4GXJA

R283k dna polymerase beta ternary complex with a templating 8og and incoming dctp analog
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
326
structure length
315
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPLAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title DNA polymerase minor groove interactions modulate mutagenic bypass of a templating 8-oxoguanine lesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 116
structure length 315
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4gxjA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4gxjA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4gxjA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4gxjA03
4QZCA 5DLGA 2HVIA 2BQRA 8ICBA 1NK9A 1D9FA 4IQTA 2KZ3A 2V4RA 5J0OA 1T7PA 4S3NA 2W8LA 2HHTA 1ZQKA 7ICTA 2Q66A 5DQHA 8ICLA 5HHIA 4DOCA 4R65A 4ED3A 3HJ4A 4X4QA 4AT9A 8ICMA 4PGQA 3KHHA 1QTMA 4E0DA 7ICGA 4O3SA 3EPGA 2A1JA 3TARA 4IR1A 2XCAA 3T5HA 7ICUA 4YXMA 4M0AA 7ICPA 2DR9A 1C7YA 4DL6A 4BDPA 8ICKA 4EYHB 1ZQRA 4WC6A 1MIVA 1SL1A 4WC0A 3OVAA 2HHPA 4IQVA 3OV7A 5J29A 3C5GA 5KFBA 8ICFA 1ZQYA 4DFPA 4E80A 4I2DA 9ICBA 1KTQA 3GV8B 3T5JA 2BQ3A 2HHVA 2R8GA 2C28A 1DK3A 1VJ7A 2ID1A 5DDYA 3NGDA 2ISOA 5KG3A 4JWMA 2W9CB 7ICQA 3SI8A 2BHNA 4KLIA 2W9AA 3RR7A 4PHEA 4B9UA 4J9QA 1MQ3A 4RWNA 3JPPA 3PX4A 4DSKA 2P6UA 2FLPA 1PZNA 4HYKA 1L3VA 5KG1A 3EW9A 4Q8EA 4Q43A 1IM4A 4ECWA 2JEJA 5KFCA 2R8KA 3JYYA 3OJUA 8ICCA 5KFVA 3UXOA 1XS9D 3H8SA 2PI5A 3RJFA 4J9OA 1KNYA 2PFOA 2W8KA 5KFDA 4F5RA 4O3PA 2BCRA 4ZH4A 4KLOA 4KLUA 5D46A 2ZTCA 4YR3A 1BPZA 4BXOB 4XQ7A 1PX5A 2J6SA 1TK5A 2HHQA 8ICXA 4TQRA 4YVZA 2FLLA 7ICIA 3TQ1A 2ZHBA 5KT5A 2AQ4A 3AQKA 2DR5A 1RXWA 5HRGA 4MF8A 5KG7A 2ZJ5A 2XY5A 5IIKA 3PNCA 1Z00A 4PGXA 3MFHA 1S76D 5J2AA 2AJQA 4X4NA 1R8CA 4PHAA 2RDJA 4R8UA 3AU6A 4F5QA 3PW4A 4MEXA 4IQWA 8ICPA 5DG8A 5J0XA 4C8OA 4J9NA 9ICQA 1VFGA 4PHPA 2Y1JA 2KZMA 2BQUA 1BGXT 5EOZA 8ICSA 3V7JA 2DRAA 2MUTA 4PH5A 4XQ8A 2AGQA 3RR8A 2W9BA 4KLDA 5BOMA 1BPYA 2M2WA 3V6HA 5J0WA 1D8YA 1KFDA 5KT2A 8ICQA 5EWFA 4MFCA 3MFIA 5L1JA 3C21A 4DOBA 7ICHA 4FBTA 1KDHA 4IRDA 5HRLA 4RQ4A 4F92B 3Q8MA 2IA6A 5KT4A 5IIMA 1DGSA 1XC9A 1T4GA 2MAXA 4WCWA 4TUPA 1X2IA 4WC7A 4ECRA 7ICKA 4RQ6A 4UB3A 4LZDA 3HPOA 4PHDA 4DLEA 4JUZA 1CUKA 5KG0A 4F91B 5KFGA 5KFFA 5J0TA 4ECSA 4ED7A 1F5AA 4F5OA 1KFTA 4P4OA 5HP4A 3TI0A 1L3TA 4ED1A 2KFNA 2RFFA 4I2FA 4ED2A 2IMWP 5J2EA 5HRBA 5L1IA 4O5EA 3OUYA 4YD1A 1L3SA 4DQIA 1U9LA 3ZDCA 4X4SA 2ZJ8A 1KFSA 3V6KA 4NKTA 2OWOA 1XSLA 4RUAA 2JZBB 3UQ0A 4M9LA 5CB1A 9ICTA 4EBJA 2ZTEA 2M2VA 1UT8A 4QZIA 4J9RA 4EBCA 4M9JA 7ICFA 5DB7A 5J0UA 4DL4A 1QLNA 4B9TA 4J9PA 4KITB 3TAPA 3QEBZ 2IHMA 5BPCA 4FH5A 5DKWA 4NLGA 2XO7A 3B0XA 2ZH8A 4F4WA 4Q45A 3C2KA 3C5FA 1NK7A 2DRBA 4TURA 3Q8RB 5KFPA 5KFWA 4O3NA 4RT2A 3ZDDA 4B9LA 4JK1A 2HHSA 3G6YA 4FHYA 1RYSA 2ZUBA 5HR9A 3JPSA 2ZH6A 9ICVA 1BPXA 3IHQB 4QW8A 4M6WB 4QZBA 9ICEA 3PMNA 1X9SA 1RXVA 1S0MA 5F9LA 2R8HA 4B9SA 2JEIA 2O5AA 3MR2A 4AT7B 2DFLA 9ICSA 4X0BA 4F5NA 1JMSA 1Y88A 4GXIA 2C2RA 4YCXA 1UA1A 4B9VA 4MF2A 3OHAA 5KFJA 1RZTA 3H40A 3M8SA 2BPFA 3HWTA 5KT7A 5KFLA 2ZH1A 3G6XA 4DS4A 2I9GA 3TANA 4ELTA 7ICJA 4NM1A 4DQRA 5EWGA 4RPYA 1ZETA 4DFKA 1SKRA 4I2BA 4M04A 4KLMA 1ZQZA 1Q78A 3AU2A 4UAZA 4ED8A 1NK4A 4BWMA 3H39A 4RWPA 3LWMA 4QZFA 4GXKA 5J0YA 1S97A 2BR0A 2KTQA 4FHPA 2F1JA 4YXJA 2I1QA 4C8MA 9ICJA 3OHBA 2NRXA 3K4GA 4QZDA 3BQ0A 4G3IA 2RDIA 2DPIA 4YN4A 4QWAA 1ZQIA 2WTFA 1FA0A 4RWOA 2V9WA 8ICEA 4E7XA 4P4PA 5J2KA 5IIIA 9ICNA 4ATBA 5HRDA 1JXLA 4DQQA 4F8RA 4RU9A 5CA7A 4ED0A 3SV4A 3AQLA 5KG4A 2M2TA 1NK8A 1ZQWA 1OU5A 2Q0ZX 2NRWA 4DSIA 2ZH3A 5HHHA 2JEGA 5DB9A 2C22A 5J2FA 3RRHA 1S9FA 3UXNA 2NRKA 4R64A 4IRKA 5HRIA 3OSNA 1K1QA 4EEYA 4NLKA 1TAUA 1ZQCA 5KFRA 5KG6A 4KLJA 3FDSA 2BKEA 5TZVA 3RJGA 9ICLA 3L9DA 3GV5B 8ICRA 1BPBA 2ZJAA 3QEAZ 3GIKA 3PW7A 4UB5A 5EWEA 9ICKA 4AT8B 5HRHA 4FHWA 3GV7B 3C1YA 2IBKA 1ZQMA 5KFAA 3RB6A 4UD5A 5DQIA 4FHVA 4BGDA 1TV9A 1ZQNA 5CWRA 1CEZA 2FPMA 5J2IA 4P2HA 7ICRA 2O1PA 3T5LA 4Q44A 3UQ2A 4YR2A 3NTUA 5J0SA 3SYZA 8ICHA 1YLQA 1NJWA 3V7LA 9ICOA 4YD2A 2HHUA 3V6JA 9ICWA 3JPRA 3FYHA 5L9XA 2BCQA 7ICSA 3T3FA 5KFOA 4RNNA 3H3AA 3OVBA 2KN7A 8ICVA 3HX0A 5KT3A 1COOA 1ZQEA 3ZD8A 5J2GA 4M2YA 2HVHA 4AT9B 4KLFA 2PXIA 4KLLA 3ZDBA 2JEFA 5DBBA 5J0RA 2XY6A 8ICNA 1ZJNA 4UB2A 2NRVA 5BOLA 3RAXA 3LWLA 2A1JB 2V4QA 4Q8FA 3MGIA 3ZD9A 5KG5A 1TVAA 4PPXA 1X9WA 3ISBA 1AROP 3H4DA 2ASJA 4I2JA 4X4UA 1D9DA 4XA5A 1ZJMA 2BDPA 5L1KA 4FBUA 5CR0A 4ECXA 3MGHA 4EZ9A 4DQPA 4QW9A 9ICIA 4QZHA 1SL0A 1NOMA 1RPLA 4J9KA 1NK5A 1SKSA 1ZQJA 5J2BA 3AUOA 4FH3A 3H7IA 2FLNA 1XSNA 3M8RA 4DL5A 5DGBA 4KTQA 2XCPA 3M9MB 3AQNA 4EP7A 2PFNA 3WFOA 1ZQPA 3MBYA 4QZAA 1NK0A 4DSJA 7ICOA 5CJ7A 4EBDA 4M9HA 4NKUA 1TFRA 3C23A 5L1LA 5HNKA 2B21A 3HT3A 4I28A 4UBBA 2XGPA 2DR8A 4DFJA 8ICGA 1LV5A 5F2VO 4MFFA 4B9NA 7ICMA 2ZH9A 3SV3A 3OGUA 4EBEA 2ZH5A 1Q79A 4KLGA 1UT5A 8ICJA 3AQMA 4Z6CA 2AGOA 2FMQA 3V72A 1S0VA 5DB6A 4RPZA 2XC9A 3MR6A 3H4BA 1TK0A 5KFUA 3RH5A 1KRPA 3RJEA 1U49A 3PO4A 4YMNA 4DFMA 1ZQUA 4QWCA 2J6UA 1TK8A 4Z6FA 3B0YA 1IXRA 3ZDEA 1H38A 1QSYA 4WC4A 3GIIA 1TFYA 5DQGA 4QZ8A 3WFQE 3PO5A 4J9MA 1Z00B 4KLTA 4DO9A 1UEUA 1WCLA 9ICFA 4R8UB 4K4HA 4WC3A 3WFRE 8ICOA 4YMMA 4GXJA 4ECUA 5J2HA 1ZYQA 4R66A 9ICHA 4FHXA 4KLSA 3M9NB 2DVIA 3OJSA 5KTQA 4R63A 2MUTB 2XY7A 2UVUA 2PFQA 2W9BB 2C2DA 2W9MA 1JQRA 4I27A 4KLEA 1UETA 1MC8A 3JPOA 4X4OA 4WC2A 3C66A 4DSFA 3MDCA 4ECTA 2UVRA 1JX4A 7ICNA 1ZQDA 4X4VA 4X4TA 4ELVA 1R89A 1TAQA 3RJKA 4YQWA 3ORYA 3SZ2A 5JUMA 3C18A 1NO5A 1ZQGA 1WOTA 4LZGA 5KFXA 2W9CA 1MIWA 4WC5A 3MDAA 2ISPA 8ICZA 4JV0A 5DG9A 3HIYA 2FPLA 4TQSA 2NRTA 4KN4A 5KFKA 4DL7A 2KFZA 3Q8KA 3BDPA 3RJJA 4K4IA 9ICAA 5HMLA 2HHWA 8ICWA 4X4RA 4JV2A 1KSPA 5KFHA 1T8EA 9ICRA 3HW8A 4I2AA 5DB8A 4UAYA 3OSPA 1JAJA 3ISDA 4DSEA 4O5KA 3OUYB 3Q8SB 3JPTA 9ICUA 5KT6A 4J9SA 5DBCA 1NK6A 3RJIA 2FPKA 4M9NA 1S0NA 3M9OB 4DWIA 5HRFA 3H8JA 3UPQA 3C2LA 1B43A 5DGAA 1K1SA 1ZQOA 3RTVA 1HJPA 3PR4A 4BXOA 1X9MA 3E2EA 1HUOA 2PI4A 4B9MA 4C8LA 4RQ1A 3PW5A 8ICAA 4RWQA 3RAQA 2F1HA 1TFWA 4RNOA 1XO1A 4F4XA 1BVSA 4XRHA 3RB4A 1S10A 1U47A 1N56A 4P4MA 3QE9Y 2VANA 1NJZA 1RYRA 1BPEA 4O9MA 4F50A 3TFRA 2C2EA 2H5XA 3GDXA 4F3OA 4RUCA 3Q8LA 5IILA 1XWLA 2HW3A 9ICPA 2F1IA 3BQ2A 2UVWA 4RQ2A 3TAQA 3HP6A 4O0IA 2UVVA 4BWJA 2XGQA 3ETLA 4F4ZA 3G6VA 2BCUA 1U4BA 1QSSA 2GWSA 1NZPA 4QWDA 4M5DA 4E8FA 1Z3EB 4DS5A 4RQ7A 5J2CA 3PX6A 3WFPA 1ZQVA 2ZHAA 4DQSA 3PW2A 1ZQHA 5IIOA 9ICXA 5DEDA 3PVXA 4RQ5A 5F9NA 2ALZA 4Z6DA 4MEYA 4X4PA 3QZ8A 4QZ9A 3RRGA 1V9PA 3MR5A 5HC9A 4K4GA 3H37A 3JPQA 4I2IA 2BPCA 3PW0A 7ICVA 4IQUA 2BE3A 2PBEA 2BPGA 1UA0A 4M47A 2VA8A 4FS1A 4DL3A 5J0QA 1SL2A 1ZQAA 3ISCA 3BQ1A 1A76A 3THVA 1L5UA 4IRCA 2KP7A 4EZ6A 3JZ0A 4ATBB 3N4MB 3RBEA 2ASLA 3PMLA 1ZQTA 3GILA 3ZDAA 4DF4A 4DF8A 8ICTA 5KFEA 4GC7A 4FS2A 2P66A 3RH4A 1BNPA 4RQ0A 4I29A 8ICYA 3Q8PB 1ZQSA 1MIYA 2KZZA 1MQ2A 4JWNA 5DECA 4YMOA 3V7KA 2M2UA 3UPSA 3H38A 1SZPA 5KG2A 4TUSA 3K75D 4Z6EA 3UXPA 1U48A 1V4AA 7ICEA 1EXNA 1D8LA 5KFIA 2Y1IA 2JZBA 3RH6A 5J0PA 4NLZA 1S0OA 1TKDA 3IM1A 4UQGA 2ZUCA 4ELUA 1HUZA 4WBYA 5KFZA 3PX0A 3RBDA 4KLQA 4O3QA 4KN7A 1JXEA 3MABA 1BPDA 1N48A 9ICCA 2LYHA 2ZH7A 4UB1A 2ZH4A 5D4BA 3EYZA 4QWBA 3Q8QB 3WFSC 2VA2A 2VA3A 9ICMA 5CP2A 5DBAA 5C5JA 1NJYA 4YFKA 4GLXA 3NYBA 4XUSA 4KLHA 1R8BA 4DEZA 3EZ5A 1NKCA 2R8IA 1L3UA 3RJHA 4M6WA 2BGWA 5KFQA 4QZEA 5DDMA 5KFNA 4DL2A 1XU4A 2R8JA 4NY8A 5KFYA 4ECVA 2J6TA 1DK2A 1JN3A 3TFSA 5DG7A 4LVSA 4AT7A 5IIJA 5KFSA 5KFMA 4KMUA 1ZQBA 8ICUA 4C8NA 1XSPA 1KLNA 1UEVA 2NRZA 4JV1A 4UAWA 5IINA 4X0AA 4YP3A 2BCSA 1U45A 4NM2A 5CHGA 2BCVA 4I2CA 4YG2A 3BQTA 1S77D 3EWAA 1JIHA 2ZUDA 8ICIA 3OVSA 4ECYA 5J2JA 2HHXA 4DLGA 4O5CA 3GIJA 3PR5B 1NKBA 3QZ7A 2AGPA 3MR3A 5HREA 4ED6A 3KHGA 4ECQA 4I2EA 3KHRA 3HJ1A 3C1ZA 1T3NA 2FMSA 5D49A 1LB2B 4F5PA 1ZQQA 2IHNA 4LT6A 4RNMA 4WBZA 2ATLA 1NJXA 5HMMA 5J2DA 4ECZA 3GQCA 4O3OA 3KHLA 4GC6A 3N97B 3RB3A 1SKWA 1ZQLA 4M9GA 1ZQXA 2ZTDA 4NXZA 4NLNA 4EBKA 4RZRA 9ICGA 4MFAA 1KEJA 4YR0A 4DOAA 4FO6A 3T5KA 4I2GA 5HRKA 1WCNA 4TUQA 5DLFA 4F2RA 2ASDA 4UB4A 2DR7A 4RQ8A 4WC1A 3BJYA 4RQ3A 4RPXA 4UBCA 4CCHA 1ZQFA 4O3RA 4UD4A 4F93B 3KTQA 4DSLA 3PV8A 4F2SA 4J9LA 3LDAA 4QWEA 1DOQA 4X5VA 2FMPA 2AQ0A 3GFKB 2AU0A 1NKEA 4C8KA 1MSWD 2ZH2A 3GIMA 4F4YA 1A77A 1QSLA 4RT3A 4AT8A 2PFPA 5KFTA 3JPNA 2DPJA 4QZGA 3C2MA 2P6RA 3PY8A 4EYIB 4IR9A 3RB0A 4PGYA 1B22A 4IG8A 7ICLA 1R8AA 4F4KA 4I2HA 3LK9A 3EPIA 3LQCB 1BNOA 3H8WA 2M9NA
chains in the Genus database with same CATH superfamily
