4GXAA

Crystal structure of sulfate free form of cysb, a member of lysr family from salmonella typhimurium lt2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Sulfate free form of CYSB, a member of LysR family from Salmonella typhimurium LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator CysB
total genus 61
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gxaA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gxaA02
1P1QA 2Y7RA 1B3HA 1MY2A 5DT6A 2Y7IA 3C9HA 5AA3A 3MBPA 3SEUA 1EZOA 5TPAB 3S9MC 4PFTA 2GRVA 3D4CA 3VE1B 4F2OA 2XX9A 2W7YA 1QVSA 1FCKA 1B3GA 3E4RA 2I3VA 5ITPA 4Z7EA 2HAVA 4H1XA 5CMMA 1LAGE 1UTBB 3FXUA 5EYFA 2Z8DA 3RN8A 3T93B 1JW5A 4GIZA 4YB5A 3IJOB 1MPBA 1N84A 1D9YA 3OO6A 2V3QA 3A09A 4GXSB 3M3FA 4O3CA 1MY3A 5AA4A 1MXUA 5FHNA 1JVYA 1O7TA 2H4IA 3FVKA 2ZNSA 1B7ZA 1NFTA 3PGFA 2B3BA 4F29A 4FE8A 4G68B 1D3KA 3C35A 1P1OA 4NMYA 1MH4A 1Y3PA 4NF8A 2NWJA 4Q8RA 3H6UA 4F2QA 4U22A 5DEXB 3ILUB 4C1UA 3H03A 5DTBA 3AXFA 3HV1A 3S2VA 1ZIUA 3E3KA 4HCWA 5KZTA 1FTLA 3OEMA 2O68A 1XHYA 3N5LA 4BLAA 1TT1A 1ZLQA 3OEKA 4XKPA 2F5XA 5DVIA 3THIA 4NF6A 1TWYA 3TCFA 2ALUA 3LSLA 3TTNA 2V3TA 2YJPA 1B58A 4BDQA 1GTKA 4Q5TA 4YZZA 3ZKKA 1FTMA 1NH7A 5I58A 1LCFA 4BDOA 3RT6B 3HHGA 3O6HA 2XXVA 4LZ7A 1AH5A 1MY4A 4RA1A 5H8NA 1SI0A 4OFOA 2PBWA 3FIRA 3K4UA 3B6TA 4ESXA 1AMFA 4H8JA 4JWYA 4OEUA 4N6PA 2VD3A 3OD7A 4RK2A 4NF4B 2ONKE 5FHOA 5DVFA 2O1MA 3PUVE 3HO7A 4QFOA 5A5XA 3IB2A 4OETA 1VR5A 5CMCA 2F8DA 4QFNA 2P1SA 4R6KA 5K2XA 5ICTA 2V84A 2XXTA 1POTA 4R9GA 3BFTA 2PMSA 4ZE9A 1LFHA 2PVUA 1OVBA 1QULA 2UVHA 4I62A 4GRKA 4PFUA 3ONMA 3R6UA 4KYSA 3H6VA 4DCXA 4YICA 2A5TA 1DPPA 3TCHA 1JETA 1MQHA 1N3WA 4G68C 4ELPA 3PPRA 2B3FA 4E0XA 3PMVA 5H8FA 2ZNTA 1Y3NA 1Y9UA 4G8HA 4U2RA 4EQBA 1B4ZA 4F18A 4DIGA 4GVOA 2Q2AA 1JW4A 1JQFA 1SW4A 3LSFB 4KHZE 4ZEIA 1SW2A 3PMXA 3UK4A 3U1OA 4LQ5A 2RC8A 3DELB 2DVZA 1NNTA 3TEPA 5AA1A 2Q89A 3CSGA 3EF7A 3KN7A 1YPNA 5IKBA 1N04A 3G3HA 4H0WA 1SW1A 2AIXA 3TAJA 1XT8A 4FEBA 3T9HB 1MG1A 2BJJX 5AE4A 2F35A 4KYEA 1YTVA 1ZKBA 2QMXA 1IXGA 2FNCA 3O28A 3FV2A 4WEPA 3SEYA 1OLCA 2UXAA 3G7WA 4EF1A 4PQJA 5TU0A 1DMBA 4QSCA 4FATA 2HXWA 2Q2CA 2ESNA 4NF5B 2OJTA 2ZNUA 4POWA 3IOWA 1XS5A 1R9LA 1IXCA 3KOTA 3PPNA 1MXXA 2F36A 2QRYA 5HBCA 3PU5A 4H5FA 1B5IA 1JNFA 4JSDA 1VFDA 1URSA 3LUYA 5H8QB 5CRYA 1LCTA 1PB7A 4U4XA 3MZ1A 2DWIA 4RY1A 2H25A 2DS9A 1FTKA 2IA4A 1Y3QA 4KD5A 1N76A 3PPOA 1B32A 2I6EA 2Q8JA 4G4PA 4ESWA 4JXIA 4I1DA 2NVUB 3JYRA 1B40A 3RGYA 3VXBA 2VP1A 3SERA 3WAEA 1BTJA 2QPQA 3HCQA 3M3KA 1P1NA 5JTYA 5KDTB 1DSNA 4E0WA 4YB6A 4GQOA 3V8XB 1H43A 4NE4A 4F3BA 4UA8A 4M1VA 5HPQA 2G29A 4ELQA 1MPCA 1FQCA 1ZMGA 2HCAA 3VLUA 1Y1ZA 2XXQA 1B3FA 1H44A 1A7LA 2I4CA 2ZYNA 3M8UA 3K6VA 1UQWA 4EQ9A 2O84X 1SQYA 1YAEA 3H7MA 3MZ9A 2QJEA 3PUZE 3RY3A 3VLVA 5IAIA 3RT8A 1ELJA 3RTFB 1USYH 2DXRA 2F7BA 2I4BA 4JDFA 1MY1A 1PDAA 4F1UA 1AL3A 4I9DA 4IO4A 1MRPA 3JZJA 3M3LA 2CMOA 1IEJA 4GWOA 1BLFA 1FTOA 2ZYMA 3SDFA 2I48A 4ND9A 3VLWA 3MWBA 5ITOA 3EHUA 3VXCA 2V3UA 4DXCA 1PC3A 4PETA 4IB2A 1IQ7A 3PUYE 5F1QA 4IO3A 1LAFE 4IO6A 1I6AA 4DXBA 2OCUA 1HSLA 2I58A 3FASA 4U23A 1JEVA 2D3IA 4PE5B 1GVCA 3DM0A 4LATA 4ZZEA 1MXVA 1SVXB 3P7IA 1FQBA 4HTGA 4HW8A 1R6ZA 1LBBA 4U1ZA 2V25A 2Z22A 3CSBA 3K6XA 4H8IA 4JWOA 2UYEA 3O9PA 4R2FA 5F7VA 1B1HA 2O51A 1DOTA 3I6VA 4BDRA 1UTBA 4BDLA 1B51A 1S9TA 1SBPA 4H5GA 3FVNA 4MFIA 3MVWA 3N94A 2Z8FA 2F7CA 3T9VA 3TMGA 1IIWA 2P2AA 2XX7A 3LBSA 1J1NA 2GHAA 2HZKA 2NUVA 3MP1A 4OTEA 3T96B 3U94A 2HEUA 3Q26A 3TTLA 1SD3A 2F7AA 2R9JA 1DPEA 1FQDA 3VFJA 4EDPA 1LB8A 1MY0A 1P1UA 2XXHA 4YKIA 1EZPA 2XD2A 3KJ7A 3B6WA 3JV9A 3B6QA 4O3BA 4GL0A 2YPNA 3QAXA 3H6WA 3TQLA 3C4MA 3VV5A 1MXZA 1NMUA 1SW5A 1T0KA 4DZ1A 3H3GA 5CMKA 3FD3A 3K1NA 1Z7NE 1OQHA 4QFKA 1WVJA 3T22A 4IGTA 2IEEA 2GH9A 1IZ1A 3TCGA 2FA7A 2DP8A 3PD8A 5FTHA 2RF1A 3G3JA 5I2KB 4KR5A 4QHQA 5I2NA 3S9LC 5ISUA 4JWXA 3VVDA 3GBBA 4GD5A 3QUFA 4ISUA 4R74A 3FVOA 3ZSFA 1OVTA 4EQ7A 3OOAA 5TP9A 3DLNA 1MH3A 3K0VA 4RNSA 3OO9A 4QFPA 4FECA 4OFLA 1XOCA 4G77A 4Q30B 4G8MA 2Y7KA 1PBQA 4F39A 5CBRA 4DE8A 3CR9A 1JEUA 2O1LA 2UVJA 3PUWE 4LVQA 1YCJA 4OERA 4XIGQ 4ZECA 5L9SA 2Y7PA 4OENA 2QS2A 2Q88A 3ECRA 3HPIA 4NWCA 3CRBA 4DCYA 4RXLA 2PT1A 2Z23A 2ZMBA 4R9FA 3PMWA 1Z7ME 1IITA 4LA9A 4RK9A 4XKRA 5K2YA 3TPAA 5I56B 3O97A 1MDP1 5I84A 1ZU0A 3CI8A 3FJGA 4MLQA 4TLLB 2PYYA 1ZBMA 2THIA 2XX8A 1LSTA 3FATA 1N0TA 2OBGA 3MPKA 4NWDA 4R6YA 4XXUA 3OSRA 2DYXA 1URGA 3KGCA 3LR1A 1PEBA 1VFEA 2OZZA 2UVGA 2Z8EA 4L17A 4X48A 3R7XA 2RC7A 1B6HA 3EQ1A 4ZEFA 2E1SA 5DEXA 2H99A 1B1XA 4XTCQ 4EXKA 4GFRA 5JEIA 3MVZA 3O6IA 2GFEA 2VOZA 4MLVA 1QKAA 2R6GE 2VD2A 3FZVA 1QJMA 2XXXA 1MXYA 4NEDA 3SKPA 1WDNA 4AB6A 2ONSA 2RINA 3MZBA 1B7UA 1PBPA 4O3AA 3TELA 1SI1A 4OESA 1UIVA 3QXMA 3D4GA 4F1YA 1URDA 1MQGA 5DVJA 4XKQA 4QRZA 3K1MA 5I58B 1CB6A 4FAJA 4GLIA 3W15C 4PFYA 4YMBA 1USYE 1VSOA 1B46A 2Y84A 4GXAA 4EF2A 1UTHB 5I57A 5H8NB 1IXIA 2HZLA 5CI5A 5BUUA 4AQ4A 4OMBA 4EXLA 1ANFA 1QUJA 1I69A 1FQEA 3GLBA 2VGQA 3KOSA 4P0IA 3QSLA 4BDMA 1MDQA 1MS7A 5CM6A 2X7QA 3RQTA 4HCYA 3DP4A 4GL8A 4IGRA 3C32A 5B70A 4FIMA 1S7YA 4R6HA 4YKKA 2XHDA 1MPDA 3TKDA 1B7HA 3B7DA 3MUQA 3VVEA 4RJZA 1JW1A 3K6WA 4IY5A 3U92A 4ZEDA 1POY1 2F34A 1EU8A 4QF9A 4AB5A 3OO7A 4F3PA 1RKMA 3TQWA 1ATGA 4YKPA 1UIUA 3UN6A 3BBRA 1EH3A 4IO5A 5L8DA 1B9JA 1OMPA 3KN3A 3U8QA 2HFBA 3FUZA 2AL5A 3IJXB 3T9UA 5AA2D 3L6GA 3S9NC 3LSWA 3HN0A 3KBRA 2H9BA 2X26A 3WAFA 5KDTA 3MW0A 2FYIA 4ZEBA 4IY6A 3SEWA 1FQFA 3UIFA 5H8HA 5KCJB 2X7PA 4KPTA 4LZ5A 1CE2A 5CMBA 1A54A 4KYDA 4U4SA 3CVGA 2F6PA 4F19A 3TTRA 3V5AA 1MQDA 2M8CA 2UVIA 2OWSA 3FXQA 3O2AA 4H65A 1NL5A 2QS4A 3EN3A 4OXVA 2O7IA 3PUXE 2ANJA 4MF3A 4WKMA 3SEXA 3HSTA 1WODA 5I59A 1QW0A 4R75A 5J1DA 4XKNA 3FXRA 2Y7WA 4DLDA 5AA2B 3K00A 4X9TA 3C34A 1M5BA 4KI0E 3RUMA 3K01A 1BKAA 3UGWA 3HHFA 3G3GA 3T9XB 4GF8A 3G3IA 4H6DA 2V93A 1LAHE 1II5A 3CG3A 4R73A 4ZZAA 3K1PA 1M5FA 1LLSA 2RC9A 3E13X 3G3KA 1M5EA 3IO6A 3QYTA 2B65A 3GBAA 5TPAA 3TTKA 3QIMA 3S9EA 1M5CA 3VVFA 1B3EA 3A3CA 2KLFA 1S50A 4MBPA 5ELVA 3H6TA 3FJMA 4QFLA 3TZAA 3Q27A 4U1OA 1Y20A 2F6GA 4OZ9A 1B0LA 1N3XA 1RYXA 3E9XA 2F78A 4LQ2A 1ZJLA 3RNNA 3O29A 3IO4A 5JTYB 5A5XB 2D21A 5AA4B 2D5WA 4OFJA 1FW0A 3MP6A 2DSFA 3K02A 3MVYA 4N13A 2NXOA 1SDXA 3C31A 5EHMA 3IOTA 1LAXA 3OXNA 4FORA 2DVCA 2YLNA 4G68A 3EHTA 5EHSA 5L9MA 3U93A 5JK4A 1Y1MA 1NNKA 4NF8B 2PX1A 2A5TB 4KCDA 5BWJA 1MXWA 1O64A 3IB1A 3W9WA 5CBSA 5ICQA 1N7XA 1B05A 1SYHA 3MP8A 4X1DA 1I6QA 2XXPA 2DWJA 1R9QA 1JVXA 2AL4A 3GXAA 4LP2B 4R72A 5FHMA 2G93A 3V89B 3DP8A 3IX1A 3MPLA 3IK6B 4ELRA 4GOTA 1LFIA 2OWTA 5CC2A 1XVXA 3KFMA 4THIA 3F11A 2DWAA 3QUJA 4NF6B 4WXJA 4DXUA 5B7DA 1LGBC 3EPEA 4JSOA 1A8FA 1D9VA 1EZ9A 2LAOA 2QSXA 2XD3A 2ZYOA 3ZKLA 3I5OA 3IB0A 1GR2A 3LSXA 2WKYA 1TFAA 2HAUA 3CFZA 1QUIA 2REGA 1Y4TA 2HQ0A 2XXIA 3K6UA 3KEIA 4F1VA 5I2KA 3PPQA 1D4NA 2OLBA 3FGSA 4M4GA 1B2HA 2GHBA 4KFQA 4N07A 3MC2A 2DQVA 4P0GA 3KN8A 4UACA 3U72A 4ELOA 5DYHA 2A5SA 3O66A 2OK2A 3CG1A 4LONB 3GZGA 5TP9B 1PB9A 3I3VA 3Q28A 3A3UA 3IORA 2XXYA 3TDJA 4F31B 2REJA 1QUKA 1H45A 3IAZA 3KZGA 4NF4A 4OHNA 4R2BA 4NF5A 4X1BA 2DOJA 3SESA 3UORA 3V83A 1RYOA 2O6AA 3H06B 4FJPA 4Z0IA 5HM4B 1B5HA 1LB9A 4QSDA 3PPPA 4F22A 2XXRA 4ECFA 2DE3A 3L6HA 3FV1A 1FQAA 2CZLA 4TOZA 1IUDA 2QMWA 1O63A 3OENA 4QSEA 2O69A 5L9OA 4JBZA 1L5TA 1M5DA 4DDDA 1P1WA 3FVGA 4C0RA 1P99A 2VHAA 3OSQA 4IO7A 1KWHA 2UYFA 1B3LA 4LUBA 1PB8A 1Q35A 3TODA 4IO2A 1HSEA 1R1NA 4MH5A 3BKIB 1IXHA 3EHSA 3DP6A 3PD9A 5H8FB 4ZE8A 4OEVA 3K2DA 2DE2A 3Q29A 2QS3A 4NTLA 2E0SA 3T66A 4F3GA 1A99A 3OO8A 2R71A 3C33A 4RPOA 3H4ZA 2ONRA 3UP9A 1Q1KA 1TXFA 4FEDA 1US5A 1B5JA 2ABHA 4LZ8A 1XC1A 3RLFE 4KCCA 1NH8A 2XXUA 3FJ7A 3ODBA 1OIBA 3TTMA 5I2NB 1A40A 1Y4CA 4U21A 2H5YA 3IOUA 1I6BA 1US4A 3UA8A 2DXYA 2PT2A 2XXWA 4YB7A 1NKXA 2H98A 1H3DA 1MQJA 2QL3A 2ZYKA 3MAMA 4P11A 3TYHA 3KSJA 4EUOA 3N6TA 3R26A 4OWDA 4YAHX 3USDA 3TUSA 1F9BA 3PV0E 3BFUA 1AOVA 1UTHA 3Q25A 3IOVA 3KJTA 1H76A 5I57B 2Q9TA 1N7WA 3RTWB 1NNPA 1ZTYA 1GV8A 3VDFA 4BDNA 2O7UA 4ZDMA 3LC8A 3KSXA 1A55A 5I56A 2RCBA 3CIJA 3S4UA 1B52A 1FTJA 2QS1A 5H8QA 1XVYA 3QK6A 4PP0A 4F3SA 2ZXTA 1GGGA 3CFLA 4TLMB 4ZS9A 1TFDA 3MJNA 3O6GA 2I49A 5H8SA 4C1TA 5FTIA 3KG2A 1LFGA 4HS7A 3IL1B 3W9VA 1B4HA 1HSJA 1LBCA 2DWHA 4JB7A 2AYSA 4YU0A 2I3WA 3SETA 4I8CA 4YMAA 1DTGA 4WEDA 3CFXA 4K3FA 3OELA 1AIVA 4KQPA 1NNFA 1MM7A 3OMBA 1MM6A 2RCAA 4OQOA 5LOMA 4RYAA 2P0SA 3TFLA 2RKMA 3RPWA 2NOOA 4RPNA 4H67A 3ZS6A 4YKJA 1OLAA 3ILTB 4TQUQ 5KCJA 1VE4A 3MVXA 5H8HB 1B0HA 3G3FA 1BIYA 1DTZA 3N6UA 4POXA 3C36A 4Q0CA 2DE4A 1OQGA 4OYVA 4G8NA 1SYIA 1QKBA 4OVJA 3N26A 1MQIA 5I59B 2F97A 3SEVA 1BP5A 2I0BA 1A8EA 2I0CA 4G2ZA 4PFWA 5AA2A 4ZEKA 4ONYA 3MQ9A 3IR1A 5M2VA
