4GXJA

R283k dna polymerase beta ternary complex with a templating 8og and incoming dctp analog
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
326
structure length
315
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPLAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA polymerase minor groove interactions modulate mutagenic bypass of a templating 8-oxoguanine lesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 116
structure length 315
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4gxjA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4gxjA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4gxjA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4gxjA03
4UB2A 1ZQWA 4I2CA 2ZH3A 2P6UA 1FA0A 2VA3A 3JPTA 1BPYA 4DO9A 3RB4A 4AT7A 2PFOA 2PFQA 4E80A 4RQ6A 8ICBA 2HW3A 5DGBA 5J0YA 2ISPA 5KFYA 5HRDA 4TUQA 3C2KA 1XWLA 4QWEA 4GXJA 5KFLA 4MFFA 7ICNA 5J2HA 1TK8A 5HRGA 4ED1A 4YR3A 1ZQUA 5HHIA 5D4BA 2FLLA 3Q8KA 1TFWA 4I2BA 9ICJA 4RWOA 5CA7A 3M9NB 4F2RA 9ICKA 1ZQQA 1UA0A 3SI8A 7ICJA 3SYZA 1U48A 1R8BA 2HHXA 3G6YA 4F4WA 2V4RA 1S77D 4Z6DA 3LWMA 3EPIA 4NLNA 2RDJA 4YFKA 1ZETA 3EWAA 3PR4A 4AT9B 5HHHA 3AU2A 4GC6A 3Q8LA 3UQ0A 4JWMA 2JEIA 2KZMA 2ZH2A 4S3NA 4F92B 3C1YA 2HVHA 4F93B 8ICAA 1K1QA 2J6UA 4O5EA 5KG2A 7ICVA 8ICMA 2JZBA 2DRBA 3AQLA 3EW9A 4QWCA 3G6VA 1ZQPA 1XO1A 5EWEA 4RT3A 5KG1A 4EZ9A 4X4SA 3K75D 4KLJA 5DECA 1KFDA 4GXIA 3RB3A 1ZYQA 3PW7A 1LV5A 4I28A 2DPJA 3PW2A 2UVUA 5DDYA 4DL4A 7ICMA 4B9LA 3UXPA 1MC8A 5KTQA 1JN3A 3ZDEA 4M9GA 1ZQEA 8ICVA 1Y88A 5DEDA 3RH6A 5L1IA 3KHGA 4FS1A 4I2IA 5KFCA 1X2IA 3PX4A 1CUKA 4TURA 3HPOA 2R8KA 1A77A 3PO4A 2V4QA 2W9MA 2W9CB 1UEVA 4X4PA 4YR2A 4TQRA 4DLEA 2ZUCA 1ZQBA 1DGSA 1PX5A 5KFKA 2BE3A 1BPZA 2ZH1A 2J6SA 2ZJ5A 5KT5A 5J2BA 4ECVA 5J2GA 5J2CA 4DQSA 4BDPA 1UEUA 3T5JA 2DR5A 3N4MB 1TAQA 4RQ5A 4FS2A 1NK4A 2M2TA 2DR9A 4DL6A 2BCQA 4FH3A 5HRKA 5HMMA 4FBUA 2ZJAA 3GQCA 3KHLA 3JPQA 1U49A 2BR0A 1NKCA 2R8IA 2BPGA 4XRHA 3OHAA 1H38A 4TQSA 4Z6EA 3EYZA 2KN7A 2PXIA 4PPXA 5HRBA 3H7IA 2HVIA 3BQTA 4P4MA 3Q8PB 1MIYA 3QE9Y 3RH5A 4QW9A 4PHPA 2ZHBA 4ECRA 3JPRA 4UAZA 1D9FA 4PGQA 1TKDA 4ECTA 2F1IA 9ICCA 4UAWA 2MAXA 1Z00B 1S0OA 2A1JA 8ICIA 3JYYA 4BWMA 4O3RA 5IIIA 5KG6A 1ZQZA 3RJFA 4WBZA 4YR0A 2P66A 4ECZA 2ZHAA 4KITB 5J2FA 3MBYA 2ATLA 1ZQJA 2M2UA 1NK6A 4M47A 4DL3A 1XC9A 2MUTA 4IR9A 5KFUA 4F5PA 3QEAZ 1DK3A 3OV7A 2ZTDA 4O5KA 3OVBA 1S97A 1X9SA 2JEFA 5HREA 4PGYA 8ICOA 3T5HA 5DBBA 4DSFA 4DQIA 4ECQA 4KLIA 4RQ1A 2AGPA 4FHXA 2OWOA 4DFKA 3KHRA 4I2HA 4I2AA 4RUCA 8ICTA 2IHNA 3EZ5A 4JV2A 4WBYA 4NKUA 1KSPA 2ZTCA 5IIMA 2R8HA 4F2SA 4EBJA 2IMWP 4EYHB 1ZQFA 3OSNA 1R89A 4UD4A 3BQ1A 4B9MA 5KT2A 4DSLA 3OSPA 3T5LA 4X4VA 3H8WA 3ORYA 3SZ2A 1DOQA 3H4BA 4P4PA 4QWDA 3H40A 4PH5A 5KFEA 2ZH5A 3BJYA 2XY6A 4YMOA 3UXOA 3GIMA 1RZTA 3GV8B 1HUOA 2FMSA 3JPNA 4ATBB 5KFBA 4Q43A 3V7JA 3Q8QB 2ASLA 2DR8A 2ZH7A 2AU0A 1NK5A 4KLLA 5JUMA 5J2EA 3ISBA 4KLSA 1B43A 8ICCA 4O3NA 2XGQA 2J6TA 5J2DA 4RPYA 4M6WB 4DS4A 3PW4A 3M8RA 2Q66A 3ISDA 5CP2A 4WC1A 4ECUA 2DVIA 4DSEA 5EWGA 1U4BA 5IIJA 7ICEA 2NRWA 4R65A 4J9NA 4LZGA 2UVVA 4IRKA 3RAXA 4KTQA 5DKWA 4ZH4A 5J0SA 4UQGA 7ICSA 2KZ3A 2O5AA 5KFMA 5J0PA 5J0WA 1QSLA 2ZH6A 1SZPA 1LB2B 4DOAA 2XCPA 1EXNA 4P2HA 4RPZA 4DL7A 4QWBA 5KFZA 8ICNA 4KN7A 2W8KA 3AU6A 2M9NA 4B9UA 2KP7A 1UETA 4O3QA 4YN4A 4TUSA 8ICUA 5KG5A 1N56A 9ICUA 4PHEA 5J0TA 5DQHA 3B0YA 1ZQHA 1BGXT 1XSPA 1VJ7A 5KFNA 9ICGA 4JWNA 1XU4A 5KFRA 2BPFA 1NKEA 4G3IA 4WC4A 4Z6CA 2W9CA 3NYBA 2RFFA 3ZD8A 5IIOA 1X9WA 4IRCA 1C7YA 4FH5A 4J9MA 5KT7A 4QZAA 1MQ3A 4ED6A 7ICRA 4RWNA 1RYSA 4M9JA 3LDAA 4ED8A 4I2EA 2FMPA 1V4AA 2XC9A 2XCAA 4FHVA 4E7XA 4ECXA 4ECYA 3BDPA 3GFKB 4NXZA 4RQ4A 3N97B 2W9BB 2HHTA 4DFMA 5D46A 2ZH4A 3EPGA 2A1JB 4R8UA 3ETLA 1BNPA 2NRVA 3G6XA 2BCVA 5KG0A 3KHHA 3H38A 1KTQA 5KFJA 3RR7A 3PV8A 3C2MA 2DFLA 1ZQXA 2C2EA 2BPCA 1ZQSA 3WFQE 5L1LA 4GLXA 2KZZA 2VA8A 9ICNA 2R8JA 1QLNA 3PY8A 4MEYA 1ZQYA 3FYHA 3RBEA 2W9AA 1ZQOA 5KFFA 4IQWA 1K1SA 1X9MA 9ICEA 4BXOB 3H39A 5KFIA 1ZQMA 4X4RA 2LYHA 4O0IA 1MSWD 1N48A 3OHBA 8ICKA 4UAYA 4RU9A 4FHWA 4F5OA 3V6HA 3MR3A 4QZBA 4I2JA 4RQ3A 4FBTA 1NZPA 8ICZA 4ED2A 1Q78A 3E2EA 1ZJNA 3HP6A 1Z00A 7ICOA 1U9LA 3MDCA 8ICSA 4PHAA 4CCHA 3HIYA 4X4QA 1T4GA 4RQ8A 4DWIA 3T3FA 4KLOA 1NO5A 8ICGA 8ICRA 3MFIA 4YXJA 5EOZA 5DGAA 2V9WA 2ZJ8A 4QZ9A 3RR8A 2I1QA 4UB4A 2NRKA 1A76A 1NOMA 5KFDA 4J9PA 1TV9A 3RJGA 4K4GA 4M2YA 2KTQA 1CEZA 4M0AA 4YMNA 1U47A 2F1HA 4DOBA 4X4OA 4O3OA 5DB7A 2XGPA 4DQRA 2ZTEA 1YLQA 2ISOA 1D8LA 3HWTA 2W9BA 3OJSA 4DOCA 3UXNA 1S0VA 1PZNA 4RQ2A 2FPMA 1L3TA 1MIWA 1SKWA 4UB3A 1ZQTA 2DRAA 1L3SA 1F5AA 4F3OA 3GILA 4RNMA 3OJUA 5KT3A 3UPSA 4RNOA 3MR2A 1L5UA 4BXOA 4I2FA 3UPQA 4AT9A 3OVSA 1RPLA 2BDPA 2HHSA 2C28A 2HHUA 1S10A 4EBCA 9ICRA 4K4HA 5DG9A 2ASDA 5CHGA 4LVSA 4EBDA 5DBCA 5KG3A 2AGQA 2KFZA 5J0OA 9ICBA 2PBEA 3AQKA 2ALZA 4MF2A 5HRLA 1TFRA 1L3UA 3PX6A 7ICFA 4DSKA 1JMSA 2Y1IA 3V6KA 5L1KA 4F4YA 3H8SA 4R66A 1NK0A 2Y1JA 5HRHA 2HHWA 2O1PA 4WC0A 3C21A 1ZQVA 4C8NA 5CWRA 5J2KA 1UA1A 4YVZA 3AQNA 4DF4A 3C5FA 4BGDA 1HJPA 1UT5A 5KG7A 4YQWA 3MDAA 3HX0A 4DF8A 4Q45A 2BQRA 5DG8A 3TI0A 3AQMA 5DB9A 3H8JA 4J9RA 2BKEA 3TARA 8ICFA 5J0QA 7ICQA 1Q79A 9ICWA 5CR0A 4X5VA 3AUOA 3RRGA 2H5XA 4P4OA 3WFOA 2ASJA 4KLQA 1ZQGA 4F4ZA 4J9LA 4R63A 4RUAA 3C1ZA 4ED0A 4WC5A 3PR5B 5TZVA 1KFSA 9ICMA 3H4DA 3ISCA 4LZDA 3Q8RB 4ECWA 5EWFA 4KLDA 3C66A 3ZDBA 3HJ4A 9ICXA 4RPXA 1JAJA 5IILA 4RWQA 3PW0A 1D8YA 5J0XA 4M04A 3V7LA 3RAQA 3IM1A 4IQUA 4M9LA 7ICKA 8ICWA 4WC6A 1TFYA 4DLGA 4B9SA 2RDIA 1UT8A 9ICOA 5KFOA 4FHPA 4WC7A 4RNNA 3RH4A 5J29A 1KDHA 2HHVA 5KFTA 3FDSA 1NK9A 2FLPA 1KFTA 1XS9D 4GC7A 1JX4A 4KLEA 4EBKA 3GV5B 4B9NA 4C8KA 4RWPA 2FPLA 1B22A 1NJXA 1QTMA 2GWSA 3LQCB 5F9NA 2JZBB 5KFQA 4IQVA 1D9DA 2IA6A 9ICIA 4GXKA 4JUZA 5J0UA 4DQQA 9ICHA 1NJWA 1BNOA 2P6RA 1OU5A 4ELTA 1IM4A 4XA5A 3GDXA 7ICHA 2M2VA 4EYIB 3T5KA 3OUYB 2MUTB 2PFNA 2VANA 5KFAA 2DR7A 4WC3A 3PVXA 1R8CA 5J2IA 3ZDDA 5KFXA 2BCRA 3GV7B 3MGIA 1ZQIA 4JK1A 2C2RA 5CB1A 4WC2A 1XSLA 1JQRA 4JV0A 1RXVA 2ID1A 1RYRA 4NKTA 5HNKA 2BQ3A 4XQ7A 4F91B 1ZQDA 3GIJA 1ZQAA 3PMLA 1BVSA 4UB1A 4F5QA 1XSNA 4MEXA 1DK2A 2C22A 9ICTA 9ICQA 1MIVA 4M5DA 1NKBA 2ZH8A 5IINA 4DL2A 2PI4A 5HRIA 4LT6A 5DB6A 3OVAA 3RRHA 4J9OA 2JEJA 5KFGA 3LK9A 4AT7B 3PO5A 4X4UA 8ICHA 4X4NA 2WTFA 1BPEA 4J9SA 4K4IA 4ELUA 8ICJA 3HJ1A 4I27A 3H3AA 3QZ7A 3Q8SB 1WCLA 3C5GA 1TK0A 4KLUA 1S0MA 1QSYA 7ICUA 4NY8A 1SKSA 4J9KA 5F2VO 3M9OB 4QZHA 4HYKA 9ICVA 1TAUA 2BCUA 3RB0A 4QW8A 4M6WA 3HT3A 3M9MB 4DFJA 3QEBZ 1TVAA 1T8EA 4FO6A 4X0BA 5HMLA 2ZUDA 3MFHA 2W8LA 4C8OA 3RJJA 4QZCA 5HP4A 1SL2A 4ECSA 5HR9A 3TFRA 2JEGA 1BPXA 3H37A 3SV3A 4MF8A 1S0NA 4I29A 3WFPA 5KG4A 1IXRA 3RJKA 4YD1A 3OGUA 5DQGA 3RJEA 4F5NA 5HC9A 2ZUBA 4QZIA 4R64A 3LWLA 3TANA 1TK5A 2AJQA 2XY7A 2UVWA 3MABA 1HUZA 4MFCA 5DLFA 3ZDAA 4EEYA 4R8UB 5L9XA 4Q44A 1MQ2A 4E0DA 2AQ4A 4C8MA 3V72A 3BQ0A 4QZFA 5KFHA 4PGXA 3TAQA 4F5RA 2BQUA 4ELVA 3GIIA 4RQ7A 4NM1A 3C18A 1SL0A 4Q8FA 4I2GA 3HW8A 3BQ2A 4DL5A 1NK8A 5KFPA 3V7KA 4IR1A 7ICIA 8ICYA 4IQTA 3WFRE 2NRZA 1ZQRA 1QSSA 4KMUA 4QWAA 1S76D 4KLFA 4DSIA 4RT2A 4KLTA 4O9MA 4AT8B 3MR6A 1T7PA 5L1JA 1WOTA 2FLNA 4DSJA 2DPIA 2PI5A 4Z6FA 5DLGA 4NM2A 4MFAA 4KN4A 4AT8A 2C2DA 4YXMA 4FHYA 4QZ8A 4IG8A 5J2AA 5BOLA 2F1JA 3B0XA 4XQ8A 7ICGA 3PX0A 3JPSA 2PFPA 2ZH9A 4C8LA 3PNCA 3L9DA 3TAPA 1JXEA 3RTVA 5C5JA 4J9QA 3RBDA 2FMQA 4Q8EA 4QZDA 1T3NA 2IHMA 2VA2A 3ZDCA 4F4KA 3JZ0A 1BPBA 3GIKA 2M2WA 3K4GA 4TUPA 4IRDA 3MGHA 4X0AA 4I2DA 5DG7A 3KTQA 4F4XA 5D49A 5KFVA 4O3SA 1NJYA 9ICSA 4UD5A 9ICAA 5F9LA 4QZGA 3WFSC 2R8GA 4YCXA 5BPCA 8ICPA 4KLHA 1JIHA 4DQPA 5KFWA 4NLKA 5KFSA 2Q0ZX 4PHDA 4KLMA 4F8RA 4WCWA 3RB6A 1ZJMA 3C2LA 4M9HA 3IHQB 1NK7A 2XY5A 4YG2A 1Z3EB 3PMNA 2UVRA 4YP3A 5DB8A 5KT4A 3RJHA 2B21A 3ZD9A 2IBKA 5BOMA 3Q8MA 9ICFA 7ICTA 3RJIA 1AROP 4RQ0A 3MR5A 4JV1A 3C23A 4E8FA 1SKRA 4ATBA 3THVA 4NLZA 5DDMA 3TQ1A 4UB5A 1COOA 1NJZA 1ZQCA 1S9FA 1KNYA 4YMMA 4DS5A 1JXLA 4M9NA 4NLGA 7ICLA 2BGWA 2AGOA 4KLGA 2BHNA 5CJ7A 2HHQA 9ICLA 4O5CA 4QZEA 3NTUA 4F50A 1SL1A 8ICQA 4YD2A 3V6JA 4XUSA 4ED3A 3PW5A 5DQIA 1ZQNA 5HRFA 3JPPA 4DFPA 1KLNA 4O3PA 4EP7A 2FPKA 2NRXA 8ICXA 4RZRA 1KRPA 3NGDA 3TFSA 1ZQLA 3OUYA 4UBBA 5J0RA 3QZ8A 5IIKA 5J2JA 1R8AA 3JPOA 1VFGA 4BWJA 4EBEA 1WCNA 4ED7A 7ICPA 2HHPA 1ZQKA 1V9PA 9ICPA 4UBCA 1L3VA 1RXWA 1BPDA 2I9GA 3UQ2A 8ICEA 1KEJA 4B9TA 3SV4A 2NRTA 2AQ0A 8ICLA 4DEZA 2KFNA 4EZ6A 4X4TA 5KT6A 3M8SA 5DBAA 2XO7A 2BCSA 1U45A 4B9VA
