A;  4RA1 A;  1BKA A;  4PE3 A;  4DXB A;  3UP9 A;  2O51 A;  2G29 A;  3EKI A;  2I6E A;  3IO4 A;  1QUK A;  3TAJ A;  4KD5 A;  3E13 X;  3TMG A;  1IMA A;  1Y4T A;  2E1S A;  1IZ1 A;  4ONY A;  5CI5 A;  2CZL A;  1N7X A;  1M5E A;  2H4I A;  3IFA A;  4G68 B;  4HCY A;  1KA1 A;  4OFJ A;  5I84 A;  2XXI A;  3Q29 A;  3IAZ A;  1S50 A;  4GQO A;  2I58 A;  2Y7K A;  3V83 A;  4OZ9 A;  4O8M A;  5H8F A;  1LFG A;  3KOT A;  3O9P A;  1NV6 A;  5ICT A;  4Q5T A;  1A99 A;  5IZ1 A;  3VLV A;  5H8F B;  5TU0 A;  3TKD A;  5CMM A;  4G8N A;  4GX3 A;  4GXA A;  3TDJ A;  1Y1Z A;  1IIW A;  2H5Y A;  3OO8 A;  2OZZ A;  4N8Y A;  1B6H A;  3HN0 A;  4MCO A;  1LCT A;  4P56 A;  2PT1 A;  3RQT A;  1SW4 A;  4PGP A;  1YPN A;  3PMW A;  2OX3 A;  3RNN A;  3R26 A;  3IX1 A;  3RN8 A;  2RCB A;  1PEB A;  2E0S A;  1G0I A;  4NAP A;  3ZKK A;  3VE1 B;  3DP6 A;  3IB0 A;  4TLM B;  4NX1 A;  1XVY A;  4JWX A;  2KR0 A;  4RY1 A;  4U2R A;  5ET6 A;  2HZL A;  3LSX A;  4YB7 A;  4F19 A;  3OEN A;  2H99 A;  1JEU A;  1Y4C A;  3TOD A;  3SEY A;  3EHT A;  5KCJ A;  5DEX A;  1B52 A;  2B4M A;  4YB5 A;  2RC8 A;  4G61 A;  1OIB A;  4FEC A;  1P1Q A;  1DSN A;  1B7H A;  2PFY A;  1SW5 A;  4BDM A;  3C33 A;  3UIF A;  5ET7 A;  4P47 A;  3K6U A;  2HQ0 A;  4N17 A;  4PFW A;  4NG7 A;  1B3L A;  3H03 A;  1MXU A;  2THI A;  4O94 A;  1G0H A;  2B4L A;  1QVS A;  3PMX A;  4U4S A;  1A54 A;  3PPO A;  1VR5 A;  4XXU A;  4QHQ A;  3S4U A;  4FIM A;  4R73 A;  1IQ7 A;  3MW0 A;  4EF1 A;  4HW8 A;  4G68 C;  3KFM A;  4L17 A;  2Q2C A;  3KBR A;  1F9B A;  4NGU A;  1SQY A;  4WED A;  2F3B A;  1LAX A;  2B3B A;  4GWY A;  1P1U A;  4PF6 A;  1MQG A;  2WEF A;  3FGS A;  3PUZ E;  2F36 A;  2V93 A;  2PVU A;  4LON B;  3KGC A;  3C34 A;  3IOT A;  4N15 A;  4MNC A;  1BTJ A;  4JB7 A;  4EXL A;  4YKJ A;  4P9K A;  3RPW A;  3EQ1 A;  4RPN A;  1OLA A;  1QGX A;  2QSX A;  1PBQ A;  3WAF A;  4H1X A;  3MP8 A;  4WKM A;  4ELR A;  1O7T A;  2ZZW A;  4JVC A;  2B3F A;  4OVP A;  4I3E A;  4ZEK A;  1JW5 A;  3Q28 A;  4IO3 A;  1XS5 A;  2XXT A;  3HCQ A;  3Q27 A;  4NF4 B;  4ZEF A;  3LV0 A;  1B58 A;  1UQW A;  4PFU A;  1YTV A;  2XX7 A;  5I59 B;  2DVC A;  4GBW A;  4BDO A;  1ATG A;  5B70 A;  3SEX A;  2KLF A;  3UN6 A;  2NXO A;  3H7M A;  1MY2 A;  5B7D A;  2FYI A;  3K6V A;  5AA4 B;  1VE4 A;  1ZTY A;  3A29 A;  2V84 A;  3BIG A;  1FBG A;  3C36 A;  2XA5 A;  2A5T B;  3DM0 A;  4I3Y A;  3LSF B;  1NNP A;  1H76 A;  2Q9T A;  1MQJ A;  1B5H A;  3T66 A;  3TPA A;  3SEW A;  2L5V A;  4PFY A;  2FIX A;  2A5S A;  3MYU A;  1LBB A;  4OFL A;  3CHG A;  5KCJ B;  1IEJ A;  3B8B A;  3O66 A;  3U94 A;  2HFB A;  1OQG A;  4H5G A;  3W9W A;  1FRP A;  3S9N C;  3M3F A;  4R6H A;  1T0K A;  3C4M A;  4RJZ A;  5FHM A;  4JWY A;  2XHD A;  4I9D A;  1M5F A;  3FVK A;  2AL5 A;  4AS4 A;  5I59 A;  2XXK A;  4N6P A;  4PBH A;  4MEV A;  3SES A;  2XXU A;  4FJP A;  2OBG A;  2AL4 A;  3SER A;  1A8F A;  3PUY E;  4QBA A;  4N8G A;  1FPG A;  3K1P A;  4DE8 A;  5AA2 B;  1NMU A;  4F22 A;  3I5O A;  3MVW A;  1SYI A;  4FE8 A;  2UVI A;  4XF5 A;  1HSL A;  5CRY A;  3C32 A;  1R9L A;  4HE1 A;  3V89 B;  2DWJ A;  5H8N A;  3FJG A;  4WXJ A;  3KC0 A;  1DBZ A;  1FPJ A;  1LBC A;  3MBP A;  4IO2 A;  4HE2 A;  2DS9 A;  4KQP A;  4FOR A;  5CMK A;  3NOH A;  4F3S A;  1SW1 A;  1B9J A;  2ABH A;  3GYY A;  1TT1 A;  3KJ7 A;  1EZP A;  2I0C A;  4OET A;  3TEL A;  4OHN A;  1EYI A;  4AQ4 A;  1FPK A;  1B46 A;  3K4U A;  3IOU A;  4NQ8 A;  1B32 A;  1N76 A;  3L6G A;  3G3I A;  3W15 C;  1JNF A;  1QUI A;  1B0H A;  4U4X A;  2DSF A;  3LR1 A;  1B2H A;  3U1O A;  1LBZ A;  4HCW A;  4LZ8 A;  4EXK A;  1B1X A;  4N07 A;  2XD3 A;  1JP4 A;  1DK4 A;  1LLS A;  2CMO A;  3HHG A;  5EHM A;  1ZMG A;  4KYE A;  2XXR A;  2R9J A;  2XXH A;  3HO7 A;  4I8C A;  4DIG A;  4YAH X;  3PUX E;  1JET A;  2ZNS A;  5H8H B;  1CB6 A;  2FIE A;  3FJM A;  4M4G A;  4NMY A;  3RTW B;  4QFL A;  4XKN A;  3WAE A;  4K3F A;  2F7B A;  2QVR A;  1H44 A;  4N91 A;  2ZYO A;  4NED A;  4PFT A;  3ISP A;  1FQE A;  2ZZX A;  3KSJ A;  1IXC A;  4PTK A;  3ILU B;  1RYX A;  2LAO A;  4ND9 A;  2F8D A;  1UIU A;  2QS3 A;  4ZE9 A;  4Q0C A;  1A7L A;  3E79 A;  1USY H;  4GWS A;  3Q26 A;  4R72 A;  1NFT A;  5TP9 A;  4LAT A;  1ZBM A;  1FSA A;  5I56 A;  4MFI A;  2QS4 A;  2PYY A;  4RK2 A;  4KYS A;  2V25 A;  4MLV A;  1A40 A;  4OES A;  3VLU A;  5ET5 A;  1FTJ A;  1FPD A;  4KYD A;  4OAN A;  4R9F A;  3RGY A;  4F1Y A;  3TCH A;  1DCU A;  4GL0 A;  1JQF A;  5JK4 A;  1CNQ A;  4F3G A;  1FCK A;  3B6Q A;  2O84 X;  4QFO A;  2WKY A;  3LSL A;  1OQH A;  5M2V A;  4PE5 B;  5IM2 A;  2CEX A;  2V3T A;  5ITO A;  3C31 A;  4JSO A;  3TZA A;  2I48 A;  4R6Y A;  5I7I A;  5TPA A;  3O28 A;  1MY4 A;  1SPI A;  3T0J A;  3VVD A;  3IJX B;  3EF7 A;  5ICQ A;  3KN7 A;  5TP9 B;  3USD A;  3FVN A;  4IY6 A;  3K2D A;  4TQU Q;  2XWI A;  4X1B A;  4LA9 A;  2F7C A;  1AWB A;  3VDF A;  4JSD A;  1D9Q A;  1Z7N E;  4N6K A;  5EHS A;  1DOT A;  4YIC A;  2Y5L A;  1MQI A;  4QSE A;  2OWZ A;  1FJ6 A;  3FJ7 A;  3H6V A;  4NF6 B;  1FQF A;  1MPD A;  5BUU A;  3BBR A;  3TCG A;  4YZZ A;  1FPB A;  3OEL A;  2R8T A;  3TTK A;  4P8B A;  1N04 A;  3RPL A;  4MMP A;  3KN3 A;  3PPQ A;  2QJE A;  2Z22 A;  4O7M A;  3K6X A;  1NH7 A;  1TFD A;  1MY0 A;  1P1W A;  3DP8 A;  3T22 A;  2VP1 A;  1LBV A;  2IA4 A;  1B40 A;  1FTM A;  2DOJ A;  1SDX A;  4OER A;  3RLF E;  3GBB A;  4OEV A;  2I3V A;  2OJT A;  3JYR A;  2WBB A;  4POW A;  1FBC A;  3SEV A;  1NV1 A;  4EQ9 A;  2UVJ A;  4F39 A;  1EU8 A;  2V4C A;  1OVB A;  2O69 A;  3TCF A;  5DVF A;  1DMB A;  4R9G A;  4GOT A;  2GHB A;  3U93 A;  3T9X B;  1FBE A;  2HEU A;  1B3H A;  2VOZ A;  1XI6 A;  3PPN A;  4PAI A;  2REJ A;  3RPL B;  1KA0 A;  5AA3 A;  5IZ3 A;  1VFE A;  1MY3 A;  2YPN A;  3SET A;  2QS1 A;  3ZS6 A;  4EQB A;  3QSL A;  2CZI A;  4G4P A;  2V3Q A;  3MWB A;  2FA7 A;  3KBZ A;  5FTI A;  4Q8R A;  4F3B A;  1LFI A;  1RDZ A;  2XXW A;  1QKA A;  1LB9 A;  3K01 A;  1Y3N A;  1FQD A;  2H25 A;  4GX6 A;  4PFR A;  2JJK A;  4OTE A;  1FPF A;  3SEU A;  3O29 A;  1LEV A;  2Y84 A;  3HFU A;  4EDP A;  4RPO A;  3L6H A;  1A55 A;  2YLN A;  2D21 A;  4MNP A;  1Y3P A;  3FXU A;  2D3I A;  3FXR A;  4GF8 A;  4I1D A;  1YYZ A;  3ILT B;  2ZMB A;  4RYA A;  1QKB A;  4H8J A;  3TTM A;  3D4C A;  3A3C A;  4JWO A;  4NF0 