4GWOA

Crystal structure of ligand binding domain of lysr family member,cysb in complex with sulfate from salmonella typhimurium lt2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ligand binding domain of LysR family member,CysB in complex with sulfate from Salmonella typhimurium LT2
rcsb
source organism Salmonella typhimurium
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator CysB
total genus 72
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gwoA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gwoA02
1P1QA 1B52A 3E13X 1H44A 1S50A 2O7IA 4KD5A 3O28A 4PFWA 2DWJA 3C33A 3G3KA 1S7YA 1GGGA 3QUJA 4PETA 5TPAA 3QIMA 4RK2A 3W9VA 4YMAA 1RKMA 5CMMA 4ZECA 1B4ZA 2F5XA 3N26A 5AE4A 2Q8JA 3ILTB 2DXYA 4BDMA 5H8QB 4AB6A 3TEPA 2HZKA 1VFDA 1B9JA 4FEBA 4JSDA 2HAVA 5LOMA 1EH3A 3FJMA 1MM6A 1FTKA 2M8CA 3V8XB 1LCTA 5IAIA 3KJTA 5JEIA 3QK6A 3ONMA 3VDFA 1WVJA 1MY4A 4E0WA 2GH9A 4KHZE 1URDA 1BP5A 4O3AA 1B1XA 1JW1A 1TT1A 4KFQA 1MRPA 3K2DA 3O2AA 4FE8A 4P11A 1QKBA 3T22A 4PE5B 1LCFA 5CC2A 5DVFA 4FAJA 5I2NA 5EYFA 4ZEFA 3QAXA 1I6BA 1QUKA 2H5YA 2XXWA 5I57A 1MQIA 2ONRA 3G3GA 3KSXA 4QFNA 4ONYA 1M5DA 1MY2A 2ONKE 2RF1A 2Z22A 5EHSA 3M3LA 4GL8A 3SEWA 1FCKA 3HV1A 3KG2A 2H25A 4H8IA 1TFAA 3B6QA 1QULA 2O51A 3IJOB 4G68A 4KYSA 4O3CA 1BLFA 3SEXA 5DYHA 1HSLA 4I62A 1MDP1 4H0WA 3IX1A 3HCQA 2A5TA 4OENA 1N84A 2OZZA 2XXPA 3U93A 3UP9A 4Q8RA 2BJJX 2XD2A 3KN7A 1A54A 2F97A 2XD3A 4TOZA 2XXTA 2B3BA 2DE2A 2F7BA 2Z8DA 3JZJA 4OFJA 1QJMA 2Q2CA 4MH5A 3MP8A 3LUYA 1IXGA 3E4RA 1VE4A 2RCBA 3P7IA 1TFDA 2PMSA 4GQOA 5H8NB 4IO4A 1B3LA 3K01A 4C0RA 2ABHA 3C36A 3G3HA 4G68B 2V3QA 4DCXA 4JDFA 3B6TA 2QMXA 3U94A 2E0SA 2PYYA 5DT6A 3RT6B 1MH4A 4H67A 1MXVA 2P1SA 2O7UA 1B5JA 4POXA 4Q30B 1XT8A 4QSDA 3DP4A 4EQBA 5BUUA 5DVJA 1SW2A 3BKIB 4JSOA 1Y3PA 3VXBA 4YB5A 5K2XA 1B7ZA 1Z7NE 3V89B 5I58A 3PMXA 4ELQA 2HEUA 4ESXA 1UTBA 3DP8A 3FJGA 4NF8B 2NWJA 3PPNA 1WODA 1FQDA 4F18A 1R9QA 4ZEKA 3TELA 2QSXA 4YB7A 1US4A 3RN8A 4BDOA 1SW5A 4OFOA 1AIVA 4H5FA 2ALUA 1LB8A 3LSWA 3LSXA 3MVZA 4FIMA 1N0TA 3DM0A 2FNCA 2H9BA 2HCAA 1YCJA 2W7YA 1JNFA 2DYXA 1OLCA 2OLBA 3M3FA 1PB9A 1YPNA 4XKPA 1A40A 1FQFA 1Y4CA 3T9HB 2ZYKA 3BFUA 4DE8A 3S9NC 2XXQA 5B7DA 4QHQA 4EQ9A 4BDQA 4F1VA 4X48A 4I8CA 4YKPA 5A5XA 4G77A 1I6AA 1PDAA 1B3FA 3IJXB 2O6AA 1P99A 4LONB 4M4GA 3TODA 1MH3A 4LUBA 1QUJA 4OERA 4Q5TA 3TMGA 3H7MA 3S9EA 1J1NA 3KGCA 1SI1A 2O1MA 3OENA 3H06B 1GVCA 3UA8A 2UXAA 1NL5A 4RPOA 1NNFA 3N5LA 4KPTA 1XVXA 1B2HA 1EZOA 3IOWA 2OBGA 3Q28A 4XKQA 4F31B 4G2ZA 4FEDA 2ZMBA 3UGWA 3H4ZA 1MPDA 3CVGA 3Q25A 4RXLA 4OETA 3ZKKA 5DTBA 2F7AA 2DS9A 1KWHA 2NVUB 1MPBA 4KR5A 2ZNTA 3Q27A 1N04A 3JYRA 4IO7A 4H65A 2OWSA 1N3XA 1PB7A 5L9OA 2YJPA 3OOAA 2A5SA 1EU8A 3SERA 3C32A 4R72A 3V5AA 1Y20A 3MP1A 1MY1A 2VOZA 3U8QA 2HFBA 5CBSA 4GWOA 2KLFA 1B5HA 4MLVA 3PUZE 3N6TA 2P2AA 4PFUA 4QFKA 3SESA 3U92A 3HPIA 1ATGA 1UIUA 4YMBA 1IXHA 4PFYA 3C9HA 4IB2A 3AXFA 3HSTA 3MVYA 3FUZA 5CRYA 3TZAA 3PV0E 5ICTA 1HSEA 2Y7RA 1II5A 2GHBA 3K1MA 3MAMA 4YKJA 3PPPA 4NTLA 4PP0A 4ESWA 4E0XA 1PB8A 1SBPA 2H98A 3K0VA 2FA7A 1N7XA 3C4MA 2RC8A 5FTIA 3VLWA 4FJPA 4N07A 4OEUA 3IO6A 1Y1ZA 4EDPA 1TWYA 3QYTA 3SEVA 5H8FA 1MQHA 4THIA 3W15C 4OMBA 1OIBA 1P1NA 3MP6A 1B32A 5F7VA 3FVKA 5I59A 1SD3A 2DXRA 1FTMA 1VSOA 2DQVA 2UYEA 3RY3A 4I9DA 4NEDA 1D9VA 3O6HA 4H6DA 4RK9A 5TU0A 1QKAA 2V3UA 4EUOA 5IKBA 1ZMGA 1MY3A 4QFOA 3S9LC 2VD2A 3EHTA 4MBPA 5H8FB 4DLDA 1YAEA 1SW4A 1MXXA 2G29A 3MVXA 3G3IA 3OSRA 5I84A 1I6QA 2Y7PA 3BBRA 4H5GA 4OHNA 5CMBA 1IXIA 3G3JA 3SEYA 4M1VA 1Y3QA 1Q35A 2X26A 3A3UA 3MVWA 4QRZA 4YZZA 3RLFE 2HAUA 4GIZA 4AQ4A 1ZTYA 2Y7WA 3B6WA 2R71A 4R9FA 1UQWA 2Q9TA 2UVJA 2XXXA 1R1NA 3O6IA 5FHNA 2PVUA 4JWYA 4IO3A 1LAHE 4HTGA 1DSNA 2XXRA 5CI5A 5EHMA 3T9UA 3CR9A 3OO9A 2VP1A 3ZKLA 3FVNA 2XX8A 3PMVA 3RQTA 3KN8A 3TAJA 4ND9A 2O69A 3BFTA 2F8DA 1MXWA 2NOOA 1QW0A 1B58A 4POWA 4UACA 5A5XB 5FHMA 4R9GA 2I58A 3IR1A 4KYEA 4MLQA 5HM4B 3N6UA 2AL4A 3SEUA 3UN6A 3TUSA 1MY0A 3OMBA 4OESA 3R7XA 1N7WA 4G8MA 4ELOA 1LFIA 4RJZA 4WEPA 4IGTA 3TTLA 3CSBA 4ISUA 3MZBA 4DXCA 1Y1MA 3VFJA 3D4CA 3I3VA 3FV1A 3FZVA 3K1PA 4DDDA 3ECRA 3E3KA 4F1UA 3H03A 4RPNA 5FHOA 3HO7A 4WKMA 3DELB 3U1OA 4ZEDA 5ICQA 3EHSA 3EN3A 1UTBB 4H8JA 3IL1B 2GFEA 1DOTA 2RKMA 5I58B 3B7DA 3VE1B 3GBAA 2QMWA 5I2NB 5KZTA 1B5IA 3OELA 1IZ1A 1JEVA 3TDJA 4YKKA 1ZBMA 4BDNA 5AA4A 3Q26A 4TQUQ 2I3VA 4EXKA 3KZGA 3SDFA 5ELVA 1OVBA 1H43A 5AA1A 3QXMA 3CIJA 1LSTA 1I69A 1OMPA 4JXIA 1N3WA 3PUYE 3TKDA 1P1WA 1NNKA 3S9MC 4GOTA 3CSGA 4NF4B 3K6XA 3H6UA 4U2RA 1D3KA 5ITOA 3CRBA 4HCYA 3JV9A 1R9LA 3A3CA 4HCWA 4LZ7A 3TTKA 2I4BA 1B4HA 3MPKA 5I2KA 2REGA 2P0SA 3EQ1A 3LC8A 1SVXB 1SI0A 1NFTA 3IK6B 3C34A 4FORA 4GFRA 3WAFA 4EXLA 3K6VA 1JW4A 1NNPA 2QPQA 4RY1A 4TLMB 4NE4A 5DVIA 1SW1A 4IY5A 3R6UA 1LGBC 1UIVA 2Q88A 2LAOA 1VR5A 3E9XA 2ZNUA 4N6PA 5AA2D 5AA2B 1B0LA 3FJ7A 3MW0A 4JWXA 4R6KA 1CB6A 1ZJLA 4LQ2A 2V93A 4NF5A 3TTNA 4U4XA 4JWOA 3THIA 1L5TA 3TFLA 2F35A 3LR1A 1LFGA 2DWIA 1FQCA 3RT8A 2VD3A 1NMUA 1A8FA 4YU0A 5M2VA 4F3PA 1GR2A 3GLBA 3FVOA 3VLUA 1JVXA 1A8EA 3N94A 4QF9A 1LBBA 1D9YA 1M5BA 3MWBA 3ODBA 4QSEA 4ZE8A 2I49A 3OO7A 5AA2A 4OYVA 2DWHA 3PPQA 1NNTA 4R74A 2B3FA 2QS4A 4RYAA 5J1DA 1XC1A 2Q89A 1O63A 2QS1A 2R6GE 1IUDA 3CFLA 1WDNA 1PEBA 1OQHA 5H8NA 3PPOA 3OEMA 3TPAA 4EF1A 1POTA 1URSA 2I4CA 3QUFA 4H1XA 4QFPA 2X7QA 5ITPA 4OEVA 2F36A 2Z8FA 3RPWA 1Q1KA 5FTHA 4OZ9A 1D4NA 1ZU0A 3GXAA 5I2KB 1H76A 2O84X 3FVGA 1O7TA 2GRVA 3OSQA 2FYIA 2HZLA 5I57B 2A5TB 3C35A 1URGA 3H6WA 4XIGQ 2QS2A 3LSFB 1B51A 1IEJA 1NH7A 4L17A 5I59B 2DVCA 2YLNA 3K6WA 1FTOA 3IB0A 3IORA 4U4SA 5CBRA 3I6VA 3MQ9A 3T9XB 3G3FA 4GL0A 5L8DA 3OO8A 4QSCA 1HSJA 2XX9A 3UORA 2I0CA 2PT2A 1BIYA 1DPPA 2DWAA 2XXHA 1BKAA 1B40A 1USYH 1POY1 2ZYMA 4YB6A 4ELPA 4UA8A 3U72A 1FW0A 1O64A 2F78A 2PBWA 2UVGA 3M8UA 4LZ8A 5L9MA 3FASA 1MG1A 4IO5A 1B3HA 5JTYB 4F19A 1UTHA 4WEDA 1PBQA 4EQ7A 1VFEA 2I3WA 2I6EA 2D21A 4NWDA 3RTFB 3VVEA 2Y7IA 5HBCA 4X1DA 3RUMA 1LAFE 1QVSA 3IB1A 2RINA 4IGRA 3TTRA 1LAXA 4GXSB 5KDTA 2QJEA 3IB2A 4F2OA 3MZ9A 3K00A 2XXIA 2ESNA 4XKRA 4LZ5A 3CI8A 2Q2AA 4FATA 4ZE9A 2UYFA 2OCUA 1H45A 2WKYA 5K2YA 4ZS9A 1FQBA 4FECA 1LAGE 4YAHX 4R2BA 2XXUA 1NKXA 2REJA 1DTZA 1MS7A 4NF8A 4BDRA 4DZ1A 4HW8A 3CFZA 5KDTB 1MXUA 2OK2A 1ZKBA 2AL5A 2V25A 3EF7A 4GLIA 5H8HB 1AMFA 4EF2A 2F7CA 4AB5A 2XX7A 5B70A 1AOVA 1OLAA 1GTKA 1RYOA 3PUVE 4LATA 2H4IA 2DP8A 3K02A 4IO6A 4OTEA 3QSLA 3SETA 4F29A 1USYE 1P1OA 3FXUA 1B0HA 4R73A 4PQJA 1SQYA 4X9TA 2DSFA 3OD7A 3DP6A 3OEKA 4KCDA 4ZDMA 3PUWE 3VVFA 1SYHA 3HN0A 2VHAA 4F39A 1MPCA 2RC7A 3OXNA 3R26A 3TCGA 2PT1A 4DXBA 3PMWA 1LB9A 4QFLA 5JTYA 3A09A 5CMCA 4TLLB 2QL3A 1PBPA 3KBRA 4GVOA 3TQWA 1OQGA 1DTGA 1Y4TA 1JW5A 2V3TA 2ZYOA 3G7WA 4OFLA 2F6GA 3PD8A 1T0KA 3MBPA 4N13A 3WAEA 1MQGA 2OWTA 3FV2A 1A7LA 4F1YA 3S4UA 3EPEA 3MJNA 4OXVA 3TCFA 1YTVA 1MXZA 4U23A 3PU5A 1EZ9A 1JVYA 4G8HA 4YKIA 1AL3A 1LLSA 5H8QA 3H3GA 2Y7KA 1EZPA 5KCJA 2F34A 3LSLA 3D4GA 5L9SA 3PUXE 1ANFA 1GV8A 3KJ7A 4LQ5A 3S2VA 3T9VA 2E1SA 1F9BA 4MF3A 3MC2A 2XHDA 2Z8EA 4G8NA 4RA1A 4C1UA 2VGQA 3H6TA 4Z7EA 1FTLA 3L6GA 3GBBA 4OWDA 2F6PA 2HXWA 3CG1A 3KOSA 4GF8A 2RCAA 2AYSA 1XHYA 4LA9A 4ZEIA 1AH5A 3K4UA 4LP2B 1B3EA 4ZZEA 1B7HA 1M5EA 5I56A 3KN3A 4GD5A 3TYHA 1FQAA 2UVIA 2QS3A 4P0GA 2DOJA 3CFXA 1B3GA 4F3BA 1LBCA 4P0IA 1PC3A 2OJTA 3IOVA 3UIFA 3EHUA 4NMYA 3V83A 4ZZAA 2RC9A 2XXYA 1IIWA 1Y3NA 2Z23A 3FATA 4YICA 5F1QA 4OQOA 3GZGA 3C31A 4DIGA 5I56B 2H99A 4R75A 4R6YA 1ZIUA 2R9JA 4KQPA 4NF5B 2GHAA 2THIA 1MQJA 3O97A 4X1BA 1JQFA 1SYIA 3FIRA 3IAZA 2I48A 4F2QA 1P1UA 1SDXA 1Z7ME 2XXVA 1UTHB 5JK4A 3FXRA 3RNNA 3VV5A 4OVJA 2IA4A 3O6GA 1OVTA 3I5OA 2DE3A 5TP9B 1BTJA 1B1HA 3RTWB 1NH8A 3MPLA 5BWJA 1LFHA 1RYXA 5HPQA 5DEXA 2ZYNA 4Q0CA 4XKNA 3ILUB 1MDQA 3IO4A 3M3KA 4U22A 3O29A 3PPRA 4WXJA 3Q29A 4K3FA 1B05A 2O1LA 5CM6A 1JEUA 1CE2A 2ZXTA 3KEIA 4R2FA 3T93B 1US5A 4HS7A 2G93A 2DVZA 1FQEA 4U21A 5DEXB 3CG3A 5AA4B 4IO2A 3T96B 3RGYA 4U1OA 5TP9A 1MXYA 1XS5A 3ZS6A 4NF4A 2B65A 2X7PA 2ZNSA 1XOCA 2CMOA 2UVHA 3H6VA 4U1ZA 3SKPA 3DLNA 5H8HA 5TPAB 2IEEA 3TCHA 4BDLA 3VXCA 1Y9UA 2PX1A 3OO6A 4ECFA 3KFMA 4GRKA 4NF6B 4F22A 3PD9A 1H3DA 3HHFA 1A55A 5KCJB 4NWCA 3K6UA 1B46A 4KI0E 4LVQA 4R6HA 3TQLA 4ZEBA 2YPNA 3VLVA 1ZLQA 5AA3A 4RNSA 1TXFA 3HHGA 4NF6A 3K1NA 4G4PA 2HQ0A 4I1DA 3ZSFA 1R6ZA 2QRYA 4JB7A 4G68C 1QUIA 3UK4A 4F3SA 4C1TA 1B6HA 2O68A 5H8SA 1N76A 3KSJA 3FXQA 3MZ1A 1JETA 2NXOA 4KCCA 3O66A 4MFIA 2Y84A 1IITA 2ANJA 1S9TA 2AIXA 1A99A 1DPEA 1MM7A 1FTJA 1XVYA 1IQ7A 3KOTA 3IOTA 4O3BA 4PFTA 3T66A 3W9WA 1DMBA 3FD3A 5CMKA 4JBZA 2CZLA 3F11A 3LBSA 2D5WA 2ONSA 4GXAA 3MUQA 3L6HA 4KYDA 4DCYA 4ELRA 5ISUA 2I0BA 3VVDA 2D3IA 2DE4A 3IOUA 1M5CA 3PGFA 4XXUA 3USDA 2V84A 1IXCA 1M5FA 4BLAA 2NUVA 3O9PA 4XTCQ 1B7UA 3FGSA 1ELJA 3TTMA 4DXUA 4IY6A 4F3GA 1MQDA 4Z0IA
