4GXAA

Crystal structure of sulfate free form of cysb, a member of lysr family from salmonella typhimurium lt2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator CysB
publication title Crystal structure of Sulfate free form of CYSB, a member of LysR family from Salmonella typhimurium LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
molecule tags Gene regulation
total genus 61
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gxaA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gxaA02
3T9UA 4LP2B 1AH5A 1S9TA 4R74A 1IXCA 4EXKA 4N6PA 3I5OA 3R26A 4XIGQ 3OSRA 3FJGA 3MBPA 1NNFA 4F22A 2H25A 4KYDA 5H8NA 1B32A 4ZS9A 1MPDA 1MXZA 5IKBA 1B3HA 4E0XA 3OO8A 4F19A 3TPAA 1MQJA 5F7VA 2AL4A 2Q8JA 3KOTA 4KD5A 3OSQA 3G3GA 2FNCA 1A55A 2M8CA 5CMCA 5FHOA 1UTBB 1QUJA 2GH9A 4GD5A 2PT1A 1R1NA 2HFBA 1A54A 3TFLA 4OESA 3MVXA 5ITPA 3O9PA 2X7PA 1OIBA 4JDFA 1FQAA 3D4CA 1Y1ZA 2DWIA 1ZMGA 2O84X 4F2QA 2O51A 5CBSA 3KJ7A 3H03A 4BDLA 1M5DA 4Q8RA 4F18A 4QSDA 1D9YA 2O68A 3IO6A 4O3BA 1JVYA 3PU5A 3IB0A 3HV1A 4QSEA 3PUVE 2XXIA 3C32A 4Q5TA 3TAJA 2CMOA 1LCFA 5CRYA 4OEVA 4MH5A 3K6XA 4KYEA 1GGGA 4LZ5A 3ILUB 2PVUA 4G68A 1Y3NA 2LAOA 2R71A 4XKQA 1OQHA 1MY3A 3PUWE 4QFKA 3RLFE 5ICQA 2VGQA 3MAMA 1XC1A 4JWXA 1EU8A 1FQFA 1B6HA 1LAFE 2OBGA 1FTLA 4LONB 3TKDA 3W9VA 1MXXA 4KCCA 4KHZE 4PFWA 2OJTA 3QK6A 2XXHA 4U4XA 4YICA 4G8HA 5J1DA 3TTNA 4LQ2A 2RKMA 1MPBA 2ZNTA 4F1YA 1A40A 3RN8A 1P1OA 4GL8A 1KWHA 4ND9A 3TTLA 1MY0A 4I9DA 2OLBA 3CRBA 3IK6B 1N0TA 4EF1A 1A8EA 2I0BA 4R72A 5CMKA 4U21A 2NXOA 5AA3A 3BKIB 2HZKA 5EYFA 3FGSA 4JBZA 3MP6A 1CE2A 1B0LA 3S9LC 4RJZA 3THIA 5F1QA 3V5AA 4GXSB 4POWA 3PD9A 4R2FA 4FECA 1LLSA 1POY1 4XTCQ 2DOJA 2XXXA 1QUIA 4M4GA 5B70A 4F1UA 1XVXA 4UA8A 3U92A 1EZPA 4F31B 3U94A 3H6WA 5L9OA 4TLLB 3G3IA 5M2VA 2ZNSA 4I62A 2GHAA 4G68C 1SYHA 3GBAA 5L9MA 2ALUA 5ISUA 1SYIA 3QIMA 4R73A 2R6GE 3M3LA 3K6WA 2XX7A 3N6TA 4NF8A 1BKAA 1RYXA 1PDAA 4OYVA 4HCYA 1JVXA 5L8DA 1Q1KA 3RY3A 1R9QA 1TWYA 3VLVA 3FV1A 4JSOA 4Q0CA 4YZZA 3LBSA 3KFMA 4LA9A 4Z0IA 2DE4A 3RGYA 1B7ZA 5CI5A 5I57A 4OQOA 1MRPA 2V25A 3BFTA 1LFGA 4ZZAA 1SVXB 2OZZA 1LFHA 4XKNA 1XT8A 3TCHA 2AL5A 1Y4TA 4TLMB 5TP9B 2A5TA 3RNNA 1NH7A 4NTLA 1VSOA 3SESA 1B1HA 3ODBA 3IAZA 3VV5A 1VR5A 3D4GA 4GXAA 1DPPA 2REGA 2HAVA 2H99A 4P0GA 1TFDA 4YKKA 2V3TA 4R9FA 4GVOA 5H8HA 1FTOA 4C1TA 5DTBA 1II5A 3KN3A 4LUBA 2Y7KA 2G29A 4ZEBA 4ZEKA 1UIUA 3PD8A 1IQ7A 2Z8DA 5AA4B 1B2HA 3K1NA 1QW0A 1XHYA 4ECFA 3PUXE 1GR2A 2FYIA 3A3UA 1D3KA 4AB6A 5I59A 4ESWA 3PMWA 1I6QA 5I2NA 1B40A 4KCDA 1P1WA 4K3FA 4ONYA 4GLIA 1WDNA 4OMBA 3IX1A 4KYSA 2Y7IA 4EQ7A 2ZNUA 5HM4B 2THIA 5AA2B 3FVKA 4EDPA 3MPLA 2F97A 3KZGA 1LAHE 1B5JA 3I6VA 2VHAA 1MY4A 1P1NA 4JXIA 5H8QA 3EQ1A 2ESNA 4DXCA 5AA2D 3PPOA 5HBCA 4R9GA 2RCBA 3KN7A 4LZ8A 5FTIA 1GTKA 2G93A 1URGA 5DT6A 2XD2A 3CIJA 3KSXA 3B6TA 5L9SA 3FZVA 4X48A 3H4ZA 2PYYA 2QPQA 4RNSA 4BDMA 3O28A 3MVYA 2OWSA 2DVZA 3HPIA 3FXRA 3RTFB 3F11A 3UIFA 1IXGA 1SBPA 3OD7A 3SEVA 4P0IA 1BIYA 3IB1A 1JEVA 3VVEA 3G3KA 4Z7EA 4BDRA 3Q28A 1QVSA 3K0VA 4H0WA 5ELVA 3UK4A 4ESXA 3TEPA 1ZIUA 3T93B 1A8FA 4NF5A 2HAUA 2DSFA 3CG3A 5DEXB 1AIVA 1LBCA 3C4MA 4EQ9A 4H8IA 3IOUA 3VVDA 4IO3A 3UP9A 4OFOA 2XXYA 4YMAA 5JK4A 2H4IA 2GFEA 2PBWA 1FTKA 4ZEDA 4F3GA 1MM6A 1I6AA 4R6HA 3LUYA 5I2KA 4R6KA 1AMFA 4X9TA 1FQBA 3EHSA 2ABHA 2Z8FA 3PPNA 1UQWA 3QAXA 2XHDA 4F3BA 1MXWA 5AA1A 2ONSA 3M3FA 2HCAA 4R6YA 3IJOB 1XS5A 3MPKA 3FXUA 3C36A 1B4HA 1O63A 5H8NB 4ZZEA 3KG2A 4DCXA 1P1QA 3HHFA 3HHGA 1B5HA 3OENA 2HEUA 2P1SA 1YCJA 3RT6B 1PC3A 3O97A 3QXMA 1NH8A 2O6AA 1RKMA 2QS2A 1R9LA 4TOZA 3E3KA 4R75A 4F29A 1B5IA 3TZAA 3H3GA 3OEMA 3VLUA 4YB7A 1USYE 4FJPA 1DPEA 3QUFA 1M5FA 4NF4A 1FTJA 5TPAA 2IA4A 2XXRA 1IZ1A 1H3DA 2Z23A 4BDQA 4YB6A 3ONMA 1QULA 2QS4A 1LFIA 4YKPA 3BBRA 1T0KA 3PPQA 5TU0A 3C34A 3PMVA 4JSDA 2CZLA 4F2OA 5KCJA 1QKBA 4G68B 4E0WA 2YJPA 3IL1B 3TCGA 1LBBA 1XVYA 3C31A 3RQTA 4MLVA 3V8XB 2AIXA 2UYFA 3T9VA 4Q30B 2IEEA 4QFOA 5H8FA 1N3WA 1VFDA 2QJEA 4HW8A 3LSFB 1TFAA 2I4BA 1I6BA 1NFTA 1N7WA 2X7QA 2F34A 1MQDA 1SQYA 3CFLA 2ONRA 3KOSA 2DVCA 1PB8A 1LGBC 3W15C 5ITOA 1M5CA 1MQGA 2X26A 1IXIA 4OENA 4YMBA 1TXFA 4RY1A 1FCKA 4UACA 3T96B 4JWYA 4G4PA 2OCUA 4N13A 5KZTA 2QMXA 4FEDA 2XXVA 1SI0A 2O7UA 2F6GA 1I69A 1Y9UA 4PP0A 2A5SA 1JW4A 1OVTA 4ZEFA 4IO5A 5FTHA 5I84A 1S7YA 4EQBA 3FV2A 2NVUB 1Y4CA 5HPQA 5K2YA 1N04A 3HSTA 5KDTA 2UVHA 4U22A 3VLWA 3ILTB 1IXHA 4ELQA 2DE3A 5KDTB 1MQIA 4F3PA 1LSTA 3H06B 4PFUA 3PUZE 3L6GA 4QRZA 3DP4A 2XXQA 2DYXA 3IB2A 2F7CA 2ONKE 3OOAA 3IO4A 3OXNA 3CI8A 4KI0E 4L17A 4IO2A 2V84A 4MBPA 5EHSA 1MG1A 2PMSA 3KN8A 4P11A 1WODA 2QL3A 3SETA 1SD3A 4NF8B 1HSEA 3FXQA 2D21A 4ZE8A 3KEIA 4FEBA 3MW0A 4AB5A 3C9HA 4OETA 3SDFA 1WVJA 4WEPA 3UGWA 4U4SA 2ZMBA 1YPNA 4THIA 2Y7PA 5EHMA 4YAHX 4DDDA 3S9NC 4NWDA 1US5A 5I57B 2BJJX 3MZ9A 2GRVA 3T9XB 5A5XA 1O64A 2REJA 4LQ5A 2O69A 3SEYA 1YAEA 2RINA 3LC8A 3W9WA 5A5XB 1QKAA 2A5TB 1NMUA 1DTGA 1LAXA 3E9XA 1LAGE 1LB8A 4G77A 3G3FA 4GFRA 2ZXTA 3OO6A 5I58A 3S4UA 3GZGA 4G8NA 1VFEA 3FASA 2ZYOA 2XX9A 5H8HB 4DZ1A 1DSNA 1J1NA 4QHQA 3O6GA 1M5EA 3IORA 1H44A 3K6UA 2F78A 4H67A 4RK9A 4G8MA 2VD3A 3TUSA 3TELA 2DWAA 4IY6A 2RC9A 4X1DA 1B3GA 4QFNA 4GRKA 4ZE9A 3DLNA 3VVFA 2XXWA 3CSGA 1IUDA 4I8CA 5I59B 4N07A 3CG1A 1OQGA 1MY2A 4WXJA 5JTYA 4M1VA 5I2NB 1A99A 3M8UA 3SEUA 4IO6A 3V89B 3T9HB 1JW1A 4H6DA 1ZTYA 3KBRA 5BUUA 3RTWB 4C0RA 2NUVA 3VE1B 3EHTA 3ZKKA 4XXUA 3C35A 4XKRA 5H8QB 4RK2A 1OLAA 2FA7A 3FIRA 2H5YA 1OMPA 4NF6A 1PBPA 3G7WA 2VOZA 3OELA 4DE8A 1IITA 4U1OA 3U72A 2WKYA 2XXUA 2PX1A 4NEDA 2Q9TA 4OTEA 1ZKBA 1PB7A 3MZ1A 3KSJA 3PV0E 4F1VA 1TT1A 4QFLA 4FIMA 2W7YA 2B3FA 3G3JA 3KJTA 3TTMA 3MVZA 3Q26A 3SEXA 4GWOA 2UVGA 3LR1A 2O7IA 2B65A 3U8QA 1JEUA 3K6VA 2ANJA 4GQOA 4MLQA 3V83A 1H76A 2D3IA 3EF7A 3OEKA 3O66A 4GF8A 4R2BA 2AYSA 2I49A 4IGTA 5IAIA 5LOMA 1M5BA 5I56A 4NF5B 1ZBMA 3UN6A 2F6PA 1MXYA 3TTRA 3QUJA 3ZKLA 1NNTA 5B7DA 2QRYA 4FORA 1Y20A 1IIWA 5DYHA 3DP8A 4FATA 1SI1A 2F7BA 1SW2A 1BLFA 1B51A 1F9BA 3MWBA 1B1XA 3FJ7A 4NWCA 3FD3A 1OLCA 2DXYA 4OZ9A 4YKJA 5I2KB 2H98A 3I3VA 1D4NA 4RYAA 5BWJA 1DTZA 2QS3A 3E4RA 4F39A 1JNFA 1MDQA 3QSLA 4DCYA 3RUMA 3CFXA 2QS1A 1BP5A 4X1BA 3B6WA 2F8DA 3R7XA 4ISUA 3Q29A 4OFLA 1P1UA 3VXBA 1SW1A 2O1LA 1LCTA 3CVGA 1Y3PA 2Y7WA 1QJMA 4PE5B 2ZYKA 3SKPA 5K2XA 2V93A 1GV8A 1NNKA 2UVIA 2OK2A 3FVOA 3FVNA 1UTBA 4LZ7A 3O6IA 4F3SA 4QSCA 2ZYNA 3SEWA 3PPRA 4OHNA 1P99A 2DE2A 1OVBA 3QYTA 4H5FA 4FE8A 4YKIA 1YTVA 4ZECA 3IOTA 2HQ0A 4EXLA 3IOWA 4NF4B 1BTJA 1HSJA 5TPAB 3K4UA 1SDXA 4QFPA 2Z8EA 4H8JA 4EF2A 3WAFA 2P2AA 1DOTA 1FQCA 3CR9A 1NNPA 1EZ9A 2XD3A 4NMYA 3MZBA 1JETA 3VFJA 2DQVA 1ATGA 4BDOA 4RPNA 2D5WA 5KCJB 1N3XA 1PEBA 3DP6A 2GHBA 1Y3QA 3H7MA 2RF1A 3A3CA 3K01A 4OWDA 2PT2A 1MS7A 3B7DA 2Z22A 2Y7RA 3H6UA 4GIZA 2Q88A 5H8FB 4WKMA 4KPTA 1MXUA 1ANFA 1N7XA 3HCQA 4RXLA 2QMWA 2YLNA 3K1PA 3P7IA 4PQJA 1JQFA 3L6HA 2ZYMA 4O3AA 4GL0A 1L5TA 2I6EA 3RPWA 3Q25A 3S9MC 3VXCA 3IJXB 1S50A 1B05A 3OO9A 1FQDA 4LVQA 3TQWA 3WAEA 3LSLA 1MDP1 1B7HA 2I3WA 1MH4A 1USYH 1PB9A 2YPNA 2I0CA 3S2VA 1B9JA 4XKPA 4KR5A 2I58A 1N76A 1Z7ME 4U1ZA 4LATA 2E0SA 3DELB 5AE4A 3MVWA 4RA1A 1AL3A 2H9BA 1B0HA 4FAJA 4JB7A 3FVGA 4ZEIA 1B7UA 3TTKA 3K2DA 2R9JA 4POXA 4WEDA 4HS7A 2V3UA 4YU0A 3MC2A 1B3FA 2UVJA 3AXFA 3VDFA 3ZS6A 4DIGA 1B4ZA 3FUZA 3MQ9A 1ZJLA 5CMBA 1MPCA 3M3KA 2XXPA 5CMMA 2Q2AA 1DMBA 2DP8A 3ZSFA 2F5XA 3IOVA 3HO7A 5CBRA 3O2AA 3N5LA 1FTMA 4ELPA 1EZOA 3PUYE 1UTHA 2DS9A 4IY5A 1UTHB 4ELOA 2E1SA 2I3VA 1RYOA 3EPEA 3PGFA 5FHMA 4OVJA 1ZLQA 2F36A 3TYHA 1URSA 3SERA 1B58A 1NL5A 2VP1A 4TQUQ 1Q35A 5TP9A 1HSLA 4MFIA 2B3BA 2RC8A 1NKXA 5FHNA 3EHUA 3R6UA 4U23A 5DVJA 3N26A 3Q27A 2OWTA 3MUQA 3USDA 4MF3A 3FATA 3IR1A 1FQEA 1MY1A 3O6HA 2NOOA 3C33A 4QF9A 1A7LA 3ECRA 4OEUA 4EUOA 2DWHA 1B52A 4H5GA 4PFTA 3GBBA 1US4A 2HXWA 3OO7A 1O7TA 4KFQA 3S9EA 4DXUA 5I58B 3TCFA 1ZU0A 1B46A 3GXAA 2XX8A 4BDNA 2RC7A 5AA4A 3U93A 4U2RA 2Q89A 3H6VA 4IO7A 3UORA 4GOTA 3RT8A 4PETA 1MM7A 2UYEA 1IEJA 1MXVA 1B3LA 2KLFA 1POTA 1PBQA 5AA2A 3JV9A 5JTYB 2I4CA 4ZDMA 1CB6A 3BFUA 3G3HA 2XXTA 3B6QA 3K00A 4C1UA 3LSWA 3OMBA 3PMXA 1XOCA 2Y84A 1H43A 5DVFA 1N84A 4I1DA 4OERA 2HZLA 3JYRA 1MH3A 4IO4A 4ELRA 1D9VA 3GLBA 1URDA 3U1OA 2F35A 4IB2A 2QSXA 1ELJA 2Q2CA 3T22A 1SW5A 4NF6B 2DXRA 1MQHA 3H6TA 1Z7NE 1B3EA 1JW5A 5CM6A 1AOVA 3TQLA 3KGCA 3CSBA 2VD2A 4HTGA 3PPPA 2P0SA 1VE4A 2UXAA 1UIVA 2F7AA 4G2ZA 5H8SA 4AQ4A 1LB9A 4H65A 3JZJA 4OXVA 3E13X 1H45A 1Y1MA 3TDJA 3K1MA 1SW4A 4DLDA 4YB5A 3FJMA 3TODA 5CC2A 3N6UA 2O1MA 4OFJA 3N94A 3UA8A 3O29A 1EH3A 3MP1A 4JWOA 2I48A 5JEIA 1R6ZA 1GVCA 3CFZA 5DEXA 3T66A 4IGRA 3TMGA 4H1XA 4KQPA 4NE4A 4RPOA 5ICTA 4DXBA 5I56B 3HN0A 1QUKA 2V3QA 2NWJA 1FW0A 5DVIA 4O3CA 3MP8A 4PFYA 3EN3A 4HCWA 3LSXA 2DWJA 3MJNA 4BLAA 3DM0A 3A09A 3K02A 2RCAA
