4GXAA

Crystal structure of sulfate free form of cysb, a member of lysr family from salmonella typhimurium lt2
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
b'EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator CysB
publication title Crystal structure of Sulfate free form of CYSB, a member of LysR family from Salmonella typhimurium LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
molecule tags Gene regulation
total genus 61
structure length 239
sequence length 239
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gxaA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4gxaA02
2QRYA 4DE8A 1SI1A 1FW0A 4X1DA 4G4PA 4GD5A 4IGTA 1JETA 3R6UA 5I59A 4XKPA 4LA9A 4POWA 1MS7A 5AE4A 3MC2A 1PB7A 3KOSA 5ITPA 4HTGA 3DP4A 1II5A 1HSLA 3RN8A 2DP8A 2QSXA 1DOTA 5LOMA 4KCCA 1FCKA 2XXHA 3PPNA 1P1UA 4MBPA 4YB5A 2NWJA 3PUVE 4OTEA 3MP6A 2AYSA 1P1OA 3KG2A 2RC8A 3V83A 4YKJA 5HPQA 3C33A 3OO8A 2DVCA 2ZNSA 5H8SA 3SETA 5L8DA 1D9YA 3O97A 1H43A 1I6AA 3FASA 3K1NA 1B2HA 2VD2A 3RTWB 3THIA 4JDFA 4OENA 5JTYB 4H5FA 3G3JA 4U22A 1B5HA 3JV9A 4Q5TA 3FJ7A 4TQUQ 4F1YA 3K6WA 5F1QA 1MQGA 4X48A 1O64A 3FVOA 3IAZA 1BKAA 3SERA 2P0SA 4Z7EA 4F3SA 1CE2A 1USYE 4GVOA 3FVGA 3KFMA 2VHAA 4P11A 3EF7A 5JTYA 4NF5B 3ILTB 1B3EA 1MXZA 3GBBA 2F7AA 3PPRA 4X9TA 3OOAA 4OMBA 1NKXA 1O63A 4ELRA 1RKMA 5K2XA 1IXCA 4QFNA 4EF1A 1QUIA 1MRPA 1XS5A 3PUXE 3H6UA 1NL5A 3K6UA 1NNKA 1XC1A 4EXLA 4C1TA 3TTRA 4ESXA 4RPOA 4ZEKA 4NF5A 4OERA 2ZYKA 4GRKA 3T9VA 3VLUA 4ESWA 2PX1A 4F2OA 2DOJA 4JWXA 1Y4CA 1YAEA 3CR9A 3KGCA 2F34A 3O28A 1ATGA 5CMMA 2XX8A 2AIXA 2Z8FA 4XKQA 1M5BA 1VE4A 2D3IA 3KSJA 3H6TA 4G8MA 1LLSA 4JXIA 2D21A 2QMWA 4IO7A 2HFBA 4FATA 3V8XB 3MP1A 2V93A 3O6GA 2ZNTA 3E4RA 1B32A 5L9OA 3QSLA 3EHSA 4F39A 2B65A 1GVCA 4YMBA 4C0RA 2Y7PA 3PGFA 2O1LA 3QYTA 3FXRA 2VP1A 4LP2B 4RK2A 3PPOA 4OQOA 3HCQA 2PMSA 3MVWA 4NTLA 5BWJA 4YKPA 1ZJLA 3PMWA 5FHNA 1IUDA 1ZIUA 4H8JA 1IITA 1DTGA 1B3FA 5IKBA 2ZYOA 2QL3A 2CZLA 1TXFA 5JEIA 3FATA 4X1BA 4OFOA 4JB7A 1PB8A 1YCJA 4BDQA 1VR5A 1NNTA 4NE4A 4U4XA 1IIWA 1GR2A 1A99A 1N0TA 2RF1A 3TQWA 4YICA 1JW4A 4DCYA 1B1XA 2ONRA 2M8CA 4Q0CA 2OCUA 3IOTA 1CB6A 4RPNA 1EH3A 2PT2A 2O7IA 4MLQA 4BDOA 1LFGA 3TEPA 3TTNA 4BDNA 4XIGQ 3KZGA 4YB6A 2PBWA 3TKDA 1JEUA 1FTJA 3N6UA 2VGQA 1GTKA 4NF4B 3CRBA 1QUKA 1Y1MA 1LFHA 4YZZA 1N7XA 4DXUA 4GQOA 1N76A 4FAJA 3C4MA 4ECFA 1WODA 3G3FA 2I48A 3QAXA 3BFTA 2O69A 4ZEDA 1IXGA 4F3PA 3C32A 1MY0A 3CFZA 3FV2A 1OIBA 2IEEA 4R6HA 5I57B 2A5SA 3U1OA 5I2KB 1D4NA 1SW5A 2RINA 2DXRA 4NF4A 3AXFA 3H4ZA 1IXIA 1I6BA 2XXIA 1M5EA 2ALUA 4M4GA 4DCXA 1ZTYA 3C34A 5CM6A 4ELPA 1GGGA 3UK4A 3O66A 3HV1A 2F6PA 3MW0A 4YKKA 5I57A 3VVFA 3U92A 5I2KA 1DMBA 4NF6B 4F1UA 4I9DA 3TPAA 3PMVA 4MF3A 1Y3QA 2FYIA 2DSFA 3BKIB 1JW5A 2F36A 3EPEA 1MDQA 2YJPA 3PD9A 3G3HA 1B3HA 3VXBA 4IO3A 5K2YA 3CG1A 3OEKA 1ZKBA 3UN6A 1TT1A 1JNFA 3Q27A 3WAEA 4ISUA 3G7WA 4EXKA 3Q29A 4G77A 3IO4A 2I4BA 4NF6A 3TFLA 1B7UA 3VLVA 5EYFA 3CG3A 1QVSA 4HCYA 5A5XB 1TFDA 2XD3A 3DP8A 1JEVA 4ZDMA 4QRZA 1MXWA 3D4CA 3O29A 2XX7A 5I84A 5ISUA 3R7XA 4Z0IA 1MM7A 2O51A 4I62A 5DTBA 3I6VA 1H76A 3IX1A 3T9UA 4O3AA 4YU0A 1FQAA 4H8IA 1FTKA 4N13A 1BTJA 3FIRA 1SYHA 2H25A 4IO2A 4EUOA 1P1NA 4LQ5A 2I58A 4N6PA 3MZ9A 1WVJA 1TFAA 3B7DA 4IO4A 5ICTA 3P7IA 3SKPA 4F22A 3OO6A 3U72A 2DS9A 3T96B 1EZ9A 5L9SA 2I3WA 3IO6A 3S9NC 1VFDA 2R71A 4QF9A 3QK6A 3FD3A 5EHSA 3TYHA 2HAUA 4L17A 3S2VA 5IAIA 4RA1A 4LZ7A 1UTBB 2DE3A 4PETA 4FJPA 1SD3A 4XKRA 2OK2A 1A7LA 1NMUA 5M2VA 3Q25A 3PUWE 4G68B 2DWIA 1MQIA 5B70A 3SEXA 4FORA 3I5OA 1R6ZA 4GLIA 1DPPA 4R75A 1ANFA 4OFJA 4F3GA 4FEDA 4ELOA 3B6QA 3CI8A 2ANJA 1UTBA 2DVZA 1Y3NA 1MXYA 1FQFA 4F29A 5CBSA 1NH7A 4TLLB 2GHBA 4PFUA 1LB9A 4G68A 3KSXA 3MZ1A 3EHUA 5FTIA 2I49A 4U1OA 4KHZE 4ZECA 4THIA 3IOVA 3IB2A 2GRVA 2UVGA 1POTA 3QIMA 3E3KA 5TPAB 3IOUA 3PMXA 3G3KA 3SEVA 1XOCA 3HO7A 3K6XA 5H8FB 3MWBA 2P2AA 3M3KA 4QFPA 3OELA 3HSTA 1AIVA 1DSNA 2H98A 2VOZA 4KI0E 2QMXA 4NWDA 1PBPA 2DXYA 1YTVA 1AMFA 2OWSA 3FVKA 1B5JA 1P1QA 3N94A 1OVTA 2RCBA 2W7YA 1PB9A 3KEIA 3S9MC 5TPAA 1XVXA 2HZLA 4LATA 1SQYA 1JQFA 3RT8A 2X7QA 1N7WA 4OWDA 3C35A 3IL1B 3CSGA 5I56B 4ZEIA 1HSEA 5H8FA 3K4UA 1Y1ZA 2XX9A 1LSTA 3VVEA 3KOTA 4R74A 2PYYA 1Y9UA 1DTZA 3MVYA 4GWOA 2O7UA 4H65A 4GL8A 4QSCA 3RLFE 2AL4A 3TCHA 1MPDA 4H1XA 1BP5A 1SVXB 1MPCA 1MY3A 4R72A 4Q8RA 3OENA 4QHQA 4GXSB 2XD2A 2ZYMA 5I56A 2Q9TA 4DLDA 4KR5A 3V89B 3D4GA 1EZPA 3VE1B 1FQEA 4TOZA 3CFLA 1B3GA 1M5DA 4OEUA 1BIYA 2FA7A 1B0LA 3OMBA 3HHGA 3Q28A 3VFJA 1O7TA 3TQLA 1PEBA 4DXBA 1H3DA 5DT6A 5CMBA 3C36A 2VD3A 4IY5A 2F78A 2NUVA 3SEWA 3DM0A 4U1ZA 1N3XA 2UVIA 2HAVA 5ITOA 3LSLA 2XXYA 1I6QA 2E0SA 4GFRA 1IZ1A 4O3BA 3FV1A 3G3IA 2XHDA 1QW0A 2Y7IA 4JSOA 2RC9A 2QS3A 3E13X 4EQ9A 1US4A 3RUMA 3KN7A 3L6GA 4AB6A 3EHTA 2X7PA 4DXCA 3EQ1A 3LUYA 3T9XB 4XTCQ 4OYVA 1MDP1 3UORA 2Q2AA 3PUZE 3GXAA 1P99A 2P1SA 2CMOA 4KPTA 4R2FA 4U21A 3KN3A 4UACA 4OFLA 3PV0E 1AH5A 2ZXTA 3FJMA 2QS4A 5I2NB 1YPNA 1N04A 1WDNA 1A54A 1D9VA 1DPEA 2XXVA 3RPWA 3ECRA 1B1HA 4OZ9A 3GLBA 1XT8A 1N84A 4R9GA 5KDTA 1ZBMA 3MUQA 1B05A 3N5LA 3QUFA 1LAFE 3USDA 1A55A 2V25A 3IORA 4AQ4A 4FIMA 4LZ8A 5DVIA 5AA2B 1R9QA 4F3BA 4OXVA 5I2NA 4U2RA 1AL3A 3TCGA 3SDFA 3H3GA 4EQ7A 2I0CA 1SI0A 4R2BA 4RYAA 1UQWA 4F18A 1B46A 5ELVA 4DZ1A 4HW8A 1NH8A 1NNPA 5H8QB 2Z23A 3VVDA 1MPBA 3LSWA 1RYXA 3K02A 1URGA 2D5WA 5AA2A 3WAFA 3TTLA 1MY2A 4GF8A 3SESA 1F9BA 1B0HA 4RY1A 1MY1A 4LZ5A 4R6YA 3FXQA 4GL0A 2ZMBA 4POXA 1ZMGA 5H8QA 4PP0A 1FQDA 3OEMA 4JWOA 2OLBA 3QXMA 4QSEA 2HEUA 3Q26A 3A3UA 1MXUA 1A8EA 3RT6B 2XXRA 3RTFB 3O6HA 5CRYA 4P0IA 3KJTA 3H7MA 5KCJB 1B3LA 5KZTA 5DVFA 1B7HA 5FHMA 3CIJA 1S50A 1R9LA 1OQHA 3K6VA 2H99A 4YKIA 1M5FA 2OBGA 3UIFA 4XKNA 4LVQA 1UTHB 4LONB 3QUJA 5TP9B 3KN8A 2GHAA 1B58A 4YB7A 4AB5A 2F7CA 1URSA 4H67A 3O6IA 4PFWA 3UA8A 5J1DA 4ZZAA 5DEXB 4UA8A 5KCJA 4JSDA 1MQJA 2O84X 5DYHA 3W15C 3BBRA 3ZS6A 2DE2A 4G8HA 3E9XA 3TCFA 4F2QA 4BLAA 3ILUB 1UTHA 2XXPA 5TP9A 3SEYA 3K0VA 3LBSA 4QFLA 4QFKA 4FEBA 4R6KA 1OLCA 3GZGA 3OO9A 4N07A 3T66A 4F1VA 3UGWA 1B5IA 2Y7KA 5HBCA 1FTLA 1KWHA 2I0BA 5DEXA 1LAHE 2Q88A 3HHFA 4ZE8A 5CMKA 3W9VA 5AA4B 4EF2A 1UIUA 3OD7A 3N6TA 4ELQA 5L9MA 4GOTA 3M3FA 4C1UA 4KFQA 2H5YA 1A40A 4M1VA 3HN0A 3PPQA 4KYDA 1LCTA 3H6WA 5AA3A 1IEJA 1QKAA 5AA1A 1A8FA 2Q8JA 1VSOA 5FHOA 3A3CA 4MH5A 1EZOA 5AA4A 3MPKA 3SEUA 2DWAA 3GBAA 4ZZEA 3DP6A 5TU0A 1LGBC 3RQTA 3RY3A 2THIA 1JVXA 2RCAA 2O1MA 5B7DA 3TTKA 4OESA 3B6TA 4WXJA 2B3BA 2NOOA 1QUJA 3OO7A 2HCAA 2G29A 2XXTA 4ND9A 3VLWA 4IY6A 4K3FA 3MVZA 4KCDA 3ZSFA 4IO6A 4ONYA 1QKBA 4RNSA 4IO5A 3FZVA 4IGRA 3T93B 2HZKA 1Y4TA 1BLFA 1PBQA 3OXNA 5FTHA 2REJA 3M3LA 1Q1KA 2WKYA 2UXAA 3IR1A 1RYOA 3G3GA 3JYRA 3ODBA 4PE5B 3K2DA 3K00A 2Y7WA 1L5TA 2Q2CA 2R9JA 3IJOB 3VV5A 4OHNA 4RK9A 2UYFA 2QPQA 2F6GA 3OSQA 5AA2D 4KD5A 1NNFA 2GFEA 2AL5A 4HCWA 3UP9A 3TELA 4JWYA 3S4UA 2V3QA 1EU8A 5F7VA 2E1SA 1B6HA 1R1NA 4O3CA 2BJJX 1SW4A 3K1PA 2QS1A 2V3TA 3A09A 5CI5A 3T22A 1N3WA 2H4IA 2F8DA 4ZEBA 1Z7ME 5H8NB 4I1DA 4RXLA 5I58B 2V3UA 1LBCA 1IQ7A 2GH9A 1FTMA 2QJEA 2G93A 2XXXA 2NXOA 2DWHA 1JVYA 2KLFA 2I6EA 3W9WA 2Y7RA 3OSRA 4ZEFA 2NVUB 1JW1A 1ZU0A 4E0XA 1MXXA 2UYEA 3M8UA 4H5GA 4G8NA 2RKMA 5H8NA 1LB8A 4H0WA 4NEDA 3U93A 4U4SA 2A5TB 3LR1A 5I58A 4YMAA 3LSXA 5CMCA 3MP8A 4BDLA 1SW2A 3U8QA 3RGYA 1SBPA 2ONSA 1VFEA 4F31B 2YPNA 4PQJA 4PFTA 3C31A 4OVJA 1OLAA 1XVYA 2LAOA 2Y84A 2UVHA 1I69A 2FNCA 1MY4A 2A5TA 2F7BA 4GXAA 3S9LC 1URDA 3VDFA 4XXUA 3KBRA 3PD8A 4OEVA 4NF8B 1B7ZA 2I3VA 1S9TA 4NMYA 2H9BA 4G2ZA 2O6AA 1OMPA 2F97A 3CFXA 5CC2A 4R73A 5H8HB 1OQGA 3I3VA 5KDTB 2DWJA 1Z7NE 2DE4A 4OETA 3MVXA 4DDDA 1SDXA 3DELB 2F5XA 1IXHA 2Z8EA 4ZE9A 3K1MA 1P1WA 4R9FA 1LFIA 4MFIA 1FTOA 2V84A 3ONMA 2PT1A 3TODA 4NF8A 1PC3A 1AOVA 2DYXA 3BFUA 2REGA 3TDJA 4QSDA 2O68A 1H44A 4WKMA 5H8HA 4EQBA 4KYEA 3TAJA 1XHYA 3MZBA 3LSFB 4QFOA 1OVBA 3MQ9A 4EDPA 4KYSA 3CVGA 3V5AA 3TMGA 1FQBA 2I4CA 5BUUA 3R26A 1B4HA 3FXUA 4H6DA 3JZJA 2QS2A 2HQ0A 3MBPA 2XXWA 3ZKLA 1B40A 3F11A 3H6VA 3LC8A 4NWCA 1POY1 2X26A 2B3FA 3RNNA 3ZKKA 2RC7A 1H45A 4WEDA 5JK4A 3IB1A 4BDRA 1MH3A 2ABHA 2OWTA 4U23A 1MM6A 4IB2A 5ICQA 1B52A 5DVJA 2YLNA 3IJXB 4RJZA 1ZLQA 4Q30B 2OJTA 3FUZA 1QJMA 1USYH 3IB0A 1FQCA 3TZAA 4LUBA 1T0KA 1S7YA 5CBRA 3H03A 4I8CA 1LCFA 1MQDA 1MG1A 5EHMA 2PVUA 2ZNUA 2XXQA 2R6GE 4LQ2A 4ZS9A 3B6WA 2Z8DA 3FGSA 4KQPA 1J1NA 1MXVA 3MPLA 1LAXA 5HM4B 3PPPA 3PU5A 1M5CA 4BDMA 2HXWA 3CSBA 3FVNA 4TLMB 4F19A 3KJ7A 1SYIA 3MAMA 3PUYE 1ELJA 2DQVA 3O2AA 4FE8A 1LAGE 2ESNA 1LBBA 1HSJA 1B51A 4E0WA 3IOWA 4MLVA 1B4ZA 1Y20A 4YAHX 3O9PA 2Q89A 3S9EA 2OZZA 3TTMA 3U94A 1Q35A 1Y3PA 1UIVA 1GV8A 3H06B 3FJGA 1PDAA 1SW1A 1MQHA 2ONKE 3EN3A 3DLNA 3HPIA 3C9HA 4HS7A 4WEPA 1NFTA 2F35A 2UVJA 3N26A 2Z22A 3MJNA 2XXUA 1MH4A 4P0GA 4PFYA 5I59B 4G68C 3TUSA 1US5A 2IA4A 4GIZA 3L6HA 4DIGA 3K01A 3VXCA 4JBZA 2ZYNA 3T9HB 3IK6B 1TWYA 1B9JA 1D3KA 1QULA 5A5XA 4FECA