A;  1EYJ A;  3H6U A;  5FHN A;  3IB2 A;  3PD9 A;  5EYH A;  5L9M A;  3N5L A;  3G7W A;  3Q25 A;  4OXV A;  3IR1 A;  3E4R A;  4PP0 A;  4LVQ A;  2O7I A;  4IB2 A;  2HAU A;  4THI A;  5H8H A;  1UIV A;  3E3K A;  3OSR A;  1GV8 A;  2F7A A;  3K1M A;  2RCA A;  3T96 B;  1WVJ A;  1H45 A;  3PTY A;  4DCY A;  4HS7 A;  3TQW A;  3O2A A;  4NF5 A;  1GGG A;  2OWS A;  1N3X A;  3FV2 A;  4R2B A;  3PPP A;  4ECF A;  2HZK A;  5DYH A;  1J1N A;  2D5W A;  4DZ1 A;  1IIT A;  4F3P A;  4ZS9 A;  3TQL A;  1N3W A;  2NOO A;  4YB6 A;  3PUV E;  1OMP A;  4YKP A;  1B3F A;  4RXL A;  3E9X A;  2XD2 A;  3QUF A;  3KC1 A;  5BWJ A;  3K6W A;  3LBS A;  4PAK A;  3CSG A;  2XXY A;  5F24 A;  2HPG A;  2VT5 A;  5JTY A;  4QXD A;  5AA2 D;  3T9V A;  2REG A;  3RT8 A;  4ESX A;  1VFD A;  5J1D A;  3K02 A;  4OEN A;  1DTG A;  3PU5 A;  1MPB A;  4M1V A;  3G3K A;  2ZNU A;  5H8Q B;  3TYH A;  2P3N A;  3T9H B;  2UXA A;  4F2O A;  5I57 A;  1IUD A;  2ZYN A;  1LBY A;  2F34 A;  1I69 A;  4MF3 A;  3PGF A;  2XXV A;  5ISU A;  1MXZ A;  3V8X B;  4BDN A;  2PFZ A;  1VSO A;  2UYF A;  4AB6 A;  2X7P A;  3C9H A;  2QS2 A;  3O6G A;  4MNI A;  3EHS A;  4ELO A;  4O3C A;  1QUL A;  2PCR A;  4G8H A;  4ZEI A;  4JXI A;  5I57 B;  1LFH A;  2PT2 A;  1IMC A;  1D9V A;  3IOR A;  4XTC Q;  1YZ0 A;  2P1S A;  1AH5 A;  1MRP A;  5EQ9 A;  2VGQ A;  2Q8J A;  2QVU A;  1Z7M E;  1MM6 A;  3H06 B;  5DEX B;  4MH5 A;  3KOS A;  2M8C A;  4DXC A;  4HXV A;  5HPQ A;  2VPN A;  2QVV A;  5AE4 A;  4IO5 A;  4R6K A;  4MBP A;  2IEE A;  3MUQ A;  1NKX A;  3S9L C;  2RIN A;  4RNS A;  1M5D A;  5ITP A;  2FVZ A;  3B6W A;  2FHY A;  4F1U A;  2ZYM A;  5ET8 A;  4GBV A;  4ZED A;  1UTB A;  3IB1 A;  4P1E A;  1US4 A;  1B7Z A;  4DDD A;  1NV4 A;  4PET A;  4GWW A;  4ZEB A;  3RTF B;  4U23 A;  2F6G A;  1S7Y A;  2R71 A;  4POX A;  4U1O A;  5LTC A;  5H8S A;  1AOV A;  3E78 A;  2DE2 A;  4IO6 A;  4X8R A;  3THI A;  2XXX A;  1UTH B;  1QW0 A;  1ZU0 A;  4AS5 A;  4DCX A;  4WEP A;  1YXI A;  4PBQ A;  1SW2 A;  1URS A;  1GVC A;  1H3D A;  5KDT B;  2OCU A;  2FNC A;  4R75 A;  5K2Y A;  3H6T A;  1P1O A;  3PV0 E;  1MPC A;  3DP4 A;  4EF2 A;  1DPP A;  1ZLQ A;  3HHF A;  3O6H A;  4NE4 A;  1MXX A;  1UTH A;  3VXC A;  1MDQ A;  4OVT A;  2OK2 A;  3CFL A;  4C1T A;  4IY5 A;  2PBW A;  3CI8 A;  3IO6 A;  4PQJ A;  4C1U A;  4MLQ A;  3MZB A;  2Y7W A;  3PUW E;  2GH9 A;  3EHU A;  5L9O A;  4DLD A;  3OO9 A;  5J16 A;  4H46 A;  3MP6 A;  2DWH A;  2Y7R A;  3PD8 A;  4PDD A;  4FEB A;  3OEK A;  2Z8D A;  4NF4 A;  5AA4 A;  5A5L A;  1D3K A;  1AMF A;  4YMB A;  1NUZ A;  1FJ9 A;  3CR9 A;  4G2Z A;  1N0T A;  1RYO A;  5CBS A;  2DWI A;  5EYF A;  1LBW A;  3VV5 A;  1TFA A;  5I2K A;  5I5P A;  4P0I A;  3FIR A;  2Q88 A;  2ZZV A;  4HE0 A;  3ONM A;  2H9B A;  3OD7 A;  1B4Z A;  1NL5 A;  3CVG A;  2GHA A;  2I4C A;  4X48 A;  3KN8 A;  4IO4 A;  4ZDM A;  5IAI A;  3BIH A;  3OMB A;  4GIZ A;  2XXQ A;  2FBP A;  3FVG A;  2QMX A;  2O7U A;  3HV1 A;  4MHF A;  4NF8 A;  4YKI A;  1S9T A;  1Y1M A;  1D4N A;  4G77 A;  3JZJ A;  4UAB A;  5CMC A;  3BFT A;  3QIM A;  3TTN A;  1WOD A;  3FVO A;  4F29 A;  4QF9 A;  5CBR A;  2F3D A;  