5DLGA 2W54A 1NK9A 1T7PA 5DQHA 3SMVA 4LEYA 1QTMA 1PUZA 4OJLA 3EPGA 1RQLA 4YXMA 1C7YA 4BDPA 1SXEA 1SL1A 2HBMA 2QB1A 4WC0A 3OV7A 1OUQA 5J29A 5KFBA 4DFPA 4I2DA 9ICBA 4X0BA 2HHVA 2C28A 4CE6A 2W9CB 3SI8A 1A6SA 2H3QA 3RR7A 4B9UA 3JPPA 4Q43A 4ECWA 5KFCA 2R8KA 2K60A 3H8SA 2W8KA 2A19A 4F5RA 4ZH4A 4KLUA 2F76X 2DQNB 4XQ7A 2J6SA 4O69A 7ICIA 3TQ1A 2ZHBA 2AQ4A 2ZXHA 1QH9A 2YN4A 2RP5A 5IIKA 1Z00A 4PGXA 1J2NA 3PNCA 5J2AA 2LYAA 3AU6A 2FDRA 4R8UA 5DG8A 2Y1JA 3TADA 3V7JA 2H3IA 1B4FA 2MUTA 2OXOA 2HMXA 1D8YA 4NV0A 4MFCA 1WG8A 3O0FA 4UASA 4IRDA 2K8AA 4F92B 3SEIA 4XJEA 5IIMA 1DGSA 4WCWA 4LZDA 3HPOA 4CF4A 1IIPA 4F91B 4PL2A 1KFTA 2W3RA 5ALTA 2RFFA 4I2FA 2IMWP 5D61A 3OUYA 2RHFA 5EE3A 3RFAA 2ZJ8A 2KEYA 2ZTEA 1KKXA 4OJOA 4M9JA 5J0UA 4CGZA 4DFDA 4ZOHC 5BPCA 4NLGA 2XO7A 4F4WA 4UB6U 3Q8RB 5KFWA 4B9LA 4JK1A 1PK1A 4FHYA 2KKVA 2QKQA 4QW8A 4M6WB 1L7NA 1RXVA 5F9LA 2JEIA 4RQMA 1UA1A 1RZTA 3M8SA 3KFUF 5AIAA 4DS4A 3TANA 4ELTA 4RPYA 1ZETA 4DFKA 4UATA 3WU2U 3LWMA 4FHPA 4GXKA 1SB3C 2F1JA 4KX3A 4KB6A 2ZIWA 4QWAA 4RWOA 2V9WA 2EWRA 4WOYA 5IIIA 5HRDA 3BS7A 4ED0A 2M2TA 2LKYA 1ZQWA 2NRWA 2JEGA 3RRHA 1K1QA 1J2MA 3QU7A 5KG6A 3FDSA 8ICRA 4F72A 3QEAZ 3NWIA 9ICKA 3MCRA 2D8CA 2EZYA 1ZQMA 4FHVA 2AH5A 1TV9A 2ZHAA 1ZRNA 3IP4B 4UARA 3T5LA 3UQ2A 7ICRA 4YR2A 3L4PA 3NTUA 5J0SA 1YLQA 1NJWA 3V7LA 4PJ0U 9ICOA 4YD2A 2HHUA 9ICWA 3JPRA 2P35A 2BCQA 2KJ5A 5HR7A 3JCFA 1D8BA 1C20A 5J2GA 4AT9B 4KLLA 2JXJA 5J0RA 1TVAA 1X9WA 3CNHA 3MC1A 4I2JA 4X4UA 1D9DA 2ZXIA 1ZJMA 2BDPA 9ICEA 1L7MA 2YX8A 1NOMA 1NK5A 5J2BA 3AUOA 5ALFA 5DGBA 2PFNA 1ZQPA 4Y2UA 2KK0A 1NK0A 4UBBA 2DR8A 4BUGA 8ICGA 3PHZA 1LV5A 1UT5A 1DXSA 4NLCA 2AGOA 3V72A 3QU5A 3H4BA 5KFUA 3RH5A 1T3QA 1SXDA 3S6JA 4YMNA 4DFMA 1ZQUA 4QWCA 4WH5A 3ZDEA 4A8EA 2YB1A 4J9MA 3LVVA 4DO9A 3QXGA 2FCLA 3SD7A 2DVIA 3QX7A 3TADC 4WQLA 2UVUA 2PFQA 3R9KA 1UETA 1MC8A 4X4OA 4WC2A 2W11A 2E8MA 2EAMA 4DSFA 2KMDA 1JX4A 4YQWA 4BJQA 1ZQGA 1WOTA 2W9CA 2KIVA 4JV0A 3HIYA 2FPLA 2KFZA 4KN4A 5ALHA 3BDPA 4K4IA 1SGGA 9ICAA 4JV2A 1KSPA 9ICRA 3L3FX 5DBCA 3RJIA 4K8VA 2FPKA 1K1SA 1ZQOA 2W43A 1HJPA 2F77X 3PW5A 3WK6A 1CRXA 1BVSA 4XRHA 1RYRA 2OHFA 1X6IA 5HRHA 4P2HA 1MIVA 4O9MA 1BPEA 2JRZA 3SAHA 5ALSA 4RQ2A 3NUQA 3FM9A 1X9XA 2VKQA 4K98A 1NZPA 3K7DA 4E8FA 1ZQHA 5IIOA 3UMGA 1KW4A 3QUBA 4MEYA 3RRGA 4X4PA 5HC9A 3MR5A 4K4GA 3JPQA 4I2IA 5ALPA 1Q3UA 2BPGA 4M47A 3N4MB 1IV8A 3GILA 4DF4A 4NXWA 4GC7A 4FS2A 2HDOA 1BNPA 4RQ0A 2DUYA 2CN1A 3V7KA 4Z6EA 1U48A 1F44A 1EXNA 1DGJA 1D8LA 5KFIA 1ZD5A 5J0PA 1TKDA 1L8OA 3IM1A 1HUZA 2HOFA 1KQQA 1JXEA 9ICCA 3NRZA 3WFSC 3Q8QB 5HR6A 5AKGA 1NJYA 2Q4TA 4Y2QA 3ERCC 4M6WA 4NY8A 4DL2A 1JN3A 4OAGA 5KFSA 4Y2YA 5KFMA 2RLTA 5GTIU 4AYBC 1UEVA 2NRZA 3CYMA 1V85A 3E58A 2BCSA 1U45A 2BCVA 5H2FU 2DBYA 2LPEA 2LHTA 1IG6A 2H3FA 1CI4A 5AKXA 3KHGA 3HJ1A 2FMSA 1LB2B 3H0LB 1Z19A 4WBZA 2EQYA 1NJXA 1Z1VA 5J2DA 1SKWA 4NXZA 2ZTDA 2EZZA 4KX5A 3T5KA 4I2GA 5HRKA 2HN1A 1WCNA 1HEKA 4WC1A 3BJYA 2HBLA 5G5GA 4O3RA 1AQ6A 4DSLA 3PV8A 2AQ0A 5AKLA 2AU0A 2ZH2A 3D2QA 1JUDA 4NWIA 2P6RA 4IR9A 3RB0A 7ICLA 2W04A 5B5EU 4C4RA 1SIJA 3LQCB 3D6JA 3K1RB 8ICBA 1D9FA 1PK3A 4S3NA 2Q66A 4DOCA 4ED3A 3H0MB 4X4QA 1UQVA 4AT9A 1PVPA 4PGQA 5AKIA 4O3SA 7ICPA 8ICKA 3QUCA 3OVAA 1Q46A 8ICFA 1ZD3A 3GV8B 1X66A 1DK3A 2LMRA 1SWVA 4JWMA 3LYSA 5KG3A 7ICQA 4KLIA 2W9AA 4J9QA 4RWNA 3PX4A 4GFJA 2QARB 2FLPA 3IG8A 5AKYA 5KG1A 1IM4A 2JEJA 2RRDA 4O3MA 4HX0A 4O67A 2WB1C 4J9OA 1KNYA 2ZIXB 2BCRA 2HN2A 1BPZA 4BXOB 4FFDA 3MGVA 4UAVA 4TQRA 2A3VA 2ZIVB 4F71A 2DR5A 5HRGA 5KG7A 3MFHA 2RDJA 4F5QA 3PW4A 4C8OA 4J9NA 4KMOB 2KZMA 2BQUA 1BGXT 2BDUA 5JRTA 5EOZA 2HOQA 8ICSA 1GO3F 4PH5A 4XQ8A 2E3TA 5G5HA 2AGQA 2WF8A 3RR8A 5D63A 2KVSA 2M2WA 5C0YA 3V6HA 2K8BB 3TACB 3ER9B 3C21A 4WQKA 4OO1J 1KDHA 4Y2TA 4RQ4A 3N7PD 2IA6A 1ZQ1C 4CRXA 2MAXA 4WC7A 2G5HB 3N28A 1SWWA 5ALLA 3FC4A 2K4PA 3F2DA 5ALGA 1F5AA 2NO5A 4ED7A 4QIWC 2HBJA 4LEWA 5HP4A 1X42A 2W03A 5HRBA 4O5EA 5AI0A 3U26A 2JGAA 4X4SA 1KFSA 5CFTA 2JZBB 2DGZA 4QZIA 4EBCA 2OH2A 3TAPA 4NL9A 1TAMA 3C2KA 1NK7A 1KBUA 2DRBA 4TURA 3L5KA 5KFPA 4RT2A 4O3NA 1GPJA 2K89A 5AKEA 3G6YA 1X6JA 2ZH6A 2EANA 5HR9A 9ICVA 5JU5A 5ALEA 1X9SA 1S0MA 1L8LA 2KHVA 3MR2A 4K97A 1RDFA 2DFLA 3GZFA 1OW5A 2C2RA 4B9VA 3RF9A 4MF2A 5KFJA 4PL1A 5KT7A 3AQFA 2G09A 5KFLA 7ICJA 4NM1A 1SKRA 4RWPA 3AU2A 4UAZA 3WKBA 4QJFB 2GOLA 4C8MA 3OHBA 3BQ0A 2NRXA 3K4GA 1QCKA 2DPIA 2WTFA 8ICEA 3QUTA 5J2KA 3BZKA 1JXLA 3HJEA 4F8RA 5CA7A 3SV4A 1NK8A 2Q0ZX 4DSIA 1RYUA 1B0XA 2C22A 1S9FA 1Q8KA 5HRIA 1RG6A 3F5EA 4EEYA 1ZQCA 1JI7A 4KLJA 4X4NA 1BPBA 2ZJAA 3GIKA 3I76A 1ZRMA 5JTIA 5EWEA 4AT8B 2Y0SF 4FHWA 3C1YA 2IBKA 4NXXA 4K9AA 3WK4A 4BGDA 1ZQNA 5J2IA 3SYZA 1P7DA 5ALYA 1N63A 2NYVA 3OTQA 5ALOA 1FFUA 2KN7A 5KT3A 2HVHA 3ZDBA 3CK6A 2XY6A 4Q8FA 4NXVA 5BOLA 3LWLA 2V4QA 4Y2XA 3MGIA 4EELA 4PPXA 3KBBA 1AROP 1ZD4A 4EZ9A 5L1KA 4ECXA 2FJ6A 2B6GA 4EX7A 1SKSA 3M8RA 4EX6A 3M9MB 3AQNA 4EP7A 3MBYA 5J8YA 4DSJA 7ICOA 4NKUA 4EBDA 1TFRA 2B21A 3SV3A 2ZH5A 4P0QB 4KLGA 4Z6CA 1S0VA 2FMQA 3NS1A 2XC9A 3C28A 1TK0A 1KRPA 1U49A 1N5XA 1VLBA 2WAQC 5AI5A 1IXRA 1H38A 4WC4A 1TFYA 4IC9A 2WF9A 5DQGA 2CRXA 4QZ8A 3WFQE 9ICFA 4WC3A 1N61A 4ECUA 3TKAA 2WFAA 2KJ9A 4KLSA 3OJSA 5KTQA 2XY7A 2HOIA 2C2DA 2W9MA 4KLEA 2VJ5A 1FIQA 3MDCA 1KN5A 7ICNA 4X4VA 3SAGA 1TAQA 5AM4A 3C18A 4LZGA 1MIWA 8ICZA 2ZG6A 2NRTA 2QARA 3AN1A 3J81j 4X4RA 5HMLA 2HHWA 5AI4A 1QQ6A 3HW8A 4I2AA 4LJXA 2G07A 2H3VA 3ISDA 3HKZC 3DEEA 1NK6A 2ZIXA 1S0NA 1Z4NA 3SENA 3PR4A 4BXOA 2WF7A 3M6KA 4C7YA 4B9MA 4Y2RA 3RAQA 5ALZA 1PVQA 1XO1A 2ZIVA 1N56A 3RB4A 2IUBA 3QE9Y 3NVWA 2H5XA 2HW3A 4RUCA 1ZOLA 2W7PA 3TAQA 2KJ8A 2QLTA 2UVVA 4BWJA 4F4ZA 3G6VA 2BCUA 2E1EA 1J97A 1XNSA 5J2CA 3PX6A 3PW2A 1XO0A 2D3DA 2KD1A 5F9NA 2ES6A 3QZ8A 5CFSA 3ED5A 3PW0A 1NI3A 1DRGA 2VA8A 4NKTA 5J0QA 2KP7A 3ISCA 3THVA 2PMZF 4P0PB 4ATBB 4K96A 3AEVA 2ASLA 4FZMA 3QU2A 1ZQSA 3QU4A 1MQ2A 4JWNA 5DECA 2M2UA 5JTGA 1LKYB 3UPSA 1SZPA 5ALWA 2BBJA 4TUSA 2I5HA 3UXPA 7ICEA 2LBOA 3RH6A 2JZBA 5FP0A 4NXUA 4OD0A 5KFZA 4OAHA 4KLQA 4O3QA 3F5AA 5ALKA 3MABA 4IS7A 4UB1A 4JB3A 5AHXA 3CRXA 2K4EA 3D2SA 2R8IA 2BGWA 2O6KA 4QZEA 3A0HU 1COKA 5KFNA 1XU4A 2KKPA 4ECVA 3TFSA 4AYBF 1UHUA 5IIJA 4C8NA 1XSPA 3N7SC 5CHGA 3SR6A 4ECYA 4DLGA 5CFUA 1NKBA 2AGPA 2BZFA 3C1ZA 1WWVA 4F5PA 2IHNA 5HMMA 4ECZA 3GQCA 4O3OA 3KHLA 3RB3A 1ZQLA 3BS5B 2NO4A 2EDUA 4YR0A 3WKEA 5DLFA 4F2RA 4K99A 3OWGA 5J8YC 4RPXA 4OAIZ 4F93B 4F2SA 1DOQA 2FMPA 3GFKB 1A77A 4AT8A 5AK6A 5KFTA 2YY6A 4ACOA 3C2MA 3PZPA 3PY8A 4PGYA 2YQEA 2F2AB 5CHEA 2IOHA 3H8WA 2M9NA 2B51A 4EBKA 4QZCA 2HVIA 2HCFA 2BQRA 2F44A 2V4RA 5J0OA 7ICTA 4C4SA 1YZ7A 3WKAA 8ICLA 2LI6A 4U6PA 4R65A 8ICMA 3KHHA 2DF4B 7ICGA 1KL9A 4HAIA 3T5HA 3AL0B 7ICUA 2DR9A 4M0AA 1RQNA 1NZBA 2HHPA 4IQVA 3C5GA 4E80A 2ID1A 3DDHA 2BQ3A 1VJ7A 5DDYA 3F2BA 3NGDA 2BHNA 4PHEA 3SAFA 2P6UA 5AI6A 3EW9A 2RQ5A 4Q8EA 2VJ4A 3OJUA 8ICCA 4US9A 5KFVA 4P0QA 4EEDA 3RJFA 5KFDA 4FZNA 4O3PA 1MN8A 1SZHA 4KLOA 2ZTCA 4YR3A 2HHQA 1TK5A 8ICXA 5GTHU 5KT5A 3WKCA 2XY5A 1WUDA 2AJQA 1R8CA 4IQWA 4MEXA 1VFGA 5AKHA 4PHPA 3ZI4A 2D6FC 2DRAA 1T94A 4KLDA 1M6YA 5EWFA 5L1JA 4FBTA 3IRUA 1T4GA 2MRLA 3F53A 4UB3A 1WYGA 4DLEA 4PHDA 4QIWF 5KG0A 5KFFA 5J0TA 4F5OA 4ED1A 5J2EA 2GO7A 3K1ZA 5L1IA 4YD1A 4O6AA 3ZDCA 3V6KA 2OWOA 4RUAA 2JHDA 3UQ0A 9ICTA 5TISU 4J9RA 5DB7A 4DL4A 4B9TA 1V97A 4GIBA 2KE7A 3A0BU 4KITB 3QEBZ 2IHMA 3B0XA 2ZH8A 3AM9A 3HILA 3ETRA 3ZDDA 5ALDA 2ZUBA 3JPSA 1BPXA 3IHQB 3NASA 2O5AA 3M6ZA 2R8HA 9ICSA 4F5NA 1Y88A 4YCXA 3OHAA 4O68A 2BPFA 3HWTA 2GA9D 5AK5A 3G6XA 4LEVA 5A0LA 4I2BA 4P0PA 4ATBA 2OCEA 4M04A 1ZQZA 1NK4A 4ED8A 4BWMA 2WF5A 4FZLA 1S97A 3WK7A 5J0YA 2KTQA 2BR0A 4YXJA 2KNJA 4QZDA 2RDIA 3FAHA 1ED1A 4YN4A 1ZQIA 2DKZA 1LKYA 9ICNA 2M0NA 5ALRA 4DQQA 5ALUA 5KG4A 2F8KA 5AKKA 3UXNA 4R64A 4IRKA 5E79U 4NLBA 4NLKA 1TAUA 4I0UA 3L9DA 5TZVA 2BKEA 1FFVA 3RJGA 2Z7JA 3GV5B 4C4TA 1Q3VA 3PW7A 4UB5A 2K8CB 4Y2JA 3GV7B 2KIWA 4UD5A 4C0ZA 5DQIA 2O1PA 1CEZA 2FPMA 2QB0B 5B66U 5L9XA 5KFOA 2E8PA 1LVHA 1PVRA 3OVBA 8ICVA 3HX0A 1COOA 1ZQEA 3ZD8A 4KLFA 2PXIA 5DBBA 2MSNA 2JH1A 4UB2A 3E0FA 2A1JB 3ONNA 3ZD9A 4FBUA 4XA5A 5AM5A 4USAA 3MGHA 9ICIA 4DQPA 5EE1A 4QZHA 4J9KA 1RPLA 3BS5A 1ZQJA 3H7IA 1ZXIA 4DL5A 3H0RB 5KAFU 4JLZA 4QZAA 5CJ7A 4EGWA 3C23A 3HT3A 4DFJA 1F0MA 2G0AA 4MFFA 4B9NA 2ZH9A 1Q79A 4UB8U 5AIBA 3AQMA 5DB6A 3RJEA 2XIDA 2KVCA 2J6UA 1TK8A 1QSYA 3GIIA 3CW2C 2ZIUB 3KOOA 3PO5A 4K4HA 1Z4OA 8ICOA 1ZYQA 4R66A 5EE0A 1YZ6A 2W9BB 2GAFD 2KG5A 3IDWA 3JPOA 1ZQDA 4ELVA 4CF3A 3ORYA 5JUMA 3HRDD 3AMZA 5KFXA 2KICA 5DG9A 2WHEA 4DL7A 3OSPA 4UAYA 4DSEA 3WK9A 2YMPA 4EV6A 5ALMA 5KT6A 3WKDA 4M9NA 3M9OB 2B4VA 5HRFA 3UPQA 5ALXA 1B43A 3C2LA 5DGAA 1X9MA 2PI4A 4C8LA 8ICAA 4Y2PA 3C29A 2HBKA 4RNOA 1S10A 1U47A 1PX5A 3Q8LA 5IILA 1XWLA 2F1IA 4O0IA 3ETLA 1U4BA 5KL8B 2GWSA 4QWDA 4DS5A 5DEDA 9ICXA 2AXTU 4Z6DA 4QZ9A 3H37A 2KHQA 2PBEA 5K4LA 1JROA 7ICVA 4DL3A 4FS1A 3BQ1A 1A76A 3UMBA 3JZ0A 4EZ6A 3RBEA 3PMLA 1ZQTA 2P66A 4I29A 5CRXA 8ICYA 2MU2A 2EAOA 1MIYA 4YMOA 1YT3A 1N62A 5KG2A 1QQ7A 3VC8A 1UCVA 3K75D 4PZOA 1V4AA 4NLZA 2Y1IA 1S0OA 3RBDA 2ZH4A 5D4BA 4UW9A 4FE3A 2VA2A 2VA3A 5DBAA 4YFKA 3IG5A 4KLHA 1R8BA 4DEZA 3EZ5A 5KL1B 1L3UA 5KFQA 3KZIU 5DDMA 3VCBA 2R8JA 1JRPA 1DK2A 3I1YA 5DG7A 3PSTA 1ZQBA 4PZNA 1HIWA 1KLNA 4JV1A 4YP3A 4NM2A 4CF5A 4YG2A 3BQTA 1S77D 3KZXA 4AP9A 5J2JA 2HHXA 3GIJA 3PR5B 3QZ7A 4EEBA 3MR3A 5HREA 5F3XB 4ED6A 4ECQA 1T3NA 4EENA 3NKUA 4RNMA 3N97B 4M5DA 4GC6A 1ZQXA 4RZRA 2YMQA 4UB4A 2DR7A 3NVYA 4RQ3A 4UBCA 4KM5A 3KKAA 4UD4A 2CPRA 3KTQA 4J9LA 3LDAA 4C8KA 1MSWD 3GIMA 5ALIA 4WJ3B 