chains in the Genus database with same CATH superfamily
2QRYA 4DE8A 1SI1A 1FW0A 2WBBA 4X1DA 4G4PA 4GD5A 4IGTA 1JETA 3R6UA 5I59A 1VDWA 4XKPA 4LA9A 4POWA 1MS7A 5AE4A 5I7IA 3MC2A 1PB7A 3KOSA 5ITPA 4P47A 4HTGA 3MSTA 3DP4A 1II5A 1NV4A 1HSLA 3RN8A 2DP8A 2QSXA 3FBPA 1DOTA 5LOMA 4KCCA 1FCKA 2XXHA 3PPNA 1P1UA 4MBPA 4YB5A 2NWJA 3PUVE 4OTEA 2CEXA 3MP6A 5EYGA 2AYSA 1P1OA 3KG2A 2RC8A 3V83A 1XI6A 4YKJA 5HPQA 3C33A 3OO8A 2DVCA 2ZNSA 5H8SA 4MJOA 3SETA 3LUZA 5L8DA 1D9YA 4AS5A 3O97A 1FJ9A 1H43A 1I6AA 1IMAA 3FASA 3K1NA 1B2HA 2VD2A 2WBDA 3RTWB 3THIA 4JDFA 4OENA 2OX3A 4H5FA 5JTYB 4I3EA 3G3JA 4U22A 1B5HA 3JV9A 2XWVA 4Q5TA 3FJ7A 4TQUQ 1NUZA 4F1YA 3K6WA 5F1QA 1MQGA 4X48A 1O64A 3FVOA 3IAZA 1BKAA 3SERA 2P0SA 4Z7EA 4F3SA 1CE2A 1USYE 4GVOA 3FVGA 3KFMA 2VHAA 4GWXA 4P11A 3EF7A 5JTYA 4NF5B 3ILTB 1B3EA 1FPBA 3ISPA 1MXZA 3GBBA 2F7AA 1LBXA 3PPRA 4X9TA 2HXRA 3OOAA 4OMBA 4XEQA 1NKXA 1O63A 5EQ7A 4ELRA 1RKMA 5K2XA 1IXCA 4QFNA 4EF1A 1QUIA 2WX9A 1MRPA 2OWZA 1XS5A 3PUXE 4PAFA 1FPIA 3H6UA 1NL5A 3K6UA 1NNKA 1XC1A 4EXLA 4C1TA 3TTRA 4ESXA 4RPOA 4ZEKA 4NF5A 4OERA 2ZYKA 4GRKA 3T9VA 3VLUA 4ESWA 2Y5KA 2PX1A 4F2OA 2DOJA 4JWXA 1Y4CA 1YAEA 1NI9A 3CR9A 2F34A 3O28A 3KGCA 1ATGA 5CMMA 2XX8A 5EQ8A 2AIXA 2Q74A 2Z8FA 4XKQA 1M5BA 4GX4A 1VE4A 2D3IA 3KSJA 3H6TA 4G8MA 1LLSA 4JXIA 2D21A 2QMWA 4PDDA 4IO7A 1AWBA 2HFBA 4FATA 5F24A 3V8XB 1FRPA 3MP1A 2V93A 3O6GA 3IFAA 1JP4A 2ZNTA 3E4RA 1B32A 1IMEA 5L9OA 3QSLA 3EHSA 4F39A 1FPGA 1D9QA 2B65A 1GVCA 5T3JA 2VPNA 4C0RA 4YMBA 4PC9A 2Y7PA 3PGFA 2O1LA 3QYTA 5IZZA 3FXRA 2VP1A 4PTKA 4LP2B 4RK2A 4JVDA 2XA5A 4O7IA 1DBZA 4GBVA 4N91A 3PPOA 4OQOA 1LBVA 3HCQA 2PMSA 3SZPA 3MVWA 4NTLA 4MEVA 5BWJA 4YKPA 1ZJLA 2VT5A 3PMWA 5FHNA 4H8JA 1IUDA 1ZIUA 1IITA 1DTGA 1B3FA 5IKBA 2ZYOA 2QL3A 2CZLA 4AS4A 1TXFA 5JEIA 4OVPA 3FATA 4X1BA 4OFOA 4JB7A 1PB8A 1YCJA 4BDQA 1VR5A 1NNTA 2CEYA 4NE4A 4U4XA 1IIWA 1IMDA 1GR2A 1A99A 1N0TA 2RF1A 3TQWA 4YICA 1JW4A 2L5VA 5DW8A 4DCYA 1B1XA 2ONRA 2M8CA 4Q0CA 2OCUA 3IOTA 1CB6A 4RPNA 1EH3A 2PT2A 2O7IA 4MLQA 4BDOA 1LFGA 3TEPA 3TTNA 4BDNA 2Q8MA 4XIGQ 3KZGA 4YB6A 2PBWA 4PAIA 3TKDA 4HE2A 1JEUA 1FTJA 3N6UA 1K9YA 2VGQA 1GTKA 4NF4B 3CRBA 1DCUA 1QUKA 4X8RA 1Y1MA 1LFHA 2ZZWA 4YZZA 1N7XA 4DXUA 4GQOA 1N76A 4FAJA 3C4MA 4ECFA 1WODA 4I40A 3G3FA 4G61A 2I48A 3QAXA 3BFTA 2O69A 4ZEDA 2QVVA 1IXGA 4F3PA 3C32A 2R8TA 1MY0A 3CFZA 3FV2A 1OIBA 2IEEA 4R6HA 4N6DA 5I57B 2A5SA 3U1OA 5I3SA 5I2KB 2ZZVA 4NX1A 1D4NA 1SW5A 1RDXA 2RINA 1FBEA 2DXRA 4NF4A 4MAGA 3HFUA 5J16A 3AXFA 3H4ZA 1IXIA 1I6BA 2XXIA 1M5EA 2ALUA 4M4GA 2WYPA 4DCXA 1ZTYA 3C34A 5CM6A 4ELPA 1GGGA 3UK4A 4MCOA 3O66A 3HV1A 2F6PA 3MW0A 4YKKA 1FBHA 5I57A 3VVFA 2Y5LA 3U92A 5I2KA 1DMBA 4NF6B 4F1UA 4I9DA 3KC0A 3TPAA 3PMVA 4MF3A 1Y3QA 2FYIA 2DSFA 3BKIB 1JW5A 2F36A 3EPEA 1MDQA 2P3NA 2YJPA 3PD9A 4P8BA 3G3HA 4PFIA 1B3HA 3VXBA 4IO3A 5K2YA 3CG1A 3OEKA 1ZKBA 3UN6A 1TT1A 4DI3D 1JNFA 3Q27A 4N6KA 3WAEA 4ISUA 3G7WA 4EXKA 3Q29A 4G77A 3BIGA 3IO4A 2I4BA 4NF6A 3TFLA 4PGNA 1B7UA 1LEVA 3VLVA 5EYFA 3CG3A 1QVSA 4HCYA 5A5XB 1TFDA 2XD3A 3DP8A 1JEVA 4ZDMA 4QRZA 1MXWA 3D4CA 3O29A 2XX7A 5I84A 5ISUA 3ROJA 3R7XA 4Z0IA 1MM7A 2O51A 4I62A 5DTBA 3I6VA 1H76A 5I5PA 3IX1A 3T9UA 4O3AA 4YU0A 1FQAA 4H8IA 1FTKA 4N13A 1BTJA 3FIRA 1SYHA 2H25A 4IO2A 4EUOA 1P1NA 4LQ5A 2I58A 4N6PA 3MZ9A 1WVJA 1TFAA 3B7DA 4IO4A 5ICTA 1RDYA 3P7IA 3SKPA 2FIEA 4F22A 3OO6A 3U72A 2DS9A 3T96B 1EZ9A 5L9SA 2I3WA 3IO6A 3S9NC 4P3LA 1IMCA 1VFDA 2R71A 4QF9A 3QK6A 4GX3A 1FBPA 3FD3A 5EHSA 3TYHA 2HAUA 2WYKA 4L17A 3S2VA 5IAIA 4RA1A 4LZ7A 1UTBB 2DE3A 4PETA 4MNIA 4FJPA 1SD3A 4XKRA 2OK2A 1SPIA 1A7LA 1NMUA 5M2VA 3Q25A 3PUWE 4G68B 2DWIA 1MQIA 5B70A 3SEXA 4FORA 3I5OA 1R6ZA 4GLIA 4HXVA 1DPPA 4R75A 1ANFA 4XFEA 4OFJA 4F3GA 4FEDA 4ELOA 1KA1A 3B6QA 3CI8A 2ANJA 3LV0A 1UTBA 2DVZA 1Y3NA 1MXYA 1FQFA 4F29A 4N4UA 5CBSA 4QBAA 1NH7A 4TLLB 2GHBA 4PFUA 1LB9A 4G68A 3KSXA 3MZ1A 3IFCA 4FBPA 3EHUA 5FTIA 2I49A 4U1OA 4KHZE 4ZECA 4THIA 5IZ3A 3IOVA 1INPA 3IB2A 4NAPA 2GRVA 2UVGA 1POTA 3QIMA 3E3KA 5TPAB 3IOUA 3PMXA 3G3KA 3SEVA 1XOCA 3HO7A 3K6XA 5H8FB 3MWBA 2P2AA 3M3KA 4QFPA 3OELA 3HSTA 1AIVA 1DSNA 2H98A 4P9KA 2VOZA 4KI0E 2QMXA 4NWDA 1PBPA 2DXYA 1YTVA 2F3BA 1AMFA 2OWSA 3FVKA 1B5JA 1P1QA 3N94A 1OVTA 2RCBA 2W7YA 1PB9A 3KEIA 3S9MC 5TPAA 1XVXA 2KR0A 2HZLA 4LATA 4JVIA 1SQYA 1JQFA 3RT8A 2X7QA 1N7WA 4OWDA 3C35A 3IL1B 3CSGA 5I56B 4ZEIA 1HSEA 5H8FA 3K4UA 1Y1ZA 2XX9A 1LSTA 3VVEA 3KOTA 4R74A 2PYYA 1Y9UA 1DTZA 3MVYA 4GWOA 2O7UA 1K9ZA 4H65A 4GL8A 4QSCA 4NQ8A 3RLFE 2AL4A 4HE1A 3TCHA 1MPDA 4H1XA 1BP5A 1SVXB 1MPCA 1MY3A 4R72A 4Q8RA 3OENA 4QHQA 4I3YA 4GXSB 2XD2A 2ZYMA 5I56A 4KXPA 2KQZA 2Q9TA 4DLDA 4KR5A 3V89B 3D4GA 1EZPA 3VE1B 1FQEA 4TOZA 3CFLA 1B3GA 1M5DA 4OEUA 1BIYA 2FA7A 1B0LA 1NV0A 3OMBA 4LN5A 3HHGA 3Q28A 3VFJA 1O7TA 3TQLA 1PEBA 4DXBA 1H3DA 1KZ8A 5DT6A 5CMBA 3C36A 2VD3A 3FXBA 4IY5A 2F78A 2NUVA 3SEWA 3DM0A 1FSAA 4U1ZA 1N3XA 2UVIA 2HAVA 5ITOA 3LSLA 2XXYA 1I6QA 2E0SA 4GFRA 1IZ1A 4N81A 4PDHA 4O3BA 3FV1A 3G3IA 2XHDA 1QW0A 2Y7IA 4JSOA 2RC9A 3RYDA 2QS3A 3E13X 4OVQA 4EQ9A 4PF8A 1US4A 3RUMA 3KN7A 3L6GA 4AB6A 3EHTA 2X7PA 4DXCA 3EQ1A 2XWOA 3LUYA 3T9XB 4XTCQ 4OYVA 1MDP1 3GYYA 3UORA 1NV2A 2Q2AA 3PUZE 2JJKA 3GXAA 1P99A 2P1SA 3QMFA 1EYKA 2CMOA 4KPTA 4R2FA 4U21A 3KN3A 4UACA 4OFLA 2PFYA 1LBZA 1FPKA 3PV0E 1AH5A 4HE0A 2ZXTA 3B50A 3FJMA 2QS4A 5I2NB 1YPNA 1N04A 1WDNA 3D1RA 1A54A 1D9VA 1DPEA 2XXVA 3RPWA 3ECRA 2QFLA 2P3VA 1B1HA 2MKZA 4OZ9A 3GLBA 1XT8A 1N84A 4NGUA 4R9GA 5KDTA 1ZBMA 3MUQA 1B05A 3N5LA 3QUFA 1LAFE 3USDA 1G0HA 3T1BA 3A29A 1A55A 2V25A 3IORA 4AQ4A 1EYJA 4FIMA 4LZ8A 5DVIA 5AA2B 1R9QA 1FBFA 4F3BA 4OXVA 5I2NA 4U2RA 4PGPA 1AL3A 4OA4A 2PFZA 3TCGA 2XXKA 3SDFA 3H3GA 4EQ7A 2I0CA 1SI0A 4R2BA 4RYAA 1UQWA 4F18A 1B46A 5ELVA 4DZ1A 4HW8A 2FHYA 2HPGA 1NH8A 1NNPA 5H8QB 4MIJA 2Z23A 2QVUA 3VVDA 1MPBA 4NF0A 5IM2A 3LSWA 1RYXA 3K02A 1URGA 2D5WA 5AA2A 2XWIA 4N17A 3TTLA 3WAFA 1MY2A 4GF8A 3SESA 1F9BA 1B0HA 4IR8A 4XF5A 4RY1A 1MY1A 3E79A 1EYIA 4LZ5A 4R6YA 3FXQA 4GL0A 4N8YA 2ZMBA 4JVCA 4POXA 3RPLB 2B4LA 1NV5A 1ZMGA 5H8QA 5IZ1A 4PP0A 1FQDA 3OEMA 4JWOA 2OLBA 3QXMA 4QSEA 4OANA 2HEUA 3Q26A 3A3UA 1MXUA 4UABA 1FBGA 1RDZA 1A8EA 3RT6B 2XXRA 2F3DA 4GWZA 3RTFB 3O6HA 5CRYA 4P0IA 3KJTA 1FPDA 4H46A 3H7MA 5KCJB 1B3LA 5KZTA 4GBWA 3RPLA 4N8GA 5DVFA 1B7HA 2FBPA 5FHMA 3CIJA 1S50A 1R9LA 1OQHA 3K6VA 2H99A 1NUXA 4YKIA 1M5FA 5EYHA 3KBZA 2OBGA 4MX6A 3UIFA 4XKNA 4LVQA 1UTHB 4LONB 3QUJA 5TP9B 3KN8A 2GHAA 1B58A 4YB7A 4AB5A 2F7CA 1URSA 4H67A 3O6IA 4PFWA 4PFRA 3UA8A 5J1DA 4ZZAA 5DEXB 1FTAA 4UA8A 5KCJA 4JSDA 1MQJA 2O84X 5DYHA 3W15C 3BBRA 4GWWA 3ZS6A 2DE2A 4G8HA 3E9XA 3TCFA 4F2QA 4BLAA 3ILUB 1UTHA 2XXPA 5TP9A 3SEYA 3K0VA 3LBSA 4QFLA 4QFKA 4FEBA 4R6KA 1OLCA 3GZGA 3OO9A 4N07A 3T66A 4F1VA 3UGWA 1B5IA 2Y7KA 5HBCA 1FTLA 1KWHA 2I0BA 5DEXA 1LAHE 2Q88A 3HHFA 4ZE8A 5CMKA 3W9VA 3E78A 5AA4B 4EF2A 1UIUA 3OD7A 3N6TA 4ELQA 5L9MA 3BIHA 4GOTA 3M3FA 4C1UA 4N15A 4KFQA 2H5YA 1A40A 4M1VA 3HN0A 3PPQA 4KYDA 1LCTA 3H6WA 5AA3A 1IEJA 1QKAA 5AA1A 1A8FA 2Q8JA 1VSOA 5FHOA 1YZ0A 3A3CA 1IMBA 4MH5A 1EZOA 5AA4A 3MPKA 3SEUA 5IZ3B 2DWAA 3GBAA 4ZZEA 3DP6A 5TU0A 1LGBC 3RQTA 3RY3A 2THIA 5EQAA 1JVXA 2RCAA 2O1MA 5B7DA 3TTKA 4OESA 3B6TA 4WXJA 2B3BA 2NOOA 1QUJA 3OO7A 2HCAA 2G29A 2XXTA 4ND9A 2VPOA 3VLWA 4IY6A 4K3FA 3MVZA 2DDKA 4KCDA 3ZSFA 4IO6A 4ONYA 1QKBA 4P56A 4RNSA 4IO5A 3FZVA 4IGRA 3T0JA 3T93B 2HZKA 1Y4TA 1BLFA 1PBQA 3OXNA 5FTHA 2REJA 3M3LA 1Q1KA 2WKYA 5LDZA 2UXAA 2FVZA 3IR1A 1RYOA 3G3GA 2PCRA 3JYRA 3ODBA 4PE5B 3K2DA 3K00A 2Y7WA 1L5TA 2Q2CA 2R9JA 1KA0A 1NV3A 3IJOB 3VV5A 4OHNA 4RK9A 2UYFA 2QPQA 3KC1A 5EQ9A 4NG7A 2F6GA 3OSQA 5AA2D 4KD5A 1NNFA 2GFEA 2AL5A 4HCWA 3UP9A 3TELA 4JWYA 5ET5A 3S4UA 2V3QA 1EU8A 5F7VA 5ET7A 2E1SA 4OVTA 1B6HA 1R1NA 4O3CA 2BJJX 1SW4A 3K1PA 4PCDA 2QS1A 2V3TA 2CZHA 5ET6A 3A09A 5CI5A 3T22A 1N3WA 4GWYA 2H4IA 2F8DA 4GX6A 4ZEBA 1Z7ME 5H8NB 4I1DA 4RXLA 5I58B 2V3UA 1LBCA 1IQ7A 2GH9A 1FTMA 2QJEA 5A5LA 3B8BA 2G93A 4P1EA 2XXXA 1FBCA 2NXOA 2DWHA 4OVRA 1JVYA 2KLFA 2I6EA 