1IMB A;  3CG1 A;  2PMS A;  1JW1 A;  4QFK A;  4P1L A;  3KJT A;  3U8Q A;  4F18 A;  4DI3 D;  4PGN A;  1DPE A;  3FBP A;  2WX9 A;  1KZ8 A;  4YMA A;  2F35 A;  3RUM A;  1ZIU A;  1SI1 A;  1JVY A;  1FBF A;  2OWT A;  1OLC A;  4FAT A;  2O68 A;  3B50 A;  1O64 A;  1LST A;  3KZG A;  2HHM A;  1FTL A;  4IGT A;  1FQA A;  3S9M C;  2WYK A;  3C35 A;  1D9Y A;  1SD3 A;  2Z8E A;  3KEI A;  3U72 A;  1FPI A;  1XVX A;  1XOC A;  1NV5 A;  4KXP A;  1TXF A;  5ESY A;  4KR5 A;  1FQC A;  2DDK A;  4LN5 A;  3IOV A;  5DTB A;  1P99 A;  3IOW A;  1I6A A;  1IXH A;  2O1M A;  1LBX A;  1AIV A;  4LZ7 A;  5EYG A;  1GTK A;  3FAT A;  1FW0 A;  1YAE A;  3MZ9 A;  4TLL B;  3U92 A;  4LQ5 A;  3OO6 A;  1HSJ A;  1YCJ A;  1MG1 A;  1I6Q A;  1QUJ A;  2V3U A;  2NWJ A;  3SDF A;  1RDX A;  1B3G A;  5IKB A;  1JVX A;  4GVO A;  1NNK A;  1NNF A;  1RKM A;  3VFJ A;  3KG2 A;  4N81 A;  1MH3 A;  4XKP A;  1TWY A;  4IO7 A;  1UTB B;  4KPT A;  5LOM A;  2DP8 A;  2WBD A;  2ZXT A;  3BFU A;  5I56 B;  3QAX A;  2ZNT A;  1LAF E;  2NUV A;  2DE4 A;  1LCF A;  3MAM A;  4N4U A;  3RT6 B;  1SVX B;  4DXU A;  2ONS A;  1GR2 A;  3LC8 A;  2I3W A;  3OXN A;  4X1D A;  5EQ7 A;  3UGW A;  4PCD A;  4NHB A;  3T9U A;  5I2N B;  1R6Z A;  4XKR A;  4JVI A;  2A5T A;  5H8Q A;  2QMW A;  1USY E;  4QSC A;  5CMB A;  2BJI A;  4Q30 B;  3KSX A;  2Q89 A;  4EUO A;  2G93 A;  5ELV A;  4XEQ A;  2AIX A;  4GWU A;  3QMF A;  4OYV A;  1FPE A;  1MDP 1;  1NI9 A;  2W7Y A;  2UYE A;  1JW4 A;  4O3A A;  4IGR A;  3M3K A;  2HXW A;  1LAG E;  3S2V A;  4H0W A;  3D4G A;  1LB8 A;  4MIJ A;  4OVR A;  2O1L A;  4ELP A;  3FD3 A;  3MJN A;  4X04 A;  2VD2 A;  2DXY A;  5I2K B;  1EH3 A;  1MS7 A;  3FXQ A;  4H65 A;  1IXG A;  3TTR A;  5DT6 A;  5LDZ A;  4QFP A;  4U22 A;  3G3G A;  4E0W A;  1Q35 A;  2DWA A;  1FTO A;  4GX4 A;  3SZP A;  3ECR A;  3GXA A;  1AL3 A;  2F78 A;  2X26 A;  1XC1 A;  4DI4 B;  4YU0 A;  2ZYK A;  3V5A A;  3N6T A;  2Y5K A;  1QJM A;  2RC9 A;  3IL1 B;  1NV7 A;  5DVI A;  3LUY A;  3FAS A;  3O6I A;  2F5X A;  2HCA A;  4GRK A;  4MJO A;  1B7U A;  3EN3 A;  1URG A;  5AA2 A;  3FUZ A;  1M5B A;  4P0G A;  3K00 A;  3K1N A;  4OWD A;  4KFQ A;  3RY3 A;  4H8I A;  3H6W A;  4OQO A;  4OVQ A;  1HSE A;  3MST A;  2BJJ X;  3ZKL A;  4ZZA A;  1KWH A;  1K9Y A;  1MXY A;  5DVJ A;  1LAH E;  3CG3 A;  3I6V A;  2AYS A;  3O97 A;  3GLB A;  1I6B A;  3RYD A;  3DLN A;  4OVS A;  2B65 A;  3IK6 B;  2Q2A A;  1Q9D A;  4NF5 B;  1R1N A;  4LP2 B;  3GBA A;  3G3F A;  4N6D A;  3MPL A;  3UA8 A;  4JBZ A;  3QYT A;  5L8D A;  1MY1 A;  4MX6 A;  4F1V A;  1FBP A;  3QK6 A;  4QRZ A;  2Z23 A;  4QSD A;  5JEI A;  1SBP A;  1ZKB A;  4GD5 A;  2P2A A;  1BK4 A;  3UOR A;  2DVZ A;  2Y7I A;  3VVF A;  1MM7 A;  2CEY A;  2ONK E;  4N13 A;  3OSQ A;  5AA1 A;  4PAF A;  3VXB A;  3B7D A;  3R6U A;  1B51 A;  3A3U A;  5I2N A;  3MP1 A;  3SKP A;  5L9S A;  4H6D A;  1II5 A;  2H98 A;  4UAC A;  3CSB A;  3HPI A;  1OVT A;  2P3V A;  5EQ8 A;  1ELJ A;  1N7W A;  4QFN A;  1RDY A;  4E0X A;  5FTH A;  1LGB C;  2ESN A;  1POT A;  4PFB A;  1NH8 A;  3TFL A;  1L5T A;  4AB5 A;  2CZH A;  2CZK A;  5I3S A;  5H8N B;  1M5C A;  4LZ5 A;  3CRB A;  2VPO A;  4OMB A;  4TOZ A;  2XXP A;  3S9E A;  4ZEC A;  1R9Q A;  3CFX A;  4H5F A;  2QRY A;  3QXM A;  1MQD A;  2HXR A; 