chains in the Genus database with same CATH superfamily
1P1QA 2WEFA 5AA3A 3MBPA 5TPAB 4P9KA 3S9MC 2GRVA 3D4CA 4F2OA 2W7YA 3A29A 1QVSA 2I3VA 4H1XA 3RN8A 5EYFA 5IGAA 2Z8DA 1JW5A 4GIZA 4YB5A 1FPIA 4GX4A 3A09A 1MY3A 5AA4A 1O7TA 2H4IA 5T3JA 1B7ZA 1D3KA 3C35A 1P1OA 5IZ3A 2NWJA 4F2QA 4U22A 5DEXB 3ILUB 1ZIUA 1FTLA 3OEMA 2O68A 4BLAA 5DVIA 3OEKA 4FBPA 3LSLA 5F24A 3ZKKA 1LCFA 3RT6B 4LZ7A 1MY4A 5EQ7A 4MX6A 2CZIA 5EQAA 1VR5A 2F8DA 4QFNA 2XXTA 1LFHA 4ZE9A 2UVHA 4GRKA 4DCXA 1JETA 1N3WA 1K9YA 4E0XA 1Y3NA 1JW4A 4KHZE 3U1OA 4LQ5A 5ET8A 3DELB 2DVZA 1K9ZA 2Q89A 5ET5A 1SPIA 3EF7A 1YPNA 3G3HA 2AIXA 3T9HB 4KYEA 2QMXA 3FV2A 1NV3A 1DMBA 2HXWA 2Q2CA 2OJTA 3IOWA 1FBGA 5HBCA 3PU5A 4O8MA 1B5IA 1URSA 5CRYA 1B32A 4G4PA 4E0WA 1H43A 4NN3A 5HPQA 2G29A 1FPDA 4ELQA 3VLUA 1H44A 1A7LA 1LBWA 2ZYNA 3H7MA 1ELJA 1USYH 2DXRA 2F7BA 2I4BA 1MY1A 4F1UA 4I9DA 1FTOA 4ND9A 2V3UA 3CHGA 1IQ7A 4IO3A 1I6AA 1Q9DA 1GVCA 4ZZEA 4U1ZA 4JWOA 2UYEA 3O9PA 5F7VA 4BDRA 3FVNA 5I3SA 2XX7A 1IMBA 2GHAA 4OTEA 3Q26A 4EDPA 1DPEA 1EZPA 4YKIA 3B6WA 1YYZA 5EQ8A 3VV5A 4IGTA 2IEEA 1IZ1A 3TCGA 2DP8A 5FTHA 2QVVA 4KR5A 3S9LC 5IM2A 3VVDA 1OVTA 3OOAA 1MH3A 4NQ8A 4G77A 3BIGA 4Q30B 2F3BA 4F39A 3PUWE 1JEUA 2O1LA 4I3EA 4XIGQ 3ECRA 2Z23A 1Z7ME 4XKRA 2CEYA 1ZU0A 3FJGA 4MLQA 2THIA 2XX8A 2OBGA 3OSRA 5B7DA 1PEBA 2V4CA 1B1XA 4O7IA 2VOZA 2R6GE 2VD2A 4Q8RA 3FZVA 4NEDA 2XXXA 3SKPA 4PCDA 1PBPA 4O3AA 4OESA 3D4GA 5I58B 1CB6A 4PFYA 1USYE 4EF2A 4PF6A 1IXIA 2QVRA 1I69A 3KOSA 4P0IA 2Q74A 4HCYA 4IGRA 5B70A 4FIMA 4YKKA 3VVEA 1JW1A 4ZEDA 3TQWA 5L8DA 2HFBA 5AA2D 3LSWA 3WAFA 3SEWA 4JVDA 1CE2A 2F6PA 3TTRA 1MQDA 2M8CA 2UVIA 3FXQA 4H65A 3EN3A 1WODA 1QW0A 2Y7WA 4DLDA 5DW8A 3RPLA 3HHFA 2XXKA 3G3GA 3T9XB 3K1PA 1M5FA 2RC9A 3QYTA 3QIMA 2KLFA 2P3NA 5ELVA 3TZAA 3Q27A 4U1OA 1Y20A 1N3XA 1ZJLA 1FSAA 3IO4A 4H45A 4OFJA 3K02A 3OXNA 5L9MA 5JK4A 2DVCA 4G68A 3U93A 4KCDA 3IB1A 1B05A 3MP8A 4MEVA 1I6QA 4LP2B 1JVXA 2G93A 2CZKA 2OWTA 4AS5A 1A8FA 3CFZA 1Y4TA 2HQ0A 4KFQA 3U72A 4MHFA 5DYHA 2A5SA 2OK2A 3CG1A 5LDZA 3I3VA 2XXYA 3IAZA 4PFRA 4PTKA 2FIEA 2CZHA 4FJPA 1B5HA 1O63A 2O69A 1M5DA 4DDDA 2VHAA 3OSQA 4IO7A 3TODA 4F18A 4PGPA 3Q29A 2QS3A 3QMFA 3C33A 4RPOA 1US5A 2ABHA 1IMAA 3TTMA 5I2NB 1I6BA 1US4A 1NKXA 4EUOA 4NAPA 2QL3A 4OWDA 3USDA 5LTCA 1F9BA 3BFUA 1KZ8A 1UTHA 2Q9TA 1N7WA 4N6KA 3LC8A 4AS4A 2RCBA 1B52A 1GGGA 3CFLA 4ZS9A 1TFDA 3MJNA 4DXUA 2I49A 3KG2A 1LFGA 3IL1B 3W9VA 4JB7A 4PFBA 4YU0A 3SETA 4YMAA 4GX6A 1NNFA 5LOMA 1MM6A 2RCAA 4OQOA 2P0SA 3TFLA 4RPNA 2FIXA 3ILTB 1VE4A 5H8HB 3N6UA 4Q0CA 1LEVA 1SYIA 4OVJA 3N26A 2I0CA 4OA4A 4G2ZA 4ZEKA 3IR1A 4GWYA 1FPBA 2XX9A 2KQZA 1B3GA 5ITPA 4GWZA 4I3YA 2OWZA 4GXSB 4O3CA 1MXUA 1RDZA 2B3BA 4F29A 4G68B 4NMYA 4HE2A 1KA1A 4C1UA 5DTBA 4XKPA 2ALUA 2YJPA 4BDQA 1GTKA 1FTMA 2B4MA 4BDOA 2OX3A 3O6HA 2XXVA 1AH5A 5H8NA 1SI0A 4P8BA 4H8JA 2VD3A 3OD7A 3PUVE 3IB2A 4OETA 5IZ1A 4N17A 4PF8A 5CMCA 1POTA 4NHBA 2PMSA 4P3LA 2PVUA 1OVBA 1QULA 3ONMA 4KYSA 3B50A 4ELPA 1DPPA 2A5TA 1MQHA 4MIJA 3PPRA 1Y9UA 2R8TA 4EQBA 1B4ZA 4DIGA 4GVOA 2Q2AA 1SW4A 3LSFB 2RC8A 2Y5LA 3CSGA 5IKBA 3HFUA 3LV0A 1MG1A 1ZKBA 3O28A 1IXGA 2FNCA 3SEYA 4FATA 2ZNUA 4POWA 3PPNA 1MXXA 2F36A 4H5FA 1JNFA 1DBZA 2DWIA 2DS9A 2IA4A 1Y3QA 4ESWA 3PPOA 5I7IA 2I6EA 2NVUB 1B40A 3VXBA 3WAEA 3M3KA 4OVPA 5JTYA 4GQOA 3V8XB 4NGUA 4F3BA 4N81A 1FQCA 2HCAA 2B4LA 1Y1ZA 2XXQA 1BK4A 4EQ9A 3M8UA 1UQWA 3PUZE 1PDAA 1AL3A 1MRPA 4GWOA 3VLWA 3PUYE 1LBYA 1D9QA 4U23A 4PE5B 4LATA 2PFYA 1LBBA 4R2FA 1B1HA 2O51A 1S9TA 1SBPA 4H5GA 2Z8FA 1IIWA 1IMFA 3MP1A 2HEUA 3TTLA 4P1LA 1SD3A 2F7AA 1IMDA 1MY0A 1P1UA 2XXHA 4P56A 1YZ0A 3KJ7A 4O3BA 2YPNA 3H6WA 1MXZA 1NMUA 1T0KA 4DZ1A 5CMKA 1OQHA 3T22A 4IR8A 5ISUA 5I2NA 4JWXA 3ZSFA 2MKZA 3DLNA 1XOCA 4G8MA 2Y7KA 1PBQA 5CBRA 4DE8A 3CR9A 4LVQA 4GWUA 4ZECA 5L9SA 4OENA 4NWCA 2ZMBA 4R9FA 3PMWA 5K2YA 3O97A 1ZBMA 1LSTA 4NWDA 4XXUA 2UVGA 2Z8EA 4MNCA 4L17A 2RC7A 4ZEFA 2E1SA 2H99A 3O6IA 4QBAA 1QJMA 1XI6A 2ONSA 3MZBA 1B7UA 1SI1A 3QXMA 4PDHA 1MQGA 4QRZA 4XFEA 4FAJA 1NV5A 1VSOA 2Y84A 4GXAA 1UTHB 5CI5A 2HZLA 4OMBA 2VGQA 1MDQA 2X7QA 3DP4A 2L5VA 3TKDA 1MPDA 3B7DA 4RJZA 4IY5A 4X8RA 1EU8A 4YKPA 3UN6A 3BBRA 2AL5A 3L6GA 3HN0A 3KBRA 2X26A 3KC0A 2VT5A 3MW0A 1FQFA 5H8HA 2X7PA 4LZ5A 5CMBA 3U65A 1G0HA 3V5AA 4OXVA 2QS4A 2O7IA 3PUXE 2ANJA 4MF3A 4XKNA 3FXRA 3C34A 3RUMA 1BKAA 4GF8A 3CG3A 4R73A 3G3KA 2B65A 3GBAA 1FJ6A 3S9EA 1M5CA 4N8YA 4QFLA 4KXPA 5J16A 3E9XA 1LBVA 5ET6A 3MVYA 2NXOA 1SDXA 1LAXA 5EHSA 3EHTA 4JVCA 2WYKA 2PX1A 1O64A 3W9WA 1N7XA 1SYHA 2XXPA 3GXAA 2AL4A 3IK6B 1LFIA 5CC2A 3KFMA 4WXJA 2DWAA 4NX1A 2LAOA 2XD3A 3ZKLA 3I5OA 4PE3A 1GR2A 1QUIA 2REGA 2XXIA 3PPQA 4M4GA 4N07A 2GHBA 4UACA 2DQVA 3KN8A 4ELOA 3GZGA 1PB9A 2REJA 3SESA 1INPA 3V83A 4N6DA 3H06B 4N8GA 2DE3A 3FV1A 1FQAA 4TOZA 4N91A 4C0RA 2VPNA 4QFPA 4PGNA 4LUBA 1PB8A 4IO2A 1R1NA 4ZE8A 1IXHA 3DP6A 4OEVA 4PBQA 2ONRA 1Q1KA 4LZ8A 1XC1A 1OIBA 1A40A 1Y4CA 2H5YA 3IOUA 2DXYA 2H98A 1H3DA 3KSJA 3N6TA 1NNPA 3VDFA 5H8QA 5I56A 4C1TA 4HS7A 2WYPA 1B4HA 1LBCA 2DWHA 2I3WA 4WEDA 1FRPA 4KQPA 4DI3D 4NG7A 1JP4A 3ZS6A 4TQUQ 5KCJA 4POXA 1DTZA 2PFZA 2I0BA 3TDJA 1MY2A 3C9HA 3SEUA 1EZOA 4PFTA 3VE1B 2HAVA 1NUXA 5CMMA 1LAGE 3T93B 3IJOB 1MPBA 1N84A 1D9YA 3SZPA 2V3QA 3M3FA 1JVYA 3MYUA 3FVKA 3PGFA 4FE8A 4MNIA 1FPLA 3IFAA 3H03A 3S2VA 4HCWA 3N5LA 1NV1A 1ZLQA 4PDDA 5ET7A 3THIA 3TCFA 4OVQA 1B58A 4YZZA 1VDWA 5I58A 3KC1A 2Y5KA 2PBWA 3K4UA 4ESXA 1AMFA 4JWYA 3PTYA 2JJKA 4RK2A 4MMPA 5FHOA 5DVFA 2O1MA 4QFOA 3HO7A 2P3VA 5A5XA 5ICTA 4PBHA 4R6KA 4R9GA 3BFTA 3R6UA 2HXRA 4YICA 3TCHA 4G68C 2XA5A 3PMVA 5H8FA 2ZNTA 4G8HA 4U2RA 1JQFA 3PMXA 4HE0A 2XWKA 1NNTA 3TEPA 5AA1A 3RYDA 1N04A 4H0WA 1FBPA 1SW1A 3TAJA 4FEBA 1YXIA 2UXAA 4HXVA 4EF1A 4PQJA 5TU0A 4QSCA 1XS5A 2QRYA 2GQ1A 3LUYA 5H8QB 1LCTA 1PB7A 3MZ1A 2Q8JA 3B8BA 3JYRA 3RGYA 1BTJA 2QPQA 1MPCA 1ZMGA 2I4CA 3MZ9A 1SQYA 1YAEA 2QJEA 3VLVA 5IAIA 3RT8A 3RTFB 4IO4A 2ZYMA 3SDFA 3MWBA 5ITOA 3EHUA 3VXCA 4DXCA 4IB2A 4P1EA 1HSLA 2I58A 3FASA 1JEVA 2D3IA 1MXVA 1SVXB 3P7IA 4HTGA 4HW8A 2V25A 3CSBA 4GBVA 2WX9A 3I6VA 4BDLA 1B51A 4MFIA 3MVWA 3N94A 3TMGA 2P2AA 4MJOA 3LBSA 1J1NA 2HZKA 2NUVA 3T96B 2R9JA 1FQDA 3JV9A 3TQLA 1CNQA 1SW5A 3H3GA 3FD3A 1Z7NE 4QFKA 2FA7A 3PD8A 3G3JA 4QHQA 4R74A 3K0VA 3OO9A 4FECA 4OERA 1YCJA 2QS2A 1EYKA 2XWIA 3CRBA 4DCYA 4RXLA 2PT1A 1IITA 4LA9A 3TPAA 4OVTA 5I56B 5I84A 4TLLB 2PYYA 3FATA 1N0TA 2DYXA 3LR1A 2OZZA 3R7XA 1B6HA 3EQ1A 5DEXA 4EXKA 4GFRA 2FBPA 4MLVA 3MSTA 2XWVA 3T1BA 3K1MA 4YMBA 4EXLA 1ANFA 1FPJA 1FQEA 2Q8MA 3QSLA 1MS7A 3RQTA 3U92A 1POY1 2F34A 4QF9A 4AB5A 4F3PA 1RKMA 1UIUA 1EH3A 4IO5A 1IMCA 1OMPA 4MAGA 3IJXB 3T9UA 3ROJA 3S9NC 2KR0A 5KDTA 2H9BA 3UIFA 4ZEBA 5KCJB 5IZZA 1A54A 4U4SA 3O2AA 2OWSA 4WKMA 5ESYA 4NF0A 4OVRA 5I59A 1LBZA 4R75A 5J1DA 5AA2B 4KI0E 1NV7A 5FBPA 4H6DA 2V93A 1LAHE 4ZZAA 2HPGA 1LLSA 3A3CA 1S50A 4MBPA 3H6TA 2CEXA 2F6GA 4OZ9A 1B0LA 3FXBA 4LQ2A 4JVIA 3O29A 2D21A 2D5WA 3C31A 5EHMA 2YLNA 1Y1MA 1NNKA 5ICQA 2A5TB 5BWJA 1MXWA 4X1DA 4Z7EA 1R9QA 4R72A 5FHMA 3V89B 3D1RA 3DP8A 4ELRA 4GOTA 1XVXA 1NV2A 3F11A 4NF6B 1LGBC 4JSOA 1AOVA 1D9VA 1EZ9A 2QSXA 3IB0A 1TFAA 2HAUA 4F1VA 5I2KA 3BIHA 1D4NA 3MC2A 3T0JA 3A3UA 1QUKA 4OHNA 2DOJA 3UORA 1LB9A 4ECFA 3L6HA 2QMWA 3OENA 4QSEA 5L9OA 4JBZA 3FVGA 1P99A 1KWHA 2UYFA 1B3LA 1Q35A 5H8FB 3EHSA 1NV6A 1IMEA 1RDYA 2DE2A 2FVZA 1NI9A 4NTLA 2E0SA 3T66A 4F3GA 3OO8A 2R71A 3UP9A 1TXFA 1B5JA 1NUWA 2XXUA 3FJ7A 4KCCA 4U21A 4HE1A 1AWBA 2XWOA 2XXWA 1MQJA 3TYHA 3TUSA 3R26A 4YAHX 3PV0E 5I57B 1ZTYA 4ZDMA 1FTJA 1XVYA 5EYHA 3O6GA 5H8SA 5FTIA 4UABA 2HHMA 2AYSA 4I8CA 1DTGA 3OELA 3KBZA 3OMBA 1MM7A 4RYAA 3RPWA 4H67A 1B0HA 3G3FA 1BIYA 3C36A 4OYVA 4G8NA 1MQIA 5I59B 3SEVA 1BP5A 2VPOA 5AA2A 4PFWA 4ONYA 3MQ9A 2Y7RA 1B3HA 1FBFA 5DT6A 2Y7IA 1FCKA 3E4RA 1UTBB 3FXUA 4XEQA 4GWSA 1NV0A 3OO6A 2ZZVA 2ZNSA 1G0IA 1NFTA 3EKIA 4MNPA 1MH4A 1DCUA 1Y3PA 4NF8A 3H6UA 3AXFA 3HV1A 3E3KA 5KZTA 1XHYA 1TT1A 4GWWA 2F5XA 4NF6A 2WBDA 1TWYA 3TTNA 2V3TA 4Q5TA 1NH7A 3HHGA 4RA1A 4OFOA 3FIRA 3B6TA 4OEUA 4N6PA 3IFCA 2ONKE 4NF4B 5K2XA 2P1SA 2V84A 4I62A 4PFUA 2QFLA 3H6VA 2B3FA 4F19A 4ZEIA 1SW2A 3UK4A 3KN7A 4PC9A 1XT8A 5AE4A 2BJJX 