5ALJA 2PFPA 3PSIA 1WWUA 2JV3A 4QZGA 1B22A 4FO1A 4IG8A 2QB0A 3EPIA 2MA1A 1BNOA 4M2YA 1L3VA 2DKXA 3ALRA 4IQTA 2KZ3A 2W8LA 4RQNA 1ZQKA 2HHTA 4NL9C 2JH7A 5HHIA 3HJ4A 3I28A 4E0DA 2A1JA 3TARA 4IR1A 2XCAA 5CEHA 3IN5A 4DL6A 4EYHB 2EAPA 1ZQRA 4WC6A 4CDGA 4QNLA 3KD3A 2NV3A 4EEKA 1ZQYA 1KTQA 2LYBA 3T5JA 2R8GA 2WF6A 3BZCA 1L6NA 2ISOA 1MQ3A 1X40A 4DSKA 1PZNA 4HYKA 1FO4A 1MA7A 3JYYA 4OJ6A 2E1FA 4G9BA 2Y0SC 4ICAA 3UXOA 3NVOA 1XS9D 2PI5A 2PFOA 3UMCA 5D46A 2KOBA 2PKEA 4YVZA 2FLLA 3AQKA 1V38A 1RXWA 4MF8A 2DWQA 2ZIUA 2ZJ5A 1S76D 1QQ5A 4PHAA 8ICPA 9ICQA 2K4HA 5J0XA 4N7RA 3B9JA 5AM3A 2W9BA 5BOMA 1BPYA 3T79A 5J0WA 1KFDA 5KT2A 8ICQA 2LM4A 3MFIA 2FI1A 2BBHA 2OM6A 4DOBA 7ICHA 5HRLA 2E8OA 3Q8MA 5KT4A 1XC9A 4TUPA 2YB4A 1X2IA 4ECRA 7ICKA 4RQ6A 3CP8A 3NVVA 4JUZA 1O03A 1CUKA 5KFGA 4ECSA 5T14A 2E8NA 2KV2A 4P4OA 3TI0A 2K4IA 1L3TA 3QUQA 2KFNA 4ED2A 3DV9A 1L3SA 4DQIA 1U9LA 4K9BA 5KNIA 1XSLA 4M9LA 5CB1A 4EBJA 2M2VA 1UT8A 7ICFA 1QLNA 4J9PA 2VIXA 1FEZA 2G5IB 2CXYA 5DKWA 4FH5A 1SV4A 1VJ5A 4Q45A 2E5SA 3C5FA 4UAUA 2HHSA 2IOFA 1ZD2P 1RYSA 5AK3A 4QZBA 3PMNA 4B9SA 5KAIU 2JR5A 2JMGA 4U7CA 4AT7B 4JLXA 3F2CA 1JMSA 4GXIA 1F5SA 3H40A 2Y9UA 1OXJA 2ZH1A 2I9GA 4OCZA 5AK4A 4DQRA 5EWGA 1Q78A 4KLMA 3H39A 4QZFA 5L1MA 2I1QA 9ICJA 4G3IA 1FA0A 4E7XA 4P4PA 3M1YA 3PSFA 5AI9A 5AM2A 2XICA 2KSOB 4RU9A 3AQLA 3UM9A 1OU5A 2ZH3A 5HHHA 5DB9A 5J2FA 1N2XA 4NJ8A 2NRKA 3KKAC 3OSNA 9ICLA 5KFRA 4C80A 4C7ZA 5KFAA 3RB6A 2WB1F 2HI0A 5CWRA 3GU3A 4Q44A 3QNMA 2F3NA 8ICHA 3ICXA 3V6JA 3FYHA 7ICSA 3T3FA 4LEZA 4RNNA 3H3AA 2Y9TA 2YTUA 1NNLA 2XVTA 2PMZC 3H8MA 5ALQA 2JEFA 8ICNA 1ZJNA 2NRVA 3RAXA 2B0CA 3N7RC 5KG5A 3ISBA 3H4DA 2ASJA 5CR0A 5B3PA 4QW9A 1SL0A 2A1AA 4FH3A 2FLNA 1XSNA 3QU9A 1A0PA 4KTQA 4CNQA 2XCPA 3WFOA 1Z1BA 1SV0A 4M9HA 5L1LA 5HNKA 4I28A 2XGPA 5F2VO 7ICMA 3OGUA 1N5WA 4EBEA 2EH9A 8ICJA 4RPZA 5B3QA 4IL6U 1S8OA 3MR6A 3PO4A 3IV6A 1L7PA 1RM6C 2I6XA 4Z6FA 2OYYA 3B0YA 3WK5A 4B6JA 2LM1A 2W55A 2R18A 3ER8C 2YMLA 1Z00B 4KLTA 1UEUA 4BX9C 1WCLA 4R8UB 3WFRE 4YMMA 3WK8A 4GXJA 5J2HA 9ICHA 4FHXA 3M9NB 4R63A 2MUTB 1N60A 1JQRA 4I27A 2L5YA 1L7OA 4ECTA 2UVRA 4JMUA 5ALVA 5EE9A 4X4TA 1R89A 3RJKA 3SZ2A 3M7DA 1NO5A 2GLEA 5D62A 2YMMA 4WC5A 3LVWA 3MDAA 2ISPA 3PSPA 4TQSA 5KFKA 3Q8KA 3RJJA 2GH1A 5AKZA 8ICWA 5KFHA 2AHOB 1T8EA 1JAJA 5DB8A 4O5KA 3OUYB 2H3ZA 3Q8SB 1URJA 3JPTA 9ICUA 4J9SA 3NVZA 4DWIA 3H8JA 3RTVA 2DL0A 3E2EA 1HUOA 5AKJA 4RQ1A 4RWQA 2F1HA 1TFWA 4F4XA 4P4MA 2VANA 1NJZA 2F8LA 2W7OA 4F50A 3TFRA 3GDXA 2C2EA 4F3OA 9ICPA 3BQ2A 2UVWA 2G06A 3HP6A 1PK1B 2XGQA 1QSSA 4Y2SA 4US8A 5AI8A 3OPXA 1Z3EB 4RQ7A 3WFPA 1ZQVA 4DQSA 2FE9A 3PVXA 4RQ5A 2ALZA 2W3SA 1V9PA 2B56A 2BPCA 2BE3A 2IOFK 4IQUA 3NRWA 1UA0A 1SL2A 1ZQAA 1L5UA 4IRCA 1ECWA 3QYPA 3ZDAA 1UPHA 4DF8A 8ICTA 5KFEA 3RH4A 2ZIWB 4OJPA 3Q8PB 2KZZA 3H38A 5AICA 2XI9A 2ODGA 4UQGA 2ZUCA 4ELUA 4WBYA 4NXTA 3PX0A 4KN7A 1BPDA 1N48A 2LYHA 2ZH7A 3EF2A 3EYZA 4QWBA 3SQIA 9ICMA 5CP2A 5C5JA 4GLXA 3NYBA 4XUSA 1NKCA 4OAFA 3RJHA 5KFYA 2WAQF 2J6TA 4AT7A 4LVSA 4KMUA 8ICUA 4UAWA 5IINA 4X0AA 4I2CA 3EWAA 1JIHA 2ZUDA 8ICIA 3OVSA 3D2NA 4O5CA 1JALA 4I2EA 2N1RA 3KHRA 1VDVA 3AQEA 5D49A 1ZQQA 5AM0A 4DCCA 4LT6A 2ATLA 4M9GA 1K5OA 2IHOA 4NLNA 2KSOA 9ICGA 4MFAA 1KEJA 4FO6A 4DOAA 1S5LU 4TUQA 4J03A 2ASDA 4OJ5A 4RQ8A 5ALNA 2ESEA 1SV0C 4CCHA 1ZQFA 4MHVA 2G08A 2HSZA 4QWEA 4MKPA 4X5VA 2EZXA 1O08A 1NKEA 4F4YA 5AM1A 1QSLA 4RT3A 3BQ7A 1TE2A 3HKZF 4Y2VA 3EUB2 3JPNA 2DPJA 4EYIB 2OEHA 1R8AA 4F4KA 4I2HA 3LK9A 3C66A
chains in the Genus database with same CATH topology
4QZCA 5DLGA 2HVIA 2BQRA 8ICBA 1NK9A 1D9FA 4IQTA 2KZ3A 2V4RA 5J0OA 1T7PA 4S3NA 2W8LA 2HHTA 1ZQKA 7ICTA 2Q66A 5DQHA 8ICLA 5HHIA 4DOCA 4R65A 4ED3A 3HJ4A 4X4QA 4AT9A 8ICMA 4PGQA 3KHHA 1QTMA 4E0DA 7ICGA 4O3SA 3EPGA 2A1JA 3TARA 4IR1A 2XCAA 3T5HA 7ICUA 4YXMA 4M0AA 7ICPA 2DR9A 1C7YA 4DL6A 4BDPA 8ICKA 4EYHB 1ZQRA 4WC6A 1MIVA 1SL1A 4WC0A 3OVAA 2HHPA 4IQVA 3OV7A 5J29A 3C5GA 5KFBA 8ICFA 1ZQYA 4DFPA 4E80A 4I2DA 9ICBA 1KTQA 3GV8B 3T5JA 2BQ3A 2HHVA 2R8GA 2C28A 1DK3A 1VJ7A 2ID1A 5DDYA 3NGDA 2ISOA 5KG3A 4JWMA 2W9CB 7ICQA 3SI8A 2BHNA 4KLIA 2W9AA 3RR7A 4PHEA 4B9UA 4J9QA 1MQ3A 4RWNA 3JPPA 3PX4A 4DSKA 2P6UA 2FLPA 1PZNA 4HYKA 1L3VA 5KG1A 3EW9A 4Q8EA 4Q43A 1IM4A 4ECWA 2JEJA 5KFCA 2R8KA 3JYYA 3OJUA 8ICCA 5KFVA 3UXOA 1XS9D 3H8SA 2PI5A 3RJFA 4J9OA 1KNYA 2PFOA 2W8KA 5KFDA 4F5RA 4O3PA 2BCRA 4ZH4A 4KLOA 4KLUA 5D46A 2ZTCA 4YR3A 1BPZA 4BXOB 4XQ7A 1PX5A 2J6SA 1TK5A 2HHQA 8ICXA 4TQRA 4YVZA 2FLLA 7ICIA 3TQ1A 2ZHBA 5KT5A 2AQ4A 3AQKA 2DR5A 1RXWA 5HRGA 4MF8A 5KG7A 2ZJ5A 2XY5A 5IIKA 3PNCA 1Z00A 4PGXA 3MFHA 1S76D 5J2AA 2AJQA 4X4NA 1R8CA 4PHAA 2RDJA 4R8UA 3AU6A 4F5QA 3PW4A 4MEXA 4IQWA 8ICPA 5DG8A 5J0XA 4C8OA 4J9NA 9ICQA 1VFGA 4PHPA 2Y1JA 2KZMA 2BQUA 1BGXT 5EOZA 8ICSA 3V7JA 2DRAA 2MUTA 4PH5A 4XQ8A 2AGQA 3RR8A 2W9BA 4KLDA 5BOMA 1BPYA 2M2WA 3V6HA 5J0WA 1D8YA 1KFDA 5KT2A 8ICQA 5EWFA 4MFCA 3MFIA 5L1JA 3C21A 4DOBA 7ICHA 4FBTA 1KDHA 4IRDA 5HRLA 4RQ4A 4F92B 3Q8MA 2IA6A 5KT4A 5IIMA 1DGSA 1XC9A 1T4GA 2MAXA 4WCWA 4TUPA 1X2IA 4WC7A 4ECRA 7ICKA 4RQ6A 4UB3A 4LZDA 3HPOA 4PHDA 4DLEA 4JUZA 1CUKA 5KG0A 4F91B 5KFGA 5KFFA 5J0TA 4ECSA 4ED7A 1F5AA 4F5OA 1KFTA 4P4OA 5HP4A 3TI0A 1L3TA 4ED1A 2KFNA 2RFFA 4I2FA 4ED2A 2IMWP 5J2EA 5HRBA 5L1IA 4O5EA 3OUYA 4YD1A 1L3SA 4DQIA 1U9LA 3ZDCA 4X4SA 2ZJ8A 1KFSA 3V6KA 4NKTA 2OWOA 1XSLA 4RUAA 2JZBB 3UQ0A 4M9LA 5CB1A 9ICTA 4EBJA 2ZTEA 2M2VA 1UT8A 4QZIA 4J9RA 4EBCA 4M9JA 7ICFA 5DB7A 5J0UA 4DL4A 1QLNA 4B9TA 4J9PA 4KITB 3TAPA 3QEBZ 2IHMA 5BPCA 4FH5A 5DKWA 4NLGA 2XO7A 3B0XA 2ZH8A 4F4WA 4Q45A 3C2KA 3C5FA 1NK7A 2DRBA 4TURA 3Q8RB 5KFPA 5KFWA 4O3NA 4RT2A 3ZDDA 4B9LA 4JK1A 2HHSA 3G6YA 4FHYA 1RYSA 2ZUBA 5HR9A 3JPSA 2ZH6A 9ICVA 1BPXA 3IHQB 4QW8A 4M6WB 4QZBA 9ICEA 3PMNA 1X9SA 1RXVA 1S0MA 5F9LA 2R8HA 4B9SA 2JEIA 2O5AA 3MR2A 4AT7B 2DFLA 9ICSA 4X0BA 4F5NA 1JMSA 1Y88A 4GXIA 2C2RA 4YCXA 1UA1A 4B9VA 4MF2A 3OHAA 5KFJA 1RZTA 3H40A 3M8SA 2BPFA 3HWTA 5KT7A 5KFLA 2ZH1A 3G6XA 4DS4A 2I9GA 3TANA 4ELTA 7ICJA 4NM1A 4DQRA 5EWGA 4RPYA 1ZETA 4DFKA 1SKRA 4I2BA 4M04A 4KLMA 1ZQZA 1Q78A 3AU2A 4UAZA 4ED8A 1NK4A 4BWMA 3H39A 4RWPA 3LWMA 4QZFA 4GXKA 5J0YA 1S97A 2BR0A 2KTQA 4FHPA 2F1JA 4YXJA 2I1QA 4C8MA 9ICJA 3OHBA 2NRXA 3K4GA 4QZDA 3BQ0A 4G3IA 2RDIA 2DPIA 4YN4A 4QWAA 1ZQIA 2WTFA 1FA0A 4RWOA 2V9WA 8ICEA 4E7XA 4P4PA 5J2KA 5IIIA 9ICNA 4ATBA 5HRDA 1JXLA 4DQQA 4F8RA 4RU9A 5CA7A 4ED0A 3SV4A 3AQLA 5KG4A 2M2TA 1NK8A 1ZQWA 1OU5A 2Q0ZX 2NRWA 4DSIA 2ZH3A 5HHHA 2JEGA 5DB9A 2C22A 5J2FA 3RRHA 1S9FA 3UXNA 2NRKA 4R64A 4IRKA 5HRIA 3OSNA 1K1QA 4EEYA 4NLKA 1TAUA 1ZQCA 5KFRA 5KG6A 4KLJA 3FDSA 2BKEA 5TZVA 3RJGA 9ICLA 3L9DA 3GV5B 8ICRA 1BPBA 2ZJAA 3QEAZ 3GIKA 3PW7A 4UB5A 5EWEA 9ICKA 4AT8B 5HRHA 4FHWA 3GV7B 3C1YA 2IBKA 1ZQMA 5KFAA 3RB6A 4UD5A 5DQIA 4FHVA 4BGDA 1TV9A 1ZQNA 5CWRA 1CEZA 2FPMA 5J2IA 4P2HA 7ICRA 2O1PA 3T5LA 4Q44A 3UQ2A 4YR2A 3NTUA 5J0SA 3SYZA 8ICHA 1YLQA 1NJWA 3V7LA 9ICOA 4YD2A 2HHUA 3V6JA 9ICWA 3JPRA 3FYHA 5L9XA 2BCQA 7ICSA 3T3FA 5KFOA 4RNNA 3H3AA 3OVBA 2KN7A 8ICVA 3HX0A 5KT3A 1COOA 1ZQEA 3ZD8A 5J2GA 4M2YA 2HVHA 4AT9B 4KLFA 2PXIA 4KLLA 3ZDBA 2JEFA 5DBBA 5J0RA 2XY6A 8ICNA 1ZJNA 4UB2A 2NRVA 5BOLA 3RAXA 3LWLA 2A1JB 2V4QA 4Q8FA 3MGIA 3ZD9A 5KG5A 1TVAA 4PPXA 1X9WA 3ISBA 1AROP 3H4DA 2ASJA 4I2JA 4X4UA 1D9DA 4XA5A 1ZJMA 2BDPA 5L1KA 4FBUA 5CR0A 4ECXA 3MGHA 4EZ9A 4DQPA 4QW9A 9ICIA 4QZHA 1SL0A 1NOMA 1RPLA 4J9KA 1NK5A 1SKSA 1ZQJA 5J2BA 3AUOA 4FH3A 3H7IA 2FLNA 1XSNA 3M8RA 4DL5A 5DGBA 4KTQA 2XCPA 3M9MB 3AQNA 4EP7A 2PFNA 3WFOA 1ZQPA 3MBYA 4QZAA 1NK0A 4DSJA 7ICOA 5CJ7A 4EBDA 4M9HA 4NKUA 1TFRA 3C23A 5L1LA 5HNKA 2B21A 3HT3A 4I28A 4UBBA 2XGPA 2DR8A 4DFJA 8ICGA 1LV5A 5F2VO 4MFFA 4B9NA 7ICMA 2ZH9A 3SV3A 3OGUA 4EBEA 2ZH5A 1Q79A 4KLGA 1UT5A 8ICJA 3AQMA 4Z6CA 2AGOA 2FMQA 3V72A 1S0VA 5DB6A 4RPZA 2XC9A 3MR6A 3H4BA 1TK0A 5KFUA 3RH5A 1KRPA 3RJEA 1U49A 3PO4A 4YMNA 4DFMA 1ZQUA 4QWCA 2J6UA 1TK8A 4Z6FA 3B0YA 1IXRA 3ZDEA 1H38A 1QSYA 4WC4A 3GIIA 1TFYA 5DQGA 4QZ8A 3WFQE 3PO5A 4J9MA 1Z00B 4KLTA 4DO9A 1UEUA 1WCLA 9ICFA 4R8UB 4K4HA 4WC3A 3WFRE 8ICOA 4YMMA 4GXJA 4ECUA 5J2HA 1ZYQA 4R66A 9ICHA 4FHXA 4KLSA 3M9NB 2DVIA 3OJSA 5KTQA 4R63A 2MUTB 2XY7A 2UVUA 2PFQA 2W9BB 2C2DA 2W9MA 1JQRA 4I27A 4KLEA 1UETA 1MC8A 3JPOA 4X4OA 4WC2A 3C66A 4DSFA 3MDCA 4ECTA 2UVRA 1JX4A 7ICNA 1ZQDA 4X4VA 4X4TA 4ELVA 1R89A 1TAQA 3RJKA 4YQWA 3ORYA 3SZ2A 5JUMA 3C18A 1NO5A 1ZQGA 1WOTA 4LZGA 5KFXA 2W9CA 1MIWA 4WC5A 3MDAA 2ISPA 8ICZA 4JV0A 5DG9A 3HIYA 2FPLA 4TQSA 2NRTA 4KN4A 5KFKA 4DL7A 2KFZA 3Q8KA 3BDPA 3RJJA 4K4IA 9ICAA 5HMLA 2HHWA 8ICWA 4X4RA 4JV2A 1KSPA 5KFHA 1T8EA 9ICRA 3HW8A 4I2AA 5DB8A 4UAYA 3OSPA 1JAJA 3ISDA 4DSEA 4O5KA 3OUYB 3Q8SB 3JPTA 9ICUA 5KT6A 4J9SA 5DBCA 1NK6A 3RJIA 2FPKA 4M9NA 1S0NA 3M9OB 4DWIA 5HRFA 3H8JA 3UPQA 3C2LA 1B43A 5DGAA 1K1SA 1ZQOA 3RTVA 1HJPA 3PR4A 4BXOA 1X9MA 3E2EA 1HUOA 2PI4A 4B9MA 4C8LA 4RQ1A 3PW5A 8ICAA 4RWQA 3RAQA 2F1HA 1TFWA 4RNOA 1XO1A 4F4XA 1BVSA 4XRHA 3RB4A 1S10A 1U47A 1N56A 4P4MA 3QE9Y 2VANA 1NJZA 1RYRA 1BPEA 4O9MA 4F50A 3TFRA 2C2EA 2H5XA 3GDXA 4F3OA 4RUCA 