chains in the Genus database with same CATH superfamily
4UB2A 3F2BA 2ZH3A 2VA3A 5AK4A 2G09A 2PFOA 4E80A 3QYPA 5HRDA 5KFYA 4TUQA 3C2KA 4QWEA 4GXJA 5KFLA 4MFFA 5HRGA 1ZQUA 3QUBA 5HHIA 2K4HA 5J8YC 4I2BA 5CA7A 9ICKA 2Y9UA 3CP8A 5JTIA 1ZQQA 3BS5B 1U48A 2HOIA 1R8BA 2KOBA 2HHXA 3EWAA 2JEIA 4JWMA 1QCKA 2KZMA 3UQ0A 2ZH2A 4F93B 4O5EA 8ICMA 2DRBA 3AQLA 1ZQPA 4QWCA 3DV9A 1XO1A 5AKHA 5KG1A 4LJXA 5DECA 3RB3A 1ZYQA 4I28A 1DXSA 3HRDD 1ZD3A 2UVUA 5DDYA 4B9LA 1MC8A 5GTHU 3CNHA 3NVZA 5E79U 5DEDA 3RH6A 1TAMA 2LKYA 4TURA 4X4PA 1ZQBA 4ECVA 5J2CA 4BDPA 3T5JA 1N5XA 3UM9A 1UCVA 5ALNA 4RQ5A 2JXJA 5ALLA 4FBUA 1U49A 4F71A 4XRHA 2PXIA 4Z6EA 3EYZA 4OAIZ 2KJ9A 3Q8PB 3QE9Y 3RH5A 4QW9A 4ECRA 9ICCA 4UAWA 1COKA 3JYYA 4BWMA 2P66A 2MA1A 4KITB 5J2FA 2M2UA 1XC9A 2XI9A 3OV7A 4IR9A 1DK3A 1S97A 1X9SA 1YZ7A 5DBBA 4DSFA 2OM6A 4RQ1A 5ALEA 2AGPA 4FHXA 2OWOA 3KHRA 2IHNA 3EZ5A 4JV2A 4NKUA 1KSPA 5IIMA 2R8HA 4F2SA 4EYHB 1ZQFA 4UD4A 4NXWA 3ORYA 1DOQA 4Y2RA 4NL9C 2HN2A 2VIXA 2XY6A 4UATA 4KLLA 8ICCA 5T14A 3AQFA 2QB1A 5J2DA 4RPYA 5ALXA 2DBYA 3M8RA 2A19A 2FJ6A 4DSEA 5EWGA 4R65A 3FAHA 4ZH4A 1F5SA 4UQGA 1X66A 3RFAA 5J0PA 1L7NA 5AIBA 4DL7A 2K8CB 5KFZA 4B9UA 4NJ8A 1IIPA 2M9NA 8ICNA 4O3QA 3WKAA 9ICUA 4PHEA 1ZQHA 1BGXT 5KFNA 3ICXA 4IC9A 1XU4A 4K9AA 5AKEA 2I5HA 4ED6A 4JLXA 2JH1A 3BDPA 2HHTA 5D46A 1SWWA 2PKEA 2A1JB 2YY6A 1V97A 3PSTA 5HR7A 2LBOA 5KFJA 3H38A 3PV8A 2DFLA 1ZQXA 1RDFA 3WFQE 2KZZA 2VA8A 2R8JA 3FYHA 4IQWA 3KD3A 4X4RA 1ZQMA 1O03A 2HN1A 2QB0B 4UAYA 2RHFA 1Q3VA 4I2JA 8ICZA 4ED2A 4K96A 4PL2A 1Z00A 3MDCA 3HIYA 3H0LB 3T3FA 2V9WA 1NOMA 5KFDA 4M2YA 2KTQA 3RJGA 1CEZA 1RQLA 2F1HA 4BUGA 3F2CA 2XGPA 1D8LA 3OJSA 1JROA 3FM9A 1PZNA 1S0VA 3NVOA 4P0PA 1ZQTA 1F5AA 2B6GA 4F3OA 3GILA 2KVSA 4RNMA 5KT3A 2ES6A 4I2FA 1X42A 2K8AA 9ICRA 2H3ZA 2ASDA 4EEDA 2F8LA 4EBDA 5DBCA 4U7CA 2AGQA 2LM1A 2GLEA 2KFZA 9ICBA 3AQKA 1DGJA 4MF2A 2LYBA 4KM5A 4DSKA 2Y1IA 3H8SA 4R66A 5HRHA 4G9BA 1ZQVA 5AK6A 2AHOB 4Y2TA 4YQWA 1HJPA 1UT5A 3HX0A 5DG8A 3AQMA 2F2AB 5DB9A 3H8JA 4J9RA 2BKEA 3TARA 9ICWA 5AM5A 1XNSA 4P4OA 2LYAA 4PZOA 4R63A 3C1ZA 4ED0A 1WG8A 3ZDBA 1VDVA 2MU2A 3IM1A 4O68A 3D2NA 4WC7A 4RNNA 3VCBA 1NK9A 2FLPA 4EBKA 4B9NA 3BS7A 1ZD4A 5KFQA 9ICIA 5J0UA 1PUZA 1NJWA 1Z4OA 2Y9TA 5KFAA 3QXGA 1R8CA 2A1AA 3AM9A 3IN5A 1XSLA 1RXVA 2ID1A 1RYRA 5HNKA 2EH9A 2HBLA 5ALRA 4XQ7A 3PSIA 1ZQAA 3PMLA 3BQ7A 4UB1A 2ZH8A 9ICTA 1NKBA 1S5LU 4UAUA 3SQIA 5DB6A 2ZIWB 2JEJA 3PO5A 8ICHA 5AK5A 3F53A 4J9SA 8ICJA 3HJ1A 3Q8SB 7ICUA 3KBBA 1QSYA 4KLUA 4NY8A 4J9KA 1ECWA 3RB0A 3M9MB 1T8EA 4X0BA 4UB6U 5AKLA 4FO6A 5HMLA 3RF9A 4C8OA 3RJJA 3TFRA 1BPXA 1S0NA 4I29A 3RJKA 4YD1A 3OGUA 2Q4TA 1V85A 3TANA 3MABA 1HUZA 3ZDAA 4MHVA 5L9XA 3V72A 3BQ0A 3C18A 1KKXA 4Q8FA 4Y2XA 1SV0A 3KZIU 3WFRE 1ZQRA 4DSIA 4O9MA 1WOTA 2DPIA 2RLTA 2GA9D 4AT8A 5AKYA 2W3RA 5J2AA 3PSPA 7ICGA 3RTVA 4Q8EA 1HEKA 2IHMA 2VA2A 2F44A 3GIKA 5DG7A 3KTQA 4WH5A 3MGVA 4O3SA 4UD5A 2GOLA 2G5HB 3L3FX 5CEHA 4DQPA 4NLKA 4KLMA 4RQMA 4CDGA 3C2LA 1NK7A 4YG2A 1Z3EB 2UVRA 2OYYA 3ZD9A 2LHTA 2FDRA 9ICFA 7ICTA 3JCFA 3F2DA 4ICAA 5EE9A 4RQ0A 4E8FA 4UB5A 4Y2YA 1JXLA 1KNYA 3M7DA 2AGOA 2BHNA 3IDWA 3QU4A 4OJ5A 4QZEA 8ICQA 5KL8B 3U26A 1Q46A 3JPPA 2WF7A 4O3PA 4RZRA 2YQEA 2HSZA 4JMUA 5J0RA 3QZ8A 4UASA 3GU3A 4EBEA 4FZLA 1VFGA 2HHPA 4UBCA 3NS1A 3UQ2A 2VKQA 2NRTA 8ICLA 4DEZA 2KFNA 5KT6A 3R9KA 4B9VA 1LKYA 2KVCA 5G5GA 1FA0A 2ZIWA 4DO9A 4AT7A 2KMDA 2PFQA 2HW3A 5DGBA 3DDHA 3SR6A 3OWGA 5J2HA 3B9JA 1TK8A 3CW2C 4YR3A 2W03A 2LM4A 3S6JA 1TFWA 9ICJA 3J81j 4EV6A 2LPEA 4RWOA 1Z19A 1UA0A 5K4LA 2V4RA 4Z6DA 2CXYA 1WUDA 4S3NA 4F92B 2HVHA 1PVRA 5KG2A 5JU5A 1PVQA 4EZ9A 4NLBA 3ONNA 1KFDA 5KAFU 4EX7A 2DPJA 1JUDA 2K60A 2E3TA 4DL4A 3UXPA 2ZIUA 1Y88A 2WF6A 4FS1A 1X2IA 4K98A 1MN8A 3PX4A 2R8KA 3PO4A 2PMZF 2V4QA 2W9MA 2H3FA 1UEVA 4YR2A 4USAA 4DLEA 2ZUCA 5KFKA 1BPZA 5KT5A 5J2BA 1ED1A 5HMMA 2ZJAA 3NRZA 3KHLA 2BPGA 2R8IA 4FZNA 4TQSA 2KN7A 1UQVA 3BQTA 4P4MA 1MIYA 2NO5A 4PHPA 3JPRA 1D9FA 4JB3A 4ECTA 2MAXA 1S0OA 2A1JA 2KHQA 4YR0A 2ZHAA 3MBYA 1ZQJA 4Y2UA 4M47A 3E58A 4DL3A 4NXVA 2MUTA 5AICA 1TE2A 5HREA 3TKAA 3KFUF 4DQIA 4ECQA 5EE1A 2IUBA 8ICTA 4RUCA 4C0ZA 2ZTCA 4EBJA 5KNIA 3OSNA 1R89A 4B9MA 4IS7A 4DSLA 3NRWA 3SZ2A 3H4BA 4PH5A 1ZXIA 3GIMA 1HUOA 5KFBA 4FFDA 1PK3A 3N7PD 2DR8A 4KX3A 5KL1B 5JUMA 4CF3A 3ISBA 1B43A 4M6WB 2DQNB 2DVIA 1N60A 4J9NA 3RAXA 2DKXA 5J0SA 2KZ3A 2K89A 2QKQA 2E8NA 2KP7A 4QWBA 3ZI4A 4KN7A 2W8KA 2DR7A 2JMGA 4TUSA 1N56A 5J0TA 3B0YA 3PHZA 9ICGA 3D6JA 1NKEA 2KG5A 3NUQA 3ZD8A 4WQKA 5KT7A 4C4TA 1RYSA 3ETRA 4ED8A 2FMPA 2B51A 3UMGA 1V4AA 4E7XA 4ECXA 4ECYA 3GFKB 1L8OA 2W9BB 4DFMA 2NYVA 5CHEA 1URJA 1BNPA 3ETLA 3K1ZA 3G6XA 1KTQA 3RR7A 3C2MA 5AK3A 5L1LA 9ICNA 4UB8U 1QLNA 4MEYA 2W9AA 3H39A 3ALRA 4BXOB 4O0IA 1N48A 2ZIXB 3I28A 5B3PA 4RQ3A 4FBTA 3QUQA 2KKVA 2JRZA 1ZJNA 1T4GA 3IG8A 4RQ8A 2FE9A 3MFIA 5EOZA 5DGAA 1FFUA 4LT6A 4UB4A 3C28A 3SAFA 1F0MA 5DB7A 3QU9A 4DQRA 2AXTU 5AI5A 2ZTEA 4CE6A 1YLQA 2ISOA 2HOQA 3HWTA 2W9BA 2KJ8A 1KQQA 1MA7A 1ZRNA 1L3TA 2PMZC 1L3SA 2HI0A 4FO1A 1X6IA 4EBCA 2GH1A 4WOYA 4K4HA 2EAMA 4AYBC 5KG3A 5AM1A 3CK6A 1L3UA 5L1KA 2O1PA 4EEKA 4WJ3B 5CWRA 5J2KA 1UA1A 2EZYA 4DF4A 3C5FA 2BQRA 4Y2VA 3QU2A 7ICQA 4P0PB 4X5VA 2EZXA 3AUOA 1SXDA 5ALTA 4UARA 4F4ZA 1ZD5A 4WC5A 3PR5B 3Q8RB 3C66A 1M6YA 4M04A 3V7LA 3RAQA 7ICKA 2YB1A 2QARA 1TFYA 2RDIA 9ICOA 3ER9B 2DF4B 3FDSA 1XS9D 2FPLA 1B22A 2GWSA 2KICA 4DQQA 2EANA 9ICHA 1BNOA 1IM4A 4XA5A 2M2VA 4EYIB 2MUTB 2WF5A 2W7PA 2PFNA 2VANA 1LVHA 3PVXA 5J2IA 5KFXA 5B3QA 3MGIA 2C2RA 2IOHA 3KZXA 4CNQA 4NKTA 2D3DA 1B0XA 4F5QA 1XSNA 4MEXA 4M5DA 1MIVA 2C22A 2D8CA 5IINA 2PI4A 4C7ZA 3RRHA 4J9OA 3LK9A 4AT7B 2KSOB 4OJOA 1BPEA 2YMPA 4K4IA 4X4NA 1LKYB 2E1FA 1X9XA 3M9OB 1TAUA 3QEBZ 5AKGA 2ZUDA 2JH7A 4OCZA 4ECSA 5HR9A 4MF8A 5KG4A 5AM2A 4F5NA 1N61A 2ZUBA 5KAIU 4QZIA 1TK5A 2AJQA 1QQ6A 4MFCA 1JALA 1UPHA 2KIVA 2YX8A 4R8UB 4Q44A 1MQ2A 4E0DA 2EQYA 3TAQA 2BQUA 4PGXA 4EEBA 4F5RA 4RQ7A 2F76X 5HR6A 1SL0A 7ICIA 3HW8A 4DL5A 5AI8A 1NK8A 8ICYA 1ZOLA 1S76D 1IG6A 4RT2A 4AT8B 3MR6A 4RQNA 1L8LA 5L1JA 2FLNA 2MSNA 1PK1A 2W55A 4NM2A 2C2DA 4FHYA 4QZ8A 2LMRA 5BOLA 2WAQC 3B0XA 3PX0A 3PNCA 3L9DA 2RQ5A 2ZIXA 3KOOA 1JXEA 3RBDA 4QJFB 4QZDA 4F4KA 3NVYA 4TUPA 3MGHA 2YMLA 4I2DA 4CF5A 4F4XA 5ALWA 5KFVA 9ICSA 1NJYA 2ZIVB 2OHFA 4QZGA 9ICAA 5BPCA 2BDUA 2CPRA 5AKJA 4M9HA 3WK5A 1F44A 4EENA 4OJPA 4YP3A 3RJHA 5KT4A 2B21A 3TADC 1AROP 3MR5A 4JV1A 3TACB 4ATBA 2KSOA 3THVA 1ZQCA 3TQ1A 2B56A 1S9FA 4YMMA 4BX9C 2BGWA 5CJ7A 9ICLA 3NTUA 4F50A 1WWVA 3WK7A 1Q8KA 3IP4B 3SAHA 5DQIA 4DFPA 1KLNA 1QQ7A 2NRXA 8ICXA 3NGDA 4B6JA 5IIKA 4LEWA 5J2JA 1R8AA 3JPOA 4BWJA 1WCNA 2K4EA 1ZQKA 1RXWA 4QIWC 2E5SA 1VJ5A 1Z4NA 