chains in the Genus database with same CATH superfamily
3O28A 3C33A 3G3KA 4PETA 3QIMA 2JJKA 1B4ZA 2Q8MA 2F5XA 3MSTA 2HAVA 3FJMA 1FTKA 2M8CA 5IAIA 3KJTA 5JEIA 3ONMA 3B50A 4QBAA 4O3AA 1URDA 1TT1A 1LCFA 5DVFA 4FAJA 2XXWA 1MQIA 3KSXA 5ET8A 4ONYA 1MY2A 2ONKE 4GL8A 3SEXA 4I62A 4H0WA 3U93A 2A5TA 1N84A 4Q8RA 2XXTA 3MP8A 1VE4A 1TFDA 4IO4A 5IZ1A 3E78A 2QMXA 2PYYA 3RT6B 2P1SA 1B5JA 3GYYA 4EQBA 5DVJA 1B7ZA 3FJGA 3PPNA 1WODA 1US4A 4BDOA 1SW5A 2ALUA 1LB8A 1N0TA 3DM0A 2H9BA 2HCAA 1JNFA 3S9NC 3BFUA 2XXQA 4F1VA 4EQ9A 4BDQA 4G77A 4LONB 4M4GA 4LUBA 2O1MA 1NNFA 3N5LA 4HE0A 1B2HA 1EZOA 3Q28A 4G2ZA 3H4ZA 4OETA 1EYIA 2DS9A 2NVUB 1MPBA 3Q27A 1N04A 2OWSA 5L9OA 2A5SA 1EU8A 4R72A 1MY1A 1K9YA 5EYGA 3N6TA 3SESA 4YMBA 1HSEA 4YKJA 2Y7RA 4XFEA 4PP0A 1N7XA 2RC8A 4FJPA 2WYKA 1Y1ZA 4EDPA 4THIA 4OMBA 1P1NA 5F7VA 3FVKA 1VSOA 2DQVA 4H6DA 4RK9A 5TU0A 4EUOA 2P3NA 2VD2A 3EHTA 4MBPA 5H8FB 4DLDA 3OSRA 1I6QA 2Y7PA 5CMBA 4YZZA 1Q35A 2HAUA 1ZTYA 4PFRA 3O6IA 4MCOA 1DSNA 2XA5A 2XXRA 3T9UA 3CR9A 3FVNA 1FRPA 2O69A 3B8BA 3IR1A 2AL4A 3SEUA 4WEPA 4H45A 1Y1MA 3VFJA 2XWIA 4AS4A 3ECRA 4WKMA 1KA0A 3EHSA 3EN3A 3IFAA 3IL1B 2DDKA 3VE1B 5I2NB 2QMWA 1INPA 1JEVA 3TDJA 4EXKA 2ZZXA 1NV7A 2F3BA 3S9MC 4MHFA 3JV9A 4HCWA 3MPKA 1SVXB 3C34A 4GFRA 4EXLA 4RY1A 1AWBA 2ZNUA 3MW0A 2F35A 1YZ0A 4NGUA 1A8FA 3VLUA 1JVXA 1A8EA 1D9YA 1M5BA 2QVVA 3TPAA 2I4CA 4P8BA 2WBBA 2X7QA 4OEVA 1Q1KA 5I2KB 1NV3A 2O84X 5ESYA 5I5PA 1B51A 5F24A 1NH7A 3K6WA 3MQ9A 3G3FA 3OO8A 2I0CA 2PT2A 2DWAA 1DPPA 1BKAA 1USYH 2F78A 4LZ8A 4AS5A 4WEDA 2I3WA 4NWDA 3RUMA 4MJOA 3IB2A 3MZ9A 2XXIA 2ESNA 2OWZA 4LZ5A 4ZE9A 5I3SA 1IMDA 1DTZA 1MS7A 4NF8A 1ZKBA 2V25A 1FBCA 4AB5A 1OLAA 5J16A 3PUVE 4LATA 4PAIA 1B0HA 2DSFA 3VVFA 4KCDA 3PUWE 1SYHA 2VHAA 5A5LA 2RC7A 3PMWA 3A09A 4TLLB 2QL3A 1PBPA 4H46A 1DTGA 3MBPA 1MQGA 2OWTA 3FV2A 1MXZA 1AL3A 1LLSA 1RDXA 3H3GA 1EZPA 3LSLA 1LBYA 1GV8A 4LQ5A 3T9VA 2XHDA 4C1UA 4N81A 2QVUA 3GBBA 4OWDA 4GF8A 3LUZA 1NV6A 3KN3A 3TYHA 2UVIA 4P56A 3CFXA 1PC3A 1FPGA 2OJTA 3UIFA 1D9QA 1RDZA 4NMYA 1Y3NA 2Z23A 3FATA 4YICA 3C31A 4R75A 4R6YA 3T9HB 2CEXA 4F2QA 3O6GA 2DE3A 1BTJA 1NH8A 1RYXA 1MDQA 3IO4A 2ZZWA 3KEIA 4HS7A 2G93A 2DVZA 5DEXB 3T96B 3ZS6A 4JVDA 2CMOA 4U1ZA 5H8HA 3VXCA 1Y9UA 4F22A 1B46A 2YPNA 3VLVA 4RNSA 4NF6A 4G4PA 3UK4A 4C1TA 1B6HA 3FXQA 3O66A 1S9TA 1FTJA 1XVYA 3T1BA 3IOTA 3MYUA 4GX4A 3FD3A 4PF6A 4JBZA 5IZZA 3F11A 3LBSA 2D5WA 2ONSA 4KYDA 4OVRA 1M5CA 3USDA 4XXUA 4DXUA 1ELJA 4IY6A 1MQDA 3E13X 4KD5A 4MAGA 3QUJA 1FTAA 1RKMA 4ZECA 5EQ8A 3N26A 3ILTB 2HZKA 1B9JA 1EH3A 1LCTA 1WVJA 1MY4A 2GH9A 4KHZE 1B1XA 4I40A 1MRPA 4X8RA 4FE8A 1QKBA 3T22A 5CC2A 5EYFA 3QAXA 1I6BA 1QUKA 4NG7A 5EHSA 2RF1A 3IJOB 2WBDA 4G68A 4KYSA 2PFZA 2OZZA 2XXPA 2BJJX 2XD2A 3KN7A 4N6DA 4TOZA 2DE2A 2Z8DA 3JZJA 4OFJA 1QJMA 2Q2CA 3LUYA 2PMSA 5H8NB 4NF0A 1LBZA 2KQZA 2E0SA 5DT6A 1MH4A 1MXVA 5BUUA 1SW2A 4JSOA 1Z7NE 3V89B 2WX9A 3PTYA 4GX3A 4ZEKA 1AIVA 4H5FA 3KBZA 4GX6A 1NUZA 1SPIA 5LOMA 1YPNA 4DE8A 2FHYA 3A29A 4X48A 4YKPA 1I6AA 3TODA 3KGCA 3H06B 1NL5A 4RPOA 1K9ZA 1IMEA 4HXVA 3CVGA 3Q25A 4NHBA 4RXLA 5EQ7A 2F7AA 1KWHA 4KR5A 2ZNTA 3OOAA 3SERA 3C32A 3V5AA 3MP1A 5CBSA 4GWOA 4PFUA 4QFKA 3C9HA 4IB2A 5ICTA 3TZAA 3PPPA 4NTLA 4PBHA 2H98A 2FA7A 4OEUA 1TWYA 3SEVA 1MQHA 3W15C 1OIBA 1B32A 1SD3A 2UYEA 1D9VA 1ZMGA 3S9LC 1NV5A 1SW4A 3G3IA 3BBRA 3SEYA 4OHNA 1IXIA 4M1VA 1FSAA 4N6KA 5LDZA 2Y7WA 3B6WA 2R71A 1IMBA 1UQWA 3NOHA 4IO3A 3U65A 4HTGA 5CI5A 3LV0A 3OO9A 2XX8A 2WEFA 3T0JA 3PMVA 3TAJA 4ND9A 2CZIA 2F8DA 1MXWA 4UACA 1QW0A 1B58A 3SZPA 4O7IA 4R9GA 4KYEA 5EQ9A 5HM4B 3R7XA 1N7WA 4ELOA 4X04A 4FBPA 4IGTA 3D4CA 3HFUA 3E3KA 5FHOA 3HO7A 3U1OA 4GWZA 4ZEDA 1LBXA 1UTBB 4H8JA 2GFEA 1DOTA 5KZTA 3OELA 2I3VA 3SDFA 1I69A 3CSGA 5ET5A 5ITOA 3CRBA 4HCYA 2I4BA 2REGA 4FORA 4KXPA 1JW4A 4NE4A 3R6UA 1UIVA 2Q88A 1VR5A 4N6PA 5AA2B 1B0LA 3FJ7A 3CHGA 4LQ2A 2V93A 4NF5A 3TTNA 4PAKA 5DW8A 4JWOA 2DWIA 3RT8A 2VD3A 4YU0A 1FBHA 1Q9DA 3ODBA 4ZE8A 4QSEA 2I49A 4OYVA 2DWHA 3PPQA 1FBPA 1FPFA 1URSA 4QFPA 3RPWA 2Z8FA 4OZ9A 1D4NA 1H76A 3EKIA 3FVGA 3OSQA 5I57B 3E79A 2FIEA 5I59B 2YLNA 1FTOA 4U4SA 4OA4A 4GL0A 5IZ3B 1HSJA 2XX9A 2ZYMA 1POY1 4YB6A 4PDDA 4UA8A 3U72A 3FASA 4IO5A 1DBZA 1PBQA 4EQ7A 3RTFB 3VVEA 5HBCA 4X1DA 1LAFE 5KDTA 2QJEA 4MEVA 4PE3A 3CI8A 2Q2AA 1FQBA 4FECA 4YAHX 4R2BA 1NKXA 3CFZA 2AL5A 4EF2A 1AMFA 4UABA 3IFCA 4NQ8A 3SETA 4IO6A 4OTEA 4F29A 1P1OA 4R73A 4X9TA 3OEKA 4F39A 3OXNA 2PT1A 1LB9A 4HE2A 1OQGA 2V3TA 1Y4TA 1JW5A 2ZYOA 3PD8A 1A7LA 3EPEA 3MJNA 1YTVA 5EYHA 3PU5A 1EZ9A 4YKIA 5H8QA 5KCJA 3PUXE 3S2VA 2L5VA 2Z8EA 4G8NA 3H6TA 1FTLA 3L6GA 2F6PA 4LA9A 1XHYA 3K4UA 2ZZVA 1M5EA 5I56A 1FQAA 2QS3A 1NUYA 1B3GA 3IOVA 2CZKA 3V83A 2XXYA 5F1QA 2H99A 2GHAA 4P1LA 4X1BA 1JQFA 1UTHB 2QVRA 2HPGA 3I5OA 1B1HA 5HPQA 5DEXA 2ZYNA 4Q0CA 4XKNA 4U22A 3O29A 3PPRA 3Q29A 1BK4A 4MNPA 1FPBA 4R2FA 1US5A 3CG3A 1FPLA 4NF4A 2X7PA 2GQ1A 3SKPA 5TPAB 2IEEA 2PX1A 4ECFA 4N8YA 4NF6B 3PD9A 1H3DA 1A55A 5KCJB 5LTCA 3K6UA 4R6HA 4ZEBA 1ZLQA 5AA3A 1TXFA 3HHGA 3BIGA 1R6ZA 2O68A 5H8SA 3KSJA 4KCCA 2QFLA 1DMBA 4DCYA 4GXAA 2I0BA 3VVDA 2D3IA 2DE4A 4BLAA 3PGFA 1M5FA 3O9PA 4F3GA 2O7IA 1S50A 4OVPA 5TPAA 4RK2A 3W9VA 5H8QB 3TEPA 4FEBA 4JSDA 1MM6A 3QK6A 3VDFA 4E0WA 1JW1A 4KFQA 3O2AA 3K2DA 4PGPA 1DK4A 2Y5KA 3G3GA 2Z22A 1IMAA 1FCKA 3HV1A 3KG2A 2H25A 4H8IA 2B4MA 3B6QA 1QULA 3RPLB 2V4CA 5DYHA 1HSLA 3IX1A 4O8MA 3UP9A 1A54A 2F97A 4MH5A 3E4RA 1NUXA 4GQOA 1NV1A 3K01A 2ABHA 3C36A 4G68B 4DCXA 4POXA 1XT8A 3BKIB 3FXBA 3VXBA 4YB5A 5I58A 3PMXA 1UTBA 4NF8B 1FQDA 3TELA 4YB7A 3LSWA 3MVZA 4FIMA 2FNCA 2DYXA 1OLCA 3M3FA 4XKPA 1Y4CA 1FQFA 2ZYKA 2PCRA 2O6AA 1P99A 4OANA 1MH3A 1QUJA 4OERA 4Q5TA 3TMGA 1J1NA 3UA8A 1XVXA 3IOWA 4XKQA 2R8TA 4FEDA 1MPDA 1LBWA 3ZKKA 5DTBA 4OVTA 2B4LA 4GWSA 2YJPA 1FBDA 2HFBA 2KLFA 1IMFA 3PUZE 2P2AA 1ATGA 3AXFA 3PV0E 3MAMA 1PB8A 3K0VA 5FTIA 3IO6A 4PCDA 3QYTA 5H8FA 2Q74A 1FTMA 4GWXA 4I9DA 2V3UA 1YAEA 1MXXA 2G29A 3G3JA 2X26A 4AQ4A 3RLFE 4GIZA 2CEYA 2Q9TA 4R9FA 2XXXA 1R1NA 1LEVA 1LAHE 4IR8A 4P1EA 3RQTA 3KN8A 2NOOA 5A5XB 4HE1A 5FHMA 2I58A 4MLQA 3N6UA 3TUSA 1MY0A 4P9KA 4RJZA 4ISUA 3MZBA 2VT5A 3K1PA 4DDDA 4F1UA 4RPNA 3DELB 3BIHA 3B7DA 3GBAA 1B5IA 1ZBMA 4BDNA 5AA4A 3Q26A 4TQUQ 3KZGA 1OVBA 3CIJA 1LSTA 1OMPA 4JXIA 1N3WA 3PUYE 1P1WA 4GOTA 1D3KA 4LZ7A 3A3CA 3TTKA 1B4HA 3LC8A 2P0SA 3IK6B 3WAFA 2QPQA 4TLMB 5DVIA 1SW1A 2LAOA 5AA2D 2F3DA 3THIA 3TFLA 1LFGA 4F3PA 3FVOA 1L5TA 4QF9A 3MWBA 5AA2A 2B3FA 2QS4A 1O63A 2QS1A 3CFLA 1IUDA 1PEBA 1OQHA 5H8NA 3OEMA 1FBEA 1POTA 4PC9A 4H1XA 4O7MA 1ZU0A 3GXAA 2GRVA 1URGA 2QS2A 2FIXA 4L17A 2DVCA 5CBRA 3IORA 5EQAA 3I6VA 3T9XB 5L8DA 4QSCA 1BIYA 1B40A 4ELPA 5L9MA 1MG1A 1B3HA 5JTYB 3QMFA 4N15A 1VFEA 2I6EA 2D21A 2Y7IA 1QVSA 3IB1A 4IGRA 1LAXA 4GXSB 1FPKA 4F2OA 2OCUA 1H45A 2WKYA 2P3VA 5K2YA 1LAGE 2XXUA 2REJA 4BDRA 4DZ1A 5KDTB 1MXUA 4O94A 3RYDA 4GLIA 3EF7A 5H8HB 1AOVA 2F7CA 5B70A 2OX3A 1GTKA 1RYOA 2H4IA 3K02A 3QSLA 4ZDMA 4PQJA 3DP6A 4XF5A 1XI6A 3TCGA 3R26A 4DXBA 4P3LA 4QFLA 5JTYA 3ISPA 4GVOA 3TQWA 2F6GA 4F1YA 4PBQA 4MMPA 4MX6A 3TCFA 1EYKA 1JVYA 2Y7KA 2F34A 1NV0A 2E1SA 3MC2A 4QXDA 2HXWA 3KOSA 3CG1A 2RCAA 2AYSA 4LP2B 4GD5A 4P0GA 2DOJA 4P0IA 4ZZAA 1IIWA 4GWYA 3GZGA 5I56B 4DIGA 1ZIUA 4NAPA 2THIA 3O97A 3FIRA 1EYJA 1P1UA 1Z7ME 2XXVA 5JK4A 1CNQA 3FXRA 3RNNA 3VV5A 4OVJA 2IA4A 5TP9B 3ILUB 4WXJA 1B05A 1JEUA 1FQEA 4U21A 3RGYA 4U1OA 1XS5A 2B65A 2ZNSA 1XOCA 3H6VA 4NX1A 3DLNA 4BDLA 3OO6A 3KFMA 4GBWA 3HHFA 4LVQA 3TQLA 1FPEA 1FJ9A 2QRYA 4JB7A 1QUIA 3ROJA 4MFIA 1JETA 2NXOA 2ANJA 3KOTA 1A99A 1MM7A 4PFTA 3T66A 3MUQA 3L6HA 5ISUA 3IOUA 1IXCA 1NV4A 4XTCQ 1B7UA 4PFBA 1P1QA 1B52A 1H44A 4PFWA 2DWJA 1S7YA 1GGGA 4YMAA 5CMMA 5AE4A 2Q8JA 2DXYA 4BDMA 1FPJA 4AB6A 1VFDA 5T3JA 4OVSA 3V8XB 1BP5A 2HHMA 5I7IA 4P11A 4PE5B 5I2NA 4ZEFA 5I57A 2H5YA 2ONRA 4QFNA 1M5DA 1IMCA 3M3LA 3SEWA 1TFAA 2O51A 4O3CA 1BLFA 1MDP1 3HCQA 4OENA 2XD3A 2B3BA 2F7BA 5IM2A 1IXGA 3P7IA 2RCBA 1VDWA 2Y5LA 1B3LA 4C0RA 3G3HA 2V3QA 4JDFA 3B6TA 1FBGA 3U94A 4H67A 2O7UA 4G61A 4Q30B 4QSDA 3DP4A 1Y3PA 5K2XA 4ELQA 4N8GA 2HEUA 4ESXA 3DP8A 