chains in the Genus database with same CATH superfamily
5EYGA 3T9UA 4LP2B 1AH5A 1S9TA 4N8GA 4R74A 1IXCA 4EXKA 4N6PA 3I5OA 4OVQA 3R26A 4XIGQ 2Y5KA 3OSRA 3FJGA 3MBPA 1NNFA 3PTYA 4F22A 2H25A 4KYDA 5H8NA 1B32A 4JVIA 4ZS9A 1MPDA 1MXZA 4PAKA 5IKBA 4OVRA 4PAIA 1B3HA 4E0XA 3OO8A 5T3JA 4F19A 3TPAA 1MQJA 5F7VA 2AL4A 2Q8JA 1YZ0A 3KOTA 4P8BA 4KD5A 3GYYA 3OSQA 2FVZA 5ET6A 2HHMA 3G3GA 2FNCA 1A55A 2M8CA 5CMCA 4I3YA 5FHOA 1UTBB 1QUJA 2GH9A 4GD5A 1Q9DA 2PT1A 1R1NA 2HFBA 1A54A 3TFLA 4OESA 1RDZA 3MVXA 5ITPA 1DCUA 3O9PA 2X7PA 2CZKA 1OIBA 4JDFA 3KC1A 2XA5A 1FQAA 3D4CA 1Y1ZA 2GQ1A 2DWIA 1ZMGA 2O84X 4F2QA 2O51A 1FJ9A 5CBSA 3KJ7A 3H03A 4BDLA 1M5DA 2CEXA 4Q8RA 2XWOA 4F18A 4QSDA 1D9YA 2O68A 3IO6A 4O3BA 1JVYA 2CZHA 3PU5A 3IB0A 3HV1A 4QSEA 3PUVE 2XXIA 2PCRA 3C32A 4Q5TA 3TAJA 2CMOA 1LCFA 5CRYA 4OEVA 4GX6A 1FPIA 4MH5A 3K6XA 4KYEA 1GGGA 4LZ5A 3ILUB 2PVUA 4G68A 1Y3NA 2LAOA 2R71A 4XKQA 1OQHA 1MY3A 3PUWE 5EQ8A 4QFKA 4JVCA 3NOHA 3RLFE 5ICQA 2VGQA 3MAMA 1XC1A 1LBZA 4JWXA 3T1BA 5EQAA 1EU8A 1FQFA 1B6HA 1LAFE 2OBGA 2R8TA 1FTLA 4MMPA 4LONB 1FTAA 3TKDA 1NV6A 3W9VA 1MXXA 4KCCA 4KHZE 4PFWA 2OJTA 3QK6A 2XXHA 4U4XA 4YICA 4G8HA 5J1DA 4N91A 3TTNA 4LQ2A 2Q74A 2RKMA 1MPBA 2ZNTA 4F1YA 1A40A 3RN8A 1P1OA 4GL8A 1KWHA 4ND9A 3TTLA 1MY0A 4I9DA 2OLBA 3CRBA 3IK6B 1N0TA 4EF1A 1A8EA 2I0BA 4R72A 5CMKA 4U21A 2NXOA 5AA3A 3BKIB 2FIEA 2HZKA 5EYFA 5LDZA 3FGSA 4JBZA 3MP6A 1CE2A 4GWXA 4MNIA 1B0LA 3S9LC 4RJZA 3THIA 5F1QA 2ZZXA 3V5AA 4GXSB 4POWA 3PD9A 4R2FA 4FECA 1LLSA 1POY1 3KC0A 4XTCQ 2WBDA 2DOJA 4N15A 2XXXA 1QUIA 4M4GA 5B70A 4F1UA 1XVXA 4N81A 2HPGA 4UA8A 3U92A 5I5PA 1EZPA 4F31B 3U94A 3H6WA 2P3NA 5ET7A 5L9OA 4TLLB 3G3IA 5M2VA 2ZNSA 4I62A 2GHAA 4G68C 1NUZA 1SYHA 3GBAA 5I7IA 5L9MA 2ALUA 5IZ3A 5ISUA 1SYIA 3QIMA 4R73A 2R6GE 3M3LA 4OVSA 3K6WA 2XX7A 1FPFA 3N6TA 4NF8A 1BKAA 1RYXA 1PDAA 4OYVA 4HCYA 1JVXA 5L8DA 1Q1KA 3RY3A 1R9QA 4MNPA 5I3SA 1TWYA 3VLVA 3FV1A 4PDHA 4JSOA 4MEVA 4Q0CA 4YZZA 3LBSA 3KFMA 5ET8A 4LA9A 4Z0IA 2DE4A 3RGYA 1B7ZA 5CI5A 5I57A 4OQOA 1LBWA 1MRPA 2V25A 3BFTA 1LFGA 4ZZAA 1SVXB 2OZZA 1LFHA 4XKNA 1XT8A 3TCHA 2WEFA 2AL5A 1Y4TA 4TLMB 5TP9B 2A5TA 3SZPA 3RNNA 1NH7A 4NTLA 1VSOA 3SESA 1B1HA 3ODBA 4H45A 2B4LA 3IAZA 3VV5A 2FBPA 1VR5A 3D4GA 4GXAA 1DPPA 2REGA 2HAVA 2H99A 4P0GA 1TFDA 4YKKA 4PBQA 2V3TA 4R9FA 4GVOA 5H8HA 1FTOA 2FHYA 4C1TA 5DTBA 1II5A 3KN3A 4LUBA 2Y7KA 2G29A 4ZEBA 4ZEKA 1UIUA 3PD8A 1IQ7A 2Z8DA 5AA4B 1B2HA 3K1NA 4N6KA 1QW0A 1XHYA 4ECFA 3PUXE 1GR2A 1NV0A 2FYIA 3A3UA 1D3KA 4AB6A 5I59A 4ESWA 3PMWA 1I6QA 5I2NA 1B40A 4KCDA 1P1WA 1FJ6A 4K3FA 4ONYA 4N17A 4GLIA 1WDNA 4OMBA 3IX1A 4KYSA 2Y7IA 4EQ7A 2ZNUA 4HE0A 5HM4B 2THIA 5AA2B 3FVKA 4EDPA 3MPLA 4NG7A 2F97A 3KZGA 1LAHE 1B5JA 1FPKA 3I6VA 4JVDA 2VHAA 1MY4A 1P1NA 4JXIA 5H8QA 3EQ1A 3RPLA 2ESNA 5FBPA 4DXCA 5AA2D 3PPOA 5HBCA 4R9GA 2RCBA 3KN7A 4LZ8A 5FTIA 4N6DA 1GTKA 2G93A 4UABA 1URGA 5DT6A 2XD2A 3CIJA 3KSXA 3B6TA 5L9SA 3FZVA 4X48A 3H4ZA 2PYYA 2KQZA 2JJKA 2QPQA 4RNSA 5EQ7A 4BDMA 3O28A 2QVUA 3MVYA 2OWSA 2DVZA 3HPIA 3FXRA 3RTFB 3F11A 1FBGA 3UIFA 1JP4A 1IXGA 1SBPA 3OD7A 2L5VA 3SEVA 4P0IA 1BIYA 3IB1A 1JEVA 3VVEA 3G3KA 4Z7EA 4BDRA 1BK4A 3Q28A 1QVSA 1FSAA 3K0VA 4H0WA 5ELVA 4MAGA 3UK4A 4ESXA 3TEPA 1ZIUA 3T93B 1A8FA 4NF5A 4PDDA 3MSTA 2HAUA 2DSFA 3CG3A 5DEXB 1AIVA 1LBCA 3LUZA 3FXBA 3C4MA 4EQ9A 4H8IA 3IOUA 4XFEA 3VVDA 4IO3A 3UP9A 4OFOA 1FBFA 4PGPA 4GBVA 2XXYA 4YMAA 5JK4A 2H4IA 2GFEA 2PBWA 4PF6A 1FTKA 4F3GA 4ZEDA 1MM6A 1I6AA 4R6HA 3E79A 3LUYA 5I2KA 4R6KA 1AMFA 4X9TA 1FQBA 3EHSA 2ABHA 2Z8FA 3PPNA 1UQWA 3QAXA 2XHDA 4F3BA 1FPBA 1MXWA 5AA1A 2ONSA 1NV2A 4PFIA 3M3FA 2HCAA 3B50A 2OWZA 4R6YA 1LBYA 3IJOB 1XS5A 3MPKA 3FXUA 3C36A 1B4HA 1O63A 5H8NB 4ZZEA 3KG2A 4DCXA 1P1QA 3HHFA 4GWWA 4NAPA 3HHGA 1B5HA 3OENA 2HEUA 2P1SA 1YCJA 3RT6B 1PC3A 3O97A 3QXMA 2XXKA 1NH8A 5EYHA 2O6AA 1RKMA 2QFLA 2QS2A 4X8RA 1R9LA 1EYJA 3E3KA 4TOZA 4I3EA 4R75A 4F29A 1B5IA 4KXPA 3TZAA 5A5LA 3H3GA 3OEMA 2QVRA 3VLUA 4YB7A 1DBZA 1USYE 4FJPA 2ZZVA 1DPEA 3QUFA 4O7IA 5ESYA 1M5FA 4NX1A 4NF4A 1FTJA 3T0JA 5TPAA 2VT5A 2IA4A 2XXRA 1IZ1A 4AS5A 1H3DA 2Z23A 3FBPA 4BDQA 1NV5A 4YB6A 3ONMA 1QULA 2QS4A 1LFIA 4YKPA 3BBRA 1T0KA 3PPQA 5TU0A 2PFYA 3C34A 3PMVA 4JSDA 1FPEA 2CZLA 4OVPA 4F2OA 5KCJA 1QKBA 3A29A 4G68B 1QGXA 3LV0A 4E0WA 3ISPA 2YJPA 3IL1B 3TCGA 1LBBA 4P1EA 1XVYA 3C31A 3RQTA 4P56A 4MLVA 3V8XB 2AIXA 2UYFA 1AWBA 3T9VA 4Q30B 2IEEA 4QFOA 5H8FA 1N3WA 1VFDA 2QJEA 4HW8A 4PFBA 3LSFB 1TFAA 2I4BA 1I6BA 1NFTA 1N7WA 4GWUA 2X7QA 2F34A 1MQDA 1SQYA 3CFLA 2ONRA 4GWZA 3KOSA 2DVCA 1PB8A 1LGBC 4GX4A 3W15C 5ITOA 1M5CA 4P9KA 1MQGA 2X26A 1IXIA 4PCDA 4GWSA 4OENA 4YMBA 1TXFA 4RY1A 1FCKA 1EYKA 2QVVA 4UACA 3T96B 4JWYA 4PC9A 4G4PA 2OCUA 4N13A 5KZTA 5IM2A 2QMXA 4FEDA 2XXVA 1SI0A 2O7UA 2F6GA 1I69A 4N4UA 1Y9UA 4PP0A 2A5SA 1JW4A 5J16A 1OVTA 4ZEFA 4IO5A 5FTHA 5I84A 1S7YA 4EQBA 3FV2A 2NVUB 1Y4CA 5HPQA 5K2YA 1N04A 3HSTA 5KDTA 2UVHA 4U22A 3IFCA 3VLWA 3ILTB 1IXHA 4ELQA 2DE3A 5KDTB 1MQIA 4F3PA 1LSTA 3H06B 4PFUA 3PUZE 3L6GA 4QRZA 3DP4A 2XXQA 2DDKA 2DYXA 3IB2A 2F7CA 2ONKE 5IZ3B 3OOAA 3IO4A 3OXNA 3CI8A 4KI0E 4L17A 4IO2A 2V84A 4HE2A 4MBPA 5EHSA 1MG1A 4O94A 2PMSA 3KN8A 4P11A 1WODA 2KR0A 2QL3A 3SETA 1SD3A 4NF8B 1INPA 1HSEA 3FXQA 2D21A 4ZE8A 3KEIA 4FEBA 3MW0A 4AB5A 3C9HA 4OETA 3SDFA 1FPDA 1WVJA 4WEPA 3UGWA 2VPOA 2CZIA 4U4SA 2ZMBA 1YPNA 4THIA 1YXIA 3U65A 2Y7PA 5EHMA 4YAHX 4DDDA 3S9NC 4NWDA 1US5A 5I57B 2BJJX 3MZ9A 2GRVA 3T9XB 5A5XA 1O64A 2REJA 4LQ5A 2O69A 3SEYA 1YAEA 2RINA 3LC8A 1RDXA 3W9WA 5A5XB 1QKAA 2A5TB 1NMUA 4GX3A 1DTGA 1LAXA 3E9XA 1LAGE 1LB8A 1NV7A 4G77A 3G3FA 4GFRA 2ZXTA 3OO6A 5I58A 3S4UA 3GZGA 4G8NA 1VFEA 3FASA 2ZYOA 1NUYA 2XX9A 5H8HB 4DZ1A 1DSNA 1J1NA 4QHQA 1KZ8A 3O6GA 1M5EA 3IORA 4PE3A 1H44A 5LTCA 3K6UA 2F78A 4H67A 4RK9A 4G8MA 2WBBA 2VD3A 3TUSA 3TELA 2DWAA 1IMAA 4IY6A 2RC9A 4X1DA 1B3GA 4QFNA 4GRKA 4ZE9A 3DLNA 4OA4A 2Y5LA 3VVFA 2XXWA 4NHBA 3CSGA 1IUDA 4I8CA 4PBHA 5I59B 4N07A 3CG1A 1OQGA 1MY2A 4WXJA 5JTYA 4M1VA 5I2NB 1A99A 3M8UA 3SEUA 4IO6A 4DI3D 3V89B 3T9HB 1NV4A 1JW1A 2XWKA 4H6DA 1ZTYA 3KBRA 5BUUA 3RTWB 4C0RA 4GWYA 1D9QA 2NUVA 3VE1B 3EHTA 3ZKKA 4XXUA 3C35A 4XKRA 5H8QB 1IMFA 4RK2A 3RPLB 4H46A 1OLAA 2FA7A 3FIRA 2H5YA 1OMPA 4NF6A 1PBPA 3G7WA 2VOZA 3OELA 4DE8A 4X04A 1IITA 4U1OA 3U72A 5F24A 2WKYA 2XXUA 2PX1A 4NEDA 2Q9TA 4OTEA 1ZKBA 1PB7A 1NV3A 3EKIA 3MZ1A 3KSJA 3PV0E 4F1VA 1TT1A 4QFLA 2WYKA 1FPJA 4FIMA 1EYIA 2W7YA 2B3FA 3G3JA 3KJTA 3TTMA 1IMCA 3MVZA 3Q26A 3SEXA 4GWOA 4XF5A 2UVGA 3HFUA 3LR1A 2O7IA 2B65A 3U8QA 5ET5A 3BIHA 1IMDA 1JEUA 3K6VA 2MKZA 2ANJA 4GQOA 1FRPA 4I40A 4MLQA 2B4MA 3V83A 1H76A 2D3IA 3EF7A 4OANA 3OEKA 3O66A 4GF8A 1G0IA 4R2BA 2AYSA 2I49A 4IGTA 5IAIA 1LBVA 5LOMA 1M5BA 5I56A 4NF5B 1ZBMA 3UN6A 2F6PA 1MXYA 4OVTA 3TTRA 3QUJA 3ZKLA 1NNTA 1RDYA 5B7DA 2QRYA 4FORA 4NN3A 4PAFA 1Y20A 1IIWA 5DYHA 3DP8A 4FATA 1SI1A 2F7BA 1SW2A 4QBAA 4MNCA 1FBHA 1BLFA 1B51A 1YYZA 1F9BA 4P47A 3MWBA 1B1XA 3FJ7A 4NWCA 1NUXA 3FD3A 1OLCA 4QXDA 2DXYA 4OZ9A 4MCOA 4YKJA 5I2KB 2H98A 3I3VA 1D4NA 4RYAA 4AS4A 5BWJA 1DTZA 1FPLA 2QS3A 2CEYA 3E4RA 4F39A 1K9YA 1JNFA 2WYPA 1MDQA 5DW8A 3QSLA 4DCYA 3RUMA 3CFXA 2QS1A 1BP5A 4X1BA 3B6WA 2F8DA 3R7XA 4ISUA 3Q29A 4OFLA 1P1UA 3VXBA 1SW1A 2O1LA 1LCTA 1LBXA 1XI6A 3CVGA 1Y3PA 2Y7WA 1QJMA 4PE5B 2ZYKA 3SKPA 5K2XA 2V93A 1GV8A 1NNKA 2UVIA 2OK2A 3FVOA 3FVNA 1UTBA 4LZ7A 3O6IA 1FBPA 2ZZWA 4F3SA 4QSCA 2HXRA 2ZYNA 3SEWA 3PPRA 4OHNA 1P99A 2DE2A 1OVBA 3QYTA 4H5FA 4P3LA 4FE8A 4YKIA 1YTVA 4ZECA 3IOTA 2HQ0A 4EXLA 3IOWA 4NF4B 1BTJA 4IR8A 4O8MA 1HSJA 5TPAB 3K4UA 1SDXA 4QFPA 2Z8EA 4PF8A 4H8JA 2XWIA 3WAFA 4EF2A 2P2AA 1DOTA 1FQCA 3CR9A 1NNPA 1EZ9A 2XD3A 1DK4A 4NMYA 3MZBA 1JETA 3VFJA 2DQVA 4P1LA 1ATGA 4BDOA 4RPNA 2D5WA 5KCJB 1N3XA 1PEBA 3DP6A 2GHBA 1Y3QA 3H7MA 2RF1A 2VPNA 3A3CA 3K01A 4OWDA 5IGAA 2PT2A 1MS7A 2P3VA 4NGUA 5IZZA 3B7DA 2FIXA 2Z22A 4G61A 2Y7RA 3H6UA 4GIZA 2Q88A 5H8FB 4WKMA 4KPTA 1MXUA 1ANFA 1N7XA 3HCQA 4RXLA 2QMWA 2YLNA 1FBDA 3K1PA 3P7IA 4PQJA 2V4CA 1JQFA 3L6HA 4MJOA 4N8YA 2ZYMA 4O3AA 4GL0A 1L5TA 2I6EA 3RPWA 3Q25A 3S9MC 3VXCA 3IJXB 1S50A 2F3DA 1B05A 4HE1A 