#chains in the Genus database with same CATH homology
 1OIB A;  1N0T A;  1RYO A;  1MQI A;  3A09 A;  2I0B A;  1MXW A;  1P1Q A;  4FEC A;  2DWI A;  4QSE A;  5EYF A;  5L8D A;  1DSN A;  3UK4 A;  2DE3 A;  2YJP A;  3N26 A;  3VV5 A;  2I4B A;  1B7H A;  1TFA A;  1SW5 A;  3DEL B;  3FJ7 A;  5I2K A;  3H6V A;  4BDM A;  1Y20 A;  3C33 A;  3MZ1 A;  4P0I A;  3UIF A;  3FIR A;  5FHO A;  1O63 A;  4NF6 B;  2Q88 A;  3K6U A;  1FQF A;  1MPD A;  5BUU A;  3BBR A;  2HQ0 A;  3MVX A;  3TCG A;  4YZZ A;  3OEL A;  4PFW A;  3TTK A;  3ONM A;  2UVG A;  1N04 A;  1B3L A;  3H03 A;  3K0V A;  1MXU A;  2H9B A;  2THI A;  3OD7 A;  3I3V A;  1B4Z A;  1NL5 A;  5I58 A;  3KN3 A;  3CVG A;  3GZG A;  2GHA A;  2I4C A;  3PPQ A;  2QJE A;  2NVU B;  2Z22 A;  1QVS A;  3PMX A;  1FQB A;  4U4S A;  1A54 A;  4X48 A;  3K6X A;  1NH7 A;  3PPO A;  1TFD A;  1MY0 A;  1P1W A;  1VR5 A;  3DP8 A;  2OLB A;  2VP1 A;  1PB9 A;  3KN8 A;  4IO4 A;  3T22 A;  3ZSF A;  2IA4 A;  4XXU A;  1B40 A;  3JV9 A;  4G68 A;  4QHQ A;  4ZDM A;  4RK9 A;  5IAI A;  3S4U A;  1FTM A;  2DOJ A;  3OMB A;  1SDX A;  4OER A;  3RLF E;  4FIM A;  4R73 A;  3B6T A;  1IQ7 A;  4GIZ A;  3GBB A;  2XXQ A;  2Y7P A;  3MW0 A;  4OEV A;  4EF1 A;  2I3V A;  2OJT A;  4HW8 A;  5KZT A;  4U21 A;  4KHZ E;  4G68 C;  3FVG A;  3JYR A;  2QMX A;  3KFM A;  4POW A;  4L17 A;  2O7U A;  2Q2C A;  3KBR A;  3HV1 A;  4NF8 A;  4YKI A;  1F9B A;  1S9T A;  1SQY A;  3G3J A;  3SEV A;  4WED A;  3CIJ A;  1LAX A;  4EQ9 A;  2B3B A;  1Y1M A;  1D4N A;  2UVJ A;  1P1U A;  1MQG A;  2HAV A;  3FGS A;  3JZJ A;  3PUZ E;  4G77 A;  4F39 A;  1EU8 A;  5CMC A;  2F36 A;  1OVB A;  2V93 A;  2PVU A;  3BFT A;  4LON B;  3QIM A;  4GWO A;  3KGC A;  2GFE A;  3C34 A;  3IOT A;  2O69 A;  3H4Z A;  4HTG A;  4YKK A;  3TTN A;  1EZO A;  5K2X A;  3AXF A;  3TCF A;  1BTJ A;  5DVF A;  1DMB A;  4R9G A;  1WOD A;  3VLW A;  3FVO A;  4JB7 A;  4GOT A;  2GHB A;  3U93 A;  4F29 A;  1B4H A;  4Z0I A;  4EXL A;  3T9X B;  4YKJ A;  3VVE A;  4QF9 A;  5CBR A;  2HEU A;  1B3H A;  2VOZ A;  3CG1 A;  3PPN A;  1MH4 A;  2REJ A;  2PMS A;  1JEV A;  2VHA A;  1JW1 A;  4QFK A;  4F3P A;  2RF1 A;  1B3E A;  3KJT A;  3RPW A;  3G3H A;  3EQ1 A;  4YIC A;  3U8Q A;  4RPN A;  1ZJL A;  1OLA A;  2QSX A;  4F18 A;  5AA3 A;  1PBQ A;  4NF6 A;  3WAF A;  1VFE A;  2R6G E;  1DPE A;  1MY3 A;  4H1X A;  4KI0 E;  3MP8 A;  2YPN A;  4WKM A;  2QS1 A;  3SET A;  3ZS6 A;  2F35 A;  1O7T A;  4ELR A;  4EQB A;  3RUM A;  4YMA A;  1ZIU A;  2B3F A;  1SI1 A;  1JVY A;  3QSL A;  4G4P A;  1IXI A;  2V3Q A;  3MWB A;  1P1N A;  4I62 A;  2XX9 A;  4XKQ A;  4ZEK A;  2FA7 A;  2OWT A;  5FTI A;  1JW5 A;  4Q8R A;  4F3B A;  1OLC A;  1POY 1;  1LFI A;  3Q28 A;  4IO3 A;  4FAT A;  1B5I A;  1XS5 A;  3V89 B;  4BDL A;  1MQH A;  4Z7E A;  5A5X A;  2XXW A;  1QKA A;  2O68 A;  2O6A A;  2XXT A;  3EPE A;  3HCQ A;  1LB9 A;  3Q27 A;  4NF4 B;  4R2F A;  1CE2 A;  2RC7 A;  1O64 A;  1Y3N A;  3K01 A;  4ZEF A;  4BDQ A;  3OEM A;  1LST A;  1FQD A;  3KZG A;  