5DBAA 4OD0A 1ZQWA 4I2CA 1BPYA 2YMQA 8ICBA 1XWLA 5ALZA 7ICNA 1GPJA 5D4BA 1IV8A 4KMOB 3M9NB 4F2RA 3SI8A 7ICJA 3SYZA 4F4WA 1S77D 3LWMA 4NLNA 4YFKA 5HHHA 3C1YA 8ICAA 7ICVA 2RP5A 2JZBA 3G6VA 1RYUA 5EWEA 4RT3A 1ZQ1C 2ZXHA 3K75D 3PW7A 5KTQA 4K99A 3ZDEA 8ICVA 4XJEA 1S8OA 1KL9A 3KHGA 1CUKA 3AMZA 2JR5A 4TQRA 1A0PA 2EWRA 1PX5A 2BE3A 4I0UA 2J6SA 2ZJ5A 4DQSA 4NLCA 5J2GA 3UMCA 1TAQA 4FS2A 1NK4A 2M2TA 4DL6A 2ZIVA 5HRKA 2QARB 3JPQA 2BR0A 5HRBA 5D63A 1QQ5A 4O3MA 4C80A 8ICIA 5G5HA 4O3RA 5KG6A 2W3SA 3QU7A 4WBZA 1NNLA 3BZKA 2OH2A 3K7DA 5B5EU 4F5PA 3QEAZ 3OVBA 4O5KA 2JEFA 8ICOA 1KBUA 5CFUA 1C20A 4KLIA 4I2HA 2HBJA 2EDUA 1Q3UA 2N1RA 3BQ1A 3T5LA 4NXUA 3H8WA 3H40A 5KFEA 4BJQA 3BJYA 4YMOA 3UXOA 1RZTA 3GV8B 3M1YA 4Q43A 3V7JA 3Q8QB 2ZH7A 2AU0A 1NK5A 3NWIA 4O3NA 3O0FA 4DS4A 3PW4A 2A3VA 4WC1A 5IIJA 7ICEA 2UVVA 4IRKA 4KTQA 5DKWA 7ICSA 2VJ4A 5KFMA 5J0WA 4NWIA 2KJ5A 2DKZA 4P2HA 4NXTA 4RPZA 1L7OA 3AU6A 2WHEA 5KG5A 5DQHA 4HAIA 1XSPA 1L7MA 1VJ7A 1CRXA 5ALHA 5KFRA 4P0QB 2BPFA 2YB4A 5AM4A 3NYBA 5IIOA 3I1YA 3N7SC 3WU2U 1C7YA 4FH5A 3ED5A 2XCAA 3KKAA 2HMXA 4NXZA 3N97B 5AKXA 2ZH4A 1OW5A 2JGAA 1DRGA 4R8UA 2NRVA 2C2EA 1ZQSA 4GLXA 4K97A 3GZFA 1ZQYA 1ZQOA 2IOFA 9ICEA 5KFFA 2K8BB 1X9MA 2ODGA 3OHBA 4O69A 3FC4A 1X40A 4F5OA 3V6HA 3MR3A 1FEZA 4AP9A 2WFAA 4CRXA 2NO4A 4X4QA 4KLOA 4DWIA 1NO5A 8ICGA 1UHUA 8ICRA 4N7RA 3RR8A 2FI1A 2ZJ8A 4QZ9A 2I1QA 1SZHA 1TV9A 2KKPA 4J9PA 1L7PA 4YMNA 4DOBA 2L5YA 4O3OA 5CRXA 4KX5A 5ALMA 3C29A 3WK4A 2ZG6A 3H8MA 4RQ2A 2FPMA 1MIWA 1SKWA 2BBHA 4US8A 2DRAA 2IOFK 3OJUA 4RNOA 3QU5A 5AI6A 3MR2A 3OVSA 4AT9A 1RPLA 2W7OA 2HHSA 2C28A 1S10A 5J8YA 5DG9A 1ZRMA 1RG6A 5ALKA 4NL9A 1SB3C 2OCEA 1KN5A 3PX6A 7ICFA 1JMSA 2NV3A 3C21A 1SWVA 4YVZA 5KG7A 3MDAA 5AKIA 4Q45A 3TI0A 5J0QA 3BS5A 3WK6A 2WF8A 3RRGA 3WFOA 2ASJA 4KLQA 5B66U 1ZQGA 2M0NA 1SIJA 4J9LA 2WAQF 5TZVA 4LZDA 4ECWA 5EWFA 4QIWF 4LEYA 4KB6A 9ICXA 5AIAA 3SMVA 2YN4A 5IILA 4RWQA 1D8YA 5J0XA 4IQUA 8ICWA 3SENA 1VLBA 3WKDA 4B9SA 1J97A 4FHPA 3L4PA 3RH4A 2HHVA 5KFTA 5AI9A 5AI0A 4GC7A 3GV5B 4RWPA 1QTMA 3F5EA 4IQVA 3UMBA 1D9DA 4GXKA 4JUZA 2P6RA 4ELTA 7ICHA 3OUYB 3T5KA 4Y2JA 4DCCA 1J2MA 4WC3A 1SXEA 3ZDDA 2BCRA 3GV7B 4JK1A 4WC2A 3DEEA 2DL0A 2BQ3A 1ZQDA 1BVSA 9ICQA 3VC8A 5HRIA 5KFGA 4X4UA 2WTFA 5AHXA 4ELUA 4I27A 3H3AA 1S0MA 5F2VO 2R18A 1T94A 4QZHA 4HYKA 3CRXA 2KV2A 4M6WA 4DFJA 2K4IA 4QZCA 5HP4A 1SL2A 2JEGA 1B4FA 3N7RC 3SV3A 4NV0A 2DWQA 1QH9A 3WFPA 2HBMA 1IXRA 3RJEA 2G0AA 4R64A 3LWLA 2UVWA 5DLFA 4OAFA 1SV4A 4EEYA 4C8MA 7ICRA 1N63A 4QZFA 4X4VA 4ELVA 1WWUA 5AKKA 4I2GA 3SAGA 5KFPA 3V7KA 4IQTA 2NRZA 1QSSA 2XICA 4CGZA 4Z6FA 4MFAA 4YXMA 1KW4A 2PFPA 4C8LA 4UW9A 3TAPA 4J9QA 5AM3A 3NVWA 1T3NA 3QUTA 3ZDCA 1BPBA 4O67A 3K4GA 2W04A 5JTGA 4X0AA 4HX0A 2E8PA 1X6JA 5F9LA 4YCXA 2WF9A 8ICPA 3T79A 1JIHA 1WYGA 5KFSA 2Q0ZX 4PHDA 4F8RA 3SD7A 3AEVA 3IHQB 2XY5A 5BOMA 3Q8MA 1CI4A 2Y0SF 3RJIA 4ZOHC 3C23A 2EAPA 4UAVA 3SEIA 1NJZA 1COOA 7ICLA 2HHQA 3BZCA 2HBKA 4O5CA 2GO7A 2OXOA 2E8OA 5AKZA 4EELA 3PZPA 3E0FA 4YD2A 3V6JA 5ALFA 5EE0A 4ED3A 4JLZA 2KHVA 2FPKA 2KIWA 1KRPA 1ZQLA 1T3QA 4Y2SA 4UBBA 2LI6A 2HDOA 4MKPA 4ED7A 9ICPA 1L3VA 8ICEA 1KEJA 4GIBA 2H3VA 2AQ0A 1SV0C 3LYSA 2G06A 3M8SA 5GTIU 2XO7A 1FFVA 3LVVA 2DGZA 2P6UA 3JPTA 3AN1A 3RB4A 4RQ6A 1YT3A 2G07A 2I6XA 2KD1A 5J0YA 2ISPA 5ALUA 4ED1A 2FLLA 3Q8KA 1OXJA 4IL6U 3G6YA 3EPIA 2RDJA 1ZETA 4AT9B 5ALSA 3PR4A 4GC6A 3AU2A 3Q8LA 2YMMA 3D2QA 1K1QA 2K4PA 2J6UA 4US9A 3ER8C 4OJLA 3EW9A 4X4SA 4KLJA 2KEYA 4GXIA 1LV5A 4PL1A 3PW2A 3L5KA 7ICMA 1V38A 3QNMA 1JN3A 4M9GA 1ZQEA 2MRLA 3NVVA 5L1IA 4OAHA 4I2IA 5KFCA 3HPOA 1A77A 2W9CB 3CYMA 1DGSA 2E1EA 1K5OA 2ZH1A 1UEUA 2DR5A 3N4MB 4C7YA 5CFSA 2DR9A 2BCQA 3D2SA 4FH3A 3GQCA 1NKCA 3OHAA 1H38A 3HILA 5AI4A 4PPXA 3H7IA 2HVIA 4EGWA 1RQNA 2H3IA 2ZHBA 4UAZA 4PGQA 4DFDA 1TKDA 2F1IA 1NZBA 1P7DA 1Z00B 3KKAC 5IIIA 3RJFA 1ZQZA 1FIQA 4ECZA 2ATLA 5D61A 1NK6A 3IV6A 3HKZF 5KFUA 1XO0A 2ZTDA 3OTQA 2D6FC 4PGYA 3T5HA 4LEVA 4DFKA 4WBYA 5D62A 4I2AA 4QNLA 4K9BA 2IMWP 3M6ZA 5KT2A 3OSPA 1N2XA 4P4PA 4QWDA 4OAGA 3F5AA 2ZH5A 2EZZA 1N62A 2FMSA 4ATBB 3JPNA 2ASLA 5A0LA 5ALVA 5J2EA 4KLSA 2W43A 2XGQA 2J6TA 2Y0SC 4F72A 4FZMA 2Q66A 3ISDA 5CP2A 4ECUA 1U4BA 2NRWA 5TISU 4LZGA 3WKEA 2HOFA 2WB1C 2B0CA 2O5AA 2ZH6A 1QSLA 4Y2PA 1SZPA 1LB2B 4DOAA 2F3NA 1EXNA 4ACOA 2XCPA 2CRXA 5ALIA 3A0BU 1UETA 1AQ6A 4WQLA 4YN4A 8ICUA 3QX7A 2Z7JA 1YZ6A 4JWNA 4G3IA 4WC4A 4Z6CA 2W9CA 2RFFA 1ZD2P 1X9WA 4IRCA 1PVPA 4J9MA 4QZAA 1MQ3A 1PK1B 1OUQA 4RWNA 4M9JA 3LDAA 4I2EA 2XC9A 4FHVA 2DUYA 4RQ4A 5EE3A 3EPGA 2BCVA 5KG0A 3KHHA 1N5WA 3WK9A 3WKBA 2BPCA 2EAOA 2G08A 3PY8A 3RBEA 1FO4A 1K1SA 2P35A 5KFIA 2LYHA 1MSWD 2JHDA 8ICKA 4FHWA 4RU9A 4QZBA 4PZNA 2BBJA 1NZPA 1Q78A 3E2EA 5FP0A 5L1MA 3HP6A 7ICOA 1U9LA 8ICSA 2W54A 4PHAA 4CCHA 1A6SA 3LQCB 4YXJA 2BZFA 2ESEA 2NRKA 1A76A 4K4GA 4M0AA 2XIDA 1U47A 4X4OA 3A0HU 3AL0B 3N28A 4DOCA 2W11A 3UXNA 2KE7A 4UB3A 3UPSA 4U6PA 1L5UA 4BXOA 3UPQA 2BDPA 4OJ6A 2HHUA 5CHGA 4LVSA 2F8KA 2WB1F 5J0OA 2PBEA 3MCRA 2ALZA 5HRLA 1TFRA 3V6KA 4F4YA 1NK0A 2Y1JA 3NASA 2HHWA 4WC0A 4C8NA 4C4RA 5ALGA 3AQNA 4BGDA 1RM6C 2CN1A 4EX6A 4DF8A 2O6KA 8ICFA 1Q79A 5F3XB 5CR0A 2H5XA 3HKZC 5AM0A 4RUAA 2AH5A 1KFSA 9ICMA 3H4DA 3ISCA 3HJ4A 4NXXA 4KLDA 2G5IB 4RPXA 1JAJA 2VJ5A 3PW0A 4M9LA 4WC6A 4DLGA 3H0RB 1UT8A 5KFOA 5J29A 1SGGA 1KDHA 1KFTA 1JRPA 1JX4A 4KLEA 3QUCA 4CF4A 4C8KA 5H2FU 1NJXA 5F9NA 2JZBB 3LVWA 2FCLA 2IA6A 3TADA 5ALYA 1OU5A 3GDXA 1ZQIA 5CB1A 2JV3A 1JQRA 4JV0A 4PJ0U 4F91B 3GIJA 1DK2A 4LEZA 4DL2A 3OVAA 4K8VA 4J03A 5ALOA 3QZ7A 1WCLA 3C5GA 1TK0A 3I76A 1SKSA 2ZXIA 9ICVA 2BCUA 3ERCC 2B4VA 4P0QA 4QW8A 3HT3A 3MC1A 1TVAA 3MFHA 2W8LA 1L6NA 2QB0A 3H37A 2RRDA 3AQEA 1HIWA 5DQGA 5HC9A 4Y2QA 2GAFD 2XY7A 2AQ4A 5KFHA 3GIIA 4NM1A 3BQ2A 4IR1A 4O6AA 4KMUA 5ALQA 4QWAA 4KLFA 4KLTA 3IG5A 1O08A 1T7PA 1GO3F 4DSJA 2PI5A 5DLGA 3NKUA 4KN4A 1J2NA 3K1RB 4IG8A 5ALJA 2E8MA 2F1JA 2XVTA 4XQ8A 2ZIUB 3JPSA 2ZH9A 3PSFA 2IHOA 2FMQA 5C5JA 3JZ0A 4OO1J 2M2WA 4IRDA 2KK0A 3IRUA 3M6KA 5D49A 5C0YA 3WFSC 2R8GA 4KLHA 5KFWA 4WCWA 3RB6A 1ZJMA 3PMNA 2H3QA 3H0MB 5DB8A 2IBKA 3EF2A 1SKRA 4NLZA 5DDMA 4AYBF 3EUB2 4DS5A 3WKCA 4M9NA 1Z1BA 4NLGA 1D8BA 4GFJA 4KLGA 5CFTA 3WK8A 1SL1A 2QLTA 3HJEA 2F77X 4XUSA 5ALPA 1Z1VA 5JRTA 1ZQNA 3PW5A 5HRFA 4EP7A 3TFSA 3OUYA 1NI3A 2YTUA 4A8EA 7ICPA 2KNJA 1JI7A 1V9PA 2I9GA 1BPDA 3OPXA 4B9TA 3SV4A 2OEHA 5ALDA 2HCFA 4EZ6A 4X4TA 4FE3A 2BCSA 1U45A 4C4SA
chains in the Genus database with same CATH topology