3Q8LA 5IILA 1XWLA 2HW3A 9ICPA 2F1IA 3BQ2A 2UVWA 4RQ2A 3TAQA 3HP6A 4O0IA 2UVVA 4BWJA 2XGQA 3ETLA 4F4ZA 3G6VA 2BCUA 1U4BA 1QSSA 2GWSA 1NZPA 4QWDA 4M5DA 4E8FA 1Z3EB 4DS5A 4RQ7A 5J2CA 3PX6A 3WFPA 1ZQVA 2ZHAA 4DQSA 3PW2A 1ZQHA 5IIOA 9ICXA 5DEDA 3PVXA 4RQ5A 5F9NA 2ALZA 4Z6DA 4MEYA 4X4PA 3QZ8A 4QZ9A 3RRGA 1V9PA 3MR5A 5HC9A 4K4GA 3H37A 3JPQA 4I2IA 2BPCA 3PW0A 7ICVA 4IQUA 2BE3A 2PBEA 2BPGA 1UA0A 4M47A 2VA8A 4FS1A 4DL3A 5J0QA 1SL2A 1ZQAA 3ISCA 3BQ1A 1A76A 3THVA 1L5UA 4IRCA 2KP7A 4EZ6A 3JZ0A 4ATBB 3N4MB 3RBEA 2ASLA 3PMLA 1ZQTA 3GILA 3ZDAA 4DF4A 4DF8A 8ICTA 5KFEA 4GC7A 4FS2A 2P66A 3RH4A 1BNPA 4RQ0A 4I29A 8ICYA 3Q8PB 1ZQSA 1MIYA 2KZZA 1MQ2A 4JWNA 5DECA 4YMOA 3V7KA 2M2UA 3UPSA 3H38A 1SZPA 5KG2A 4TUSA 3K75D 4Z6EA 3UXPA 1U48A 1V4AA 7ICEA 1EXNA 1D8LA 5KFIA 2Y1IA 2JZBA 3RH6A 5J0PA 4NLZA 1S0OA 1TKDA 3IM1A 4UQGA 2ZUCA 4ELUA 1HUZA 4WBYA 5KFZA 3PX0A 3RBDA 4KLQA 4O3QA 4KN7A 1JXEA 3MABA 1BPDA 1N48A 9ICCA 2LYHA 2ZH7A 4UB1A 2ZH4A 5D4BA 3EYZA 4QWBA 3Q8QB 3WFSC 2VA2A 2VA3A 9ICMA 5CP2A 5DBAA 5C5JA 1NJYA 4YFKA 4GLXA 3NYBA 4XUSA 4KLHA 1R8BA 4DEZA 3EZ5A 1NKCA 2R8IA 1L3UA 3RJHA 4M6WA 2BGWA 5KFQA 4QZEA 5DDMA 5KFNA 4DL2A 1XU4A 2R8JA 4NY8A 5KFYA 4ECVA 2J6TA 1DK2A 1JN3A 3TFSA 5DG7A 4LVSA 4AT7A 5IIJA 5KFSA 5KFMA 4KMUA 1ZQBA 8ICUA 4C8NA 1XSPA 1KLNA 1UEVA 2NRZA 4JV1A 4UAWA 5IINA 4X0AA 4YP3A 2BCSA 1U45A 4NM2A 5CHGA 2BCVA 4I2CA 4YG2A 3BQTA 1S77D 3EWAA 1JIHA 2ZUDA 8ICIA 3OVSA 4ECYA 5J2JA 2HHXA 4DLGA 4O5CA 3GIJA 3PR5B 1NKBA 3QZ7A 2AGPA 3MR3A 5HREA 4ED6A 3KHGA 4ECQA 4I2EA 3KHRA 3HJ1A 3C1ZA 1T3NA 2FMSA 5D49A 1LB2B 4F5PA 1ZQQA 2IHNA 4LT6A 4RNMA 4WBZA 2ATLA 1NJXA 5HMMA 5J2DA 4ECZA 3GQCA 4O3OA 3KHLA 4GC6A 3N97B 3RB3A 1SKWA 1ZQLA 4M9GA 1ZQXA 2ZTDA 4NXZA 4NLNA 4EBKA 4RZRA 9ICGA 4MFAA 1KEJA 4YR0A 4DOAA 4FO6A 3T5KA 4I2GA 5HRKA 1WCNA 4TUQA 5DLFA 4F2RA 2ASDA 4UB4A 2DR7A 4RQ8A 4WC1A 3BJYA 4RQ3A 4RPXA 4UBCA 4CCHA 1ZQFA 4O3RA 4UD4A 4F93B 3KTQA 4DSLA 3PV8A 4F2SA 4J9LA 3LDAA 4QWEA 1DOQA 4X5VA 2FMPA 2AQ0A 3GFKB 2AU0A 1NKEA 4C8KA 1MSWD 2ZH2A 3GIMA 4F4YA 1A77A 1QSLA 4RT3A 4AT8A 2PFPA 5KFTA 3JPNA 2DPJA 4QZGA 3C2MA 2P6RA 3PY8A 4EYIB 4IR9A 3RB0A 4PGYA 1B22A 4IG8A 7ICLA 1R8AA 4F4KA 4I2HA 3LK9A 3EPIA 3LQCB 1BNOA 3H8WA 2M9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QZC A;  5DLG A;  2HVI A;  2BQR A;  8ICB A;  1NK9 A;  1D9F A;  4IQT A;  2KZ3 A;  2V4R A;  5J0O A;  1T7P A;  4S3N A;  2W8L A;  2HHT A;  1ZQK A;  7ICT A;  2Q66 A;  5DQH A;  8ICL A;  5HHI A;  4DOC A;  4R65 A;  4ED3 A;  3HJ4 A;  4X4Q A;  4AT9 A;  8ICM A;  4PGQ A;  3KHH A;  1QTM A;  4E0D A;  7ICG A;  4O3S A;  3EPG A;  2A1J A;  3TAR A;  4IR1 A;  2XCA A;  3T5H A;  7ICU A;  4YXM A;  4M0A A;  7ICP A;  2DR9 A;  1C7Y A;  4DL6 A;  4BDP A;  8ICK A;  4EYH B;  1ZQR A;  4WC6 A;  1MIV A;  1SL1 A;  4WC0 A;  3OVA A;  2HHP A;  4IQV A;  3OV7 A;  5J29 A;  3C5G A;  5KFB A;  8ICF A;  1ZQY A;  4DFP A;  4E80 A;  4I2D A;  9ICB A;  1KTQ A;  3GV8 B;  3T5J A;  2BQ3 A;  2HHV A;  2R8G A;  2C28 A;  1DK3 A;  1VJ7 A;  2ID1 A;  5DDY A;  3NGD A;  2ISO A;  5KG3 A;  4JWM A;  2W9C B;  7ICQ A;  3SI8 A;  2BHN A;  4KLI A;  2W9A A;  3RR7 A;  4PHE A;  4B9U A;  4J9Q A;  1MQ3 A;  4RWN A;  3JPP A;  3PX4 A;  4DSK A;  2P6U A;  2FLP A;  1PZN A;  4HYK A;  1L3V A;  5KG1 A;  3EW9 A;  4Q8E A;  4Q43 A;  1IM4 A;  4ECW A;  2JEJ A;  5KFC A;  2R8K A;  3JYY A;  3OJU A;  8ICC A;  5KFV A;  3UXO A;  1XS9 D;  3H8S A;  2PI5 A;  3RJF A;  4J9O A;  1KNY A;  2PFO A;  2W8K A;  5KFD A;  4F5R A;  4O3P A;  2BCR A;  4ZH4 A;  4KLO A;  4KLU A;  5D46 A;  2ZTC A;  4YR3 A;  1BPZ A;  4BXO B;  4XQ7 A;  1PX5 A;  2J6S A;  1TK5 A;  2HHQ A;  8ICX A;  4TQR A;  4YVZ A;  2FLL A;  7ICI A;  3TQ1 A;  2ZHB A;  5KT5 A;  2AQ4 A;  3AQK A;  2DR5 A;  1RXW A;  5HRG A;  4MF8 A;  5KG7 A;  2ZJ5 A;  2XY5 A;  5IIK A;  3PNC A;  1Z00 A;  4PGX A;  3MFH A;  1S76 D;  5J2A A;  2AJQ A;  4X4N A;  1R8C A;  4PHA A;  2RDJ A;  4R8U A;  3AU6 A;  4F5Q A;  3PW4 A;  4MEX A;  4IQW A;  8ICP A;  5DG8 A;  5J0X A;  4C8O A;  4J9N A;  9ICQ A;  1VFG A;  4PHP A;  2Y1J A;  2KZM A;  2BQU A;  1BGX T;  5EOZ A;  8ICS A;  3V7J A;  2DRA A;  2MUT A;  4PH5 A;  4XQ8 A;  2AGQ A;  3RR8 A;  2W9B A;  4KLD A;  5BOM A;  1BPY A;  2M2W A;  3V6H A;  5J0W A;  1D8Y A;  1KFD A;  5KT2 A;  8ICQ A;  5EWF A;  4MFC A;  3MFI A;  5L1J A;  3C21 A;  4DOB A;  7ICH A;  4FBT A;  1KDH A;  4IRD A;  5HRL A;  4RQ4 A;  4F92 B;  3Q8M A;  2IA6 A;  5KT4 A;  5IIM A;  1DGS A;  1XC9 A;  1T4G A;  2MAX A;  4WCW A;  4TUP A;  1X2I A;  4WC7 A;  4ECR A;  7ICK A;  4RQ6 A;  4UB3 A;  4LZD A;  3HPO A;  4PHD A;  4DLE A;  4JUZ A;  1CUK A;  5KG0 A;  4F91 B;  5KFG A;  5KFF A;  5J0T A;  4ECS A;  4ED7 A;  1F5A A;  4F5O A;  1KFT A;  4P4O A;  5HP4 A;  3TI0 A;  1L3T A;  4ED1 A;  2KFN A;  2RFF A;  4I2F A;  4ED2 A;  2IMW P;  5J2E A;  5HRB A;  5L1I A;  4O5E A;  3OUY A;  4YD1 A;  1L3S A;  4DQI A;  1U9L A;  3ZDC A;  4X4S A;  2ZJ8 A;  1KFS A;  3V6K A;  4NKT A;  2OWO A;  1XSL A;  4RUA A;  2JZB B;  3UQ0 A;  4M9L A;  5CB1 A;  9ICT A;  4EBJ A;  2ZTE A;  2M2V A;  1UT8 A;  4QZI A;  4J9R A;  4EBC A;  4M9J A;  7ICF A;  5DB7 A;  5J0U A;  4DL4 A;  1QLN A;  4B9T A;  4J9P A;  4KIT B;  3TAP A;  3QEB Z;  2IHM A;  5BPC A;  4FH5 A;  5DKW A;  4NLG A;  2XO7 A;  3B0X A;  2ZH8 A;  4F4W A;  4Q45 A;  3C2K A;  3C5F A;  1NK7 A;  2DRB A;  4TUR A;  3Q8R B;  5KFP A;  5KFW A;  4O3N A;  4RT2 A;  3ZDD A;  4B9L A;  4JK1 A;  2HHS A;  3G6Y A;  4FHY A;  1RYS A;  2ZUB A;  5HR9 A;  3JPS A;  2ZH6 A;  9ICV A;  1BPX A;  3IHQ B;  4QW8 A;  4M6W B;  4QZB A;  9ICE A;  3PMN A;  1X9S A;  1RXV A;  1S0M A;  5F9L A;  2R8H A;  4B9S A;  2JEI A;  2O5A A;  3MR2 A;  4AT7 B;  2DFL A;  9ICS A;  4X0B A;  4F5N A;  1JMS A;  1Y88 A;  4GXI A;  2C2R A;  4YCX A;  1UA1 A;  4B9V A;  4MF2 A;  3OHA A;  5KFJ A;  1RZT A;  3H40 A;  3M8S A;  2BPF A;  3HWT A;  5KT7 A;  5KFL A;  2ZH1 A;  3G6X A;  4DS4 A;  2I9G A;  3TAN A;  4ELT A;  7ICJ A;  4NM1 A;  4DQR A;  5EWG A;  4RPY A;  1ZET A;  4DFK A;  1SKR A;  4I2B A;  4M04 A;  4KLM A;  1ZQZ A;  1Q78 A;  3AU2 A;  4UAZ A;  4ED8 A;  1NK4 A;  4BWM A;  3H39 A;  4RWP A;  3LWM A;  4QZF A;  4GXK A;  5J0Y A;  1S97 A;  2BR0 A;  2KTQ A;  4FHP A;  2F1J A;  4YXJ A;  2I1Q A;  4C8M A;  9ICJ A;  3OHB A;  2NRX A;  3K4G A;  4QZD A;  3BQ0 A;  4G3I A;  2RDI A;  2DPI A;  4YN4 A;  4QWA A;  1ZQI A;  2WTF A;  1FA0 A;  4RWO A;  2V9W A;  8ICE A;  4E7X A;  4P4P A;  5J2K A;  5III A;  9ICN A;  4ATB A;  5HRD A;  1JXL A;  4DQQ A;  4F8R A;  4RU9 A;  5CA7 A;  4ED0 A;  3SV4 A;  3AQL A;  5KG4 A;  2M2T A;  1NK8 A;  1ZQW A;  1OU5 A;  2Q0Z X;  2NRW A;  4DSI A;  2ZH3 A;  5HHH A;  2JEG A;  5DB9 A;  2C22 A;  5J2F A;  3RRH A;  1S9F A;  3UXN A;  2NRK A;  4R64 A;  4IRK A;  5HRI A;  3OSN A;  1K1Q A;  4EEY A;  4NLK A;  1TAU A;  1ZQC A;  5KFR A;  5KG6 A;  4KLJ A;  3FDS A;  2BKE A;  5TZV A;  3RJG A;  9ICL A;  3L9D A;  3GV5 B;  8ICR A;  1BPB A;  2ZJA A;  3QEA Z;  3GIK A;  3PW7 A;  4UB5 A;  5EWE A;  9ICK A;  4AT8 B;  5HRH A;  4FHW A;  3GV7 B;  3C1Y A;  2IBK A;  1ZQM A;  5KFA A;  3RB6 A;  4UD5 A;  5DQI A;  4FHV A;  4BGD A;  1TV9 A;  1ZQN A;  5CWR A;  1CEZ A;  2FPM A;  5J2I A;  4P2H A;  7ICR A;  2O1P A;  3T5L A;  4Q44 A;  3UQ2 A;  4YR2 A;  3NTU A;  5J0S A;  3SYZ A;  8ICH A;  1YLQ A;  1NJW A;  3V7L A;  9ICO A;  4YD2 A;  2HHU A;  3V6J A;  9ICW A;  3JPR A;  3FYH A;  5L9X A;  2BCQ A;  7ICS A;  3T3F A;  5KFO A;  4RNN A;  3H3A A;  3OVB A;  2KN7 A;  8ICV A;  3HX0 A;  5KT3 A;  1COO A;  1ZQE A;  3ZD8 A;  5J2G A;  4M2Y A;  2HVH A;  4AT9 B;  4KLF A;  2PXI A;  4KLL A;  3ZDB A;  2JEF A;  5DBB A;  5J0R A;  2XY6 A;  8ICN A;  1ZJN A;  4UB2 A;  2NRV A;  5BOL A;  3RAX A;  3LWL A;  2A1J B;  2V4Q A;  4Q8F A;  3MGI A;  3ZD9 A;  5KG5 A;  1TVA A;  4PPX A;  1X9W A;  3ISB A;  1ARO P;  3H4D A;  2ASJ A;  4I2J A;  4X4U A;  1D9D A;  4XA5 A;  1ZJM A;  2BDP A;  5L1K A;  4FBU A;  5CR0 A;  4ECX A;  3MGH A;  4EZ9 A;  4DQP A;  4QW9 A;  9ICI A;  4QZH A;  1SL0 A;  1NOM A;  1RPL A;  4J9K A;  1NK5 A;  1SKS A;  1ZQJ A;  5J2B A;  3AUO A;  4FH3 A;  3H7I A;  2FLN A;  1XSN A;  3M8R A;  4DL5 A;  5DGB A;  4KTQ A;  2XCP A;  3M9M B;  3AQN A;  4EP7 A;  2PFN A;  3WFO A;  1ZQP A;  3MBY A;  4QZA A;  1NK0 A;  4DSJ A;  7ICO A;  5CJ7 A;  4EBD A;  4M9H A;  4NKU A;  1TFR A;  3C23 A;  5L1L A;  5HNK A;  2B21 A;  3HT3 A;  4I28 A;  4UBB A;  2XGP A;  2DR8 A;  4DFJ A;  8ICG A;  1LV5 A;  5F2V O;  4MFF A;  4B9N A;  7ICM A;  2ZH9 A;  3SV3 A;  3OGU A;  4EBE A;  2ZH5 A;  1Q79 A;  4KLG A;  1UT5 A;  8ICJ A;  3AQM A;  4Z6C A;  2AGO A;  2FMQ A;  3V72 A;  1S0V A;  5DB6 A;  4RPZ A;  2XC9 A;  3MR6 A;  3H4B A;  1TK0 A;  5KFU A;  3RH5 A;  1KRP A;  3RJE A;  1U49 A;  3PO4 A;  4YMN A;  4DFM A;  1ZQU A;  4QWC A;  2J6U A;  1TK8 A;  4Z6F A;  3B0Y A;  1IXR A;  3ZDE A;  1H38 A;  1QSY A;  4WC4 A;  3GII A;  1TFY A;  5DQG A;  4QZ8 A;  3WFQ E;  3PO5 A;  4J9M A;  1Z00 B;  4KLT A;  4DO9 A;  1UEU A;  1WCL A;  9ICF A;  4R8U B;  4K4H A;  4WC3 A;  3WFR E;  8ICO