1G0HA 2NWJA 4PF8A 4F18A 1R9QA 2QSXA 2XXKA 4OFOA 3LSXA 2W7YA 1YCJA 2OLBA 1FPDA 1PB9A 1A40A 5B7DA 4QHQA 1NI9A 4I8CA 5A5XA 1PDAA 1B3FA 3IJXB 3H7MA 3S9EA 3OENA 1SI1A 1GVCA 3D1RA 5IZ3A 2UXAA 4KPTA 2OBGA 4F31B 3UGWA 2ZMBA 4GWUA 4DI4B 3JYRA 4IO7A 4H65A 1N3XA 1PB7A 4PTKA 4PFIA 1Y20A 3U8QA 2VOZA 4MLVA 1B5HA 3U92A 3HPIA 1UIUA 1IXHA 4PFYA 3MVYA 3HSTA 5CRYA 3FUZA 4LN5A 1II5A 1LBVA 1NV2A 2GHBA 3K1MA 4ESWA 4E0XA 1FPIA 1SBPA 3C4MA 2VPNA 3VLWA 4N07A 3MP6A 5I59A 2DXRA 3RY3A 4NEDA 3O6HA 5IKBA 1QKAA 1MY3A 4QFOA 4GBVA 3MVXA 5I84A 4H5GA 2HXRA 1Y3QA 3A3UA 4QRZA 3MVWA 2UVJA 5FHNA 2PVUA 4JWYA 5EHMA 2VP1A 3ZKLA 3BFTA 4POWA 2WYPA 4N91A 3UN6A 2FVZA 3OMBA 4G8MA 1LFIA 4NN3A 3TTLA 3CSBA 4DXCA 3I3VA 3FV1A 3FZVA 3H03A 4GWWA 4OVQA 1YXIA 5ICQA 2RKMA 5I58B 1IZ1A 1DCUA 4YKKA 5ELVA 1H43A 2KR0A 5AA1A 3QXMA 3TKDA 2FBPA 1NNKA 4DI3D 4NF4B 3K6XA 3H6UA 2VPOA 4U2RA 4N4UA 3WAEA 5ET7A 1R9LA 5I2KA 3EQ1A 1SI0A 1NFTA 3K6VA 1NNPA 4IY5A 1LGBC 4PGNA 3RPLA 3E9XA 4P47A 4JWXA 4R6KA 1CB6A 1ZJLA 4U4XA 2CZHA 3LR1A 1FQCA 1NMUA 5M2VA 1GR2A 3GLBA 3N94A 1LBBA 3OO7A 1NNTA 4R74A 4RYAA 5J1DA 1XC1A 2Q89A 2R6GE 1WDNA 3PPOA 4EF1A 3QUFA 2XWVA 5ITPA 2F36A 5FTHA 1O7TA 2FYIA 2HZLA 2A5TB 3C35A 3H6WA 4XIGQ 3LSFB 1IEJA 3IB0A 3UORA 2XXHA 1FW0A 1O64A 2PBWA 2UVGA 4I3YA 3M8UA 1KZ8A 4F19A 3FBPA 1UTHA 2MKZA 3ZSFA 3TTRA 2RINA 4MNCA 4XKRA 3K00A 2XWKA 4FATA 3KC0A 2UYFA 4ZS9A 4HW8A 1FBFA 2OK2A 2XX7A 1YYZA 2DP8A 1USYE 3FXUA 1NUWA 1SQYA 3OD7A 3HN0A 4PAFA 5IGAA 1MPCA 5CMCA 3KBRA 4OFLA 4I3EA 1T0KA 3G7WA 4N13A 3S4UA 4OXVA 4PDHA 1G0IA 4U23A 4G8HA 3D4GA 5L9SA 1KA1A 1ANFA 3KJ7A 1F9BA 4MF3A 4RA1A 2VGQA 5ET6A 4Z7EA 3RN8A 4N17A 4ZEIA 2BJIA 1AH5A 1B3EA 4ZZEA 1B7HA 1RDYA 3KC1A 2XWOA 1QGXA 4F3BA 1LBCA 4MIJA 3EHUA 2RC9A 4OQOA 4NF5B 2R9JA 4KQPA 1MQJA 1SYIA 3IAZA 2I48A 1SDXA 1FJ6A 1OVTA 3RTWB 4JVCA 3MPLA 5BWJA 1LFHA 5FBPA 3M3KA 4K3FA 2O1LA 4MNIA 5CM6A 4XEQA 1CE2A 2ZXTA 3T93B 5AA4B 4IO2A 5TP9A 1MXYA 2UVHA 3TCHA 4JVIA 4GRKA 4NWCA 4KI0E 3K1NA 2HQ0A 4I1DA 4G68C 1JP4A 4F3SA 2PFYA 1N76A 4OESA 3MZ1A 2Y84A 1IITA 1DPEA 2AIXA 4O3BA 1IQ7A 3W9WA 5CMKA 2CZLA 4ELRA 2V84A 2NUVA 3FGSA 3TTMA 4Z0IA
chains in the Genus database with same CATH topology
1P1QA 1B52A 3E13X 1H44A 1S50A 2O7IA 4KD5A 3O28A 4PFWA 2DWJA 3C33A 3G3KA 1S7YA 1GGGA 3QUJA 4PETA 5TPAA 3QIMA 4RK2A 3W9VA 4YMAA 1RKMA 5CMMA 4ZECA 1B4ZA 2F5XA 3N26A 5AE4A 2Q8JA 3ILTB 2DXYA 4BDMA 5H8QB 4AB6A 3TEPA 2HZKA 1VFDA 1B9JA 4FEBA 4JSDA 2HAVA 5LOMA 1EH3A 3FJMA 1MM6A 1FTKA 2M8CA 3V8XB 1LCTA 5IAIA 3KJTA 5JEIA 3QK6A 3ONMA 3VDFA 1WVJA 1MY4A 4E0WA 2GH9A 4KHZE 1URDA 1BP5A 4O3AA 1B1XA 1JW1A 1TT1A 4KFQA 1MRPA 3K2DA 3O2AA 4FE8A 4P11A 1QKBA 3T22A 4PE5B 1LCFA 5CC2A 5DVFA 4FAJA 5I2NA 5EYFA 4ZEFA 3QAXA 1I6BA 1QUKA 2H5YA 2XXWA 5I57A 1MQIA 2ONRA 3G3GA 3KSXA 4QFNA 4ONYA 1M5DA 1MY2A 2ONKE 2RF1A 2Z22A 5EHSA 3M3LA 4GL8A 3SEWA 1FCKA 3HV1A 3KG2A 2H25A 4H8IA 1TFAA 3B6QA 1QULA 2O51A 3IJOB 4G68A 4KYSA 4O3CA 1BLFA 3SEXA 5DYHA 1HSLA 4I62A 1MDP1 4H0WA 3IX1A 3HCQA 2A5TA 4OENA 1N84A 2OZZA 2XXPA 3U93A 3UP9A 4Q8RA 2BJJX 2XD2A 3KN7A 1A54A 2F97A 2XD3A 4TOZA 2XXTA 2B3BA 2DE2A 2F7BA 2Z8DA 3JZJA 4OFJA 1QJMA 2Q2CA 4MH5A 3MP8A 3LUYA 1IXGA 3E4RA 1VE4A 2RCBA 3P7IA 1TFDA 2PMSA 4GQOA 5H8NB 4IO4A 1B3LA 3K01A 4C0RA 2ABHA 3C36A 3G3HA 4G68B 2V3QA 4DCXA 4JDFA 3B6TA 2QMXA 3U94A 2E0SA 2PYYA 5DT6A 3RT6B 1MH4A 4H67A 1MXVA 2P1SA 2O7UA 1B5JA 4POXA 4Q30B 1XT8A 4QSDA 3DP4A 4EQBA 5BUUA 5DVJA 1SW2A 3BKIB 4JSOA 1Y3PA 3VXBA 4YB5A 5K2XA 1B7ZA 1Z7NE 3V89B 5I58A 3PMXA 4ELQA 2HEUA 4ESXA 1UTBA 3DP8A 3FJGA 4NF8B 2NWJA 3PPNA 1WODA 1FQDA 4F18A 1R9QA 4ZEKA 3TELA 2QSXA 4YB7A 1US4A 3RN8A 4BDOA 1SW5A 4OFOA 1AIVA 4H5FA 2ALUA 1LB8A 3LSWA 3LSXA 3MVZA 4FIMA 1N0TA 3DM0A 2FNCA 2H9BA 2HCAA 1YCJA 2W7YA 1JNFA 2DYXA 1OLCA 2OLBA 3M3FA 1PB9A 1YPNA 4XKPA 1A40A 1FQFA 1Y4CA 3T9HB 2ZYKA 3BFUA 4DE8A 3S9NC 2XXQA 5B7DA 4QHQA 4EQ9A 4BDQA 4F1VA 4X48A 4I8CA 4YKPA 5A5XA 4G77A 1I6AA 1PDAA 1B3FA 3IJXB 2O6AA 1P99A 4LONB 4M4GA 3TODA 1MH3A 4LUBA 1QUJA 4OERA 4Q5TA 3TMGA 3H7MA 3S9EA 1J1NA 3KGCA 1SI1A 2O1MA 3OENA 3H06B 1GVCA 3UA8A 2UXAA 1NL5A 4RPOA 1NNFA 3N5LA 4KPTA 1XVXA 1B2HA 1EZOA 3IOWA 2OBGA 3Q28A 4XKQA 4F31B 4G2ZA 4FEDA 2ZMBA 3UGWA 3H4ZA 1MPDA 3CVGA 3Q25A 4RXLA 4OETA 3ZKKA 5DTBA 2F7AA 2DS9A 1KWHA 2NVUB 1MPBA 4KR5A 2ZNTA 3Q27A 1N04A 3JYRA 4IO7A 4H65A 2OWSA 1N3XA 1PB7A 5L9OA 2YJPA 3OOAA 2A5SA 1EU8A 3SERA 3C32A 4R72A 3V5AA 1Y20A 3MP1A 1MY1A 2VOZA 3U8QA 2HFBA 5CBSA 4GWOA 2KLFA 1B5HA 4MLVA 3PUZE 3N6TA 2P2AA 4PFUA 4QFKA 3SESA 3U92A 3HPIA 1ATGA 1UIUA 4YMBA 1IXHA 4PFYA 3C9HA 4IB2A 3AXFA 3HSTA 3MVYA 3FUZA 5CRYA 3TZAA 3PV0E 5ICTA 1HSEA 2Y7RA 1II5A 2GHBA 3K1MA 3MAMA 4YKJA 3PPPA 4NTLA 4PP0A 4ESWA 4E0XA 1PB8A 1SBPA 2H98A 3K0VA 2FA7A 1N7XA 3C4MA 2RC8A 5FTIA 3VLWA 4FJPA 4N07A 4OEUA 3IO6A 1Y1ZA 4EDPA 1TWYA 3QYTA 3SEVA 5H8FA 1MQHA 4THIA 3W15C 4OMBA 1OIBA 1P1NA 3MP6A 1B32A 5F7VA 3FVKA 5I59A 1SD3A 2DXRA 1FTMA 1VSOA 2DQVA 2UYEA 3RY3A 4I9DA 4NEDA 1D9VA 3O6HA 4H6DA 4RK9A 5TU0A 1QKAA 2V3UA 4EUOA 5IKBA 1ZMGA 1MY3A 4QFOA 3S9LC 2VD2A 3EHTA 4MBPA 5H8FB 4DLDA 1YAEA 1SW4A 1MXXA 2G29A 3MVXA 3G3IA 3OSRA 5I84A 1I6QA 2Y7PA 3BBRA 4H5GA 4OHNA 5CMBA 1IXIA 3G3JA 3SEYA 4M1VA 1Y3QA 1Q35A 2X26A 3A3UA 3MVWA 4QRZA 4YZZA 3RLFE 2HAUA 4GIZA 4AQ4A 1ZTYA 2Y7WA 3B6WA 2R71A 4R9FA 1UQWA 2Q9TA 2UVJA 2XXXA 1R1NA 3O6IA 5FHNA 2PVUA 4JWYA 4IO3A 1LAHE 4HTGA 1DSNA 2XXRA 5CI5A 5EHMA 3T9UA 3CR9A 3OO9A 2VP1A 3ZKLA 3FVNA 2XX8A 3PMVA 3RQTA 3KN8A 3TAJA 4ND9A 2O69A 3BFTA 2F8DA 1MXWA 2NOOA 1QW0A 1B58A 4POWA 4UACA 5A5XB 5FHMA 4R9GA 2I58A 3IR1A 4KYEA 4MLQA 5HM4B 3N6UA 2AL4A 3SEUA 3UN6A 3TUSA 1MY0A 3OMBA 4OESA 3R7XA 1N7WA 4G8MA 4ELOA 1LFIA 4RJZA 4WEPA 4IGTA 3TTLA 3CSBA 4ISUA 3MZBA 4DXCA 1Y1MA 3VFJA 3D4CA 3I3VA 3FV1A 3FZVA 3K1PA 4DDDA 3ECRA 3E3KA 4F1UA 3H03A 4RPNA 5FHOA 3HO7A 4WKMA 3DELB 3U1OA 4ZEDA 5ICQA 3EHSA 3EN3A 1UTBB 4H8JA 3IL1B 2GFEA 1DOTA 2RKMA 5I58B 3B7DA 3VE1B 3GBAA 2QMWA 5I2NB 5KZTA 1B5IA 3OELA 1IZ1A 1JEVA 3TDJA 4YKKA 1ZBMA 4BDNA 5AA4A 3Q26A 4TQUQ 2I3VA 4EXKA 3KZGA 3SDFA 5ELVA 1OVBA 1H43A 5AA1A 3QXMA 3CIJA 1LSTA 1I69A 1OMPA 4JXIA 1N3WA 3PUYE 3TKDA 1P1WA 1NNKA 3S9MC 4GOTA 3CSGA 4NF4B 3K6XA 3H6UA 4U2RA 1D3KA 5ITOA 3CRBA 4HCYA 3JV9A 1R9LA 3A3CA 4HCWA 4LZ7A 3TTKA 2I4BA 1B4HA 3MPKA 5I2KA 2REGA 2P0SA 3EQ1A 3LC8A 1SVXB 1SI0A 1NFTA 3IK6B 3C34A 4FORA 4GFRA 3WAFA 4EXLA 3K6VA 1JW4A 1NNPA 2QPQA 4RY1A 4TLMB 4NE4A 5DVIA 1SW1A 4IY5A 3R6UA 1LGBC 1UIVA 2Q88A 2LAOA 1VR5A 3E9XA 2ZNUA 4N6PA 5AA2D 5AA2B 1B0LA 3FJ7A 3MW0A 4JWXA 4R6KA 1CB6A 1ZJLA 4LQ2A 2V93A 4NF5A 3TTNA 4U4XA 4JWOA 3THIA 1L5TA 3TFLA 2F35A 3LR1A 1LFGA 2DWIA 1FQCA 3RT8A 2VD3A 1NMUA 1A8FA 4YU0A 5M2VA 4F3PA 1GR2A 3GLBA 3FVOA 3VLUA 1JVXA 1A8EA 3N94A 4QF9A 1LBBA 1D9YA 1M5BA 3MWBA 3ODBA 4QSEA 4ZE8A 2I49A 3OO7A 5AA2A 4OYVA 2DWHA 3PPQA 1NNTA 4R74A 2B3FA 2QS4A 4RYAA 5J1DA 1XC1A 2Q89A 1O63A 2QS1A 2R6GE 1IUDA 3CFLA 1WDNA 1PEBA 1OQHA 5H8NA 3PPOA 3OEMA 3TPAA 4EF1A 1POTA 1URSA 2I4CA 3QUFA 4H1XA 4QFPA 2X7QA 5ITPA 4OEVA 2F36A 2Z8FA 3RPWA 1Q1KA 5FTHA 4OZ9A 1D4NA 1ZU0A 3GXAA 5I2KB 1H76A 2O84X 3FVGA 1O7TA 2GRVA 3OSQA 2FYIA 2HZLA 5I57B 2A5TB 3C35A 1URGA 3H6WA 4XIGQ 2QS2A 3LSFB 1B51A 1IEJA 1NH7A 4L17A 5I59B 2DVCA 2YLNA 3K6WA 1FTOA 3IB0A 3IORA 4U4SA 5CBRA 3I6VA 3MQ9A 3T9XB 3G3FA 4GL0A 5L8DA 3OO8A 4QSCA 1HSJA 2XX9A 3UORA 2I0CA 2PT2A 1BIYA 1DPPA 2DWAA 2XXHA 1BKAA 1B40A 1USYH 1POY1 2ZYMA 4YB6A 4ELPA 4UA8A 3U72A 1FW0A 1O64A 2F78A 2PBWA 2UVGA 3M8UA 4LZ8A 5L9MA 3FASA 1MG1A 4IO5A 1B3HA 5JTYB 4F19A 1UTHA 4WEDA 1PBQA 4EQ7A 1VFEA 2I3WA 2I6EA 2D21A 4NWDA 3RTFB 3VVEA 2Y7IA 5HBCA 4X1DA 3RUMA 1LAFE 1QVSA 3IB1A 2RINA 4IGRA 3TTRA 1LAXA 4GXSB 5KDTA 2QJEA 3IB2A 4F2OA 3MZ9A 3K00A 2XXIA 2ESNA 4XKRA 4LZ5A 3CI8A 2Q2AA 4FATA 4ZE9A 2UYFA 2OCUA 1H45A 2WKYA 5K2YA 4ZS9A 1FQBA 4FECA 1LAGE 4YAHX 4R2BA 2XXUA 1NKXA 2REJA 1DTZA 1MS7A 4NF8A 4BDRA 4DZ1A 4HW8A 3CFZA 5KDTB 1MXUA 2OK2A 1ZKBA 2AL5A 2V25A 3EF7A 4GLIA 5H8HB 1AMFA 4EF2A 2F7CA 4AB5A 2XX7A 5B70A 1AOVA 1OLAA 1GTKA 1RYOA 3PUVE 4LATA 2H4IA 2DP8A 3K02A 4IO6A 4OTEA 3QSLA 3SETA 4F29A 1USYE 1P1OA 3FXUA 1B0HA 4R73A 4PQJA 1SQYA 4X9TA 2DSFA 3OD7A 3DP6A 3OEKA 4KCDA 4ZDMA 3PUWE 3VVFA 1SYHA 3HN0A 2VHAA 4F39A 1MPCA 2RC7A 3OXNA 3R26A 3TCGA 2PT1A 4DXBA 3PMWA 1LB9A 4QFLA 5JTYA 3A09A 5CMCA 4TLLB 2QL3A 1PBPA 3KBRA 4GVOA 3TQWA 1OQGA 1DTGA 1Y4TA 1JW5A 2V3TA 2ZYOA 3G7WA 4OFLA 2F6GA 3PD8A 1T0KA 3MBPA 4N13A 3WAEA 1MQGA 2OWTA 3FV2A 