4UB2A 1ZQWA 4I2CA 2ZH3A 2P6UA 1FA0A 2VA3A 3JPTA 1BPYA 4DO9A 3RB4A 4AT7A 2PFOA 2PFQA 4E80A 4RQ6A 8ICBA 2HW3A 5DGBA 5J0YA 2ISPA 5KFYA 5HRDA 4TUQA 3C2KA 1XWLA 4QWEA 4GXJA 5KFLA 4MFFA 7ICNA 5J2HA 1TK8A 5HRGA 4ED1A 4YR3A 1ZQUA 5HHIA 5D4BA 2FLLA 3Q8KA 1TFWA 4I2BA 9ICJA 4RWOA 5CA7A 3M9NB 4F2RA 9ICKA 1ZQQA 1UA0A 3SI8A 7ICJA 3SYZA 1U48A 1R8BA 2HHXA 3G6YA 4F4WA 2V4RA 1S77D 4Z6DA 3LWMA 3EPIA 4NLNA 2RDJA 4YFKA 1ZETA 3EWAA 3PR4A 4AT9B 5HHHA 3AU2A 4GC6A 3Q8LA 3UQ0A 4JWMA 2JEIA 2KZMA 2ZH2A 4S3NA 4F92B 3C1YA 2HVHA 4F93B 8ICAA 1K1QA 2J6UA 4O5EA 5KG2A 7ICVA 8ICMA 2JZBA 2DRBA 3AQLA 3EW9A 4QWCA 3G6VA 1ZQPA 1XO1A 5EWEA 4RT3A 5KG1A 4EZ9A 4X4SA 3K75D 4KLJA 5DECA 1KFDA 4GXIA 3RB3A 1ZYQA 3PW7A 1LV5A 4I28A 2DPJA 3PW2A 2UVUA 5DDYA 4DL4A 7ICMA 4B9LA 3UXPA 1MC8A 5KTQA 1JN3A 3ZDEA 4M9GA 1ZQEA 8ICVA 1Y88A 5DEDA 3RH6A 5L1IA 3KHGA 4FS1A 4I2IA 5KFCA 1X2IA 3PX4A 1CUKA 4TURA 3HPOA 2R8KA 1A77A 3PO4A 2V4QA 2W9MA 2W9CB 1UEVA 4X4PA 4YR2A 4TQRA 4DLEA 2ZUCA 1ZQBA 1DGSA 1PX5A 5KFKA 2BE3A 1BPZA 2ZH1A 2J6SA 2ZJ5A 5KT5A 5J2BA 4ECVA 5J2GA 5J2CA 4DQSA 4BDPA 1UEUA 3T5JA 2DR5A 3N4MB 1TAQA 4RQ5A 4FS2A 1NK4A 2M2TA 2DR9A 4DL6A 2BCQA 4FH3A 5HRKA 5HMMA 4FBUA 2ZJAA 3GQCA 3KHLA 3JPQA 1U49A 2BR0A 1NKCA 2R8IA 2BPGA 4XRHA 3OHAA 1H38A 4TQSA 4Z6EA 3EYZA 2KN7A 2PXIA 4PPXA 5HRBA 3H7IA 2HVIA 3BQTA 4P4MA 3Q8PB 1MIYA 3QE9Y 3RH5A 4QW9A 4PHPA 2ZHBA 4ECRA 3JPRA 4UAZA 1D9FA 4PGQA 1TKDA 4ECTA 2F1IA 9ICCA 4UAWA 2MAXA 1Z00B 1S0OA 2A1JA 8ICIA 3JYYA 4BWMA 4O3RA 5IIIA 5KG6A 1ZQZA 3RJFA 4WBZA 4YR0A 2P66A 4ECZA 2ZHAA 4KITB 5J2FA 3MBYA 2ATLA 1ZQJA 2M2UA 1NK6A 4M47A 4DL3A 1XC9A 2MUTA 4IR9A 5KFUA 4F5PA 3QEAZ 1DK3A 3OV7A 2ZTDA 4O5KA 3OVBA 1S97A 1X9SA 2JEFA 5HREA 4PGYA 8ICOA 3T5HA 5DBBA 4DSFA 4DQIA 4ECQA 4KLIA 4RQ1A 2AGPA 4FHXA 2OWOA 4DFKA 3KHRA 4I2HA 4I2AA 4RUCA 8ICTA 2IHNA 3EZ5A 4JV2A 4WBYA 4NKUA 1KSPA 2ZTCA 5IIMA 2R8HA 4F2SA 4EBJA 2IMWP 4EYHB 1ZQFA 3OSNA 1R89A 4UD4A 3BQ1A 4B9MA 5KT2A 4DSLA 3OSPA 3T5LA 4X4VA 3H8WA 3ORYA 3SZ2A 1DOQA 3H4BA 4P4PA 4QWDA 3H40A 4PH5A 5KFEA 2ZH5A 3BJYA 2XY6A 4YMOA 3UXOA 3GIMA 1RZTA 3GV8B 1HUOA 2FMSA 3JPNA 4ATBB 5KFBA 4Q43A 3V7JA 3Q8QB 2ASLA 2DR8A 2ZH7A 2AU0A 1NK5A 4KLLA 5JUMA 5J2EA 3ISBA 4KLSA 1B43A 8ICCA 4O3NA 2XGQA 2J6TA 5J2DA 4RPYA 4M6WB 4DS4A 3PW4A 3M8RA 2Q66A 3ISDA 5CP2A 4WC1A 4ECUA 2DVIA 4DSEA 5EWGA 1U4BA 5IIJA 7ICEA 2NRWA 4R65A 4J9NA 4LZGA 2UVVA 4IRKA 3RAXA 4KTQA 5DKWA 4ZH4A 5J0SA 4UQGA 7ICSA 2KZ3A 2O5AA 5KFMA 5J0PA 5J0WA 1QSLA 2ZH6A 1SZPA 1LB2B 4DOAA 2XCPA 1EXNA 4P2HA 4RPZA 4DL7A 4QWBA 5KFZA 8ICNA 4KN7A 2W8KA 3AU6A 2M9NA 4B9UA 2KP7A 1UETA 4O3QA 4YN4A 4TUSA 8ICUA 5KG5A 1N56A 9ICUA 4PHEA 5J0TA 5DQHA 3B0YA 1ZQHA 1BGXT 1XSPA 1VJ7A 5KFNA 9ICGA 4JWNA 1XU4A 5KFRA 2BPFA 1NKEA 4G3IA 4WC4A 4Z6CA 2W9CA 3NYBA 2RFFA 3ZD8A 5IIOA 1X9WA 4IRCA 1C7YA 4FH5A 4J9MA 5KT7A 4QZAA 1MQ3A 4ED6A 7ICRA 4RWNA 1RYSA 4M9JA 3LDAA 4ED8A 4I2EA 2FMPA 1V4AA 2XC9A 2XCAA 4FHVA 4E7XA 4ECXA 4ECYA 3BDPA 3GFKB 4NXZA 4RQ4A 3N97B 2W9BB 2HHTA 4DFMA 5D46A 2ZH4A 3EPGA 2A1JB 4R8UA 3ETLA 1BNPA 2NRVA 3G6XA 2BCVA 5KG0A 3KHHA 3H38A 1KTQA 5KFJA 3RR7A 3PV8A 3C2MA 2DFLA 1ZQXA 2C2EA 2BPCA 1ZQSA 3WFQE 5L1LA 4GLXA 2KZZA 2VA8A 9ICNA 2R8JA 1QLNA 3PY8A 4MEYA 1ZQYA 3FYHA 3RBEA 2W9AA 1ZQOA 5KFFA 4IQWA 1K1SA 1X9MA 9ICEA 4BXOB 3H39A 5KFIA 1ZQMA 4X4RA 2LYHA 4O0IA 1MSWD 1N48A 3OHBA 8ICKA 4UAYA 4RU9A 4FHWA 4F5OA 3V6HA 3MR3A 4QZBA 4I2JA 4RQ3A 4FBTA 1NZPA 8ICZA 4ED2A 1Q78A 3E2EA 1ZJNA 3HP6A 1Z00A 7ICOA 1U9LA 3MDCA 8ICSA 4PHAA 4CCHA 3HIYA 4X4QA 1T4GA 4RQ8A 4DWIA 3T3FA 4KLOA 1NO5A 8ICGA 8ICRA 3MFIA 4YXJA 5EOZA 5DGAA 2V9WA 2ZJ8A 4QZ9A 3RR8A 2I1QA 4UB4A 2NRKA 1A76A 1NOMA 5KFDA 4J9PA 1TV9A 3RJGA 4K4GA 4M2YA 2KTQA 1CEZA 4M0AA 4YMNA 1U47A 2F1HA 4DOBA 4X4OA 4O3OA 5DB7A 2XGPA 4DQRA 2ZTEA 1YLQA 2ISOA 1D8LA 3HWTA 2W9BA 3OJSA 4DOCA 3UXNA 1S0VA 1PZNA 4RQ2A 2FPMA 1L3TA 1MIWA 1SKWA 4UB3A 1ZQTA 2DRAA 1L3SA 1F5AA 4F3OA 3GILA 4RNMA 3OJUA 5KT3A 3UPSA 4RNOA 3MR2A 1L5UA 4BXOA 4I2FA 3UPQA 4AT9A 3OVSA 1RPLA 2BDPA 2HHSA 2C28A 2HHUA 1S10A 4EBCA 9ICRA 4K4HA 5DG9A 2ASDA 5CHGA 4LVSA 4EBDA 5DBCA 5KG3A 2AGQA 2KFZA 5J0OA 9ICBA 2PBEA 3AQKA 2ALZA 4MF2A 5HRLA 1TFRA 1L3UA 3PX6A 7ICFA 4DSKA 1JMSA 2Y1IA 3V6KA 5L1KA 4F4YA 3H8SA 4R66A 1NK0A 2Y1JA 5HRHA 2HHWA 2O1PA 4WC0A 3C21A 1ZQVA 4C8NA 5CWRA 5J2KA 1UA1A 4YVZA 3AQNA 4DF4A 3C5FA 4BGDA 1HJPA 1UT5A 5KG7A 4YQWA 3MDAA 3HX0A 4DF8A 4Q45A 2BQRA 5DG8A 3TI0A 3AQMA 5DB9A 3H8JA 4J9RA 2BKEA 3TARA 8ICFA 5J0QA 7ICQA 1Q79A 9ICWA 5CR0A 4X5VA 3AUOA 3RRGA 2H5XA 4P4OA 3WFOA 2ASJA 4KLQA 1ZQGA 4F4ZA 4J9LA 4R63A 4RUAA 3C1ZA 4ED0A 4WC5A 3PR5B 5TZVA 1KFSA 9ICMA 3H4DA 3ISCA 4LZDA 3Q8RB 4ECWA 5EWFA 4KLDA 3C66A 3ZDBA 3HJ4A 9ICXA 4RPXA 1JAJA 5IILA 4RWQA 3PW0A 1D8YA 5J0XA 4M04A 3V7LA 3RAQA 3IM1A 4IQUA 4M9LA 7ICKA 8ICWA 4WC6A 1TFYA 4DLGA 4B9SA 2RDIA 1UT8A 9ICOA 5KFOA 4FHPA 4WC7A 4RNNA 3RH4A 5J29A 1KDHA 2HHVA 5KFTA 3FDSA 1NK9A 2FLPA 1KFTA 1XS9D 4GC7A 1JX4A 4KLEA 4EBKA 3GV5B 4B9NA 4C8KA 4RWPA 2FPLA 1B22A 1NJXA 1QTMA 2GWSA 3LQCB 5F9NA 2JZBB 5KFQA 4IQVA 1D9DA 2IA6A 9ICIA 4GXKA 4JUZA 5J0UA 4DQQA 9ICHA 1NJWA 1BNOA 2P6RA 1OU5A 4ELTA 1IM4A 4XA5A 3GDXA 7ICHA 2M2VA 4EYIB 3T5KA 3OUYB 2MUTB 2PFNA 2VANA 5KFAA 2DR7A 4WC3A 3PVXA 1R8CA 5J2IA 3ZDDA 5KFXA 2BCRA 3GV7B 3MGIA 1ZQIA 4JK1A 2C2RA 5CB1A 4WC2A 1XSLA 1JQRA 4JV0A 1RXVA 2ID1A 1RYRA 4NKTA 5HNKA 2BQ3A 4XQ7A 4F91B 1ZQDA 3GIJA 1ZQAA 3PMLA 1BVSA 4UB1A 4F5QA 1XSNA 4MEXA 1DK2A 2C22A 9ICTA 9ICQA 1MIVA 4M5DA 1NKBA 2ZH8A 5IINA 4DL2A 2PI4A 5HRIA 4LT6A 5DB6A 3OVAA 3RRHA 4J9OA 2JEJA 5KFGA 3LK9A 4AT7B 3PO5A 4X4UA 8ICHA 4X4NA 2WTFA 1BPEA 4J9SA 4K4IA 4ELUA 8ICJA 3HJ1A 4I27A 3H3AA 3QZ7A 3Q8SB 1WCLA 3C5GA 1TK0A 4KLUA 1S0MA 1QSYA 7ICUA 4NY8A 1SKSA 4J9KA 5F2VO 3M9OB 4QZHA 4HYKA 9ICVA 1TAUA 2BCUA 3RB0A 4QW8A 4M6WA 3HT3A 3M9MB 4DFJA 3QEBZ 1TVAA 1T8EA 4FO6A 4X0BA 5HMLA 2ZUDA 3MFHA 2W8LA 4C8OA 3RJJA 4QZCA 5HP4A 1SL2A 4ECSA 5HR9A 3TFRA 2JEGA 1BPXA 3H37A 3SV3A 4MF8A 1S0NA 4I29A 3WFPA 5KG4A 1IXRA 3RJKA 4YD1A 3OGUA 5DQGA 3RJEA 4F5NA 5HC9A 2ZUBA 4QZIA 4R64A 3LWLA 3TANA 1TK5A 2AJQA 2XY7A 2UVWA 3MABA 1HUZA 4MFCA 5DLFA 3ZDAA 4EEYA 4R8UB 5L9XA 4Q44A 1MQ2A 4E0DA 2AQ4A 4C8MA 3V72A 3BQ0A 4QZFA 5KFHA 4PGXA 3TAQA 4F5RA 2BQUA 4ELVA 3GIIA 4RQ7A 4NM1A 3C18A 1SL0A 4Q8FA 4I2GA 3HW8A 3BQ2A 4DL5A 1NK8A 5KFPA 3V7KA 4IR1A 7ICIA 8ICYA 4IQTA 3WFRE 2NRZA 1ZQRA 1QSSA 4KMUA 4QWAA 1S76D 4KLFA 4DSIA 4RT2A 4KLTA 4O9MA 4AT8B 3MR6A 1T7PA 5L1JA 1WOTA 2FLNA 4DSJA 2DPIA 2PI5A 4Z6FA 5DLGA 4NM2A 4MFAA 4KN4A 4AT8A 2C2DA 4YXMA 4FHYA 4QZ8A 4IG8A 5J2AA 5BOLA 2F1JA 3B0XA 4XQ8A 7ICGA 3PX0A 3JPSA 2PFPA 2ZH9A 4C8LA 3PNCA 3L9DA 3TAPA 1JXEA 3RTVA 5C5JA 4J9QA 3RBDA 2FMQA 4Q8EA 4QZDA 1T3NA 2IHMA 2VA2A 3ZDCA 4F4KA 3JZ0A 1BPBA 3GIKA 2M2WA 3K4GA 4TUPA 4IRDA 3MGHA 4X0AA 4I2DA 5DG7A 3KTQA 4F4XA 5D49A 5KFVA 4O3SA 1NJYA 9ICSA 4UD5A 9ICAA 5F9LA 4QZGA 3WFSC 2R8GA 4YCXA 5BPCA 8ICPA 4KLHA 1JIHA 4DQPA 5KFWA 4NLKA 5KFSA 2Q0ZX 4PHDA 4KLMA 4F8RA 4WCWA 3RB6A 1ZJMA 3C2LA 4M9HA 3IHQB 1NK7A 2XY5A 4YG2A 1Z3EB 3PMNA 2UVRA 4YP3A 5DB8A 5KT4A 3RJHA 2B21A 3ZD9A 2IBKA 5BOMA 3Q8MA 9ICFA 7ICTA 3RJIA 1AROP 4RQ0A 3MR5A 4JV1A 3C23A 4E8FA 1SKRA 4ATBA 3THVA 4NLZA 5DDMA 3TQ1A 4UB5A 1COOA 1NJZA 1ZQCA 1S9FA 1KNYA 4YMMA 4DS5A 1JXLA 4M9NA 4NLGA 7ICLA 2BGWA 2AGOA 4KLGA 2BHNA 5CJ7A 2HHQA 9ICLA 4O5CA 4QZEA 3NTUA 4F50A 1SL1A 8ICQA 4YD2A 3V6JA 4XUSA 4ED3A 3PW5A 5DQIA 1ZQNA 5HRFA 3JPPA 4DFPA 1KLNA 4O3PA 4EP7A 2FPKA 2NRXA 8ICXA 4RZRA 1KRPA 3NGDA 3TFSA 1ZQLA 3OUYA 4UBBA 5J0RA 3QZ8A 5IIKA 5J2JA 1R8AA 3JPOA 1VFGA 4BWJA 4EBEA 1WCNA 4ED7A 7ICPA 2HHPA 1ZQKA 1V9PA 9ICPA 4UBCA 1L3VA 1RXWA 1BPDA 2I9GA 3UQ2A 8ICEA 1KEJA 4B9TA 3SV4A 2NRTA 2AQ0A 8ICLA 4DEZA 2KFNA 4EZ6A 4X4TA 5KT6A 3M8SA 5DBAA 2XO7A 2BCSA 1U45A 4B9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB2 A;  1ZQW A;  4I2C A;  2ZH3 A;  2P6U A;  1FA0 A;  2VA3 A;  3JPT A;  1BPY A;  4DO9 A;  3RB4 A;  4AT7 A;  2PFO A;  2PFQ A;  4E80 A;  4RQ6 A;  8ICB A;  2HW3 A;  5DGB A;  5J0Y A;  2ISP A;  5KFY A;  5HRD A;  4TUQ A;  3C2K A;  1XWL A;  4QWE A;  4GXJ A;  5KFL A;  4MFF A;  7ICN A;  5J2H A;  1TK8 A;  5HRG A;  4ED1 A;  4YR3 A;  1ZQU A;  5HHI A;  5D4B A;  2FLL A;  3Q8K A;  1TFW A;  4I2B A;  9ICJ A;  4RWO A;  5CA7 A;  3M9N B;  4F2R A;  9ICK A;  1ZQQ A;  1UA0 A;  3SI8 A;  7ICJ A;  3SYZ A;  1U48 A;  1R8B A;  2HHX A;  3G6Y A;  4F4W A;  2V4R A;  1S77 D;  4Z6D A;  3LWM A;  3EPI A;  4NLN A;  2RDJ A;  4YFK A;  1ZET A;  3EWA A;  3PR4 A;  4AT9 B;  5HHH A;  3AU2 A;  4GC6 A;  3Q8L A;  3UQ0 A;  4JWM A;  2JEI A;  2KZM A;  2ZH2 A;  4S3N A;  4F92 B;  3C1Y A;  2HVH A;  4F93 B;  8ICA A;  1K1Q A;  2J6U A;  4O5E A;  5KG2 A;  7ICV A;  8ICM A;  2JZB A;  2DRB