3OO9A 1FQDA 4LVQA 3TQWA 3WAEA 3LSLA 1MDP1 1B7HA 2I3WA 1MH4A 1USYH 1PB9A 4NF0A 2YPNA 2I0CA 3S2VA 1B9JA 4XKPA 4MIJA 4KR5A 2I58A 1N76A 3QMFA 1Z7ME 4U1ZA 4LATA 2E0SA 4PTKA 3DELB 5AE4A 1FBEA 3D1RA 3MVWA 4RA1A 1AL3A 2H9BA 1B0HA 4FAJA 4JB7A 3FVGA 4ZEIA 4NQ8A 1B7UA 3MYUA 3TTKA 3K2DA 2R9JA 4POXA 4WEDA 4HS7A 2V3UA 2PFZA 3IFAA 4YU0A 3CHGA 3MC2A 1B3FA 2UVJA 3AXFA 3VDFA 5IZ1A 3ZS6A 4DIGA 1B4ZA 3FUZA 3MQ9A 1ZJLA 5CMBA 1MPCA 3M3KA 2XXPA 5CMMA 2Q2AA 1DMBA 2DP8A 1IMBA 3ZSFA 1VDWA 2F3BA 1NI9A 2F5XA 3IOVA 3HO7A 5CBRA 3O2AA 4LN5A 3N5LA 1FTMA 4DI4B 4ELPA 1EZOA 3PUYE 1UTHA 2DS9A 4IY5A 1UTHB 4O7MA 4ELOA 2E1SA 2I3VA 1RYOA 3EPEA 3PGFA 5FHMA 4OVJA 1ZLQA 4FBPA 2F36A 3TYHA 1URSA 3SERA 1B58A 1NL5A 2VP1A 4TQUQ 1Q35A 5TP9A 2WX9A 1HSLA 4MFIA 2B3BA 1FPGA 2RC8A 1NKXA 5FHNA 3EHUA 3R6UA 4U23A 5DVJA 3N26A 1LEVA 3Q27A 2OWTA 1NUWA 3MUQA 3RYDA 3USDA 4MF3A 3FATA 3IR1A 1FQEA 1MY1A 3O6HA 2NOOA 3C33A 4QF9A 1A7LA 3ECRA 4OEUA 4EUOA 2DWHA 1B52A 4H5GA 4PFTA 3GBBA 1US4A 2HXWA 3OO7A 1O7TA 4KFQA 3S9EA 4DXUA 3BIGA 5I58B 3TCFA 1ZU0A 1B46A 3GXAA 2XX8A 4BDNA 2RC7A 5AA4A 3U93A 4U2RA 2Q89A 3H6VA 4IO7A 3UORA 4GOTA 3RT8A 4PETA 1IMEA 1MM7A 4PGNA 2UYEA 1FBCA 2OX3A 1IEJA 1MXVA 1B3LA 2KLFA 3ROJA 1NV1A 1POTA 1PBQA 5AA2A 3JV9A 5JTYB 2I4CA 4ZDMA 2Q8MA 1CB6A 3BFUA 3G3HA 2XXTA 3B6QA 3K00A 4C1UA 4MX6A 3LSWA 3OMBA 3PMXA 1XOCA 2Y84A 1H43A 5DVFA 1N84A 4I1DA 4OERA 2HZLA 3JYRA 1MH3A 4IO4A 4ELRA 1D9VA 3GLBA 1URDA 3U1OA 2F35A 2BJIA 4IB2A 2QSXA 5EQ9A 1ELJA 2Q2CA 1G0HA 3T22A 1SW5A 4NF6B 2DXRA 1MQHA 3H6TA 1Z7NE 1B3EA 1JW5A 5CM6A 1AOVA 3TQLA 3KGCA 3CSBA 2VD2A 4HTGA 3PPPA 2P0SA 1VE4A 2UXAA 1UIVA 2F7AA 4G2ZA 4PFRA 5H8SA 4AQ4A 1K9ZA 1LB9A 4H65A 3JZJA 4OXVA 3E13X 1H45A 1Y1MA 3TDJA 3K1MA 1SW4A 4DLDA 4YB5A 3FJMA 3B8BA 3TODA 5CC2A 3N6UA 2XWVA 4GBWA 2O1MA 4OFJA 1KA0A 3N94A 4XEQA 3UA8A 3O29A 1EH3A 3MP1A 4JWOA 2I48A 1CNQA 5JEIA 1R6ZA 1GVCA 3CFZA 5DEXA 3T66A 4IGRA 3E78A 3TMGA 4H1XA 4HXVA 4KQPA 4NE4A 4RPOA 1SPIA 5ICTA 4DXBA 5I56B 1KA1A 1QUKA 3HN0A 3KBZA 2V3QA 2NWJA 1FW0A 5DVIA 4O3CA 3MP8A 4PFYA 3EN3A 4HCWA 4MHFA 3LSXA 2DWJA 3MJNA 4BLAA 3DM0A 3A09A 3K02A 2RCAA
chains in the Genus database with same CATH topology
3T9UA 4LP2B 1AH5A 1S9TA 4R74A 1IXCA 4EXKA 4N6PA 3I5OA 3R26A 4XIGQ 3OSRA 3FJGA 3MBPA 1NNFA 4F22A 2H25A 4KYDA 5H8NA 1B32A 4ZS9A 1MPDA 1MXZA 5IKBA 1B3HA 4E0XA 3OO8A 4F19A 3TPAA 1MQJA 5F7VA 2AL4A 2Q8JA 3KOTA 4KD5A 3OSQA 3G3GA 2FNCA 1A55A 2M8CA 5CMCA 5FHOA 1UTBB 1QUJA 2GH9A 4GD5A 2PT1A 1R1NA 2HFBA 1A54A 3TFLA 4OESA 3MVXA 5ITPA 3O9PA 2X7PA 1OIBA 4JDFA 1FQAA 3D4CA 1Y1ZA 2DWIA 1ZMGA 2O84X 4F2QA 2O51A 5CBSA 3KJ7A 3H03A 4BDLA 1M5DA 4Q8RA 4F18A 4QSDA 1D9YA 2O68A 3IO6A 4O3BA 1JVYA 3PU5A 3IB0A 3HV1A 4QSEA 3PUVE 2XXIA 3C32A 4Q5TA 3TAJA 2CMOA 1LCFA 5CRYA 4OEVA 4MH5A 3K6XA 4KYEA 1GGGA 4LZ5A 3ILUB 2PVUA 4G68A 1Y3NA 2LAOA 2R71A 4XKQA 1OQHA 1MY3A 3PUWE 4QFKA 3RLFE 5ICQA 2VGQA 3MAMA 1XC1A 4JWXA 1EU8A 1FQFA 1B6HA 1LAFE 2OBGA 1FTLA 4LONB 3TKDA 3W9VA 1MXXA 4KCCA 4KHZE 4PFWA 2OJTA 3QK6A 2XXHA 4U4XA 4YICA 4G8HA 5J1DA 3TTNA 4LQ2A 2RKMA 1MPBA 2ZNTA 4F1YA 1A40A 3RN8A 1P1OA 4GL8A 1KWHA 4ND9A 3TTLA 1MY0A 4I9DA 2OLBA 3CRBA 3IK6B 1N0TA 4EF1A 1A8EA 2I0BA 4R72A 5CMKA 4U21A 2NXOA 5AA3A 3BKIB 2HZKA 5EYFA 3FGSA 4JBZA 3MP6A 1CE2A 1B0LA 3S9LC 4RJZA 3THIA 5F1QA 3V5AA 4GXSB 4POWA 3PD9A 4R2FA 4FECA 1LLSA 1POY1 4XTCQ 2DOJA 2XXXA 1QUIA 4M4GA 5B70A 4F1UA 1XVXA 4UA8A 3U92A 1EZPA 4F31B 3U94A 3H6WA 5L9OA 4TLLB 3G3IA 5M2VA 2ZNSA 4I62A 2GHAA 4G68C 1SYHA 3GBAA 5L9MA 2ALUA 5ISUA 1SYIA 3QIMA 4R73A 2R6GE 3M3LA 3K6WA 2XX7A 3N6TA 4NF8A 1BKAA 1RYXA 1PDAA 4OYVA 4HCYA 1JVXA 5L8DA 1Q1KA 3RY3A 1R9QA 1TWYA 3VLVA 3FV1A 4JSOA 4Q0CA 4YZZA 3LBSA 3KFMA 4LA9A 4Z0IA 2DE4A 3RGYA 1B7ZA 5CI5A 5I57A 4OQOA 1MRPA 2V25A 3BFTA 1LFGA 4ZZAA 1SVXB 2OZZA 1LFHA 4XKNA 1XT8A 3TCHA 2AL5A 1Y4TA 4TLMB 5TP9B 2A5TA 3RNNA 1NH7A 4NTLA 1VSOA 3SESA 1B1HA 3ODBA 3IAZA 3VV5A 1VR5A 3D4GA 4GXAA 1DPPA 2REGA 2HAVA 2H99A 4P0GA 1TFDA 4YKKA 2V3TA 4R9FA 4GVOA 5H8HA 1FTOA 4C1TA 5DTBA 1II5A 3KN3A 4LUBA 2Y7KA 2G29A 4ZEBA 4ZEKA 1UIUA 3PD8A 1IQ7A 2Z8DA 5AA4B 1B2HA 3K1NA 1QW0A 1XHYA 4ECFA 3PUXE 1GR2A 2FYIA 3A3UA 1D3KA 4AB6A 5I59A 4ESWA 3PMWA 1I6QA 5I2NA 1B40A 4KCDA 1P1WA 4K3FA 4ONYA 4GLIA 1WDNA 4OMBA 3IX1A 4KYSA 2Y7IA 4EQ7A 2ZNUA 5HM4B 2THIA 5AA2B 3FVKA 4EDPA 3MPLA 2F97A 3KZGA 1LAHE 1B5JA 3I6VA 2VHAA 1MY4A 1P1NA 4JXIA 5H8QA 3EQ1A 2ESNA 4DXCA 5AA2D 3PPOA 5HBCA 4R9GA 2RCBA 3KN7A 4LZ8A 5FTIA 1GTKA 2G93A 1URGA 5DT6A 2XD2A 3CIJA 3KSXA 3B6TA 5L9SA 3FZVA 4X48A 3H4ZA 2PYYA 2QPQA 4RNSA 4BDMA 3O28A 3MVYA 2OWSA 2DVZA 3HPIA 3FXRA 3RTFB 3F11A 3UIFA 1IXGA 1SBPA 3OD7A 3SEVA 4P0IA 1BIYA 3IB1A 1JEVA 3VVEA 3G3KA 4Z7EA 4BDRA 3Q28A 1QVSA 3K0VA 4H0WA 5ELVA 3UK4A 4ESXA 3TEPA 1ZIUA 3T93B 1A8FA 4NF5A 2HAUA 2DSFA 3CG3A 5DEXB 1AIVA 1LBCA 3C4MA 4EQ9A 4H8IA 3IOUA 3VVDA 4IO3A 3UP9A 4OFOA 2XXYA 4YMAA 5JK4A 2H4IA 2GFEA 2PBWA 1FTKA 4ZEDA 4F3GA 1MM6A 1I6AA 4R6HA 3LUYA 5I2KA 4R6KA 1AMFA 4X9TA 1FQBA 3EHSA 2ABHA 2Z8FA 3PPNA 1UQWA 3QAXA 2XHDA 4F3BA 1MXWA 5AA1A 2ONSA 3M3FA 2HCAA 4R6YA 3IJOB 1XS5A 3MPKA 3FXUA 3C36A 1B4HA 1O63A 5H8NB 4ZZEA 3KG2A 4DCXA 1P1QA 3HHFA 3HHGA 1B5HA 3OENA 2HEUA 2P1SA 1YCJA 3RT6B 1PC3A 3O97A 3QXMA 1NH8A 2O6AA 1RKMA 2QS2A 1R9LA 4TOZA 3E3KA 4R75A 4F29A 1B5IA 3TZAA 3H3GA 3OEMA 3VLUA 4YB7A 1USYE 4FJPA 1DPEA 3QUFA 1M5FA 4NF4A 1FTJA 5TPAA 2IA4A 2XXRA 1IZ1A 1H3DA 2Z23A 4BDQA 4YB6A 3ONMA 1QULA 2QS4A 1LFIA 4YKPA 3BBRA 1T0KA 3PPQA 5TU0A 3C34A 3PMVA 4JSDA 2CZLA 4F2OA 5KCJA 1QKBA 4G68B 4E0WA 2YJPA 3IL1B 3TCGA 1LBBA 1XVYA 3C31A 3RQTA 4MLVA 3V8XB 2AIXA 2UYFA 3T9VA 4Q30B 2IEEA 4QFOA 5H8FA 1N3WA 1VFDA 2QJEA 4HW8A 3LSFB 1TFAA 2I4BA 1I6BA 1NFTA 1N7WA 2X7QA 2F34A 1MQDA 1SQYA 3CFLA 2ONRA 3KOSA 2DVCA 1PB8A 1LGBC 3W15C 5ITOA 1M5CA 1MQGA 2X26A 1IXIA 4OENA 4YMBA 1TXFA 4RY1A 1FCKA 4UACA 3T96B 4JWYA 4G4PA 2OCUA 4N13A 5KZTA 2QMXA 4FEDA 2XXVA 1SI0A 2O7UA 2F6GA 1I69A 1Y9UA 4PP0A 2A5SA 1JW4A 1OVTA 4ZEFA 4IO5A 5FTHA 5I84A 1S7YA 4EQBA 3FV2A 2NVUB 1Y4CA 5HPQA 5K2YA 1N04A 3HSTA 5KDTA 2UVHA 4U22A 3VLWA 3ILTB 1IXHA 4ELQA 2DE3A 5KDTB 1MQIA 4F3PA 1LSTA 3H06B 4PFUA 3PUZE 3L6GA 4QRZA 3DP4A 2XXQA 2DYXA 3IB2A 2F7CA 2ONKE 3OOAA 3IO4A 3OXNA 3CI8A 4KI0E 4L17A 4IO2A 2V84A 4MBPA 5EHSA 1MG1A 2PMSA 3KN8A 4P11A 1WODA 2QL3A 3SETA 1SD3A 4NF8B 1HSEA 3FXQA 2D21A 4ZE8A 3KEIA 4FEBA 3MW0A 4AB5A 3C9HA 4OETA 3SDFA 1WVJA 4WEPA 3UGWA 4U4SA 2ZMBA 1YPNA 4THIA 2Y7PA 5EHMA 4YAHX 4DDDA 3S9NC 4NWDA 1US5A 5I57B 2BJJX 3MZ9A 2GRVA 3T9XB 5A5XA 1O64A 2REJA 4LQ5A 2O69A 3SEYA 1YAEA 2RINA 3LC8A 3W9WA 5A5XB 1QKAA 2A5TB 1NMUA 1DTGA 1LAXA 3E9XA 1LAGE 1LB8A 4G77A 3G3FA 4GFRA 2ZXTA 3OO6A 5I58A 3S4UA 3GZGA 4G8NA 1VFEA 3FASA 2ZYOA 2XX9A 5H8HB 4DZ1A 1DSNA 1J1NA 4QHQA 3O6GA 1M5EA 3IORA 1H44A 3K6UA 2F78A 4H67A 4RK9A 4G8MA 2VD3A 3TUSA 3TELA 2DWAA 4IY6A 2RC9A 4X1DA 1B3GA 4QFNA 4GRKA 4ZE9A 3DLNA 3VVFA 2XXWA 3CSGA 1IUDA 4I8CA 5I59B 4N07A 3CG1A 1OQGA 1MY2A 4WXJA 5JTYA 4M1VA 5I2NB 1A99A 3M8UA 3SEUA 4IO6A 3V89B 3T9HB 1JW1A 4H6DA 1ZTYA 3KBRA 5BUUA 3RTWB 4C0RA 2NUVA 3VE1B 3EHTA 3ZKKA 4XXUA 3C35A 4XKRA 5H8QB 4RK2A 1OLAA 2FA7A 3FIRA 2H5YA 1OMPA 4NF6A 1PBPA 3G7WA 2VOZA 3OELA 4DE8A 1IITA 4U1OA 3U72A 2WKYA 2XXUA 2PX1A 4NEDA 2Q9TA 4OTEA 1ZKBA 1PB7A 3MZ1A 3KSJA 3PV0E 4F1VA 1TT1A 4QFLA 4FIMA 2W7YA 2B3FA 3G3JA 3KJTA 3TTMA 3MVZA 3Q26A 3SEXA 4GWOA 2UVGA 3LR1A 2O7IA 2B65A 3U8QA 1JEUA 3K6VA 2ANJA 4GQOA 4MLQA 3V83A 1H76A 2D3IA 3EF7A 3OEKA 3O66A 4GF8A 4R2BA 2AYSA 2I49A 4IGTA 5IAIA 5LOMA 1M5BA 5I56A 4NF5B 1ZBMA 3UN6A 2F6PA 1MXYA 3TTRA 3QUJA 3ZKLA 1NNTA 5B7DA 2QRYA 4FORA 1Y20A 1IIWA 5DYHA 3DP8A 4FATA 1SI1A 2F7BA 1SW2A 1BLFA 1B51A 1F9BA 3MWBA 1B1XA 3FJ7A 4NWCA 3FD3A 1OLCA 2DXYA 4OZ9A 4YKJA 5I2KB 2H98A 3I3VA 1D4NA 4RYAA 5BWJA 1DTZA 2QS3A 3E4RA 4F39A 1JNFA 1MDQA 3QSLA 4DCYA 3RUMA 3CFXA 2QS1A 1BP5A 4X1BA 3B6WA 2F8DA 3R7XA 4ISUA 3Q29A 4OFLA 1P1UA 3VXBA 1SW1A 2O1LA 1LCTA 3CVGA 1Y3PA 2Y7WA 1QJMA 4PE5B 2ZYKA 3SKPA 5K2XA 2V93A 1GV8A 1NNKA 2UVIA 2OK2A 3FVOA 3FVNA 1UTBA 4LZ7A 3O6IA 4F3SA 4QSCA 2ZYNA 3SEWA 3PPRA 4OHNA 1P99A 2DE2A 1OVBA 3QYTA 4H5FA 4FE8A 4YKIA 1YTVA 4ZECA 3IOTA 2HQ0A 4EXLA 3IOWA 4NF4B 1BTJA 1HSJA 5TPAB 3K4UA 1SDXA 4QFPA 2Z8EA 4H8JA 4EF2A 3WAFA 2P2AA 1DOTA 1FQCA 3CR9A 1NNPA 1EZ9A 2XD3A 4NMYA 3MZBA 1JETA 3VFJA 2DQVA 1ATGA 4BDOA 4RPNA 2D5WA 5KCJB 1N3XA 1PEBA 3DP6A 2GHBA 1Y3QA 3H7MA 2RF1A 3A3CA 3K01A 4OWDA 2PT2A 1MS7A 3B7DA 2Z22A 2Y7RA 3H6UA 4GIZA 