1A7LA 4F1YA 3S4UA 3EPEA 3MJNA 4OXVA 3TCFA 1YTVA 1MXZA 4U23A 3PU5A 1EZ9A 1JVYA 4G8HA 4YKIA 1AL3A 1LLSA 5H8QA 3H3GA 2Y7KA 1EZPA 5KCJA 2F34A 3LSLA 3D4GA 5L9SA 3PUXE 1ANFA 1GV8A 3KJ7A 4LQ5A 3S2VA 3T9VA 2E1SA 1F9BA 4MF3A 3MC2A 2XHDA 2Z8EA 4G8NA 4RA1A 4C1UA 2VGQA 3H6TA 4Z7EA 1FTLA 3L6GA 3GBBA 4OWDA 2F6PA 2HXWA 3CG1A 3KOSA 4GF8A 2RCAA 2AYSA 1XHYA 4LA9A 4ZEIA 1AH5A 3K4UA 4LP2B 1B3EA 4ZZEA 1B7HA 1M5EA 5I56A 3KN3A 4GD5A 3TYHA 1FQAA 2UVIA 2QS3A 4P0GA 2DOJA 3CFXA 1B3GA 4F3BA 1LBCA 4P0IA 1PC3A 2OJTA 3IOVA 3UIFA 3EHUA 4NMYA 3V83A 4ZZAA 2RC9A 2XXYA 1IIWA 1Y3NA 2Z23A 3FATA 4YICA 5F1QA 4OQOA 3GZGA 3C31A 4DIGA 5I56B 2H99A 4R75A 4R6YA 1ZIUA 2R9JA 4KQPA 4NF5B 2GHAA 2THIA 1MQJA 3O97A 4X1BA 1JQFA 1SYIA 3FIRA 3IAZA 2I48A 4F2QA 1P1UA 1SDXA 1Z7ME 2XXVA 1UTHB 5JK4A 3FXRA 3RNNA 3VV5A 4OVJA 2IA4A 3O6GA 1OVTA 3I5OA 2DE3A 5TP9B 1BTJA 1B1HA 3RTWB 1NH8A 3MPLA 5BWJA 1LFHA 1RYXA 5HPQA 5DEXA 2ZYNA 4Q0CA 4XKNA 3ILUB 1MDQA 3IO4A 3M3KA 4U22A 3O29A 3PPRA 4WXJA 3Q29A 4K3FA 1B05A 2O1LA 5CM6A 1JEUA 1CE2A 2ZXTA 3KEIA 4R2FA 3T93B 1US5A 4HS7A 2G93A 2DVZA 1FQEA 4U21A 5DEXB 3CG3A 5AA4B 4IO2A 3T96B 3RGYA 4U1OA 5TP9A 1MXYA 1XS5A 3ZS6A 4NF4A 2B65A 2X7PA 2ZNSA 1XOCA 2CMOA 2UVHA 3H6VA 4U1ZA 3SKPA 3DLNA 5H8HA 5TPAB 2IEEA 3TCHA 4BDLA 3VXCA 1Y9UA 2PX1A 3OO6A 4ECFA 3KFMA 4GRKA 4NF6B 4F22A 3PD9A 1H3DA 3HHFA 1A55A 5KCJB 4NWCA 3K6UA 1B46A 4KI0E 4LVQA 4R6HA 3TQLA 4ZEBA 2YPNA 3VLVA 1ZLQA 5AA3A 4RNSA 1TXFA 3HHGA 4NF6A 3K1NA 4G4PA 2HQ0A 4I1DA 3ZSFA 1R6ZA 2QRYA 4JB7A 4G68C 1QUIA 3UK4A 4F3SA 4C1TA 1B6HA 2O68A 5H8SA 1N76A 3KSJA 3FXQA 3MZ1A 1JETA 2NXOA 4KCCA 3O66A 4MFIA 2Y84A 1IITA 2ANJA 1S9TA 2AIXA 1A99A 1DPEA 1MM7A 1FTJA 1XVYA 1IQ7A 3KOTA 3IOTA 4O3BA 4PFTA 3T66A 3W9WA 1DMBA 3FD3A 5CMKA 4JBZA 2CZLA 3F11A 3LBSA 2D5WA 2ONSA 4GXAA 3MUQA 3L6HA 4KYDA 4DCYA 4ELRA 5ISUA 2I0BA 3VVDA 2D3IA 2DE4A 3IOUA 1M5CA 3PGFA 4XXUA 3USDA 2V84A 1IXCA 1M5FA 4BLAA 2NUVA 3O9PA 4XTCQ 1B7UA 3FGSA 1ELJA 3TTMA 4DXUA 4IY6A 4F3GA 1MQDA 4Z0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P1Q A;  1B52 A;  3E13 X;  1H44 A;  1S50 A;  2O7I A;  4KD5 A;  3O28 A;  4PFW A;  2DWJ A;  3C33 A;  3G3K A;  1S7Y A;  1GGG A;  3QUJ A;  4PET A;  5TPA A;  3QIM A;  4RK2 A;  3W9V A;  4YMA A;  1RKM A;  5CMM A;  4ZEC A;  1B4Z A;  2F5X A;  3N26 A;  5AE4 A;  2Q8J A;  3ILT B;  2DXY A;  4BDM A;  5H8Q B;  4AB6 A;  3TEP A;  2HZK A;  1VFD A;  1B9J A;  4FEB A;  4JSD A;  2HAV A;  5LOM A;  1EH3 A;  3FJM A;  1MM6 A;  1FTK A;  2M8C A;  3V8X B;  1LCT A;  5IAI A;  3KJT A;  5JEI A;  3QK6 A;  3ONM A;  3VDF A;  1WVJ A;  1MY4 A;  4E0W A;  2GH9 A;  4KHZ E;  1URD A;  1BP5 A;  4O3A A;  1B1X A;  1JW1 A;  1TT1 A;  4KFQ A;  1MRP A;  3K2D A;  3O2A A;  4FE8 A;  4P11 A;  1QKB A;  3T22 A;  4PE5 B;  1LCF A;  5CC2 A;  5DVF A;  4FAJ A;  5I2N A;  5EYF A;  4ZEF A;  3QAX A;  1I6B A;  1QUK A;  2H5Y A;  2XXW A;  5I57 A;  1MQI A;  2ONR A;  3G3G A;  3KSX A;  4QFN A;  4ONY A;  1M5D A;  1MY2 A;  2ONK E;  2RF1 A;  2Z22 A;  5EHS A;  3M3L A;  4GL8 A;  3SEW A;  1FCK A;  3HV1 A;  3KG2 A;  2H25 A;  4H8I A;  1TFA A;  3B6Q A;  1QUL A;  2O51 A;  3IJO B;  4G68 A;  4KYS A;  4O3C A;  1BLF A;  3SEX A;  5DYH A;  1HSL A;  4I62 A;  1MDP 1;  4H0W A;  3IX1 A;  3HCQ A;  2A5T A;  4OEN A;  1N84 A;  2OZZ A;  2XXP A;  3U93 A;  3UP9 A;  4Q8R A;  2BJJ X;  2XD2 A;  3KN7 A;  1A54 A;  2F97 A;  2XD3 A;  4TOZ A;  2XXT A;  2B3B A;  2DE2 A;  2F7B A;  2Z8D A;  3JZJ A;  4OFJ A;  1QJM A;  2Q2C A;  4MH5 A;  3MP8 A;  3LUY A;  1IXG A;  3E4R A;  1VE4 A;  2RCB A;  3P7I A;  1TFD A;  2PMS A;  4GQO A;  5H8N B;  4IO4 A;  1B3L A;  3K01 A;  4C0R A;  2ABH A;  3C36 A;  3G3H A;  4G68 B;  2V3Q A;  4DCX A;  4JDF A;  3B6T A;  2QMX A;  3U94 A;  2E0S A;  2PYY A;  5DT6 A;  3RT6 B;  1MH4 A;  4H67 A;  1MXV A;  2P1S A;  2O7U A;  1B5J A;  4POX A;  4Q30 B;  1XT8 A;  4QSD A;  3DP4 A;  4EQB A;  5BUU A;  5DVJ A;  1SW2 A;  3BKI B;  4JSO A;  1Y3P A;  3VXB A;  4YB5 A;  5K2X A;  1B7Z A;  1Z7N E;  3V89 B;  5I58 A;  3PMX A;  4ELQ A;  2HEU A;  4ESX A;  1UTB A;  3DP8 A;  3FJG A;  4NF8 B;  2NWJ A;  3PPN A;  1WOD A;  1FQD A;  4F18 A;  1R9Q A;  4ZEK A;  3TEL A;  2QSX A;  4YB7 A;  1US4 A;  3RN8 A;  4BDO A;  1SW5 A;  4OFO A;  1AIV A;  4H5F A;  2ALU A;  1LB8 A;  3LSW A;  3LSX A;  3MVZ A;  4FIM A;  1N0T A;  3DM0 A;  2FNC A;  2H9B A;  2HCA A;  1YCJ A;  2W7Y A;  1JNF A;  2DYX A;  1OLC A;  2OLB A;  3M3F A;  1PB9 A;  1YPN A;  4XKP A;  1A40 A;  1FQF A;  1Y4C A;  3T9H B;  2ZYK A;  3BFU A;  4DE8 A;  3S9N C;  2XXQ A;  5B7D A;  4QHQ A;  4EQ9 A;  4BDQ A;  4F1V A;  4X48 A;  4I8C A;  4YKP A;  5A5X A;  4G77 A;  1I6A A;  1PDA A;  1B3F A;  3IJX B;  2O6A A;  1P99 A;  4LON B;  4M4G A;  3TOD A;  1MH3 A;  4LUB A;  1QUJ A;  4OER A;  4Q5T A;  3TMG A;  3H7M A;  3S9E A;  1J1N A;  3KGC A;  1SI1 A;  2O1M A;  3OEN A;  3H06 B;  1GVC A;  3UA8 A;  2UXA A;  1NL5 A;  4RPO A;  1NNF A;  3N5L A;  4KPT A;  1XVX A;  1B2H A;  1EZO A;  3IOW A;  2OBG A;  3Q28 A;  4XKQ A;  4F31 B;  4G2Z A;  4FED A;  2ZMB A;  3UGW A;  3H4Z A;  1MPD A;  3CVG A;  3Q25 A;  4RXL A;  4OET A;  3ZKK A;  5DTB A;  2F7A A;  2DS9 A;  1KWH A;  2NVU B;  1MPB A;  4KR5 A;  2ZNT A;  3Q27 A;  1N04 A;  3JYR A;  4IO7 A;  4H65 A;  2OWS A;  1N3X A;  1PB7 A;  5L9O A;  2YJP A;  3OOA A;  2A5S A;  1EU8 A;  3SER A;  3C32 A;  4R72 A;  3V5A A;  1Y20 A;  3MP1 A;  1MY1 A;  2VOZ A;  3U8Q A;  2HFB A;  5CBS A;  4GWO A;  2KLF A;  1B5H A;  4MLV A;  3PUZ E;  3N6T A;  2P2A A;  4PFU A;  4QFK A;  3SES A;  3U92 A;  3HPI A;  1ATG A;  1UIU A;  4YMB A;  1IXH A;  4PFY A;  3C9H A;  4IB2 A;  3AXF A;  3HST A;  3MVY A;  3FUZ A;  5CRY A;  3TZA A;  3PV0 E;  5ICT A;  1HSE A;  2Y7R A;  1II5 A;  2GHB A;  3K1M A;  3MAM A;  4YKJ A;  3PPP A;  4NTL A;  4PP0 A;  4ESW A;  4E0X A;  1PB8 A;  1SBP A;  2H98 A;  3K0V A;  2FA7 A;  1N7X A;  3C4M A;  2RC8 A;  5FTI A;  3VLW A;  4FJP A;  4N07 A;  4OEU A;  3IO6 A;  1Y1Z A;  4EDP A;  1TWY A;  3QYT A;  3SEV A;  5H8F A;  1MQH A;  4THI A;  3W15 C;  4OMB A;  1OIB A;  1P1N A;  3MP6 A;  1B32 A;  5F7V A;  3FVK A;  5I59 A;  1SD3 A;  2DXR A;  1FTM A;  1VSO A;  2DQV A;  2UYE A;  3RY3 A;  4I9D A;  4NED A;  1D9V A;  3O6H A;  4H6D A;  4RK9 A;  5TU0 A;  1QKA A;  2V3U A;  4EUO A;  5IKB A;  1ZMG A;  1MY3 A;  4QFO A;  3S9L C;  2VD2 A;  3EHT A;  4MBP A;  5H8F B;  4DLD A;  1YAE A;  1SW4 A;  1MXX A;  2G29 A;  3MVX A;  3G3I A;  3OSR A;  5I84 A;  1I6Q A;  2Y7P A;  3BBR A;  4H5G A;  4OHN A;  5CMB A;  1IXI A;  3G3J A;  3SEY A;  4M1V A;  1Y3Q A;  1Q35 A;  2X26 A;  3A3U A;  3MVW A;  4QRZ A;  4YZZ A;  3RLF E;  2HAU A;  4GIZ A;  4AQ4 A;  1ZTY A;  2Y7W A;  3B6W A;  2R71 A;  4R9F A;  1UQW A;  2Q9T A;  2UVJ A;  2XXX A;  1R1N A;  3O6I A;  5FHN A;  2PVU A;  4JWY A;  4IO3 A;  1LAH E;  4HTG A;  1DSN A;  2XXR A;  5CI5 A;  5EHM A;  3T9U A;  3CR9 A;  3OO9 A;  2VP1 A;  3ZKL A;  3FVN A;  2XX8 A;  3PMV A;  3RQT A;  3KN8 A;  3TAJ A;  4ND9 A;  2O69 A;  3BFT A;  2F8D A;  1MXW A;  2NOO A;  1QW0 A;  1B58 A;  4POW A;  4UAC A;  5A5X B;  5FHM A;  4R9G A;  2I58 A;  3IR1 A;  4KYE A;  4MLQ A;  5HM4 B;  3N6U A;  2AL4 A;  3SEU A;  3UN6 A;  3TUS A;  1MY0 A;  3OMB A;  4OES A;  3R7X A;  1N7W A;  4G8M A;  4ELO A;  1LFI A;  4RJZ A;  4WEP A;  4IGT A;  3TTL A;  3CSB A;  4ISU A;  3MZB A;  4DXC A;  1Y1M A;  3VFJ A;  3D4C A;  3I3V A;  3FV1 A;  3FZV A;  3K1P A;  4DDD A;  3ECR A;  3E3K A;  4F1U A;  3H03 A;  4RPN A;  5FHO A;  3HO7 A;  4WKM A;  3DEL B;  3U1O A;  4ZED A;  5ICQ A;  3EHS A;  3EN3 A;  1UTB B;  4H8J A;  3IL1 B;  2GFE A;  1DOT A;  2RKM A;  5I58 B;  3B7D A;  3VE1 B;  3GBA A;  2QMW A;  5I2N B;  5KZT A;  1B5I A;  3OEL A;  1IZ1 A;  1JEV A;  3TDJ A;  4YKK A;  1ZBM A;  4BDN A;  5AA4 A;  3Q26 A;  4TQU Q;  2I3V A;  4EXK A;  3KZG A;  3SDF A;  5ELV A;  1OVB A;  1H43 A;  5AA1 A;  3QXM A;  3CIJ A;  1LST A;  1I69 A;  1OMP A;  4JXI A;  1N3W A;  3PUY E;  3TKD A;  1P1W A;  1NNK A;  3S9M C;  4GOT A;  3CSG A;  4NF4 B;  3K6X A;  3H6U A;  4U2R A;  1D3K A;  5ITO A;  3CRB A;  4HCY A;  3JV9 A;  1R9L A;  3A3C A;  4HCW A;  4LZ7 A;  3TTK A;  2I4B A;  1B4H A;  3MPK A;  5I2K A;  2REG A;  2P0S A;  3EQ1 A;  3LC8 A;  1SVX B;  1SI0 A;  1NFT A;  3IK6 B;  3C34 A;  4FOR A;  4GFR A;  3WAF A;  4EXL A;  3K6V A;  1JW4 A;  1NNP A;  2QPQ A;  4RY1 A;  4TLM B;  4NE4 A;  5DVI A;  1SW1 A;  4IY5 A;  3R6U A;  1LGB C;  1UIV A;  2Q88 A;  2LAO A;  