2H25 A;  1H43 A;  1FTL A;  4IGT A;  1FQA A;  2Z8F A;  3S9M C;  1B58 A;  1UQW A;  4OTE A;  4PFU A;  4GXS B;  1YTV A;  2XX7 A;  5I59 B;  2DVC A;  3C35 A;  1D9Y A;  1SD3 A;  2Z8E A;  3SEU A;  3O29 A;  4BDO A;  1ATG A;  3FV1 A;  5B70 A;  3KEI A;  3U72 A;  3SEX A;  2Y84 A;  2KLF A;  4ELQ A;  3UN6 A;  1N84 A;  2DQV A;  2DXR A;  2NXO A;  2ONR A;  4EDP A;  3H7M A;  1XVX A;  4KCC A;  1XOC A;  3L6H A;  4RPO A;  1A55 A;  2YLN A;  2D21 A;  5TPA B;  1MY2 A;  3H3G A;  5B7D A;  2FYI A;  1NNT A;  3K6V A;  1Y3P A;  3FXU A;  4P11 A;  5AA4 B;  1TXF A;  3OOA A;  2D3I A;  1VE4 A;  4KR5 A;  1ZTY A;  4NWD A;  1FQC A;  3FXR A;  4GF8 A;  2V84 A;  5JTY B;  3IOV A;  4I1D A;  5DTB A;  1BIY A;  3MVY A;  3C36 A;  3ILT B;  2P0S A;  3BKI B;  1P99 A;  1Q1K A;  2ZMB A;  2A5T B;  1QKB A;  3IOW A;  4H8J A;  4RYA A;  3TTM A;  3D4C A;  5CM6 A;  1I6A A;  1IXH A;  3A3C A;  3DM0 A;  2O1M A;  4JWO A;  1XHY A;  4BDR A;  1AIV A;  3LSF B;  1NNP A;  3H6U A;  3IB2 A;  1H76 A;  4NWC A;  3PD9 A;  5FHN A;  2Q9T A;  1MQJ A;  4LZ7 A;  1B5H A;  2ALU A;  3P7I A;  5CBS A;  5L9M A;  3T66 A;  3N5L A;  1GTK A;  3FAT A;  4XIG Q;  1FW0 A;  1YAE A;  3G7W A;  3MZ9 A;  1PB8 A;  3Q25 A;  4OXV A;  3SEW A;  3TPA A;  1B0L A;  3HST A;  4TLL B;  1BLF A;  4PFY A;  3IR1 A;  3E4R A;  3U92 A;  5AE4 A;  2A5S A;  4PP0 A;  4LVQ A;  4LQ5 A;  1LBB A;  1URD A;  3OO6 A;  4LUB A;  4OFO A;  2UVH A;  1B1H A;  4OFL A;  5H8F A;  5KCJ B;  1HSJ A;  1IEJ A;  2O7I A;  1YCJ A;  1MG1 A;  2HAU A;  4IB2 A;  5HBC A;  2XX8 A;  1PC3 A;  1I6Q A;  3O66 A;  1QUJ A;  4YB5 A;  2HFB A;  3U94 A;  2V3U A;  1OQG A;  2NWJ A;  4X9T A;  4THI A;  3SDF A;  3ODB A;  5H8H A;  1UIV A;  3OO7 A;  4H5G A;  1WDN A;  3E3K A;  3OSR A;  1GV8 A;  2F7A A;  3K1M A;  3W9W A;  4C0R A;  5HM4 B;  5L9S A;  1B3G A;  2RCA A;  1JVX A;  4GVO A;  1NNK A;  3M3F A;  5IKB A;  4R6H A;  1NNF A;  3T96 B;  3S9N C;  1T0K A;  1WVJ A;  1H45 A;  4DCY A;  3QUJ A;  3C4M A;  1RKM A;  4HS7 A;  2QL3 A;  4RJZ A;  3TQW A;  3VFJ A;  3O2A A;  5FHM A;  4JWY A;  3KG2 A;  3F11 A;  2XHD A;  4NF5 A;  1GGG A;  1MH3 A;  4ISU A;  5A5X B;  4I9D A;  2OWS A;  1N3X A;  4XKP A;  3MPK A;  3N6U A;  1TWY A;  4NTL A;  4IO7 A;  3FV2 A;  1UTB B;  1M5F A;  4R2B A;  3FVK A;  3PPP A;  4ECF A;  2HZK A;  4JDF A;  4KPT A;  4F31 B;  3LSW A;  5LOM A;  2DP8 A;  2ZXT A;  3BFU A;  4R74 A;  1J1N A;  2D5W A;  2AL5 A;  3MVZ A;  3QAX A;  5DYH A;  2ZNT A;  3W9V A;  5CC2 A;  5I56 B;  1LAF E;  1IIT A;  4DZ1 A;  2NUV A;  2DE4 A;  1LCF A;  3MAM A;  5I59 A;  1SVX B;  1ANF A;  4ZS9 A;  3RT6 B;  1SI0 A;  4N6P A;  2ONS A;  1GR2 A;  3LC8 A;  4DXU A;  2I3W A;  3CFZ A;  3OXN A;  1A8E A;  3TQL A;  1EZ9 A;  4X1D A;  3R7X A;  3UGW A;  3MQ9 A;  1N3W A;  4G8M A;  2NOO A;  4YB6 A;  3TEP A;  3PUV E;  1OMP A;  3T9U A;  3SES A;  5I2N B;  1R6Z A;  4XKR A;  2XXU A;  4YKP A;  1B3F A;  4FJP A;  4RXL A;  3E9X A;  2XD2 A;  3TTL A;  2OBG A;  3QUF A;  4GL8 A;  4FAJ A;  2AL4 A;  2A5T A;  5BWJ A;  3SER A;  3K6W A;  3LBS A;  3CSG A;  5H8Q A;  2QMW A;  4ZE8 A;  1A8F A;  2XXY A;  3PPR A;  1USY E;  4OEU