2F35A 1YTVA 4WEPA 1OLCA 3G7WA 2ESNA 4NF5B 3LUZA 3GYYA 1R9LA 1IXCA 3KOTA 4PFIA 4JSDA 1VFDA 4U4XA 4RY1A 2H25A 1FTKA 4KD5A 1N76A 4JXIA 4I1DA 2VP1A 3SERA 3HCQA 3E78A 1P1NA 5KDTB 1DSNA 4YB6A 4NE4A 4UA8A 4M1VA 4PAIA 1B3FA 3K6VA 2O84X 3RY3A 4JDFA 3JZJA 3M3LA 2CMOA 1IEJA 1BLFA 2I48A 1FTAA 1PC3A 4PETA 5F1QA 1LAFE 4IO6A 1KA0A 2OCUA 4DI4B 3DM0A 1FQBA 1R6ZA 2Z22A 3K6XA 4H8IA 4GBWA 1DOTA 1UTBA 2F3DA 2F7CA 3T9VA 4XF5A 4O7MA 3U94A 3VFJA 1LB8A 1NUYA 2XD2A 3B6QA 4GL0A 3QAXA 3C4MA 1RDXA 5A5LA 3K1NA 4GWXA 1WVJA 2GH9A 2RF1A 5I2KB 3GBBA 4GD5A 3QUFA 4ISUA 3FVOA 4EQ7A 5TP9A 4N15A 4RNSA 4OFLA 2WBBA 2BJIA 2UVJA 2Y7PA 2Q88A 3HPIA 4RK9A 1MDP1 3CI8A 4G61A 3MPKA 4R6YA 1URGA 4PAFA 3KGCA 1VFEA 4X48A 1FBHA 4XTCQ 5JEIA 3MVZA 2GFEA 1DK4A 1QKAA 4AB6A 1MXYA 1WDNA 2RINA 3TELA 1UIVA 1URDA 5DVJA 4XKQA 4GLIA 3W15C 1B46A 5EYGA 4H46A 5I57A 5H8NB 4AQ4A 1QUJA 3GLBA 4BDMA 5CM6A 4GL8A 3C32A 4R6HA 1S7YA 2XHDA 1B7HA 3MUQA 3K6WA 3OO7A 1ATGA 1B9JA 3KN3A 3U8QA 3FUZA 2PCRA 2FYIA 4IY6A 4KPTA 4KYDA 3CVGA 4GX3A 1NL5A 5BUUA 3SEXA 4P47A 3HSTA 1FPFA 3K00A 4X9TA 1M5BA 3K01A 3UGWA 3G3IA 1II5A 5TPAA 3E13X 1M5EA 3IO6A 3TTKA 3VVFA 1QGXA 1B3EA 3FBPA 4I40A 1FJ9A 3FJMA 1RYXA 2F78A 3RNNA 2ZZWA 1NV4A 5JTYB 5A5XB 5AA4B 1FW0A 3MP6A 2DSFA 4N13A 3IOTA 4FORA 5IZ3B 4NF8B 5CBSA 4F22A 2DWJA 4X04A 3IX1A 3MPLA 1LBXA 4O94A 4THIA 3QUJA 3EPEA 2ZYOA 3LSXA 2WKYA 3KEIA 3K6UA 4OANA 2OLBA 4P0GA 3FGSA 5FHNA 1B2HA 3O66A 4LONB 5TP9B 3Q28A 1FPEA 3IORA 3ISPA 4F31B 4X1BA 1H45A 4R2BA 3KZGA 4NF4A 3NOHA 4NF5A 1RYOA 2O6AA 4Z0IA 5HM4B 4QSDA 3PPPA 2XXRA 2CZLA 1IUDA 1FBDA 1L5TA 1P1WA 4F1YA 1HSEA 4MH5A 3BKIB 3PD9A 1FPGA 1FPKA 4QXDA 3K2DA 1A99A 2ZZXA 3H4ZA 4FEDA 3RLFE 1NH8A 3ODBA 4N4UA 3UA8A 2PT2A 4YB7A 2ZYKA 4P11A 3MAMA 4OVSA 3Q25A 3IOVA 3KJTA 1H76A 3RTWB 1GV8A 4BDNA 2O7UA 3KSXA 1A55A 5I5PA 3CIJA 3S4UA 2QS1A 4F3SA 2DDKA 3QK6A 4PP0A 2ZXTA 4DXBA 4TLMB 1HSJA 3E79A 3CFXA 4K3FA 1FBCA 1AIVA 1EYIA 5EQ9A 4MCOA 1NUZA 1FBEA 2RKMA 2NOOA 4PAKA 4YKJA 1OLAA 3MVXA 2DE4A 1EYJA 1OQGA 1QKBA 2F97A 2FHYA 2QVUA 1A8EA 4LN5A 3RPLB 5M2VA
chains in the Genus database with same CATH topology
1P1QA 2Y7RA 1B3HA 1MY2A 5DT6A 2Y7IA 3C9HA 5AA3A 3MBPA 3SEUA 1EZOA 5TPAB 3S9MC 4PFTA 2GRVA 3D4CA 3VE1B 4F2OA 2XX9A 2W7YA 1QVSA 1FCKA 1B3GA 3E4RA 2I3VA 5ITPA 4Z7EA 2HAVA 4H1XA 5CMMA 1LAGE 1UTBB 3FXUA 5EYFA 2Z8DA 3RN8A 3T93B 1JW5A 4GIZA 4YB5A 3IJOB 1MPBA 1N84A 1D9YA 3OO6A 2V3QA 3A09A 4GXSB 3M3FA 4O3CA 1MY3A 5AA4A 1MXUA 5FHNA 1JVYA 1O7TA 2H4IA 3FVKA 2ZNSA 1B7ZA 1NFTA 3PGFA 2B3BA 4F29A 4FE8A 4G68B 1D3KA 3C35A 1P1OA 4NMYA 1MH4A 1Y3PA 4NF8A 2NWJA 4Q8RA 3H6UA 4F2QA 4U22A 5DEXB 3ILUB 4C1UA 3H03A 5DTBA 3AXFA 3HV1A 3S2VA 1ZIUA 3E3KA 4HCWA 5KZTA 1FTLA 3OEMA 2O68A 1XHYA 3N5LA 4BLAA 1TT1A 1ZLQA 3OEKA 4XKPA 2F5XA 5DVIA 3THIA 4NF6A 1TWYA 3TCFA 2ALUA 3LSLA 3TTNA 2V3TA 2YJPA 1B58A 4BDQA 1GTKA 4Q5TA 4YZZA 3ZKKA 1FTMA 1NH7A 5I58A 1LCFA 4BDOA 3RT6B 3HHGA 3O6HA 2XXVA 4LZ7A 1AH5A 1MY4A 4RA1A 5H8NA 1SI0A 4OFOA 2PBWA 3FIRA 3K4UA 3B6TA 4ESXA 1AMFA 4H8JA 4JWYA 4OEUA 4N6PA 2VD3A 3OD7A 4RK2A 4NF4B 2ONKE 5FHOA 5DVFA 2O1MA 3PUVE 3HO7A 4QFOA 5A5XA 3IB2A 4OETA 1VR5A 5CMCA 2F8DA 4QFNA 2P1SA 4R6KA 5K2XA 5ICTA 2V84A 2XXTA 1POTA 4R9GA 3BFTA 2PMSA 4ZE9A 1LFHA 2PVUA 1OVBA 1QULA 2UVHA 4I62A 4GRKA 4PFUA 3ONMA 3R6UA 4KYSA 3H6VA 4DCXA 4YICA 2A5TA 1DPPA 3TCHA 1JETA 1MQHA 1N3WA 4G68C 4ELPA 3PPRA 2B3FA 4E0XA 3PMVA 5H8FA 2ZNTA 1Y3NA 1Y9UA 4G8HA 4U2RA 4EQBA 1B4ZA 4F18A 4DIGA 4GVOA 2Q2AA 1JW4A 1JQFA 1SW4A 3LSFB 4KHZE 4ZEIA 1SW2A 3PMXA 3UK4A 3U1OA 4LQ5A 2RC8A 3DELB 2DVZA 1NNTA 3TEPA 5AA1A 2Q89A 3CSGA 3EF7A 3KN7A 1YPNA 5IKBA 1N04A 3G3HA 4H0WA 1SW1A 2AIXA 3TAJA 1XT8A 4FEBA 3T9HB 1MG1A 2BJJX 5AE4A 2F35A 4KYEA 1YTVA 1ZKBA 2QMXA 1IXGA 2FNCA 3O28A 3FV2A 4WEPA 3SEYA 1OLCA 2UXAA 3G7WA 4EF1A 4PQJA 5TU0A 1DMBA 4QSCA 4FATA 2HXWA 2Q2CA 2ESNA 4NF5B 2OJTA 2ZNUA 4POWA 3IOWA 1XS5A 1R9LA 1IXCA 3KOTA 3PPNA 1MXXA 2F36A 2QRYA 5HBCA 3PU5A 4H5FA 1B5IA 1JNFA 4JSDA 1VFDA 1URSA 3LUYA 5H8QB 5CRYA 1LCTA 1PB7A 4U4XA 3MZ1A 2DWIA 4RY1A 2H25A 2DS9A 1FTKA 2IA4A 1Y3QA 4KD5A 1N76A 3PPOA 1B32A 2I6EA 2Q8JA 4G4PA 4ESWA 4JXIA 4I1DA 2NVUB 3JYRA 1B40A 3RGYA 3VXBA 2VP1A 3SERA 3WAEA 1BTJA 2QPQA 3HCQA 3M3KA 1P1NA 5JTYA 5KDTB 1DSNA 4E0WA 4YB6A 4GQOA 3V8XB 1H43A 4NE4A 4F3BA 4UA8A 4M1VA 5HPQA 2G29A 4ELQA 1MPCA 1FQCA 1ZMGA 2HCAA 3VLUA 1Y1ZA 2XXQA 1B3FA 1H44A 1A7LA 2I4CA 2ZYNA 3M8UA 3K6VA 1UQWA 4EQ9A 2O84X 1SQYA 1YAEA 3H7MA 3MZ9A 2QJEA 3PUZE 3RY3A 3VLVA 5IAIA 3RT8A 1ELJA 3RTFB 1USYH 2DXRA 2F7BA 2I4BA 4JDFA 1MY1A 1PDAA 4F1UA 1AL3A 4I9DA 4IO4A 1MRPA 3JZJA 3M3LA 2CMOA 1IEJA 4GWOA 1BLFA 1FTOA 2ZYMA 3SDFA 2I48A 4ND9A 3VLWA 3MWBA 5ITOA 3EHUA 3VXCA 2V3UA 4DXCA 1PC3A 4PETA 4IB2A 1IQ7A 3PUYE 5F1QA 4IO3A 1LAFE 4IO6A 1I6AA 4DXBA 2OCUA 1HSLA 2I58A 3FASA 4U23A 1JEVA 2D3IA 4PE5B 1GVCA 3DM0A 4LATA 4ZZEA 1MXVA 1SVXB 3P7IA 1FQBA 4HTGA 4HW8A 1R6ZA 1LBBA 4U1ZA 2V25A 2Z22A 3CSBA 3K6XA 4H8IA 4JWOA 2UYEA 3O9PA 4R2FA 5F7VA 1B1HA 2O51A 1DOTA 3I6VA 4BDRA 1UTBA 4BDLA 1B51A 1S9TA 1SBPA 4H5GA 3FVNA 4MFIA 3MVWA 3N94A 2Z8FA 2F7CA 3T9VA 3TMGA 1IIWA 2P2AA 2XX7A 3LBSA 1J1NA 2GHAA 2HZKA 2NUVA 3MP1A 4OTEA 3T96B 3U94A 2HEUA 3Q26A 3TTLA 1SD3A 2F7AA 2R9JA 1DPEA 1FQDA 3VFJA 4EDPA 1LB8A 1MY0A 1P1UA 2XXHA 4YKIA 1EZPA 2XD2A 3KJ7A 3B6WA 3JV9A 3B6QA 4O3BA 4GL0A 2YPNA 3QAXA 3H6WA 3TQLA 3C4MA 3VV5A 1MXZA 1NMUA 1SW5A 1T0KA 4DZ1A 3H3GA 5CMKA 3FD3A 3K1NA 1Z7NE 1OQHA 4QFKA 1WVJA 3T22A 4IGTA 2IEEA 2GH9A 1IZ1A 3TCGA 2FA7A 2DP8A 3PD8A 5FTHA 2RF1A 3G3JA 5I2KB 4KR5A 4QHQA 5I2NA 3S9LC 5ISUA 4JWXA 3VVDA 3GBBA 4GD5A 3QUFA 4ISUA 4R74A 3FVOA 3ZSFA 1OVTA 4EQ7A 3OOAA 5TP9A 3DLNA 1MH3A 3K0VA 4RNSA 3OO9A 4QFPA 4FECA 4OFLA 1XOCA 4G77A 4Q30B 4G8MA 2Y7KA 1PBQA 4F39A 5CBRA 4DE8A 3CR9A 1JEUA 2O1LA 2UVJA 3PUWE 4LVQA 1YCJA 4OERA 4XIGQ 4ZECA 5L9SA 2Y7PA 4OENA 2QS2A 2Q88A 3ECRA 3HPIA 4NWCA 3CRBA 4DCYA 4RXLA 2PT1A 2Z23A 2ZMBA 4R9FA 3PMWA 1Z7ME 1IITA 4LA9A 4RK9A 4XKRA 5K2YA 3TPAA 5I56B 3O97A 1MDP1 5I84A 1ZU0A 3CI8A 3FJGA 4MLQA 4TLLB 2PYYA 1ZBMA 2THIA 2XX8A 1LSTA 3FATA 1N0TA 2OBGA 3MPKA 4NWDA 4R6YA 4XXUA 3OSRA 2DYXA 1URGA 3KGCA 3LR1A 1PEBA 1VFEA 2OZZA 2UVGA 2Z8EA 4L17A 4X48A 3R7XA 2RC7A 1B6HA 3EQ1A 4ZEFA 2E1SA 5DEXA 2H99A 1B1XA 4XTCQ 4EXKA 4GFRA 5JEIA 3MVZA 3O6IA 2GFEA 2VOZA 4MLVA 1QKAA 2R6GE 2VD2A 3FZVA 1QJMA 2XXXA 1MXYA 4NEDA 3SKPA 1WDNA 4AB6A 2ONSA 2RINA 3MZBA 1B7UA 1PBPA 4O3AA 3TELA 1SI1A 4OESA 1UIVA 3QXMA 3D4GA 4F1YA 1URDA 1MQGA 5DVJA 4XKQA 4QRZA 3K1MA 5I58B 1CB6A 4FAJA 4GLIA 3W15C 4PFYA 4YMBA 1USYE 1VSOA 1B46A 2Y84A 4GXAA 4EF2A 1UTHB 5I57A 5H8NB 1IXIA 2HZLA 5CI5A 5BUUA 4AQ4A 4OMBA 4EXLA 1ANFA 1QUJA 1I69A 1FQEA 3GLBA 2VGQA 3KOSA 4P0IA 3QSLA 4BDMA 1MDQA 1MS7A 5CM6A 2X7QA 3RQTA 4HCYA 3DP4A 4GL8A 4IGRA 3C32A 5B70A 4FIMA 1S7YA 4R6HA 4YKKA 2XHDA 1MPDA 3TKDA 1B7HA 3B7DA 3MUQA 3VVEA 4RJZA 1JW1A 3K6WA 4IY5A 3U92A 4ZEDA 1POY1 2F34A 1EU8A 4QF9A 4AB5A 3OO7A 4F3PA 1RKMA 3TQWA 1ATGA 4YKPA 1UIUA 3UN6A 3BBRA 1EH3A 4IO5A 5L8DA 1B9JA 1OMPA 3KN3A 3U8QA 2HFBA 3FUZA 2AL5A 3IJXB 3T9UA 5AA2D 3L6GA 3S9NC 3LSWA 3HN0A 3KBRA 2H9BA 2X26A 3WAFA 5KDTA 3MW0A 2FYIA 4ZEBA 4IY6A 3SEWA 1FQFA 3UIFA 5H8HA 5KCJB 2X7PA 4KPTA 4LZ5A 1CE2A 5CMBA 1A54A 4KYDA 4U4SA 3CVGA 2F6PA 4F19A 3TTRA 3V5AA 1MQDA 2M8CA 2UVIA 2OWSA 3FXQA 3O2AA 4H65A 1NL5A 2QS4A 3EN3A 4OXVA 2O7IA 3PUXE 2ANJA 4MF3A 4WKMA 3SEXA 3HSTA 1WODA 5I59A 1QW0A 4R75A 5J1DA 4XKNA 3FXRA 2Y7WA 4DLDA 5AA2B 3K00A 4X9TA 3C34A 1M5BA 4KI0E 3RUMA 3K01A 1BKAA 3UGWA 3HHFA 3G3GA 3T9XB 4GF8A 3G3IA 4H6DA 2V93A 1LAHE 1II5A 3CG3A 4R73A 4ZZAA 3K1PA 1M5FA 1LLSA 2RC9A 3E13X 3G3KA 1M5EA 3IO6A 3QYTA 2B65A 3GBAA 5TPAA 3TTKA 3QIMA 3S9EA 1M5CA 3VVFA 1B3EA 3A3CA 2KLFA 1S50A 4MBPA 5ELVA 3H6TA 3FJMA 4QFLA 3TZAA 3Q27A 4U1OA 1Y20A 2F6GA 4OZ9A 1B0LA 1N3XA 1RYXA 3E9XA 2F78A 4LQ2A 1ZJLA 3RNNA 3O29A 3IO4A 5JTYB 5A5XB 2D21A 5AA4B 2D5WA 4OFJA 1FW0A 3MP6A 2DSFA 3K02A 3MVYA 4N13A 2NXOA 1SDXA 3C31A 5EHMA 3IOTA 1LAXA 3OXNA 4FORA 2DVCA 2YLNA 4G68A 3EHTA 5EHSA 5L9MA 3U93A 5JK4A 1Y1MA 1NNKA 4NF8B 2PX1A 2A5TB 4KCDA 5BWJA 1MXWA 1O64A 3IB1A 3W9WA 5CBSA 5ICQA 1N7XA 1B05A 1SYHA 3MP8A 4X1DA 1I6QA 2XXPA 2DWJA 1R9QA 1JVXA 2AL4A 3GXAA 4LP2B 4R72A 5FHMA 2G93A 3V89B 3DP8A 3IX1A 3MPLA 3IK6B 4ELRA 4GOTA 1LFIA 2OWTA 5CC2A 1XVXA 3KFMA 4THIA 3F11A 2DWAA 3QUJA 4NF6B 4WXJA 4DXUA 5B7DA 1LGBC 3EPEA 4JSOA 1A8FA 1D9VA 1EZ9A 2LAOA 2QSXA 2XD3A 2ZYOA 3ZKLA 3I5OA 3IB0A 1GR2A 3LSXA 