A;  4YMM A;  4GXJ A;  4ECU A;  5J2H A;  1ZYQ A;  4R66 A;  9ICH A;  4FHX A;  4KLS A;  3M9N B;  2DVI A;  3OJS A;  5KTQ A;  4R63 A;  2MUT B;  2XY7 A;  2UVU A;  2PFQ A;  2W9B B;  2C2D A;  2W9M A;  1JQR A;  4I27 A;  4KLE A;  1UET A;  1MC8 A;  3JPO A;  4X4O A;  4WC2 A;  3C66 A;  4DSF A;  3MDC A;  4ECT A;  2UVR A;  1JX4 A;  7ICN A;  1ZQD A;  4X4V A;  4X4T A;  4ELV A;  1R89 A;  1TAQ A;  3RJK A;  4YQW A;  3ORY A;  3SZ2 A;  5JUM A;  3C18 A;  1NO5 A;  1ZQG A;  1WOT A;  4LZG A;  5KFX A;  2W9C A;  1MIW A;  4WC5 A;  3MDA A;  2ISP A;  8ICZ A;  4JV0 A;  5DG9 A;  3HIY A;  2FPL A;  4TQS A;  2NRT A;  4KN4 A;  5KFK A;  4DL7 A;  2KFZ A;  3Q8K A;  3BDP A;  3RJJ A;  4K4I A;  9ICA A;  5HML A;  2HHW A;  8ICW A;  4X4R A;  4JV2 A;  1KSP A;  5KFH A;  1T8E A;  9ICR A;  3HW8 A;  4I2A A;  5DB8 A;  4UAY A;  3OSP A;  1JAJ A;  3ISD A;  4DSE A;  4O5K A;  3OUY B;  3Q8S B;  3JPT A;  9ICU A;  5KT6 A;  4J9S A;  5DBC A;  1NK6 A;  3RJI A;  2FPK A;  4M9N A;  1S0N A;  3M9O B;  4DWI A;  5HRF A;  3H8J A;  3UPQ A;  3C2L A;  1B43 A;  5DGA A;  1K1S A;  1ZQO A;  3RTV A;  1HJP A;  3PR4 A;  4BXO A;  1X9M A;  3E2E A;  1HUO A;  2PI4 A;  4B9M A;  4C8L A;  4RQ1 A;  3PW5 A;  8ICA A;  4RWQ A;  3RAQ A;  2F1H A;  1TFW A;  4RNO A;  1XO1 A;  4F4X A;  1BVS A;  4XRH A;  3RB4 A;  1S10 A;  1U47 A;  1N56 A;  4P4M A;  3QE9 Y;  2VAN A;  1NJZ A;  1RYR A;  1BPE A;  4O9M A;  4F50 A;  3TFR A;  2C2E A;  2H5X A;  3GDX A;  4F3O A;  4RUC A;  3Q8L A;  5IIL A;  1XWL A;  2HW3 A;  9ICP A;  2F1I A;  3BQ2 A;  2UVW A;  4RQ2 A;  3TAQ A;  3HP6 A;  4O0I A;  2UVV A;  4BWJ A;  2XGQ A;  3ETL A;  4F4Z A;  3G6V A;  2BCU A;  1U4B A;  1QSS A;  2GWS A;  1NZP A;  4QWD A;  4M5D A;  4E8F A;  1Z3E B;  4DS5 A;  4RQ7 A;  5J2C A;  3PX6 A;  3WFP A;  1ZQV A;  2ZHA A;  4DQS A;  3PW2 A;  1ZQH A;  5IIO A;  9ICX A;  5DED A;  3PVX A;  4RQ5 A;  5F9N A;  2ALZ A;  4Z6D A;  4MEY A;  4X4P A;  3QZ8 A;  4QZ9 A;  3RRG A;  1V9P A;  3MR5 A;  5HC9 A;  4K4G A;  3H37 A;  3JPQ A;  4I2I A;  2BPC A;  3PW0 A;  7ICV A;  4IQU A;  2BE3 A;  2PBE A;  2BPG A;  1UA0 A;  4M47 A;  2VA8 A;  4FS1 A;  4DL3 A;  5J0Q A;  1SL2 A;  1ZQA A;  3ISC A;  3BQ1 A;  1A76 A;  3THV A;  1L5U A;  4IRC A;  2KP7 A;  4EZ6 A;  3JZ0 A;  4ATB B;  3N4M B;  3RBE A;  2ASL A;  3PML A;  1ZQT A;  3GIL A;  3ZDA A;  4DF4 A;  4DF8 A;  8ICT A;  5KFE A;  4GC7 A;  4FS2 A;  2P66 A;  3RH4 A;  1BNP A;  4RQ0 A;  4I29 A;  8ICY A;  3Q8P B;  1ZQS A;  1MIY A;  2KZZ A;  1MQ2 A;  4JWN A;  5DEC A;  4YMO A;  3V7K A;  2M2U A;  3UPS A;  3H38 A;  1SZP A;  5KG2 A;  4TUS A;  3K75 D;  4Z6E A;  3UXP A;  1U48 A;  1V4A A;  7ICE A;  1EXN A;  1D8L A;  5KFI A;  2Y1I A;  2JZB A;  3RH6 A;  5J0P A;  4NLZ A;  1S0O A;  1TKD A;  3IM1 A;  4UQG A;  2ZUC A;  4ELU A;  1HUZ A;  4WBY A;  5KFZ A;  3PX0 A;  3RBD A;  4KLQ A;  4O3Q A;  4KN7 A;  1JXE A;  3MAB A;  1BPD A;  1N48 A;  9ICC A;  2LYH A;  2ZH7 A;  4UB1 A;  2ZH4 A;  5D4B A;  3EYZ A;  4QWB A;  3Q8Q B;  3WFS C;  2VA2 A;  2VA3 A;  9ICM A;  5CP2 A;  5DBA A;  5C5J A;  1NJY A;  4YFK A;  4GLX A;  3NYB A;  4XUS A;  4KLH A;  1R8B A;  4DEZ A;  3EZ5 A;  1NKC A;  2R8I A;  1L3U A;  3RJH A;  4M6W A;  2BGW A;  5KFQ A;  4QZE A;  5DDM A;  5KFN A;  4DL2 A;  1XU4 A;  2R8J A;  4NY8 A;  5KFY A;  4ECV A;  2J6T A;  1DK2 A;  1JN3 A;  3TFS A;  5DG7 A;  4LVS A;  4AT7 A;  5IIJ A;  5KFS A;  5KFM A;  4KMU A;  1ZQB A;  8ICU A;  4C8N A;  1XSP A;  1KLN A;  1UEV A;  2NRZ A;  4JV1 A;  4UAW A;  5IIN A;  4X0A A;  4YP3 A;  2BCS A;  1U45 A;  4NM2 A;  5CHG A;  2BCV A;  4I2C A;  4YG2 A;  3BQT A;  1S77 D;  3EWA A;  1JIH A;  2ZUD A;  8ICI A;  3OVS A;  4ECY A;  5J2J A;  2HHX A;  4DLG A;  4O5C A;  3GIJ A;  3PR5 B;  1NKB A;  3QZ7 A;  2AGP A;  3MR3 A;  5HRE A;  4ED6 A;  3KHG A;  4ECQ A;  4I2E A;  3KHR A;  3HJ1 A;  3C1Z A;  1T3N A;  2FMS A;  5D49 A;  1LB2 B;  4F5P A;  1ZQQ A;  2IHN A;  4LT6 A;  4RNM A;  4WBZ A;  2ATL A;  1NJX A;  5HMM A;  5J2D A;  4ECZ A;  3GQC A;  4O3O A;  3KHL A;  4GC6 A;  3N97 B;  3RB3 A;  1SKW A;  1ZQL A;  4M9G A;  1ZQX A;  2ZTD A;  4NXZ A;  4NLN A;  4EBK A;  4RZR A;  9ICG A;  4MFA A;  1KEJ A;  4YR0 A;  4DOA A;  4FO6 A;  3T5K A;  4I2G A;  5HRK A;  1WCN A;  4TUQ A;  5DLF A;  4F2R A;  2ASD A;  4UB4 A;  2DR7 A;  4RQ8 A;  4WC1 A;  3BJY A;  4RQ3 A;  4RPX A;  4UBC A;  4CCH A;  1ZQF A;  4O3R A;  4UD4 A;  4F93 B;  3KTQ A;  4DSL A;  3PV8 A;  4F2S A;  4J9L A;  3LDA A;  4QWE A;  1DOQ A;  4X5V A;  2FMP A;  2AQ0 A;  3GFK B;  2AU0 A;  1NKE A;  4C8K A;  1MSW D;  2ZH2 A;  3GIM A;  4F4Y A;  1A77 A;  1QSL A;  4RT3 A;  4AT8 A;  2PFP A;  5KFT A;  3JPN A;  2DPJ A;  4QZG A;  3C2M A;  2P6R A;  3PY8 A;  4EYI B;  4IR9 A;  3RB0 A;  4PGY A;  1B22 A;  4IG8 A;  7ICL A;  1R8A A;  4F4K A;  4I2H A;  3LK9 A;  3EPI A;  3LQC B;  1BNO A;  3H8W A;  2M9N A; 
#chains in the Genus database with same CATH topology
 5DLG A;  2W54 A;  1NK9 A;  1T7P A;  5DQH A;  3SMV A;  4LEY A;  1QTM A;  1PUZ A;  4OJL A;  3EPG A;  1RQL A;  4YXM A;  1C7Y A;  4BDP A;  1SXE A;  1SL1 A;  2HBM A;  2QB1 A;  4WC0 A;  3OV7 A;  1OUQ A;  5J29 A;  5KFB A;  4DFP A;  4I2D A;  9ICB A;  4X0B A;  2HHV A;  2C28 A;  4CE6 A;  2W9C B;  3SI8 A;  1A6S A;  2H3Q A;  3RR7 A;  4B9U A;  3JPP A;  4Q43 A;  4ECW A;  5KFC A;  2R8K A;  2K60 A;  3H8S A;  2W8K A;  2A19 A;  4F5R A;  4ZH4 A;  4KLU A;  2F76 X;  2DQN B;  4XQ7 A;  2J6S A;  4O69 A;  7ICI A;  3TQ1 A;  2ZHB A;  2AQ4 A;  2ZXH A;  1QH9 A;  2YN4 A;  2RP5 A;  5IIK A;  1Z00 A;  4PGX A;  1J2N A;  3PNC A;  5J2A A;  2LYA A;  3AU6 A;  2FDR A;  4R8U A;  5DG8 A;  2Y1J A;  3TAD A;  3V7J A;  2H3I A;  1B4F A;  2MUT A;  2OXO A;  2HMX A;  1D8Y A;  4NV0 A;  4MFC A;  1WG8 A;  3O0F A;  4UAS A;  4IRD A;  2K8A A;  4F92 B;  3SEI A;  4XJE A;  5IIM A;  1DGS A;  4WCW A;  4LZD A;  3HPO A;  4CF4 A;  1IIP A;  4F91 B;  4PL2 A;  1KFT A;  2W3R A;  5ALT A;  2RFF A;  4I2F A;  2IMW P;  5D61 A;  3OUY A;  2RHF A;  5EE3 A;  3RFA A;  2ZJ8 A;  2KEY A;  2ZTE A;  1KKX A;  4OJO A;  4M9J A;  5J0U A;  4CGZ A;  4DFD A;  4ZOH C;  5BPC A;  4NLG A;  2XO7 A;  4F4W A;  4UB6 U;  3Q8R B;  5KFW A;  4B9L A;  4JK1 A;  1PK1 A;  4FHY A;  2KKV A;  2QKQ A;  4QW8 A;  4M6W B;  1L7N A;  1RXV A;  5F9L A;  2JEI A;  4RQM A;  1UA1 A;  1RZT A;  3M8S A;  3KFU F;  5AIA A;  4DS4 A;  3TAN A;  4ELT A;  4RPY A;  1ZET A;  4DFK A;  4UAT A;  3WU2 U;  3LWM A;  4FHP A;  4GXK A;  1SB3 C;  2F1J A;  4KX3 A;  4KB6 A;  2ZIW A;  4QWA A;  4RWO A;  2V9W A;  2EWR A;  4WOY A;  5III A;  5HRD A;  3BS7 A;  4ED0 A;  2M2T A;  2LKY A;  1ZQW A;  2NRW A;  2JEG A;  3RRH A;  1K1Q A;  1J2M A;  3QU7 A;  5KG6 A;  3FDS A;  8ICR A;  4F72 A;  3QEA Z;  3NWI A;  9ICK A;  3MCR A;  2D8C A;  2EZY A;  1ZQM A;  4FHV A;  2AH5 A;  1TV9 A;  2ZHA A;  1ZRN A;  3IP4 B;  4UAR A;  3T5L A;  3UQ2 A;  7ICR A;  4YR2 A;  3L4P A;  3NTU A;  5J0S A;  1YLQ A;  1NJW A;  3V7L A;  4PJ0 U;  9ICO A;  4YD2 A;  2HHU A;  9ICW A;  3JPR A;  2P35 A;  2BCQ A;  2KJ5 A;  5HR7 A;  3JCF A;  1D8B A;  1C20 A;  5J2G A;  4AT9 B;  4KLL A;  2JXJ A;  5J0R A;  1TVA A;  1X9W A;  3CNH A;  3MC1 A;  4I2J A;  4X4U A;  1D9D A;  2ZXI A;  1ZJM A;  2BDP A;  9ICE A;  1L7M A;  2YX8 A;  1NOM A;  1NK5 A;  5J2B A;  3AUO A;  5ALF A;  5DGB A;  2PFN A;  1ZQP A;  4Y2U A;  2KK0 A;  1NK0 A;  4UBB A;  2DR8 A;  4BUG A;  8ICG A;  3PHZ A;  1LV5 A;  1UT5 A;  1DXS A;  4NLC A;  2AGO A;  3V72 A;  3QU5 A;  3H4B A;  5KFU A;  3RH5 A;  1T3Q A;  1SXD A;  3S6J A;  4YMN A;  4DFM A;  1ZQU A;  4QWC A;  4WH5 A;  3ZDE A;  4A8E A;  2YB1 A;  4J9M A;  3LVV A;  4DO9 A;  3QXG A;  2FCL A;  3SD7 A;  2DVI A;  3QX7 A;  3TAD C;  4WQL A;  2UVU A;  2PFQ A;  3R9K A;  1UET A;  1MC8 A;  4X4O A;  4WC2 A;  2W11 A;  2E8M A;  2EAM A;  4DSF A;  2KMD A;  1JX4 A;  4YQW A;  4BJQ A;  1ZQG A;  1WOT A;  2W9C A;  2KIV A;  4JV0 A;  3HIY A;  2FPL A;  2KFZ A;  4KN4 A;  5ALH A;  3BDP A;  4K4I A;  1SGG A;  9ICA A;  4JV2 A;  1KSP A;  9ICR A;  3L3F X;  5DBC A;  3RJI A;  4K8V A;  2FPK A;  1K1S A;  1ZQO A;  2W43 A;  1HJP A;  2F77 X;  3PW5 A;  3WK6 A;  1CRX A;  1BVS A;  4XRH A;  1RYR A;  2OHF A;  1X6I A;  5HRH A;  4P2H A;  1MIV A;  4O9M A;  1BPE A;  2JRZ A;  3SAH A;  5ALS A;  4RQ2 A;  3NUQ A;  3FM9 A;  1X9X A;  2VKQ A;  4K98 A;  1NZP A;  3K7D A;  4E8F A;  1ZQH A;  5IIO A;  3UMG A;  1KW4 A;  3QUB A;  4MEY A;  3RRG A;  4X4P A;  5HC9 A;  3MR5 A;  4K4G A;  3JPQ A;  4I2I A;  5ALP A;  1Q3U A;  2BPG A;  4M47 A;  3N4M B;  1IV8 A;  3GIL A;  4DF4 A;  4NXW A;  4GC7 A;  4FS2 A;  2HDO A;  1BNP A;  4RQ0 A;  2DUY A;  2CN1 A;  3V7K A;  4Z6E A;  1U48 A;  1F44 A;  1EXN A;  1DGJ A;  1D8L A;  5KFI A;  1ZD5 A;  5J0P A;  1TKD A;  1L8O A;  3IM1 A;  1HUZ A;  2HOF A;  1KQQ A;  1JXE A;  9ICC A;  3NRZ A;  3WFS C;  3Q8Q B;  5HR6 A;  5AKG A;  1NJY A;  2Q4T A;  4Y2Q A;  3ERC C;  4M6W A;  4NY8 A;  4DL2 A;  1JN3 A;  4OAG A;  5KFS A;  4Y2Y A;  5KFM A;  2RLT A;  5GTI U;  4AYB C;  1UEV A;  2NRZ A;  3CYM A;  1V85 A;  3E58 A;  2BCS A;  1U45 A;  2BCV A;  5H2F U;  