A;  3AQL A;  3EW9 A;  4QWC A;  3G6V A;  1ZQP A;  1XO1 A;  5EWE A;  4RT3 A;  5KG1 A;  4EZ9 A;  4X4S A;  3K75 D;  4KLJ A;  5DEC A;  1KFD A;  4GXI A;  3RB3 A;  1ZYQ A;  3PW7 A;  1LV5 A;  4I28 A;  2DPJ A;  3PW2 A;  2UVU A;  5DDY A;  4DL4 A;  7ICM A;  4B9L A;  3UXP A;  1MC8 A;  5KTQ A;  1JN3 A;  3ZDE A;  4M9G A;  1ZQE A;  8ICV A;  1Y88 A;  5DED A;  3RH6 A;  5L1I A;  3KHG A;  4FS1 A;  4I2I A;  5KFC A;  1X2I A;  3PX4 A;  1CUK A;  4TUR A;  3HPO A;  2R8K A;  1A77 A;  3PO4 A;  2V4Q A;  2W9M A;  2W9C B;  1UEV A;  4X4P A;  4YR2 A;  4TQR A;  4DLE A;  2ZUC A;  1ZQB A;  1DGS A;  1PX5 A;  5KFK A;  2BE3 A;  1BPZ A;  2ZH1 A;  2J6S A;  2ZJ5 A;  5KT5 A;  5J2B A;  4ECV A;  5J2G A;  5J2C A;  4DQS A;  4BDP A;  1UEU A;  3T5J A;  2DR5 A;  3N4M B;  1TAQ A;  4RQ5 A;  4FS2 A;  1NK4 A;  2M2T A;  2DR9 A;  4DL6 A;  2BCQ A;  4FH3 A;  5HRK A;  5HMM A;  4FBU A;  2ZJA A;  3GQC A;  3KHL A;  3JPQ A;  1U49 A;  2BR0 A;  1NKC A;  2R8I A;  2BPG A;  4XRH A;  3OHA A;  1H38 A;  4TQS A;  4Z6E A;  3EYZ A;  2KN7 A;  2PXI A;  4PPX A;  5HRB A;  3H7I A;  2HVI A;  3BQT A;  4P4M A;  3Q8P B;  1MIY A;  3QE9 Y;  3RH5 A;  4QW9 A;  4PHP A;  2ZHB A;  4ECR A;  3JPR A;  4UAZ A;  1D9F A;  4PGQ A;  1TKD A;  4ECT A;  2F1I A;  9ICC A;  4UAW A;  2MAX A;  1Z00 B;  1S0O A;  2A1J A;  8ICI A;  3JYY A;  4BWM A;  4O3R A;  5III A;  5KG6 A;  1ZQZ A;  3RJF A;  4WBZ A;  4YR0 A;  2P66 A;  4ECZ A;  2ZHA A;  4KIT B;  5J2F A;  3MBY A;  2ATL A;  1ZQJ A;  2M2U A;  1NK6 A;  4M47 A;  4DL3 A;  1XC9 A;  2MUT A;  4IR9 A;  5KFU A;  4F5P A;  3QEA Z;  1DK3 A;  3OV7 A;  2ZTD A;  4O5K A;  3OVB A;  1S97 A;  1X9S A;  2JEF A;  5HRE A;  4PGY A;  8ICO A;  3T5H A;  5DBB A;  4DSF A;  4DQI A;  4ECQ A;  4KLI A;  4RQ1 A;  2AGP A;  4FHX A;  2OWO A;  4DFK A;  3KHR A;  4I2H A;  4I2A A;  4RUC A;  8ICT A;  2IHN A;  3EZ5 A;  4JV2 A;  4WBY A;  4NKU A;  1KSP A;  2ZTC A;  5IIM A;  2R8H A;  4F2S A;  4EBJ A;  2IMW P;  4EYH B;  1ZQF A;  3OSN A;  1R89 A;  4UD4 A;  3BQ1 A;  4B9M A;  5KT2 A;  4DSL A;  3OSP A;  3T5L A;  4X4V A;  3H8W A;  3ORY A;  3SZ2 A;  1DOQ A;  3H4B A;  4P4P A;  4QWD A;  3H40 A;  4PH5 A;  5KFE A;  2ZH5 A;  3BJY A;  2XY6 A;  4YMO A;  3UXO A;  3GIM A;  1RZT A;  3GV8 B;  1HUO A;  2FMS A;  3JPN A;  4ATB B;  5KFB A;  4Q43 A;  3V7J A;  3Q8Q B;  2ASL A;  2DR8 A;  2ZH7 A;  2AU0 A;  1NK5 A;  4KLL A;  5JUM A;  5J2E A;  3ISB A;  4KLS A;  1B43 A;  8ICC A;  4O3N A;  2XGQ A;  2J6T A;  5J2D A;  4RPY A;  4M6W B;  4DS4 A;  3PW4 A;  3M8R A;  2Q66 A;  3ISD A;  5CP2 A;  4WC1 A;  4ECU A;  2DVI A;  4DSE A;  5EWG A;  1U4B A;  5IIJ A;  7ICE A;  2NRW A;  4R65 A;  4J9N A;  4LZG A;  2UVV A;  4IRK A;  3RAX A;  4KTQ A;  5DKW A;  4ZH4 A;  5J0S A;  4UQG A;  7ICS A;  2KZ3 A;  2O5A A;  5KFM A;  5J0P A;  5J0W A;  1QSL A;  2ZH6 A;  1SZP A;  1LB2 B;  4DOA A;  2XCP A;  1EXN A;  4P2H A;  4RPZ A;  4DL7 A;  4QWB A;  5KFZ A;  8ICN A;  4KN7 A;  2W8K A;  3AU6 A;  2M9N A;  4B9U A;  2KP7 A;  1UET A;  4O3Q A;  4YN4 A;  4TUS A;  8ICU A;  5KG5 A;  1N56 A;  9ICU A;  4PHE A;  5J0T A;  5DQH A;  3B0Y A;  1ZQH A;  1BGX T;  1XSP A;  1VJ7 A;  5KFN A;  9ICG A;  4JWN A;  1XU4 A;  5KFR A;  2BPF A;  1NKE A;  4G3I A;  4WC4 A;  4Z6C A;  2W9C A;  3NYB A;  2RFF A;  3ZD8 A;  5IIO A;  1X9W A;  4IRC A;  1C7Y A;  4FH5 A;  4J9M A;  5KT7 A;  4QZA A;  1MQ3 A;  4ED6 A;  7ICR A;  4RWN A;  1RYS A;  4M9J A;  3LDA A;  4ED8 A;  4I2E A;  2FMP A;  1V4A A;  2XC9 A;  2XCA A;  4FHV A;  4E7X A;  4ECX A;  4ECY A;  3BDP A;  3GFK B;  4NXZ A;  4RQ4 A;  3N97 B;  2W9B B;  2HHT A;  4DFM A;  5D46 A;  2ZH4 A;  3EPG A;  2A1J B;  4R8U A;  3ETL A;  1BNP A;  2NRV A;  3G6X A;  2BCV A;  5KG0 A;  3KHH A;  3H38 A;  1KTQ A;  5KFJ A;  3RR7 A;  3PV8 A;  3C2M A;  2DFL A;  1ZQX A;  2C2E A;  2BPC A;  1ZQS A;  3WFQ E;  5L1L A;  4GLX A;  2KZZ A;  2VA8 A;  9ICN A;  2R8J A;  1QLN A;  3PY8 A;  4MEY A;  1ZQY A;  3FYH A;  3RBE A;  2W9A A;  1ZQO A;  5KFF A;  4IQW A;  1K1S A;  1X9M A;  9ICE A;  4BXO B;  3H39 A;  5KFI A;  1ZQM A;  4X4R A;  2LYH A;  4O0I A;  1MSW D;  1N48 A;  3OHB A;  8ICK A;  4UAY A;  4RU9 A;  4FHW A;  4F5O A;  3V6H A;  3MR3 A;  4QZB A;  4I2J A;  4RQ3 A;  4FBT A;  1NZP A;  8ICZ A;  4ED2 A;  1Q78 A;  3E2E A;  1ZJN A;  3HP6 A;  1Z00 A;  7ICO A;  1U9L A;  3MDC A;  8ICS A;  4PHA A;  4CCH A;  3HIY A;  4X4Q A;  1T4G A;  4RQ8 A;  4DWI A;  3T3F A;  4KLO A;  1NO5 A;  8ICG A;  8ICR A;  3MFI A;  4YXJ A;  5EOZ A;  5DGA A;  2V9W A;  2ZJ8 A;  4QZ9 A;  3RR8 A;  2I1Q A;  4UB4 A;  2NRK A;  1A76 A;  1NOM A;  5KFD A;  4J9P A;  1TV9 A;  3RJG A;  4K4G A;  4M2Y A;  2KTQ A;  1CEZ A;  4M0A A;  4YMN A;  1U47 A;  2F1H A;  4DOB A;  4X4O A;  4O3O A;  5DB7 A;  2XGP A;  4DQR A;  2ZTE A;  1YLQ A;  2ISO A;  1D8L A;  3HWT A;  2W9B A;  3OJS A;  4DOC A;  3UXN A;  1S0V A;  1PZN A;  4RQ2 A;  2FPM A;  1L3T A;  1MIW A;  1SKW A;  4UB3 A;  1ZQT A;  2DRA A;  1L3S A;  1F5A A;  4F3O A;  3GIL A;  4RNM A;  3OJU A;  5KT3 A;  3UPS A;  4RNO A;  3MR2 A;  1L5U A;  4BXO A;  4I2F A;  3UPQ A;  4AT9 A;  3OVS A;  1RPL A;  2BDP A;  2HHS A;  2C28 A;  2HHU A;  1S10 A;  4EBC A;  9ICR A;  4K4H A;  5DG9 A;  2ASD A;  5CHG A;  4LVS A;  4EBD A;  5DBC A;  5KG3 A;  2AGQ A;  2KFZ A;  5J0O A;  9ICB A;  2PBE A;  3AQK A;  2ALZ A;  4MF2 A;  5HRL A;  1TFR A;  1L3U A;  3PX6 A;  7ICF A;  4DSK A;  1JMS A;  2Y1I A;  3V6K A;  5L1K A;  4F4Y A;  3H8S A;  4R66 A;  1NK0 A;  2Y1J A;  5HRH A;  2HHW A;  2O1P A;  4WC0 A;  3C21 A;  1ZQV A;  4C8N A;  5CWR A;  5J2K A;  1UA1 A;  4YVZ A;  3AQN A;  4DF4 A;  3C5F A;  4BGD A;  1HJP A;  1UT5 A;  5KG7 A;  4YQW A;  3MDA A;  3HX0 A;  4DF8 A;  4Q45 A;  2BQR A;  5DG8 A;  3TI0 A;  3AQM A;  5DB9 A;  3H8J A;  4J9R A;  2BKE A;  3TAR A;  8ICF A;  5J0Q A;  7ICQ A;  1Q79 A;  9ICW A;  5CR0 A;  4X5V A;  3AUO A;  3RRG A;  2H5X A;  4P4O A;  3WFO A;  2ASJ A;  4KLQ A;  1ZQG A;  4F4Z A;  4J9L A;  4R63 A;  4RUA A;  3C1Z A;  4ED0 A;  4WC5 A;  3PR5 B;  5TZV A;  1KFS A;  9ICM A;  3H4D A;  3ISC A;  4LZD A;  3Q8R B;  4ECW A;  5EWF A;  4KLD A;  3C66 A;  3ZDB A;  3HJ4 A;  9ICX A;  4RPX A;  1JAJ A;  5IIL A;  4RWQ A;  3PW0 A;  1D8Y A;  5J0X A;  4M04 A;  3V7L A;  3RAQ A;  3IM1 A;  4IQU A;  4M9L A;  7ICK A;  8ICW A;  4WC6 A;  1TFY A;  4DLG A;  4B9S A;  2RDI A;  1UT8 A;  9ICO A;  5KFO A;  4FHP A;  4WC7 A;  4RNN A;  3RH4 A;  5J29 A;  1KDH A;  2HHV A;  5KFT A;  3FDS A;  1NK9 A;  2FLP A;  1KFT A;  1XS9 D;  4GC7 A;  1JX4 A;  4KLE A;  4EBK A;  3GV5 B;  4B9N A;  4C8K A;  4RWP A;  2FPL A;  1B22 A;  1NJX A;  1QTM A;  2GWS A;  3LQC B;  5F9N A;  2JZB B;  5KFQ A;  4IQV A;  1D9D A;  2IA6 A;  9ICI A;  4GXK A;  4JUZ A;  5J0U A;  4DQQ A;  9ICH A;  1NJW A;  1BNO A;  2P6R A;  1OU5 A;  4ELT A;  1IM4 A;  4XA5 A;  3GDX A;  7ICH A;  2M2V A;  4EYI B;  3T5K A;  3OUY B;  2MUT B;  2PFN A;  2VAN A;  5KFA A;  2DR7 A;  4WC3 A;  3PVX A;  1R8C A;  5J2I A;  3ZDD A;  5KFX A;  2BCR A;  3GV7 B;  3MGI A;  1ZQI A;  4JK1 A;  2C2R A;  5CB1 A;  4WC2 A;  1XSL A;  1JQR A;  4JV0 A;  1RXV A;  2ID1 A;  1RYR A;  4NKT A;  5HNK A;  2BQ3 A;  4XQ7 A;  4F91 B;  1ZQD A;  3GIJ A;  1ZQA A;  3PML A;  1BVS A;  4UB1 A;  4F5Q A;  1XSN A;  4MEX A;  1DK2 A;  2C22 A;  9ICT A;  9ICQ A;  1MIV A;  4M5D A;  1NKB A;  2ZH8 A;  5IIN A;  4DL2 A;  2PI4 A;  5HRI A;  4LT6 A;  5DB6 A;  3OVA A;  3RRH A;  4J9O A;  2JEJ A;  5KFG A;  3LK9 A;  4AT7 B;  3PO5 A;  4X4U A;  8ICH A;  4X4N A;  2WTF A;  1BPE A;  4J9S A;  4K4I A;  4ELU A;  8ICJ A;  3HJ1 A;  4I27 A;  3H3A A;  3QZ7 A;  3Q8S B;  1WCL A;  