2WKYA 1TFAA 2HAUA 3CFZA 1QUIA 2REGA 1Y4TA 2HQ0A 2XXIA 3K6UA 3KEIA 4F1VA 5I2KA 3PPQA 1D4NA 2OLBA 3FGSA 4M4GA 1B2HA 2GHBA 4KFQA 4N07A 3MC2A 2DQVA 4P0GA 3KN8A 4UACA 3U72A 4ELOA 5DYHA 2A5SA 3O66A 2OK2A 3CG1A 4LONB 3GZGA 5TP9B 1PB9A 3I3VA 3Q28A 3A3UA 3IORA 2XXYA 3TDJA 4F31B 2REJA 1QUKA 1H45A 3IAZA 3KZGA 4NF4A 4OHNA 4R2BA 4NF5A 4X1BA 2DOJA 3SESA 3UORA 3V83A 1RYOA 2O6AA 3H06B 4FJPA 4Z0IA 5HM4B 1B5HA 1LB9A 4QSDA 3PPPA 4F22A 2XXRA 4ECFA 2DE3A 3L6HA 3FV1A 1FQAA 2CZLA 4TOZA 1IUDA 2QMWA 1O63A 3OENA 4QSEA 2O69A 5L9OA 4JBZA 1L5TA 1M5DA 4DDDA 1P1WA 3FVGA 4C0RA 1P99A 2VHAA 3OSQA 4IO7A 1KWHA 2UYFA 1B3LA 4LUBA 1PB8A 1Q35A 3TODA 4IO2A 1HSEA 1R1NA 4MH5A 3BKIB 1IXHA 3EHSA 3DP6A 3PD9A 5H8FB 4ZE8A 4OEVA 3K2DA 2DE2A 3Q29A 2QS3A 4NTLA 2E0SA 3T66A 4F3GA 1A99A 3OO8A 2R71A 3C33A 4RPOA 3H4ZA 2ONRA 3UP9A 1Q1KA 1TXFA 4FEDA 1US5A 1B5JA 2ABHA 4LZ8A 1XC1A 3RLFE 4KCCA 1NH8A 2XXUA 3FJ7A 3ODBA 1OIBA 3TTMA 5I2NB 1A40A 1Y4CA 4U21A 2H5YA 3IOUA 1I6BA 1US4A 3UA8A 2DXYA 2PT2A 2XXWA 4YB7A 1NKXA 2H98A 1H3DA 1MQJA 2QL3A 2ZYKA 3MAMA 4P11A 3TYHA 3KSJA 4EUOA 3N6TA 3R26A 4OWDA 4YAHX 3USDA 3TUSA 1F9BA 3PV0E 3BFUA 1AOVA 1UTHA 3Q25A 3IOVA 3KJTA 1H76A 5I57B 2Q9TA 1N7WA 3RTWB 1NNPA 1ZTYA 1GV8A 3VDFA 4BDNA 2O7UA 4ZDMA 3LC8A 3KSXA 1A55A 5I56A 2RCBA 3CIJA 3S4UA 1B52A 1FTJA 2QS1A 5H8QA 1XVYA 3QK6A 4PP0A 4F3SA 2ZXTA 1GGGA 3CFLA 4TLMB 4ZS9A 1TFDA 3MJNA 3O6GA 2I49A 5H8SA 4C1TA 5FTIA 3KG2A 1LFGA 4HS7A 3IL1B 3W9VA 1B4HA 1HSJA 1LBCA 2DWHA 4JB7A 2AYSA 4YU0A 2I3WA 3SETA 4I8CA 4YMAA 1DTGA 4WEDA 3CFXA 4K3FA 3OELA 1AIVA 4KQPA 1NNFA 1MM7A 3OMBA 1MM6A 2RCAA 4OQOA 5LOMA 4RYAA 2P0SA 3TFLA 2RKMA 3RPWA 2NOOA 4RPNA 4H67A 3ZS6A 4YKJA 1OLAA 3ILTB 4TQUQ 5KCJA 1VE4A 3MVXA 5H8HB 1B0HA 3G3FA 1BIYA 1DTZA 3N6UA 4POXA 3C36A 4Q0CA 2DE4A 1OQGA 4OYVA 4G8NA 1SYIA 1QKBA 4OVJA 3N26A 1MQIA 5I59B 2F97A 3SEVA 1BP5A 2I0BA 1A8EA 2I0CA 4G2ZA 4PFWA 5AA2A 4ZEKA 4ONYA 3MQ9A 3IR1A 5M2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P1Q A;  2Y7R A;  1B3H A;  1MY2 A;  5DT6 A;  2Y7I A;  3C9H A;  5AA3 A;  3MBP A;  3SEU A;  1EZO A;  5TPA B;  3S9M C;  4PFT A;  2GRV A;  3D4C A;  3VE1 B;  4F2O A;  2XX9 A;  2W7Y A;  1QVS A;  1FCK A;  1B3G A;  3E4R A;  2I3V A;  5ITP A;  4Z7E A;  2HAV A;  4H1X A;  5CMM A;  1LAG E;  1UTB B;  3FXU A;  5EYF A;  2Z8D A;  3RN8 A;  3T93 B;  1JW5 A;  4GIZ A;  4YB5 A;  3IJO B;  1MPB A;  1N84 A;  1D9Y A;  3OO6 A;  2V3Q A;  3A09 A;  4GXS B;  3M3F A;  4O3C A;  1MY3 A;  5AA4 A;  1MXU A;  5FHN A;  1JVY A;  1O7T A;  2H4I A;  3FVK A;  2ZNS A;  1B7Z A;  1NFT A;  3PGF A;  2B3B A;  4F29 A;  4FE8 A;  4G68 B;  1D3K A;  3C35 A;  1P1O A;  4NMY A;  1MH4 A;  1Y3P A;  4NF8 A;  2NWJ A;  4Q8R A;  3H6U A;  4F2Q A;  4U22 A;  5DEX B;  3ILU B;  4C1U A;  3H03 A;  5DTB A;  3AXF A;  3HV1 A;  3S2V A;  1ZIU A;  3E3K A;  4HCW A;  5KZT A;  1FTL A;  3OEM A;  2O68 A;  1XHY A;  3N5L A;  4BLA A;  1TT1 A;  1ZLQ A;  3OEK A;  4XKP A;  2F5X A;  5DVI A;  3THI A;  4NF6 A;  1TWY A;  3TCF A;  2ALU A;  3LSL A;  3TTN A;  2V3T A;  2YJP A;  1B58 A;  4BDQ A;  1GTK A;  4Q5T A;  4YZZ A;  3ZKK A;  1FTM A;  1NH7 A;  5I58 A;  1LCF A;  4BDO A;  3RT6 B;  3HHG A;  3O6H A;  2XXV A;  4LZ7 A;  1AH5 A;  1MY4 A;  4RA1 A;  5H8N A;  1SI0 A;  4OFO A;  2PBW A;  3FIR A;  3K4U A;  3B6T A;  4ESX A;  1AMF A;  4H8J A;  4JWY A;  4OEU A;  4N6P A;  2VD3 A;  3OD7 A;  4RK2 A;  4NF4 B;  2ONK E;  5FHO A;  5DVF A;  2O1M A;  3PUV E;  3HO7 A;  4QFO A;  5A5X A;  3IB2 A;  4OET A;  1VR5 A;  5CMC A;  2F8D A;  4QFN A;  2P1S A;  4R6K A;  5K2X A;  5ICT A;  2V84 A;  2XXT A;  1POT A;  4R9G A;  3BFT A;  2PMS A;  4ZE9 A;  1LFH A;  2PVU A;  1OVB A;  1QUL A;  2UVH A;  4I62 A;  4GRK A;  4PFU A;  3ONM A;  3R6U A;  4KYS A;  3H6V A;  4DCX A;  4YIC A;  2A5T A;  1DPP A;  3TCH A;  1JET A;  1MQH A;  1N3W A;  4G68 C;  4ELP A;  3PPR A;  2B3F A;  4E0X A;  3PMV A;  5H8F A;  2ZNT A;  1Y3N A;  1Y9U A;  4G8H A;  4U2R A;  4EQB A;  1B4Z A;  4F18 A;  4DIG A;  4GVO A;  2Q2A A;  1JW4 A;  1JQF A;  1SW4 A;  3LSF B;  4KHZ E;  4ZEI A;  1SW2 A;  3PMX A;  3UK4 A;  3U1O A;  4LQ5 A;  2RC8 A;  3DEL B;  2DVZ A;  1NNT A;  3TEP A;  5AA1 A;  2Q89 A;  3CSG A;  3EF7 A;  3KN7 A;  1YPN A;  5IKB A;  1N04 A;  3G3H A;  4H0W A;  1SW1 A;  2AIX A;  3TAJ A;  1XT8 A;  4FEB A;  3T9H B;  1MG1 A;  2BJJ X;  5AE4 A;  2F35 A;  4KYE A;  1YTV A;  1ZKB A;  2QMX A;  1IXG A;  2FNC A;  3O28 A;  3FV2 A;  4WEP A;  3SEY A;  1OLC A;  2UXA A;  3G7W A;  4EF1 A;  4PQJ A;  5TU0 A;  1DMB A;  4QSC A;  4FAT A;  2HXW A;  2Q2C A;  2ESN A;  4NF5 B;  2OJT A;  2ZNU A;  4POW A;  3IOW A;  1XS5 A;  1R9L A;  1IXC A;  3KOT A;  3PPN A;  1MXX A;  2F36 A;  2QRY A;  5HBC A;  3PU5 A;  4H5F A;  1B5I A;  1JNF A;  4JSD A;  1VFD A;  1URS A;  3LUY A;  5H8Q B;  5CRY A;  1LCT A;  1PB7 A;  4U4X A;  3MZ1 A;  2DWI A;  4RY1 A;  2H25 A;  2DS9 A;  1FTK A;  2IA4 A;  1Y3Q A;  4KD5 A;  1N76 A;  3PPO A;  1B32 A;  2I6E A;  2Q8J A;  4G4P A;  4ESW A;  4JXI A;  4I1D A;  2NVU B;  3JYR A;  1B40 A;  3RGY A;  3VXB A;  2VP1 A;  3SER A;  3WAE A;  1BTJ A;  2QPQ A;  3HCQ A;  3M3K A;  1P1N A;  5JTY A;  5KDT B;  1DSN A;  4E0W A;  4YB6 A;  4GQO A;  3V8X B;  1H43 A;  4NE4 A;  4F3B A;  4UA8 A;  4M1V A;  5HPQ A;  2G29 A;  4ELQ A;  1MPC A;  1FQC A;  1ZMG A;  2HCA A;  3VLU A;  1Y1Z A;  2XXQ A;  1B3F A;  1H44 A;  1A7L A;  2I4C A;  2ZYN A;  3M8U A;  3K6V A;  1UQW A;  4EQ9 A;  2O84 X;  1SQY A;  1YAE A;  3H7M A;  3MZ9 A;  2QJE A;  3PUZ E;  3RY3 A;  3VLV A;  5IAI A;  3RT8 A;  1ELJ A;  3RTF B;  1USY H;  2DXR A;  2F7B A;  2I4B A;  4JDF A;  1MY1 A;  1PDA A;  4F1U A;  1AL3 A;  4I9D A;  4IO4 A;  1MRP A;  3JZJ A;  3M3L A;  2CMO A;  1IEJ A;  4GWO A;  1BLF A;  1FTO A;  2ZYM A;  3SDF A;  2I48 A;  4ND9 A;  3VLW A;  3MWB A;  5ITO A;  3EHU A;  3VXC A;  2V3U A;  4DXC A;  1PC3 A;  4PET A;  4IB2 A;  1IQ7 A;  3PUY E;  5F1Q A;  4IO3 A;  1LAF E;  4IO6 A;  1I6A A;  4DXB A;  2OCU A;  1HSL A;  2I58 A;  3FAS A;  4U23 A;  1JEV A;  2D3I A;  4PE5 B;  1GVC A;  3DM0 A;  4LAT A;  4ZZE A;  1MXV A;  1SVX B;  3P7I A;  1FQB A;  4HTG A;  4HW8 A;  1R6Z A;  1LBB A;  4U1Z A;  2V25 A;  2Z22 A;  3CSB A;  3K6X A;  4H8I A;  4JWO A;  2UYE A;  3O9P A;  4R2F A;  5F7V A;  1B1H A;  2O51 A;  1DOT A;  3I6V A;  4BDR A;  1UTB A;  4BDL A;  1B51 A;  1S9T A;  1SBP A;  4H5G A;  3FVN A;  4MFI A;  3MVW A;  3N94 A;  2Z8F A;  2F7C A;  3T9V A;  3TMG A;  1IIW A;  2P2A A;  2XX7 A;  3LBS A;  1J1N A;  2GHA A;  2HZK A;  2NUV A;  3MP1 A;  4OTE A;  3T96 B;  3U94 A;  2HEU A;  3Q26 A;  3TTL A;  1SD3 A;  2F7A A;  2R9J A;  1DPE A;  1FQD A;  3VFJ A;  4EDP A;  1LB8 A;  1MY0 A;  1P1U A;  2XXH A;  4YKI A;  1EZP A;  2XD2 A;  3KJ7 A;  3B6W A;  3JV9 A;  3B6Q A;  4O3B A;  4GL0 A;  2YPN A;  3QAX A;  3H6W A;  3TQL A;  3C4M A;  3VV5 A;  1MXZ A;  1NMU A;  1SW5 A;  1T0K A;  4DZ1 A;  3H3G A;  5CMK A;  3FD3 A;  3K1N A;  1Z7N E;  1OQH A;  4QFK A;  1WVJ A;  3T22 A;  4IGT A;  2IEE A;  2GH9 A;  1IZ1 A;  3TCG A;  2FA7 A;  2DP8 A;  3PD8 A;  5FTH A;  2RF1 A;  3G3J A;  5I2K B;  4KR5 A;  4QHQ A;  5I2N A;  3S9L C;  5ISU A;  4JWX A;  3VVD A;  3GBB A;  4GD5 A;  3QUF A;  4ISU A;  4R74 A;  3FVO A;  3ZSF A;  1OVT A;  4EQ7 A;  3OOA A;  5TP9 A;  3DLN A;  1MH3 A;  3K0V A;  4RNS A;  3OO9 A;  4QFP A;  4FEC A;  4OFL A;  1XOC A;  4G77 A;  4Q30 B;  4G8M A;  2Y7K A;  1PBQ A;  4F39 A;  5CBR A;  4DE8 A;  3CR9 A;  1JEU A;  2O1L A;  2UVJ A;  3PUW E;  4LVQ A;  1YCJ A;  4OER A;  4XIG Q;  4ZEC A;  5L9S A;  2Y7P A;  4OEN A;  2QS2 A;  2Q88 A;  3ECR A;  3HPI A;  4NWC A;  3CRB A;  4DCY A;  4RXL A;  2PT1 A;  2Z23 A;  2ZMB A;  4R9F A;  3PMW A;  1Z7M E;  1IIT A;  4LA9 A;  4RK9 A;  4XKR A;  5K2Y A;  3TPA A;  5I56 B;  3O97 A;  1MDP 1;  5I84 A;  1ZU0 A;  3CI8 A;  3FJG A;  4MLQ A;  4TLL B;  2PYY A;  1ZBM A;  2THI A;  2XX8 A;  1LST A;  3FAT A;  1N0T A;  2OBG A;  3MPK A;  4NWD A;  4R6Y A;  4XXU A;  3OSR A;  2DYX A;  1URG A;  3KGC A;  3LR1 A;  1PEB A;  1VFE A;  2OZZ A;  2UVG A;  2Z8E A;  4L17 A;  4X48 A;  3R7X A;  2RC7 A;  1B6H A;  3EQ1 A;  4ZEF A;  2E1S A;  5DEX A;  2H99 A;  1B1X A;  4XTC Q;  4EXK A;  4GFR A;  5JEI A;  3MVZ A;  3O6I A;  2GFE A;  2VOZ A;  4MLV A;  1QKA A;  2R6G E;  2VD2 A;  3FZV A;  1QJM A;  2XXX A;  1MXY A;  4NED A;  3SKP A;  1WDN A;  4AB6 A;  2ONS A;  2RIN A;  3MZB A;  1B7U A;  1PBP A;  4O3A A;  3TEL A;  1SI1 A;  4OES A;  