2DBY A;  2LPE A;  2LHT A;  1IG6 A;  2H3F A;  1CI4 A;  5AKX A;  3KHG A;  3HJ1 A;  2FMS A;  1LB2 B;  3H0L B;  1Z19 A;  4WBZ A;  2EQY A;  1NJX A;  1Z1V A;  5J2D A;  1SKW A;  4NXZ A;  2ZTD A;  2EZZ A;  4KX5 A;  3T5K A;  4I2G A;  5HRK A;  2HN1 A;  1WCN A;  1HEK A;  4WC1 A;  3BJY A;  2HBL A;  5G5G A;  4O3R A;  1AQ6 A;  4DSL A;  3PV8 A;  2AQ0 A;  5AKL A;  2AU0 A;  2ZH2 A;  3D2Q A;  1JUD A;  4NWI A;  2P6R A;  4IR9 A;  3RB0 A;  7ICL A;  2W04 A;  5B5E U;  4C4R A;  1SIJ A;  3LQC B;  3D6J A;  3K1R B;  8ICB A;  1D9F A;  1PK3 A;  4S3N A;  2Q66 A;  4DOC A;  4ED3 A;  3H0M B;  4X4Q A;  1UQV A;  4AT9 A;  1PVP A;  4PGQ A;  5AKI A;  4O3S A;  7ICP A;  8ICK A;  3QUC A;  3OVA A;  1Q46 A;  8ICF A;  1ZD3 A;  3GV8 B;  1X66 A;  1DK3 A;  2LMR A;  1SWV A;  4JWM A;  3LYS A;  5KG3 A;  7ICQ A;  4KLI A;  2W9A A;  4J9Q A;  4RWN A;  3PX4 A;  4GFJ A;  2QAR B;  2FLP A;  3IG8 A;  5AKY A;  5KG1 A;  1IM4 A;  2JEJ A;  2RRD A;  4O3M A;  4HX0 A;  4O67 A;  2WB1 C;  4J9O A;  1KNY A;  2ZIX B;  2BCR A;  2HN2 A;  1BPZ A;  4BXO B;  4FFD A;  3MGV A;  4UAV A;  4TQR A;  2A3V A;  2ZIV B;  4F71 A;  2DR5 A;  5HRG A;  5KG7 A;  3MFH A;  2RDJ A;  4F5Q A;  3PW4 A;  4C8O A;  4J9N A;  4KMO B;  2KZM A;  2BQU A;  1BGX T;  2BDU A;  5JRT A;  5EOZ A;  2HOQ A;  8ICS A;  1GO3 F;  4PH5 A;  4XQ8 A;  2E3T A;  5G5H A;  2AGQ A;  2WF8 A;  3RR8 A;  5D63 A;  2KVS A;  2M2W A;  5C0Y A;  3V6H A;  2K8B B;  3TAC B;  3ER9 B;  3C21 A;  4WQK A;  4OO1 J;  1KDH A;  4Y2T A;  4RQ4 A;  3N7P D;  2IA6 A;  1ZQ1 C;  4CRX A;  2MAX A;  4WC7 A;  2G5H B;  3N28 A;  1SWW A;  5ALL A;  3FC4 A;  2K4P A;  3F2D A;  5ALG A;  1F5A A;  2NO5 A;  4ED7 A;  4QIW C;  2HBJ A;  4LEW A;  5HP4 A;  1X42 A;  2W03 A;  5HRB A;  4O5E A;  5AI0 A;  3U26 A;  2JGA A;  4X4S A;  1KFS A;  5CFT A;  2JZB B;  2DGZ A;  4QZI A;  4EBC A;  2OH2 A;  3TAP A;  4NL9 A;  1TAM A;  3C2K A;  1NK7 A;  1KBU A;  2DRB A;  4TUR A;  3L5K A;  5KFP A;  4RT2 A;  4O3N A;  1GPJ A;  2K89 A;  5AKE A;  3G6Y A;  1X6J A;  2ZH6 A;  2EAN A;  5HR9 A;  9ICV A;  5JU5 A;  5ALE A;  1X9S A;  1S0M A;  1L8L A;  2KHV A;  3MR2 A;  4K97 A;  1RDF A;  2DFL A;  3GZF A;  1OW5 A;  2C2R A;  4B9V A;  3RF9 A;  4MF2 A;  5KFJ A;  4PL1 A;  5KT7 A;  3AQF A;  2G09 A;  5KFL A;  7ICJ A;  4NM1 A;  1SKR A;  4RWP A;  3AU2 A;  4UAZ A;  3WKB A;  4QJF B;  2GOL A;  4C8M A;  3OHB A;  3BQ0 A;  2NRX A;  3K4G A;  1QCK A;  2DPI A;  2WTF A;  8ICE A;  3QUT A;  5J2K A;  3BZK A;  1JXL A;  3HJE A;  4F8R A;  5CA7 A;  3SV4 A;  1NK8 A;  2Q0Z X;  4DSI A;  1RYU A;  1B0X A;  2C22 A;  1S9F A;  1Q8K A;  5HRI A;  1RG6 A;  3F5E A;  4EEY A;  1ZQC A;  1JI7 A;  4KLJ A;  4X4N A;  1BPB A;  2ZJA A;  3GIK A;  3I76 A;  1ZRM A;  5JTI A;  5EWE A;  4AT8 B;  2Y0S F;  4FHW A;  3C1Y A;  2IBK A;  4NXX A;  4K9A A;  3WK4 A;  4BGD A;  1ZQN A;  5J2I A;  3SYZ A;  1P7D A;  5ALY A;  1N63 A;  2NYV A;  3OTQ A;  5ALO A;  1FFU A;  2KN7 A;  5KT3 A;  2HVH A;  3ZDB A;  3CK6 A;  2XY6 A;  4Q8F A;  4NXV A;  5BOL A;  3LWL A;  2V4Q A;  4Y2X A;  3MGI A;  4EEL A;  4PPX A;  3KBB A;  1ARO P;  1ZD4 A;  4EZ9 A;  5L1K A;  4ECX A;  2FJ6 A;  2B6G A;  4EX7 A;  1SKS A;  3M8R A;  4EX6 A;  3M9M B;  3AQN A;  4EP7 A;  3MBY A;  5J8Y A;  4DSJ A;  7ICO A;  4NKU A;  4EBD A;  1TFR A;  2B21 A;  3SV3 A;  2ZH5 A;  4P0Q B;  4KLG A;  4Z6C A;  1S0V A;  2FMQ A;  3NS1 A;  2XC9 A;  3C28 A;  1TK0 A;  1KRP A;  1U49 A;  1N5X A;  1VLB A;  2WAQ C;  5AI5 A;  1IXR A;  1H38 A;  4WC4 A;  1TFY A;  4IC9 A;  2WF9 A;  5DQG A;  2CRX A;  4QZ8 A;  3WFQ E;  9ICF A;  4WC3 A;  1N61 A;  4ECU A;  3TKA A;  2WFA A;  2KJ9 A;  4KLS A;  3OJS A;  5KTQ A;  2XY7 A;  2HOI A;  2C2D A;  2W9M A;  4KLE A;  2VJ5 A;  1FIQ A;  3MDC A;  1KN5 A;  7ICN A;  4X4V A;  3SAG A;  1TAQ A;  5AM4 A;  3C18 A;  4LZG A;  1MIW A;  8ICZ A;  2ZG6 A;  2NRT A;  2QAR A;  3AN1 A;  3J81 j;  4X4R A;  5HML A;  2HHW A;  5AI4 A;  1QQ6 A;  3HW8 A;  4I2A A;  4LJX A;  2G07 A;  2H3V A;  3ISD A;  3HKZ C;  3DEE A;  1NK6 A;  2ZIX A;  1S0N A;  1Z4N A;  3SEN A;  3PR4 A;  4BXO A;  2WF7 A;  3M6K A;  4C7Y A;  4B9M A;  4Y2R A;  3RAQ A;  5ALZ A;  1PVQ A;  1XO1 A;  2ZIV A;  1N56 A;  3RB4 A;  2IUB A;  3QE9 Y;  3NVW A;  2H5X A;  2HW3 A;  4RUC A;  1ZOL A;  2W7P A;  3TAQ A;  2KJ8 A;  2QLT A;  2UVV A;  4BWJ A;  4F4Z A;  3G6V A;  2BCU A;  2E1E A;  1J97 A;  1XNS A;  5J2C A;  3PX6 A;  3PW2 A;  1XO0 A;  2D3D A;  2KD1 A;  5F9N A;  2ES6 A;  3QZ8 A;  5CFS A;  3ED5 A;  3PW0 A;  1NI3 A;  1DRG A;  2VA8 A;  4NKT A;  5J0Q A;  2KP7 A;  3ISC A;  3THV A;  2PMZ F;  4P0P B;  4ATB B;  4K96 A;  3AEV A;  2ASL A;  4FZM A;  3QU2 A;  1ZQS A;  3QU4 A;  1MQ2 A;  4JWN A;  5DEC A;  2M2U A;  5JTG A;  1LKY B;  3UPS A;  1SZP A;  5ALW A;  2BBJ A;  4TUS A;  2I5H A;  3UXP A;  7ICE A;  2LBO A;  3RH6 A;  2JZB A;  5FP0 A;  4NXU A;  4OD0 A;  5KFZ A;  4OAH A;  4KLQ A;  4O3Q A;  3F5A A;  5ALK A;  3MAB A;  4IS7 A;  4UB1 A;  4JB3 A;  5AHX A;  3CRX A;  2K4E A;  3D2S A;  2R8I A;  2BGW A;  2O6K A;  4QZE A;  3A0H U;  1COK A;  5KFN A;  1XU4 A;  2KKP A;  4ECV A;  3TFS A;  4AYB F;  1UHU A;  5IIJ A;  4C8N A;  1XSP A;  3N7S C;  5CHG A;  3SR6 A;  4ECY A;  4DLG A;  5CFU A;  1NKB A;  2AGP A;  2BZF A;  3C1Z A;  1WWV A;  4F5P A;  2IHN A;  5HMM A;  4ECZ A;  3GQC A;  4O3O A;  3KHL A;  3RB3 A;  1ZQL A;  3BS5 B;  2NO4 A;  2EDU A;  4YR0 A;  3WKE A;  5DLF A;  4F2R A;  4K99 A;  3OWG A;  5J8Y C;  4RPX A;  4OAI Z;  4F93 B;  4F2S A;  1DOQ A;  2FMP A;  3GFK B;  1A77 A;  4AT8 A;  5AK6 A;  5KFT A;  2YY6 A;  4ACO A;  3C2M A;  3PZP A;  3PY8 A;  4PGY A;  2YQE A;  2F2A B;  5CHE A;  2IOH A;  3H8W A;  2M9N A;  2B51 A;  4EBK A;  4QZC A;  2HVI A;  2HCF A;  2BQR A;  2F44 A;  2V4R A;  5J0O A;  7ICT A;  4C4S A;  1YZ7 A;  3WKA A;  8ICL A;  2LI6 A;  4U6P A;  4R65 A;  8ICM A;  3KHH A;  2DF4 B;  7ICG A;  1KL9 A;  4HAI A;  3T5H A;  3AL0 B;  7ICU A;  2DR9 A;  4M0A A;  1RQN A;  1NZB A;  2HHP A;  4IQV A;  3C5G A;  4E80 A;  2ID1 A;  3DDH A;  2BQ3 A;  1VJ7 A;  5DDY A;  3F2B A;  3NGD A;  2BHN A;  4PHE A;  3SAF A;  2P6U A;  5AI6 A;  3EW9 A;  2RQ5 A;  4Q8E A;  2VJ4 A;  3OJU A;  8ICC A;  4US9 A;  5KFV A;  4P0Q A;  4EED A;  3RJF A;  5KFD A;  4FZN A;  4O3P A;  1MN8 A;  1SZH A;  4KLO A;  2ZTC A;  4YR3 A;  2HHQ A;  1TK5 A;  8ICX A;  5GTH U;  5KT5 A;  3WKC A;  2XY5 A;  1WUD A;  2AJQ A;  1R8C A;  4IQW A;  4MEX A;  1VFG A;  5AKH A;  4PHP A;  3ZI4 A;  2D6F C;  2DRA A;  1T94 A;  4KLD A;  1M6Y A;  5EWF A;  5L1J A;  4FBT A;  3IRU A;  1T4G A;  2MRL A;  3F53 A;  4UB3 A;  1WYG A;  4DLE A;  4PHD A;  4QIW F;  5KG0 A;  5KFF A;  5J0T A;  4F5O A;  4ED1 A;  5J2E A;  2GO7 A;  3K1Z A;  5L1I A;  4YD1 A;  4O6A A;  3ZDC A;  3V6K A;  2OWO A;  4RUA A;  2JHD A;  3UQ0 A;  9ICT A;  5TIS U;  4J9R A;  5DB7 A;  4DL4 A;  4B9T A;  1V97 A;  4GIB A;  2KE7 A;  3A0B U;  4KIT B;  3QEB Z;  2IHM A;  3B0X A;  2ZH8 A;  3AM9 A;  3HIL A;  3ETR A;  3ZDD A;  5ALD A;  2ZUB A;  3JPS A;  1BPX A;  3IHQ B;  3NAS A;  2O5A A;  3M6Z A;  2R8H A;  9ICS A;  4F5N A;  1Y88 A;  4YCX A;  3OHA A;  4O68 A;  2BPF A;  3HWT A;  2GA9 D;  5AK5 A;  3G6X A;  4LEV A;  5A0L A;  4I2B A;  4P0P A;  4ATB A;  2OCE A;  4M04 A;  1ZQZ A;  1NK4 A;  4ED8 A;  4BWM A;  2WF5 A;  4FZL A;  1S97 A;  3WK7 A;  5J0Y A;  2KTQ A;  2BR0 A;  4YXJ A;  2KNJ A;  4QZD A;  2RDI A;  3FAH A;  1ED1 A;  4YN4 A;  1ZQI A;  2DKZ A;  1LKY A;  9ICN A;  2M0N A;  5ALR A;  4DQQ A;  5ALU A;  5KG4 A;  2F8K A;  5AKK A;  3UXN A;  4R64 A;  4IRK A;  5E79 U;  4NLB A;  4NLK A;  1TAU A;  4I0U A;  3L9D A;  5TZV A;  2BKE A;  1FFV A;  3RJG A;  2Z7J A;  3GV5 B;  4C4T A;  1Q3V A;  3PW7 A;  4UB5 A;  2K8C B;  4Y2J A;  3GV7 B;  2KIW A;  4UD5 A;  4C0Z A;  5DQI A;  2O1P A;  1CEZ A;  2FPM A;  2QB0 B;  5B66 U;  5L9X A;  5KFO A;  2E8P A;  1LVH A;  1PVR A;  3OVB A;  8ICV A;  3HX0 A;  1COO A;  1ZQE A;  3ZD8 A;  4KLF A;  2PXI A;  5DBB A;  2MSN A;  2JH1 A;  4UB2 A;  3E0F A;  2A1J B;  3ONN A;  3ZD9 A;  4FBU A;  4XA5 A;  5AM5 A;  4USA A;  3MGH A;  9ICI A;  4DQP A;  5EE1 A;  4QZH A;  4J9K A;  1RPL A;  3BS5 A;  1ZQJ A;  3H7I A;  1ZXI A;  4DL5 A;  3H0R B;  5KAF U;  4JLZ A;  4QZA A;  5CJ7 A;  4EGW A;  3C23 A;  3HT3 A;  4DFJ A;  1F0M A;  2G0A A;  4MFF A;  4B9N A;  2ZH9 A;  1Q79 A;  4UB8 U;  5AIB A;  3AQM A;  5DB6 A;  3RJE A;  2XID A;  2KVC A;  2J6U A;  1TK8 A;  1QSY A;  3GII A;  3CW2 C;  2ZIU B;  3KOO A;  3PO5 A;  4K4H A;  1Z4O A;  8ICO A;  1ZYQ A;  4R66 A;  5EE0 A;  1YZ6 A;  2W9B B;  2GAF D;  2KG5 A;  3IDW A;  3JPO A;  1ZQD A;  4ELV A;  4CF3 A;  3ORY A;  5JUM A;  3HRD D;  3AMZ A;  5KFX A;  2KIC A;  5DG9 A;  2WHE A;  4DL7 A;  3OSP A;  4UAY A;  4DSE A;  3WK9 A;  2YMP A;  4EV6 A;  5ALM A;  5KT6 A;  3WKD A;  4M9N A;  3M9O B;  2B4V A;  5HRF A;  3UPQ A;  5ALX A;  1B43 A;  3C2L A;  5DGA A;  1X9M A;  2PI4 A;  4C8L A;  8ICA A;  4Y2P A;  3C29 A;  2HBK A;  4RNO A;  1S10 A;  1U47 A;  1PX5 A;  3Q8L A;  5IIL A;  1XWL A;  2F1I A;  4O0I A;  3ETL A;  1U4B A;  5KL8 B;  2GWS A;  4QWD A;  4DS5 A;  5DED