3W9WA 2Y7RA 3OSRA 4ZEFA 5ET8A 2NVUB 4P1LA 1CNQA 1JW1A 1ZU0A 4O7MA 1MXXA 4E0XA 2UYEA 2QVRA 3M8UA 4H5GA 4PAKA 4G8NA 2RKMA 5H8NA 1LB8A 1DK4A 4H0WA 4NEDA 3U93A 4U4SA 2A5TB 4PE3A 3LR1A 5I58A 4YMAA 3LSXA 2CZKA 5CMCA 3MP8A 4BDLA 1NV7A 1SW2A 3U8QA 3RGYA 1SBPA 2ONSA 1VFEA 4F31B 1YXIA 2YPNA 4PQJA 4PFTA 3C31A 4OVJA 4MNPA 1OLAA 1XVYA 2LAOA 2Y84A 2UVHA 4GWSA 1I69A 2FNCA 2XWKA 1FBDA 1MY4A 2A5TA 1NUYA 2F7BA 4GXAA 3NOHA 3S9LC 2HHMA 1URDA 3VDFA 4XXUA 3KBRA 1LBWA 3PD8A 4OEVA 4NF8B 1B7ZA 2I3VA 4NN3A 1S9TA 4NMYA 2H9BA 1BK4A 4PF6A 4G2ZA 2O6AA 2FIXA 1OMPA 2F97A 4QXDA 3CFXA 5CC2A 4R73A 2WEFA 4PBQA 5H8HB 1OQGA 3I3VA 5KDTB 2DWJA 1Z7NE 2DE4A 4OETA 3MVXA 4DDDA 1SDXA 3DELB 2F5XA 1IXHA 2Z8EA 1NUWA 4ZE9A 4PFBA 3K1MA 1P1WA 4R9FA 1LFIA 4MFIA 1FTOA 2V84A 3ONMA 2PT1A 3TODA 4NF8A 1PC3A 1AOVA 2DYXA 3BFUA 2REGA 5LTCA 3TDJA 4QSDA 2O68A 4PBHA 1H44A 4WKMA 1FPFA 5H8HA 4EQBA 4KYEA 3TAJA 1XHYA 3MZBA 5ESYA 3LSFB 4QFOA 1OVBA 3MQ9A 4EDPA 1FPLA 4O94A 1NV6A 4KYSA 3CVGA 3V5AA 3TMGA 1FQBA 2I4CA 1FJ6A 5BUUA 3R26A 1B4HA 3FXUA 4H6DA 3JZJA 2QS2A 2HQ0A 3MBPA 2XXWA 3ZKLA 1B40A 3F11A 3H6VA 5IGAA 3LC8A 4NWCA 1POY1 2X26A 2B3FA 3RNNA 4GWUA 3ZKKA 1Q9DA 2RC7A 1H45A 4WEDA 5JK4A 3IB1A 2GQ1A 4BDRA 1FPEA 1MH3A 2ABHA 2OWTA 4U23A 1MM6A 4IB2A 4MHFA 5ICQA 2B4MA 1B52A 5DVJA 1LBYA 2YLNA 3IJXB 4RJZA 1ZLQA 4Q30B 2OJTA 3FUZA 1QJMA 1USYH 3IB0A 2CZIA 1FQCA 3TZAA 4LUBA 1T0KA 1S7YA 4MMPA 4X04A 5CBRA 3H03A 4I8CA 1IMFA 1LCFA 1MQDA 1FPJA 1MG1A 5EHMA 2PVUA 2ZNUA 2XXQA 2R6GE 4LQ2A 3U65A 4ZS9A 3B6WA 1YYZA 2Z8DA 3FGSA 4KQPA 1J1NA 1MXVA 3MPLA 1LAXA 1NV1A 5HM4B 3PPPA 3PU5A 1G0IA 1M5CA 4BDMA 2HXWA 3CSBA 3FVNA 4TLMB 4F19A 3KJ7A 1SYIA 3MAMA 3PUYE 3CHGA 1ELJA 2DQVA 3O2AA 4FE8A 1LAGE 2ZZXA 2ESNA 4OVSA 1LBBA 1HSJA 1B51A 4E0WA 3IOWA 4MLVA 2V4CA 1B4ZA 1Y20A 4YAHX 3O9PA 2Q89A 3S9EA 2OZZA 3TTMA 3U94A 1Q35A 1Y3PA 4MNCA 1UIVA 1GV8A 3H06B 3FJGA 1PDAA 1SW1A 1MQHA 1QGXA 3MYUA 3PTYA 2ONKE 3EN3A 3DLNA 3HPIA 3C9HA 4HS7A 4H45A 3EKIA 4WEPA 1NFTA 2F35A 2UVJA 3N26A 2Z22A 3MJNA 4O8MA 2XXUA 4NHBA 1MH4A 4P0GA 4PFYA 5I59B 4G68C 3TUSA 2BJIA 1US5A 2IA4A 4GIZA 3L6HA 4DIGA 3K01A 3VXCA 4JBZA 2ZYNA 3T9HB 3IK6B 5FBPA 1TWYA 1B9JA 1D3KA 1QULA 5A5XA 4FECA 4DI4B
chains in the Genus database with same CATH topology
2QRYA 4DE8A 1SI1A 1FW0A 4X1DA 4G4PA 4GD5A 4IGTA 1JETA 3R6UA 5I59A 4XKPA 4LA9A 4POWA 1MS7A 5AE4A 3MC2A 1PB7A 3KOSA 5ITPA 4HTGA 3DP4A 1II5A 1HSLA 3RN8A 2DP8A 2QSXA 1DOTA 5LOMA 4KCCA 1FCKA 2XXHA 3PPNA 1P1UA 4MBPA 4YB5A 2NWJA 3PUVE 4OTEA 3MP6A 2AYSA 1P1OA 3KG2A 2RC8A 3V83A 4YKJA 5HPQA 3C33A 3OO8A 2DVCA 2ZNSA 5H8SA 3SETA 5L8DA 1D9YA 3O97A 1H43A 1I6AA 3FASA 3K1NA 1B2HA 2VD2A 3RTWB 3THIA 4JDFA 4OENA 5JTYB 4H5FA 3G3JA 4U22A 1B5HA 3JV9A 4Q5TA 3FJ7A 4TQUQ 4F1YA 3K6WA 5F1QA 1MQGA 4X48A 1O64A 3FVOA 3IAZA 1BKAA 3SERA 2P0SA 4Z7EA 4F3SA 1CE2A 1USYE 4GVOA 3FVGA 3KFMA 2VHAA 4P11A 3EF7A 5JTYA 4NF5B 3ILTB 1B3EA 1MXZA 3GBBA 2F7AA 3PPRA 4X9TA 3OOAA 4OMBA 1NKXA 1O63A 4ELRA 1RKMA 5K2XA 1IXCA 4QFNA 4EF1A 1QUIA 1MRPA 1XS5A 3PUXE 3H6UA 1NL5A 3K6UA 1NNKA 1XC1A 4EXLA 4C1TA 3TTRA 4ESXA 4RPOA 4ZEKA 4NF5A 4OERA 2ZYKA 4GRKA 3T9VA 3VLUA 4ESWA 2PX1A 4F2OA 2DOJA 4JWXA 1Y4CA 1YAEA 3CR9A 3KGCA 2F34A 3O28A 1ATGA 5CMMA 2XX8A 2AIXA 2Z8FA 4XKQA 1M5BA 1VE4A 2D3IA 3KSJA 3H6TA 4G8MA 1LLSA 4JXIA 2D21A 2QMWA 4IO7A 2HFBA 4FATA 3V8XB 3MP1A 2V93A 3O6GA 2ZNTA 3E4RA 1B32A 5L9OA 3QSLA 3EHSA 4F39A 2B65A 1GVCA 4YMBA 4C0RA 2Y7PA 3PGFA 2O1LA 3QYTA 3FXRA 2VP1A 4LP2B 4RK2A 3PPOA 4OQOA 3HCQA 2PMSA 3MVWA 4NTLA 5BWJA 4YKPA 1ZJLA 3PMWA 5FHNA 1IUDA 1ZIUA 4H8JA 1IITA 1DTGA 1B3FA 5IKBA 2ZYOA 2QL3A 2CZLA 1TXFA 5JEIA 3FATA 4X1BA 4OFOA 4JB7A 1PB8A 1YCJA 4BDQA 1VR5A 1NNTA 4NE4A 4U4XA 1IIWA 1GR2A 1A99A 1N0TA 2RF1A 3TQWA 4YICA 1JW4A 4DCYA 1B1XA 2ONRA 2M8CA 4Q0CA 2OCUA 3IOTA 1CB6A 4RPNA 1EH3A 2PT2A 2O7IA 4MLQA 4BDOA 1LFGA 3TEPA 3TTNA 4BDNA 4XIGQ 3KZGA 4YB6A 2PBWA 3TKDA 1JEUA 1FTJA 3N6UA 2VGQA 1GTKA 4NF4B 3CRBA 1QUKA 1Y1MA 1LFHA 4YZZA 1N7XA 4DXUA 4GQOA 1N76A 4FAJA 3C4MA 4ECFA 1WODA 3G3FA 2I48A 3QAXA 3BFTA 2O69A 4ZEDA 1IXGA 4F3PA 3C32A 1MY0A 3CFZA 3FV2A 1OIBA 2IEEA 4R6HA 5I57B 2A5SA 3U1OA 5I2KB 1D4NA 1SW5A 2RINA 2DXRA 4NF4A 3AXFA 3H4ZA 1IXIA 1I6BA 2XXIA 1M5EA 2ALUA 4M4GA 4DCXA 1ZTYA 3C34A 5CM6A 4ELPA 1GGGA 3UK4A 3O66A 3HV1A 2F6PA 3MW0A 4YKKA 5I57A 3VVFA 3U92A 5I2KA 1DMBA 4NF6B 4F1UA 4I9DA 3TPAA 3PMVA 4MF3A 1Y3QA 2FYIA 2DSFA 3BKIB 1JW5A 2F36A 3EPEA 1MDQA 2YJPA 3PD9A 3G3HA 1B3HA 3VXBA 4IO3A 5K2YA 3CG1A 3OEKA 1ZKBA 3UN6A 1TT1A 1JNFA 3Q27A 3WAEA 4ISUA 3G7WA 4EXKA 3Q29A 4G77A 3IO4A 2I4BA 4NF6A 3TFLA 1B7UA 3VLVA 5EYFA 3CG3A 1QVSA 4HCYA 5A5XB 1TFDA 2XD3A 3DP8A 1JEVA 4ZDMA 4QRZA 1MXWA 3D4CA 3O29A 2XX7A 5I84A 5ISUA 3R7XA 4Z0IA 1MM7A 2O51A 4I62A 5DTBA 3I6VA 1H76A 3IX1A 3T9UA 4O3AA 4YU0A 1FQAA 4H8IA 1FTKA 4N13A 1BTJA 3FIRA 1SYHA 2H25A 4IO2A 4EUOA 1P1NA 4LQ5A 2I58A 4N6PA 3MZ9A 1WVJA 1TFAA 3B7DA 4IO4A 5ICTA 3P7IA 3SKPA 4F22A 3OO6A 3U72A 2DS9A 3T96B 1EZ9A 5L9SA 2I3WA 3IO6A 3S9NC 1VFDA 2R71A 4QF9A 3QK6A 3FD3A 5EHSA 3TYHA 2HAUA 4L17A 3S2VA 5IAIA 4RA1A 4LZ7A 1UTBB 2DE3A 4PETA 4FJPA 1SD3A 4XKRA 2OK2A 1A7LA 1NMUA 5M2VA 3Q25A 3PUWE 4G68B 2DWIA 1MQIA 5B70A 3SEXA 4FORA 3I5OA 1R6ZA 4GLIA 1DPPA 4R75A 1ANFA 4OFJA 4F3GA 4FEDA 4ELOA 3B6QA 3CI8A 2ANJA 1UTBA 2DVZA 1Y3NA 1MXYA 1FQFA 4F29A 5CBSA 1NH7A 4TLLB 2GHBA 4PFUA 1LB9A 4G68A 3KSXA 3MZ1A 3EHUA 5FTIA 2I49A 4U1OA 4KHZE 4ZECA 4THIA 3IOVA 3IB2A 2GRVA 2UVGA 1POTA 3QIMA 3E3KA 5TPAB 3IOUA 3PMXA 3G3KA 3SEVA 1XOCA 3HO7A 3K6XA 5H8FB 3MWBA 2P2AA 3M3KA 4QFPA 3OELA 3HSTA 1AIVA 1DSNA 2H98A 2VOZA 4KI0E 2QMXA 4NWDA 1PBPA 2DXYA 1YTVA 1AMFA 2OWSA 3FVKA 1B5JA 1P1QA 3N94A 1OVTA 2RCBA 2W7YA 1PB9A 3KEIA 3S9MC 5TPAA 1XVXA 2HZLA 4LATA 1SQYA 1JQFA 3RT8A 2X7QA 1N7WA 4OWDA 3C35A 3IL1B 3CSGA 5I56B 4ZEIA 1HSEA 5H8FA 3K4UA 1Y1ZA 2XX9A 1LSTA 3VVEA 3KOTA 4R74A 2PYYA 1Y9UA 1DTZA 3MVYA 4GWOA 2O7UA 4H65A 4GL8A 4QSCA 3RLFE 2AL4A 3TCHA 1MPDA 4H1XA 1BP5A 1SVXB 1MPCA 1MY3A 4R72A 4Q8RA 3OENA 4QHQA 4GXSB 2XD2A 2ZYMA 5I56A 2Q9TA 4DLDA 4KR5A 3V89B 3D4GA 1EZPA 3VE1B 1FQEA 4TOZA 3CFLA 1B3GA 1M5DA 4OEUA 1BIYA 2FA7A 1B0LA 3OMBA 3HHGA 3Q28A 3VFJA 1O7TA 3TQLA 1PEBA 4DXBA 1H3DA 5DT6A 5CMBA 3C36A 2VD3A 4IY5A 2F78A 2NUVA 3SEWA 3DM0A 4U1ZA 1N3XA 2UVIA 2HAVA 5ITOA 3LSLA 2XXYA 1I6QA 2E0SA 4GFRA 1IZ1A 4O3BA 3FV1A 3G3IA 2XHDA 1QW0A 2Y7IA 4JSOA 2RC9A 2QS3A 3E13X 4EQ9A 1US4A 3RUMA 3KN7A 3L6GA 4AB6A 3EHTA 2X7PA 4DXCA 3EQ1A 3LUYA 3T9XB 4XTCQ 4OYVA 1MDP1 3UORA 2Q2AA 3PUZE 3GXAA 1P99A 2P1SA 2CMOA 4KPTA 4R2FA 4U21A 3KN3A 4UACA 4OFLA 3PV0E 1AH5A 2ZXTA 3FJMA 2QS4A 5I2NB 1YPNA 1N04A 1WDNA 1A54A 1D9VA 1DPEA 2XXVA 3RPWA 3ECRA 1B1HA 4OZ9A 3GLBA 1XT8A 1N84A 4R9GA 5KDTA 1ZBMA 3MUQA 1B05A 3N5LA 3QUFA 1LAFE 3USDA 1A55A 2V25A 3IORA 4AQ4A 4FIMA 4LZ8A 5DVIA 5AA2B 1R9QA 4F3BA 4OXVA 5I2NA 4U2RA 1AL3A 3TCGA 3SDFA 3H3GA 4EQ7A 2I0CA 1SI0A 4R2BA 4RYAA 1UQWA 4F18A 1B46A 5ELVA 4DZ1A 4HW8A 1NH8A 1NNPA 5H8QB 2Z23A 3VVDA 1MPBA 3LSWA 1RYXA 3K02A 1URGA 2D5WA 5AA2A 3WAFA 3TTLA 1MY2A 4GF8A 3SESA 1F9BA 1B0HA 4RY1A 1MY1A 4LZ5A 4R6YA 3FXQA 4GL0A 2ZMBA 4POXA 1ZMGA 5H8QA 4PP0A 1FQDA 3OEMA 4JWOA 2OLBA 3QXMA 4QSEA 2HEUA 3Q26A 3A3UA 1MXUA 1A8EA 3RT6B 2XXRA 3RTFB 3O6HA 5CRYA 4P0IA 3KJTA 3H7MA 5KCJB 1B3LA 5KZTA 5DVFA 1B7HA 5FHMA 3CIJA 1S50A 1R9LA 1OQHA 3K6VA 2H99A 4YKIA 1M5FA 2OBGA 3UIFA 4XKNA 4LVQA 1UTHB 4LONB 3QUJA 5TP9B 3KN8A 2GHAA 1B58A 4YB7A 4AB5A 2F7CA 1URSA 4H67A 3O6IA 4PFWA 3UA8A 5J1DA 4ZZAA 5DEXB 4UA8A 5KCJA 4JSDA 1MQJA 2O84X 5DYHA 3W15C 3BBRA 3ZS6A 2DE2A 4G8HA 3E9XA 3TCFA 4F2QA 4BLAA 3ILUB 1UTHA 2XXPA 5TP9A 3SEYA 3K0VA 3LBSA 4QFLA 4QFKA 4FEBA 4R6KA 1OLCA 3GZGA 3OO9A 4N07A 3T66A 4F1VA 3UGWA 1B5IA 2Y7KA 5HBCA 1FTLA 1KWHA 2I0BA 5DEXA 1LAHE 2Q88A 3HHFA 4ZE8A 5CMKA 3W9VA 5AA4B 4EF2A 1UIUA 3OD7A 3N6TA 4ELQA 5L9MA 4GOTA 3M3FA 4C1UA 4KFQA 2H5YA 1A40A 4M1VA 3HN0A 3PPQA 4KYDA 1LCTA 3H6WA 5AA3A 1IEJA 1QKAA 5AA1A 1A8FA 2Q8JA 1VSOA 5FHOA 3A3CA 4MH5A 1EZOA 5AA4A 3MPKA 3SEUA 2DWAA 3GBAA 4ZZEA 3DP6A 5TU0A 1LGBC 3RQTA 3RY3A 2THIA 1JVXA 2RCAA 2O1MA 5B7DA 3TTKA 4OESA 3B6TA 4WXJA 2B3BA 2NOOA 1QUJA 3OO7A 2HCAA 2G29A 2XXTA 4ND9A 3VLWA 4IY6A 4K3FA 3MVZA 4KCDA 3ZSFA 4IO6A 4ONYA 1QKBA 4RNSA 4IO5A 3FZVA 4IGRA 3T93B 2HZKA 1Y4TA 1BLFA 1PBQA 3OXNA 5FTHA 2REJA 3M3LA 1Q1KA 2WKYA 2UXAA 3IR1A 1RYOA 3G3GA 3JYRA 3ODBA 4PE5B 3K2DA 3K00A 2Y7WA 1L5TA 2Q2CA 2R9JA 3IJOB 3VV5A 4OHNA 4RK9A 2UYFA 2QPQA 2F6GA 3OSQA 5AA2D 4KD5A 1NNFA 2GFEA 