1UIV A;  3QXM A;  3D4G A;  4F1Y A;  1URD A;  1MQG A;  5DVJ A;  4XKQ A;  4QRZ A;  3K1M A;  5I58 B;  1CB6 A;  4FAJ A;  4GLI A;  3W15 C;  4PFY A;  4YMB A;  1USY E;  1VSO A;  1B46 A;  2Y84 A;  4GXA A;  4EF2 A;  1UTH B;  5I57 A;  5H8N B;  1IXI A;  2HZL A;  5CI5 A;  5BUU A;  4AQ4 A;  4OMB A;  4EXL A;  1ANF A;  1QUJ A;  1I69 A;  1FQE A;  3GLB A;  2VGQ A;  3KOS A;  4P0I A;  3QSL A;  4BDM A;  1MDQ A;  1MS7 A;  5CM6 A;  2X7Q A;  3RQT A;  4HCY A;  3DP4 A;  4GL8 A;  4IGR A;  3C32 A;  5B70 A;  4FIM A;  1S7Y A;  4R6H A;  4YKK A;  2XHD A;  1MPD A;  3TKD A;  1B7H A;  3B7D A;  3MUQ A;  3VVE A;  4RJZ A;  1JW1 A;  3K6W A;  4IY5 A;  3U92 A;  4ZED A;  1POY 1;  2F34 A;  1EU8 A;  4QF9 A;  4AB5 A;  3OO7 A;  4F3P A;  1RKM A;  3TQW A;  1ATG A;  4YKP A;  1UIU A;  3UN6 A;  3BBR A;  1EH3 A;  4IO5 A;  5L8D A;  1B9J A;  1OMP A;  3KN3 A;  3U8Q A;  2HFB A;  3FUZ A;  2AL5 A;  3IJX B;  3T9U A;  5AA2 D;  3L6G A;  3S9N C;  3LSW A;  3HN0 A;  3KBR A;  2H9B A;  2X26 A;  3WAF A;  5KDT A;  3MW0 A;  2FYI A;  4ZEB A;  4IY6 A;  3SEW A;  1FQF A;  3UIF A;  5H8H A;  5KCJ B;  2X7P A;  4KPT A;  4LZ5 A;  1CE2 A;  5CMB A;  1A54 A;  4KYD A;  4U4S A;  3CVG A;  2F6P A;  4F19 A;  3TTR A;  3V5A A;  1MQD A;  2M8C A;  2UVI A;  2OWS A;  3FXQ A;  3O2A A;  4H65 A;  1NL5 A;  2QS4 A;  3EN3 A;  4OXV A;  2O7I A;  3PUX E;  2ANJ A;  4MF3 A;  4WKM A;  3SEX A;  3HST A;  1WOD A;  5I59 A;  1QW0 A;  4R75 A;  5J1D A;  4XKN A;  3FXR A;  2Y7W A;  4DLD A;  5AA2 B;  3K00 A;  4X9T A;  3C34 A;  1M5B A;  4KI0 E;  3RUM A;  3K01 A;  1BKA A;  3UGW A;  3HHF A;  3G3G A;  3T9X B;  4GF8 A;  3G3I A;  4H6D A;  2V93 A;  1LAH E;  1II5 A;  3CG3 A;  4R73 A;  4ZZA A;  3K1P A;  1M5F A;  1LLS A;  2RC9 A;  3E13 X;  3G3K A;  1M5E A;  3IO6 A;  3QYT A;  2B65 A;  3GBA A;  5TPA A;  3TTK A;  3QIM A;  3S9E A;  1M5C A;  3VVF A;  1B3E A;  3A3C A;  2KLF A;  1S50 A;  4MBP A;  5ELV A;  3H6T A;  3FJM A;  4QFL A;  3TZA A;  3Q27 A;  4U1O A;  1Y20 A;  2F6G A;  4OZ9 A;  1B0L A;  1N3X A;  1RYX A;  3E9X A;  2F78 A;  4LQ2 A;  1ZJL A;  3RNN A;  3O29 A;  3IO4 A;  5JTY B;  5A5X B;  2D21 A;  5AA4 B;  2D5W A;  4OFJ A;  1FW0 A;  3MP6 A;  2DSF A;  3K02 A;  3MVY A;  4N13 A;  2NXO A;  1SDX A;  3C31 A;  5EHM A;  3IOT A;  1LAX A;  3OXN A;  4FOR A;  2DVC A;  2YLN A;  4G68 A;  3EHT A;  5EHS A;  5L9M A;  3U93 A;  5JK4 A;  1Y1M A;  1NNK A;  4NF8 B;  2PX1 A;  2A5T B;  4KCD A;  5BWJ A;  1MXW A;  1O64 A;  3IB1 A;  3W9W A;  5CBS A;  5ICQ A;  1N7X A;  1B05 A;  1SYH A;  3MP8 A;  4X1D A;  1I6Q A;  2XXP A;  2DWJ A;  1R9Q A;  1JVX A;  2AL4 A;  3GXA A;  4LP2 B;  4R72 A;  5FHM A;  2G93 A;  3V89 B;  3DP8 A;  3IX1 A;  3MPL A;  3IK6 B;  4ELR A;  4GOT A;  1LFI A;  2OWT A;  5CC2 A;  1XVX A;  3KFM A;  4THI A;  3F11 A;  2DWA A;  3QUJ A;  4NF6 B;  4WXJ A;  4DXU A;  5B7D A;  1LGB C;  3EPE A;  4JSO A;  1A8F A;  1D9V A;  1EZ9 A;  2LAO A;  2QSX A;  2XD3 A;  2ZYO A;  3ZKL A;  3I5O A;  3IB0 A;  1GR2 A;  3LSX A;  2WKY A;  1TFA A;  2HAU A;  3CFZ A;  1QUI A;  2REG A;  1Y4T A;  2HQ0 A;  2XXI A;  3K6U A;  3KEI A;  4F1V A;  5I2K A;  3PPQ A;  1D4N A;  2OLB A;  3FGS A;  4M4G A;  1B2H A;  2GHB A;  4KFQ A;  4N07 A;  3MC2 A;  2DQV A;  4P0G A;  3KN8 A;  4UAC A;  3U72 A;  4ELO A;  5DYH A;  2A5S A;  3O66 A;  2OK2 A;  3CG1 A;  4LON B;  3GZG A;  5TP9 B;  1PB9 A;  3I3V A;  3Q28 A;  3A3U A;  3IOR A;  2XXY A;  3TDJ A;  4F31 B;  2REJ A;  1QUK A;  1H45 A;  3IAZ A;  3KZG A;  4NF4 A;  4OHN A;  4R2B A;  4NF5 A;  4X1B A;  2DOJ A;  3SES A;  3UOR A;  3V83 A;  1RYO A;  2O6A A;  3H06 B;  4FJP A;  4Z0I A;  5HM4 B;  1B5H A;  1LB9 A;  4QSD A;  3PPP A;  4F22 A;  2XXR A;  4ECF A;  2DE3 A;  3L6H A;  3FV1 A;  1FQA A;  2CZL A;  4TOZ A;  1IUD A;  2QMW A;  1O63 A;  3OEN A;  4QSE A;  2O69 A;  5L9O A;  4JBZ A;  1L5T A;  1M5D A;  4DDD A;  1P1W A;  3FVG A;  4C0R A;  1P99 A;  2VHA A;  3OSQ A;  4IO7 A;  1KWH A;  2UYF A;  1B3L A;  4LUB A;  1PB8 A;  1Q35 A;  3TOD A;  4IO2 A;  1HSE A;  1R1N A;  4MH5 A;  3BKI B;  1IXH A;  3EHS A;  3DP6 A;  3PD9 A;  5H8F B;  4ZE8 A;  4OEV A;  3K2D A;  2DE2 A;  3Q29 A;  2QS3 A;  4NTL A;  2E0S A;  3T66 A;  4F3G A;  1A99 A;  3OO8 A;  2R71 A;  3C33 A;  4RPO A;  3H4Z A;  2ONR A;  3UP9 A;  1Q1K A;  1TXF A;  4FED A;  1US5 A;  1B5J A;  2ABH A;  4LZ8 A;  1XC1 A;  3RLF E;  4KCC A;  1NH8 A;  2XXU A;  3FJ7 A;  3ODB A;  1OIB A;  3TTM A;  5I2N B;  1A40 A;  1Y4C A;  4U21 A;  2H5Y A;  3IOU A;  1I6B A;  1US4 A;  3UA8 A;  2DXY A;  2PT2 A;  2XXW A;  4YB7 A;  1NKX A;  2H98 A;  1H3D A;  1MQJ A;  2QL3 A;  2ZYK A;  3MAM A;  4P11 A;  3TYH A;  3KSJ A;  4EUO A;  3N6T A;  3R26 A;  4OWD A;  4YAH X;  3USD A;  3TUS A;  1F9B A;  3PV0 E;  3BFU A;  1AOV A;  1UTH A;  3Q25 A;  3IOV A;  3KJT A;  1H76 A;  5I57 B;  2Q9T A;  1N7W A;  3RTW B;  1NNP A;  1ZTY A;  1GV8 A;  3VDF A;  4BDN A;  2O7U A;  4ZDM A;  3LC8 A;  3KSX A;  1A55 A;  5I56 A;  2RCB A;  3CIJ A;  3S4U A;  1B52 A;  1FTJ A;  2QS1 A;  5H8Q A;  1XVY A;  3QK6 A;  4PP0 A;  4F3S A;  2ZXT A;  1GGG A;  3CFL A;  4TLM B;  4ZS9 A;  1TFD A;  3MJN A;  3O6G A;  2I49 A;  5H8S A;  4C1T A;  5FTI A;  3KG2 A;  1LFG A;  4HS7 A;  3IL1 B;  3W9V A;  1B4H A;  1HSJ A;  1LBC A;  2DWH A;  4JB7 A;  2AYS A;  4YU0 A;  2I3W A;  3SET A;  4I8C A;  4YMA A;  1DTG A;  4WED A;  3CFX A;  4K3F A;  3OEL A;  1AIV A;  4KQP A;  1NNF A;  1MM7 A;  3OMB A;  1MM6 A;  2RCA A;  4OQO A;  5LOM A;  4RYA A;  2P0S A;  3TFL A;  2RKM A;  3RPW A;  2NOO A;  4RPN A;  4H67 A;  3ZS6 A;  4YKJ A;  1OLA A;  3ILT B;  4TQU Q;  5KCJ A;  1VE4 A;  3MVX A;  5H8H B;  1B0H A;  3G3F A;  1BIY A;  1DTZ A;  3N6U A;  4POX A;  3C36 A;  4Q0C A;  2DE4 A;  1OQG A;  4OYV A;  4G8N A;  1SYI A;  1QKB A;  4OVJ A;  3N26 A;  1MQI A;  5I59 B;  2F97 A;  3SEV A;  1BP5 A;  2I0B A;  1A8E A;  2I0C A;  4G2Z A;  4PFW A;  5AA2 A;  4ZEK A;  4ONY A;  3MQ9 A;  3IR1 A;  5M2V A; 
#chains in the Genus database with same CATH topology
 1P1Q A;  2WEF A;  5AA3 A;  3MBP A;  5TPA B;  4P9K A;  3S9M C;  2GRV A;  3D4C A;  4F2O A;  2W7Y A;  3A29 A;  1QVS A;  2I3V A;  4H1X A;  3RN8 A;  5EYF A;  5IGA A;  2Z8D A;  1JW5 A;  4GIZ A;  4YB5 A;  1FPI A;  4GX4 A;  3A09 A;  1MY3 A;  5AA4 A;  1O7T A;  2H4I A;  5T3J A;  1B7Z A;  1D3K A;  3C35 A;  1P1O A;  5IZ3 A;  2NWJ A;  4F2Q A;  4U22 A;  5DEX B;  3ILU B;  1ZIU A;  1FTL A;  3OEM A;  2O68 A;  4BLA A;  5DVI A;  3OEK A;  4FBP A;  3LSL A;  5F24 A;  3ZKK A;  1LCF A;  3RT6 B;  4LZ7 A;  1MY4 A;  5EQ7 A;  4MX6 A;  2CZI A;  5EQA A;  1VR5 A;  2F8D A;  4QFN A;  2XXT A;  1LFH A;  4ZE9 A;  2UVH A;  4GRK A;  4DCX A;  1JET A;  1N3W A;  1K9Y A;  4E0X A;  1Y3N A;  1JW4 A;  4KHZ E;  3U1O A;  4LQ5 A;  5ET8 A;  3DEL B;  2DVZ A;  1K9Z A;  2Q89 A;  5ET5 A;  1SPI A;  3EF7 A;  1YPN A;  3G3H A;  2AIX A;  3T9H B;  4KYE A;  2QMX A;  3FV2 A;  1NV3 A;  1DMB A;  2HXW A;  2Q2C A;  2OJT A;  3IOW A;  1FBG A;  5HBC A;  3PU5 A;  4O8M A;  1B5I A;  1URS A;  5CRY A;  1B32 A;  4G4P A;  4E0W A;  1H43 A;  4NN3 A;  5HPQ A;  2G29 A;  1FPD A;  4ELQ A;  3VLU A;  1H44 A;  1A7L A;  1LBW A;  2ZYN A;  3H7M A;  1ELJ A;  1USY H;  2DXR A;  2F7B A;  2I4B A;  1MY1 A;  4F1U A;  4I9D A;  1FTO A;  4ND9 A;  2V3U A;  3CHG A;  1IQ7 A;  4IO3 A;  1I6A A;  1Q9D A;  1GVC A;  4ZZE A;  4U1Z A;  4JWO A;  2UYE A;  3O9P A;  5F7V A;  4BDR A;  3FVN A;  5I3S A;  2XX7 A;  1IMB A;  2GHA A;  4OTE A;  3Q26 A;  4EDP A;  1DPE A;  1EZP A;  4YKI A;  3B6W A;  1YYZ A;  5EQ8 A;  3VV5 A;  4IGT A;  2IEE A;  1IZ1 A;  3TCG A;  2DP8 A;  5FTH A;  2QVV A;  4KR5 A;  3S9L C;  5IM2 A;  3VVD A;  1OVT A;  3OOA A;  1MH3 A;  4NQ8 A;  4G77 A;  3BIG A;  4Q30 B;  2F3B A;  4F39 A;  3PUW E;  1JEU A;  2O1L A;  4I3E A;  4XIG Q;  3ECR A;  2Z23 A;  1Z7M E;  4XKR A;  2CEY A;  1ZU0 A;  3FJG A;  4MLQ A;  2THI A;  2XX8 A;  2OBG A;  3OSR A;  5B7D A;  1PEB A;  2V4C A;  1B1X A;  4O7I A;  2VOZ A;  2R6G E;  2VD2 A;  4Q8R A;  3FZV A;  4NED A;  2XXX A;  3SKP A;  4PCD A;  1PBP A;  4O3A A;  4OES A;  3D4G A;  5I58 B;  1CB6 A;  4PFY A;  1USY E;  4EF2 A;  4PF6 A;  1IXI A;  2QVR A;  1I69 A;  3KOS A;  4P0I A;  2Q74 A;  4HCY A;  4IGR A;  5B70 A;  4FIM A;  4YKK A;  3VVE A;  1JW1 A;  4ZED A;  3TQW A;  5L8D A;  2HFB A;  5AA2 D;  3LSW A;  3WAF A;  3SEW A;  4JVD A;  1CE2 A;  2F6P A;  3TTR A;  1MQD A;  2M8C A;  2UVI A;  3FXQ A;  4H65 A;  3EN3 A;  1WOD A;  1QW0 A;  2Y7W A;  