2Q88A 5H8FB 4WKMA 4KPTA 1MXUA 1ANFA 1N7XA 3HCQA 4RXLA 2QMWA 2YLNA 3K1PA 3P7IA 4PQJA 1JQFA 3L6HA 2ZYMA 4O3AA 4GL0A 1L5TA 2I6EA 3RPWA 3Q25A 3S9MC 3VXCA 3IJXB 1S50A 1B05A 3OO9A 1FQDA 4LVQA 3TQWA 3WAEA 3LSLA 1MDP1 1B7HA 2I3WA 1MH4A 1USYH 1PB9A 2YPNA 2I0CA 3S2VA 1B9JA 4XKPA 4KR5A 2I58A 1N76A 1Z7ME 4U1ZA 4LATA 2E0SA 3DELB 5AE4A 3MVWA 4RA1A 1AL3A 2H9BA 1B0HA 4FAJA 4JB7A 3FVGA 4ZEIA 1B7UA 3TTKA 3K2DA 2R9JA 4POXA 4WEDA 4HS7A 2V3UA 4YU0A 3MC2A 1B3FA 2UVJA 3AXFA 3VDFA 3ZS6A 4DIGA 1B4ZA 3FUZA 3MQ9A 1ZJLA 5CMBA 1MPCA 3M3KA 2XXPA 5CMMA 2Q2AA 1DMBA 2DP8A 3ZSFA 2F5XA 3IOVA 3HO7A 5CBRA 3O2AA 3N5LA 1FTMA 4ELPA 1EZOA 3PUYE 1UTHA 2DS9A 4IY5A 1UTHB 4ELOA 2E1SA 2I3VA 1RYOA 3EPEA 3PGFA 5FHMA 4OVJA 1ZLQA 2F36A 3TYHA 1URSA 3SERA 1B58A 1NL5A 2VP1A 4TQUQ 1Q35A 5TP9A 1HSLA 4MFIA 2B3BA 2RC8A 1NKXA 5FHNA 3EHUA 3R6UA 4U23A 5DVJA 3N26A 3Q27A 2OWTA 3MUQA 3USDA 4MF3A 3FATA 3IR1A 1FQEA 1MY1A 3O6HA 2NOOA 3C33A 4QF9A 1A7LA 3ECRA 4OEUA 4EUOA 2DWHA 1B52A 4H5GA 4PFTA 3GBBA 1US4A 2HXWA 3OO7A 1O7TA 4KFQA 3S9EA 4DXUA 5I58B 3TCFA 1ZU0A 1B46A 3GXAA 2XX8A 4BDNA 2RC7A 5AA4A 3U93A 4U2RA 2Q89A 3H6VA 4IO7A 3UORA 4GOTA 3RT8A 4PETA 1MM7A 2UYEA 1IEJA 1MXVA 1B3LA 2KLFA 1POTA 1PBQA 5AA2A 3JV9A 5JTYB 2I4CA 4ZDMA 1CB6A 3BFUA 3G3HA 2XXTA 3B6QA 3K00A 4C1UA 3LSWA 3OMBA 3PMXA 1XOCA 2Y84A 1H43A 5DVFA 1N84A 4I1DA 4OERA 2HZLA 3JYRA 1MH3A 4IO4A 4ELRA 1D9VA 3GLBA 1URDA 3U1OA 2F35A 4IB2A 2QSXA 1ELJA 2Q2CA 3T22A 1SW5A 4NF6B 2DXRA 1MQHA 3H6TA 1Z7NE 1B3EA 1JW5A 5CM6A 1AOVA 3TQLA 3KGCA 3CSBA 2VD2A 4HTGA 3PPPA 2P0SA 1VE4A 2UXAA 1UIVA 2F7AA 4G2ZA 5H8SA 4AQ4A 1LB9A 4H65A 3JZJA 4OXVA 3E13X 1H45A 1Y1MA 3TDJA 3K1MA 1SW4A 4DLDA 4YB5A 3FJMA 3TODA 5CC2A 3N6UA 2O1MA 4OFJA 3N94A 3UA8A 3O29A 1EH3A 3MP1A 4JWOA 2I48A 5JEIA 1R6ZA 1GVCA 3CFZA 5DEXA 3T66A 4IGRA 3TMGA 4H1XA 4KQPA 4NE4A 4RPOA 5ICTA 4DXBA 5I56B 3HN0A 1QUKA 2V3QA 2NWJA 1FW0A 5DVIA 4O3CA 3MP8A 4PFYA 3EN3A 4HCWA 3LSXA 2DWJA 3MJNA 4BLAA 3DM0A 3A09A 3K02A 2RCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9U A;  4LP2 B;  1AH5 A;  1S9T A;  4R74 A;  1IXC A;  4EXK A;  4N6P A;  3I5O A;  3R26 A;  4XIG Q;  3OSR A;  3FJG A;  3MBP A;  1NNF A;  4F22 A;  2H25 A;  4KYD A;  5H8N A;  1B32 A;  4ZS9 A;  1MPD A;  1MXZ A;  5IKB A;  1B3H A;  4E0X A;  3OO8 A;  4F19 A;  3TPA A;  1MQJ A;  5F7V A;  2AL4 A;  2Q8J A;  3KOT A;  4KD5 A;  3OSQ A;  3G3G A;  2FNC A;  1A55 A;  2M8C A;  5CMC A;  5FHO A;  1UTB B;  1QUJ A;  2GH9 A;  4GD5 A;  2PT1 A;  1R1N A;  2HFB A;  1A54 A;  3TFL A;  4OES A;  3MVX A;  5ITP A;  3O9P A;  2X7P A;  1OIB A;  4JDF A;  1FQA A;  3D4C A;  1Y1Z A;  2DWI A;  1ZMG A;  2O84 X;  4F2Q A;  2O51 A;  5CBS A;  3KJ7 A;  3H03 A;  4BDL A;  1M5D A;  4Q8R A;  4F18 A;  4QSD A;  1D9Y A;  2O68 A;  3IO6 A;  4O3B A;  1JVY A;  3PU5 A;  3IB0 A;  3HV1 A;  4QSE A;  3PUV E;  2XXI A;  3C32 A;  4Q5T A;  3TAJ A;  2CMO A;  1LCF A;  5CRY A;  4OEV A;  4MH5 A;  3K6X A;  4KYE A;  1GGG A;  4LZ5 A;  3ILU B;  2PVU A;  4G68 A;  1Y3N A;  2LAO A;  2R71 A;  4XKQ A;  1OQH A;  1MY3 A;  3PUW E;  4QFK A;  3RLF E;  5ICQ A;  2VGQ A;  3MAM A;  1XC1 A;  4JWX A;  1EU8 A;  1FQF A;  1B6H A;  1LAF E;  2OBG A;  1FTL A;  4LON B;  3TKD A;  3W9V A;  1MXX A;  4KCC A;  4KHZ E;  4PFW A;  2OJT A;  3QK6 A;  2XXH A;  4U4X A;  4YIC A;  4G8H A;  5J1D A;  3TTN A;  4LQ2 A;  2RKM A;  1MPB A;  2ZNT A;  4F1Y A;  1A40 A;  3RN8 A;  1P1O A;  4GL8 A;  1KWH A;  4ND9 A;  3TTL A;  1MY0 A;  4I9D A;  2OLB A;  3CRB A;  3IK6 B;  1N0T A;  4EF1 A;  1A8E A;  2I0B A;  4R72 A;  5CMK A;  4U21 A;  2NXO A;  5AA3 A;  3BKI B;  2HZK A;  5EYF A;  3FGS A;  4JBZ A;  3MP6 A;  1CE2 A;  1B0L A;  3S9L C;  4RJZ A;  3THI A;  5F1Q A;  3V5A A;  4GXS B;  4POW A;  3PD9 A;  4R2F A;  4FEC A;  1LLS A;  1POY 1;  4XTC Q;  2DOJ A;  2XXX A;  1QUI A;  4M4G A;  5B70 A;  4F1U A;  1XVX A;  4UA8 A;  3U92 A;  1EZP A;  4F31 B;  3U94 A;  3H6W A;  5L9O A;  4TLL B;  3G3I A;  5M2V A;  2ZNS A;  4I62 A;  2GHA A;  4G68 C;  1SYH A;  3GBA A;  5L9M A;  2ALU A;  5ISU A;  1SYI A;  3QIM A;  4R73 A;  2R6G E;  3M3L A;  3K6W A;  2XX7 A;  3N6T A;  4NF8 A;  1BKA A;  1RYX A;  1PDA A;  4OYV A;  4HCY A;  1JVX A;  5L8D A;  1Q1K A;  3RY3 A;  1R9Q A;  1TWY A;  3VLV A;  3FV1 A;  4JSO A;  4Q0C A;  4YZZ A;  3LBS A;  3KFM A;  4LA9 A;  4Z0I A;  2DE4 A;  3RGY A;  1B7Z A;  5CI5 A;  5I57 A;  4OQO A;  1MRP A;  2V25 A;  3BFT A;  1LFG A;  4ZZA A;  1SVX B;  2OZZ A;  1LFH A;  4XKN A;  1XT8 A;  3TCH A;  2AL5 A;  1Y4T A;  4TLM B;  5TP9 B;  2A5T A;  3RNN A;  1NH7 A;  4NTL A;  1VSO A;  3SES A;  1B1H A;  3ODB A;  3IAZ A;  3VV5 A;  1VR5 A;  3D4G A;  4GXA A;  1DPP A;  2REG A;  2HAV A;  2H99 A;  4P0G A;  1TFD A;  4YKK A;  2V3T A;  4R9F A;  4GVO A;  5H8H A;  1FTO A;  4C1T A;  5DTB A;  1II5 A;  3KN3 A;  4LUB A;  2Y7K A;  2G29 A;  4ZEB A;  4ZEK A;  1UIU A;  3PD8 A;  1IQ7 A;  2Z8D A;  5AA4 B;  1B2H A;  3K1N A;  1QW0 A;  1XHY A;  4ECF A;  3PUX E;  1GR2 A;  2FYI A;  3A3U A;  1D3K A;  4AB6 A;  5I59 A;  4ESW A;  3PMW A;  1I6Q A;  5I2N A;  1B40 A;  4KCD A;  1P1W A;  4K3F A;  4ONY A;  4GLI A;  1WDN A;  4OMB A;  3IX1 A;  4KYS A;  2Y7I A;  4EQ7 A;  2ZNU A;  5HM4 B;  2THI A;  5AA2 B;  3FVK A;  4EDP A;  3MPL A;  2F97 A;  3KZG A;  1LAH E;  1B5J A;  3I6V A;  2VHA A;  1MY4 A;  1P1N A;  4JXI A;  5H8Q A;  3EQ1 A;  2ESN A;  4DXC A;  5AA2 D;  3PPO A;  5HBC A;  4R9G A;  2RCB A;  3KN7 A;  4LZ8 A;  5FTI A;  1GTK A;  2G93 A;  1URG A;  5DT6 A;  2XD2 A;  3CIJ A;  3KSX A;  3B6T A;  5L9S A;  3FZV A;  4X48 A;  3H4Z A;  2PYY A;  2QPQ A;  4RNS A;  4BDM A;  3O28 A;  3MVY A;  2OWS A;  2DVZ A;  3HPI A;  3FXR A;  3RTF B;  3F11 A;  3UIF A;  1IXG A;  1SBP A;  3OD7 A;  3SEV A;  4P0I A;  1BIY A;  3IB1 A;  1JEV A;  3VVE A;  3G3K A;  4Z7E A;  4BDR A;  3Q28 A;  1QVS A;  3K0V A;  4H0W A;  5ELV A;  3UK4 A;  4ESX A;  3TEP A;  1ZIU A;  3T93 B;  1A8F A;  4NF5 A;  2HAU A;  2DSF A;  3CG3 A;  5DEX B;  1AIV A;  1LBC A;  3C4M A;  4EQ9 A;  4H8I A;  3IOU A;  3VVD A;  4IO3 A;  3UP9 A;  4OFO A;  2XXY A;  4YMA A;  5JK4 A;  2H4I A;  2GFE A;  2PBW A;  1FTK A;  4ZED A;  4F3G A;  1MM6 A;  1I6A A;  4R6H A;  3LUY A;  5I2K A;  4R6K A;  1AMF A;  4X9T A;  1FQB A;  3EHS A;  2ABH A;  2Z8F A;  3PPN A;  1UQW A;  3QAX A;  2XHD A;  4F3B A;  1MXW A;  5AA1 A;  2ONS A;  3M3F A;  2HCA A;  4R6Y A;  3IJO B;  1XS5 A;  3MPK A;  3FXU A;  3C36 A;  1B4H A;  1O63 A;  5H8N B;  4ZZE A;  3KG2 A;  4DCX A;  1P1Q A;  3HHF A;  3HHG A;  1B5H A;  3OEN A;  2HEU A;  2P1S A;  1YCJ A;  3RT6 B;  1PC3 A;  3O97 A;  3QXM A;  1NH8 A;  2O6A A;  1RKM A;  2QS2 A;  1R9L A;  4TOZ A;  3E3K A;  4R75 A;  4F29 A;  1B5I A;  3TZA A;  3H3G A;  3OEM A;  3VLU A;  4YB7 A;  1USY E;  4FJP A;  1DPE A;  3QUF A;  1M5F A;  4NF4 A;  1FTJ A;  5TPA A;  2IA4 A;  2XXR A;  1IZ1 A;  1H3D A;  2Z23 A;  4BDQ A;  4YB6 A;  3ONM A;  1QUL A;  2QS4 A;  1LFI A;  4YKP A;  3BBR A;  1T0K A;  3PPQ A;  5TU0 A;  3C34 A;  3PMV A;  4JSD A;  2CZL A;  4F2O A;  5KCJ A;  1QKB A;  4G68 B;  4E0W A;  2YJP A;  3IL1 B;  3TCG A;  1LBB A;  1XVY A;  3C31 A;  3RQT A;  4MLV A;  3V8X B;  2AIX A;  2UYF A;  3T9V A;  4Q30 B;  2IEE A;  4QFO A;  5H8F A;  1N3W A;  1VFD A;  2QJE A;  4HW8 A;  3LSF B;  1TFA A;  2I4B A;  1I6B A;  1NFT A;  1N7W A;  2X7Q A;  2F34 A;  1MQD A;  1SQY A;  3CFL A;  2ONR A;  3KOS A;  2DVC A;  1PB8 A;  1LGB C;  3W15 C;  5ITO A;  1M5C A;  1MQG A;  2X26 A;  1IXI A;  4OEN A;  4YMB A;  1TXF A;  4RY1 A;  1FCK A;  4UAC A;  3T96 B;  4JWY A;  4G4P A;  2OCU A;  4N13 A;  5KZT A;  2QMX A;  4FED A;  2XXV A;  1SI0 A;  2O7U A;  2F6G A;  1I69 A;  1Y9U A;  4PP0 A;  2A5S A;  1JW4 A;  1OVT A;  4ZEF A;  4IO5 A;  5FTH A;  5I84 A;  1S7Y A;  4EQB A;  3FV2 A;  2NVU B;  1Y4C A;  5HPQ A;  5K2Y A;  1N04 A;  3HST A;  5KDT A;  2UVH A;  4U22 A;  3VLW A;  3ILT B;  1IXH A;  4ELQ A;  2DE3 A;  5KDT B;  1MQI A;  4F3P A;  1LST A;  3H06 B;  4PFU A;  3PUZ E;  3L6G A;  4QRZ A;  3DP4 A;  2XXQ A;  2DYX A;  3IB2 A;  2F7C A;  2ONK E;  3OOA A;  3IO4 A;  3OXN A;  3CI8 A;  4KI0 E;  4L17 A;  4IO2 A;  2V84 A;  4MBP A;  5EHS A;  1MG1 A;  2PMS A;  3KN8 A;  4P11 A;  1WOD A;  2QL3 A;  3SET A;  1SD3 A;  4NF8 B;  1HSE A;  3FXQ A;  2D21 A;  4ZE8 A;  3KEI A;  4FEB A;  3MW0 A;  4AB5 A;  3C9H A;  4OET A;  3SDF A;  1WVJ A;  4WEP A;  3UGW A;  4U4S A;  2ZMB A;  1YPN A;  4THI A;  2Y7P A;  5EHM A;  4YAH X;  4DDD A;  3S9N C;  4NWD