2AL5A 4HCWA 3UP9A 3TELA 4JWYA 3S4UA 2V3QA 1EU8A 5F7VA 2E1SA 1B6HA 1R1NA 4O3CA 2BJJX 1SW4A 3K1PA 2QS1A 2V3TA 3A09A 5CI5A 3T22A 1N3WA 2H4IA 2F8DA 4ZEBA 1Z7ME 5H8NB 4I1DA 4RXLA 5I58B 2V3UA 1LBCA 1IQ7A 2GH9A 1FTMA 2QJEA 2G93A 2XXXA 2NXOA 2DWHA 1JVYA 2KLFA 2I6EA 3W9WA 2Y7RA 3OSRA 4ZEFA 2NVUB 1JW1A 1ZU0A 4E0XA 1MXXA 2UYEA 3M8UA 4H5GA 4G8NA 2RKMA 5H8NA 1LB8A 4H0WA 4NEDA 3U93A 4U4SA 2A5TB 3LR1A 5I58A 4YMAA 3LSXA 5CMCA 3MP8A 4BDLA 1SW2A 3U8QA 3RGYA 1SBPA 2ONSA 1VFEA 4F31B 2YPNA 4PQJA 4PFTA 3C31A 4OVJA 1OLAA 1XVYA 2LAOA 2Y84A 2UVHA 1I69A 2FNCA 1MY4A 2A5TA 2F7BA 4GXAA 3S9LC 1URDA 3VDFA 4XXUA 3KBRA 3PD8A 4OEVA 4NF8B 1B7ZA 2I3VA 1S9TA 4NMYA 2H9BA 4G2ZA 2O6AA 1OMPA 2F97A 3CFXA 5CC2A 4R73A 5H8HB 1OQGA 3I3VA 5KDTB 2DWJA 1Z7NE 2DE4A 4OETA 3MVXA 4DDDA 1SDXA 3DELB 2F5XA 1IXHA 2Z8EA 4ZE9A 3K1MA 1P1WA 4R9FA 1LFIA 4MFIA 1FTOA 2V84A 3ONMA 2PT1A 3TODA 4NF8A 1PC3A 1AOVA 2DYXA 3BFUA 2REGA 3TDJA 4QSDA 2O68A 1H44A 4WKMA 5H8HA 4EQBA 4KYEA 3TAJA 1XHYA 3MZBA 3LSFB 4QFOA 1OVBA 3MQ9A 4EDPA 4KYSA 3CVGA 3V5AA 3TMGA 1FQBA 2I4CA 5BUUA 3R26A 1B4HA 3FXUA 4H6DA 3JZJA 2QS2A 2HQ0A 3MBPA 2XXWA 3ZKLA 1B40A 3F11A 3H6VA 3LC8A 4NWCA 1POY1 2X26A 2B3FA 3RNNA 3ZKKA 2RC7A 1H45A 4WEDA 5JK4A 3IB1A 4BDRA 1MH3A 2ABHA 2OWTA 4U23A 1MM6A 4IB2A 5ICQA 1B52A 5DVJA 2YLNA 3IJXB 4RJZA 1ZLQA 4Q30B 2OJTA 3FUZA 1QJMA 1USYH 3IB0A 1FQCA 3TZAA 4LUBA 1T0KA 1S7YA 5CBRA 3H03A 4I8CA 1LCFA 1MQDA 1MG1A 5EHMA 2PVUA 2ZNUA 2XXQA 2R6GE 4LQ2A 4ZS9A 3B6WA 2Z8DA 3FGSA 4KQPA 1J1NA 1MXVA 3MPLA 1LAXA 5HM4B 3PPPA 3PU5A 1M5CA 4BDMA 2HXWA 3CSBA 3FVNA 4TLMB 4F19A 3KJ7A 1SYIA 3MAMA 3PUYE 1ELJA 2DQVA 3O2AA 4FE8A 1LAGE 2ESNA 1LBBA 1HSJA 1B51A 4E0WA 3IOWA 4MLVA 1B4ZA 1Y20A 4YAHX 3O9PA 2Q89A 3S9EA 2OZZA 3TTMA 3U94A 1Q35A 1Y3PA 1UIVA 1GV8A 3H06B 3FJGA 1PDAA 1SW1A 1MQHA 2ONKE 3EN3A 3DLNA 3HPIA 3C9HA 4HS7A 4WEPA 1NFTA 2F35A 2UVJA 3N26A 2Z22A 3MJNA 2XXUA 1MH4A 4P0GA 4PFYA 5I59B 4G68C 3TUSA 1US5A 2IA4A 4GIZA 3L6HA 4DIGA 3K01A 3VXCA 4JBZA 2ZYNA 3T9HB 3IK6B 1TWYA 1B9JA 1D3KA 1QULA 5A5XA 4FECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRY A;  4DE8 A;  1SI1 A;  1FW0 A;  4X1D A;  4G4P A;  4GD5 A;  4IGT A;  1JET A;  3R6U A;  5I59 A;  4XKP A;  4LA9 A;  4POW A;  1MS7 A;  5AE4 A;  3MC2 A;  1PB7 A;  3KOS A;  5ITP A;  4HTG A;  3DP4 A;  1II5 A;  1HSL A;  3RN8 A;  2DP8 A;  2QSX A;  1DOT A;  5LOM A;  4KCC A;  1FCK A;  2XXH A;  3PPN A;  1P1U A;  4MBP A;  4YB5 A;  2NWJ A;  3PUV E;  4OTE A;  3MP6 A;  2AYS A;  1P1O A;  3KG2 A;  2RC8 A;  3V83 A;  4YKJ A;  5HPQ A;  3C33 A;  3OO8 A;  2DVC A;  2ZNS A;  5H8S A;  3SET A;  5L8D A;  1D9Y A;  3O97 A;  1H43 A;  1I6A A;  3FAS A;  3K1N A;  1B2H A;  2VD2 A;  3RTW B;  3THI A;  4JDF A;  4OEN A;  5JTY B;  4H5F A;  3G3J A;  4U22 A;  1B5H A;  3JV9 A;  4Q5T A;  3FJ7 A;  4TQU Q;  4F1Y A;  3K6W A;  5F1Q A;  1MQG A;  4X48 A;  1O64 A;  3FVO A;  3IAZ A;  1BKA A;  3SER A;  2P0S A;  4Z7E A;  4F3S A;  1CE2 A;  1USY E;  4GVO A;  3FVG A;  3KFM A;  2VHA A;  4P11 A;  3EF7 A;  5JTY A;  4NF5 B;  3ILT B;  1B3E A;  1MXZ A;  3GBB A;  2F7A A;  3PPR A;  4X9T A;  3OOA A;  4OMB A;  1NKX A;  1O63 A;  4ELR A;  1RKM A;  5K2X A;  1IXC A;  4QFN A;  4EF1 A;  1QUI A;  1MRP A;  1XS5 A;  3PUX E;  3H6U A;  1NL5 A;  3K6U A;  1NNK A;  1XC1 A;  4EXL A;  4C1T A;  3TTR A;  4ESX A;  4RPO A;  4ZEK A;  4NF5 A;  4OER A;  2ZYK A;  4GRK A;  3T9V A;  3VLU A;  4ESW A;  2PX1 A;  4F2O A;  2DOJ A;  4JWX A;  1Y4C A;  1YAE A;  3CR9 A;  3KGC A;  2F34 A;  3O28 A;  1ATG A;  5CMM A;  2XX8 A;  2AIX A;  2Z8F A;  4XKQ A;  1M5B A;  1VE4 A;  2D3I A;  3KSJ A;  3H6T A;  4G8M A;  1LLS A;  4JXI A;  2D21 A;  2QMW A;  4IO7 A;  2HFB A;  4FAT A;  3V8X B;  3MP1 A;  2V93 A;  3O6G A;  2ZNT A;  3E4R A;  1B32 A;  5L9O A;  3QSL A;  3EHS A;  4F39 A;  2B65 A;  1GVC A;  4YMB A;  4C0R A;  2Y7P A;  3PGF A;  2O1L A;  3QYT A;  3FXR A;  2VP1 A;  4LP2 B;  4RK2 A;  3PPO A;  4OQO A;  3HCQ A;  2PMS A;  3MVW A;  4NTL A;  5BWJ A;  4YKP A;  1ZJL A;  3PMW A;  5FHN A;  1IUD A;  1ZIU A;  4H8J A;  1IIT A;  1DTG A;  1B3F A;  5IKB A;  2ZYO A;  2QL3 A;  2CZL A;  1TXF A;  5JEI A;  3FAT A;  4X1B A;  4OFO A;  4JB7 A;  1PB8 A;  1YCJ A;  4BDQ A;  1VR5 A;  1NNT A;  4NE4 A;  4U4X A;  1IIW A;  1GR2 A;  1A99 A;  1N0T A;  2RF1 A;  3TQW A;  4YIC A;  1JW4 A;  4DCY A;  1B1X A;  2ONR A;  2M8C A;  4Q0C A;  2OCU A;  3IOT A;  1CB6 A;  4RPN A;  1EH3 A;  2PT2 A;  2O7I A;  4MLQ A;  4BDO A;  1LFG A;  3TEP A;  3TTN A;  4BDN A;  4XIG Q;  3KZG A;  4YB6 A;  2PBW A;  3TKD A;  1JEU A;  1FTJ A;  3N6U A;  2VGQ A;  1GTK A;  4NF4 B;  3CRB A;  1QUK A;  1Y1M A;  1LFH A;  4YZZ A;  1N7X A;  4DXU A;  4GQO A;  1N76 A;  4FAJ A;  3C4M A;  4ECF A;  1WOD A;  3G3F A;  2I48 A;  3QAX A;  3BFT A;  2O69 A;  4ZED A;  1IXG A;  4F3P A;  3C32 A;  1MY0 A;  3CFZ A;  3FV2 A;  1OIB A;  2IEE A;  4R6H A;  5I57 B;  2A5S A;  3U1O A;  5I2K B;  1D4N A;  1SW5 A;  2RIN A;  2DXR A;  4NF4 A;  3AXF A;  3H4Z A;  1IXI A;  1I6B A;  2XXI A;  1M5E A;  2ALU A;  4M4G A;  4DCX A;  1ZTY A;  3C34 A;  5CM6 A;  4ELP A;  1GGG A;  3UK4 A;  3O66 A;  3HV1 A;  2F6P A;  3MW0 A;  4YKK A;  5I57 A;  3VVF A;  3U92 A;  5I2K A;  1DMB A;  4NF6 B;  4F1U A;  4I9D A;  3TPA A;  3PMV A;  4MF3 A;  1Y3Q A;  2FYI A;  2DSF A;  3BKI B;  1JW5 A;  2F36 A;  3EPE A;  1MDQ A;  2YJP A;  3PD9 A;  3G3H A;  1B3H A;  3VXB A;  4IO3 A;  5K2Y A;  3CG1 A;  3OEK A;  1ZKB A;  3UN6 A;  1TT1 A;  1JNF A;  3Q27 A;  3WAE A;  4ISU A;  3G7W A;  4EXK A;  3Q29 A;  4G77 A;  3IO4 A;  2I4B A;  4NF6 A;  3TFL A;  1B7U A;  3VLV A;  5EYF A;  3CG3 A;  1QVS A;  4HCY A;  5A5X B;  1TFD A;  2XD3 A;  3DP8 A;  1JEV A;  4ZDM A;  4QRZ A;  1MXW A;  3D4C A;  3O29 A;  2XX7 A;  5I84 A;  5ISU A;  3R7X A;  4Z0I A;  1MM7 A;  2O51 A;  4I62 A;  5DTB A;  3I6V A;  1H76 A;  3IX1 A;  3T9U A;  4O3A A;  4YU0 A;  1FQA A;  4H8I A;  1FTK A;  4N13 A;  1BTJ A;  3FIR A;  1SYH A;  2H25 A;  4IO2 A;  4EUO A;  1P1N A;  4LQ5 A;  2I58 A;  4N6P A;  3MZ9 A;  1WVJ A;  1TFA A;  3B7D A;  4IO4 A;  5ICT A;  3P7I A;  3SKP A;  4F22 A;  3OO6 A;  3U72 A;  2DS9 A;  3T96 B;  1EZ9 A;  5L9S A;  2I3W A;  3IO6 A;  3S9N C;  1VFD A;  2R71 A;  4QF9 A;  3QK6 A;  3FD3 A;  5EHS A;  3TYH A;  2HAU A;  4L17 A;  3S2V A;  5IAI A;  4RA1 A;  4LZ7 A;  1UTB B;  2DE3 A;  4PET A;  4FJP A;  1SD3 A;  4XKR A;  2OK2 A;  1A7L A;  1NMU A;  5M2V A;  3Q25 A;  3PUW E;  4G68 B;  2DWI A;  1MQI A;  5B70 A;  3SEX A;  4FOR A;  3I5O A;  1R6Z A;  4GLI A;  1DPP A;  4R75 A;  1ANF A;  4OFJ A;  4F3G A;  4FED A;  4ELO A;  3B6Q A;  3CI8 A;  2ANJ A;  1UTB A;  2DVZ A;  1Y3N A;  1MXY A;  1FQF A;  4F29 A;  5CBS A;  1NH7 A;  4TLL B;  2GHB A;  4PFU A;  1LB9 A;  4G68 A;  3KSX A;  3MZ1 A;  3EHU A;  5FTI A;  2I49 A;  4U1O A;  4KHZ E;  4ZEC A;  4THI A;  3IOV A;  3IB2 A;  2GRV A;  2UVG A;  1POT A;  3QIM A;  3E3K A;  5TPA B;  3IOU A;  3PMX A;  3G3K A;  3SEV A;  1XOC A;  3HO7 A;  3K6X A;  5H8F B;  3MWB A;  2P2A A;  3M3K A;  4QFP A;  3OEL A;  3HST A;  1AIV A;  1DSN A;  2H98 A;  2VOZ A;  4KI0 E;  2QMX A;  4NWD A;  1PBP A;  2DXY A;  1YTV A;  1AMF A;  2OWS A;  3FVK A;  1B5J A;  1P1Q A;  3N94 A;  1OVT A;  2RCB A;  2W7Y A;  1PB9 A;  3KEI A;  3S9M C;  5TPA A;  1XVX A;  2HZL A;  4LAT A;  1SQY A;  1JQF A;  3RT8 A;  2X7Q A;  1N7W A;  4OWD A;  3C35 A;  3IL1 B;  3CSG A;  5I56 B;  4ZEI A;  1HSE A;  5H8F A;  3K4U A;  1Y1Z A;  2XX9 A;  1LST A;  3VVE A;  3KOT A;  4R74 A;  2PYY A;  1Y9U A;  1DTZ A;  3MVY A;  4GWO A;  2O7U A;  4H65 A;  4GL8 A;  4QSC A;  3RLF E;  2AL4 A;  3TCH A;  1MPD A;  4H1X A;  1BP5 A;  1SVX B;  1MPC A;  1MY3 A;  4R72 A;  4Q8R A;  3OEN A;  4QHQ A;  4GXS B;  2XD2 A;  2ZYM A;  5I56 A;  2Q9T A;  4DLD A;  4KR5 A;  3V89 B;  3D4G A;  1EZP A;  3VE1 B;  1FQE A;  4TOZ A;  3CFL A;  1B3G A;  1M5D A;  4OEU A;  1BIY A;  2FA7 A;  1B0L A;  3OMB A;  3HHG A;  3Q28 A;  3VFJ A;  1O7T A;  3TQL A;  1PEB A;  4DXB A;  1H3D A;  5DT6 A;  5CMB A;  3C36 A;  2VD3 A;  4IY5 A;  2F78 A;  2NUV A;  3SEW A;  3DM0 A;  4U1Z A;  1N3X A;  2UVI A;  2HAV A;  5ITO A;  3LSL A;  2XXY A;  1I6Q A;  2E0S A;  4GFR A;  1IZ1 A;  4O3B A;  3FV1 A;  3G3I A;  2XHD A;  1QW0 A;  2Y7I A;  4JSO A;  2RC9 A;  2QS3 A;  3E13 X;  4EQ9 A;  1US4 A;  3RUM A;  3KN7 A;  3L6G A;  4AB6 A;  3EHT A;  2X7P A;  4DXC A;  3EQ1 A;  3LUY A;  3T9X B;  4XTC Q;  4OYV A;  1MDP 1;  3UOR A;  2Q2A A;  3PUZ E;  3GXA A;  1P99 A;  