4DLD A;  5DW8 A;  3RPL A;  3HHF A;  2XXK A;  3G3G A;  3T9X B;  3K1P A;  1M5F A;  2RC9 A;  3QYT A;  3QIM A;  2KLF A;  2P3N A;  5ELV A;  3TZA A;  3Q27 A;  4U1O A;  1Y20 A;  1N3X A;  1ZJL A;  1FSA A;  3IO4 A;  4H45 A;  4OFJ A;  3K02 A;  3OXN A;  5L9M A;  5JK4 A;  2DVC A;  4G68 A;  3U93 A;  4KCD A;  3IB1 A;  1B05 A;  3MP8 A;  4MEV A;  1I6Q A;  4LP2 B;  1JVX A;  2G93 A;  2CZK A;  2OWT A;  4AS5 A;  1A8F A;  3CFZ A;  1Y4T A;  2HQ0 A;  4KFQ A;  3U72 A;  4MHF A;  5DYH A;  2A5S A;  2OK2 A;  3CG1 A;  5LDZ A;  3I3V A;  2XXY A;  3IAZ A;  4PFR A;  4PTK A;  2FIE A;  2CZH A;  4FJP A;  1B5H A;  1O63 A;  2O69 A;  1M5D A;  4DDD A;  2VHA A;  3OSQ A;  4IO7 A;  3TOD A;  4F18 A;  4PGP A;  3Q29 A;  2QS3 A;  3QMF A;  3C33 A;  4RPO A;  1US5 A;  2ABH A;  1IMA A;  3TTM A;  5I2N B;  1I6B A;  1US4 A;  1NKX A;  4EUO A;  4NAP A;  2QL3 A;  4OWD A;  3USD A;  5LTC A;  1F9B A;  3BFU A;  1KZ8 A;  1UTH A;  2Q9T A;  1N7W A;  4N6K A;  3LC8 A;  4AS4 A;  2RCB A;  1B52 A;  1GGG A;  3CFL A;  4ZS9 A;  1TFD A;  3MJN A;  4DXU A;  2I49 A;  3KG2 A;  1LFG A;  3IL1 B;  3W9V A;  4JB7 A;  4PFB A;  4YU0 A;  3SET A;  4YMA A;  4GX6 A;  1NNF A;  5LOM A;  1MM6 A;  2RCA A;  4OQO A;  2P0S A;  3TFL A;  4RPN A;  2FIX A;  3ILT B;  1VE4 A;  5H8H B;  3N6U A;  4Q0C A;  1LEV A;  1SYI A;  4OVJ A;  3N26 A;  2I0C A;  4OA4 A;  4G2Z A;  4ZEK A;  3IR1 A;  4GWY A;  1FPB A;  2XX9 A;  2KQZ A;  1B3G A;  5ITP A;  4GWZ A;  4I3Y A;  2OWZ A;  4GXS B;  4O3C A;  1MXU A;  1RDZ A;  2B3B A;  4F29 A;  4G68 B;  4NMY A;  4HE2 A;  1KA1 A;  4C1U A;  5DTB A;  4XKP A;  2ALU A;  2YJP A;  4BDQ A;  1GTK A;  1FTM A;  2B4M A;  4BDO A;  2OX3 A;  3O6H A;  2XXV A;  1AH5 A;  5H8N A;  1SI0 A;  4P8B A;  4H8J A;  2VD3 A;  3OD7 A;  3PUV E;  3IB2 A;  4OET A;  5IZ1 A;  4N17 A;  4PF8 A;  5CMC A;  1POT A;  4NHB A;  2PMS A;  4P3L A;  2PVU A;  1OVB A;  1QUL A;  3ONM A;  4KYS A;  3B50 A;  4ELP A;  1DPP A;  2A5T A;  1MQH A;  4MIJ A;  3PPR A;  1Y9U A;  2R8T A;  4EQB A;  1B4Z A;  4DIG A;  4GVO A;  2Q2A A;  1SW4 A;  3LSF B;  2RC8 A;  2Y5L A;  3CSG A;  5IKB A;  3HFU A;  3LV0 A;  1MG1 A;  1ZKB A;  3O28 A;  1IXG A;  2FNC A;  3SEY A;  4FAT A;  2ZNU A;  4POW A;  3PPN A;  1MXX A;  2F36 A;  4H5F A;  1JNF A;  1DBZ A;  2DWI A;  2DS9 A;  2IA4 A;  1Y3Q A;  4ESW A;  3PPO A;  5I7I A;  2I6E A;  2NVU B;  1B40 A;  3VXB A;  3WAE A;  3M3K A;  4OVP A;  5JTY A;  4GQO A;  3V8X B;  4NGU A;  4F3B A;  4N81 A;  1FQC A;  2HCA A;  2B4L A;  1Y1Z A;  2XXQ A;  1BK4 A;  4EQ9 A;  3M8U A;  1UQW A;  3PUZ E;  1PDA A;  1AL3 A;  1MRP A;  4GWO A;  3VLW A;  3PUY E;  1LBY A;  1D9Q A;  4U23 A;  4PE5 B;  4LAT A;  2PFY A;  1LBB A;  4R2F A;  1B1H A;  2O51 A;  1S9T A;  1SBP A;  4H5G A;  2Z8F A;  1IIW A;  1IMF A;  3MP1 A;  2HEU A;  3TTL A;  4P1L A;  1SD3 A;  2F7A A;  1IMD A;  1MY0 A;  1P1U A;  2XXH A;  4P56 A;  1YZ0 A;  3KJ7 A;  4O3B A;  2YPN A;  3H6W A;  1MXZ A;  1NMU A;  1T0K A;  4DZ1 A;  5CMK A;  1OQH A;  3T22 A;  4IR8 A;  5ISU A;  5I2N A;  4JWX A;  3ZSF A;  2MKZ A;  3DLN A;  1XOC A;  4G8M A;  2Y7K A;  1PBQ A;  5CBR A;  4DE8 A;  3CR9 A;  4LVQ A;  4GWU A;  4ZEC A;  5L9S A;  4OEN A;  4NWC A;  2ZMB A;  4R9F A;  3PMW A;  5K2Y A;  3O97 A;  1ZBM A;  1LST A;  4NWD A;  4XXU A;  2UVG A;  2Z8E A;  4MNC A;  4L17 A;  2RC7 A;  4ZEF A;  2E1S A;  2H99 A;  3O6I A;  4QBA A;  1QJM A;  1XI6 A;  2ONS A;  3MZB A;  1B7U A;  1SI1 A;  3QXM A;  4PDH A;  1MQG A;  4QRZ A;  4XFE A;  4FAJ A;  1NV5 A;  1VSO A;  2Y84 A;  4GXA A;  1UTH B;  5CI5 A;  2HZL A;  4OMB A;  2VGQ A;  1MDQ A;  2X7Q A;  3DP4 A;  2L5V A;  3TKD A;  1MPD A;  3B7D A;  4RJZ A;  4IY5 A;  4X8R A;  1EU8 A;  4YKP A;  3UN6 A;  3BBR A;  2AL5 A;  3L6G A;  3HN0 A;  3KBR A;  2X26 A;  3KC0 A;  2VT5 A;  3MW0 A;  1FQF A;  5H8H A;  2X7P A;  4LZ5 A;  5CMB A;  3U65 A;  1G0H A;  3V5A A;  4OXV A;  2QS4 A;  2O7I A;  3PUX E;  2ANJ A;  4MF3 A;  4XKN A;  3FXR A;  3C34 A;  3RUM A;  1BKA A;  4GF8 A;  3CG3 A;  4R73 A;  3G3K A;  2B65 A;  3GBA A;  1FJ6 A;  3S9E A;  1M5C A;  4N8Y A;  4QFL A;  4KXP A;  5J16 A;  3E9X A;  1LBV A;  5ET6 A;  3MVY A;  2NXO A;  1SDX A;  1LAX A;  5EHS A;  3EHT A;  4JVC A;  2WYK A;  2PX1 A;  1O64 A;  3W9W A;  1N7X A;  1SYH A;  2XXP A;  3GXA A;  2AL4 A;  3IK6 B;  1LFI A;  5CC2 A;  3KFM A;  4WXJ A;  2DWA A;  4NX1 A;  2LAO A;  2XD3 A;  3ZKL A;  3I5O A;  4PE3 A;  1GR2 A;  1QUI A;  2REG A;  2XXI A;  3PPQ A;  4M4G A;  4N07 A;  2GHB A;  4UAC A;  2DQV A;  3KN8 A;  4ELO A;  3GZG A;  1PB9 A;  2REJ A;  3SES A;  1INP A;  3V83 A;  4N6D A;  3H06 B;  4N8G A;  2DE3 A;  3FV1 A;  1FQA A;  4TOZ A;  4N91 A;  4C0R A;  2VPN A;  4QFP A;  4PGN A;  4LUB A;  1PB8 A;  4IO2 A;  1R1N A;  4ZE8 A;  1IXH A;  3DP6 A;  4OEV A;  4PBQ A;  2ONR A;  1Q1K A;  4LZ8 A;  1XC1 A;  1OIB A;  1A40 A;  1Y4C A;  2H5Y A;  3IOU A;  2DXY A;  2H98 A;  1H3D A;  3KSJ A;  3N6T A;  1NNP A;  3VDF A;  5H8Q A;  5I56 A;  4C1T A;  4HS7 A;  2WYP A;  1B4H A;  1LBC A;  2DWH A;  2I3W A;  4WED A;  1FRP A;  4KQP A;  4DI3 D;  4NG7 A;  1JP4 A;  3ZS6 A;  4TQU Q;  5KCJ A;  4POX A;  1DTZ A;  2PFZ A;  2I0B A;  3TDJ A;  1MY2 A;  3C9H A;  3SEU A;  1EZO A;  4PFT A;  3VE1 B;  2HAV A;  1NUX A;  5CMM A;  1LAG E;  3T93 B;  3IJO B;  1MPB A;  1N84 A;  1D9Y A;  3SZP A;  2V3Q A;  3M3F A;  1JVY A;  3MYU A;  3FVK A;  3PGF A;  4FE8 A;  4MNI A;  1FPL A;  3IFA A;  3H03 A;  3S2V A;  4HCW A;  3N5L A;  1NV1 A;  1ZLQ A;  4PDD A;  5ET7 A;  3THI A;  3TCF A;  4OVQ A;  1B58 A;  4YZZ A;  1VDW A;  5I58 A;  3KC1 A;  2Y5K A;  2PBW A;  3K4U A;  4ESX A;  1AMF A;  4JWY A;  3PTY A;  2JJK A;  4RK2 A;  4MMP A;  5FHO A;  5DVF A;  2O1M A;  4QFO A;  3HO7 A;  2P3V A;  5A5X A;  5ICT A;  4PBH A;  4R6K A;  4R9G A;  3BFT A;  3R6U A;  2HXR A;  4YIC A;  3TCH A;  4G68 C;  2XA5 A;  3PMV A;  5H8F A;  2ZNT A;  4G8H A;  4U2R A;  1JQF A;  3PMX A;  4HE0 A;  2XWK A;  1NNT A;  3TEP A;  5AA1 A;  3RYD A;  1N04 A;  4H0W A;  1FBP A;  1SW1 A;  3TAJ A;  4FEB A;  1YXI A;  2UXA A;  4HXV A;  4EF1 A;  4PQJ A;  5TU0 A;  4QSC A;  1XS5 A;  2QRY A;  2GQ1 A;  3LUY A;  5H8Q B;  1LCT A;  1PB7 A;  3MZ1 A;  2Q8J A;  3B8B A;  3JYR A;  3RGY A;  1BTJ A;  2QPQ A;  1MPC A;  1ZMG A;  2I4C A;  3MZ9 A;  1SQY A;  1YAE A;  2QJE A;  3VLV A;  5IAI A;  3RT8 A;  3RTF B;  4IO4 A;  2ZYM A;  3SDF A;  3MWB A;  5ITO A;  3EHU A;  3VXC A;  4DXC A;  4IB2 A;  4P1E A;  1HSL A;  2I58 A;  3FAS A;  1JEV A;  2D3I A;  1MXV A;  1SVX B;  3P7I A;  4HTG A;  4HW8 A;  2V25 A;  3CSB A;  4GBV A;  2WX9 A;  3I6V A;  4BDL A;  1B51 A;  4MFI A;  3MVW A;  3N94 A;  3TMG A;  2P2A A;  4MJO A;  3LBS A;  1J1N A;  2HZK A;  2NUV A;  3T96 B;  2R9J A;  1FQD A;  3JV9 A;  3TQL A;  1CNQ A;  1SW5 A;  3H3G A;  3FD3 A;  1Z7N E;  4QFK A;  2FA7 A;  3PD8 A;  3G3J A;  4QHQ A;  4R74 A;  3K0V A;  3OO9 A;  4FEC A;  4OER A;  1YCJ A;  2QS2 A;  1EYK A;  2XWI A;  3CRB A;  4DCY A;  4RXL A;  2PT1 A;  1IIT A;  4LA9 A;  3TPA A;  4OVT A;  5I56 B;  5I84 A;  4TLL B;  2PYY A;  3FAT A;  1N0T A;  2DYX A;  3LR1 A;  2OZZ A;  3R7X A;  1B6H A;  3EQ1 A;  5DEX A;  4EXK A;  4GFR A;  2FBP A;  4MLV A;  3MST A;  2XWV A;  3T1B A;  3K1M A;  4YMB A;  4EXL A;  1ANF A;  1FPJ A;  1FQE A;  2Q8M A;  3QSL A;  1MS7 A;  3RQT A;  3U92 A;  1POY 1;  2F34 A;  4QF9 A;  4AB5 A;  4F3P A;  1RKM A;  1UIU A;  1EH3 A;  4IO5 A;  1IMC A;  1OMP A;  4MAG A;  3IJX B;  3T9U A;  3ROJ A;  3S9N C;  2KR0 A;  5KDT A;  2H9B A;  3UIF A;  4ZEB A;  5KCJ B;  5IZZ A;  1A54 A;  4U4S A;  3O2A A;  2OWS A;  4WKM A;  5ESY A;  4NF0 A;  4OVR A;  5I59 A;  1LBZ A;  4R75 A;  5J1D A;  5AA2 B;  4KI0 E;  1NV7 A;  5FBP A;  4H6D A;  2V93 A;  1LAH E;  4ZZA A;  2HPG A;  1LLS A;  3A3C A;  1S50 A;  4MBP A;  3H6T A;  2CEX A;  2F6G A;  4OZ9 A;  1B0L A;  3FXB A;  4LQ2 A;  4JVI A;  3O29 A;  2D21 A;  2D5W A;  3C31 A;  5EHM A;  2YLN A;  1Y1M A;  1NNK A;  5ICQ A;  2A5T B;  5BWJ A;  1MXW A;  4X1D A;  4Z7E A;  1R9Q A;  4R72 A;  5FHM A;  3V89 B;  3D1R A;  3DP8 A;  4ELR A;  4GOT A;  1XVX A;  1NV2 A;  3F11 A;  4NF6 B;  1LGB C;  4JSO A;  1AOV A;  1D9V A;  1EZ9 A;  2QSX A;  3IB0 A;  1TFA A;  2HAU A;  4F1V A;  5I2K A;  3BIH A;  1D4N A;  3MC2 A;  3T0J A;  3A3U A;  1QUK A;  4OHN A;  2DOJ A;  3UOR A;  1LB9 A;  4ECF A;  3L6H A;  2QMW A;  3OEN A;  4QSE A;  5L9O A;  4JBZ A;  3FVG A;  1P99 A;  1KWH A;  2UYF A;  1B3L A;  1Q35 A;  5H8F B;  3EHS A;  1NV6 A;  