A;  9ICX A;  2AXT U;  4Z6D A;  4QZ9 A;  3H37 A;  2KHQ A;  2PBE A;  5K4L A;  1JRO A;  7ICV A;  4DL3 A;  4FS1 A;  3BQ1 A;  1A76 A;  3UMB A;  3JZ0 A;  4EZ6 A;  3RBE A;  3PML A;  1ZQT A;  2P66 A;  4I29 A;  5CRX A;  8ICY A;  2MU2 A;  2EAO A;  1MIY A;  4YMO A;  1YT3 A;  1N62 A;  5KG2 A;  1QQ7 A;  3VC8 A;  1UCV A;  3K75 D;  4PZO A;  1V4A A;  4NLZ A;  2Y1I A;  1S0O A;  3RBD A;  2ZH4 A;  5D4B A;  4UW9 A;  4FE3 A;  2VA2 A;  2VA3 A;  5DBA A;  4YFK A;  3IG5 A;  4KLH A;  1R8B A;  4DEZ A;  3EZ5 A;  5KL1 B;  1L3U A;  5KFQ A;  3KZI U;  5DDM A;  3VCB A;  2R8J A;  1JRP A;  1DK2 A;  3I1Y A;  5DG7 A;  3PST A;  1ZQB A;  4PZN A;  1HIW A;  1KLN A;  4JV1 A;  4YP3 A;  4NM2 A;  4CF5 A;  4YG2 A;  3BQT A;  1S77 D;  3KZX A;  4AP9 A;  5J2J A;  2HHX A;  3GIJ A;  3PR5 B;  3QZ7 A;  4EEB A;  3MR3 A;  5HRE A;  5F3X B;  4ED6 A;  4ECQ A;  1T3N A;  4EEN A;  3NKU A;  4RNM A;  3N97 B;  4M5D A;  4GC6 A;  1ZQX A;  4RZR A;  2YMQ A;  4UB4 A;  2DR7 A;  3NVY A;  4RQ3 A;  4UBC A;  4KM5 A;  3KKA A;  4UD4 A;  2CPR A;  3KTQ A;  4J9L A;  3LDA A;  4C8K A;  1MSW D;  3GIM A;  5ALI A;  4WJ3 B;  5ALJ A;  2PFP A;  3PSI A;  1WWU A;  2JV3 A;  4QZG A;  1B22 A;  4FO1 A;  4IG8 A;  2QB0 A;  3EPI A;  2MA1 A;  1BNO A;  4M2Y A;  1L3V A;  2DKX A;  3ALR A;  4IQT A;  2KZ3 A;  2W8L A;  4RQN A;  1ZQK A;  2HHT A;  4NL9 C;  2JH7 A;  5HHI A;  3HJ4 A;  3I28 A;  4E0D A;  2A1J A;  3TAR A;  4IR1 A;  2XCA A;  5CEH A;  3IN5 A;  4DL6 A;  4EYH B;  2EAP A;  1ZQR A;  4WC6 A;  4CDG A;  4QNL A;  3KD3 A;  2NV3 A;  4EEK A;  1ZQY A;  1KTQ A;  2LYB A;  3T5J A;  2R8G A;  2WF6 A;  3BZC A;  1L6N A;  2ISO A;  1MQ3 A;  1X40 A;  4DSK A;  1PZN A;  4HYK A;  1FO4 A;  1MA7 A;  3JYY A;  4OJ6 A;  2E1F A;  4G9B A;  2Y0S C;  4ICA A;  3UXO A;  3NVO A;  1XS9 D;  2PI5 A;  2PFO A;  3UMC A;  5D46 A;  2KOB A;  2PKE A;  4YVZ A;  2FLL A;  3AQK A;  1V38 A;  1RXW A;  4MF8 A;  2DWQ A;  2ZIU A;  2ZJ5 A;  1S76 D;  1QQ5 A;  4PHA A;  8ICP A;  9ICQ A;  2K4H A;  5J0X A;  4N7R A;  3B9J A;  5AM3 A;  2W9B A;  5BOM A;  1BPY A;  3T79 A;  5J0W A;  1KFD A;  5KT2 A;  8ICQ A;  2LM4 A;  3MFI A;  2FI1 A;  2BBH A;  2OM6 A;  4DOB A;  7ICH A;  5HRL A;  2E8O A;  3Q8M A;  5KT4 A;  1XC9 A;  4TUP A;  2YB4 A;  1X2I A;  4ECR A;  7ICK A;  4RQ6 A;  3CP8 A;  3NVV A;  4JUZ A;  1O03 A;  1CUK A;  5KFG A;  4ECS A;  5T14 A;  2E8N A;  2KV2 A;  4P4O A;  3TI0 A;  2K4I A;  1L3T A;  3QUQ A;  2KFN A;  4ED2 A;  3DV9 A;  1L3S A;  4DQI A;  1U9L A;  4K9B A;  5KNI A;  1XSL A;  4M9L A;  5CB1 A;  4EBJ A;  2M2V A;  1UT8 A;  7ICF A;  1QLN A;  4J9P A;  2VIX A;  1FEZ A;  2G5I B;  2CXY A;  5DKW A;  4FH5 A;  1SV4 A;  1VJ5 A;  4Q45 A;  2E5S A;  3C5F A;  4UAU A;  2HHS A;  2IOF A;  1ZD2 P;  1RYS A;  5AK3 A;  4QZB A;  3PMN A;  4B9S A;  5KAI U;  2JR5 A;  2JMG A;  4U7C A;  4AT7 B;  4JLX A;  3F2C A;  1JMS A;  4GXI A;  1F5S A;  3H40 A;  2Y9U A;  1OXJ A;  2ZH1 A;  2I9G A;  4OCZ A;  5AK4 A;  4DQR A;  5EWG A;  1Q78 A;  4KLM A;  3H39 A;  4QZF A;  5L1M A;  2I1Q A;  9ICJ A;  4G3I A;  1FA0 A;  4E7X A;  4P4P A;  3M1Y A;  3PSF A;  5AI9 A;  5AM2 A;  2XIC A;  2KSO B;  4RU9 A;  3AQL A;  3UM9 A;  1OU5 A;  2ZH3 A;  5HHH A;  5DB9 A;  5J2F A;  1N2X A;  4NJ8 A;  2NRK A;  3KKA C;  3OSN A;  9ICL A;  5KFR A;  4C80 A;  4C7Z A;  5KFA A;  3RB6 A;  2WB1 F;  2HI0 A;  5CWR A;  3GU3 A;  4Q44 A;  3QNM A;  2F3N A;  8ICH A;  3ICX A;  3V6J A;  3FYH A;  7ICS A;  3T3F A;  4LEZ A;  4RNN A;  3H3A A;  2Y9T A;  2YTU A;  1NNL A;  2XVT A;  2PMZ C;  3H8M A;  5ALQ A;  2JEF A;  8ICN A;  1ZJN A;  2NRV A;  3RAX A;  2B0C A;  3N7R C;  5KG5 A;  3ISB A;  3H4D A;  2ASJ A;  5CR0 A;  5B3P A;  4QW9 A;  1SL0 A;  2A1A A;  4FH3 A;  2FLN A;  1XSN A;  3QU9 A;  1A0P A;  4KTQ A;  4CNQ A;  2XCP A;  3WFO A;  1Z1B A;  1SV0 A;  4M9H A;  5L1L A;  5HNK A;  4I28 A;  2XGP A;  5F2V O;  7ICM A;  3OGU A;  1N5W A;  4EBE A;  2EH9 A;  8ICJ A;  4RPZ A;  5B3Q A;  4IL6 U;  1S8O A;  3MR6 A;  3PO4 A;  3IV6 A;  1L7P A;  1RM6 C;  2I6X A;  4Z6F A;  2OYY A;  3B0Y A;  3WK5 A;  4B6J A;  2LM1 A;  2W55 A;  2R18 A;  3ER8 C;  2YML A;  1Z00 B;  4KLT A;  1UEU A;  4BX9 C;  1WCL A;  4R8U B;  3WFR E;  4YMM A;  3WK8 A;  4GXJ A;  5J2H A;  9ICH A;  4FHX A;  3M9N B;  4R63 A;  2MUT B;  1N60 A;  1JQR A;  4I27 A;  2L5Y A;  1L7O A;  4ECT A;  2UVR A;  4JMU A;  5ALV A;  5EE9 A;  4X4T A;  1R89 A;  3RJK A;  3SZ2 A;  3M7D A;  1NO5 A;  2GLE A;  5D62 A;  2YMM A;  4WC5 A;  3LVW A;  3MDA A;  2ISP A;  3PSP A;  4TQS A;  5KFK A;  3Q8K A;  3RJJ A;  2GH1 A;  5AKZ A;  8ICW A;  5KFH A;  2AHO B;  1T8E A;  1JAJ A;  5DB8 A;  4O5K A;  3OUY B;  2H3Z A;  3Q8S B;  1URJ A;  3JPT A;  9ICU A;  4J9S A;  3NVZ A;  4DWI A;  3H8J A;  3RTV A;  2DL0 A;  3E2E A;  1HUO A;  5AKJ A;  4RQ1 A;  4RWQ A;  2F1H A;  1TFW A;  4F4X A;  4P4M A;  2VAN A;  1NJZ A;  2F8L A;  2W7O A;  4F50 A;  3TFR A;  3GDX A;  2C2E A;  4F3O A;  9ICP A;  3BQ2 A;  2UVW A;  2G06 A;  3HP6 A;  1PK1 B;  2XGQ A;  1QSS A;  4Y2S A;  4US8 A;  5AI8 A;  3OPX A;  1Z3E B;  4RQ7 A;  3WFP A;  1ZQV A;  4DQS A;  2FE9 A;  3PVX A;  4RQ5 A;  2ALZ A;  2W3S A;  1V9P A;  2B56 A;  2BPC A;  2BE3 A;  2IOF K;  4IQU A;  3NRW A;  1UA0 A;  1SL2 A;  1ZQA A;  1L5U A;  4IRC A;  1ECW A;  3QYP A;  3ZDA A;  1UPH A;  4DF8 A;  8ICT A;  5KFE A;  3RH4 A;  2ZIW B;  4OJP A;  3Q8P B;  2KZZ A;  3H38 A;  5AIC A;  2XI9 A;  2ODG A;  4UQG A;  2ZUC A;  4ELU A;  4WBY A;  4NXT A;  3PX0 A;  4KN7 A;  1BPD A;  1N48 A;  2LYH A;  2ZH7 A;  3EF2 A;  3EYZ A;  4QWB A;  3SQI A;  9ICM A;  5CP2 A;  5C5J A;  4GLX A;  3NYB A;  4XUS A;  1NKC A;  4OAF A;  3RJH A;  5KFY A;  2WAQ F;  2J6T A;  4AT7 A;  4LVS A;  4KMU A;  8ICU A;  4UAW A;  5IIN A;  4X0A A;  4I2C A;  3EWA A;  1JIH A;  2ZUD A;  8ICI A;  3OVS A;  3D2N A;  4O5C A;  1JAL A;  4I2E A;  2N1R A;  3KHR A;  1VDV A;  3AQE A;  5D49 A;  1ZQQ A;  5AM0 A;  4DCC A;  4LT6 A;  2ATL A;  4M9G A;  1K5O A;  2IHO A;  4NLN A;  2KSO A;  9ICG A;  4MFA A;  1KEJ A;  4FO6 A;  4DOA A;  1S5L U;  4TUQ A;  4J03 A;  2ASD A;  4OJ5 A;  4RQ8 A;  5ALN A;  2ESE A;  1SV0 C;  4CCH A;  1ZQF A;  4MHV A;  2G08 A;  2HSZ A;  4QWE A;  4MKP A;  4X5V A;  2EZX A;  1O08 A;  1NKE A;  4F4Y A;  5AM1 A;  1QSL A;  4RT3 A;  3BQ7 A;  1TE2 A;  3HKZ F;  4Y2V A;  3EUB 2;  3JPN A;  2DPJ A;  4EYI B;  2OEH A;  1R8A A;  4F4K A;  4I2H A;  3LK9 A;  3C66 A; 
#chains in the Genus database with same CATH homology
 4QZC A;  5DLG A;  2HVI A;  2BQR A;  8ICB A;  1NK9 A;  1D9F A;  4IQT A;  2KZ3 A;  2V4R A;  5J0O A;  1T7P A;  4S3N A;  2W8L A;  2HHT A;  1ZQK A;  7ICT A;  2Q66 A;  5DQH A;  8ICL A;  5HHI A;  4DOC A;  4R65 A;  4ED3 A;  3HJ4 A;  4X4Q A;  4AT9 A;  8ICM A;  4PGQ A;  3KHH A;  1QTM A;  4E0D A;  7ICG A;  4O3S A;  3EPG A;  2A1J A;  3TAR A;  4IR1 A;  2XCA A;  3T5H A;  7ICU A;  4YXM A;  4M0A A;  7ICP A;  2DR9 A;  1C7Y A;  4DL6 A;  4BDP A;  8ICK A;  4EYH B;  1ZQR A;  4WC6 A;  1MIV A;  1SL1 A;  4WC0 A;  3OVA A;  2HHP A;  4IQV A;  3OV7 A;  5J29 A;  3C5G A;  5KFB A;  8ICF A;  1ZQY A;  4DFP A;  4E80 A;  4I2D A;  9ICB A;  1KTQ A;  3GV8 B;  3T5J A;  2BQ3 A;  2HHV A;  2R8G A;  2C28 A;  1DK3 A;  1VJ7 A;  2ID1 A;  5DDY A;  3NGD A;  2ISO A;  5KG3 A;  4JWM A;  2W9C B;  7ICQ A;  3SI8 A;  2BHN A;  4KLI A;  2W9A A;  3RR7 A;  4PHE A;  4B9U A;  4J9Q A;  1MQ3 A;  4RWN A;  3JPP A;  3PX4 A;  4DSK A;  2P6U A;  2FLP A;  1PZN A;  4HYK A;  1L3V A;  5KG1 A;  3EW9 A;  4Q8E A;  4Q43 A;  1IM4 A;  4ECW A;  2JEJ A;  5KFC A;  2R8K A;  3JYY A;  3OJU A;  8ICC A;  5KFV A;  3UXO A;  1XS9 D;  3H8S A;  2PI5 A;  3RJF A;  4J9O A;  1KNY A;  2PFO A;  2W8K A;  5KFD A;  4F5R A;  4O3P A;  2BCR A;  4ZH4 A;  4KLO A;  4KLU A;  5D46 A;  2ZTC A;  4YR3 A;  1BPZ A;  4BXO B;  4XQ7 A;  1PX5 A;  2J6S A;  1TK5 A;  2HHQ A;  8ICX A;  4TQR A;  4YVZ A;  2FLL A;  7ICI A;  3TQ1 A;  2ZHB A;  5KT5 A;  2AQ4 A;  3AQK A;  2DR5 A;  1RXW A;  5HRG A;  4MF8 A;  5KG7 A;  2ZJ5 A;  2XY5 A;  5IIK A;  3PNC A;  1Z00 A;  4PGX A;  3MFH A;  1S76 D;  5J2A A;  2AJQ A;  4X4N A;  1R8C A;  4PHA A;  2RDJ A;  4R8U A;  3AU6 A;  4F5Q A;  3PW4 A;  4MEX A;  4IQW A;  8ICP A;  5DG8 A;  5J0X A;  4C8O A;  4J9N A;  9ICQ A;  1VFG A;  4PHP A;  2Y1J A;  2KZM A;  2BQU A;  1BGX T;  5EOZ A;  8ICS A;  3V7J A;  2DRA A;  2MUT A;  4PH5 A;  4XQ8 A;  2AGQ A;  3RR8 A;  2W9B A;  4KLD A;  5BOM A;  1BPY A;  2M2W A;  3V6H A;  5J0W A;  1D8Y A;  1KFD A;  5KT2 A;  8ICQ A;  5EWF A;  4MFC A;  3MFI A;  5L1J A;  3C21 A;  4DOB A;  7ICH A;  4FBT A;  1KDH A;  4IRD A;  5HRL A;  4RQ4 A;  4F92 B;  3Q8M A;  2IA6 A;  5KT4 A;  5IIM A;  1DGS A;  1XC9 A;  1T4G A;  2MAX A;  4WCW A;  4TUP A;  1X2I A;  4WC7 A;  4ECR A;  7ICK A;  4RQ6 A;  4UB3 A;  4LZD A;  3HPO A;  4PHD A;  4DLE A;  4JUZ A;  1CUK A;  5KG0 A;  4F91 B;  5KFG A;  5KFF A;  5J0T A;  4ECS A;  4ED7 A;  1F5A A;  4F5O A;  1KFT A;  4P4O A;  5HP4 A;  3TI0 A;  1L3T A;  4ED1 A;  2KFN A;  2RFF A;  4I2F A;  4ED2 A;  2IMW P;  5J2E A;  5HRB A;  5L1I A;  4O5E A;  3OUY A;  4YD1 A;  1L3S A;  