2P1S A;  2CMO A;  4KPT A;  4R2F A;  4U21 A;  3KN3 A;  4UAC A;  4OFL A;  3PV0 E;  1AH5 A;  2ZXT A;  3FJM A;  2QS4 A;  5I2N B;  1YPN A;  1N04 A;  1WDN A;  1A54 A;  1D9V A;  1DPE A;  2XXV A;  3RPW A;  3ECR A;  1B1H A;  4OZ9 A;  3GLB A;  1XT8 A;  1N84 A;  4R9G A;  5KDT A;  1ZBM A;  3MUQ A;  1B05 A;  3N5L A;  3QUF A;  1LAF E;  3USD A;  1A55 A;  2V25 A;  3IOR A;  4AQ4 A;  4FIM A;  4LZ8 A;  5DVI A;  5AA2 B;  1R9Q A;  4F3B A;  4OXV A;  5I2N A;  4U2R A;  1AL3 A;  3TCG A;  3SDF A;  3H3G A;  4EQ7 A;  2I0C A;  1SI0 A;  4R2B A;  4RYA A;  1UQW A;  4F18 A;  1B46 A;  5ELV A;  4DZ1 A;  4HW8 A;  1NH8 A;  1NNP A;  5H8Q B;  2Z23 A;  3VVD A;  1MPB A;  3LSW A;  1RYX A;  3K02 A;  1URG A;  2D5W A;  5AA2 A;  3WAF A;  3TTL A;  1MY2 A;  4GF8 A;  3SES A;  1F9B A;  1B0H A;  4RY1 A;  1MY1 A;  4LZ5 A;  4R6Y A;  3FXQ A;  4GL0 A;  2ZMB A;  4POX A;  1ZMG A;  5H8Q A;  4PP0 A;  1FQD A;  3OEM A;  4JWO A;  2OLB A;  3QXM A;  4QSE A;  2HEU A;  3Q26 A;  3A3U A;  1MXU A;  1A8E A;  3RT6 B;  2XXR A;  3RTF B;  3O6H A;  5CRY A;  4P0I A;  3KJT A;  3H7M A;  5KCJ B;  1B3L A;  5KZT A;  5DVF A;  1B7H A;  5FHM A;  3CIJ A;  1S50 A;  1R9L A;  1OQH A;  3K6V A;  2H99 A;  4YKI A;  1M5F A;  2OBG A;  3UIF A;  4XKN A;  4LVQ A;  1UTH B;  4LON B;  3QUJ A;  5TP9 B;  3KN8 A;  2GHA A;  1B58 A;  4YB7 A;  4AB5 A;  2F7C A;  1URS A;  4H67 A;  3O6I A;  4PFW A;  3UA8 A;  5J1D A;  4ZZA A;  5DEX B;  4UA8 A;  5KCJ A;  4JSD A;  1MQJ A;  2O84 X;  5DYH A;  3W15 C;  3BBR A;  3ZS6 A;  2DE2 A;  4G8H A;  3E9X A;  3TCF A;  4F2Q A;  4BLA A;  3ILU B;  1UTH A;  2XXP A;  5TP9 A;  3SEY A;  3K0V A;  3LBS A;  4QFL A;  4QFK A;  4FEB A;  4R6K A;  1OLC A;  3GZG A;  3OO9 A;  4N07 A;  3T66 A;  4F1V A;  3UGW A;  1B5I A;  2Y7K A;  5HBC A;  1FTL A;  1KWH A;  2I0B A;  5DEX A;  1LAH E;  2Q88 A;  3HHF A;  4ZE8 A;  5CMK A;  3W9V A;  5AA4 B;  4EF2 A;  1UIU A;  3OD7 A;  3N6T A;  4ELQ A;  5L9M A;  4GOT A;  3M3F A;  4C1U A;  4KFQ A;  2H5Y A;  1A40 A;  4M1V A;  3HN0 A;  3PPQ A;  4KYD A;  1LCT A;  3H6W A;  5AA3 A;  1IEJ A;  1QKA A;  5AA1 A;  1A8F A;  2Q8J A;  1VSO A;  5FHO A;  3A3C A;  4MH5 A;  1EZO A;  5AA4 A;  3MPK A;  3SEU A;  2DWA A;  3GBA A;  4ZZE A;  3DP6 A;  5TU0 A;  1LGB C;  3RQT A;  3RY3 A;  2THI A;  1JVX A;  2RCA A;  2O1M A;  5B7D A;  3TTK A;  4OES A;  3B6T A;  4WXJ A;  2B3B A;  2NOO A;  1QUJ A;  3OO7 A;  2HCA A;  2G29 A;  2XXT A;  4ND9 A;  3VLW A;  4IY6 A;  4K3F A;  3MVZ A;  4KCD A;  3ZSF A;  4IO6 A;  4ONY A;  1QKB A;  4RNS A;  4IO5 A;  3FZV A;  4IGR A;  3T93 B;  2HZK A;  1Y4T A;  1BLF A;  1PBQ A;  3OXN A;  5FTH A;  2REJ A;  3M3L A;  1Q1K A;  2WKY A;  2UXA A;  3IR1 A;  1RYO A;  3G3G A;  3JYR A;  3ODB A;  4PE5 B;  3K2D A;  3K00 A;  2Y7W A;  1L5T A;  2Q2C A;  2R9J A;  3IJO B;  3VV5 A;  4OHN A;  4RK9 A;  2UYF A;  2QPQ A;  2F6G A;  3OSQ A;  5AA2 D;  4KD5 A;  1NNF A;  2GFE A;  2AL5 A;  4HCW A;  3UP9 A;  3TEL A;  4JWY A;  3S4U A;  2V3Q A;  1EU8 A;  5F7V A;  2E1S A;  1B6H A;  1R1N A;  4O3C A;  2BJJ X;  1SW4 A;  3K1P A;  2QS1 A;  2V3T A;  3A09 A;  5CI5 A;  3T22 A;  1N3W A;  2H4I A;  2F8D A;  4ZEB A;  1Z7M E;  5H8N B;  4I1D A;  4RXL A;  5I58 B;  2V3U A;  1LBC A;  1IQ7 A;  2GH9 A;  1FTM A;  2QJE A;  2G93 A;  2XXX A;  2NXO A;  2DWH A;  1JVY A;  2KLF A;  2I6E A;  3W9W A;  2Y7R A;  3OSR A;  4ZEF A;  2NVU B;  1JW1 A;  1ZU0 A;  4E0X A;  1MXX A;  2UYE A;  3M8U A;  4H5G A;  4G8N A;  2RKM A;  5H8N A;  1LB8 A;  4H0W A;  4NED A;  3U93 A;  4U4S A;  2A5T B;  3LR1 A;  5I58 A;  4YMA A;  3LSX A;  5CMC A;  3MP8 A;  4BDL A;  1SW2 A;  3U8Q A;  3RGY A;  1SBP A;  2ONS A;  1VFE A;  4F31 B;  2YPN A;  4PQJ A;  4PFT A;  3C31 A;  4OVJ A;  1OLA A;  1XVY A;  2LAO A;  2Y84 A;  2UVH A;  1I69 A;  2FNC A;  1MY4 A;  2A5T A;  2F7B A;  4GXA A;  3S9L C;  1URD A;  3VDF A;  4XXU A;  3KBR A;  3PD8 A;  4OEV A;  4NF8 B;  1B7Z A;  2I3V A;  1S9T A;  4NMY A;  2H9B A;  4G2Z A;  2O6A A;  1OMP A;  2F97 A;  3CFX A;  5CC2 A;  4R73 A;  5H8H B;  1OQG A;  3I3V A;  5KDT B;  2DWJ A;  1Z7N E;  2DE4 A;  4OET A;  3MVX A;  4DDD A;  1SDX A;  3DEL B;  2F5X A;  1IXH A;  2Z8E A;  4ZE9 A;  3K1M A;  1P1W A;  4R9F A;  1LFI A;  4MFI A;  1FTO A;  2V84 A;  3ONM A;  2PT1 A;  3TOD A;  4NF8 A;  1PC3 A;  1AOV A;  2DYX A;  3BFU A;  2REG A;  3TDJ A;  4QSD A;  2O68 A;  1H44 A;  4WKM A;  5H8H A;  4EQB A;  4KYE A;  3TAJ A;  1XHY A;  3MZB A;  3LSF B;  4QFO A;  1OVB A;  3MQ9 A;  4EDP A;  4KYS A;  3CVG A;  3V5A A;  3TMG A;  1FQB A;  2I4C A;  5BUU A;  3R26 A;  1B4H A;  3FXU A;  4H6D A;  3JZJ A;  2QS2 A;  2HQ0 A;  3MBP A;  2XXW A;  3ZKL A;  1B40 A;  3F11 A;  3H6V A;  3LC8 A;  4NWC A;  1POY 1;  2X26 A;  2B3F A;  3RNN A;  3ZKK A;  2RC7 A;  1H45 A;  4WED A;  5JK4 A;  3IB1 A;  4BDR A;  1MH3 A;  2ABH A;  2OWT A;  4U23 A;  1MM6 A;  4IB2 A;  5ICQ A;  1B52 A;  5DVJ A;  2YLN A;  3IJX B;  4RJZ A;  1ZLQ A;  4Q30 B;  2OJT A;  3FUZ A;  1QJM A;  1USY H;  3IB0 A;  1FQC A;  3TZA A;  4LUB A;  1T0K A;  1S7Y A;  5CBR A;  3H03 A;  4I8C A;  1LCF A;  1MQD A;  1MG1 A;  5EHM A;  2PVU A;  2ZNU A;  2XXQ A;  2R6G E;  4LQ2 A;  4ZS9 A;  3B6W A;  2Z8D A;  3FGS A;  4KQP A;  1J1N A;  1MXV A;  3MPL A;  1LAX A;  5HM4 B;  3PPP A;  3PU5 A;  1M5C A;  4BDM A;  2HXW A;  3CSB A;  3FVN A;  4TLM B;  4F19 A;  3KJ7 A;  1SYI A;  3MAM A;  3PUY E;  1ELJ A;  2DQV A;  3O2A A;  4FE8 A;  1LAG E;  2ESN A;  1LBB A;  1HSJ A;  1B51 A;  4E0W A;  3IOW A;  4MLV A;  1B4Z A;  1Y20 A;  4YAH X;  3O9P A;  2Q89 A;  3S9E A;  2OZZ A;  3TTM A;  3U94 A;  1Q35 A;  1Y3P A;  1UIV A;  1GV8 A;  3H06 B;  3FJG A;  1PDA A;  1SW1 A;  1MQH A;  2ONK E;  3EN3 A;  3DLN A;  3HPI A;  3C9H A;  4HS7 A;  4WEP A;  1NFT A;  2F35 A;  2UVJ A;  3N26 A;  2Z22 A;  3MJN A;  2XXU A;  1MH4 A;  4P0G A;  4PFY A;  5I59 B;  4G68 C;  3TUS A;  1US5 A;  2IA4 A;  4GIZ A;  3L6H A;  4DIG A;  3K01 A;  3VXC A;  4JBZ A;  2ZYN A;  3T9H B;  3IK6 B;  1TWY A;  1B9J A;  1D3K A;  1QUL A;  5A5X A;  4FEC A; 
#chains in the Genus database with same CATH topology
 2QRY A;  4DE8 A;  1SI1 A;  1FW0 A;  2WBB A;  4X1D A;  4G4P A;  4GD5 A;  4IGT A;  1JET A;  3R6U A;  5I59 A;  1VDW A;  4XKP A;  4LA9 A;  4POW A;  1MS7 A;  5AE4 A;  5I7I A;  3MC2 A;  1PB7 A;  3KOS A;  5ITP A;  4P47 A;  4HTG A;  3MST A;  3DP4 A;  1II5 A;  1NV4 A;  1HSL A;  3RN8 A;  2DP8 A;  2QSX A;  3FBP A;  1DOT A;  5LOM A;  4KCC A;  1FCK A;  2XXH A;  3PPN A;  1P1U A;  4MBP A;  4YB5 A;  2NWJ A;  3PUV E;  4OTE A;  2CEX A;  3MP6 A;  5EYG A;  2AYS A;  1P1O A;  3KG2 A;  2RC8 A;  3V83 A;  1XI6 A;  4YKJ A;  5HPQ A;  3C33 A;  3OO8 A;  2DVC A;  2ZNS A;  5H8S A;  4MJO A;  3SET A;  3LUZ A;  5L8D A;  1D9Y A;  4AS5 A;  3O97 A;  1FJ9 A;  1H43 A;  1I6A A;  1IMA A;  3FAS A;  3K1N A;  1B2H A;  2VD2 A;  2WBD A;  3RTW B;  3THI A;  4JDF A;  4OEN A;  2OX3 A;  4H5F A;  5JTY B;  4I3E A;  3G3J A;  4U22 A;  1B5H A;  3JV9 A;  2XWV A;  4Q5T A;  3FJ7 A;  4TQU Q;  1NUZ A;  4F1Y A;  3K6W A;  5F1Q A;  1MQG A;  4X48 A;  1O64 A;  3FVO A;  3IAZ A;  1BKA A;  3SER A;  2P0S A;  4Z7E A;  4F3S A;  1CE2 A;  1USY E;  4GVO A;  3FVG A;  3KFM A;  2VHA A;  4GWX A;  4P11 A;  3EF7 A;  5JTY A;  4NF5 B;  3ILT B;  1B3E A;  1FPB A;  3ISP A;  1MXZ A;  3GBB A;  2F7A A;  1LBX A;  3PPR A;  4X9T A;  2HXR A;  3OOA A;  4OMB A;  4XEQ A;  1NKX A;  1O63 A;  5EQ7 A;  4ELR A;  1RKM A;  5K2X A;  1IXC A;  4QFN A;  4EF1 A;  1QUI A;  2WX9 A;  1MRP A;  2OWZ A;  1XS5 A;  3PUX E;  4PAF A;  1FPI A;  3H6U A;  1NL5 A;  3K6U A;  1NNK A;  1XC1 A;  4EXL A;  4C1T A;  3TTR A;  4ESX A;  4RPO A;  4ZEK A;  4NF5 A;  4OER A;  2ZYK A;  4GRK A;  3T9V A;  3VLU A;  4ESW A;  2Y5K A;  2PX1 A;  4F2O A;  2DOJ A;  4JWX A;  1Y4C A;  1YAE A;  1NI9 A;  3CR9 A;  2F34 A;  3O28 A;  3KGC A;  1ATG A;  5CMM A;  2XX8 A;  5EQ8 A;  2AIX A;  2Q74 A;  2Z8F A;  4XKQ A;  1M5B A;  4GX4 A;  1VE4 A;  2D3I A;  3KSJ A;  3H6T A;  4G8M A;  1LLS A;  4JXI A;  2D21 A;  2QMW A;  4PDD A;  4IO7 A;  1AWB A;  2HFB A;  4FAT A;  5F24 A;  3V8X B;  1FRP A;  3MP1 A;  2V93 A;  3O6G A;  3IFA A;  1JP4 A;  2ZNT A;  3E4R A;  1B32 A;  1IME A;  5L9O A;  3QSL A;  3EHS A;  4F39 A;  1FPG A;  1D9Q A;  2B65 A;  1GVC A;  5T3J A;  2VPN A;  4C0R A;  4YMB A;  4PC9 A;  2Y7P A;  3PGF A;  2O1L A;  3QYT A;  5IZZ A;  3FXR A;  2VP1 A;  4PTK A;  4LP2 B;  4RK2 A;  4JVD A;  2XA5 A;  4O7I A;  1DBZ A;  4GBV A;  4N91 A;  3PPO A;  4OQO A;  