A;  1US5 A;  5I57 B;  2BJJ X;  3MZ9 A;  2GRV A;  3T9X B;  5A5X A;  1O64 A;  2REJ A;  4LQ5 A;  2O69 A;  3SEY A;  1YAE A;  2RIN A;  3LC8 A;  3W9W A;  5A5X B;  1QKA A;  2A5T B;  1NMU A;  1DTG A;  1LAX A;  3E9X A;  1LAG E;  1LB8 A;  4G77 A;  3G3F A;  4GFR A;  2ZXT A;  3OO6 A;  5I58 A;  3S4U A;  3GZG A;  4G8N A;  1VFE A;  3FAS A;  2ZYO A;  2XX9 A;  5H8H B;  4DZ1 A;  1DSN A;  1J1N A;  4QHQ A;  3O6G A;  1M5E A;  3IOR A;  1H44 A;  3K6U A;  2F78 A;  4H67 A;  4RK9 A;  4G8M A;  2VD3 A;  3TUS A;  3TEL A;  2DWA A;  4IY6 A;  2RC9 A;  4X1D A;  1B3G A;  4QFN A;  4GRK A;  4ZE9 A;  3DLN A;  3VVF A;  2XXW A;  3CSG A;  1IUD A;  4I8C A;  5I59 B;  4N07 A;  3CG1 A;  1OQG A;  1MY2 A;  4WXJ A;  5JTY A;  4M1V A;  5I2N B;  1A99 A;  3M8U A;  3SEU A;  4IO6 A;  3V89 B;  3T9H B;  1JW1 A;  4H6D A;  1ZTY A;  3KBR A;  5BUU A;  3RTW B;  4C0R A;  2NUV A;  3VE1 B;  3EHT A;  3ZKK A;  4XXU A;  3C35 A;  4XKR A;  5H8Q B;  4RK2 A;  1OLA A;  2FA7 A;  3FIR A;  2H5Y A;  1OMP A;  4NF6 A;  1PBP A;  3G7W A;  2VOZ A;  3OEL A;  4DE8 A;  1IIT A;  4U1O A;  3U72 A;  2WKY A;  2XXU A;  2PX1 A;  4NED A;  2Q9T A;  4OTE A;  1ZKB A;  1PB7 A;  3MZ1 A;  3KSJ A;  3PV0 E;  4F1V A;  1TT1 A;  4QFL A;  4FIM A;  2W7Y A;  2B3F A;  3G3J A;  3KJT A;  3TTM A;  3MVZ A;  3Q26 A;  3SEX A;  4GWO A;  2UVG A;  3LR1 A;  2O7I A;  2B65 A;  3U8Q A;  1JEU A;  3K6V A;  2ANJ A;  4GQO A;  4MLQ A;  3V83 A;  1H76 A;  2D3I A;  3EF7 A;  3OEK A;  3O66 A;  4GF8 A;  4R2B A;  2AYS A;  2I49 A;  4IGT A;  5IAI A;  5LOM A;  1M5B A;  5I56 A;  4NF5 B;  1ZBM A;  3UN6 A;  2F6P A;  1MXY A;  3TTR A;  3QUJ A;  3ZKL A;  1NNT A;  5B7D A;  2QRY A;  4FOR A;  1Y20 A;  1IIW A;  5DYH A;  3DP8 A;  4FAT A;  1SI1 A;  2F7B A;  1SW2 A;  1BLF A;  1B51 A;  1F9B A;  3MWB A;  1B1X A;  3FJ7 A;  4NWC A;  3FD3 A;  1OLC A;  2DXY A;  4OZ9 A;  4YKJ A;  5I2K B;  2H98 A;  3I3V A;  1D4N A;  4RYA A;  5BWJ A;  1DTZ A;  2QS3 A;  3E4R A;  4F39 A;  1JNF A;  1MDQ A;  3QSL A;  4DCY A;  3RUM A;  3CFX A;  2QS1 A;  1BP5 A;  4X1B A;  3B6W A;  2F8D A;  3R7X A;  4ISU A;  3Q29 A;  4OFL A;  1P1U A;  3VXB A;  1SW1 A;  2O1L A;  1LCT A;  3CVG A;  1Y3P A;  2Y7W A;  1QJM A;  4PE5 B;  2ZYK A;  3SKP A;  5K2X A;  2V93 A;  1GV8 A;  1NNK A;  2UVI A;  2OK2 A;  3FVO A;  3FVN A;  1UTB A;  4LZ7 A;  3O6I A;  4F3S A;  4QSC A;  2ZYN A;  3SEW A;  3PPR A;  4OHN A;  1P99 A;  2DE2 A;  1OVB A;  3QYT A;  4H5F A;  4FE8 A;  4YKI A;  1YTV A;  4ZEC A;  3IOT A;  2HQ0 A;  4EXL A;  3IOW A;  4NF4 B;  1BTJ A;  1HSJ A;  5TPA B;  3K4U A;  1SDX A;  4QFP A;  2Z8E A;  4H8J A;  4EF2 A;  3WAF A;  2P2A A;  1DOT A;  1FQC A;  3CR9 A;  1NNP A;  1EZ9 A;  2XD3 A;  4NMY A;  3MZB A;  1JET A;  3VFJ A;  2DQV A;  1ATG A;  4BDO A;  4RPN A;  2D5W A;  5KCJ B;  1N3X A;  1PEB A;  3DP6 A;  2GHB A;  1Y3Q A;  3H7M A;  2RF1 A;  3A3C A;  3K01 A;  4OWD A;  2PT2 A;  1MS7 A;  3B7D A;  2Z22 A;  2Y7R A;  3H6U A;  4GIZ A;  2Q88 A;  5H8F B;  4WKM A;  4KPT A;  1MXU A;  1ANF A;  1N7X A;  3HCQ A;  4RXL A;  2QMW A;  2YLN A;  3K1P A;  3P7I A;  4PQJ A;  1JQF A;  3L6H A;  2ZYM A;  4O3A A;  4GL0 A;  1L5T A;  2I6E A;  3RPW A;  3Q25 A;  3S9M C;  3VXC A;  3IJX B;  1S50 A;  1B05 A;  3OO9 A;  1FQD A;  4LVQ A;  3TQW A;  3WAE A;  3LSL A;  1MDP 1;  1B7H A;  2I3W A;  1MH4 A;  1USY H;  1PB9 A;  2YPN A;  2I0C A;  3S2V A;  1B9J A;  4XKP A;  4KR5 A;  2I58 A;  1N76 A;  1Z7M E;  4U1Z A;  4LAT A;  2E0S A;  3DEL B;  5AE4 A;  3MVW A;  4RA1 A;  1AL3 A;  2H9B A;  1B0H A;  4FAJ A;  4JB7 A;  3FVG A;  4ZEI A;  1B7U A;  3TTK A;  3K2D A;  2R9J A;  4POX A;  4WED A;  4HS7 A;  2V3U A;  4YU0 A;  3MC2 A;  1B3F A;  2UVJ A;  3AXF A;  3VDF A;  3ZS6 A;  4DIG A;  1B4Z A;  3FUZ A;  3MQ9 A;  1ZJL A;  5CMB A;  1MPC A;  3M3K A;  2XXP A;  5CMM A;  2Q2A A;  1DMB A;  2DP8 A;  3ZSF A;  2F5X A;  3IOV A;  3HO7 A;  5CBR A;  3O2A A;  3N5L A;  1FTM A;  4ELP A;  1EZO A;  3PUY E;  1UTH A;  2DS9 A;  4IY5 A;  1UTH B;  4ELO A;  2E1S A;  2I3V A;  1RYO A;  3EPE A;  3PGF A;  5FHM A;  4OVJ A;  1ZLQ A;  2F36 A;  3TYH A;  1URS A;  3SER A;  1B58 A;  1NL5 A;  2VP1 A;  4TQU Q;  1Q35 A;  5TP9 A;  1HSL A;  4MFI A;  2B3B A;  2RC8 A;  1NKX A;  5FHN A;  3EHU A;  3R6U A;  4U23 A;  5DVJ A;  3N26 A;  3Q27 A;  2OWT A;  3MUQ A;  3USD A;  4MF3 A;  3FAT A;  3IR1 A;  1FQE A;  1MY1 A;  3O6H A;  2NOO A;  3C33 A;  4QF9 A;  1A7L A;  3ECR A;  4OEU A;  4EUO A;  2DWH A;  1B52 A;  4H5G A;  4PFT A;  3GBB A;  1US4 A;  2HXW A;  3OO7 A;  1O7T A;  4KFQ A;  3S9E A;  4DXU A;  5I58 B;  3TCF A;  1ZU0 A;  1B46 A;  3GXA A;  2XX8 A;  4BDN A;  2RC7 A;  5AA4 A;  3U93 A;  4U2R A;  2Q89 A;  3H6V A;  4IO7 A;  3UOR A;  4GOT A;  3RT8 A;  4PET A;  1MM7 A;  2UYE A;  1IEJ A;  1MXV A;  1B3L A;  2KLF A;  1POT A;  1PBQ A;  5AA2 A;  3JV9 A;  5JTY B;  2I4C A;  4ZDM A;  1CB6 A;  3BFU A;  3G3H A;  2XXT A;  3B6Q A;  3K00 A;  4C1U A;  3LSW A;  3OMB A;  3PMX A;  1XOC A;  2Y84 A;  1H43 A;  5DVF A;  1N84 A;  4I1D A;  4OER A;  2HZL A;  3JYR A;  1MH3 A;  4IO4 A;  4ELR A;  1D9V A;  3GLB A;  1URD A;  3U1O A;  2F35 A;  4IB2 A;  2QSX A;  1ELJ A;  2Q2C A;  3T22 A;  1SW5 A;  4NF6 B;  2DXR A;  1MQH A;  3H6T A;  1Z7N E;  1B3E A;  1JW5 A;  5CM6 A;  1AOV A;  3TQL A;  3KGC A;  3CSB A;  2VD2 A;  4HTG A;  3PPP A;  2P0S A;  1VE4 A;  2UXA A;  1UIV A;  2F7A A;  4G2Z A;  5H8S A;  4AQ4 A;  1LB9 A;  4H65 A;  3JZJ A;  4OXV A;  3E13 X;  1H45 A;  1Y1M A;  3TDJ A;  3K1M A;  1SW4 A;  4DLD A;  4YB5 A;  3FJM A;  3TOD A;  5CC2 A;  3N6U A;  2O1M A;  4OFJ A;  3N94 A;  3UA8 A;  3O29 A;  1EH3 A;  3MP1 A;  4JWO A;  2I48 A;  5JEI A;  1R6Z A;  1GVC A;  3CFZ A;  5DEX A;  3T66 A;  4IGR A;  3TMG A;  4H1X A;  4KQP A;  4NE4 A;  4RPO A;  5ICT A;  4DXB A;  5I56 B;  3HN0 A;  1QUK A;  2V3Q A;  2NWJ A;  1FW0 A;  5DVI A;  4O3C A;  3MP8 A;  4PFY A;  3EN3 A;  4HCW A;  3LSX A;  2DWJ A;  3MJN A;  4BLA A;  3DM0 A;  3A09 A;  3K02 A;  2RCA A; 
#chains in the Genus database with same CATH topology
 5EYG A;  3T9U A;  4LP2 B;  1AH5 A;  1S9T A;  4N8G A;  4R74 A;  1IXC A;  4EXK A;  4N6P A;  3I5O A;  4OVQ A;  3R26 A;  4XIG Q;  2Y5K A;  3OSR A;  3FJG A;  3MBP A;  1NNF A;  3PTY A;  4F22 A;  2H25 A;  4KYD A;  5H8N A;  1B32 A;  4JVI A;  4ZS9 A;  1MPD A;  1MXZ A;  4PAK A;  5IKB A;  4OVR A;  4PAI A;  1B3H A;  4E0X A;  3OO8 A;  5T3J A;  4F19 A;  3TPA A;  1MQJ A;  5F7V A;  2AL4 A;  2Q8J A;  1YZ0 A;  3KOT A;  4P8B A;  4KD5 A;  3GYY A;  3OSQ A;  2FVZ A;  5ET6 A;  2HHM A;  3G3G A;  2FNC A;  1A55 A;  2M8C A;  5CMC A;  4I3Y A;  5FHO A;  1UTB B;  1QUJ A;  2GH9 A;  4GD5 A;  1Q9D A;  2PT1 A;  1R1N A;  2HFB A;  1A54 A;  3TFL A;  4OES A;  1RDZ A;  3MVX A;  5ITP A;  1DCU A;  3O9P A;  2X7P A;  2CZK A;  1OIB A;  4JDF A;  3KC1 A;  2XA5 A;  1FQA A;  3D4C A;  1Y1Z A;  2GQ1 A;  2DWI A;  1ZMG A;  2O84 X;  4F2Q A;  2O51 A;  1FJ9 A;  5CBS A;  3KJ7 A;  3H03 A;  4BDL A;  1M5D A;  2CEX A;  4Q8R A;  2XWO A;  4F18 A;  4QSD A;  1D9Y A;  2O68 A;  3IO6 A;  4O3B A;  1JVY A;  2CZH A;  3PU5 A;  3IB0 A;  3HV1 A;  4QSE A;  3PUV E;  2XXI A;  2PCR A;  3C32 A;  4Q5T A;  3TAJ A;  2CMO A;  1LCF A;  5CRY A;  4OEV A;  4GX6 A;  1FPI A;  4MH5 A;  3K6X A;  4KYE A;  1GGG A;  4LZ5 A;  3ILU B;  2PVU A;  4G68 A;  1Y3N A;  2LAO A;  2R71 A;  4XKQ A;  1OQH A;  1MY3 A;  3PUW E;  5EQ8 A;  4QFK A;  4JVC A;  3NOH A;  3RLF E;  5ICQ A;  2VGQ A;  3MAM A;  1XC1 A;  1LBZ A;  4JWX A;  3T1B A;  5EQA A;  1EU8 A;  1FQF A;  1B6H A;  1LAF E;  2OBG A;  2R8T A;  1FTL A;  4MMP A;  4LON B;  1FTA A;  3TKD A;  1NV6 A;  3W9V A;  1MXX A;  4KCC A;  4KHZ E;  4PFW A;  2OJT A;  3QK6 A;  2XXH A;  4U4X A;  4YIC A;  4G8H A;  5J1D A;  4N91 A;  3TTN A;  4LQ2 A;  2Q74 A;  2RKM A;  1MPB A;  2ZNT A;  4F1Y A;  1A40 A;  3RN8 A;  1P1O A;  4GL8 A;  1KWH A;  4ND9 A;  3TTL A;  1MY0 A;  4I9D A;  2OLB A;  3CRB A;  3IK6 B;  1N0T A;  4EF1 A;  1A8E A;  2I0B A;  4R72 A;  5CMK A;  4U21 A;  2NXO A;  5AA3 A;  3BKI B;  2FIE A;  2HZK A;  5EYF A;  5LDZ A;  3FGS A;  4JBZ A;  3MP6 A;  1CE2 A;  4GWX A;  4MNI A;  1B0L A;  3S9L C;  4RJZ A;  3THI A;  5F1Q A;  2ZZX A;  3V5A A;  4GXS B;  4POW A;  3PD9 A;  4R2F A;  4FEC A;  1LLS A;  1POY 1;  3KC0 A;  4XTC Q;  2WBD A;  2DOJ A;  4N15 A;  2XXX A;  1QUI A;  4M4G A;  5B70 A;  4F1U A;  1XVX A;  4N81 A;  2HPG A;  4UA8 A;  3U92 A;  5I5P A;  1EZP A;  4F31 B;  3U94 A;  3H6W A;  2P3N A;  5ET7 A;  