4DQI A;  1U9L A;  3ZDC A;  4X4S A;  2ZJ8 A;  1KFS A;  3V6K A;  4NKT A;  2OWO A;  1XSL A;  4RUA A;  2JZB B;  3UQ0 A;  4M9L A;  5CB1 A;  9ICT A;  4EBJ A;  2ZTE A;  2M2V A;  1UT8 A;  4QZI A;  4J9R A;  4EBC A;  4M9J A;  7ICF A;  5DB7 A;  5J0U A;  4DL4 A;  1QLN A;  4B9T A;  4J9P A;  4KIT B;  3TAP A;  3QEB Z;  2IHM A;  5BPC A;  4FH5 A;  5DKW A;  4NLG A;  2XO7 A;  3B0X A;  2ZH8 A;  4F4W A;  4Q45 A;  3C2K A;  3C5F A;  1NK7 A;  2DRB A;  4TUR A;  3Q8R B;  5KFP A;  5KFW A;  4O3N A;  4RT2 A;  3ZDD A;  4B9L A;  4JK1 A;  2HHS A;  3G6Y A;  4FHY A;  1RYS A;  2ZUB A;  5HR9 A;  3JPS A;  2ZH6 A;  9ICV A;  1BPX A;  3IHQ B;  4QW8 A;  4M6W B;  4QZB A;  9ICE A;  3PMN A;  1X9S A;  1RXV A;  1S0M A;  5F9L A;  2R8H A;  4B9S A;  2JEI A;  2O5A A;  3MR2 A;  4AT7 B;  2DFL A;  9ICS A;  4X0B A;  4F5N A;  1JMS A;  1Y88 A;  4GXI A;  2C2R A;  4YCX A;  1UA1 A;  4B9V A;  4MF2 A;  3OHA A;  5KFJ A;  1RZT A;  3H40 A;  3M8S A;  2BPF A;  3HWT A;  5KT7 A;  5KFL A;  2ZH1 A;  3G6X A;  4DS4 A;  2I9G A;  3TAN A;  4ELT A;  7ICJ A;  4NM1 A;  4DQR A;  5EWG A;  4RPY A;  1ZET A;  4DFK A;  1SKR A;  4I2B A;  4M04 A;  4KLM A;  1ZQZ A;  1Q78 A;  3AU2 A;  4UAZ A;  4ED8 A;  1NK4 A;  4BWM A;  3H39 A;  4RWP A;  3LWM A;  4QZF A;  4GXK A;  5J0Y A;  1S97 A;  2BR0 A;  2KTQ A;  4FHP A;  2F1J A;  4YXJ A;  2I1Q A;  4C8M A;  9ICJ A;  3OHB A;  2NRX A;  3K4G A;  4QZD A;  3BQ0 A;  4G3I A;  2RDI A;  2DPI A;  4YN4 A;  4QWA A;  1ZQI A;  2WTF A;  1FA0 A;  4RWO A;  2V9W A;  8ICE A;  4E7X A;  4P4P A;  5J2K A;  5III A;  9ICN A;  4ATB A;  5HRD A;  1JXL A;  4DQQ A;  4F8R A;  4RU9 A;  5CA7 A;  4ED0 A;  3SV4 A;  3AQL A;  5KG4 A;  2M2T A;  1NK8 A;  1ZQW A;  1OU5 A;  2Q0Z X;  2NRW A;  4DSI A;  2ZH3 A;  5HHH A;  2JEG A;  5DB9 A;  2C22 A;  5J2F A;  3RRH A;  1S9F A;  3UXN A;  2NRK A;  4R64 A;  4IRK A;  5HRI A;  3OSN A;  1K1Q A;  4EEY A;  4NLK A;  1TAU A;  1ZQC A;  5KFR A;  5KG6 A;  4KLJ A;  3FDS A;  2BKE A;  5TZV A;  3RJG A;  9ICL A;  3L9D A;  3GV5 B;  8ICR A;  1BPB A;  2ZJA A;  3QEA Z;  3GIK A;  3PW7 A;  4UB5 A;  5EWE A;  9ICK A;  4AT8 B;  5HRH A;  4FHW A;  3GV7 B;  3C1Y A;  2IBK A;  1ZQM A;  5KFA A;  3RB6 A;  4UD5 A;  5DQI A;  4FHV A;  4BGD A;  1TV9 A;  1ZQN A;  5CWR A;  1CEZ A;  2FPM A;  5J2I A;  4P2H A;  7ICR A;  2O1P A;  3T5L A;  4Q44 A;  3UQ2 A;  4YR2 A;  3NTU A;  5J0S A;  3SYZ A;  8ICH A;  1YLQ A;  1NJW A;  3V7L A;  9ICO A;  4YD2 A;  2HHU A;  3V6J A;  9ICW A;  3JPR A;  3FYH A;  5L9X A;  2BCQ A;  7ICS A;  3T3F A;  5KFO A;  4RNN A;  3H3A A;  3OVB A;  2KN7 A;  8ICV A;  3HX0 A;  5KT3 A;  1COO A;  1ZQE A;  3ZD8 A;  5J2G A;  4M2Y A;  2HVH A;  4AT9 B;  4KLF A;  2PXI A;  4KLL A;  3ZDB A;  2JEF A;  5DBB A;  5J0R A;  2XY6 A;  8ICN A;  1ZJN A;  4UB2 A;  2NRV A;  5BOL A;  3RAX A;  3LWL A;  2A1J B;  2V4Q A;  4Q8F A;  3MGI A;  3ZD9 A;  5KG5 A;  1TVA A;  4PPX A;  1X9W A;  3ISB A;  1ARO P;  3H4D A;  2ASJ A;  4I2J A;  4X4U A;  1D9D A;  4XA5 A;  1ZJM A;  2BDP A;  5L1K A;  4FBU A;  5CR0 A;  4ECX A;  3MGH A;  4EZ9 A;  4DQP A;  4QW9 A;  9ICI A;  4QZH A;  1SL0 A;  1NOM A;  1RPL A;  4J9K A;  1NK5 A;  1SKS A;  1ZQJ A;  5J2B A;  3AUO A;  4FH3 A;  3H7I A;  2FLN A;  1XSN A;  3M8R A;  4DL5 A;  5DGB A;  4KTQ A;  2XCP A;  3M9M B;  3AQN A;  4EP7 A;  2PFN A;  3WFO A;  1ZQP A;  3MBY A;  4QZA A;  1NK0 A;  4DSJ A;  7ICO A;  5CJ7 A;  4EBD A;  4M9H A;  4NKU A;  1TFR A;  3C23 A;  5L1L A;  5HNK A;  2B21 A;  3HT3 A;  4I28 A;  4UBB A;  2XGP A;  2DR8 A;  4DFJ A;  8ICG A;  1LV5 A;  5F2V O;  4MFF A;  4B9N A;  7ICM A;  2ZH9 A;  3SV3 A;  3OGU A;  4EBE A;  2ZH5 A;  1Q79 A;  4KLG A;  1UT5 A;  8ICJ A;  3AQM A;  4Z6C A;  2AGO A;  2FMQ A;  3V72 A;  1S0V A;  5DB6 A;  4RPZ A;  2XC9 A;  3MR6 A;  3H4B A;  1TK0 A;  5KFU A;  3RH5 A;  1KRP A;  3RJE A;  1U49 A;  3PO4 A;  4YMN A;  4DFM A;  1ZQU A;  4QWC A;  2J6U A;  1TK8 A;  4Z6F A;  3B0Y A;  1IXR A;  3ZDE A;  1H38 A;  1QSY A;  4WC4 A;  3GII A;  1TFY A;  5DQG A;  4QZ8 A;  3WFQ E;  3PO5 A;  4J9M A;  1Z00 B;  4KLT A;  4DO9 A;  1UEU A;  1WCL A;  9ICF A;  4R8U B;  4K4H A;  4WC3 A;  3WFR E;  8ICO A;  4YMM A;  4GXJ A;  4ECU A;  5J2H A;  1ZYQ A;  4R66 A;  9ICH A;  4FHX A;  4KLS A;  3M9N B;  2DVI A;  3OJS A;  5KTQ A;  4R63 A;  2MUT B;  2XY7 A;  2UVU A;  2PFQ A;  2W9B B;  2C2D A;  2W9M A;  1JQR A;  4I27 A;  4KLE A;  1UET A;  1MC8 A;  3JPO A;  4X4O A;  4WC2 A;  3C66 A;  4DSF A;  3MDC A;  4ECT A;  2UVR A;  1JX4 A;  7ICN A;  1ZQD A;  4X4V A;  4X4T A;  4ELV A;  1R89 A;  1TAQ A;  3RJK A;  4YQW A;  3ORY A;  3SZ2 A;  5JUM A;  3C18 A;  1NO5 A;  1ZQG A;  1WOT A;  4LZG A;  5KFX A;  2W9C A;  1MIW A;  4WC5 A;  3MDA A;  2ISP A;  8ICZ A;  4JV0 A;  5DG9 A;  3HIY A;  2FPL A;  4TQS A;  2NRT A;  4KN4 A;  5KFK A;  4DL7 A;  2KFZ A;  3Q8K A;  3BDP A;  3RJJ A;  4K4I A;  9ICA A;  5HML A;  2HHW A;  8ICW A;  4X4R A;  4JV2 A;  1KSP A;  5KFH A;  1T8E A;  9ICR A;  3HW8 A;  4I2A A;  5DB8 A;  4UAY A;  3OSP A;  1JAJ A;  3ISD A;  4DSE A;  4O5K A;  3OUY B;  3Q8S B;  3JPT A;  9ICU A;  5KT6 A;  4J9S A;  5DBC A;  1NK6 A;  3RJI A;  2FPK A;  4M9N A;  1S0N A;  3M9O B;  4DWI A;  5HRF A;  3H8J A;  3UPQ A;  3C2L A;  1B43 A;  5DGA A;  1K1S A;  1ZQO A;  3RTV A;  1HJP A;  3PR4 A;  4BXO A;  1X9M A;  3E2E A;  1HUO A;  2PI4 A;  4B9M A;  4C8L A;  4RQ1 A;  3PW5 A;  8ICA A;  4RWQ A;  3RAQ A;  2F1H A;  1TFW A;  4RNO A;  1XO1 A;  4F4X A;  1BVS A;  4XRH A;  3RB4 A;  1S10 A;  1U47 A;  1N56 A;  4P4M A;  3QE9 Y;  2VAN A;  1NJZ A;  1RYR A;  1BPE A;  4O9M A;  4F50 A;  3TFR A;  2C2E A;  2H5X A;  3GDX A;  4F3O A;  4RUC A;  3Q8L A;  5IIL A;  1XWL A;  2HW3 A;  9ICP A;  2F1I A;  3BQ2 A;  2UVW A;  4RQ2 A;  3TAQ A;  3HP6 A;  4O0I A;  2UVV A;  4BWJ A;  2XGQ A;  3ETL A;  4F4Z A;  3G6V A;  2BCU A;  1U4B A;  1QSS A;  2GWS A;  1NZP A;  4QWD A;  4M5D A;  4E8F A;  1Z3E B;  4DS5 A;  4RQ7 A;  5J2C A;  3PX6 A;  3WFP A;  1ZQV A;  2ZHA A;  4DQS A;  3PW2 A;  1ZQH A;  5IIO A;  9ICX A;  5DED A;  3PVX A;  4RQ5 A;  5F9N A;  2ALZ A;  4Z6D A;  4MEY A;  4X4P A;  3QZ8 A;  4QZ9 A;  3RRG A;  1V9P A;  3MR5 A;  5HC9 A;  4K4G A;  3H37 A;  3JPQ A;  4I2I A;  2BPC A;  3PW0 A;  7ICV A;  4IQU A;  2BE3 A;  2PBE A;  2BPG A;  1UA0 A;  4M47 A;  2VA8 A;  4FS1 A;  4DL3 A;  5J0Q A;  1SL2 A;  1ZQA A;  3ISC A;  3BQ1 A;  1A76 A;  3THV A;  1L5U A;  4IRC A;  2KP7 A;  4EZ6 A;  3JZ0 A;  4ATB B;  3N4M B;  3RBE A;  2ASL A;  3PML A;  1ZQT A;  3GIL A;  3ZDA A;  4DF4 A;  4DF8 A;  8ICT A;  5KFE A;  4GC7 A;  4FS2 A;  2P66 A;  3RH4 A;  1BNP A;  4RQ0 A;  4I29 A;  8ICY A;  3Q8P B;  1ZQS A;  1MIY A;  2KZZ A;  1MQ2 A;  4JWN A;  5DEC A;  4YMO A;  3V7K A;  2M2U A;  3UPS A;  3H38 A;  1SZP A;  5KG2 A;  4TUS A;  3K75 D;  4Z6E A;  3UXP A;  1U48 A;  1V4A A;  7ICE A;  1EXN A;  1D8L A;  5KFI A;  2Y1I A;  2JZB A;  3RH6 A;  5J0P A;  4NLZ A;  1S0O A;  1TKD A;  3IM1 A;  4UQG A;  2ZUC A;  4ELU A;  1HUZ A;  4WBY A;  5KFZ A;  3PX0 A;  3RBD A;  4KLQ A;  4O3Q A;  4KN7 A;  1JXE A;  3MAB A;  1BPD A;  1N48 A;  9ICC A;  2LYH A;  2ZH7 A;  4UB1 A;  2ZH4 A;  5D4B A;  3EYZ A;  4QWB A;  3Q8Q B;  3WFS C;  2VA2 A;  2VA3 A;  9ICM A;  5CP2 A;  5DBA A;  5C5J A;  1NJY A;  4YFK A;  4GLX A;  3NYB A;  4XUS A;  4KLH A;  1R8B A;  4DEZ A;  3EZ5 A;  1NKC A;  2R8I A;  1L3U A;  3RJH A;  4M6W A;  2BGW A;  5KFQ A;  4QZE A;  5DDM A;  5KFN A;  4DL2 A;  1XU4 A;  2R8J A;  4NY8 A;  5KFY A;  4ECV A;  2J6T A;  1DK2 A;  1JN3 A;  3TFS A;  5DG7 A;  4LVS A;  4AT7 A;  5IIJ A;  5KFS A;  5KFM A;  4KMU A;  1ZQB A;  8ICU A;  4C8N A;  1XSP A;  1KLN A;  1UEV A;  2NRZ A;  4JV1 A;  4UAW A;  5IIN A;  4X0A A;  4YP3 A;  2BCS A;  1U45 A;  4NM2 A;  5CHG A;  2BCV A;  4I2C A;  4YG2 A;  3BQT A;  1S77 D;  3EWA A;  1JIH A;  2ZUD A;  8ICI A;  3OVS A;  4ECY A;  5J2J A;  2HHX A;  4DLG A;  4O5C A;  3GIJ A;  3PR5 B;  1NKB A;  3QZ7 A;  2AGP A;  3MR3 A;  5HRE A;  4ED6 A;  3KHG A;  4ECQ A;  4I2E A;  3KHR A;  3HJ1 A;  3C1Z A;  1T3N A;  2FMS A;  5D49 A;  1LB2 B;  4F5P A;  1ZQQ A;  2IHN A;  4LT6 A;  4RNM A;  4WBZ A;  2ATL A;  1NJX A;  5HMM A;  5J2D A;  4ECZ A;  3GQC A;  4O3O A;  3KHL A;  4GC6 A;  3N97 B;  3RB3 A;  1SKW A;  1ZQL A;  4M9G A;  1ZQX A;  2ZTD A;  4NXZ A;  4NLN A;  4EBK A;  4RZR A;  9ICG A;  4MFA A;  1KEJ A;  4YR0 A;  4DOA A;  4FO6 A;  3T5K A;  4I2G A;  5HRK A;  1WCN A;  4TUQ A;  5DLF A;  4F2R A;  2ASD A;  4UB4 A;  2DR7 A;  4RQ8 A;  4WC1 A;  3BJY A;  4RQ3 A;  4RPX A;  4UBC A;  4CCH A;  1ZQF A;  4O3R A;  4UD4 A;  4F93 B;  3KTQ A;  4DSL A;  3PV8 A;  4F2S A;  4J9L A;  3LDA A;  4QWE A;  1DOQ A;  4X5V A;  2FMP A;  2AQ0 A;  3GFK B;  2AU0 A;  1NKE A;  4C8K A;  1MSW D;  2ZH2 A;  3GIM A;  4F4Y A;  1A77 A;  1QSL A;  4RT3 A;  4AT8 A;  2PFP A;  5KFT A;  3JPN A;  2DPJ A;  4QZG A;  3C2M A;  2P6R A;  3PY8 A;  4EYI B;  4IR9 A;  3RB0 A;  4PGY A;  1B22 A;  4IG8 A;  7ICL A;  1R8A A;  4F4K A;  4I2H A;  3LK9 A;  3EPI A;  3LQC B;  1BNO A;  3H8W A;  2M9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...