1LBV A;  3HCQ A;  2PMS A;  3SZP A;  3MVW A;  4NTL A;  4MEV A;  5BWJ A;  4YKP A;  1ZJL A;  2VT5 A;  3PMW A;  5FHN A;  4H8J A;  1IUD A;  1ZIU A;  1IIT A;  1DTG A;  1B3F A;  5IKB A;  2ZYO A;  2QL3 A;  2CZL A;  4AS4 A;  1TXF A;  5JEI A;  4OVP A;  3FAT A;  4X1B A;  4OFO A;  4JB7 A;  1PB8 A;  1YCJ A;  4BDQ A;  1VR5 A;  1NNT A;  2CEY A;  4NE4 A;  4U4X A;  1IIW A;  1IMD A;  1GR2 A;  1A99 A;  1N0T A;  2RF1 A;  3TQW A;  4YIC A;  1JW4 A;  2L5V A;  5DW8 A;  4DCY A;  1B1X A;  2ONR A;  2M8C A;  4Q0C A;  2OCU A;  3IOT A;  1CB6 A;  4RPN A;  1EH3 A;  2PT2 A;  2O7I A;  4MLQ A;  4BDO A;  1LFG A;  3TEP A;  3TTN A;  4BDN A;  2Q8M A;  4XIG Q;  3KZG A;  4YB6 A;  2PBW A;  4PAI A;  3TKD A;  4HE2 A;  1JEU A;  1FTJ A;  3N6U A;  1K9Y A;  2VGQ A;  1GTK A;  4NF4 B;  3CRB A;  1DCU A;  1QUK A;  4X8R A;  1Y1M A;  1LFH A;  2ZZW A;  4YZZ A;  1N7X A;  4DXU A;  4GQO A;  1N76 A;  4FAJ A;  3C4M A;  4ECF A;  1WOD A;  4I40 A;  3G3F A;  4G61 A;  2I48 A;  3QAX A;  3BFT A;  2O69 A;  4ZED A;  2QVV A;  1IXG A;  4F3P A;  3C32 A;  2R8T A;  1MY0 A;  3CFZ A;  3FV2 A;  1OIB A;  2IEE A;  4R6H A;  4N6D A;  5I57 B;  2A5S A;  3U1O A;  5I3S A;  5I2K B;  2ZZV A;  4NX1 A;  1D4N A;  1SW5 A;  1RDX A;  2RIN A;  1FBE A;  2DXR A;  4NF4 A;  4MAG A;  3HFU A;  5J16 A;  3AXF A;  3H4Z A;  1IXI A;  1I6B A;  2XXI A;  1M5E A;  2ALU A;  4M4G A;  2WYP A;  4DCX A;  1ZTY A;  3C34 A;  5CM6 A;  4ELP A;  1GGG A;  3UK4 A;  4MCO A;  3O66 A;  3HV1 A;  2F6P A;  3MW0 A;  4YKK A;  1FBH A;  5I57 A;  3VVF A;  2Y5L A;  3U92 A;  5I2K A;  1DMB A;  4NF6 B;  4F1U A;  4I9D A;  3KC0 A;  3TPA A;  3PMV A;  4MF3 A;  1Y3Q A;  2FYI A;  2DSF A;  3BKI B;  1JW5 A;  2F36 A;  3EPE A;  1MDQ A;  2P3N A;  2YJP A;  3PD9 A;  4P8B A;  3G3H A;  4PFI A;  1B3H A;  3VXB A;  4IO3 A;  5K2Y A;  3CG1 A;  3OEK A;  1ZKB A;  3UN6 A;  1TT1 A;  4DI3 D;  1JNF A;  3Q27 A;  4N6K A;  3WAE A;  4ISU A;  3G7W A;  4EXK A;  3Q29 A;  4G77 A;  3BIG A;  3IO4 A;  2I4B A;  4NF6 A;  3TFL A;  4PGN A;  1B7U A;  1LEV A;  3VLV A;  5EYF A;  3CG3 A;  1QVS A;  4HCY A;  5A5X B;  1TFD A;  2XD3 A;  3DP8 A;  1JEV A;  4ZDM A;  4QRZ A;  1MXW A;  3D4C A;  3O29 A;  2XX7 A;  5I84 A;  5ISU A;  3ROJ A;  3R7X A;  4Z0I A;  1MM7 A;  2O51 A;  4I62 A;  5DTB A;  3I6V A;  1H76 A;  5I5P A;  3IX1 A;  3T9U A;  4O3A A;  4YU0 A;  1FQA A;  4H8I A;  1FTK A;  4N13 A;  1BTJ A;  3FIR A;  1SYH A;  2H25 A;  4IO2 A;  4EUO A;  1P1N A;  4LQ5 A;  2I58 A;  4N6P A;  3MZ9 A;  1WVJ A;  1TFA A;  3B7D A;  4IO4 A;  5ICT A;  1RDY A;  3P7I A;  3SKP A;  2FIE A;  4F22 A;  3OO6 A;  3U72 A;  2DS9 A;  3T96 B;  1EZ9 A;  5L9S A;  2I3W A;  3IO6 A;  3S9N C;  4P3L A;  1IMC A;  1VFD A;  2R71 A;  4QF9 A;  3QK6 A;  4GX3 A;  1FBP A;  3FD3 A;  5EHS A;  3TYH A;  2HAU A;  2WYK A;  4L17 A;  3S2V A;  5IAI A;  4RA1 A;  4LZ7 A;  1UTB B;  2DE3 A;  4PET A;  4MNI A;  4FJP A;  1SD3 A;  4XKR A;  2OK2 A;  1SPI A;  1A7L A;  1NMU A;  5M2V A;  3Q25 A;  3PUW E;  4G68 B;  2DWI A;  1MQI A;  5B70 A;  3SEX A;  4FOR A;  3I5O A;  1R6Z A;  4GLI A;  4HXV A;  1DPP A;  4R75 A;  1ANF A;  4XFE A;  4OFJ A;  4F3G A;  4FED A;  4ELO A;  1KA1 A;  3B6Q A;  3CI8 A;  2ANJ A;  3LV0 A;  1UTB A;  2DVZ A;  1Y3N A;  1MXY A;  1FQF A;  4F29 A;  4N4U A;  5CBS A;  4QBA A;  1NH7 A;  4TLL B;  2GHB A;  4PFU A;  1LB9 A;  4G68 A;  3KSX A;  3MZ1 A;  3IFC A;  4FBP A;  3EHU A;  5FTI A;  2I49 A;  4U1O A;  4KHZ E;  4ZEC A;  4THI A;  5IZ3 A;  3IOV A;  1INP A;  3IB2 A;  4NAP A;  2GRV A;  2UVG A;  1POT A;  3QIM A;  3E3K A;  5TPA B;  3IOU A;  3PMX A;  3G3K A;  3SEV A;  1XOC A;  3HO7 A;  3K6X A;  5H8F B;  3MWB A;  2P2A A;  3M3K A;  4QFP A;  3OEL A;  3HST A;  1AIV A;  1DSN A;  2H98 A;  4P9K A;  2VOZ A;  4KI0 E;  2QMX A;  4NWD A;  1PBP A;  2DXY A;  1YTV A;  2F3B A;  1AMF A;  2OWS A;  3FVK A;  1B5J A;  1P1Q A;  3N94 A;  1OVT A;  2RCB A;  2W7Y A;  1PB9 A;  3KEI A;  3S9M C;  5TPA A;  1XVX A;  2KR0 A;  2HZL A;  4LAT A;  4JVI A;  1SQY A;  1JQF A;  3RT8 A;  2X7Q A;  1N7W A;  4OWD A;  3C35 A;  3IL1 B;  3CSG A;  5I56 B;  4ZEI A;  1HSE A;  5H8F A;  3K4U A;  1Y1Z A;  2XX9 A;  1LST A;  3VVE A;  3KOT A;  4R74 A;  2PYY A;  1Y9U A;  1DTZ A;  3MVY A;  4GWO A;  2O7U A;  1K9Z A;  4H65 A;  4GL8 A;  4QSC A;  4NQ8 A;  3RLF E;  2AL4 A;  4HE1 A;  3TCH A;  1MPD A;  4H1X A;  1BP5 A;  1SVX B;  1MPC A;  1MY3 A;  4R72 A;  4Q8R A;  3OEN A;  4QHQ A;  4I3Y A;  4GXS B;  2XD2 A;  2ZYM A;  5I56 A;  4KXP A;  2KQZ A;  2Q9T A;  4DLD A;  4KR5 A;  3V89 B;  3D4G A;  1EZP A;  3VE1 B;  1FQE A;  4TOZ A;  3CFL A;  1B3G A;  1M5D A;  4OEU A;  1BIY A;  2FA7 A;  1B0L A;  1NV0 A;  3OMB A;  4LN5 A;  3HHG A;  3Q28 A;  3VFJ A;  1O7T A;  3TQL A;  1PEB A;  4DXB A;  1H3D A;  1KZ8 A;  5DT6 A;  5CMB A;  3C36 A;  2VD3 A;  3FXB A;  4IY5 A;  2F78 A;  2NUV A;  3SEW A;  3DM0 A;  1FSA A;  4U1Z A;  1N3X A;  2UVI A;  2HAV A;  5ITO A;  3LSL A;  2XXY A;  1I6Q A;  2E0S A;  4GFR A;  1IZ1 A;  4N81 A;  4PDH A;  4O3B A;  3FV1 A;  3G3I A;  2XHD A;  1QW0 A;  2Y7I A;  4JSO A;  2RC9 A;  3RYD A;  2QS3 A;  3E13 X;  4OVQ A;  4EQ9 A;  4PF8 A;  1US4 A;  3RUM A;  3KN7 A;  3L6G A;  4AB6 A;  3EHT A;  2X7P A;  4DXC A;  3EQ1 A;  2XWO A;  3LUY A;  3T9X B;  4XTC Q;  4OYV A;  1MDP 1;  3GYY A;  3UOR A;  1NV2 A;  2Q2A A;  3PUZ E;  2JJK A;  3GXA A;  1P99 A;  2P1S A;  3QMF A;  1EYK A;  2CMO A;  4KPT A;  4R2F A;  4U21 A;  3KN3 A;  4UAC A;  4OFL A;  2PFY A;  1LBZ A;  1FPK A;  3PV0 E;  1AH5 A;  4HE0 A;  2ZXT A;  3B50 A;  3FJM A;  2QS4 A;  5I2N B;  1YPN A;  1N04 A;  1WDN A;  3D1R A;  1A54 A;  1D9V A;  1DPE A;  2XXV A;  3RPW A;  3ECR A;  2QFL A;  2P3V A;  1B1H A;  2MKZ A;  4OZ9 A;  3GLB A;  1XT8 A;  1N84 A;  4NGU A;  4R9G A;  5KDT A;  1ZBM A;  3MUQ A;  1B05 A;  3N5L A;  3QUF A;  1LAF E;  3USD A;  1G0H A;  3T1B A;  3A29 A;  1A55 A;  2V25 A;  3IOR A;  4AQ4 A;  1EYJ A;  4FIM A;  4LZ8 A;  5DVI A;  5AA2 B;  1R9Q A;  1FBF A;  4F3B A;  4OXV A;  5I2N A;  4U2R A;  4PGP A;  1AL3 A;  4OA4 A;  2PFZ A;  3TCG A;  2XXK A;  3SDF A;  3H3G A;  4EQ7 A;  2I0C A;  1SI0 A;  4R2B A;  4RYA A;  1UQW A;  4F18 A;  1B46 A;  5ELV A;  4DZ1 A;  4HW8 A;  2FHY A;  2HPG A;  1NH8 A;  1NNP A;  5H8Q B;  4MIJ A;  2Z23 A;  2QVU A;  3VVD A;  1MPB A;  4NF0 A;  5IM2 A;  3LSW A;  1RYX A;  3K02 A;  1URG A;  2D5W A;  5AA2 A;  2XWI A;  4N17 A;  3TTL A;  3WAF A;  1MY2 A;  4GF8 A;  3SES A;  1F9B A;  1B0H A;  4IR8 A;  4XF5 A;  4RY1 A;  1MY1 A;  3E79 A;  1EYI A;  4LZ5 A;  4R6Y A;  3FXQ A;  4GL0 A;  4N8Y A;  2ZMB A;  4JVC A;  4POX A;  3RPL B;  2B4L A;  1NV5 A;  1ZMG A;  5H8Q A;  5IZ1 A;  4PP0 A;  1FQD A;  3OEM A;  4JWO A;  2OLB A;  3QXM A;  4QSE A;  4OAN A;  2HEU A;  3Q26 A;  3A3U A;  1MXU A;  4UAB A;  1FBG A;  1RDZ A;  1A8E A;  3RT6 B;  2XXR A;  2F3D A;  4GWZ A;  3RTF B;  3O6H A;  5CRY A;  4P0I A;  3KJT A;  1FPD A;  4H46 A;  3H7M A;  5KCJ B;  1B3L A;  5KZT A;  4GBW A;  3RPL A;  4N8G A;  5DVF A;  1B7H A;  2FBP A;  5FHM A;  3CIJ A;  1S50 A;  1R9L A;  1OQH A;  3K6V A;  2H99 A;  1NUX A;  4YKI A;  1M5F A;  5EYH A;  3KBZ A;  2OBG A;  4MX6 A;  3UIF A;  4XKN A;  4LVQ A;  1UTH B;  4LON B;  3QUJ A;  5TP9 B;  3KN8 A;  2GHA A;  1B58 A;  4YB7 A;  4AB5 A;  2F7C A;  1URS A;  4H67 A;  3O6I A;  4PFW A;  4PFR A;  3UA8 A;  5J1D A;  4ZZA A;  5DEX B;  1FTA A;  4UA8 A;  5KCJ A;  4JSD A;  1MQJ A;  2O84 X;  5DYH A;  3W15 C;  3BBR A;  4GWW A;  3ZS6 A;  2DE2 A;  4G8H A;  3E9X A;  3TCF A;  4F2Q A;  4BLA A;  3ILU B;  1UTH A;  2XXP A;  5TP9 A;  3SEY A;  3K0V A;  3LBS A;  4QFL A;  4QFK A;  4FEB A;  4R6K A;  1OLC A;  3GZG A;  3OO9 A;  4N07 A;  3T66 A;  4F1V A;  3UGW A;  1B5I A;  2Y7K A;  5HBC A;  1FTL A;  1KWH A;  2I0B A;  5DEX A;  1LAH E;  2Q88 A;  3HHF A;  4ZE8 A;  5CMK A;  3W9V A;  3E78 A;  5AA4 B;  4EF2 A;  1UIU A;  3OD7 A;  3N6T A;  4ELQ A;  5L9M A;  3BIH A;  4GOT A;  3M3F A;  4C1U A;  4N15 A;  4KFQ A;  2H5Y A;  1A40 A;  4M1V A;  3HN0 A;  3PPQ A;  4KYD A;  1LCT A;  3H6W A;  5AA3 A;  1IEJ A;  1QKA A;  5AA1 A;  1A8F A;  2Q8J A;  1VSO A;  5FHO A;  1YZ0 A;  3A3C A;  1IMB A;  4MH5 A;  1EZO A;  5AA4 A;  3MPK A;  3SEU A;  5IZ3 B;  2DWA A;  3GBA A;  4ZZE A;  3DP6 A;  5TU0 A;  1LGB C;  3RQT A;  3RY3 A;  2THI A;  5EQA A;  1JVX A;  2RCA A;  2O1M A;  5B7D A;  3TTK A;  4OES A;  3B6T A;  4WXJ A;  2B3B A;  2NOO A;  1QUJ A;  3OO7 A;  2HCA A;  2G29 A;  2XXT A;  4ND9 A;  2VPO A;  3VLW A;  