5L9O A;  4TLL B;  3G3I A;  5M2V A;  2ZNS A;  4I62 A;  2GHA A;  4G68 C;  1NUZ A;  1SYH A;  3GBA A;  5I7I A;  5L9M A;  2ALU A;  5IZ3 A;  5ISU A;  1SYI A;  3QIM A;  4R73 A;  2R6G E;  3M3L A;  4OVS A;  3K6W A;  2XX7 A;  1FPF A;  3N6T A;  4NF8 A;  1BKA A;  1RYX A;  1PDA A;  4OYV A;  4HCY A;  1JVX A;  5L8D A;  1Q1K A;  3RY3 A;  1R9Q A;  4MNP A;  5I3S A;  1TWY A;  3VLV A;  3FV1 A;  4PDH A;  4JSO A;  4MEV A;  4Q0C A;  4YZZ A;  3LBS A;  3KFM A;  5ET8 A;  4LA9 A;  4Z0I A;  2DE4 A;  3RGY A;  1B7Z A;  5CI5 A;  5I57 A;  4OQO A;  1LBW A;  1MRP A;  2V25 A;  3BFT A;  1LFG A;  4ZZA A;  1SVX B;  2OZZ A;  1LFH A;  4XKN A;  1XT8 A;  3TCH A;  2WEF A;  2AL5 A;  1Y4T A;  4TLM B;  5TP9 B;  2A5T A;  3SZP A;  3RNN A;  1NH7 A;  4NTL A;  1VSO A;  3SES A;  1B1H A;  3ODB A;  4H45 A;  2B4L A;  3IAZ A;  3VV5 A;  2FBP A;  1VR5 A;  3D4G A;  4GXA A;  1DPP A;  2REG A;  2HAV A;  2H99 A;  4P0G A;  1TFD A;  4YKK A;  4PBQ A;  2V3T A;  4R9F A;  4GVO A;  5H8H A;  1FTO A;  2FHY A;  4C1T A;  5DTB A;  1II5 A;  3KN3 A;  4LUB A;  2Y7K A;  2G29 A;  4ZEB A;  4ZEK A;  1UIU A;  3PD8 A;  1IQ7 A;  2Z8D A;  5AA4 B;  1B2H A;  3K1N A;  4N6K A;  1QW0 A;  1XHY A;  4ECF A;  3PUX E;  1GR2 A;  1NV0 A;  2FYI A;  3A3U A;  1D3K A;  4AB6 A;  5I59 A;  4ESW A;  3PMW A;  1I6Q A;  5I2N A;  1B40 A;  4KCD A;  1P1W A;  1FJ6 A;  4K3F A;  4ONY A;  4N17 A;  4GLI A;  1WDN A;  4OMB A;  3IX1 A;  4KYS A;  2Y7I A;  4EQ7 A;  2ZNU A;  4HE0 A;  5HM4 B;  2THI A;  5AA2 B;  3FVK A;  4EDP A;  3MPL A;  4NG7 A;  2F97 A;  3KZG A;  1LAH E;  1B5J A;  1FPK A;  3I6V A;  4JVD A;  2VHA A;  1MY4 A;  1P1N A;  4JXI A;  5H8Q A;  3EQ1 A;  3RPL A;  2ESN A;  5FBP A;  4DXC A;  5AA2 D;  3PPO A;  5HBC A;  4R9G A;  2RCB A;  3KN7 A;  4LZ8 A;  5FTI A;  4N6D A;  1GTK A;  2G93 A;  4UAB A;  1URG A;  5DT6 A;  2XD2 A;  3CIJ A;  3KSX A;  3B6T A;  5L9S A;  3FZV A;  4X48 A;  3H4Z A;  2PYY A;  2KQZ A;  2JJK A;  2QPQ A;  4RNS A;  5EQ7 A;  4BDM A;  3O28 A;  2QVU A;  3MVY A;  2OWS A;  2DVZ A;  3HPI A;  3FXR A;  3RTF B;  3F11 A;  1FBG A;  3UIF A;  1JP4 A;  1IXG A;  1SBP A;  3OD7 A;  2L5V A;  3SEV A;  4P0I A;  1BIY A;  3IB1 A;  1JEV A;  3VVE A;  3G3K A;  4Z7E A;  4BDR A;  1BK4 A;  3Q28 A;  1QVS A;  1FSA A;  3K0V A;  4H0W A;  5ELV A;  4MAG A;  3UK4 A;  4ESX A;  3TEP A;  1ZIU A;  3T93 B;  1A8F A;  4NF5 A;  4PDD A;  3MST A;  2HAU A;  2DSF A;  3CG3 A;  5DEX B;  1AIV A;  1LBC A;  3LUZ A;  3FXB A;  3C4M A;  4EQ9 A;  4H8I A;  3IOU A;  4XFE A;  3VVD A;  4IO3 A;  3UP9 A;  4OFO A;  1FBF A;  4PGP A;  4GBV A;  2XXY A;  4YMA A;  5JK4 A;  2H4I A;  2GFE A;  2PBW A;  4PF6 A;  1FTK A;  4F3G A;  4ZED A;  1MM6 A;  1I6A A;  4R6H A;  3E79 A;  3LUY A;  5I2K A;  4R6K A;  1AMF A;  4X9T A;  1FQB A;  3EHS A;  2ABH A;  2Z8F A;  3PPN A;  1UQW A;  3QAX A;  2XHD A;  4F3B A;  1FPB A;  1MXW A;  5AA1 A;  2ONS A;  1NV2 A;  4PFI A;  3M3F A;  2HCA A;  3B50 A;  2OWZ A;  4R6Y A;  1LBY A;  3IJO B;  1XS5 A;  3MPK A;  3FXU A;  3C36 A;  1B4H A;  1O63 A;  5H8N B;  4ZZE A;  3KG2 A;  4DCX A;  1P1Q A;  3HHF A;  4GWW A;  4NAP A;  3HHG A;  1B5H A;  3OEN A;  2HEU A;  2P1S A;  1YCJ A;  3RT6 B;  1PC3 A;  3O97 A;  3QXM A;  2XXK A;  1NH8 A;  5EYH A;  2O6A A;  1RKM A;  2QFL A;  2QS2 A;  4X8R A;  1R9L A;  1EYJ A;  3E3K A;  4TOZ A;  4I3E A;  4R75 A;  4F29 A;  1B5I A;  4KXP A;  3TZA A;  5A5L A;  3H3G A;  3OEM A;  2QVR A;  3VLU A;  4YB7 A;  1DBZ A;  1USY E;  4FJP A;  2ZZV A;  1DPE A;  3QUF A;  4O7I A;  5ESY A;  1M5F A;  4NX1 A;  4NF4 A;  1FTJ A;  3T0J A;  5TPA A;  2VT5 A;  2IA4 A;  2XXR A;  1IZ1 A;  4AS5 A;  1H3D A;  2Z23 A;  3FBP A;  4BDQ A;  1NV5 A;  4YB6 A;  3ONM A;  1QUL A;  2QS4 A;  1LFI A;  4YKP A;  3BBR A;  1T0K A;  3PPQ A;  5TU0 A;  2PFY A;  3C34 A;  3PMV A;  4JSD A;  1FPE A;  2CZL A;  4OVP A;  4F2O A;  5KCJ A;  1QKB A;  3A29 A;  4G68 B;  1QGX A;  3LV0 A;  4E0W A;  3ISP A;  2YJP A;  3IL1 B;  3TCG A;  1LBB A;  4P1E A;  1XVY A;  3C31 A;  3RQT A;  4P56 A;  4MLV A;  3V8X B;  2AIX A;  2UYF A;  1AWB A;  3T9V A;  4Q30 B;  2IEE A;  4QFO A;  5H8F A;  1N3W A;  1VFD A;  2QJE A;  4HW8 A;  4PFB A;  3LSF B;  1TFA A;  2I4B A;  1I6B A;  1NFT A;  1N7W A;  4GWU A;  2X7Q A;  2F34 A;  1MQD A;  1SQY A;  3CFL A;  2ONR A;  4GWZ A;  3KOS A;  2DVC A;  1PB8 A;  1LGB C;  4GX4 A;  3W15 C;  5ITO A;  1M5C A;  4P9K A;  1MQG A;  2X26 A;  1IXI A;  4PCD A;  4GWS A;  4OEN A;  4YMB A;  1TXF A;  4RY1 A;  1FCK A;  1EYK A;  2QVV A;  4UAC A;  3T96 B;  4JWY A;  4PC9 A;  4G4P A;  2OCU A;  4N13 A;  5KZT A;  5IM2 A;  2QMX A;  4FED A;  2XXV A;  1SI0 A;  2O7U A;  2F6G A;  1I69 A;  4N4U A;  1Y9U A;  4PP0 A;  2A5S A;  1JW4 A;  5J16 A;  1OVT A;  4ZEF A;  4IO5 A;  5FTH A;  5I84 A;  1S7Y A;  4EQB A;  3FV2 A;  2NVU B;  1Y4C A;  5HPQ A;  5K2Y A;  1N04 A;  3HST A;  5KDT A;  2UVH A;  4U22 A;  3IFC A;  3VLW A;  3ILT B;  1IXH A;  4ELQ A;  2DE3 A;  5KDT B;  1MQI A;  4F3P A;  1LST A;  3H06 B;  4PFU A;  3PUZ E;  3L6G A;  4QRZ A;  3DP4 A;  2XXQ A;  2DDK A;  2DYX A;  3IB2 A;  2F7C A;  2ONK E;  5IZ3 B;  3OOA A;  3IO4 A;  3OXN A;  3CI8 A;  4KI0 E;  4L17 A;  4IO2 A;  2V84 A;  4HE2 A;  4MBP A;  5EHS A;  1MG1 A;  4O94 A;  2PMS A;  3KN8 A;  4P11 A;  1WOD A;  2KR0 A;  2QL3 A;  3SET A;  1SD3 A;  4NF8 B;  1INP A;  1HSE A;  3FXQ A;  2D21 A;  4ZE8 A;  3KEI A;  4FEB A;  3MW0 A;  4AB5 A;  3C9H A;  4OET A;  3SDF A;  1FPD A;  1WVJ A;  4WEP A;  3UGW A;  2VPO A;  2CZI A;  4U4S A;  2ZMB A;  1YPN A;  4THI A;  1YXI A;  3U65 A;  2Y7P A;  5EHM A;  4YAH X;  4DDD A;  3S9N C;  4NWD A;  1US5 A;  5I57 B;  2BJJ X;  3MZ9 A;  2GRV A;  3T9X B;  5A5X A;  1O64 A;  2REJ A;  4LQ5 A;  2O69 A;  3SEY A;  1YAE A;  2RIN A;  3LC8 A;  1RDX A;  3W9W A;  5A5X B;  1QKA A;  2A5T B;  1NMU A;  4GX3 A;  1DTG A;  1LAX A;  3E9X A;  1LAG E;  1LB8 A;  1NV7 A;  4G77 A;  3G3F A;  4GFR A;  2ZXT A;  3OO6 A;  5I58 A;  3S4U A;  3GZG A;  4G8N A;  1VFE A;  3FAS A;  2ZYO A;  1NUY A;  2XX9 A;  5H8H B;  4DZ1 A;  1DSN A;  1J1N A;  4QHQ A;  1KZ8 A;  3O6G A;  1M5E A;  3IOR A;  4PE3 A;  1H44 A;  5LTC A;  3K6U A;  2F78 A;  4H67 A;  4RK9 A;  4G8M A;  2WBB A;  2VD3 A;  3TUS A;  3TEL A;  2DWA A;  1IMA A;  4IY6 A;  2RC9 A;  4X1D A;  1B3G A;  4QFN A;  4GRK A;  4ZE9 A;  3DLN A;  4OA4 A;  2Y5L A;  3VVF A;  2XXW A;  4NHB A;  3CSG A;  1IUD A;  4I8C A;  4PBH A;  5I59 B;  4N07 A;  3CG1 A;  1OQG A;  1MY2 A;  4WXJ A;  5JTY A;  4M1V A;  5I2N B;  1A99 A;  3M8U A;  3SEU A;  4IO6 A;  4DI3 D;  3V89 B;  3T9H B;  1NV4 A;  1JW1 A;  2XWK A;  4H6D A;  1ZTY A;  3KBR A;  5BUU A;  3RTW B;  4C0R A;  4GWY A;  1D9Q A;  2NUV A;  3VE1 B;  3EHT A;  3ZKK A;  4XXU A;  3C35 A;  4XKR A;  5H8Q B;  1IMF A;  4RK2 A;  3RPL B;  4H46 A;  1OLA A;  2FA7 A;  3FIR A;  2H5Y A;  1OMP A;  4NF6 A;  1PBP A;  3G7W A;  2VOZ A;  3OEL A;  4DE8 A;  4X04 A;  1IIT A;  4U1O A;  3U72 A;  5F24 A;  2WKY A;  2XXU A;  2PX1 A;  4NED A;  2Q9T A;  4OTE A;  1ZKB A;  1PB7 A;  1NV3 A;  3EKI A;  3MZ1 A;  3KSJ A;  3PV0 E;  4F1V A;  1TT1 A;  4QFL A;  2WYK A;  1FPJ A;  4FIM A;  1EYI A;  2W7Y A;  2B3F A;  3G3J A;  3KJT A;  3TTM A;  1IMC A;  3MVZ A;  3Q26 A;  3SEX A;  4GWO A;  4XF5 A;  2UVG A;  3HFU A;  3LR1 A;  2O7I A;  2B65 A;  3U8Q A;  5ET5 A;  3BIH A;  1IMD A;  1JEU A;  3K6V A;  2MKZ A;  2ANJ A;  4GQO A;  1FRP A;  4I40 A;  4MLQ A;  2B4M A;  3V83 A;  1H76 A;  2D3I A;  3EF7 A;  4OAN A;  3OEK A;  3O66 A;  4GF8 A;  1G0I A;  4R2B A;  2AYS A;  2I49 A;  4IGT A;  5IAI A;  1LBV A;  5LOM A;  1M5B A;  5I56 A;  4NF5 B;  1ZBM A;  3UN6 A;  2F6P A;  1MXY A;  4OVT A;  3TTR A;  3QUJ A;  3ZKL A;  1NNT A;  1RDY A;  5B7D A;  2QRY A;  4FOR A;  4NN3 A;  4PAF A;  1Y20 A;  1IIW A;  5DYH A;  3DP8 A;  4FAT A;  1SI1 A;  2F7B A;  1SW2 A;  4QBA A;  4MNC A;  1FBH A;  1BLF A;  1B51 A;  1YYZ A;  1F9B A;  4P47 A;  3MWB A;  1B1X A;  3FJ7 A;  4NWC A;  1NUX A;  3FD3 A;  1OLC A;  4QXD A;  2DXY A;  4OZ9 A;  4MCO A;  4YKJ A;  5I2K B;  2H98 A;  3I3V A;  1D4N A;  4RYA A;  4AS4 A;  5BWJ A;  1DTZ A;  1FPL A;  2QS3 A;  2CEY A;  3E4R A;  4F39 A;  1K9Y A;  1JNF A;  2WYP A;  1MDQ A;  5DW8 A;  3QSL A;  4DCY A;  3RUM A;  3CFX A;  2QS1 A;  1BP5 A;  4X1B A;  3B6W A;  2F8D A;  3R7X A;  4ISU A;  3Q29 A;  4OFL A;  1P1U A;  3VXB A;  1SW1 A;  2O1L A;  1LCT A;  1LBX A;  1XI6 A;  3CVG A;  1Y3P A;  2Y7W A;  1QJM A;  4PE5 B;  2ZYK A;  3SKP A;  5K2X A;  2V93 A;  