1VR5 A;  3E9X A;  2ZNU A;  4N6P A;  5AA2 D;  5AA2 B;  1B0L A;  3FJ7 A;  3MW0 A;  4JWX A;  4R6K A;  1CB6 A;  1ZJL A;  4LQ2 A;  2V93 A;  4NF5 A;  3TTN A;  4U4X A;  4JWO A;  3THI A;  1L5T A;  3TFL A;  2F35 A;  3LR1 A;  1LFG A;  2DWI A;  1FQC A;  3RT8 A;  2VD3 A;  1NMU A;  1A8F A;  4YU0 A;  5M2V A;  4F3P A;  1GR2 A;  3GLB A;  3FVO A;  3VLU A;  1JVX A;  1A8E A;  3N94 A;  4QF9 A;  1LBB A;  1D9Y A;  1M5B A;  3MWB A;  3ODB A;  4QSE A;  4ZE8 A;  2I49 A;  3OO7 A;  5AA2 A;  4OYV A;  2DWH A;  3PPQ A;  1NNT A;  4R74 A;  2B3F A;  2QS4 A;  4RYA A;  5J1D A;  1XC1 A;  2Q89 A;  1O63 A;  2QS1 A;  2R6G E;  1IUD A;  3CFL A;  1WDN A;  1PEB A;  1OQH A;  5H8N A;  3PPO A;  3OEM A;  3TPA A;  4EF1 A;  1POT A;  1URS A;  2I4C A;  3QUF A;  4H1X A;  4QFP A;  2X7Q A;  5ITP A;  4OEV A;  2F36 A;  2Z8F A;  3RPW A;  1Q1K A;  5FTH A;  4OZ9 A;  1D4N A;  1ZU0 A;  3GXA A;  5I2K B;  1H76 A;  2O84 X;  3FVG A;  1O7T A;  2GRV A;  3OSQ A;  2FYI A;  2HZL A;  5I57 B;  2A5T B;  3C35 A;  1URG A;  3H6W A;  4XIG Q;  2QS2 A;  3LSF B;  1B51 A;  1IEJ A;  1NH7 A;  4L17 A;  5I59 B;  2DVC A;  2YLN A;  3K6W A;  1FTO A;  3IB0 A;  3IOR A;  4U4S A;  5CBR A;  3I6V A;  3MQ9 A;  3T9X B;  3G3F A;  4GL0 A;  5L8D A;  3OO8 A;  4QSC A;  1HSJ A;  2XX9 A;  3UOR A;  2I0C A;  2PT2 A;  1BIY A;  1DPP A;  2DWA A;  2XXH A;  1BKA A;  1B40 A;  1USY H;  1POY 1;  2ZYM A;  4YB6 A;  4ELP A;  4UA8 A;  3U72 A;  1FW0 A;  1O64 A;  2F78 A;  2PBW A;  2UVG A;  3M8U A;  4LZ8 A;  5L9M A;  3FAS A;  1MG1 A;  4IO5 A;  1B3H A;  5JTY B;  4F19 A;  1UTH A;  4WED A;  1PBQ A;  4EQ7 A;  1VFE A;  2I3W A;  2I6E A;  2D21 A;  4NWD A;  3RTF B;  3VVE A;  2Y7I A;  5HBC A;  4X1D A;  3RUM A;  1LAF E;  1QVS A;  3IB1 A;  2RIN A;  4IGR A;  3TTR A;  1LAX A;  4GXS B;  5KDT A;  2QJE A;  3IB2 A;  4F2O A;  3MZ9 A;  3K00 A;  2XXI A;  2ESN A;  4XKR A;  4LZ5 A;  3CI8 A;  2Q2A A;  4FAT A;  4ZE9 A;  2UYF A;  2OCU A;  1H45 A;  2WKY A;  5K2Y A;  4ZS9 A;  1FQB A;  4FEC A;  1LAG E;  4YAH X;  4R2B A;  2XXU A;  1NKX A;  2REJ A;  1DTZ A;  1MS7 A;  4NF8 A;  4BDR A;  4DZ1 A;  4HW8 A;  3CFZ A;  5KDT B;  1MXU A;  2OK2 A;  1ZKB A;  2AL5 A;  2V25 A;  3EF7 A;  4GLI A;  5H8H B;  1AMF A;  4EF2 A;  2F7C A;  4AB5 A;  2XX7 A;  5B70 A;  1AOV A;  1OLA A;  1GTK A;  1RYO A;  3PUV E;  4LAT A;  2H4I A;  2DP8 A;  3K02 A;  4IO6 A;  4OTE A;  3QSL A;  3SET A;  4F29 A;  1USY E;  1P1O A;  3FXU A;  1B0H A;  4R73 A;  4PQJ A;  1SQY A;  4X9T A;  2DSF A;  3OD7 A;  3DP6 A;  3OEK A;  4KCD A;  4ZDM A;  3PUW E;  3VVF A;  1SYH A;  3HN0 A;  2VHA A;  4F39 A;  1MPC A;  2RC7 A;  3OXN A;  3R26 A;  3TCG A;  2PT1 A;  4DXB A;  3PMW A;  1LB9 A;  4QFL A;  5JTY A;  3A09 A;  5CMC A;  4TLL B;  2QL3 A;  1PBP A;  3KBR A;  4GVO A;  3TQW A;  1OQG A;  1DTG A;  1Y4T A;  1JW5 A;  2V3T A;  2ZYO A;  3G7W A;  4OFL A;  2F6G A;  3PD8 A;  1T0K A;  3MBP A;  4N13 A;  3WAE A;  1MQG A;  2OWT A;  3FV2 A;  1A7L A;  4F1Y A;  3S4U A;  3EPE A;  3MJN A;  4OXV A;  3TCF A;  1YTV A;  1MXZ A;  4U23 A;  3PU5 A;  1EZ9 A;  1JVY A;  4G8H A;  4YKI A;  1AL3 A;  1LLS A;  5H8Q A;  3H3G A;  2Y7K A;  1EZP A;  5KCJ A;  2F34 A;  3LSL A;  3D4G A;  5L9S A;  3PUX E;  1ANF A;  1GV8 A;  3KJ7 A;  4LQ5 A;  3S2V A;  3T9V A;  2E1S A;  1F9B A;  4MF3 A;  3MC2 A;  2XHD A;  2Z8E A;  4G8N A;  4RA1 A;  4C1U A;  2VGQ A;  3H6T A;  4Z7E A;  1FTL A;  3L6G A;  3GBB A;  4OWD A;  2F6P A;  2HXW A;  3CG1 A;  3KOS A;  4GF8 A;  2RCA A;  2AYS A;  1XHY A;  4LA9 A;  4ZEI A;  1AH5 A;  3K4U A;  4LP2 B;  1B3E A;  4ZZE A;  1B7H A;  1M5E A;  5I56 A;  3KN3 A;  4GD5 A;  3TYH A;  1FQA A;  2UVI A;  2QS3 A;  4P0G A;  2DOJ A;  3CFX A;  1B3G A;  4F3B A;  1LBC A;  4P0I A;  1PC3 A;  2OJT A;  3IOV A;  3UIF A;  3EHU A;  4NMY A;  3V83 A;  4ZZA A;  2RC9 A;  2XXY A;  1IIW A;  1Y3N A;  2Z23 A;  3FAT A;  4YIC A;  5F1Q A;  4OQO A;  3GZG A;  3C31 A;  4DIG A;  5I56 B;  2H99 A;  4R75 A;  4R6Y A;  1ZIU A;  2R9J A;  4KQP A;  4NF5 B;  2GHA A;  2THI A;  1MQJ A;  3O97 A;  4X1B A;  1JQF A;  1SYI A;  3FIR A;  3IAZ A;  2I48 A;  4F2Q A;  1P1U A;  1SDX A;  1Z7M E;  2XXV A;  1UTH B;  5JK4 A;  3FXR A;  3RNN A;  3VV5 A;  4OVJ A;  2IA4 A;  3O6G A;  1OVT A;  3I5O A;  2DE3 A;  5TP9 B;  1BTJ A;  1B1H A;  3RTW B;  1NH8 A;  3MPL A;  5BWJ A;  1LFH A;  1RYX A;  5HPQ A;  5DEX A;  2ZYN A;  4Q0C A;  4XKN A;  3ILU B;  1MDQ A;  3IO4 A;  3M3K A;  4U22 A;  3O29 A;  3PPR A;  4WXJ A;  3Q29 A;  4K3F A;  1B05 A;  2O1L A;  5CM6 A;  1JEU A;  1CE2 A;  2ZXT A;  3KEI A;  4R2F A;  3T93 B;  1US5 A;  4HS7 A;  2G93 A;  2DVZ A;  1FQE A;  4U21 A;  5DEX B;  3CG3 A;  5AA4 B;  4IO2 A;  3T96 B;  3RGY A;  4U1O A;  5TP9 A;  1MXY A;  1XS5 A;  3ZS6 A;  4NF4 A;  2B65 A;  2X7P A;  2ZNS A;  1XOC A;  2CMO A;  2UVH A;  3H6V A;  4U1Z A;  3SKP A;  3DLN A;  5H8H A;  5TPA B;  2IEE A;  3TCH A;  4BDL A;  3VXC A;  1Y9U A;  2PX1 A;  3OO6 A;  4ECF A;  3KFM A;  4GRK A;  4NF6 B;  4F22 A;  3PD9 A;  1H3D A;  3HHF A;  1A55 A;  5KCJ B;  4NWC A;  3K6U A;  1B46 A;  4KI0 E;  4LVQ A;  4R6H A;  3TQL A;  4ZEB A;  2YPN A;  3VLV A;  1ZLQ A;  5AA3 A;  4RNS A;  1TXF A;  3HHG A;  4NF6 A;  3K1N A;  4G4P A;  2HQ0 A;  4I1D A;  3ZSF A;  1R6Z A;  2QRY A;  4JB7 A;  4G68 C;  1QUI A;  3UK4 A;  4F3S A;  4C1T A;  1B6H A;  2O68 A;  5H8S A;  1N76 A;  3KSJ A;  3FXQ A;  3MZ1 A;  1JET A;  2NXO A;  4KCC A;  3O66 A;  4MFI A;  2Y84 A;  1IIT A;  2ANJ A;  1S9T A;  2AIX A;  1A99 A;  1DPE A;  1MM7 A;  1FTJ A;  1XVY A;  1IQ7 A;  3KOT A;  3IOT A;  4O3B A;  4PFT A;  3T66 A;  3W9W A;  1DMB A;  3FD3 A;  5CMK A;  4JBZ A;  2CZL A;  3F11 A;  3LBS A;  2D5W A;  2ONS A;  4GXA A;  3MUQ A;  3L6H A;  4KYD A;  4DCY A;  4ELR A;  5ISU A;  2I0B A;  3VVD A;  2D3I A;  2DE4 A;  3IOU A;  1M5C A;  3PGF A;  4XXU A;  3USD A;  2V84 A;  1IXC A;  1M5F A;  4BLA A;  2NUV A;  3O9P A;  4XTC Q;  1B7U A;  3FGS A;  1ELJ A;  3TTM A;  4DXU A;  4IY6 A;  4F3G A;  1MQD A;  4Z0I A; 
#chains in the Genus database with same CATH topology
 3O28 A;  3C33 A;  3G3K A;  4PET A;  3QIM A;  2JJK A;  1B4Z A;  2Q8M A;  2F5X A;  3MST A;  2HAV A;  3FJM A;  1FTK A;  2M8C A;  5IAI A;  3KJT A;  5JEI A;  3ONM A;  3B50 A;  4QBA A;  4O3A A;  1URD A;  1TT1 A;  1LCF A;  5DVF A;  4FAJ A;  2XXW A;  1MQI A;  3KSX A;  5ET8 A;  4ONY A;  1MY2 A;  2ONK E;  4GL8 A;  3SEX A;  4I62 A;  4H0W A;  3U93 A;  2A5T A;  1N84 A;  4Q8R A;  2XXT A;  3MP8 A;  1VE4 A;  1TFD A;  4IO4 A;  5IZ1 A;  3E78 A;  2QMX A;  2PYY A;  3RT6 B;  2P1S A;  1B5J A;  3GYY A;  4EQB A;  5DVJ A;  1B7Z A;  3FJG A;  3PPN A;  1WOD A;  1US4 A;  4BDO A;  1SW5 A;  2ALU A;  1LB8 A;  1N0T A;  3DM0 A;  2H9B A;  2HCA A;  1JNF A;  3S9N C;  3BFU A;  2XXQ A;  4F1V A;  4EQ9 A;  4BDQ A;  4G77 A;  4LON B;  4M4G A;  4LUB A;  2O1M A;  1NNF A;  3N5L A;  4HE0 A;  1B2H A;  1EZO A;  3Q28 A;  4G2Z A;  3H4Z A;  4OET A;  1EYI A;  2DS9 A;  2NVU B;  1MPB A;  3Q27 A;  1N04 A;  2OWS A;  5L9O A;  2A5S A;  1EU8 A;  4R72 A;  1MY1 A;  1K9Y A;  5EYG A;  3N6T A;  3SES A;  4YMB A;  1HSE A;  4YKJ A;  2Y7R A;  4XFE A;  4PP0 A;  1N7X A;  2RC8 A;  4FJP A;  2WYK A;  1Y1Z A;  4EDP A;  4THI A;  4OMB A;  1P1N A;  5F7V A;  3FVK A;  1VSO A;  2DQV A;  4H6D A;  4RK9 A;  5TU0 A;  4EUO A;  2P3N A;  2VD2 A;  3EHT A;  4MBP A;  5H8F B;  4DLD A;  3OSR A;  1I6Q A;  2Y7P A;  5CMB A;  4YZZ A;  1Q35 A;  2HAU A;  1ZTY A;  4PFR A;  3O6I A;  4MCO A;  1DSN A;  2XA5 A;  2XXR A;  3T9U A;  3CR9 A;  3FVN A;  1FRP A;  2O69 A;  3B8B A;  3IR1 A;  2AL4 A;  3SEU A;  4WEP A;  4H45 A;  1Y1M A;  3VFJ A;  2XWI A;  4AS4 A;  3ECR A;  4WKM A;  1KA0 A;  3EHS A;  3EN3 A;  3IFA A;  3IL1 B;  2DDK A;  3VE1 B;  5I2N B;  2QMW A;  1INP A;  1JEV A;  3TDJ A;  4EXK A;  2ZZX A;  1NV7 A;  2F3B A;  3S9M C;  4MHF A;  3JV9 A;  4HCW A;  3MPK A;  1SVX B;  3C34 A;  4GFR A;  4EXL A;  4RY1 A;  1AWB A;  2ZNU A;  3MW0 A;  2F35 A;  1YZ0 A;  4NGU A;  1A8F A;  3VLU A;  1JVX A;  1A8E A;  1D9Y A;  1M5B A;  2QVV A;  3TPA A;  2I4C A;  4P8B A;  2WBB A;  2X7Q A;  4OEV A;  1Q1K A;  5I2K B;  1NV3 A;  2O84 X;  5ESY A;  5I5P A;  1B51 A;  5F24 A;  1NH7 A;  3K6W A;  3MQ9 A;  3G3F A;  3OO8 A;  2I0C A;  2PT2 A;  2DWA A;  1DPP A;  1BKA A;  1USY H;  2F78 A;  4LZ8 A;  4AS5 A;  4WED A;  2I3W A;  4NWD A;  3RUM A;  4MJO A;  3IB2 A;  3MZ9 A;  2XXI A;  2ESN A;  2OWZ A;  4LZ5 A;  4ZE9 A;  5I3S A;  1IMD A;  1DTZ A;  1MS7 A;  4NF8 A;  