3C5G A;  1TK0 A;  4KLU A;  1S0M A;  1QSY A;  7ICU A;  4NY8 A;  1SKS A;  4J9K A;  5F2V O;  3M9O B;  4QZH A;  4HYK A;  9ICV A;  1TAU A;  2BCU A;  3RB0 A;  4QW8 A;  4M6W A;  3HT3 A;  3M9M B;  4DFJ A;  3QEB Z;  1TVA A;  1T8E A;  4FO6 A;  4X0B A;  5HML A;  2ZUD A;  3MFH A;  2W8L A;  4C8O A;  3RJJ A;  4QZC A;  5HP4 A;  1SL2 A;  4ECS A;  5HR9 A;  3TFR A;  2JEG A;  1BPX A;  3H37 A;  3SV3 A;  4MF8 A;  1S0N A;  4I29 A;  3WFP A;  5KG4 A;  1IXR A;  3RJK A;  4YD1 A;  3OGU A;  5DQG A;  3RJE A;  4F5N A;  5HC9 A;  2ZUB A;  4QZI A;  4R64 A;  3LWL A;  3TAN A;  1TK5 A;  2AJQ A;  2XY7 A;  2UVW A;  3MAB A;  1HUZ A;  4MFC A;  5DLF A;  3ZDA A;  4EEY A;  4R8U B;  5L9X A;  4Q44 A;  1MQ2 A;  4E0D A;  2AQ4 A;  4C8M A;  3V72 A;  3BQ0 A;  4QZF A;  5KFH A;  4PGX A;  3TAQ A;  4F5R A;  2BQU A;  4ELV A;  3GII A;  4RQ7 A;  4NM1 A;  3C18 A;  1SL0 A;  4Q8F A;  4I2G A;  3HW8 A;  3BQ2 A;  4DL5 A;  1NK8 A;  5KFP A;  3V7K A;  4IR1 A;  7ICI A;  8ICY A;  4IQT A;  3WFR E;  2NRZ A;  1ZQR A;  1QSS A;  4KMU A;  4QWA A;  1S76 D;  4KLF A;  4DSI A;  4RT2 A;  4KLT A;  4O9M A;  4AT8 B;  3MR6 A;  1T7P A;  5L1J A;  1WOT A;  2FLN A;  4DSJ A;  2DPI A;  2PI5 A;  4Z6F A;  5DLG A;  4NM2 A;  4MFA A;  4KN4 A;  4AT8 A;  2C2D A;  4YXM A;  4FHY A;  4QZ8 A;  4IG8 A;  5J2A A;  5BOL A;  2F1J A;  3B0X A;  4XQ8 A;  7ICG A;  3PX0 A;  3JPS A;  2PFP A;  2ZH9 A;  4C8L A;  3PNC A;  3L9D A;  3TAP A;  1JXE A;  3RTV A;  5C5J A;  4J9Q A;  3RBD A;  2FMQ A;  4Q8E A;  4QZD A;  1T3N A;  2IHM A;  2VA2 A;  3ZDC A;  4F4K A;  3JZ0 A;  1BPB A;  3GIK A;  2M2W A;  3K4G A;  4TUP A;  4IRD A;  3MGH A;  4X0A A;  4I2D A;  5DG7 A;  3KTQ A;  4F4X A;  5D49 A;  5KFV A;  4O3S A;  1NJY A;  9ICS A;  4UD5 A;  9ICA A;  5F9L A;  4QZG A;  3WFS C;  2R8G A;  4YCX A;  5BPC A;  8ICP A;  4KLH A;  1JIH A;  4DQP A;  5KFW A;  4NLK A;  5KFS A;  2Q0Z X;  4PHD A;  4KLM A;  4F8R A;  4WCW A;  3RB6 A;  1ZJM A;  3C2L A;  4M9H A;  3IHQ B;  1NK7 A;  2XY5 A;  4YG2 A;  1Z3E B;  3PMN A;  2UVR A;  4YP3 A;  5DB8 A;  5KT4 A;  3RJH A;  2B21 A;  3ZD9 A;  2IBK A;  5BOM A;  3Q8M A;  9ICF A;  7ICT A;  3RJI A;  1ARO P;  4RQ0 A;  3MR5 A;  4JV1 A;  3C23 A;  4E8F A;  1SKR A;  4ATB A;  3THV A;  4NLZ A;  5DDM A;  3TQ1 A;  4UB5 A;  1COO A;  1NJZ A;  1ZQC A;  1S9F A;  1KNY A;  4YMM A;  4DS5 A;  1JXL A;  4M9N A;  4NLG A;  7ICL A;  2BGW A;  2AGO A;  4KLG A;  2BHN A;  5CJ7 A;  2HHQ A;  9ICL A;  4O5C A;  4QZE A;  3NTU A;  4F50 A;  1SL1 A;  8ICQ A;  4YD2 A;  3V6J A;  4XUS A;  4ED3 A;  3PW5 A;  5DQI A;  1ZQN A;  5HRF A;  3JPP A;  4DFP A;  1KLN A;  4O3P A;  4EP7 A;  2FPK A;  2NRX A;  8ICX A;  4RZR A;  1KRP A;  3NGD A;  3TFS A;  1ZQL A;  3OUY A;  4UBB A;  5J0R A;  3QZ8 A;  5IIK A;  5J2J A;  1R8A A;  3JPO A;  1VFG A;  4BWJ A;  4EBE A;  1WCN A;  4ED7 A;  7ICP A;  2HHP A;  1ZQK A;  1V9P A;  9ICP A;  4UBC A;  1L3V A;  1RXW A;  1BPD A;  2I9G A;  3UQ2 A;  8ICE A;  1KEJ A;  4B9T A;  3SV4 A;  2NRT A;  2AQ0 A;  8ICL A;  4DEZ A;  2KFN A;  4EZ6 A;  4X4T A;  5KT6 A;  3M8S A;  5DBA A;  2XO7 A;  2BCS A;  1U45 A;  4B9V A; 
#chains in the Genus database with same CATH topology
 4UB2 A;  3F2B A;  2ZH3 A;  2VA3 A;  5AK4 A;  2G09 A;  2PFO A;  4E80 A;  3QYP A;  5HRD A;  5KFY A;  4TUQ A;  3C2K A;  4QWE A;  4GXJ A;  5KFL A;  4MFF A;  5HRG A;  1ZQU A;  3QUB A;  5HHI A;  2K4H A;  5J8Y C;  4I2B A;  5CA7 A;  9ICK A;  2Y9U A;  3CP8 A;  5JTI A;  1ZQQ A;  3BS5 B;  1U48 A;  2HOI A;  1R8B A;  2KOB A;  2HHX A;  3EWA A;  2JEI A;  4JWM A;  1QCK A;  2KZM A;  3UQ0 A;  2ZH2 A;  4F93 B;  4O5E A;  8ICM A;  2DRB A;  3AQL A;  1ZQP A;  4QWC A;  3DV9 A;  1XO1 A;  5AKH A;  5KG1 A;  4LJX A;  5DEC A;  3RB3 A;  1ZYQ A;  4I28 A;  1DXS A;  3HRD D;  1ZD3 A;  2UVU A;  5DDY A;  4B9L A;  1MC8 A;  5GTH U;  3CNH A;  3NVZ A;  5E79 U;  5DED A;  3RH6 A;  1TAM A;  2LKY A;  4TUR A;  4X4P A;  1ZQB A;  4ECV A;  5J2C A;  4BDP A;  3T5J A;  1N5X A;  3UM9 A;  1UCV A;  5ALN A;  4RQ5 A;  2JXJ A;  5ALL A;  4FBU A;  1U49 A;  4F71 A;  4XRH A;  2PXI A;  4Z6E A;  3EYZ A;  4OAI Z;  2KJ9 A;  3Q8P B;  3QE9 Y;  3RH5 A;  4QW9 A;  4ECR A;  9ICC A;  4UAW A;  1COK A;  3JYY A;  4BWM A;  2P66 A;  2MA1 A;  4KIT B;  5J2F A;  2M2U A;  1XC9 A;  2XI9 A;  3OV7 A;  4IR9 A;  1DK3 A;  1S97 A;  1X9S A;  1YZ7 A;  5DBB A;  4DSF A;  2OM6 A;  4RQ1 A;  5ALE A;  2AGP A;  4FHX A;  2OWO A;  3KHR A;  2IHN A;  3EZ5 A;  4JV2 A;  4NKU A;  1KSP A;  5IIM A;  2R8H A;  4F2S A;  4EYH B;  1ZQF A;  4UD4 A;  4NXW A;  3ORY A;  1DOQ A;  4Y2R A;  4NL9 C;  2HN2 A;  2VIX A;  2XY6 A;  4UAT A;  4KLL A;  8ICC A;  5T14 A;  3AQF A;  2QB1 A;  5J2D A;  4RPY A;  5ALX A;  2DBY A;  3M8R A;  2A19 A;  2FJ6 A;  4DSE A;  5EWG A;  4R65 A;  3FAH A;  4ZH4 A;  1F5S A;  4UQG A;  1X66 A;  3RFA A;  5J0P A;  1L7N A;  5AIB A;  4DL7 A;  2K8C B;  5KFZ A;  4B9U A;  4NJ8 A;  1IIP A;  2M9N A;  8ICN A;  4O3Q A;  3WKA A;  9ICU A;  4PHE A;  1ZQH A;  1BGX T;  5KFN A;  3ICX A;  4IC9 A;  1XU4 A;  4K9A A;  5AKE A;  2I5H A;  4ED6 A;  4JLX A;  2JH1 A;  3BDP A;  2HHT A;  5D46 A;  1SWW A;  2PKE A;  2A1J B;  2YY6 A;  1V97 A;  3PST A;  5HR7 A;  2LBO A;  5KFJ A;  3H38 A;  3PV8 A;  2DFL A;  1ZQX A;  1RDF A;  3WFQ E;  2KZZ A;  2VA8 A;  2R8J A;  3FYH A;  4IQW A;  3KD3 A;  4X4R A;  1ZQM A;  1O03 A;  2HN1 A;  2QB0 B;  4UAY A;  2RHF A;  1Q3V A;  4I2J A;  8ICZ A;  4ED2 A;  4K96 A;  4PL2 A;  1Z00 A;  3MDC A;  3HIY A;  3H0L B;  3T3F A;  2V9W A;  1NOM A;  5KFD A;  4M2Y A;  2KTQ A;  3RJG A;  1CEZ A;  1RQL A;  2F1H A;  4BUG A;  3F2C A;  2XGP A;  1D8L A;  3OJS A;  1JRO A;  3FM9 A;  1PZN A;  1S0V A;  3NVO A;  4P0P A;  1ZQT A;  1F5A A;  2B6G A;  4F3O A;  3GIL A;  2KVS A;  4RNM A;  5KT3 A;  2ES6 A;  4I2F A;  1X42 A;  2K8A A;  9ICR A;  2H3Z A;  2ASD A;  4EED A;  2F8L A;  4EBD A;  5DBC A;  4U7C A;  2AGQ A;  2LM1 A;  2GLE A;  2KFZ A;  9ICB A;  3AQK A;  1DGJ A;  4MF2 A;  2LYB A;  4KM5 A;  4DSK A;  2Y1I A;  3H8S A;  4R66 A;  5HRH A;  4G9B A;  1ZQV A;  5AK6 A;  2AHO B;  4Y2T A;  4YQW A;  1HJP A;  1UT5 A;  3HX0 A;  5DG8 A;  3AQM A;  2F2A B;  5DB9 A;  3H8J A;  4J9R A;  2BKE A;  3TAR A;  9ICW A;  5AM5 A;  1XNS A;  4P4O A;  2LYA A;  4PZO A;  4R63 A;  3C1Z A;  4ED0 A;  1WG8 A;  3ZDB A;  1VDV A;  2MU2 A;  3IM1 A;  4O68 A;  3D2N A;  4WC7 A;  4RNN A;  3VCB A;  1NK9 A;  2FLP A;  4EBK A;  4B9N A;  3BS7 A;  1ZD4 A;  5KFQ A;  9ICI A;  5J0U A;  1PUZ A;  1NJW A;  1Z4O A;  2Y9T A;  5KFA A;  3QXG A;  1R8C A;  2A1A A;  3AM9 A;  3IN5 A;  1XSL A;  1RXV A;  2ID1 A;  1RYR A;  5HNK A;  2EH9 A;  2HBL A;  5ALR A;  4XQ7 A;  3PSI A;  1ZQA A;  3PML A;  3BQ7 A;  4UB1 A;  2ZH8 A;  9ICT A;  1NKB A;  1S5L U;  4UAU A;  3SQI A;  5DB6 A;  2ZIW B;  2JEJ A;  3PO5 A;  8ICH A;  5AK5 A;  3F53 A;  4J9S A;  8ICJ A;  3HJ1 A;  3Q8S B;  7ICU A;  3KBB A;  1QSY A;  4KLU A;  4NY8 A;  4J9K A;  1ECW A;  3RB0 A;  3M9M B;  1T8E A;  4X0B A;  4UB6 U;  5AKL A;  4FO6 A;  5HML A;  3RF9 A;  4C8O A;  3RJJ A;  3TFR A;  1BPX A;  1S0N A;  4I29 A;  3RJK A;  4YD1 A;  3OGU A;  2Q4T A;  1V85 A;  3TAN A;  3MAB A;  1HUZ A;  3ZDA A;  4MHV A;  5L9X A;  3V72 A;  3BQ0 A;  3C18 A;  1KKX A;  4Q8F A;  4Y2X A;  1SV0 A;  3KZI U;  3WFR E;  1ZQR A;  4DSI A;  4O9M A;  1WOT A;  2DPI A;  2RLT A;  2GA9 D;  4AT8 A;  5AKY A;  2W3R A;  5J2A A;  3PSP A;  7ICG A;  3RTV A;  4Q8E A;  1HEK A;  2IHM A;  2VA2 A;  2F44 A;  3GIK A;  5DG7 A;  3KTQ A;  4WH5 A;  3MGV A;  4O3S A;  4UD5 A;  2GOL A;  2G5H B;  3L3F X;  5CEH A;  4DQP A;  4NLK A;  4KLM A;  4RQM A;  4CDG A;  