1GV8 A;  1NNK A;  2UVI A;  2OK2 A;  3FVO A;  3FVN A;  1UTB A;  4LZ7 A;  3O6I A;  1FBP A;  2ZZW A;  4F3S A;  4QSC A;  2HXR A;  2ZYN A;  3SEW A;  3PPR A;  4OHN A;  1P99 A;  2DE2 A;  1OVB A;  3QYT A;  4H5F A;  4P3L A;  4FE8 A;  4YKI A;  1YTV A;  4ZEC A;  3IOT A;  2HQ0 A;  4EXL A;  3IOW A;  4NF4 B;  1BTJ A;  4IR8 A;  4O8M A;  1HSJ A;  5TPA B;  3K4U A;  1SDX A;  4QFP A;  2Z8E A;  4PF8 A;  4H8J A;  2XWI A;  3WAF A;  4EF2 A;  2P2A A;  1DOT A;  1FQC A;  3CR9 A;  1NNP A;  1EZ9 A;  2XD3 A;  1DK4 A;  4NMY A;  3MZB A;  1JET A;  3VFJ A;  2DQV A;  4P1L A;  1ATG A;  4BDO A;  4RPN A;  2D5W A;  5KCJ B;  1N3X A;  1PEB A;  3DP6 A;  2GHB A;  1Y3Q A;  3H7M A;  2RF1 A;  2VPN A;  3A3C A;  3K01 A;  4OWD A;  5IGA A;  2PT2 A;  1MS7 A;  2P3V A;  4NGU A;  5IZZ A;  3B7D A;  2FIX A;  2Z22 A;  4G61 A;  2Y7R A;  3H6U A;  4GIZ A;  2Q88 A;  5H8F B;  4WKM A;  4KPT A;  1MXU A;  1ANF A;  1N7X A;  3HCQ A;  4RXL A;  2QMW A;  2YLN A;  1FBD A;  3K1P A;  3P7I A;  4PQJ A;  2V4C A;  1JQF A;  3L6H A;  4MJO A;  4N8Y A;  2ZYM A;  4O3A A;  4GL0 A;  1L5T A;  2I6E A;  3RPW A;  3Q25 A;  3S9M C;  3VXC A;  3IJX B;  1S50 A;  2F3D A;  1B05 A;  4HE1 A;  3OO9 A;  1FQD A;  4LVQ A;  3TQW A;  3WAE A;  3LSL A;  1MDP 1;  1B7H A;  2I3W A;  1MH4 A;  1USY H;  1PB9 A;  4NF0 A;  2YPN A;  2I0C A;  3S2V A;  1B9J A;  4XKP A;  4MIJ A;  4KR5 A;  2I58 A;  1N76 A;  3QMF A;  1Z7M E;  4U1Z A;  4LAT A;  2E0S A;  4PTK A;  3DEL B;  5AE4 A;  1FBE A;  3D1R A;  3MVW A;  4RA1 A;  1AL3 A;  2H9B A;  1B0H A;  4FAJ A;  4JB7 A;  3FVG A;  4ZEI A;  4NQ8 A;  1B7U A;  3MYU A;  3TTK A;  3K2D A;  2R9J A;  4POX A;  4WED A;  4HS7 A;  2V3U A;  2PFZ A;  3IFA A;  4YU0 A;  3CHG A;  3MC2 A;  1B3F A;  2UVJ A;  3AXF A;  3VDF A;  5IZ1 A;  3ZS6 A;  4DIG A;  1B4Z A;  3FUZ A;  3MQ9 A;  1ZJL A;  5CMB A;  1MPC A;  3M3K A;  2XXP A;  5CMM A;  2Q2A A;  1DMB A;  2DP8 A;  1IMB A;  3ZSF A;  1VDW A;  2F3B A;  1NI9 A;  2F5X A;  3IOV A;  3HO7 A;  5CBR A;  3O2A A;  4LN5 A;  3N5L A;  1FTM A;  4DI4 B;  4ELP A;  1EZO A;  3PUY E;  1UTH A;  2DS9 A;  4IY5 A;  1UTH B;  4O7M A;  4ELO A;  2E1S A;  2I3V A;  1RYO A;  3EPE A;  3PGF A;  5FHM A;  4OVJ A;  1ZLQ A;  4FBP A;  2F36 A;  3TYH A;  1URS A;  3SER A;  1B58 A;  1NL5 A;  2VP1 A;  4TQU Q;  1Q35 A;  5TP9 A;  2WX9 A;  1HSL A;  4MFI A;  2B3B A;  1FPG A;  2RC8 A;  1NKX A;  5FHN A;  3EHU A;  3R6U A;  4U23 A;  5DVJ A;  3N26 A;  1LEV A;  3Q27 A;  2OWT A;  1NUW A;  3MUQ A;  3RYD A;  3USD A;  4MF3 A;  3FAT A;  3IR1 A;  1FQE A;  1MY1 A;  3O6H A;  2NOO A;  3C33 A;  4QF9 A;  1A7L A;  3ECR A;  4OEU A;  4EUO A;  2DWH A;  1B52 A;  4H5G A;  4PFT A;  3GBB A;  1US4 A;  2HXW A;  3OO7 A;  1O7T A;  4KFQ A;  3S9E A;  4DXU A;  3BIG A;  5I58 B;  3TCF A;  1ZU0 A;  1B46 A;  3GXA A;  2XX8 A;  4BDN A;  2RC7 A;  5AA4 A;  3U93 A;  4U2R A;  2Q89 A;  3H6V A;  4IO7 A;  3UOR A;  4GOT A;  3RT8 A;  4PET A;  1IME A;  1MM7 A;  4PGN A;  2UYE A;  1FBC A;  2OX3 A;  1IEJ A;  1MXV A;  1B3L A;  2KLF A;  3ROJ A;  1NV1 A;  1POT A;  1PBQ A;  5AA2 A;  3JV9 A;  5JTY B;  2I4C A;  4ZDM A;  2Q8M A;  1CB6 A;  3BFU A;  3G3H A;  2XXT A;  3B6Q A;  3K00 A;  4C1U A;  4MX6 A;  3LSW A;  3OMB A;  3PMX A;  1XOC A;  2Y84 A;  1H43 A;  5DVF A;  1N84 A;  4I1D A;  4OER A;  2HZL A;  3JYR A;  1MH3 A;  4IO4 A;  4ELR A;  1D9V A;  3GLB A;  1URD A;  3U1O A;  2F35 A;  2BJI A;  4IB2 A;  2QSX A;  5EQ9 A;  1ELJ A;  2Q2C A;  1G0H A;  3T22 A;  1SW5 A;  4NF6 B;  2DXR A;  1MQH A;  3H6T A;  1Z7N E;  1B3E A;  1JW5 A;  5CM6 A;  1AOV A;  3TQL A;  3KGC A;  3CSB A;  2VD2 A;  4HTG A;  3PPP A;  2P0S A;  1VE4 A;  2UXA A;  1UIV A;  2F7A A;  4G2Z A;  4PFR A;  5H8S A;  4AQ4 A;  1K9Z A;  1LB9 A;  4H65 A;  3JZJ A;  4OXV A;  3E13 X;  1H45 A;  1Y1M A;  3TDJ A;  3K1M A;  1SW4 A;  4DLD A;  4YB5 A;  3FJM A;  3B8B A;  3TOD A;  5CC2 A;  3N6U A;  2XWV A;  4GBW A;  2O1M A;  4OFJ A;  1KA0 A;  3N94 A;  4XEQ A;  3UA8 A;  3O29 A;  1EH3 A;  3MP1 A;  4JWO A;  2I48 A;  1CNQ A;  5JEI A;  1R6Z A;  1GVC A;  3CFZ A;  5DEX A;  3T66 A;  4IGR A;  3E78 A;  3TMG A;  4H1X A;  4HXV A;  4KQP A;  4NE4 A;  4RPO A;  1SPI A;  5ICT A;  4DXB A;  5I56 B;  1KA1 A;  1QUK A;  3HN0 A;  3KBZ A;  2V3Q A;  2NWJ A;  1FW0 A;  5DVI A;  4O3C A;  3MP8 A;  4PFY A;  3EN3 A;  4HCW A;  4MHF A;  3LSX A;  2DWJ A;  3MJN A;  4BLA A;  3DM0 A;  3A09 A;  3K02 A;  2RCA A; 
#chains in the Genus database with same CATH homology
 3T9U A;  4LP2 B;  1AH5 A;  1S9T A;  4R74 A;  1IXC A;  4EXK A;  4N6P A;  3I5O A;  3R26 A;  4XIG Q;  3OSR A;  3FJG A;  3MBP A;  1NNF A;  4F22 A;  2H25 A;  4KYD A;  5H8N A;  1B32 A;  4ZS9 A;  1MPD A;  1MXZ A;  5IKB A;  1B3H A;  4E0X A;  3OO8 A;  4F19 A;  3TPA A;  1MQJ A;  5F7V A;  2AL4 A;  2Q8J A;  3KOT A;  4KD5 A;  3OSQ A;  3G3G A;  2FNC A;  1A55 A;  2M8C A;  5CMC A;  5FHO A;  1UTB B;  1QUJ A;  2GH9 A;  4GD5 A;  2PT1 A;  1R1N A;  2HFB A;  1A54 A;  3TFL A;  4OES A;  3MVX A;  5ITP A;  3O9P A;  2X7P A;  1OIB A;  4JDF A;  1FQA A;  3D4C A;  1Y1Z A;  2DWI A;  1ZMG A;  2O84 X;  4F2Q A;  2O51 A;  5CBS A;  3KJ7 A;  3H03 A;  4BDL A;  1M5D A;  4Q8R A;  4F18 A;  4QSD A;  1D9Y A;  2O68 A;  3IO6 A;  4O3B A;  1JVY A;  3PU5 A;  3IB0 A;  3HV1 A;  4QSE A;  3PUV E;  2XXI A;  3C32 A;  4Q5T A;  3TAJ A;  2CMO A;  1LCF A;  5CRY A;  4OEV A;  4MH5 A;  3K6X A;  4KYE A;  1GGG A;  4LZ5 A;  3ILU B;  2PVU A;  4G68 A;  1Y3N A;  2LAO A;  2R71 A;  4XKQ A;  1OQH A;  1MY3 A;  3PUW E;  4QFK A;  3RLF E;  5ICQ A;  2VGQ A;  3MAM A;  1XC1 A;  4JWX A;  1EU8 A;  1FQF A;  1B6H A;  1LAF E;  2OBG A;  1FTL A;  4LON B;  3TKD A;  3W9V A;  1MXX A;  4KCC A;  4KHZ E;  4PFW A;  2OJT A;  3QK6 A;  2XXH A;  4U4X A;  4YIC A;  4G8H A;  5J1D A;  3TTN A;  4LQ2 A;  2RKM A;  1MPB A;  2ZNT A;  4F1Y A;  1A40 A;  3RN8 A;  1P1O A;  4GL8 A;  1KWH A;  4ND9 A;  3TTL A;  1MY0 A;  4I9D A;  2OLB A;  3CRB A;  3IK6 B;  1N0T A;  4EF1 A;  1A8E A;  2I0B A;  4R72 A;  5CMK A;  4U21 A;  2NXO A;  5AA3 A;  3BKI B;  2HZK A;  5EYF A;  3FGS A;  4JBZ A;  3MP6 A;  1CE2 A;  1B0L A;  3S9L C;  4RJZ A;  3THI A;  5F1Q A;  3V5A A;  4GXS B;  4POW A;  3PD9 A;  4R2F A;  4FEC A;  1LLS A;  1POY 1;  4XTC Q;  2DOJ A;  2XXX A;  1QUI A;  4M4G A;  5B70 A;  4F1U A;  1XVX A;  4UA8 A;  3U92 A;  1EZP A;  4F31 B;  3U94 A;  3H6W A;  5L9O A;  4TLL B;  3G3I A;  5M2V A;  2ZNS A;  4I62 A;  2GHA A;  4G68 C;  1SYH A;  3GBA A;  5L9M A;  2ALU A;  5ISU A;  1SYI A;  3QIM A;  4R73 A;  2R6G E;  3M3L A;  3K6W A;  2XX7 A;  3N6T A;  4NF8 A;  1BKA A;  1RYX A;  1PDA A;  4OYV A;  4HCY A;  1JVX A;  5L8D A;  1Q1K A;  3RY3 A;  1R9Q A;  1TWY A;  3VLV A;  3FV1 A;  4JSO A;  4Q0C A;  4YZZ A;  3LBS A;  3KFM A;  4LA9 A;  4Z0I A;  2DE4 A;  3RGY A;  1B7Z A;  5CI5 A;  5I57 A;  4OQO A;  1MRP A;  2V25 A;  3BFT A;  1LFG A;  4ZZA A;  1SVX B;  2OZZ A;  1LFH A;  4XKN A;  1XT8 A;  3TCH A;  2AL5 A;  1Y4T A;  4TLM B;  5TP9 B;  2A5T A;  3RNN A;  1NH7 A;  4NTL A;  1VSO A;  3SES A;  1B1H A;  3ODB A;  3IAZ A;  3VV5 A;  1VR5 A;  3D4G A;  4GXA A;  1DPP A;  2REG A;  2HAV A;  2H99 A;  4P0G A;  1TFD A;  4YKK A;  2V3T A;  4R9F A;  4GVO A;  5H8H A;  1FTO A;  4C1T A;  5DTB A;  1II5 A;  3KN3 A;  4LUB A;  2Y7K A;  2G29 A;  4ZEB A;  4ZEK A;  1UIU A;  3PD8 A;  1IQ7 A;  2Z8D A;  5AA4 B;  1B2H A;  3K1N A;  1QW0 A;  1XHY A;  4ECF A;  3PUX E;  1GR2 A;  2FYI A;  3A3U A;  1D3K A;  4AB6 A;  5I59 A;  4ESW A;  3PMW A;  1I6Q A;  5I2N A;  1B40 A;  4KCD A;  1P1W A;  4K3F A;  4ONY A;  4GLI A;  1WDN A;  4OMB A;  3IX1 A;  4KYS A;  2Y7I A;  4EQ7 A;  2ZNU A;  5HM4 B;  2THI A;  5AA2 B;  3FVK A;  4EDP A;  3MPL A;  2F97 A;  3KZG A;  1LAH E;  1B5J A;  3I6V A;  2VHA A;  1MY4 A;  1P1N A;  4JXI A;  5H8Q A;  3EQ1 A;  2ESN A;  4DXC A;  5AA2 D;  3PPO A;  5HBC A;  4R9G A;  2RCB A;  3KN7 A;  4LZ8 A;  5FTI A;  1GTK A;  2G93 A;  1URG A;  5DT6 A;  2XD2 A;  3CIJ A;  3KSX A;  3B6T A;  5L9S A;  3FZV A;  4X48 A;  3H4Z A;  2PYY A;  2QPQ A;  4RNS A;  4BDM A;  3O28 A;  3MVY A;  2OWS A;  2DVZ A;  3HPI A;  3FXR A;  3RTF B;  3F11 A;  3UIF A;  1IXG A;  1SBP A;  3OD7 A;  3SEV A;  4P0I A;  1BIY A;  3IB1 A;  1JEV A;  3VVE A;  3G3K A;  4Z7E A;  4BDR A;  3Q28 A;  1QVS A;  3K0V A;  4H0W A;  5ELV A;  3UK4 A;  4ESX A;  3TEP A;  1ZIU A;  3T93 B;  1A8F A;  4NF5 A;  2HAU A;  2DSF A;  3CG3 A;  5DEX B;  1AIV A;  1LBC A;  3C4M A;  4EQ9 A;  4H8I A;  3IOU