1ZKB A;  2V25 A;  1FBC A;  4AB5 A;  1OLA A;  5J16 A;  3PUV E;  4LAT A;  4PAI A;  1B0H A;  2DSF A;  3VVF A;  4KCD A;  3PUW E;  1SYH A;  2VHA A;  5A5L A;  2RC7 A;  3PMW A;  3A09 A;  4TLL B;  2QL3 A;  1PBP A;  4H46 A;  1DTG A;  3MBP A;  1MQG A;  2OWT A;  3FV2 A;  1MXZ A;  1AL3 A;  1LLS A;  1RDX A;  3H3G A;  1EZP A;  3LSL A;  1LBY A;  1GV8 A;  4LQ5 A;  3T9V A;  2XHD A;  4C1U A;  4N81 A;  2QVU A;  3GBB A;  4OWD A;  4GF8 A;  3LUZ A;  1NV6 A;  3KN3 A;  3TYH A;  2UVI A;  4P56 A;  3CFX A;  1PC3 A;  1FPG A;  2OJT A;  3UIF A;  1D9Q A;  1RDZ A;  4NMY A;  1Y3N A;  2Z23 A;  3FAT A;  4YIC A;  3C31 A;  4R75 A;  4R6Y A;  3T9H B;  2CEX A;  4F2Q A;  3O6G A;  2DE3 A;  1BTJ A;  1NH8 A;  1RYX A;  1MDQ A;  3IO4 A;  2ZZW A;  3KEI A;  4HS7 A;  2G93 A;  2DVZ A;  5DEX B;  3T96 B;  3ZS6 A;  4JVD A;  2CMO A;  4U1Z A;  5H8H A;  3VXC A;  1Y9U A;  4F22 A;  1B46 A;  2YPN A;  3VLV A;  4RNS A;  4NF6 A;  4G4P A;  3UK4 A;  4C1T A;  1B6H A;  3FXQ A;  3O66 A;  1S9T A;  1FTJ A;  1XVY A;  3T1B A;  3IOT A;  3MYU A;  4GX4 A;  3FD3 A;  4PF6 A;  4JBZ A;  5IZZ A;  3F11 A;  3LBS A;  2D5W A;  2ONS A;  4KYD A;  4OVR A;  1M5C A;  3USD A;  4XXU A;  4DXU A;  1ELJ A;  4IY6 A;  1MQD A;  3E13 X;  4KD5 A;  4MAG A;  3QUJ A;  1FTA A;  1RKM A;  4ZEC A;  5EQ8 A;  3N26 A;  3ILT B;  2HZK A;  1B9J A;  1EH3 A;  1LCT A;  1WVJ A;  1MY4 A;  2GH9 A;  4KHZ E;  1B1X A;  4I40 A;  1MRP A;  4X8R A;  4FE8 A;  1QKB A;  3T22 A;  5CC2 A;  5EYF A;  3QAX A;  1I6B A;  1QUK A;  4NG7 A;  5EHS A;  2RF1 A;  3IJO B;  2WBD A;  4G68 A;  4KYS A;  2PFZ A;  2OZZ A;  2XXP A;  2BJJ X;  2XD2 A;  3KN7 A;  4N6D A;  4TOZ A;  2DE2 A;  2Z8D A;  3JZJ A;  4OFJ A;  1QJM A;  2Q2C A;  3LUY A;  2PMS A;  5H8N B;  4NF0 A;  1LBZ A;  2KQZ A;  2E0S A;  5DT6 A;  1MH4 A;  1MXV A;  5BUU A;  1SW2 A;  4JSO A;  1Z7N E;  3V89 B;  2WX9 A;  3PTY A;  4GX3 A;  4ZEK A;  1AIV A;  4H5F A;  3KBZ A;  4GX6 A;  1NUZ A;  1SPI A;  5LOM A;  1YPN A;  4DE8 A;  2FHY A;  3A29 A;  4X48 A;  4YKP A;  1I6A A;  3TOD A;  3KGC A;  3H06 B;  1NL5 A;  4RPO A;  1K9Z A;  1IME A;  4HXV A;  3CVG A;  3Q25 A;  4NHB A;  4RXL A;  5EQ7 A;  2F7A A;  1KWH A;  4KR5 A;  2ZNT A;  3OOA A;  3SER A;  3C32 A;  3V5A A;  3MP1 A;  5CBS A;  4GWO A;  4PFU A;  4QFK A;  3C9H A;  4IB2 A;  5ICT A;  3TZA A;  3PPP A;  4NTL A;  4PBH A;  2H98 A;  2FA7 A;  4OEU A;  1TWY A;  3SEV A;  1MQH A;  3W15 C;  1OIB A;  1B32 A;  1SD3 A;  2UYE A;  1D9V A;  1ZMG A;  3S9L C;  1NV5 A;  1SW4 A;  3G3I A;  3BBR A;  3SEY A;  4OHN A;  1IXI A;  4M1V A;  1FSA A;  4N6K A;  5LDZ A;  2Y7W A;  3B6W A;  2R71 A;  1IMB A;  1UQW A;  3NOH A;  4IO3 A;  3U65 A;  4HTG A;  5CI5 A;  3LV0 A;  3OO9 A;  2XX8 A;  2WEF A;  3T0J A;  3PMV A;  3TAJ A;  4ND9 A;  2CZI A;  2F8D A;  1MXW A;  4UAC A;  1QW0 A;  1B58 A;  3SZP A;  4O7I A;  4R9G A;  4KYE A;  5EQ9 A;  5HM4 B;  3R7X A;  1N7W A;  4ELO A;  4X04 A;  4FBP A;  4IGT A;  3D4C A;  3HFU A;  3E3K A;  5FHO A;  3HO7 A;  3U1O A;  4GWZ A;  4ZED A;  1LBX A;  1UTB B;  4H8J A;  2GFE A;  1DOT A;  5KZT A;  3OEL A;  2I3V A;  3SDF A;  1I69 A;  3CSG A;  5ET5 A;  5ITO A;  3CRB A;  4HCY A;  2I4B A;  2REG A;  4FOR A;  4KXP A;  1JW4 A;  4NE4 A;  3R6U A;  1UIV A;  2Q88 A;  1VR5 A;  4N6P A;  5AA2 B;  1B0L A;  3FJ7 A;  3CHG A;  4LQ2 A;  2V93 A;  4NF5 A;  3TTN A;  4PAK A;  5DW8 A;  4JWO A;  2DWI A;  3RT8 A;  2VD3 A;  4YU0 A;  1FBH A;  1Q9D A;  3ODB A;  4ZE8 A;  4QSE A;  2I49 A;  4OYV A;  2DWH A;  3PPQ A;  1FBP A;  1FPF A;  1URS A;  4QFP A;  3RPW A;  2Z8F A;  4OZ9 A;  1D4N A;  1H76 A;  3EKI A;  3FVG A;  3OSQ A;  5I57 B;  3E79 A;  2FIE A;  5I59 B;  2YLN A;  1FTO A;  4U4S A;  4OA4 A;  4GL0 A;  5IZ3 B;  1HSJ A;  2XX9 A;  2ZYM A;  1POY 1;  4YB6 A;  4PDD A;  4UA8 A;  3U72 A;  3FAS A;  4IO5 A;  1DBZ A;  1PBQ A;  4EQ7 A;  3RTF B;  3VVE A;  5HBC A;  4X1D A;  1LAF E;  5KDT A;  2QJE A;  4MEV A;  4PE3 A;  3CI8 A;  2Q2A A;  1FQB A;  4FEC A;  4YAH X;  4R2B A;  1NKX A;  3CFZ A;  2AL5 A;  4EF2 A;  1AMF A;  4UAB A;  3IFC A;  4NQ8 A;  3SET A;  4IO6 A;  4OTE A;  4F29 A;  1P1O A;  4R73 A;  4X9T A;  3OEK A;  4F39 A;  3OXN A;  2PT1 A;  1LB9 A;  4HE2 A;  1OQG A;  2V3T A;  1Y4T A;  1JW5 A;  2ZYO A;  3PD8 A;  1A7L A;  3EPE A;  3MJN A;  1YTV A;  5EYH A;  3PU5 A;  1EZ9 A;  4YKI A;  5H8Q A;  5KCJ A;  3PUX E;  3S2V A;  2L5V A;  2Z8E A;  4G8N A;  3H6T A;  1FTL A;  3L6G A;  2F6P A;  4LA9 A;  1XHY A;  3K4U A;  2ZZV A;  1M5E A;  5I56 A;  1FQA A;  2QS3 A;  1NUY A;  1B3G A;  3IOV A;  2CZK A;  3V83 A;  2XXY A;  5F1Q A;  2H99 A;  2GHA A;  4P1L A;  4X1B A;  1JQF A;  1UTH B;  2QVR A;  2HPG A;  3I5O A;  1B1H A;  5HPQ A;  5DEX A;  2ZYN A;  4Q0C A;  4XKN A;  4U22 A;  3O29 A;  3PPR A;  3Q29 A;  1BK4 A;  4MNP A;  1FPB A;  4R2F A;  1US5 A;  3CG3 A;  1FPL A;  4NF4 A;  2X7P A;  2GQ1 A;  3SKP A;  5TPA B;  2IEE A;  2PX1 A;  4ECF A;  4N8Y A;  4NF6 B;  3PD9 A;  1H3D A;  1A55 A;  5KCJ B;  5LTC A;  3K6U A;  4R6H A;  4ZEB A;  1ZLQ A;  5AA3 A;  1TXF A;  3HHG A;  3BIG A;  1R6Z A;  2O68 A;  5H8S A;  3KSJ A;  4KCC A;  2QFL A;  1DMB A;  4DCY A;  4GXA A;  2I0B A;  3VVD A;  2D3I A;  2DE4 A;  4BLA A;  3PGF A;  1M5F A;  3O9P A;  4F3G A;  2O7I A;  1S50 A;  4OVP A;  5TPA A;  4RK2 A;  3W9V A;  5H8Q B;  3TEP A;  4FEB A;  4JSD A;  1MM6 A;  3QK6 A;  3VDF A;  4E0W A;  1JW1 A;  4KFQ A;  3O2A A;  3K2D A;  4PGP A;  1DK4 A;  2Y5K A;  3G3G A;  2Z22 A;  1IMA A;  1FCK A;  3HV1 A;  3KG2 A;  2H25 A;  4H8I A;  2B4M A;  3B6Q A;  1QUL A;  3RPL B;  2V4C A;  5DYH A;  1HSL A;  3IX1 A;  4O8M A;  3UP9 A;  1A54 A;  2F97 A;  4MH5 A;  3E4R A;  1NUX A;  4GQO A;  1NV1 A;  3K01 A;  2ABH A;  3C36 A;  4G68 B;  4DCX A;  4POX A;  1XT8 A;  3BKI B;  3FXB A;  3VXB A;  4YB5 A;  5I58 A;  3PMX A;  1UTB A;  4NF8 B;  1FQD A;  3TEL A;  4YB7 A;  3LSW A;  3MVZ A;  4FIM A;  2FNC A;  2DYX A;  1OLC A;  3M3F A;  4XKP A;  1Y4C A;  1FQF A;  2ZYK A;  2PCR A;  2O6A A;  1P99 A;  4OAN A;  1MH3 A;  1QUJ A;  4OER A;  4Q5T A;  3TMG A;  1J1N A;  3UA8 A;  1XVX A;  3IOW A;  4XKQ A;  2R8T A;  4FED A;  1MPD A;  1LBW A;  3ZKK A;  5DTB A;  4OVT A;  2B4L A;  4GWS A;  2YJP A;  1FBD A;  2HFB A;  2KLF A;  1IMF A;  3PUZ E;  2P2A A;  1ATG A;  3AXF A;  3PV0 E;  3MAM A;  1PB8 A;  3K0V A;  5FTI A;  3IO6 A;  4PCD A;  3QYT A;  5H8F A;  2Q74 A;  1FTM A;  4GWX A;  4I9D A;  2V3U A;  1YAE A;  1MXX A;  2G29 A;  3G3J A;  2X26 A;  4AQ4 A;  3RLF E;  4GIZ A;  2CEY A;  2Q9T A;  4R9F A;  2XXX A;  1R1N A;  1LEV A;  1LAH E;  4IR8 A;  4P1E A;  3RQT A;  3KN8 A;  2NOO A;  5A5X B;  4HE1 A;  5FHM A;  2I58 A;  4MLQ A;  3N6U A;  3TUS A;  1MY0 A;  4P9K A;  4RJZ A;  4ISU A;  3MZB A;  2VT5 A;  3K1P A;  4DDD A;  4F1U A;  4RPN A;  3DEL B;  3BIH A;  3B7D A;  3GBA A;  1B5I A;  1ZBM A;  4BDN A;  5AA4 A;  3Q26 A;  4TQU Q;  3KZG A;  1OVB A;  3CIJ A;  1LST A;  1OMP A;  4JXI A;  1N3W A;  3PUY E;  1P1W A;  4GOT A;  1D3K A;  4LZ7 A;  3A3C A;  3TTK A;  1B4H A;  3LC8 A;  2P0S A;  3IK6 B;  3WAF A;  2QPQ A;  4TLM B;  5DVI A;  1SW1 A;  2LAO A;  5AA2 D;  2F3D A;  3THI A;  3TFL A;  1LFG A;  4F3P A;  3FVO A;  1L5T A;  4QF9 A;  3MWB A;  5AA2 A;  2B3F A;  2QS4 A;  1O63 A;  2QS1 A;  3CFL A;  1IUD A;  1PEB A;  1OQH A;  5H8N A;  3OEM A;  1FBE A;  1POT A;  4PC9 A;  4H1X A;  4O7M A;  1ZU0 A;  3GXA A;  2GRV A;  1URG A;  2QS2 A;  2FIX A;  4L17 A;  2DVC A;  5CBR A;  3IOR A;  5EQA A;  3I6V A;  3T9X B;  5L8D A;  4QSC A;  1BIY A;  1B40 A;  4ELP A;  5L9M A;  1MG1 A;  1B3H A;  5JTY B;  3QMF A;  4N15 A;  1VFE A;  2I6E A;  2D21 A;  2Y7I A;  1QVS A;  3IB1 A;  4IGR A;  1LAX A;  4GXS B;  1FPK A;  4F2O A;  2OCU A;  1H45 A;  2WKY A;  2P3V A;  5K2Y A;  1LAG E;  2XXU A;  2REJ A;  4BDR A;  4DZ1 A;  5KDT B;  1MXU A;  4O94 A;  3RYD A;  4GLI A;  3EF7 A;  5H8H B;  1AOV A;  2F7C A;  5B70 A;  2OX3 A;  1GTK A;  1RYO A;  2H4I A;  3K02 A;  3QSL A;  4ZDM A;  4PQJ A;  3DP6 A;  4XF5 A;  1XI6 A;  3TCG A;  3R26 A;  4DXB A;  4P3L A;  4QFL A;  5JTY A;  3ISP A;  4GVO A;  3TQW A;  2F6G A;  4F1Y A;  4PBQ A;  4MMP A;  4MX6 A;  3TCF A;  1EYK A;  1JVY A;  2Y7K A;  2F34 A;  1NV0 A;  2E1S A;  3MC2 A;  4QXD A;  2HXW A;  3KOS A;  3CG1 A;  2RCA A;  2AYS A;  4LP2 B;  4GD5 A;  4P0G A;  2DOJ A;  4P0I A;  4ZZA A;  1IIW A;  4GWY A;  3GZG A;  5I56 B;  4DIG A;  1ZIU A;  4NAP A;  2THI A;  3O97 A;  3FIR A;  1EYJ A;  1P1U A;  1Z7M E;  2XXV A;  5JK4 A;  1CNQ A;  3FXR