3C2L A;  1NK7 A;  4YG2 A;  1Z3E B;  2UVR A;  2OYY A;  3ZD9 A;  2LHT A;  2FDR A;  9ICF A;  7ICT A;  3JCF A;  3F2D A;  4ICA A;  5EE9 A;  4RQ0 A;  4E8F A;  4UB5 A;  4Y2Y A;  1JXL A;  1KNY A;  3M7D A;  2AGO A;  2BHN A;  3IDW A;  3QU4 A;  4OJ5 A;  4QZE A;  8ICQ A;  5KL8 B;  3U26 A;  1Q46 A;  3JPP A;  2WF7 A;  4O3P A;  4RZR A;  2YQE A;  2HSZ A;  4JMU A;  5J0R A;  3QZ8 A;  4UAS A;  3GU3 A;  4EBE A;  4FZL A;  1VFG A;  2HHP A;  4UBC A;  3NS1 A;  3UQ2 A;  2VKQ A;  2NRT A;  8ICL A;  4DEZ A;  2KFN A;  5KT6 A;  3R9K A;  4B9V A;  1LKY A;  2KVC A;  5G5G A;  1FA0 A;  2ZIW A;  4DO9 A;  4AT7 A;  2KMD A;  2PFQ A;  2HW3 A;  5DGB A;  3DDH A;  3SR6 A;  3OWG A;  5J2H A;  3B9J A;  1TK8 A;  3CW2 C;  4YR3 A;  2W03 A;  2LM4 A;  3S6J A;  1TFW A;  9ICJ A;  3J81 j;  4EV6 A;  2LPE A;  4RWO A;  1Z19 A;  1UA0 A;  5K4L A;  2V4R A;  4Z6D A;  2CXY A;  1WUD A;  4S3N A;  4F92 B;  2HVH A;  1PVR A;  5KG2 A;  5JU5 A;  1PVQ A;  4EZ9 A;  4NLB A;  3ONN A;  1KFD A;  5KAF U;  4EX7 A;  2DPJ A;  1JUD A;  2K60 A;  2E3T A;  4DL4 A;  3UXP A;  2ZIU A;  1Y88 A;  2WF6 A;  4FS1 A;  1X2I A;  4K98 A;  1MN8 A;  3PX4 A;  2R8K A;  3PO4 A;  2PMZ F;  2V4Q A;  2W9M A;  2H3F A;  1UEV A;  4YR2 A;  4USA A;  4DLE A;  2ZUC A;  5KFK A;  1BPZ A;  5KT5 A;  5J2B A;  1ED1 A;  5HMM A;  2ZJA A;  3NRZ A;  3KHL A;  2BPG A;  2R8I A;  4FZN A;  4TQS A;  2KN7 A;  1UQV A;  3BQT A;  4P4M A;  1MIY A;  2NO5 A;  4PHP A;  3JPR A;  1D9F A;  4JB3 A;  4ECT A;  2MAX A;  1S0O A;  2A1J A;  2KHQ A;  4YR0 A;  2ZHA A;  3MBY A;  1ZQJ A;  4Y2U A;  4M47 A;  3E58 A;  4DL3 A;  4NXV A;  2MUT A;  5AIC A;  1TE2 A;  5HRE A;  3TKA A;  3KFU F;  4DQI A;  4ECQ A;  5EE1 A;  2IUB A;  8ICT A;  4RUC A;  4C0Z A;  2ZTC A;  4EBJ A;  5KNI A;  3OSN A;  1R89 A;  4B9M A;  4IS7 A;  4DSL A;  3NRW A;  3SZ2 A;  3H4B A;  4PH5 A;  1ZXI A;  3GIM A;  1HUO A;  5KFB A;  4FFD A;  1PK3 A;  3N7P D;  2DR8 A;  4KX3 A;  5KL1 B;  5JUM A;  4CF3 A;  3ISB A;  1B43 A;  4M6W B;  2DQN B;  2DVI A;  1N60 A;  4J9N A;  3RAX A;  2DKX A;  5J0S A;  2KZ3 A;  2K89 A;  2QKQ A;  2E8N A;  2KP7 A;  4QWB A;  3ZI4 A;  4KN7 A;  2W8K A;  2DR7 A;  2JMG A;  4TUS A;  1N56 A;  5J0T A;  3B0Y A;  3PHZ A;  9ICG A;  3D6J A;  1NKE A;  2KG5 A;  3NUQ A;  3ZD8 A;  4WQK A;  5KT7 A;  4C4T A;  1RYS A;  3ETR A;  4ED8 A;  2FMP A;  2B51 A;  3UMG A;  1V4A A;  4E7X A;  4ECX A;  4ECY A;  3GFK B;  1L8O A;  2W9B B;  4DFM A;  2NYV A;  5CHE A;  1URJ A;  1BNP A;  3ETL A;  3K1Z A;  3G6X A;  1KTQ A;  3RR7 A;  3C2M A;  5AK3 A;  5L1L A;  9ICN A;  4UB8 U;  1QLN A;  4MEY A;  2W9A A;  3H39 A;  3ALR A;  4BXO B;  4O0I A;  1N48 A;  2ZIX B;  3I28 A;  5B3P A;  4RQ3 A;  4FBT A;  3QUQ A;  2KKV A;  2JRZ A;  1ZJN A;  1T4G A;  3IG8 A;  4RQ8 A;  2FE9 A;  3MFI A;  5EOZ A;  5DGA A;  1FFU A;  4LT6 A;  4UB4 A;  3C28 A;  3SAF A;  1F0M A;  5DB7 A;  3QU9 A;  4DQR A;  2AXT U;  5AI5 A;  2ZTE A;  4CE6 A;  1YLQ A;  2ISO A;  2HOQ A;  3HWT A;  2W9B A;  2KJ8 A;  1KQQ A;  1MA7 A;  1ZRN A;  1L3T A;  2PMZ C;  1L3S A;  2HI0 A;  4FO1 A;  1X6I A;  4EBC A;  2GH1 A;  4WOY A;  4K4H A;  2EAM A;  4AYB C;  5KG3 A;  5AM1 A;  3CK6 A;  1L3U A;  5L1K A;  2O1P A;  4EEK A;  4WJ3 B;  5CWR A;  5J2K A;  1UA1 A;  2EZY A;  4DF4 A;  3C5F A;  2BQR A;  4Y2V A;  3QU2 A;  7ICQ A;  4P0P B;  4X5V A;  2EZX A;  3AUO A;  1SXD A;  5ALT A;  4UAR A;  4F4Z A;  1ZD5 A;  4WC5 A;  3PR5 B;  3Q8R B;  3C66 A;  1M6Y A;  4M04 A;  3V7L A;  3RAQ A;  7ICK A;  2YB1 A;  2QAR A;  1TFY A;  2RDI A;  9ICO A;  3ER9 B;  2DF4 B;  3FDS A;  1XS9 D;  2FPL A;  1B22 A;  2GWS A;  2KIC A;  4DQQ A;  2EAN A;  9ICH A;  1BNO A;  1IM4 A;  4XA5 A;  2M2V A;  4EYI B;  2MUT B;  2WF5 A;  2W7P A;  2PFN A;  2VAN A;  1LVH A;  3PVX A;  5J2I A;  5KFX A;  5B3Q A;  3MGI A;  2C2R A;  2IOH A;  3KZX A;  4CNQ A;  4NKT A;  2D3D A;  1B0X A;  4F5Q A;  1XSN A;  4MEX A;  4M5D A;  1MIV A;  2C22 A;  2D8C A;  5IIN A;  2PI4 A;  4C7Z A;  3RRH A;  4J9O A;  3LK9 A;  4AT7 B;  2KSO B;  4OJO A;  1BPE A;  2YMP A;  4K4I A;  4X4N A;  1LKY B;  2E1F A;  1X9X A;  3M9O B;  1TAU A;  3QEB Z;  5AKG A;  2ZUD A;  2JH7 A;  4OCZ A;  4ECS A;  5HR9 A;  4MF8 A;  5KG4 A;  5AM2 A;  4F5N A;  1N61 A;  2ZUB A;  5KAI U;  4QZI A;  1TK5 A;  2AJQ A;  1QQ6 A;  4MFC A;  1JAL A;  1UPH A;  2KIV A;  2YX8 A;  4R8U B;  4Q44 A;  1MQ2 A;  4E0D A;  2EQY A;  3TAQ A;  2BQU A;  4PGX A;  4EEB A;  4F5R A;  4RQ7 A;  2F76 X;  5HR6 A;  1SL0 A;  7ICI A;  3HW8 A;  4DL5 A;  5AI8 A;  1NK8 A;  8ICY A;  1ZOL A;  1S76 D;  1IG6 A;  4RT2 A;  4AT8 B;  3MR6 A;  4RQN A;  1L8L A;  5L1J A;  2FLN A;  2MSN A;  1PK1 A;  2W55 A;  4NM2 A;  2C2D A;  4FHY A;  4QZ8 A;  2LMR A;  5BOL A;  2WAQ C;  3B0X A;  3PX0 A;  3PNC A;  3L9D A;  2RQ5 A;  2ZIX A;  3KOO A;  1JXE A;  3RBD A;  4QJF B;  4QZD A;  4F4K A;  3NVY A;  4TUP A;  3MGH A;  2YML A;  4I2D A;  4CF5 A;  4F4X A;  5ALW A;  5KFV A;  9ICS A;  1NJY A;  2ZIV B;  2OHF A;  4QZG A;  9ICA A;  5BPC A;  2BDU A;  2CPR A;  5AKJ A;  4M9H A;  3WK5 A;  1F44 A;  4EEN A;  4OJP A;  4YP3 A;  3RJH A;  5KT4 A;  2B21 A;  3TAD C;  1ARO P;  3MR5 A;  4JV1 A;  3TAC B;  4ATB A;  2KSO A;  3THV A;  1ZQC A;  3TQ1 A;  2B56 A;  1S9F A;  4YMM A;  4BX9 C;  2BGW A;  5CJ7 A;  9ICL A;  3NTU A;  4F50 A;  1WWV A;  3WK7 A;  1Q8K A;  3IP4 B;  3SAH A;  5DQI A;  4DFP A;  1KLN A;  1QQ7 A;  2NRX A;  8ICX A;  3NGD A;  4B6J A;  5IIK A;  4LEW A;  5J2J A;  1R8A A;  3JPO A;  4BWJ A;  1WCN A;  2K4E A;  1ZQK A;  1RXW A;  4QIW C;  2E5S A;  1VJ5 A;  1Z4N A;  5DBA A;  4OD0 A;  1ZQW A;  4I2C A;  1BPY A;  2YMQ A;  8ICB A;  1XWL A;  5ALZ A;  7ICN A;  1GPJ A;  5D4B A;  1IV8 A;  4KMO B;  3M9N B;  4F2R A;  3SI8 A;  7ICJ A;  3SYZ A;  4F4W A;  1S77 D;  3LWM A;  4NLN A;  4YFK A;  5HHH A;  3C1Y A;  8ICA A;  7ICV A;  2RP5 A;  2JZB A;  3G6V A;  1RYU A;  5EWE A;  4RT3 A;  1ZQ1 C;  2ZXH A;  3K75 D;  3PW7 A;  5KTQ A;  4K99 A;  3ZDE A;  8ICV A;  4XJE A;  1S8O A;  1KL9 A;  3KHG A;  1CUK A;  3AMZ A;  2JR5 A;  4TQR A;  1A0P A;  2EWR A;  1PX5 A;  2BE3 A;  4I0U A;  2J6S A;  2ZJ5 A;  4DQS A;  4NLC A;  5J2G A;  3UMC A;  1TAQ A;  4FS2 A;  1NK4 A;  2M2T A;  4DL6 A;  2ZIV A;  5HRK A;  2QAR B;  3JPQ A;  2BR0 A;  5HRB A;  5D63 A;  1QQ5 A;  4O3M A;  4C80 A;  8ICI A;  5G5H A;  4O3R A;  5KG6 A;  2W3S A;  3QU7 A;  4WBZ A;  1NNL A;  3BZK A;  2OH2 A;  3K7D A;  5B5E U;  4F5P A;  3QEA Z;  3OVB A;  4O5K A;  2JEF A;  8ICO A;  1KBU A;  5CFU A;  1C20 A;  4KLI A;  4I2H A;  2HBJ A;  2EDU A;  1Q3U A;  2N1R A;  3BQ1 A;  3T5L A;  4NXU A;  3H8W A;  3H40 A;  5KFE A;  4BJQ A;  3BJY A;  4YMO A;  3UXO A;  1RZT A;  3GV8 B;  3M1Y A;  4Q43 A;  3V7J A;  3Q8Q B;  2ZH7 A;  2AU0 A;  1NK5 A;  3NWI A;  4O3N A;  3O0F A;  4DS4 A;  3PW4 A;  2A3V A;  4WC1 A;  5IIJ A;  7ICE A;  2UVV A;  4IRK A;  4KTQ A;  5DKW A;  7ICS A;  2VJ4 A;  5KFM A;  5J0W A;  4NWI A;  2KJ5 A;  2DKZ A;  4P2H A;  4NXT A;  4RPZ A;  1L7O A;  3AU6 A;  2WHE A;  5KG5 A;  5DQH A;  4HAI A;  1XSP A;  1L7M A;  1VJ7 A;  1CRX A;  5ALH A;  5KFR A;  4P0Q B;  2BPF A;  2YB4 A;  5AM4 A;  3NYB A;  5IIO A;  3I1Y A;  3N7S C;  3WU2 U;  1C7Y A;  4FH5 A;  3ED5 A;  2XCA A;  3KKA A;  2HMX A;  4NXZ A;  3N97 B;  5AKX A;  2ZH4 A;  1OW5 A;  2JGA A;  1DRG A;  4R8U A;  2NRV A;  2C2E A;  1ZQS A;  4GLX A;  4K97 A;  3GZF A;  1ZQY A;  1ZQO A;  2IOF A;  9ICE A;  5KFF A;  2K8B B;  1X9M A;  2ODG A;  3OHB A;  4O69 A;  3FC4 A;  1X40 A;  4F5O A;  3V6H A;  3MR3 A;  1FEZ A;  4AP9 A;  2WFA A;  4CRX A;  2NO4 A;  4X4Q A;  4KLO A;  4DWI A;  1NO5 A;  8ICG A;  1UHU A;  8ICR