4IY6 A;  4K3F A;  3MVZ A;  2DDK A;  4KCD A;  3ZSF A;  4IO6 A;  4ONY A;  1QKB A;  4P56 A;  4RNS A;  4IO5 A;  3FZV A;  4IGR A;  3T0J A;  3T93 B;  2HZK A;  1Y4T A;  1BLF A;  1PBQ A;  3OXN A;  5FTH A;  2REJ A;  3M3L A;  1Q1K A;  2WKY A;  5LDZ A;  2UXA A;  2FVZ A;  3IR1 A;  1RYO A;  3G3G A;  2PCR A;  3JYR A;  3ODB A;  4PE5 B;  3K2D A;  3K00 A;  2Y7W A;  1L5T A;  2Q2C A;  2R9J A;  1KA0 A;  1NV3 A;  3IJO B;  3VV5 A;  4OHN A;  4RK9 A;  2UYF A;  2QPQ A;  3KC1 A;  5EQ9 A;  4NG7 A;  2F6G A;  3OSQ A;  5AA2 D;  4KD5 A;  1NNF A;  2GFE A;  2AL5 A;  4HCW A;  3UP9 A;  3TEL A;  4JWY A;  5ET5 A;  3S4U A;  2V3Q A;  1EU8 A;  5F7V A;  5ET7 A;  2E1S A;  4OVT A;  1B6H A;  1R1N A;  4O3C A;  2BJJ X;  1SW4 A;  3K1P A;  4PCD A;  2QS1 A;  2V3T A;  2CZH A;  5ET6 A;  3A09 A;  5CI5 A;  3T22 A;  1N3W A;  4GWY A;  2H4I A;  2F8D A;  4GX6 A;  4ZEB A;  1Z7M E;  5H8N B;  4I1D A;  4RXL A;  5I58 B;  2V3U A;  1LBC A;  1IQ7 A;  2GH9 A;  1FTM A;  2QJE A;  5A5L A;  3B8B A;  2G93 A;  4P1E A;  2XXX A;  1FBC A;  2NXO A;  2DWH A;  4OVR A;  1JVY A;  2KLF A;  2I6E A;  3W9W A;  2Y7R A;  3OSR A;  4ZEF A;  5ET8 A;  2NVU B;  4P1L A;  1CNQ A;  1JW1 A;  1ZU0 A;  4O7M A;  1MXX A;  4E0X A;  2UYE A;  2QVR A;  3M8U A;  4H5G A;  4PAK A;  4G8N A;  2RKM A;  5H8N A;  1LB8 A;  1DK4 A;  4H0W A;  4NED A;  3U93 A;  4U4S A;  2A5T B;  4PE3 A;  3LR1 A;  5I58 A;  4YMA A;  3LSX A;  2CZK A;  5CMC A;  3MP8 A;  4BDL A;  1NV7 A;  1SW2 A;  3U8Q A;  3RGY A;  1SBP A;  2ONS A;  1VFE A;  4F31 B;  1YXI A;  2YPN A;  4PQJ A;  4PFT A;  3C31 A;  4OVJ A;  4MNP A;  1OLA A;  1XVY A;  2LAO A;  2Y84 A;  2UVH A;  4GWS A;  1I69 A;  2FNC A;  2XWK A;  1FBD A;  1MY4 A;  2A5T A;  1NUY A;  2F7B A;  4GXA A;  3NOH A;  3S9L C;  2HHM A;  1URD A;  3VDF A;  4XXU A;  3KBR A;  1LBW A;  3PD8 A;  4OEV A;  4NF8 B;  1B7Z A;  2I3V A;  4NN3 A;  1S9T A;  4NMY A;  2H9B A;  1BK4 A;  4PF6 A;  4G2Z A;  2O6A A;  2FIX A;  1OMP A;  2F97 A;  4QXD A;  3CFX A;  5CC2 A;  4R73 A;  2WEF A;  4PBQ A;  5H8H B;  1OQG A;  3I3V A;  5KDT B;  2DWJ A;  1Z7N E;  2DE4 A;  4OET A;  3MVX A;  4DDD A;  1SDX A;  3DEL B;  2F5X A;  1IXH A;  2Z8E A;  1NUW A;  4ZE9 A;  4PFB A;  3K1M A;  1P1W A;  4R9F A;  1LFI A;  4MFI A;  1FTO A;  2V84 A;  3ONM A;  2PT1 A;  3TOD A;  4NF8 A;  1PC3 A;  1AOV A;  2DYX A;  3BFU A;  2REG A;  5LTC A;  3TDJ A;  4QSD A;  2O68 A;  4PBH A;  1H44 A;  4WKM A;  1FPF A;  5H8H A;  4EQB A;  4KYE A;  3TAJ A;  1XHY A;  3MZB A;  5ESY A;  3LSF B;  4QFO A;  1OVB A;  3MQ9 A;  4EDP A;  1FPL A;  4O94 A;  1NV6 A;  4KYS A;  3CVG A;  3V5A A;  3TMG A;  1FQB A;  2I4C A;  1FJ6 A;  5BUU A;  3R26 A;  1B4H A;  3FXU A;  4H6D A;  3JZJ A;  2QS2 A;  2HQ0 A;  3MBP A;  2XXW A;  3ZKL A;  1B40 A;  3F11 A;  3H6V A;  5IGA A;  3LC8 A;  4NWC A;  1POY 1;  2X26 A;  2B3F A;  3RNN A;  4GWU A;  3ZKK A;  1Q9D A;  2RC7 A;  1H45 A;  4WED A;  5JK4 A;  3IB1 A;  2GQ1 A;  4BDR A;  1FPE A;  1MH3 A;  2ABH A;  2OWT A;  4U23 A;  1MM6 A;  4IB2 A;  4MHF A;  5ICQ A;  2B4M A;  1B52 A;  5DVJ A;  1LBY A;  2YLN A;  3IJX B;  4RJZ A;  1ZLQ A;  4Q30 B;  2OJT A;  3FUZ A;  1QJM A;  1USY H;  3IB0 A;  2CZI A;  1FQC A;  3TZA A;  4LUB A;  1T0K A;  1S7Y A;  4MMP A;  4X04 A;  5CBR A;  3H03 A;  4I8C A;  1IMF A;  1LCF A;  1MQD A;  1FPJ A;  1MG1 A;  5EHM A;  2PVU A;  2ZNU A;  2XXQ A;  2R6G E;  4LQ2 A;  3U65 A;  4ZS9 A;  3B6W A;  1YYZ A;  2Z8D A;  3FGS A;  4KQP A;  1J1N A;  1MXV A;  3MPL A;  1LAX A;  1NV1 A;  5HM4 B;  3PPP A;  3PU5 A;  1G0I A;  1M5C A;  4BDM A;  2HXW A;  3CSB A;  3FVN A;  4TLM B;  4F19 A;  3KJ7 A;  1SYI A;  3MAM A;  3PUY E;  3CHG A;  1ELJ A;  2DQV A;  3O2A A;  4FE8 A;  1LAG E;  2ZZX A;  2ESN A;  4OVS A;  1LBB A;  1HSJ A;  1B51 A;  4E0W A;  3IOW A;  4MLV A;  2V4C A;  1B4Z A;  1Y20 A;  4YAH X;  3O9P A;  2Q89 A;  3S9E A;  2OZZ A;  3TTM A;  3U94 A;  1Q35 A;  1Y3P A;  4MNC A;  1UIV A;  1GV8 A;  3H06 B;  3FJG A;  1PDA A;  1SW1 A;  1MQH A;  1QGX A;  3MYU A;  3PTY A;  2ONK E;  3EN3 A;  3DLN A;  3HPI A;  3C9H A;  4HS7 A;  4H45 A;  3EKI A;  4WEP A;  1NFT A;  2F35 A;  2UVJ A;  3N26 A;  2Z22 A;  3MJN A;  4O8M A;  2XXU A;  4NHB A;  1MH4 A;  4P0G A;  4PFY A;  5I59 B;  4G68 C;  3TUS A;  2BJI A;  1US5 A;  2IA4 A;  4GIZ A;  3L6H A;  4DIG A;  3K01 A;  3VXC A;  4JBZ A;  2ZYN A;  3T9H B;  3IK6 B;  5FBP A;  1TWY A;  1B9J A;  1D3K A;  1QUL A;  5A5X A;  4FEC A;  4DI4 B; 
#chains in the Genus database with same CATH homology
 2QRY A;  4DE8 A;  1SI1 A;  1FW0 A;  4X1D A;  4G4P A;  4GD5 A;  4IGT A;  1JET A;  3R6U A;  5I59 A;  4XKP A;  4LA9 A;  4POW A;  1MS7 A;  5AE4 A;  3MC2 A;  1PB7 A;  3KOS A;  5ITP A;  4HTG A;  3DP4 A;  1II5 A;  1HSL A;  3RN8 A;  2DP8 A;  2QSX A;  1DOT A;  5LOM A;  4KCC A;  1FCK A;  2XXH A;  3PPN A;  1P1U A;  4MBP A;  4YB5 A;  2NWJ A;  3PUV E;  4OTE A;  3MP6 A;  2AYS A;  1P1O A;  3KG2 A;  2RC8 A;  3V83 A;  4YKJ A;  5HPQ A;  3C33 A;  3OO8 A;  2DVC A;  2ZNS A;  5H8S A;  3SET A;  5L8D A;  1D9Y A;  3O97 A;  1H43 A;  1I6A A;  3FAS A;  3K1N A;  1B2H A;  2VD2 A;  3RTW B;  3THI A;  4JDF A;  4OEN A;  5JTY B;  4H5F A;  3G3J A;  4U22 A;  1B5H A;  3JV9 A;  4Q5T A;  3FJ7 A;  4TQU Q;  4F1Y A;  3K6W A;  5F1Q A;  1MQG A;  4X48 A;  1O64 A;  3FVO A;  3IAZ A;  1BKA A;  3SER A;  2P0S A;  4Z7E A;  4F3S A;  1CE2 A;  1USY E;  4GVO A;  3FVG A;  3KFM A;  2VHA A;  4P11 A;  3EF7 A;  5JTY A;  4NF5 B;  3ILT B;  1B3E A;  1MXZ A;  3GBB A;  2F7A A;  3PPR A;  4X9T A;  3OOA A;  4OMB A;  1NKX A;  1O63 A;  4ELR A;  1RKM A;  5K2X A;  1IXC A;  4QFN A;  4EF1 A;  1QUI A;  1MRP A;  1XS5 A;  3PUX E;  3H6U A;  1NL5 A;  3K6U A;  1NNK A;  1XC1 A;  4EXL A;  4C1T A;  3TTR A;  4ESX A;  4RPO A;  4ZEK A;  4NF5 A;  4OER A;  2ZYK A;  4GRK A;  3T9V A;  3VLU A;  4ESW A;  2PX1 A;  4F2O A;  2DOJ A;  4JWX A;  1Y4C A;  1YAE A;  3CR9 A;  3KGC A;  2F34 A;  3O28 A;  1ATG A;  5CMM A;  2XX8 A;  2AIX A;  2Z8F A;  4XKQ A;  1M5B A;  1VE4 A;  2D3I A;  3KSJ A;  3H6T A;  4G8M A;  1LLS A;  4JXI A;  2D21 A;  2QMW A;  4IO7 A;  2HFB A;  4FAT A;  3V8X B;  3MP1 A;  2V93 A;  3O6G A;  2ZNT A;  3E4R A;  1B32 A;  5L9O A;  3QSL A;  3EHS A;  4F39 A;  2B65 A;  1GVC A;  4YMB A;  4C0R A;  2Y7P A;  3PGF A;  2O1L A;  3QYT A;  3FXR A;  2VP1 A;  4LP2 B;  4RK2 A;  3PPO A;  4OQO A;  3HCQ A;  2PMS A;  3MVW A;  4NTL A;  5BWJ A;  4YKP A;  1ZJL A;  3PMW A;  5FHN A;  1IUD A;  1ZIU A;  4H8J A;  1IIT A;  1DTG A;  1B3F A;  5IKB A;  2ZYO A;  2QL3 A;  2CZL A;  1TXF A;  5JEI A;  3FAT A;  4X1B A;  4OFO A;  4JB7 A;  1PB8 A;  1YCJ A;  4BDQ A;  1VR5 A;  1NNT A;  4NE4 A;  4U4X A;  1IIW A;  1GR2 A;  1A99 A;  1N0T A;  2RF1 A;  3TQW A;  4YIC A;  1JW4 A;  4DCY A;  1B1X A;  2ONR A;  2M8C A;  4Q0C A;  2OCU A;  3IOT A;  1CB6 A;  4RPN A;  1EH3 A;  2PT2 A;  2O7I A;  4MLQ A;  4BDO A;  1LFG A;  3TEP A;  3TTN A;  4BDN A;  4XIG Q;  3KZG A;  4YB6 A;  2PBW A;  3TKD A;  1JEU A;  1FTJ A;  3N6U A;  2VGQ A;  1GTK A;  4NF4 B;  3CRB A;  1QUK A;  1Y1M A;  1LFH A;  4YZZ A;  1N7X A;  4DXU A;  4GQO A;  1N76 A;  4FAJ A;  3C4M A;  4ECF A;  1WOD A;  3G3F A;  2I48 A;  3QAX A;  3BFT A;  2O69 A;  4ZED A;  1IXG A;  4F3P A;  3C32 A;  1MY0 A;  3CFZ A;  3FV2 A;  1OIB A;  2IEE A;  4R6H A;  5I57 B;  2A5S A;  3U1O A;  5I2K B;  1D4N A;  1SW5 A;  2RIN A;  2DXR A;  4NF4 A;  3AXF A;  3H4Z A;  1IXI A;  1I6B A;  2XXI A;  1M5E A;  2ALU A;  4M4G A;  4DCX A;  1ZTY A;  3C34 A;  5CM6 A;  4ELP A;  1GGG A;  3UK4 A;  3O66 A;  3HV1 A;  2F6P A;  3MW0 A;  4YKK A;  5I57 A;  3VVF A;  3U92 A;  5I2K A;  1DMB A;  4NF6 B;  4F1U A;  4I9D A;  3TPA A;  3PMV A;  4MF3 A;  1Y3Q A;  2FYI A;  2DSF A;  3BKI B;  1JW5 A;  2F36 A;  3EPE A;  1MDQ A;  2YJP A;  3PD9 A;  3G3H A;  1B3H A;  3VXB A;  4IO3 A;  5K2Y A;  3CG1 A;  3OEK A;  1ZKB A;  3UN6 A;  1TT1 A;  1JNF A;  3Q27 A;  3WAE A;  4ISU A;  3G7W A;  4EXK A;  3Q29 A;  4G77 A;  3IO4 A;  2I4B A;  4NF6 A;  3TFL A;  1B7U A;  3VLV A;  5EYF A;  3CG3 A;  1QVS A;  4HCY A;  5A5X B;  1TFD A;  2XD3 A;  3DP8 A;  1JEV A;  4ZDM A;  4QRZ A;  1MXW A;  3D4C A;  3O29 A;  2XX7 A;  5I84 A;  5ISU A;  3R7X A;  4Z0I A;  1MM7 A;  2O51 A;  4I62 A;  5DTB A;  3I6V A;  1H76 A;  3IX1 A;  3T9U A;  4O3A A;  4YU0 A;  1FQA A;  4H8I A;  1FTK A;  4N13 A;  1BTJ A;  3FIR A;  1SYH A;  2H25 A;  4IO2 A;  4EUO A;  1P1N A;  4LQ5 A;  2I58 A;  4N6P A;  3MZ9 A;  1WVJ A;  1TFA A;  3B7D A;  4IO4 A;  5ICT