A;  4QSC A;  5CMB A;  3PUY E;  5JTY A;  4Q30 B;  3KSX A;  2Q89 A;  5AA2 D;  1MXV A;  4EUO A;  3K1P A;  2REG A;  3T9V A;  4DE8 A;  2G93 A;  1B05 A;  4FED A;  5AA2 B;  1NMU A;  4KCD A;  5ELV A;  3I5O A;  1VFD A;  3RT8 A;  4ESX A;  4F22 A;  5J1D A;  1PB7 A;  3K02 A;  2AIX A;  3MVW A;  1SYI A;  4FE8 A;  4OEN A;  1DTG A;  2UVI A;  3PU5 A;  3T93 B;  1MPB A;  4GLI A;  4OYV A;  4EQ7 A;  1PDA A;  4M1V A;  4ZZE A;  1HSL A;  5CRY A;  1B5J A;  3C32 A;  1MDP 1;  2X7Q A;  1R9L A;  2W7Y A;  4GFR A;  3G3K A;  1SYH A;  2ZNU A;  1DTZ A;  3PMV A;  2UYE A;  5H8Q B;  3TYH A;  3IJO B;  1JW4 A;  2ANJ A;  3T9H B;  2DWJ A;  2UXA A;  3M3L A;  3MC2 A;  1Y3Q A;  3FJG A;  3M3K A;  2HXW A;  4IGR A;  1LAG E;  4O3A A;  4UA8 A;  4WXJ A;  3S2V A;  4F2O A;  5I57 A;  4H0W A;  1LBC A;  1IUD A;  3D4G A;  1LB8 A;  2VD3 A;  2ZYN A;  3MBP A;  4ESW A;  2O1L A;  1US5 A;  1FTK A;  2F34 A;  3FD3 A;  3MJN A;  1I69 A;  2VD2 A;  4IO2 A;  4MF3 A;  4ELP A;  3PGF A;  2DYX A;  2DXY A;  2DS9 A;  1EH3 A;  5I2K B;  1MS7 A;  2XXV A;  4KQP A;  5ISU A;  3FXQ A;  1MXZ A;  4FOR A;  1IXG A;  4H65 A;  3TTR A;  3V8X B;  1SW1 A;  4F3S A;  2GRV A;  5CMK A;  4BDN A;  3M8U A;  1B9J A;  4O3B A;  5DT6 A;  4QFP A;  4U22 A;  2ABH A;  1VSO A;  2UYF A;  3G3G A;  1TT1 A;  4AB6 A;  4E0W A;  2X7P A;  3C9H A;  3KJ7 A;  4F2Q A;  1EZP A;  1Q35 A;  2DWA A;  2QS2 A;  2I0C A;  1FTO A;  3O6G A;  4OET A;  5H8N A;  3TEL A;  2F97 A;  3EHS A;  5I58 B;  4NF8 B;  3ECR A;  3GXA A;  1Y9U A;  4U1Z A;  4ELO A;  1AL3 A;  2F78 A;  2X26 A;  1QUL A;  1XC1 A;  4O3C A;  4OHN A;  4AQ4 A;  2I49 A;  4G8H A;  1B46 A;  3K4U A;  3IOU A;  4YU0 A;  5F7V A;  1B32 A;  2ZYK A;  4ZEI A;  3V5A A;  3N6T A;  4JXI A;  2PX1 A;  1N76 A;  3S9L C;  3L6G A;  5I57 B;  3G3I A;  4H67 A;  1QJM A;  3N94 A;  2PT2 A;  1LFH A;  3W15 C;  1D9V A;  1PBP A;  1JNF A;  1QUI A;  2RC9 A;  3IL1 B;  3IOR A;  1B0H A;  4U4X A;  4XTC Q;  5DVI A;  2DSF A;  2P1S A;  1AH5 A;  1BP5 A;  1B2H A;  1MRP A;  2VGQ A;  3FAS A;  3LR1 A;  3LUY A;  4LQ2 A;  1Z7M E;  2RKM A;  2F5X A;  3O6I A;  4OVJ A;  1MM6 A;  3U1O A;  2HCA A;  3H06 B;  4HCW A;  5DEX B;  4MH5 A;  5F1Q A;  3KOS A;  2F6P A;  3FZV A;  2QPQ A;  2M8C A;  4BLA A;  4DXC A;  1XT8 A;  4GRK A;  4LZ8 A;  4EXK A;  1B1X A;  5HPQ A;  4N07 A;  1B7U A;  3EN3 A;  2XD3 A;  1URG A;  5AA2 A;  3FUZ A;  1LLS A;  1M5B A;  4P0G A;  2CMO A;  3K00 A;  3K1N A;  4RA1 A;  1BKA A;  4OWD A;  3HHG A;  4KFQ A;  5EHM A;  4DXB A;  4H8I A;  1ZMG A;  4IO5 A;  4KYE A;  4R6K A;  2XXR A;  3RY3 A;  3H6W A;  2R9J A;  4OQO A;  3UP9 A;  2O51 A;  2XXH A;  3HO7 A;  4I8C A;  2G29 A;  4MBP A;  4DIG A;  4YAH X;  1HSE A;  5KDT A;  3PUX E;  2BJJ X;  1JET A;  2IEE A;  2I6E A;  2ZNS A;  5H8H B;  3IO4 A;  1CB6 A;  1QUK A;  3TAJ A;  3ZKL A;  4KD5 A;  3E13 X;  3MUQ A;  3TMG A;  1NKX A;  1Y4T A;  3FJM A;  2E1S A;  1IZ1 A;  4M4G A;  4NMY A;  2RIN A;  4ONY A;  4RNS A;  4ZZA A;  1KWH A;  5CI5 A;  2CZL A;  1N7X A;  3RTW B;  1M5D A;  1M5E A;  1MXY A;  5DVJ A;  2H4I A;  1LAH E;  3CG3 A;  4G68 B;  4QFL A;  4HCY A;  4XKN A;  5ITP A;  3B6W