1IME A;  1RDY A;  2DE2 A;  2FVZ A;  1NI9 A;  4NTL A;  2E0S A;  3T66 A;  4F3G A;  3OO8 A;  2R71 A;  3UP9 A;  1TXF A;  1B5J A;  1NUW A;  2XXU A;  3FJ7 A;  4KCC A;  4U21 A;  4HE1 A;  1AWB A;  2XWO A;  2XXW A;  1MQJ A;  3TYH A;  3TUS A;  3R26 A;  4YAH X;  3PV0 E;  5I57 B;  1ZTY A;  4ZDM A;  1FTJ A;  1XVY A;  5EYH A;  3O6G A;  5H8S A;  5FTI A;  4UAB A;  2HHM A;  2AYS A;  4I8C A;  1DTG A;  3OEL A;  3KBZ A;  3OMB A;  1MM7 A;  4RYA A;  3RPW A;  4H67 A;  1B0H A;  3G3F A;  1BIY A;  3C36 A;  4OYV A;  4G8N A;  1MQI A;  5I59 B;  3SEV A;  1BP5 A;  2VPO A;  5AA2 A;  4PFW A;  4ONY A;  3MQ9 A;  2Y7R A;  1B3H A;  1FBF A;  5DT6 A;  2Y7I A;  1FCK A;  3E4R A;  1UTB B;  3FXU A;  4XEQ A;  4GWS A;  1NV0 A;  3OO6 A;  2ZZV A;  2ZNS A;  1G0I A;  1NFT A;  3EKI A;  4MNP A;  1MH4 A;  1DCU A;  1Y3P A;  4NF8 A;  3H6U A;  3AXF A;  3HV1 A;  3E3K A;  5KZT A;  1XHY A;  1TT1 A;  4GWW A;  2F5X A;  4NF6 A;  2WBD A;  1TWY A;  3TTN A;  2V3T A;  4Q5T A;  1NH7 A;  3HHG A;  4RA1 A;  4OFO A;  3FIR A;  3B6T A;  4OEU A;  4N6P A;  3IFC A;  2ONK E;  4NF4 B;  5K2X A;  2P1S A;  2V84 A;  4I62 A;  4PFU A;  2QFL A;  3H6V A;  2B3F A;  4F19 A;  4ZEI A;  1SW2 A;  3UK4 A;  3KN7 A;  4PC9 A;  1XT8 A;  5AE4 A;  2BJJ X;  2F35 A;  1YTV A;  4WEP A;  1OLC A;  3G7W A;  2ESN A;  4NF5 B;  3LUZ A;  3GYY A;  1R9L A;  1IXC A;  3KOT A;  4PFI A;  4JSD A;  1VFD A;  4U4X A;  4RY1 A;  2H25 A;  1FTK A;  4KD5 A;  1N76 A;  4JXI A;  4I1D A;  2VP1 A;  3SER A;  3HCQ A;  3E78 A;  1P1N A;  5KDT B;  1DSN A;  4YB6 A;  4NE4 A;  4UA8 A;  4M1V A;  4PAI A;  1B3F A;  3K6V A;  2O84 X;  3RY3 A;  4JDF A;  3JZJ A;  3M3L A;  2CMO A;  1IEJ A;  1BLF A;  2I48 A;  1FTA A;  1PC3 A;  4PET A;  5F1Q A;  1LAF E;  4IO6 A;  1KA0 A;  2OCU A;  4DI4 B;  3DM0 A;  1FQB A;  1R6Z A;  2Z22 A;  3K6X A;  4H8I A;  4GBW A;  1DOT A;  1UTB A;  2F3D A;  2F7C A;  3T9V A;  4XF5 A;  4O7M A;  3U94 A;  3VFJ A;  1LB8 A;  1NUY A;  2XD2 A;  3B6Q A;  4GL0 A;  3QAX A;  3C4M A;  1RDX A;  5A5L A;  3K1N A;  4GWX A;  1WVJ A;  2GH9 A;  2RF1 A;  5I2K B;  3GBB A;  4GD5 A;  3QUF A;  4ISU A;  3FVO A;  4EQ7 A;  5TP9 A;  4N15 A;  4RNS A;  4OFL A;  2WBB A;  2BJI A;  2UVJ A;  2Y7P A;  2Q88 A;  3HPI A;  4RK9 A;  1MDP 1;  3CI8 A;  4G61 A;  3MPK A;  4R6Y A;  1URG A;  4PAF A;  3KGC A;  1VFE A;  4X48 A;  1FBH A;  4XTC Q;  5JEI A;  3MVZ A;  2GFE A;  1DK4 A;  1QKA A;  4AB6 A;  1MXY A;  1WDN A;  2RIN A;  3TEL A;  1UIV A;  1URD A;  5DVJ A;  4XKQ A;  4GLI A;  3W15 C;  1B46 A;  5EYG A;  4H46 A;  5I57 A;  5H8N B;  4AQ4 A;  1QUJ A;  3GLB A;  4BDM A;  5CM6 A;  4GL8 A;  3C32 A;  4R6H A;  1S7Y A;  2XHD A;  1B7H A;  3MUQ A;  3K6W A;  3OO7 A;  1ATG A;  1B9J A;  3KN3 A;  3U8Q A;  3FUZ A;  2PCR A;  2FYI A;  4IY6 A;  4KPT A;  4KYD A;  3CVG A;  4GX3 A;  1NL5 A;  5BUU A;  3SEX A;  4P47 A;  3HST A;  1FPF A;  3K00 A;  4X9T A;  1M5B A;  3K01 A;  3UGW A;  3G3I A;  1II5 A;  5TPA A;  3E13 X;  1M5E A;  3IO6 A;  3TTK A;  3VVF A;  1QGX A;  1B3E A;  3FBP A;  4I40 A;  1FJ9 A;  3FJM A;  1RYX A;  2F78 A;  3RNN A;  2ZZW A;  1NV4 A;  5JTY B;  5A5X B;  5AA4 B;  1FW0 A;  3MP6 A;  2DSF A;  4N13 A;  3IOT A;  4FOR A;  5IZ3 B;  4NF8 B;  5CBS A;  4F22 A;  2DWJ A;  4X04 A;  3IX1 A;  3MPL A;  1LBX A;  4O94 A;  4THI A;  3QUJ A;  3EPE A;  2ZYO A;  3LSX A;  2WKY A;  3KEI A;  3K6U A;  4OAN A;  2OLB A;  4P0G A;  3FGS A;  5FHN A;  1B2H A;  3O66 A;  4LON B;  5TP9 B;  3Q28 A;  1FPE A;  3IOR A;  3ISP A;  4F31 B;  4X1B A;  1H45 A;  4R2B A;  3KZG A;  4NF4 A;  3NOH A;  4NF5 A;  1RYO A;  2O6A A;  4Z0I A;  5HM4 B;  4QSD A;  3PPP A;  2XXR A;  2CZL A;  1IUD A;  1FBD A;  1L5T A;  1P1W A;  4F1Y A;  1HSE A;  4MH5 A;  3BKI B;  3PD9 A;  1FPG A;  1FPK A;  4QXD A;  3K2D A;  1A99 A;  2ZZX A;  3H4Z A;  4FED A;  3RLF E;  1NH8 A;  3ODB A;  4N4U A;  3UA8 A;  2PT2 A;  4YB7 A;  2ZYK A;  4P11 A;  3MAM A;  4OVS A;  3Q25 A;  3IOV A;  3KJT A;  1H76 A;  3RTW B;  1GV8 A;  4BDN A;  2O7U A;  3KSX A;  1A55 A;  5I5P A;  3CIJ A;  3S4U A;  2QS1 A;  4F3S A;  2DDK A;  3QK6 A;  4PP0 A;  2ZXT A;  4DXB A;  4TLM B;  1HSJ A;  3E79 A;  3CFX A;  4K3F A;  1FBC A;  1AIV A;  1EYI A;  5EQ9 A;  4MCO A;  1NUZ A;  1FBE A;  2RKM A;  2NOO A;  4PAK A;  4YKJ A;  1OLA A;  3MVX A;  2DE4 A;  1EYJ A;  1OQG A;  1QKB A;  2F97 A;  2FHY A;  2QVU A;  1A8E A;  4LN5 A;  3RPL B;  5M2V A; 
#chains in the Genus database with same CATH homology
 1P1Q A;  2Y7R A;  1B3H A;  1MY2 A;  5DT6 A;  2Y7I A;  3C9H A;  5AA3 A;  3MBP A;  3SEU A;  1EZO A;  5TPA B;  3S9M C;  4PFT A;  2GRV A;  3D4C A;  3VE1 B;  4F2O A;  2XX9 A;  2W7Y A;  1QVS A;  1FCK A;  1B3G A;  3E4R A;  2I3V A;  5ITP A;  4Z7E A;  2HAV A;  4H1X A;  5CMM A;  1LAG E;  1UTB B;  3FXU A;  5EYF A;  2Z8D A;  3RN8 A;  3T93 B;  1JW5 A;  4GIZ A;  4YB5 A;  3IJO B;  1MPB A;  1N84 A;  1D9Y A;  3OO6 A;  2V3Q A;  3A09 A;  4GXS B;  3M3F A;  4O3C A;  1MY3 A;  5AA4 A;  1MXU A;  5FHN A;  1JVY A;  1O7T A;  2H4I A;  3FVK A;  2ZNS A;  1B7Z A;  1NFT A;  3PGF A;  2B3B A;  4F29 A;  4FE8 A;  4G68 B;  1D3K A;  3C35 A;  1P1O A;  4NMY A;  1MH4 A;  1Y3P A;  4NF8 A;  2NWJ A;  4Q8R A;  3H6U A;  4F2Q A;  4U22 A;  5DEX B;  3ILU B;  4C1U A;  3H03 A;  5DTB A;  3AXF A;  3HV1 A;  3S2V A;  1ZIU A;  3E3K A;  4HCW A;  5KZT A;  1FTL A;  3OEM A;  2O68 A;  1XHY A;  3N5L A;  4BLA A;  1TT1 A;  1ZLQ A;  3OEK A;  4XKP A;  2F5X A;  5DVI A;  3THI A;  4NF6 A;  1TWY A;  3TCF A;  2ALU A;  3LSL A;  3TTN A;  2V3T A;  2YJP A;  1B58 A;  4BDQ A;  1GTK A;  4Q5T A;  4YZZ A;  3ZKK A;  1FTM A;  1NH7 A;  5I58 A;  1LCF A;  4BDO A;  3RT6 B;  3HHG A;  3O6H A;  2XXV A;  4LZ7 A;  1AH5 A;  1MY4 A;  4RA1 A;  5H8N A;  1SI0 A;  4OFO A;  2PBW A;  3FIR A;  3K4U A;  3B6T A;  4ESX A;  1AMF A;  4H8J A;  4JWY A;  4OEU A;  4N6P A;  2VD3 A;  3OD7 A;  4RK2 A;  4NF4 B;  2ONK E;  5FHO A;  5DVF A;  2O1M A;  3PUV E;  3HO7 A;  4QFO A;  5A5X A;  3IB2 A;  4OET A;  1VR5 A;  5CMC A;  2F8D A;  4QFN A;  2P1S A;  4R6K A;  5K2X A;  5ICT A;  2V84 A;  2XXT A;  1POT A;  4R9G A;  3BFT A;  2PMS A;  4ZE9 A;  1LFH A;  2PVU A;  1OVB A;  1QUL A;  2UVH A;  4I62 A;  4GRK A;  4PFU A;  3ONM A;  3R6U A;  4KYS A;  3H6V A;  4DCX A;  4YIC A;  2A5T A;  1DPP A;  3TCH A;  1JET A;  1MQH A;  1N3W A;  4G68 C;  4ELP A;  3PPR A;  2B3F A;  4E0X A;  3PMV A;  5H8F A;  2ZNT A;  1Y3N A;  1Y9U A;  4G8H A;  4U2R A;  4EQB A;  1B4Z A;  4F18 A;  4DIG A;  4GVO A;  2Q2A A;  1JW4 A;  1JQF A;  1SW4 A;  3LSF B;  4KHZ E;  4ZEI A;  1SW2 A;  3PMX A;  3UK4 A;  3U1O A;  4LQ5 A;  2RC8 A;  3DEL B;  2DVZ A;  1NNT A;  3TEP A;  5AA1 A;  2Q89 A;  3CSG A;  3EF7 A;  3KN7 A;  1YPN A;  5IKB A;  1N04 A;  3G3H A;  4H0W A;  1SW1 A;  2AIX A;  3TAJ A;  1XT8 A;  4FEB A;  3T9H B;  1MG1 A;  2BJJ X;  5AE4 A;  2F35 A;  4KYE A;  1YTV A;  1ZKB A;  2QMX A;  1IXG A;  2FNC A;  3O28 A;  3FV2 A;  4WEP A;  3SEY A;  1OLC A;  2UXA A;  3G7W A;  4EF1 A;  4PQJ A;  5TU0 A;  1DMB A;  4QSC A;  4FAT A;  2HXW A;  2Q2C A;  2ESN A;  4NF5 B;  2OJT A;  2ZNU A;  4POW A;  3IOW A;  1XS5 A;  1R9L A;  1IXC A;  3KOT A;  3PPN A;  1MXX A;  2F36 A;  2QRY A;  5HBC A;  3PU5 A;  4H5F A;  1B5I A;  1JNF A;  4JSD A;  1VFD A;  1URS A;  3LUY A;  5H8Q B;  5CRY A;  1LCT A;  1PB7 A;  4U4X A;  3MZ1 A;  2DWI A;  4RY1 A;  2H25 A;  2DS9 A;  1FTK A;  2IA4 A;  1Y3Q A;  4KD5 A;  1N76 A;  3PPO A;  1B32 A;  2I6E A;  2Q8J A;  4G4P A;  4ESW A;  4JXI A;  4I1D A;  2NVU B;  3JYR A;  1B40 A;  3RGY A;  3VXB A;  2VP1 A;  3SER A;  3WAE A;  1BTJ A;  2QPQ A;  3HCQ A;  3M3K A;  1P1N A;  5JTY A;  5KDT B;  1DSN A;  4E0W A;  4YB6 A;  4GQO A;  3V8X B;  1H43 A;  4NE4 A;  4F3B A;  4UA8 A;  4M1V A;  5HPQ A;  2G29 A;  4ELQ A;  1MPC A;  1FQC A;  1ZMG A;  2HCA A;  3VLU A;  1Y1Z A;  2XXQ A;  1B3F A;  1H44 A;  1A7L A;  2I4C A;  2ZYN A;  3M8U A;  3K6V A;  1UQW A;  4EQ9 A;  2O84 X;  1SQY A;  1YAE A;  3H7M A;  3MZ9 A;  2QJE A;  3PUZ E;  3RY3 A;  3VLV A;  5IAI A;  3RT8 A;  1ELJ A;  3RTF B;  1USY H;  2DXR A;  2F7B A;  2I4B A;  4JDF A;  1MY1 A;  1PDA A;  4F1U A;  1AL3 A;  4I9D A;  4IO4 A;  1MRP A;  3JZJ A;  3M3L A;  2CMO A;  1IEJ A;  4GWO A;  1BLF A;  1FTO A;  2ZYM A;  3SDF A;  2I48 A;  4ND9 A;  3VLW A;  3MWB A;  5ITO A;  3EHU A;  3VXC A;  2V3U A;  4DXC A;  1PC3 A;  4PET A;  4IB2 A;  1IQ7 A;  3PUY E;  5F1Q A;  4IO3 A;  1LAF E;  4IO6 A;  1I6A A;  4DXB A;  2OCU A;  1HSL