A;  3P7I A;  3SKP A;  4F22 A;  3OO6 A;  3U72 A;  2DS9 A;  3T96 B;  1EZ9 A;  5L9S A;  2I3W A;  3IO6 A;  3S9N C;  1VFD A;  2R71 A;  4QF9 A;  3QK6 A;  3FD3 A;  5EHS A;  3TYH A;  2HAU A;  4L17 A;  3S2V A;  5IAI A;  4RA1 A;  4LZ7 A;  1UTB B;  2DE3 A;  4PET A;  4FJP A;  1SD3 A;  4XKR A;  2OK2 A;  1A7L A;  1NMU A;  5M2V A;  3Q25 A;  3PUW E;  4G68 B;  2DWI A;  1MQI A;  5B70 A;  3SEX A;  4FOR A;  3I5O A;  1R6Z A;  4GLI A;  1DPP A;  4R75 A;  1ANF A;  4OFJ A;  4F3G A;  4FED A;  4ELO A;  3B6Q A;  3CI8 A;  2ANJ A;  1UTB A;  2DVZ A;  1Y3N A;  1MXY A;  1FQF A;  4F29 A;  5CBS A;  1NH7 A;  4TLL B;  2GHB A;  4PFU A;  1LB9 A;  4G68 A;  3KSX A;  3MZ1 A;  3EHU A;  5FTI A;  2I49 A;  4U1O A;  4KHZ E;  4ZEC A;  4THI A;  3IOV A;  3IB2 A;  2GRV A;  2UVG A;  1POT A;  3QIM A;  3E3K A;  5TPA B;  3IOU A;  3PMX A;  3G3K A;  3SEV A;  1XOC A;  3HO7 A;  3K6X A;  5H8F B;  3MWB A;  2P2A A;  3M3K A;  4QFP A;  3OEL A;  3HST A;  1AIV A;  1DSN A;  2H98 A;  2VOZ A;  4KI0 E;  2QMX A;  4NWD A;  1PBP A;  2DXY A;  1YTV A;  1AMF A;  2OWS A;  3FVK A;  1B5J A;  1P1Q A;  3N94 A;  1OVT A;  2RCB A;  2W7Y A;  1PB9 A;  3KEI A;  3S9M C;  5TPA A;  1XVX A;  2HZL A;  4LAT A;  1SQY A;  1JQF A;  3RT8 A;  2X7Q A;  1N7W A;  4OWD A;  3C35 A;  3IL1 B;  3CSG A;  5I56 B;  4ZEI A;  1HSE A;  5H8F A;  3K4U A;  1Y1Z A;  2XX9 A;  1LST A;  3VVE A;  3KOT A;  4R74 A;  2PYY A;  1Y9U A;  1DTZ A;  3MVY A;  4GWO A;  2O7U A;  4H65 A;  4GL8 A;  4QSC A;  3RLF E;  2AL4 A;  3TCH A;  1MPD A;  4H1X A;  1BP5 A;  1SVX B;  1MPC A;  1MY3 A;  4R72 A;  4Q8R A;  3OEN A;  4QHQ A;  4GXS B;  2XD2 A;  2ZYM A;  5I56 A;  2Q9T A;  4DLD A;  4KR5 A;  3V89 B;  3D4G A;  1EZP A;  3VE1 B;  1FQE A;  4TOZ A;  3CFL A;  1B3G A;  1M5D A;  4OEU A;  1BIY A;  2FA7 A;  1B0L A;  3OMB A;  3HHG A;  3Q28 A;  3VFJ A;  1O7T A;  3TQL A;  1PEB A;  4DXB A;  1H3D A;  5DT6 A;  5CMB A;  3C36 A;  2VD3 A;  4IY5 A;  2F78 A;  2NUV A;  3SEW A;  3DM0 A;  4U1Z A;  1N3X A;  2UVI A;  2HAV A;  5ITO A;  3LSL A;  2XXY A;  1I6Q A;  2E0S A;  4GFR A;  1IZ1 A;  4O3B A;  3FV1 A;  3G3I A;  2XHD A;  1QW0 A;  2Y7I A;  4JSO A;  2RC9 A;  2QS3 A;  3E13 X;  4EQ9 A;  1US4 A;  3RUM A;  3KN7 A;  3L6G A;  4AB6 A;  3EHT A;  2X7P A;  4DXC A;  3EQ1 A;  3LUY A;  3T9X B;  4XTC Q;  4OYV A;  1MDP 1;  3UOR A;  2Q2A A;  3PUZ E;  3GXA A;  1P99 A;  2P1S A;  2CMO A;  4KPT A;  4R2F A;  4U21 A;  3KN3 A;  4UAC A;  4OFL A;  3PV0 E;  1AH5 A;  2ZXT A;  3FJM A;  2QS4 A;  5I2N B;  1YPN A;  1N04 A;  1WDN A;  1A54 A;  1D9V A;  1DPE A;  2XXV A;  3RPW A;  3ECR A;  1B1H A;  4OZ9 A;  3GLB A;  1XT8 A;  1N84 A;  4R9G A;  5KDT A;  1ZBM A;  3MUQ A;  1B05 A;  3N5L A;  3QUF A;  1LAF E;  3USD A;  1A55 A;  2V25 A;  3IOR A;  4AQ4 A;  4FIM A;  4LZ8 A;  5DVI A;  5AA2 B;  1R9Q A;  4F3B A;  4OXV A;  5I2N A;  4U2R A;  1AL3 A;  3TCG A;  3SDF A;  3H3G A;  4EQ7 A;  2I0C A;  1SI0 A;  4R2B A;  4RYA A;  1UQW A;  4F18 A;  1B46 A;  5ELV A;  4DZ1 A;  4HW8 A;  1NH8 A;  1NNP A;  5H8Q B;  2Z23 A;  3VVD A;  1MPB A;  3LSW A;  1RYX A;  3K02 A;  1URG A;  2D5W A;  5AA2 A;  3WAF A;  3TTL A;  1MY2 A;  4GF8 A;  3SES A;  1F9B A;  1B0H A;  4RY1 A;  1MY1 A;  4LZ5 A;  4R6Y A;  3FXQ A;  4GL0 A;  2ZMB A;  4POX A;  1ZMG A;  5H8Q A;  4PP0 A;  1FQD A;  3OEM A;  4JWO A;  2OLB A;  3QXM A;  4QSE A;  2HEU A;  3Q26 A;  3A3U A;  1MXU A;  1A8E A;  3RT6 B;  2XXR A;  3RTF B;  3O6H A;  5CRY A;  4P0I A;  3KJT A;  3H7M A;  5KCJ B;  1B3L A;  5KZT A;  5DVF A;  1B7H A;  5FHM A;  3CIJ A;  1S50 A;  1R9L A;  1OQH A;  3K6V A;  2H99 A;  4YKI A;  1M5F A;  2OBG A;  3UIF A;  4XKN A;  4LVQ A;  1UTH B;  4LON B;  3QUJ A;  5TP9 B;  3KN8 A;  2GHA A;  1B58 A;  4YB7 A;  4AB5 A;  2F7C A;  1URS A;  4H67 A;  3O6I A;  4PFW A;  3UA8 A;  5J1D A;  4ZZA A;  5DEX B;  4UA8 A;  5KCJ A;  4JSD A;  1MQJ A;  2O84 X;  5DYH A;  3W15 C;  3BBR A;  3ZS6 A;  2DE2 A;  4G8H A;  3E9X A;  3TCF A;  4F2Q A;  4BLA A;  3ILU B;  1UTH A;  2XXP A;  5TP9 A;  3SEY A;  3K0V A;  3LBS A;  4QFL A;  4QFK A;  4FEB A;  4R6K A;  1OLC A;  3GZG A;  3OO9 A;  4N07 A;  3T66 A;  4F1V A;  3UGW A;  1B5I A;  2Y7K A;  5HBC A;  1FTL A;  1KWH A;  2I0B A;  5DEX A;  1LAH E;  2Q88 A;  3HHF A;  4ZE8 A;  5CMK A;  3W9V A;  5AA4 B;  4EF2 A;  1UIU A;  3OD7 A;  3N6T A;  4ELQ A;  5L9M A;  4GOT A;  3M3F A;  4C1U A;  4KFQ A;  2H5Y A;  1A40 A;  4M1V A;  3HN0 A;  3PPQ A;  4KYD A;  1LCT A;  3H6W A;  5AA3 A;  1IEJ A;  1QKA A;  5AA1 A;  1A8F A;  2Q8J A;  1VSO A;  5FHO A;  3A3C A;  4MH5 A;  1EZO A;  5AA4 A;  3MPK A;  3SEU A;  2DWA A;  3GBA A;  4ZZE A;  3DP6 A;  5TU0 A;  1LGB C;  3RQT A;  3RY3 A;  2THI A;  1JVX A;  2RCA A;  2O1M A;  5B7D A;  3TTK A;  4OES A;  3B6T A;  4WXJ A;  2B3B A;  2NOO A;  1QUJ A;  3OO7 A;  2HCA A;  2G29 A;  2XXT A;  4ND9 A;  3VLW A;  4IY6 A;  4K3F A;  3MVZ A;  4KCD A;  3ZSF A;  4IO6 A;  4ONY A;  1QKB A;  4RNS A;  4IO5 A;  3FZV A;  4IGR A;  3T93 B;  2HZK A;  1Y4T A;  1BLF A;  1PBQ A;  3OXN A;  5FTH A;  2REJ A;  3M3L A;  1Q1K A;  2WKY A;  2UXA A;  3IR1 A;  1RYO A;  3G3G A;  3JYR A;  3ODB A;  4PE5 B;  3K2D A;  3K00 A;  2Y7W A;  1L5T A;  2Q2C A;  2R9J A;  3IJO B;  3VV5 A;  4OHN A;  4RK9 A;  2UYF A;  2QPQ A;  2F6G A;  3OSQ A;  5AA2 D;  4KD5 A;  1NNF A;  2GFE A;  2AL5 A;  4HCW A;  3UP9 A;  3TEL A;  4JWY A;  3S4U A;  2V3Q A;  1EU8 A;  5F7V A;  2E1S A;  1B6H A;  1R1N A;  4O3C A;  2BJJ X;  1SW4 A;  3K1P A;  2QS1 A;  2V3T A;  3A09 A;  5CI5 A;  3T22 A;  1N3W A;  2H4I A;  2F8D A;  4ZEB A;  1Z7M E;  5H8N B;  4I1D A;  4RXL A;  5I58 B;  2V3U A;  1LBC A;  1IQ7 A;  2GH9 A;  1FTM A;  2QJE A;  2G93 A;  2XXX A;  2NXO A;  2DWH A;  1JVY A;  2KLF A;  2I6E A;  3W9W A;  2Y7R A;  3OSR A;  4ZEF A;  2NVU B;  1JW1 A;  1ZU0 A;  4E0X A;  1MXX A;  2UYE A;  3M8U A;  4H5G A;  4G8N A;  2RKM A;  5H8N A;  1LB8 A;  4H0W A;  4NED A;  3U93 A;  4U4S A;  2A5T B;  3LR1 A;  5I58 A;  4YMA A;  3LSX A;  5CMC A;  3MP8 A;  4BDL A;  1SW2 A;  3U8Q A;  3RGY A;  1SBP A;  2ONS A;  1VFE A;  4F31 B;  2YPN A;  4PQJ A;  4PFT A;  3C31 A;  4OVJ A;  1OLA A;  1XVY A;  2LAO A;  2Y84 A;  2UVH A;  1I69 A;  2FNC A;  1MY4 A;  2A5T A;  2F7B A;  4GXA A;  3S9L C;  1URD A;  3VDF A;  4XXU A;  3KBR A;  3PD8 A;  4OEV A;  4NF8 B;  1B7Z A;  2I3V A;  1S9T A;  4NMY A;  2H9B A;  4G2Z A;  2O6A A;  1OMP A;  2F97 A;  3CFX A;  5CC2 A;  4R73 A;  5H8H B;  1OQG A;  3I3V A;  5KDT B;  2DWJ A;  1Z7N E;  2DE4 A;  4OET A;  3MVX A;  4DDD A;  1SDX A;  3DEL B;  2F5X A;  1IXH A;  2Z8E A;  4ZE9 A;  3K1M A;  1P1W A;  4R9F A;  1LFI A;  4MFI A;  1FTO A;  2V84 A;  3ONM A;  2PT1 A;  3TOD A;  4NF8 A;  1PC3 A;  1AOV A;  2DYX A;  3BFU A;  2REG A;  3TDJ A;  4QSD A;  2O68 A;  1H44 A;  4WKM A;  5H8H A;  4EQB A;  4KYE A;  3TAJ A;  1XHY A;  3MZB A;  3LSF B;  4QFO A;  1OVB A;  3MQ9 A;  4EDP A;  4KYS A;  3CVG A;  3V5A A;  3TMG A;  1FQB A;  2I4C A;  5BUU A;  3R26 A;  1B4H A;  3FXU A;  4H6D A;  3JZJ A;  2QS2 A;  2HQ0 A;  3MBP A;  2XXW A;  3ZKL A;  1B40 A;  3F11 A;  3H6V A;  3LC8 A;  4NWC A;  1POY 1;  2X26 A;  2B3F A;  3RNN A;  3ZKK A;  2RC7 A;  1H45 A;  4WED A;  5JK4 A;  3IB1 A;  4BDR A;  1MH3 A;  2ABH A;  2OWT A;  4U23 A;  1MM6 A;  4IB2 A;  5ICQ A;  1B52 A;  5DVJ A;  2YLN A;  3IJX B;  4RJZ A;  1ZLQ A;  4Q30 B;  2OJT A;  3FUZ A;  1QJM A;  1USY H;  3IB0 A;  1FQC A;  3TZA A;  4LUB A;  1T0K A;  1S7Y A;  5CBR A;  3H03 A;  4I8C A;  1LCF A;  1MQD A;  1MG1 A;  5EHM A;  2PVU A;  2ZNU A;  2XXQ A;  2R6G E;  4LQ2 A;  4ZS9 A;  3B6W A;  2Z8D A;  3FGS A;  4KQP A;  1J1N A;  1MXV A;  3MPL A;  1LAX A;  5HM4 B;  3PPP A;  3PU5 A;  1M5C A;  4BDM A;  2HXW A;  3CSB A;  3FVN A;  4TLM B;  4F19 A;  3KJ7 A;  1SYI A;  3MAM A;  3PUY E;  1ELJ A;  2DQV A;  3O2A A;  4FE8 A;  1LAG E;  2ESN A;  1LBB A;  1HSJ A;  1B51 A;  4E0W A;  3IOW A;  4MLV A;  1B4Z A;  1Y20 A;  4YAH X;  3O9P A;  2Q89 A;  3S9E A;  2OZZ A;  3TTM A;  3U94 A;  1Q35 A;  1Y3P A;  1UIV A;  1GV8 A;  3H06 B;  3FJG A;  1PDA A;  1SW1 A;  1MQH A;  2ONK E;  3EN3 A;  3DLN A;  3HPI A;  3C9H A;  4HS7 A;  4WEP A;  1NFT A;  2F35 A;  2UVJ A;  3N26 A;  2Z22 A;  3MJN A;  2XXU A;  1MH4 A;  4P0G A;  4PFY A;  5I59 B;  4G68 C;  3TUS A;  1US5 A;  2IA4 A;  4GIZ A;  3L6H A;  4DIG A;  3K01 A;  3VXC A;  4JBZ A;  2ZYN A;  3T9H B;  3IK6 B;  1TWY A;  1B9J A;  1D3K A;  1QUL A;  5A5X A;  4FEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...