A;  3VVD A;  4IO3 A;  3UP9 A;  4OFO A;  2XXY A;  4YMA A;  5JK4 A;  2H4I A;  2GFE A;  2PBW A;  1FTK A;  4ZED A;  4F3G A;  1MM6 A;  1I6A A;  4R6H A;  3LUY A;  5I2K A;  4R6K A;  1AMF A;  4X9T A;  1FQB A;  3EHS A;  2ABH A;  2Z8F A;  3PPN A;  1UQW A;  3QAX A;  2XHD A;  4F3B A;  1MXW A;  5AA1 A;  2ONS A;  3M3F A;  2HCA A;  4R6Y A;  3IJO B;  1XS5 A;  3MPK A;  3FXU A;  3C36 A;  1B4H A;  1O63 A;  5H8N B;  4ZZE A;  3KG2 A;  4DCX A;  1P1Q A;  3HHF A;  3HHG A;  1B5H A;  3OEN A;  2HEU A;  2P1S A;  1YCJ A;  3RT6 B;  1PC3 A;  3O97 A;  3QXM A;  1NH8 A;  2O6A A;  1RKM A;  2QS2 A;  1R9L A;  4TOZ A;  3E3K A;  4R75 A;  4F29 A;  1B5I A;  3TZA A;  3H3G A;  3OEM A;  3VLU A;  4YB7 A;  1USY E;  4FJP A;  1DPE A;  3QUF A;  1M5F A;  4NF4 A;  1FTJ A;  5TPA A;  2IA4 A;  2XXR A;  1IZ1 A;  1H3D A;  2Z23 A;  4BDQ A;  4YB6 A;  3ONM A;  1QUL A;  2QS4 A;  1LFI A;  4YKP A;  3BBR A;  1T0K A;  3PPQ A;  5TU0 A;  3C34 A;  3PMV A;  4JSD A;  2CZL A;  4F2O A;  5KCJ A;  1QKB A;  4G68 B;  4E0W A;  2YJP A;  3IL1 B;  3TCG A;  1LBB A;  1XVY A;  3C31 A;  3RQT A;  4MLV A;  3V8X B;  2AIX A;  2UYF A;  3T9V A;  4Q30 B;  2IEE A;  4QFO A;  5H8F A;  1N3W A;  1VFD A;  2QJE A;  4HW8 A;  3LSF B;  1TFA A;  2I4B A;  1I6B A;  1NFT A;  1N7W A;  2X7Q A;  2F34 A;  1MQD A;  1SQY A;  3CFL A;  2ONR A;  3KOS A;  2DVC A;  1PB8 A;  1LGB C;  3W15 C;  5ITO A;  1M5C A;  1MQG A;  2X26 A;  1IXI A;  4OEN A;  4YMB A;  1TXF A;  4RY1 A;  1FCK A;  4UAC A;  3T96 B;  4JWY A;  4G4P A;  2OCU A;  4N13 A;  5KZT A;  2QMX A;  4FED A;  2XXV A;  1SI0 A;  2O7U A;  2F6G A;  1I69 A;  1Y9U A;  4PP0 A;  2A5S A;  1JW4 A;  1OVT A;  4ZEF A;  4IO5 A;  5FTH A;  5I84 A;  1S7Y A;  4EQB A;  3FV2 A;  2NVU B;  1Y4C A;  5HPQ A;  5K2Y A;  1N04 A;  3HST A;  5KDT A;  2UVH A;  4U22 A;  3VLW A;  3ILT B;  1IXH A;  4ELQ A;  2DE3 A;  5KDT B;  1MQI A;  4F3P A;  1LST A;  3H06 B;  4PFU A;  3PUZ E;  3L6G A;  4QRZ A;  3DP4 A;  2XXQ A;  2DYX A;  3IB2 A;  2F7C A;  2ONK E;  3OOA A;  3IO4 A;  3OXN A;  3CI8 A;  4KI0 E;  4L17 A;  4IO2 A;  2V84 A;  4MBP A;  5EHS A;  1MG1 A;  2PMS A;  3KN8 A;  4P11 A;  1WOD A;  2QL3 A;  3SET A;  1SD3 A;  4NF8 B;  1HSE A;  3FXQ A;  2D21 A;  4ZE8 A;  3KEI A;  4FEB A;  3MW0 A;  4AB5 A;  3C9H A;  4OET A;  3SDF A;  1WVJ A;  4WEP A;  3UGW A;  4U4S A;  2ZMB A;  1YPN A;  4THI A;  2Y7P A;  5EHM A;  4YAH X;  4DDD A;  3S9N C;  4NWD A;  1US5 A;  5I57 B;  2BJJ X;  3MZ9 A;  2GRV A;  3T9X B;  5A5X A;  1O64 A;  2REJ A;  4LQ5 A;  2O69 A;  3SEY A;  1YAE A;  2RIN A;  3LC8 A;  3W9W A;  5A5X B;  1QKA A;  2A5T B;  1NMU A;  1DTG A;  1LAX A;  3E9X A;  1LAG E;  1LB8 A;  4G77 A;  3G3F A;  4GFR A;  2ZXT A;  3OO6 A;  5I58 A;  3S4U A;  3GZG A;  4G8N A;  1VFE A;  3FAS A;  2ZYO A;  2XX9 A;  5H8H B;  4DZ1 A;  1DSN A;  1J1N A;  4QHQ A;  3O6G A;  1M5E A;  3IOR A;  1H44 A;  3K6U A;  2F78 A;  4H67 A;  4RK9 A;  4G8M A;  2VD3 A;  3TUS A;  3TEL A;  2DWA A;  4IY6 A;  2RC9 A;  4X1D A;  1B3G A;  4QFN A;  4GRK A;  4ZE9 A;  3DLN A;  3VVF A;  2XXW A;  3CSG A;  1IUD A;  4I8C A;  5I59 B;  4N07 A;  3CG1 A;  1OQG A;  1MY2 A;  4WXJ A;  5JTY A;  4M1V A;  5I2N B;  1A99 A;  3M8U A;  3SEU A;  4IO6 A;  3V89 B;  3T9H B;  1JW1 A;  4H6D A;  1ZTY A;  3KBR A;  5BUU A;  3RTW B;  4C0R A;  2NUV A;  3VE1 B;  3EHT A;  3ZKK A;  4XXU A;  3C35 A;  4XKR A;  5H8Q B;  4RK2 A;  1OLA A;  2FA7 A;  3FIR A;  2H5Y A;  1OMP A;  4NF6 A;  1PBP A;  3G7W A;  2VOZ A;  3OEL A;  4DE8 A;  1IIT A;  4U1O A;  3U72 A;  2WKY A;  2XXU A;  2PX1 A;  4NED A;  2Q9T A;  4OTE A;  1ZKB A;  1PB7 A;  3MZ1 A;  3KSJ A;  3PV0 E;  4F1V A;  1TT1 A;  4QFL A;  4FIM A;  2W7Y A;  2B3F A;  3G3J A;  3KJT A;  3TTM A;  3MVZ A;  3Q26 A;  3SEX A;  4GWO A;  2UVG A;  3LR1 A;  2O7I A;  2B65 A;  3U8Q A;  1JEU A;  3K6V A;  2ANJ A;  4GQO A;  4MLQ A;  3V83 A;  1H76 A;  2D3I A;  3EF7 A;  3OEK A;  3O66 A;  4GF8 A;  4R2B A;  2AYS A;  2I49 A;  4IGT A;  5IAI A;  5LOM A;  1M5B A;  5I56 A;  4NF5 B;  1ZBM A;  3UN6 A;  2F6P A;  1MXY A;  3TTR A;  3QUJ A;  3ZKL A;  1NNT A;  5B7D A;  2QRY A;  4FOR A;  1Y20 A;  1IIW A;  5DYH A;  3DP8 A;  4FAT A;  1SI1 A;  2F7B A;  1SW2 A;  1BLF A;  1B51 A;  1F9B A;  3MWB A;  1B1X A;  3FJ7 A;  4NWC A;  3FD3 A;  1OLC A;  2DXY A;  4OZ9 A;  4YKJ A;  5I2K B;  2H98 A;  3I3V A;  1D4N A;  4RYA A;  5BWJ A;  1DTZ A;  2QS3 A;  3E4R A;  4F39 A;  1JNF A;  1MDQ A;  3QSL A;  4DCY A;  3RUM A;  3CFX A;  2QS1 A;  1BP5 A;  4X1B A;  3B6W A;  2F8D A;  3R7X A;  4ISU A;  3Q29 A;  4OFL A;  1P1U A;  3VXB A;  1SW1 A;  2O1L A;  1LCT A;  3CVG A;  1Y3P A;  2Y7W A;  1QJM A;  4PE5 B;  2ZYK A;  3SKP A;  5K2X A;  2V93 A;  1GV8 A;  1NNK A;  2UVI A;  2OK2 A;  3FVO A;  3FVN A;  1UTB A;  4LZ7 A;  3O6I A;  4F3S A;  4QSC A;  2ZYN A;  3SEW A;  3PPR A;  4OHN A;  1P99 A;  2DE2 A;  1OVB A;  3QYT A;  4H5F A;  4FE8 A;  4YKI A;  1YTV A;  4ZEC A;  3IOT A;  2HQ0 A;  4EXL A;  3IOW A;  4NF4 B;  1BTJ A;  1HSJ A;  5TPA B;  3K4U A;  1SDX A;  4QFP A;  2Z8E A;  4H8J A;  4EF2 A;  3WAF A;  2P2A A;  1DOT A;  1FQC A;  3CR9 A;  1NNP A;  1EZ9 A;  2XD3 A;  4NMY A;  3MZB A;  1JET A;  3VFJ A;  2DQV A;  1ATG A;  4BDO A;  4RPN A;  2D5W A;  5KCJ B;  1N3X A;  1PEB A;  3DP6 A;  2GHB A;  1Y3Q A;  3H7M A;  2RF1 A;  3A3C A;  3K01 A;  4OWD A;  2PT2 A;  1MS7 A;  3B7D A;  2Z22 A;  2Y7R A;  3H6U A;  4GIZ A;  2Q88 A;  5H8F B;  4WKM A;  4KPT A;  1MXU A;  1ANF A;  1N7X A;  3HCQ A;  4RXL A;  2QMW A;  2YLN A;  3K1P A;  3P7I A;  4PQJ A;  1JQF A;  3L6H A;  2ZYM A;  4O3A A;  4GL0 A;  1L5T A;  2I6E A;  3RPW A;  3Q25 A;  3S9M C;  3VXC A;  3IJX B;  1S50 A;  1B05 A;  3OO9 A;  1FQD A;  4LVQ A;  3TQW A;  3WAE A;  3LSL A;  1MDP 1;  1B7H A;  2I3W A;  1MH4 A;  1USY H;  1PB9 A;  2YPN A;  2I0C A;  3S2V A;  1B9J A;  4XKP A;  4KR5 A;  2I58 A;  1N76 A;  1Z7M E;  4U1Z A;  4LAT A;  2E0S A;  3DEL B;  5AE4 A;  3MVW A;  4RA1 A;  1AL3 A;  2H9B A;  1B0H A;  4FAJ A;  4JB7 A;  3FVG A;  4ZEI A;  1B7U A;  3TTK A;  3K2D A;  2R9J A;  4POX A;  4WED A;  4HS7 A;  2V3U A;  4YU0 A;  3MC2 A;  1B3F A;  2UVJ A;  3AXF A;  3VDF A;  3ZS6 A;  4DIG A;  1B4Z A;  3FUZ A;  3MQ9 A;  1ZJL A;  5CMB A;  1MPC A;  3M3K A;  2XXP A;  5CMM A;  2Q2A A;  1DMB A;  2DP8 A;  3ZSF A;  2F5X A;  3IOV A;  3HO7 A;  5CBR A;  3O2A A;  3N5L A;  1FTM A;  4ELP A;  1EZO A;  3PUY E;  1UTH A;  2DS9 A;  4IY5 A;  1UTH B;  4ELO A;  2E1S A;  2I3V A;  1RYO A;  3EPE A;  3PGF A;  5FHM A;  4OVJ A;  1ZLQ A;  2F36 A;  3TYH A;  1URS A;  3SER A;  1B58 A;  1NL5 A;  2VP1 A;  4TQU Q;  1Q35 A;  5TP9 A;  1HSL A;  4MFI A;  2B3B A;  2RC8 A;  1NKX A;  5FHN A;  3EHU A;  3R6U A;  4U23 A;  5DVJ A;  3N26 A;  3Q27 A;  2OWT A;  3MUQ A;  3USD A;  4MF3 A;  3FAT A;  3IR1 A;  1FQE A;  1MY1 A;  3O6H A;  2NOO A;  3C33 A;  4QF9 A;  1A7L A;  3ECR A;  4OEU A;  4EUO A;  2DWH A;  1B52 A;  4H5G A;  4PFT A;  3GBB A;  1US4 A;  2HXW A;  3OO7 A;  1O7T A;  4KFQ A;  3S9E A;  4DXU A;  5I58 B;  3TCF A;  1ZU0 A;  1B46 A;  3GXA A;  2XX8 A;  4BDN A;  2RC7 A;  5AA4 A;  3U93 A;  4U2R A;  2Q89 A;  3H6V A;  4IO7 A;  3UOR A;  4GOT A;  3RT8 A;  4PET A;  1MM7 A;  2UYE A;  1IEJ A;  1MXV A;  1B3L A;  2KLF A;  1POT A;  1PBQ A;  5AA2 A;  3JV9 A;  5JTY B;  2I4C A;  4ZDM A;  1CB6 A;  3BFU A;  3G3H A;  2XXT A;  3B6Q A;  3K00 A;  4C1U A;  3LSW A;  3OMB A;  3PMX A;  1XOC A;  2Y84 A;  1H43 A;  5DVF A;  1N84 A;  4I1D A;  4OER A;  2HZL A;  3JYR A;  1MH3 A;  4IO4 A;  4ELR A;  1D9V A;  3GLB A;  1URD A;  3U1O A;  2F35 A;  4IB2 A;  2QSX A;  1ELJ A;  2Q2C A;  3T22 A;  1SW5 A;  4NF6 B;  2DXR A;  1MQH A;  3H6T A;  1Z7N E;  1B3E A;  1JW5 A;  5CM6 A;  1AOV A;  3TQL A;  3KGC A;  3CSB A;  2VD2 A;  4HTG A;  3PPP A;  2P0S A;  1VE4 A;  2UXA A;  1UIV A;  2F7A A;  4G2Z A;  5H8S A;  4AQ4 A;  1LB9 A;  4H65 A;  3JZJ A;  4OXV A;  3E13 X;  1H45 A;  1Y1M A;  3TDJ A;  3K1M A;  1SW4 A;  4DLD A;  4YB5 A;  3FJM A;  3TOD A;  5CC2 A;  3N6U A;  2O1M A;  4OFJ A;  3N94 A;  3UA8 A;  3O29 A;  1EH3 A;  3MP1 A;  4JWO A;  2I48 A;  5JEI A;  1R6Z A;  1GVC A;  3CFZ A;  5DEX A;  3T66 A;  4IGR A;  3TMG A;  4H1X A;  4KQP A;  4NE4 A;  4RPO A;  5ICT A;  4DXB A;  5I56 B;  3HN0 A;  1QUK A;  2V3Q A;  2NWJ A;  1FW0 A;  5DVI A;  4O3C A;  3MP8 A;  4PFY A;  3EN3 A;  4HCW A;  3LSX A;  2DWJ A;  3MJN A;  4BLA A;  3DM0 A;  3A09 A;  3K02 A;  2RCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...