A;  3RNN A;  3VV5 A;  4OVJ A;  2IA4 A;  5TP9 B;  3ILU B;  4WXJ A;  1B05 A;  1JEU A;  1FQE A;  4U21 A;  3RGY A;  4U1O A;  1XS5 A;  2B65 A;  2ZNS A;  1XOC A;  3H6V A;  4NX1 A;  3DLN A;  4BDL A;  3OO6 A;  3KFM A;  4GBW A;  3HHF A;  4LVQ A;  3TQL A;  1FPE A;  1FJ9 A;  2QRY A;  4JB7 A;  1QUI A;  3ROJ A;  4MFI A;  1JET A;  2NXO A;  2ANJ A;  3KOT A;  1A99 A;  1MM7 A;  4PFT A;  3T66 A;  3MUQ A;  3L6H A;  5ISU A;  3IOU A;  1IXC A;  1NV4 A;  4XTC Q;  1B7U A;  4PFB A;  1P1Q A;  1B52 A;  1H44 A;  4PFW A;  2DWJ A;  1S7Y A;  1GGG A;  4YMA A;  5CMM A;  5AE4 A;  2Q8J A;  2DXY A;  4BDM A;  1FPJ A;  4AB6 A;  1VFD A;  5T3J A;  4OVS A;  3V8X B;  1BP5 A;  2HHM A;  5I7I A;  4P11 A;  4PE5 B;  5I2N A;  4ZEF A;  5I57 A;  2H5Y A;  2ONR A;  4QFN A;  1M5D A;  1IMC A;  3M3L A;  3SEW A;  1TFA A;  2O51 A;  4O3C A;  1BLF A;  1MDP 1;  3HCQ A;  4OEN A;  2XD3 A;  2B3B A;  2F7B A;  5IM2 A;  1IXG A;  3P7I A;  2RCB A;  1VDW A;  2Y5L A;  1B3L A;  4C0R A;  3G3H A;  2V3Q A;  4JDF A;  3B6T A;  1FBG A;  3U94 A;  4H67 A;  2O7U A;  4G61 A;  4Q30 B;  4QSD A;  3DP4 A;  1Y3P A;  5K2X A;  4ELQ A;  4N8G A;  2HEU A;  4ESX A;  3DP8 A;  1G0H A;  2NWJ A;  4PF8 A;  4F18 A;  1R9Q A;  2QSX A;  2XXK A;  4OFO A;  3LSX A;  2W7Y A;  1YCJ A;  2OLB A;  1FPD A;  1PB9 A;  1A40 A;  5B7D A;  4QHQ A;  1NI9 A;  4I8C A;  5A5X A;  1PDA A;  1B3F A;  3IJX B;  3H7M A;  3S9E A;  3OEN A;  1SI1 A;  1GVC A;  3D1R A;  5IZ3 A;  2UXA A;  4KPT A;  2OBG A;  4F31 B;  3UGW A;  2ZMB A;  4GWU A;  4DI4 B;  3JYR A;  4IO7 A;  4H65 A;  1N3X A;  1PB7 A;  4PTK A;  4PFI A;  1Y20 A;  3U8Q A;  2VOZ A;  4MLV A;  1B5H A;  3U92 A;  3HPI A;  1UIU A;  1IXH A;  4PFY A;  3MVY A;  3HST A;  5CRY A;  3FUZ A;  4LN5 A;  1II5 A;  1LBV A;  1NV2 A;  2GHB A;  3K1M A;  4ESW A;  4E0X A;  1FPI A;  1SBP A;  3C4M A;  2VPN A;  3VLW A;  4N07 A;  3MP6 A;  5I59 A;  2DXR A;  3RY3 A;  4NED A;  3O6H A;  5IKB A;  1QKA A;  1MY3 A;  4QFO A;  4GBV A;  3MVX A;  5I84 A;  4H5G A;  2HXR A;  1Y3Q A;  3A3U A;  4QRZ A;  3MVW A;  2UVJ A;  5FHN A;  2PVU A;  4JWY A;  5EHM A;  2VP1 A;  3ZKL A;  3BFT A;  4POW A;  2WYP A;  4N91 A;  3UN6 A;  2FVZ A;  3OMB A;  4G8M A;  1LFI A;  4NN3 A;  3TTL A;  3CSB A;  4DXC A;  3I3V A;  3FV1 A;  3FZV A;  3H03 A;  4GWW A;  4OVQ A;  1YXI A;  5ICQ A;  2RKM A;  5I58 B;  1IZ1 A;  1DCU A;  4YKK A;  5ELV A;  1H43 A;  2KR0 A;  5AA1 A;  3QXM A;  3TKD A;  2FBP A;  1NNK A;  4DI3 D;  4NF4 B;  3K6X A;  3H6U A;  2VPO A;  4U2R A;  4N4U A;  3WAE A;  5ET7 A;  1R9L A;  5I2K A;  3EQ1 A;  1SI0 A;  1NFT A;  3K6V A;  1NNP A;  4IY5 A;  1LGB C;  4PGN A;  3RPL A;  3E9X A;  4P47 A;  4JWX A;  4R6K A;  1CB6 A;  1ZJL A;  4U4X A;  2CZH A;  3LR1 A;  1FQC A;  1NMU A;  5M2V A;  1GR2 A;  3GLB A;  3N94 A;  1LBB A;  3OO7 A;  1NNT A;  4R74 A;  4RYA A;  5J1D A;  1XC1 A;  2Q89 A;  2R6G E;  1WDN A;  3PPO A;  4EF1 A;  3QUF A;  2XWV A;  5ITP A;  2F36 A;  5FTH A;  1O7T A;  2FYI A;  2HZL A;  2A5T B;  3C35 A;  3H6W A;  4XIG Q;  3LSF B;  1IEJ A;  3IB0 A;  3UOR A;  2XXH A;  1FW0 A;  1O64 A;  2PBW A;  2UVG A;  4I3Y A;  3M8U A;  1KZ8 A;  4F19 A;  3FBP A;  1UTH A;  2MKZ A;  3ZSF A;  3TTR A;  2RIN A;  4MNC A;  4XKR A;  3K00 A;  2XWK A;  4FAT A;  3KC0 A;  2UYF A;  4ZS9 A;  4HW8 A;  1FBF A;  2OK2 A;  2XX7 A;  1YYZ A;  2DP8 A;  1USY E;  3FXU A;  1NUW A;  1SQY A;  3OD7 A;  3HN0 A;  4PAF A;  5IGA A;  1MPC A;  5CMC A;  3KBR A;  4OFL A;  4I3E A;  1T0K A;  3G7W A;  4N13 A;  3S4U A;  4OXV A;  4PDH A;  1G0I A;  4U23 A;  4G8H A;  3D4G A;  5L9S A;  1KA1 A;  1ANF A;  3KJ7 A;  1F9B A;  4MF3 A;  4RA1 A;  2VGQ A;  5ET6 A;  4Z7E A;  3RN8 A;  4N17 A;  4ZEI A;  2BJI A;  1AH5 A;  1B3E A;  4ZZE A;  1B7H A;  1RDY A;  3KC1 A;  2XWO A;  1QGX A;  4F3B A;  1LBC A;  4MIJ A;  3EHU A;  2RC9 A;  4OQO A;  4NF5 B;  2R9J A;  4KQP A;  1MQJ A;  1SYI A;  3IAZ A;  2I48 A;  1SDX A;  1FJ6 A;  1OVT A;  3RTW B;  4JVC A;  3MPL A;  5BWJ A;  1LFH A;  5FBP A;  3M3K A;  4K3F A;  2O1L A;  4MNI A;  5CM6 A;  4XEQ A;  1CE2 A;  2ZXT A;  3T93 B;  5AA4 B;  4IO2 A;  5TP9 A;  1MXY A;  2UVH A;  3TCH A;  4JVI A;  4GRK A;  4NWC A;  4KI0 E;  3K1N A;  2HQ0 A;  4I1D A;  4G68 C;  1JP4 A;  4F3S A;  2PFY A;  1N76 A;  4OES A;  3MZ1 A;  2Y84 A;  1IIT A;  1DPE A;  2AIX A;  4O3B A;  1IQ7 A;  3W9W A;  5CMK A;  2CZL A;  4ELR A;  2V84 A;  2NUV A;  3FGS A;  3TTM A;  4Z0I A; 
#chains in the Genus database with same CATH homology
 1P1Q A;  1B52 A;  3E13 X;  1H44 A;  1S50 A;  2O7I A;  4KD5 A;  3O28 A;  4PFW A;  2DWJ A;  3C33 A;  3G3K A;  1S7Y A;  1GGG A;  3QUJ A;  4PET A;  5TPA A;  3QIM A;  4RK2 A;  3W9V A;  4YMA A;  1RKM A;  5CMM A;  4ZEC A;  1B4Z A;  2F5X A;  3N26 A;  5AE4 A;  2Q8J A;  3ILT B;  2DXY A;  4BDM A;  5H8Q B;  4AB6 A;  3TEP A;  2HZK A;  1VFD A;  1B9J A;  4FEB A;  4JSD A;  2HAV A;  5LOM A;  1EH3 A;  3FJM A;  1MM6 A;  1FTK A;  2M8C A;  3V8X B;  1LCT A;  5IAI A;  3KJT A;  5JEI A;  3QK6 A;  3ONM A;  3VDF A;  1WVJ A;  1MY4 A;  4E0W A;  2GH9 A;  4KHZ E;  1URD A;  1BP5 A;  4O3A A;  1B1X A;  1JW1 A;  1TT1 A;  4KFQ A;  1MRP A;  3K2D A;  3O2A A;  4FE8 A;  4P11 A;  1QKB A;  3T22 A;  4PE5 B;  1LCF A;  5CC2 A;  5DVF A;  4FAJ A;  5I2N A;  5EYF A;  4ZEF A;  3QAX A;  1I6B A;  1QUK A;  2H5Y A;  2XXW A;  5I57 A;  1MQI A;  2ONR A;  3G3G A;  3KSX A;  4QFN A;  4ONY A;  1M5D A;  1MY2 A;  2ONK E;  2RF1 A;  2Z22 A;  5EHS A;  3M3L A;  4GL8 A;  3SEW A;  1FCK A;  3HV1 A;  3KG2 A;  2H25 A;  4H8I A;  1TFA A;  3B6Q A;  1QUL A;  2O51 A;  3IJO B;  4G68 A;  4KYS A;  4O3C A;  1BLF A;  3SEX A;  5DYH A;  1HSL A;  4I62 A;  1MDP 1;  4H0W A;  3IX1 A;  3HCQ A;  2A5T A;  4OEN A;  1N84 A;  2OZZ A;  2XXP A;  3U93 A;  3UP9 A;  4Q8R A;  2BJJ X;  2XD2 A;  3KN7 A;  1A54 A;  2F97 A;  2XD3 A;  4TOZ A;  2XXT A;  2B3B A;  2DE2 A;  2F7B A;  2Z8D A;  3JZJ A;  4OFJ A;  1QJM A;  2Q2C A;  4MH5 A;  3MP8 A;  3LUY A;  1IXG A;  3E4R A;  1VE4 A;  2RCB A;  3P7I A;  1TFD A;  2PMS A;  4GQO A;  5H8N B;  4IO4 A;  1B3L A;  3K01 A;  4C0R A;  2ABH A;  3C36 A;  3G3H A;  4G68 B;  2V3Q A;  4DCX A;  4JDF A;  3B6T A;  2QMX A;  3U94 A;  2E0S A;  2PYY A;  5DT6 A;  3RT6 B;  1MH4 A;  4H67 A;  1MXV A;  2P1S A;  2O7U A;  1B5J A;  4POX A;  4Q30 B;  1XT8 A;  4QSD A;  3DP4 A;  4EQB A;  5BUU A;  5DVJ A;  1SW2 A;  3BKI B;  4JSO A;  1Y3P A;  3VXB A;  4YB5 A;  5K2X A;  1B7Z A;  1Z7N E;  3V89 B;  5I58 A;  3PMX A;  4ELQ A;  2HEU A;  4ESX A;  1UTB A;  3DP8 A;  3FJG A;  4NF8 B;  2NWJ A;  3PPN A;  1WOD A;  1FQD A;  4F18 A;  1R9Q A;  4ZEK A;  3TEL A;  2QSX A;  4YB7 A;  1US4 A;  3RN8 A;  4BDO A;  1SW5 A;  4OFO A;  1AIV A;  4H5F A;  2ALU A;  1LB8 A;  3LSW A;  3LSX A;  3MVZ A;  4FIM A;  1N0T A;  3DM0 A;  2FNC A;  2H9B A;  2HCA A;  1YCJ A;  2W7Y A;  1JNF A;  2DYX A;  1OLC A;  2OLB A;  3M3F A;  1PB9 A;  1YPN A;  4XKP A;  1A40 A;  1FQF A;  1Y4C A;  3T9H B;  2ZYK A;  3BFU A;  4DE8 A;  3S9N C;  2XXQ A;  5B7D A;  4QHQ A;  4EQ9 A;  4BDQ A;  4F1V A;  4X48 A;  4I8C A;  4YKP A;  5A5X A;  4G77 A;  1I6A A;  1PDA A;  1B3F A;  3IJX B;  2O6A A;  1P99 A;  4LON B;  4M4G A;  3TOD A;  1MH3 A;  4LUB A;  1QUJ A;  4OER A;  4Q5T A;  3TMG A;  3H7M A;  3S9E A;  1J1N A;  3KGC A;  1SI1 A;  2O1M A;  3OEN A;  3H06 B;  1GVC A;  3UA8 A;  2UXA A;  1NL5 A;  4RPO A;  1NNF A;  3N5L A;  4KPT A;  1XVX A;  1B2H A;  1EZO A;  3IOW A;  2OBG A;  3Q28 A;  4XKQ A;  4F31 B;  4G2Z A;  4FED A;  2ZMB A;  3UGW A;  3H4Z A;  1MPD A;  3CVG A;  3Q25 A;  4RXL A;  4OET A;  3ZKK A;  5DTB A;  2F7A A;  2DS9 A;  1KWH A;  2NVU B;  1MPB A;  4KR5 A;  2ZNT A;  3Q27 A;  1N04 A;  3JYR A;  4IO7 A;  4H65 A;  2OWS A;  1N3X A;  1PB7 A;  5L9O A;  2YJP A;  3OOA A;  2A5S A;  1EU8 A;  3SER A;  3C32 A;  4R72 A;  3V5A A;  1Y20 A;  3MP1 A;  1MY1 A;  2VOZ A;  3U8Q A;  2HFB A;  5CBS A;  4GWO A;  2KLF A;  1B5H A;  4MLV A;  3PUZ E;  3N6T A;  2P2A A;  4PFU A;  4QFK A;  3SES A;  3U92 A;  3HPI A;  1ATG A;  1UIU A;  4YMB A;  1IXH A;  4PFY A;  3C9H A;  4IB2 A;  3AXF A;  3HST A;  3MVY A;  3FUZ A;  5CRY A;  3TZA A;  3PV0 E;  5ICT A;  1HSE A;  2Y7R A;  1II5 A;  2GHB A;  3K1M A;  3MAM A;  4YKJ A;  3PPP A;  4NTL A;  4PP0 A;  4ESW A;  4E0X A;  1PB8 A;  1SBP A;  2H98 A;  3K0V A;  2FA7 A;  1N7X A;  3C4M A;  2RC8 A;  5FTI A;  3VLW A;  4FJP A;  4N07 A;  4OEU A;  3IO6 A;  1Y1Z A;  4EDP A;  1TWY A;  3QYT A;  3SEV A;  5H8F A;  1MQH A;  4THI