A;  3I6V A;  3WAE A;  2AYS A;  4K3F A;  2F7B A;  3O97 A;  4F1U A;  4OFJ A;  5I84 A;  2ZYM A;  1H44 A;  2XXI A;  3GLB A;  1I6B A;  3Q29 A;  4ZED A;  2ZYO A;  3DLN A;  2Q8J A;  1UTB A;  3IB1 A;  4NED A;  3IAZ A;  4PFT A;  2B65 A;  1US4 A;  1B7Z A;  1FQE A;  1S50 A;  4GQO A;  2I58 A;  2Y7K A;  3V83 A;  3IK6 B;  3KSJ A;  1IXC A;  2Q2A A;  3ILU B;  1RYX A;  4DDD A;  2LAO A;  4OZ9 A;  4ND9 A;  4NF5 B;  4PET A;  1R1N A;  2F8D A;  1UIU A;  4LP2 B;  4ZEB A;  3GBA A;  2QS3 A;  3RTF B;  3G3F A;  1LFG A;  4ZE9 A;  3MPL A;  3UA8 A;  2F6G A;  3KOT A;  4JBZ A;  1S7Y A;  1A7L A;  3QYT A;  2R71 A;  1USY H;  4Q0C A;  4U23 A;  4POX A;  3Q26 A;  4U1O A;  5EHS A;  3O9P A;  4R72 A;  1MY1 A;  5H8S A;  1AOV A;  5ICT A;  4Q5T A;  1A99 A;  3VLV A;  4F1V A;  1NFT A;  5H8F B;  3QK6 A;  4QRZ A;  5TU0 A;  5TP9 A;  2DE2 A;  3TKD A;  4LAT A;  2Z23 A;  1ZBM A;  5CMM A;  4QSD A;  5JEI A;  4G8N A;  1SBP A;  1ZKB A;  4GD5 A;  4IO6 A;  3THI A;  4GXA A;  4MFI A;  2XXX A;  2QS4 A;  3TDJ A;  5I56 A;  2P2A A;  1UTH B;  1Y1Z A;  1QW0 A;  2PYY A;  1ZU0 A;  4KYS A;  4RK2 A;  4DCX A;  2V25 A;  4WEP A;  1IIW A;  4MLV A;  1A40 A;  1SW2 A;  3UOR A;  2H5Y A;  3OO8 A;  2DVZ A;  1URS A;  2OZZ A;  4OES A;  1GVC A;  1H3D A;  3VLU A;  5KDT B;  2Y7I A;  2OCU A;  1B6H A;  3HN0 A;  1FTJ A;  4KYD A;  4R9F A;  3RGY A;  3VVF A;  4F1Y A;  1LCT A;  1MM7 A;  2FNC A;  2PT1 A;  4R75 A;  2ONK E;  4N13 A;  5K2Y A;  3RQT A;  3TCH A;  3H6T A;  3OSQ A;  4GL0 A;  5AA1 A;  1P1O A;  3PV0 E;  1JQF A;  5JK4 A;  1MPC A;  3VXB A;  3DP4 A;  3B7D A;  3R6U A;  1B51 A;  1SW4 A;  3A3U A;  3MP1 A;  3SKP A;  4EF2 A;  4F3G A;  5I2N A;  4H6D A;  1FCK A;  3B6Q A;  1DPP A;  1II5 A;  1YPN A;  2H98 A;  2O84 X;  1ZLQ A;  2WKY A;  3LSL A;  4QFO A;  4UAC A;  3PMW A;  1OQH A;  3CSB A;  3RNN A;  5M2V A;  3HHF A;  3R26 A;  4PE5 B;  3HPI A;  1OVT A;  3IX1 A;  3O6H A;  4NE4 A;  3RN8 A;  1MXX A;  2RCB A;  1UTH A;  3VXC A;  1MDQ A;  2V3T A;  5ITO A;  3C31 A;  1ELJ A;  1PEB A;  2OK2 A;  3CFL A;  4JSO A;  4C1T A;  3TZA A;  4IY5 A;  1N7W A;  2E0S A;  2I48 A;  2PBW A;  4R6Y A;  4QFN A;  4E0X A;  5FTH A;  5TPA A;  1LGB C;  3ZKK A;  2ESN A;  3CI8 A;  1POT A;  3O28 A;  1NH8 A;  3IO6 A;  1MY4 A;  4PQJ A;  3VE1 B;  4C1U A;  3DP6 A;  4MLQ A;  3MZB A;  3IB0 A;  1L5T A;  3TFL A;  4TLM B;  3VVD A;  3IJX B;  4AB5 A;  3EF7 A;  1XVY A;  5ICQ A;  2Y7W A;  3PUW E;  2GH9 A;  3EHU A;  3KN7 A;  4JWX A;  5TP9 B;  5L9O A;  3USD A;  5H8N B;  4DLD A;  3OO9 A;  1M5C A;  4LZ5 A;  3TUS A;  3FVN A;  3CRB A;  4IY6 A;  4OMB A;  4TOZ A;  4RY1 A;  2XXP A;  4U2R A;  3K2D A;  3S9E A;  4ZEC A;  4TQU Q;  1R9Q A;  2HZL A;  3LSX A;  3MP6 A;  2DWH A;  3CFX A;  4YB7 A;  2Y7R A;  3PD8 A;  4FEB A;  3OEK A;  3OEN A;  4H5F A;  2H99 A;  2Z8D A;  4LA9 A;  2F7C A;  4X1B A;  4F19 A;  4NF4 A;  5AA4 A;  3VDF A;  1JEU A;  1Y4C A;  2QRY A;  3TOD A;  1D3K A;  4JSD A;  3SEY A;  3EHT A;  1AMF A;  3QXM A;  4YMB A;  5KCJ A;  1Z7N E;  1B52 A;  5DEX A;  3CR9 A;  1MQD A;  2RC8 A;  1DOT A;  4G2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...