A;  2I58 A;  3FAS A;  4U23 A;  1JEV A;  2D3I A;  4PE5 B;  1GVC A;  3DM0 A;  4LAT A;  4ZZE A;  1MXV A;  1SVX B;  3P7I A;  1FQB A;  4HTG A;  4HW8 A;  1R6Z A;  1LBB A;  4U1Z A;  2V25 A;  2Z22 A;  3CSB A;  3K6X A;  4H8I A;  4JWO A;  2UYE A;  3O9P A;  4R2F A;  5F7V A;  1B1H A;  2O51 A;  1DOT A;  3I6V A;  4BDR A;  1UTB A;  4BDL A;  1B51 A;  1S9T A;  1SBP A;  4H5G A;  3FVN A;  4MFI A;  3MVW A;  3N94 A;  2Z8F A;  2F7C A;  3T9V A;  3TMG A;  1IIW A;  2P2A A;  2XX7 A;  3LBS A;  1J1N A;  2GHA A;  2HZK A;  2NUV A;  3MP1 A;  4OTE A;  3T96 B;  3U94 A;  2HEU A;  3Q26 A;  3TTL A;  1SD3 A;  2F7A A;  2R9J A;  1DPE A;  1FQD A;  3VFJ A;  4EDP A;  1LB8 A;  1MY0 A;  1P1U A;  2XXH A;  4YKI A;  1EZP A;  2XD2 A;  3KJ7 A;  3B6W A;  3JV9 A;  3B6Q A;  4O3B A;  4GL0 A;  2YPN A;  3QAX A;  3H6W A;  3TQL A;  3C4M A;  3VV5 A;  1MXZ A;  1NMU A;  1SW5 A;  1T0K A;  4DZ1 A;  3H3G A;  5CMK A;  3FD3 A;  3K1N A;  1Z7N E;  1OQH A;  4QFK A;  1WVJ A;  3T22 A;  4IGT A;  2IEE A;  2GH9 A;  1IZ1 A;  3TCG A;  2FA7 A;  2DP8 A;  3PD8 A;  5FTH A;  2RF1 A;  3G3J A;  5I2K B;  4KR5 A;  4QHQ A;  5I2N A;  3S9L C;  5ISU A;  4JWX A;  3VVD A;  3GBB A;  4GD5 A;  3QUF A;  4ISU A;  4R74 A;  3FVO A;  3ZSF A;  1OVT A;  4EQ7 A;  3OOA A;  5TP9 A;  3DLN A;  1MH3 A;  3K0V A;  4RNS A;  3OO9 A;  4QFP A;  4FEC A;  4OFL A;  1XOC A;  4G77 A;  4Q30 B;  4G8M A;  2Y7K A;  1PBQ A;  4F39 A;  5CBR A;  4DE8 A;  3CR9 A;  1JEU A;  2O1L A;  2UVJ A;  3PUW E;  4LVQ A;  1YCJ A;  4OER A;  4XIG Q;  4ZEC A;  5L9S A;  2Y7P A;  4OEN A;  2QS2 A;  2Q88 A;  3ECR A;  3HPI A;  4NWC A;  3CRB A;  4DCY A;  4RXL A;  2PT1 A;  2Z23 A;  2ZMB A;  4R9F A;  3PMW A;  1Z7M E;  1IIT A;  4LA9 A;  4RK9 A;  4XKR A;  5K2Y A;  3TPA A;  5I56 B;  3O97 A;  1MDP 1;  5I84 A;  1ZU0 A;  3CI8 A;  3FJG A;  4MLQ A;  4TLL B;  2PYY A;  1ZBM A;  2THI A;  2XX8 A;  1LST A;  3FAT A;  1N0T A;  2OBG A;  3MPK A;  4NWD A;  4R6Y A;  4XXU A;  3OSR A;  2DYX A;  1URG A;  3KGC A;  3LR1 A;  1PEB A;  1VFE A;  2OZZ A;  2UVG A;  2Z8E A;  4L17 A;  4X48 A;  3R7X A;  2RC7 A;  1B6H A;  3EQ1 A;  4ZEF A;  2E1S A;  5DEX A;  2H99 A;  1B1X A;  4XTC Q;  4EXK A;  4GFR A;  5JEI A;  3MVZ A;  3O6I A;  2GFE A;  2VOZ A;  4MLV A;  1QKA A;  2R6G E;  2VD2 A;  3FZV A;  1QJM A;  2XXX A;  1MXY A;  4NED A;  3SKP A;  1WDN A;  4AB6 A;  2ONS A;  2RIN A;  3MZB A;  1B7U A;  1PBP A;  4O3A A;  3TEL A;  1SI1 A;  4OES A;  1UIV A;  3QXM A;  3D4G A;  4F1Y A;  1URD A;  1MQG A;  5DVJ A;  4XKQ A;  4QRZ A;  3K1M A;  5I58 B;  1CB6 A;  4FAJ A;  4GLI A;  3W15 C;  4PFY A;  4YMB A;  1USY E;  1VSO A;  1B46 A;  2Y84 A;  4GXA A;  4EF2 A;  1UTH B;  5I57 A;  5H8N B;  1IXI A;  2HZL A;  5CI5 A;  5BUU A;  4AQ4 A;  4OMB A;  4EXL A;  1ANF A;  1QUJ A;  1I69 A;  1FQE A;  3GLB A;  2VGQ A;  3KOS A;  4P0I A;  3QSL A;  4BDM A;  1MDQ A;  1MS7 A;  5CM6 A;  2X7Q A;  3RQT A;  4HCY A;  3DP4 A;  4GL8 A;  4IGR A;  3C32 A;  5B70 A;  4FIM A;  1S7Y A;  4R6H A;  4YKK A;  2XHD A;  1MPD A;  3TKD A;  1B7H A;  3B7D A;  3MUQ A;  3VVE A;  4RJZ A;  1JW1 A;  3K6W A;  4IY5 A;  3U92 A;  4ZED A;  1POY 1;  2F34 A;  1EU8 A;  4QF9 A;  4AB5 A;  3OO7 A;  4F3P A;  1RKM A;  3TQW A;  1ATG A;  4YKP A;  1UIU A;  3UN6 A;  3BBR A;  1EH3 A;  4IO5 A;  5L8D A;  1B9J A;  1OMP A;  3KN3 A;  3U8Q A;  2HFB A;  3FUZ A;  2AL5 A;  3IJX B;  3T9U A;  5AA2 D;  3L6G A;  3S9N C;  3LSW A;  3HN0 A;  3KBR A;  2H9B A;  2X26 A;  3WAF A;  5KDT A;  3MW0 A;  2FYI A;  4ZEB A;  4IY6 A;  3SEW A;  1FQF A;  3UIF A;  5H8H A;  5KCJ B;  2X7P A;  4KPT A;  4LZ5 A;  1CE2 A;  5CMB A;  1A54 A;  4KYD A;  4U4S A;  3CVG A;  2F6P A;  4F19 A;  3TTR A;  3V5A A;  1MQD A;  2M8C A;  2UVI A;  2OWS A;  3FXQ A;  3O2A A;  4H65 A;  1NL5 A;  2QS4 A;  3EN3 A;  4OXV A;  2O7I A;  3PUX E;  2ANJ A;  4MF3 A;  4WKM A;  3SEX A;  3HST A;  1WOD A;  5I59 A;  1QW0 A;  4R75 A;  5J1D A;  4XKN A;  3FXR A;  2Y7W A;  4DLD A;  5AA2 B;  3K00 A;  4X9T A;  3C34 A;  1M5B A;  4KI0 E;  3RUM A;  3K01 A;  1BKA A;  3UGW A;  3HHF A;  3G3G A;  3T9X B;  4GF8 A;  3G3I A;  4H6D A;  2V93 A;  1LAH E;  1II5 A;  3CG3 A;  4R73 A;  4ZZA A;  3K1P A;  1M5F A;  1LLS A;  2RC9 A;  3E13 X;  3G3K A;  1M5E A;  3IO6 A;  3QYT A;  2B65 A;  3GBA A;  5TPA A;  3TTK A;  3QIM A;  3S9E A;  1M5C A;  3VVF A;  1B3E A;  3A3C A;  2KLF A;  1S50 A;  4MBP A;  5ELV A;  3H6T A;  3FJM A;  4QFL A;  3TZA A;  3Q27 A;  4U1O A;  1Y20 A;  2F6G A;  4OZ9 A;  1B0L A;  1N3X A;  1RYX A;  3E9X A;  2F78 A;  4LQ2 A;  1ZJL A;  3RNN A;  3O29 A;  3IO4 A;  5JTY B;  5A5X B;  2D21 A;  5AA4 B;  2D5W A;  4OFJ A;  1FW0 A;  3MP6 A;  2DSF A;  3K02 A;  3MVY A;  4N13 A;  2NXO A;  1SDX A;  3C31 A;  5EHM A;  3IOT A;  1LAX A;  3OXN A;  4FOR A;  2DVC A;  2YLN A;  4G68 A;  3EHT A;  5EHS A;  5L9M A;  3U93 A;  5JK4 A;  1Y1M A;  1NNK A;  4NF8 B;  2PX1 A;  2A5T B;  4KCD A;  5BWJ A;  1MXW A;  1O64 A;  3IB1 A;  3W9W A;  5CBS A;  5ICQ A;  1N7X A;  1B05 A;  1SYH A;  3MP8 A;  4X1D A;  1I6Q A;  2XXP A;  2DWJ A;  1R9Q A;  1JVX A;  2AL4 A;  3GXA A;  4LP2 B;  4R72 A;  5FHM A;  2G93 A;  3V89 B;  3DP8 A;  3IX1 A;  3MPL A;  3IK6 B;  4ELR A;  4GOT A;  1LFI A;  2OWT A;  5CC2 A;  1XVX A;  3KFM A;  4THI A;  3F11 A;  2DWA A;  3QUJ A;  4NF6 B;  4WXJ A;  4DXU A;  5B7D A;  1LGB C;  3EPE A;  4JSO A;  1A8F A;  1D9V A;  1EZ9 A;  2LAO A;  2QSX A;  2XD3 A;  2ZYO A;  3ZKL A;  3I5O A;  3IB0 A;  1GR2 A;  3LSX A;  2WKY A;  1TFA A;  2HAU A;  3CFZ A;  1QUI A;  2REG A;  1Y4T A;  2HQ0 A;  2XXI A;  3K6U A;  3KEI A;  4F1V A;  5I2K A;  3PPQ A;  1D4N A;  2OLB A;  3FGS A;  4M4G A;  1B2H A;  2GHB A;  4KFQ A;  4N07 A;  3MC2 A;  2DQV A;  4P0G A;  3KN8 A;  4UAC A;  3U72 A;  4ELO A;  5DYH A;  2A5S A;  3O66 A;  2OK2 A;  3CG1 A;  4LON B;  3GZG A;  5TP9 B;  1PB9 A;  3I3V A;  3Q28 A;  3A3U A;  3IOR A;  2XXY A;  3TDJ A;  4F31 B;  2REJ A;  1QUK A;  1H45 A;  3IAZ A;  3KZG A;  4NF4 A;  4OHN A;  4R2B A;  4NF5 A;  4X1B A;  2DOJ A;  3SES A;  3UOR A;  3V83 A;  1RYO A;  2O6A A;  3H06 B;  4FJP A;  4Z0I A;  5HM4 B;  1B5H A;  1LB9 A;  4QSD A;  3PPP A;  4F22 A;  2XXR A;  4ECF A;  2DE3 A;  3L6H A;  3FV1 A;  1FQA A;  2CZL A;  4TOZ A;  1IUD A;  2QMW A;  1O63 A;  3OEN A;  4QSE A;  2O69 A;  5L9O A;  4JBZ A;  1L5T A;  1M5D A;  4DDD A;  1P1W A;  3FVG A;  4C0R A;  1P99 A;  2VHA A;  3OSQ A;  4IO7 A;  1KWH A;  2UYF A;  1B3L A;  4LUB A;  1PB8 A;  1Q35 A;  3TOD A;  4IO2 A;  1HSE A;  1R1N A;  4MH5 A;  3BKI B;  1IXH A;  3EHS A;  3DP6 A;  3PD9 A;  5H8F B;  4ZE8 A;  4OEV A;  3K2D A;  2DE2 A;  3Q29 A;  2QS3 A;  4NTL A;  2E0S A;  3T66 A;  4F3G A;  1A99 A;  3OO8 A;  2R71 A;  3C33 A;  4RPO A;  3H4Z A;  2ONR A;  3UP9 A;  1Q1K A;  1TXF A;  4FED A;  1US5 A;  1B5J A;  2ABH A;  4LZ8 A;  1XC1 A;  3RLF E;  4KCC A;  1NH8 A;  2XXU A;  3FJ7 A;  3ODB A;  1OIB A;  3TTM A;  5I2N B;  1A40 A;  1Y4C A;  4U21 A;  2H5Y A;  3IOU A;  1I6B A;  1US4 A;  3UA8 A;  2DXY A;  2PT2 A;  2XXW A;  4YB7 A;  1NKX A;  2H98 A;  1H3D A;  1MQJ A;  2QL3 A;  2ZYK A;  3MAM A;  4P11 A;  3TYH A;  3KSJ A;  4EUO A;  3N6T A;  3R26 A;  4OWD A;  4YAH X;  3USD A;  3TUS A;  1F9B A;  3PV0 E;  3BFU A;  1AOV A;  1UTH A;  3Q25 A;  3IOV A;  3KJT A;  1H76 A;  5I57 B;  2Q9T A;  1N7W A;  3RTW B;  1NNP A;  1ZTY A;  1GV8 A;  3VDF A;  4BDN A;  2O7U A;  4ZDM A;  3LC8 A;  3KSX A;  1A55 A;  5I56 A;  2RCB A;  3CIJ A;  3S4U A;  1B52 A;  1FTJ A;  2QS1 A;  5H8Q A;  1XVY A;  3QK6 A;  4PP0 A;  4F3S A;  2ZXT A;  1GGG A;  3CFL A;  4TLM B;  4ZS9 A;  1TFD A;  3MJN A;  3O6G A;  2I49 A;  5H8S A;  4C1T A;  5FTI A;  3KG2 A;  1LFG A;  4HS7 A;  3IL1 B;  3W9V A;  1B4H A;  1HSJ A;  1LBC A;  2DWH A;  4JB7 A;  2AYS A;  4YU0 A;  2I3W A;  3SET A;  4I8C A;  4YMA A;  1DTG A;  4WED A;  3CFX A;  4K3F A;  3OEL A;  1AIV A;  4KQP A;  1NNF A;  1MM7 A;  3OMB A;  1MM6 A;  2RCA A;  4OQO A;  5LOM A;  4RYA A;  2P0S A;  3TFL A;  2RKM A;  3RPW A;  2NOO A;  4RPN A;  4H67 A;  3ZS6 A;  4YKJ A;  1OLA A;  3ILT B;  4TQU Q;  5KCJ A;  1VE4 A;  3MVX A;  5H8H B;  1B0H A;  3G3F A;  1BIY A;  1DTZ A;  3N6U A;  4POX A;  3C36 A;  4Q0C A;  2DE4 A;  1OQG A;  4OYV A;  4G8N A;  1SYI A;  1QKB A;  4OVJ A;  3N26 A;  1MQI A;  5I59 B;  2F97 A;  3SEV A;  1BP5 A;  2I0B A;  1A8E A;  2I0C A;  4G2Z A;  4PFW A;  5AA2 A;  4ZEK A;  4ONY A;  3MQ9 A;  3IR1 A;  5M2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...