A;  3W15 C;  4OMB A;  1OIB A;  1P1N A;  3MP6 A;  1B32 A;  5F7V A;  3FVK A;  5I59 A;  1SD3 A;  2DXR A;  1FTM A;  1VSO A;  2DQV A;  2UYE A;  3RY3 A;  4I9D A;  4NED A;  1D9V A;  3O6H A;  4H6D A;  4RK9 A;  5TU0 A;  1QKA A;  2V3U A;  4EUO A;  5IKB A;  1ZMG A;  1MY3 A;  4QFO A;  3S9L C;  2VD2 A;  3EHT A;  4MBP A;  5H8F B;  4DLD A;  1YAE A;  1SW4 A;  1MXX A;  2G29 A;  3MVX A;  3G3I A;  3OSR A;  5I84 A;  1I6Q A;  2Y7P A;  3BBR A;  4H5G A;  4OHN A;  5CMB A;  1IXI A;  3G3J A;  3SEY A;  4M1V A;  1Y3Q A;  1Q35 A;  2X26 A;  3A3U A;  3MVW A;  4QRZ A;  4YZZ A;  3RLF E;  2HAU A;  4GIZ A;  4AQ4 A;  1ZTY A;  2Y7W A;  3B6W A;  2R71 A;  4R9F A;  1UQW A;  2Q9T A;  2UVJ A;  2XXX A;  1R1N A;  3O6I A;  5FHN A;  2PVU A;  4JWY A;  4IO3 A;  1LAH E;  4HTG A;  1DSN A;  2XXR A;  5CI5 A;  5EHM A;  3T9U A;  3CR9 A;  3OO9 A;  2VP1 A;  3ZKL A;  3FVN A;  2XX8 A;  3PMV A;  3RQT A;  3KN8 A;  3TAJ A;  4ND9 A;  2O69 A;  3BFT A;  2F8D A;  1MXW A;  2NOO A;  1QW0 A;  1B58 A;  4POW A;  4UAC A;  5A5X B;  5FHM A;  4R9G A;  2I58 A;  3IR1 A;  4KYE A;  4MLQ A;  5HM4 B;  3N6U A;  2AL4 A;  3SEU A;  3UN6 A;  3TUS A;  1MY0 A;  3OMB A;  4OES A;  3R7X A;  1N7W A;  4G8M A;  4ELO A;  1LFI A;  4RJZ A;  4WEP A;  4IGT A;  3TTL A;  3CSB A;  4ISU A;  3MZB A;  4DXC A;  1Y1M A;  3VFJ A;  3D4C A;  3I3V A;  3FV1 A;  3FZV A;  3K1P A;  4DDD A;  3ECR A;  3E3K A;  4F1U A;  3H03 A;  4RPN A;  5FHO A;  3HO7 A;  4WKM A;  3DEL B;  3U1O A;  4ZED A;  5ICQ A;  3EHS A;  3EN3 A;  1UTB B;  4H8J A;  3IL1 B;  2GFE A;  1DOT A;  2RKM A;  5I58 B;  3B7D A;  3VE1 B;  3GBA A;  2QMW A;  5I2N B;  5KZT A;  1B5I A;  3OEL A;  1IZ1 A;  1JEV A;  3TDJ A;  4YKK A;  1ZBM A;  4BDN A;  5AA4 A;  3Q26 A;  4TQU Q;  2I3V A;  4EXK A;  3KZG A;  3SDF A;  5ELV A;  1OVB A;  1H43 A;  5AA1 A;  3QXM A;  3CIJ A;  1LST A;  1I69 A;  1OMP A;  4JXI A;  1N3W A;  3PUY E;  3TKD A;  1P1W A;  1NNK A;  3S9M C;  4GOT A;  3CSG A;  4NF4 B;  3K6X A;  3H6U A;  4U2R A;  1D3K A;  5ITO A;  3CRB A;  4HCY A;  3JV9 A;  1R9L A;  3A3C A;  4HCW A;  4LZ7 A;  3TTK A;  2I4B A;  1B4H A;  3MPK A;  5I2K A;  2REG A;  2P0S A;  3EQ1 A;  3LC8 A;  1SVX B;  1SI0 A;  1NFT A;  3IK6 B;  3C34 A;  4FOR A;  4GFR A;  3WAF A;  4EXL A;  3K6V A;  1JW4 A;  1NNP A;  2QPQ A;  4RY1 A;  4TLM B;  4NE4 A;  5DVI A;  1SW1 A;  4IY5 A;  3R6U A;  1LGB C;  1UIV A;  2Q88 A;  2LAO A;  1VR5 A;  3E9X A;  2ZNU A;  4N6P A;  5AA2 D;  5AA2 B;  1B0L A;  3FJ7 A;  3MW0 A;  4JWX A;  4R6K A;  1CB6 A;  1ZJL A;  4LQ2 A;  2V93 A;  4NF5 A;  3TTN A;  4U4X A;  4JWO A;  3THI A;  1L5T A;  3TFL A;  2F35 A;  3LR1 A;  1LFG A;  2DWI A;  1FQC A;  3RT8 A;  2VD3 A;  1NMU A;  1A8F A;  4YU0 A;  5M2V A;  4F3P A;  1GR2 A;  3GLB A;  3FVO A;  3VLU A;  1JVX A;  1A8E A;  3N94 A;  4QF9 A;  1LBB A;  1D9Y A;  1M5B A;  3MWB A;  3ODB A;  4QSE A;  4ZE8 A;  2I49 A;  3OO7 A;  5AA2 A;  4OYV A;  2DWH A;  3PPQ A;  1NNT A;  4R74 A;  2B3F A;  2QS4 A;  4RYA A;  5J1D A;  1XC1 A;  2Q89 A;  1O63 A;  2QS1 A;  2R6G E;  1IUD A;  3CFL A;  1WDN A;  1PEB A;  1OQH A;  5H8N A;  3PPO A;  3OEM A;  3TPA A;  4EF1 A;  1POT A;  1URS A;  2I4C A;  3QUF A;  4H1X A;  4QFP A;  2X7Q A;  5ITP A;  4OEV A;  2F36 A;  2Z8F A;  3RPW A;  1Q1K A;  5FTH A;  4OZ9 A;  1D4N A;  1ZU0 A;  3GXA A;  5I2K B;  1H76 A;  2O84 X;  3FVG A;  1O7T A;  2GRV A;  3OSQ A;  2FYI A;  2HZL A;  5I57 B;  2A5T B;  3C35 A;  1URG A;  3H6W A;  4XIG Q;  2QS2 A;  3LSF B;  1B51 A;  1IEJ A;  1NH7 A;  4L17 A;  5I59 B;  2DVC A;  2YLN A;  3K6W A;  1FTO A;  3IB0 A;  3IOR A;  4U4S A;  5CBR A;  3I6V A;  3MQ9 A;  3T9X B;  3G3F A;  4GL0 A;  5L8D A;  3OO8 A;  4QSC A;  1HSJ A;  2XX9 A;  3UOR A;  2I0C A;  2PT2 A;  1BIY A;  1DPP A;  2DWA A;  2XXH A;  1BKA A;  1B40 A;  1USY H;  1POY 1;  2ZYM A;  4YB6 A;  4ELP A;  4UA8 A;  3U72 A;  1FW0 A;  1O64 A;  2F78 A;  2PBW A;  2UVG A;  3M8U A;  4LZ8 A;  5L9M A;  3FAS A;  1MG1 A;  4IO5 A;  1B3H A;  5JTY B;  4F19 A;  1UTH A;  4WED A;  1PBQ A;  4EQ7 A;  1VFE A;  2I3W A;  2I6E A;  2D21 A;  4NWD A;  3RTF B;  3VVE A;  2Y7I A;  5HBC A;  4X1D A;  3RUM A;  1LAF E;  1QVS A;  3IB1 A;  2RIN A;  4IGR A;  3TTR A;  1LAX A;  4GXS B;  5KDT A;  2QJE A;  3IB2 A;  4F2O A;  3MZ9 A;  3K00 A;  2XXI A;  2ESN A;  4XKR A;  4LZ5 A;  3CI8 A;  2Q2A A;  4FAT A;  4ZE9 A;  2UYF A;  2OCU A;  1H45 A;  2WKY A;  5K2Y A;  4ZS9 A;  1FQB A;  4FEC A;  1LAG E;  4YAH X;  4R2B A;  2XXU A;  1NKX A;  2REJ A;  1DTZ A;  1MS7 A;  4NF8 A;  4BDR A;  4DZ1 A;  4HW8 A;  3CFZ A;  5KDT B;  1MXU A;  2OK2 A;  1ZKB A;  2AL5 A;  2V25 A;  3EF7 A;  4GLI A;  5H8H B;  1AMF A;  4EF2 A;  2F7C A;  4AB5 A;  2XX7 A;  5B70 A;  1AOV A;  1OLA A;  1GTK A;  1RYO A;  3PUV E;  4LAT A;  2H4I A;  2DP8 A;  3K02 A;  4IO6 A;  4OTE A;  3QSL A;  3SET A;  4F29 A;  1USY E;  1P1O A;  3FXU A;  1B0H A;  4R73 A;  4PQJ A;  1SQY A;  4X9T A;  2DSF A;  3OD7 A;  3DP6 A;  3OEK A;  4KCD A;  4ZDM A;  3PUW E;  3VVF A;  1SYH A;  3HN0 A;  2VHA A;  4F39 A;  1MPC A;  2RC7 A;  3OXN A;  3R26 A;  3TCG A;  2PT1 A;  4DXB A;  3PMW A;  1LB9 A;  4QFL A;  5JTY A;  3A09 A;  5CMC A;  4TLL B;  2QL3 A;  1PBP A;  3KBR A;  4GVO A;  3TQW A;  1OQG A;  1DTG A;  1Y4T A;  1JW5 A;  2V3T A;  2ZYO A;  3G7W A;  4OFL A;  2F6G A;  3PD8 A;  1T0K A;  3MBP A;  4N13 A;  3WAE A;  1MQG A;  2OWT A;  3FV2 A;  1A7L A;  4F1Y A;  3S4U A;  3EPE A;  3MJN A;  4OXV A;  3TCF A;  1YTV A;  1MXZ A;  4U23 A;  3PU5 A;  1EZ9 A;  1JVY A;  4G8H A;  4YKI A;  1AL3 A;  1LLS A;  5H8Q A;  3H3G A;  2Y7K A;  1EZP A;  5KCJ A;  2F34 A;  3LSL A;  3D4G A;  5L9S A;  3PUX E;  1ANF A;  1GV8 A;  3KJ7 A;  4LQ5 A;  3S2V A;  3T9V A;  2E1S A;  1F9B A;  4MF3 A;  3MC2 A;  2XHD A;  2Z8E A;  4G8N A;  4RA1 A;  4C1U A;  2VGQ A;  3H6T A;  4Z7E A;  1FTL A;  3L6G A;  3GBB A;  4OWD A;  2F6P A;  2HXW A;  3CG1 A;  3KOS A;  4GF8 A;  2RCA A;  2AYS A;  1XHY A;  4LA9 A;  4ZEI A;  1AH5 A;  3K4U A;  4LP2 B;  1B3E A;  4ZZE A;  1B7H A;  1M5E A;  5I56 A;  3KN3 A;  4GD5 A;  3TYH A;  1FQA A;  2UVI A;  2QS3 A;  4P0G A;  2DOJ A;  3CFX A;  1B3G A;  4F3B A;  1LBC A;  4P0I A;  1PC3 A;  2OJT A;  3IOV A;  3UIF A;  3EHU A;  4NMY A;  3V83 A;  4ZZA A;  2RC9 A;  2XXY A;  1IIW A;  1Y3N A;  2Z23 A;  3FAT A;  4YIC A;  5F1Q A;  4OQO A;  3GZG A;  3C31 A;  4DIG A;  5I56 B;  2H99 A;  4R75 A;  4R6Y A;  1ZIU A;  2R9J A;  4KQP A;  4NF5 B;  2GHA A;  2THI A;  1MQJ A;  3O97 A;  4X1B A;  1JQF A;  1SYI A;  3FIR A;  3IAZ A;  2I48 A;  4F2Q A;  1P1U A;  1SDX A;  1Z7M E;  2XXV A;  1UTH B;  5JK4 A;  3FXR A;  3RNN A;  3VV5 A;  4OVJ A;  2IA4 A;  3O6G A;  1OVT A;  3I5O A;  2DE3 A;  5TP9 B;  1BTJ A;  1B1H A;  3RTW B;  1NH8 A;  3MPL A;  5BWJ A;  1LFH A;  1RYX A;  5HPQ A;  5DEX A;  2ZYN A;  4Q0C A;  4XKN A;  3ILU B;  1MDQ A;  3IO4 A;  3M3K A;  4U22 A;  3O29 A;  3PPR A;  4WXJ A;  3Q29 A;  4K3F A;  1B05 A;  2O1L A;  5CM6 A;  1JEU A;  1CE2 A;  2ZXT A;  3KEI A;  4R2F A;  3T93 B;  1US5 A;  4HS7 A;  2G93 A;  2DVZ A;  1FQE A;  4U21 A;  5DEX B;  3CG3 A;  5AA4 B;  4IO2 A;  3T96 B;  3RGY A;  4U1O A;  5TP9 A;  1MXY A;  1XS5 A;  3ZS6 A;  4NF4 A;  2B65 A;  2X7P A;  2ZNS A;  1XOC A;  2CMO A;  2UVH A;  3H6V A;  4U1Z A;  3SKP A;  3DLN A;  5H8H A;  5TPA B;  2IEE A;  3TCH A;  4BDL A;  3VXC A;  1Y9U A;  2PX1 A;  3OO6 A;  4ECF A;  3KFM A;  4GRK A;  4NF6 B;  4F22 A;  3PD9 A;  1H3D A;  3HHF A;  1A55 A;  5KCJ B;  4NWC A;  3K6U A;  1B46 A;  4KI0 E;  4LVQ A;  4R6H A;  3TQL A;  4ZEB A;  2YPN A;  3VLV A;  1ZLQ A;  5AA3 A;  4RNS A;  1TXF A;  3HHG A;  4NF6 A;  3K1N A;  4G4P A;  2HQ0 A;  4I1D A;  3ZSF A;  1R6Z A;  2QRY A;  4JB7 A;  4G68 C;  1QUI A;  3UK4 A;  4F3S A;  4C1T A;  1B6H A;  2O68 A;  5H8S A;  1N76 A;  3KSJ A;  3FXQ A;  3MZ1 A;  1JET A;  2NXO A;  4KCC A;  3O66 A;  4MFI A;  2Y84 A;  1IIT A;  2ANJ A;  1S9T A;  2AIX A;  1A99 A;  1DPE A;  1MM7 A;  1FTJ A;  1XVY A;  1IQ7 A;  3KOT A;  3IOT A;  4O3B A;  4PFT A;  3T66 A;  3W9W A;  1DMB A;  3FD3 A;  5CMK A;  4JBZ A;  2CZL A;  3F11 A;  3LBS A;  2D5W A;  2ONS A;  4GXA A;  3MUQ A;  3L6H A;  4KYD A;  4DCY A;  4ELR A;  5ISU A;  2I0B A;  3VVD A;  2D3I A;  2DE4 A;  3IOU A;  1M5C A;  3PGF A;  4XXU A;  3USD A;  2V84 A;  1IXC A;  1M5F A;  4BLA A;  2NUV A;  3O9P A;  4XTC Q;  1B7U A;  3FGS A;  1ELJ A;  3TTM A;  4DXU A;  4IY6 A;  4F3G A;  1MQD A;  4Z0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...