A;  4N7R A;  3RR8 A;  2FI1 A;  2ZJ8 A;  4QZ9 A;  2I1Q A;  1SZH A;  1TV9 A;  2KKP A;  4J9P A;  1L7P A;  4YMN A;  4DOB A;  2L5Y A;  4O3O A;  5CRX A;  4KX5 A;  5ALM A;  3C29 A;  3WK4 A;  2ZG6 A;  3H8M A;  4RQ2 A;  2FPM A;  1MIW A;  1SKW A;  2BBH A;  4US8 A;  2DRA A;  2IOF K;  3OJU A;  4RNO A;  3QU5 A;  5AI6 A;  3MR2 A;  3OVS A;  4AT9 A;  1RPL A;  2W7O A;  2HHS A;  2C28 A;  1S10 A;  5J8Y A;  5DG9 A;  1ZRM A;  1RG6 A;  5ALK A;  4NL9 A;  1SB3 C;  2OCE A;  1KN5 A;  3PX6 A;  7ICF A;  1JMS A;  2NV3 A;  3C21 A;  1SWV A;  4YVZ A;  5KG7 A;  3MDA A;  5AKI A;  4Q45 A;  3TI0 A;  5J0Q A;  3BS5 A;  3WK6 A;  2WF8 A;  3RRG A;  3WFO A;  2ASJ A;  4KLQ A;  5B66 U;  1ZQG A;  2M0N A;  1SIJ A;  4J9L A;  2WAQ F;  5TZV A;  4LZD A;  4ECW A;  5EWF A;  4QIW F;  4LEY A;  4KB6 A;  9ICX A;  5AIA A;  3SMV A;  2YN4 A;  5IIL A;  4RWQ A;  1D8Y A;  5J0X A;  4IQU A;  8ICW A;  3SEN A;  1VLB A;  3WKD A;  4B9S A;  1J97 A;  4FHP A;  3L4P A;  3RH4 A;  2HHV A;  5KFT A;  5AI9 A;  5AI0 A;  4GC7 A;  3GV5 B;  4RWP A;  1QTM A;  3F5E A;  4IQV A;  3UMB A;  1D9D A;  4GXK A;  4JUZ A;  2P6R A;  4ELT A;  7ICH A;  3OUY B;  3T5K A;  4Y2J A;  4DCC A;  1J2M A;  4WC3 A;  1SXE A;  3ZDD A;  2BCR A;  3GV7 B;  4JK1 A;  4WC2 A;  3DEE A;  2DL0 A;  2BQ3 A;  1ZQD A;  1BVS A;  9ICQ A;  3VC8 A;  5HRI A;  5KFG A;  4X4U A;  2WTF A;  5AHX A;  4ELU A;  4I27 A;  3H3A A;  1S0M A;  5F2V O;  2R18 A;  1T94 A;  4QZH A;  4HYK A;  3CRX A;  2KV2 A;  4M6W A;  4DFJ A;  2K4I A;  4QZC A;  5HP4 A;  1SL2 A;  2JEG A;  1B4F A;  3N7R C;  3SV3 A;  4NV0 A;  2DWQ A;  1QH9 A;  3WFP A;  2HBM A;  1IXR A;  3RJE A;  2G0A A;  4R64 A;  3LWL A;  2UVW A;  5DLF A;  4OAF A;  1SV4 A;  4EEY A;  4C8M A;  7ICR A;  1N63 A;  4QZF A;  4X4V A;  4ELV A;  1WWU A;  5AKK A;  4I2G A;  3SAG A;  5KFP A;  3V7K A;  4IQT A;  2NRZ A;  1QSS A;  2XIC A;  4CGZ A;  4Z6F A;  4MFA A;  4YXM A;  1KW4 A;  2PFP A;  4C8L A;  4UW9 A;  3TAP A;  4J9Q A;  5AM3 A;  3NVW A;  1T3N A;  3QUT A;  3ZDC A;  1BPB A;  4O67 A;  3K4G A;  2W04 A;  5JTG A;  4X0A A;  4HX0 A;  2E8P A;  1X6J A;  5F9L A;  4YCX A;  2WF9 A;  8ICP A;  3T79 A;  1JIH A;  1WYG A;  5KFS A;  2Q0Z X;  4PHD A;  4F8R A;  3SD7 A;  3AEV A;  3IHQ B;  2XY5 A;  5BOM A;  3Q8M A;  1CI4 A;  2Y0S F;  3RJI A;  4ZOH C;  3C23 A;  2EAP A;  4UAV A;  3SEI A;  1NJZ A;  1COO A;  7ICL A;  2HHQ A;  3BZC A;  2HBK A;  4O5C A;  2GO7 A;  2OXO A;  2E8O A;  5AKZ A;  4EEL A;  3PZP A;  3E0F A;  4YD2 A;  3V6J A;  5ALF A;  5EE0 A;  4ED3 A;  4JLZ A;  2KHV A;  2FPK A;  2KIW A;  1KRP A;  1ZQL A;  1T3Q A;  4Y2S A;  4UBB A;  2LI6 A;  2HDO A;  4MKP A;  4ED7 A;  9ICP A;  1L3V A;  8ICE A;  1KEJ A;  4GIB A;  2H3V A;  2AQ0 A;  1SV0 C;  3LYS A;  2G06 A;  3M8S A;  5GTI U;  2XO7 A;  1FFV A;  3LVV A;  2DGZ A;  2P6U A;  3JPT A;  3AN1 A;  3RB4 A;  4RQ6 A;  1YT3 A;  2G07 A;  2I6X A;  2KD1 A;  5J0Y A;  2ISP A;  5ALU A;  4ED1 A;  2FLL A;  3Q8K A;  1OXJ A;  4IL6 U;  3G6Y A;  3EPI A;  2RDJ A;  1ZET A;  4AT9 B;  5ALS A;  3PR4 A;  4GC6 A;  3AU2 A;  3Q8L A;  2YMM A;  3D2Q A;  1K1Q A;  2K4P A;  2J6U A;  4US9 A;  3ER8 C;  4OJL A;  3EW9 A;  4X4S A;  4KLJ A;  2KEY A;  4GXI A;  1LV5 A;  4PL1 A;  3PW2 A;  3L5K A;  7ICM A;  1V38 A;  3QNM A;  1JN3 A;  4M9G A;  1ZQE A;  2MRL A;  3NVV A;  5L1I A;  4OAH A;  4I2I A;  5KFC A;  3HPO A;  1A77 A;  2W9C B;  3CYM A;  1DGS A;  2E1E A;  1K5O A;  2ZH1 A;  1UEU A;  2DR5 A;  3N4M B;  4C7Y A;  5CFS A;  2DR9 A;  2BCQ A;  3D2S A;  4FH3 A;  3GQC A;  1NKC A;  3OHA A;  1H38 A;  3HIL A;  5AI4 A;  4PPX A;  3H7I A;  2HVI A;  4EGW A;  1RQN A;  2H3I A;  2ZHB A;  4UAZ A;  4PGQ A;  4DFD A;  1TKD A;  2F1I A;  1NZB A;  1P7D A;  1Z00 B;  3KKA C;  5III A;  3RJF A;  1ZQZ A;  1FIQ A;  4ECZ A;  2ATL A;  5D61 A;  1NK6 A;  3IV6 A;  3HKZ F;  5KFU A;  1XO0 A;  2ZTD A;  3OTQ A;  2D6F C;  4PGY A;  3T5H A;  4LEV A;  4DFK A;  4WBY A;  5D62 A;  4I2A A;  4QNL A;  4K9B A;  2IMW P;  3M6Z A;  5KT2 A;  3OSP A;  1N2X A;  4P4P A;  4QWD A;  4OAG A;  3F5A A;  2ZH5 A;  2EZZ A;  1N62 A;  2FMS A;  4ATB B;  3JPN A;  2ASL A;  5A0L A;  5ALV A;  5J2E A;  4KLS A;  2W43 A;  2XGQ A;  2J6T A;  2Y0S C;  4F72 A;  4FZM A;  2Q66 A;  3ISD A;  5CP2 A;  4ECU A;  1U4B A;  2NRW A;  5TIS U;  4LZG A;  3WKE A;  2HOF A;  2WB1 C;  2B0C A;  2O5A A;  2ZH6 A;  1QSL A;  4Y2P A;  1SZP A;  1LB2 B;  4DOA A;  2F3N A;  1EXN A;  4ACO A;  2XCP A;  2CRX A;  5ALI A;  3A0B U;  1UET A;  1AQ6 A;  4WQL A;  4YN4 A;  8ICU A;  3QX7 A;  2Z7J A;  1YZ6 A;  4JWN A;  4G3I A;  4WC4 A;  4Z6C A;  2W9C A;  2RFF A;  1ZD2 P;  1X9W A;  4IRC A;  1PVP A;  4J9M A;  4QZA A;  1MQ3 A;  1PK1 B;  1OUQ A;  4RWN A;  4M9J A;  3LDA A;  4I2E A;  2XC9 A;  4FHV A;  2DUY A;  4RQ4 A;  5EE3 A;  3EPG A;  2BCV A;  5KG0 A;  3KHH A;  1N5W A;  3WK9 A;  3WKB A;  2BPC A;  2EAO A;  2G08 A;  3PY8 A;  3RBE A;  1FO4 A;  1K1S A;  2P35 A;  5KFI A;  2LYH A;  1MSW D;  2JHD A;  8ICK A;  4FHW A;  4RU9 A;  4QZB A;  4PZN A;  2BBJ A;  1NZP A;  1Q78 A;  3E2E A;  5FP0 A;  5L1M A;  3HP6 A;  7ICO A;  1U9L A;  8ICS A;  2W54 A;  4PHA A;  4CCH A;  1A6S A;  3LQC B;  4YXJ A;  2BZF A;  2ESE A;  2NRK A;  1A76 A;  4K4G A;  4M0A A;  2XID A;  1U47 A;  4X4O A;  3A0H U;  3AL0 B;  3N28 A;  4DOC A;  2W11 A;  3UXN A;  2KE7 A;  4UB3 A;  3UPS A;  4U6P A;  1L5U A;  4BXO A;  3UPQ A;  2BDP A;  4OJ6 A;  2HHU A;  5CHG A;  4LVS A;  2F8K A;  2WB1 F;  5J0O A;  2PBE A;  3MCR A;  2ALZ A;  5HRL A;  1TFR A;  3V6K A;  4F4Y A;  1NK0 A;  2Y1J A;  3NAS A;  2HHW A;  4WC0 A;  4C8N A;  4C4R A;  5ALG A;  3AQN A;  4BGD A;  1RM6 C;  2CN1 A;  4EX6 A;  4DF8 A;  2O6K A;  8ICF A;  1Q79 A;  5F3X B;  5CR0 A;  2H5X A;  3HKZ C;  5AM0 A;  4RUA A;  2AH5 A;  1KFS A;  9ICM A;  3H4D A;  3ISC A;  3HJ4 A;  4NXX A;  4KLD A;  2G5I B;  4RPX A;  1JAJ A;  2VJ5 A;  3PW0 A;  4M9L A;  4WC6 A;  4DLG A;  3H0R B;  1UT8 A;  5KFO A;  5J29 A;  1SGG A;  1KDH A;  1KFT A;  1JRP A;  1JX4 A;  4KLE A;  3QUC A;  4CF4 A;  4C8K A;  5H2F U;  1NJX A;  5F9N A;  2JZB B;  3LVW A;  2FCL A;  2IA6 A;  3TAD A;  5ALY A;  1OU5 A;  3GDX A;  1ZQI A;  5CB1 A;  2JV3 A;  1JQR A;  4JV0 A;  4PJ0 U;  4F91 B;  3GIJ A;  1DK2 A;  4LEZ A;  4DL2 A;  3OVA A;  4K8V A;  4J03 A;  5ALO A;  3QZ7 A;  1WCL A;  3C5G A;  1TK0 A;  3I76 A;  1SKS A;  2ZXI A;  9ICV A;  2BCU A;  3ERC C;  2B4V A;  4P0Q A;  4QW8 A;  3HT3 A;  3MC1 A;  1TVA A;  3MFH A;  2W8L A;  1L6N A;  2QB0 A;  3H37 A;  2RRD A;  3AQE A;  1HIW A;  5DQG A;  5HC9 A;  4Y2Q A;  2GAF D;  2XY7 A;  2AQ4 A;  5KFH A;  3GII A;  4NM1 A;  3BQ2 A;  4IR1 A;  4O6A A;  4KMU A;  5ALQ A;  4QWA A;  4KLF A;  4KLT A;  3IG5 A;  1O08 A;  1T7P A;  1GO3 F;  4DSJ A;  2PI5 A;  5DLG A;  3NKU A;  4KN4 A;  1J2N A;  3K1R B;  4IG8 A;  5ALJ A;  2E8M A;  2F1J A;  2XVT A;  4XQ8 A;  2ZIU B;  3JPS A;  2ZH9 A;  3PSF A;  2IHO A;  2FMQ A;  5C5J A;  3JZ0 A;  4OO1 J;  2M2W A;  4IRD A;  2KK0 A;  3IRU A;  3M6K A;  5D49 A;  5C0Y A;  3WFS C;  2R8G A;  4KLH A;  5KFW A;  4WCW A;  3RB6 A;  1ZJM A;  3PMN A;  2H3Q A;  3H0M B;  5DB8 A;  2IBK A;  3EF2 A;  1SKR A;  4NLZ A;  5DDM A;  4AYB F;  3EUB 2;  4DS5 A;  3WKC A;  4M9N A;  1Z1B A;  4NLG A;  1D8B A;  4GFJ A;  4KLG A;  5CFT A;  3WK8 A;  1SL1 A;  2QLT A;  3HJE A;  2F77 X;  4XUS A;  5ALP A;  1Z1V A;  5JRT A;  1ZQN A;  3PW5 A;  5HRF A;  4EP7 A;  3TFS A;  3OUY A;  1NI3 A;  2YTU A;  4A8E A;  7ICP A;  2KNJ A;  1JI7 A;  1V9P A;  2I9G A;  1BPD A;  3OPX A;  4B9T A;  3SV4 A;  2OEH A;  5ALD A;  2HCF A;  4EZ6 A;  4X4T A;  4FE3 A;  2BCS A;  1U45 A;  4C4S A; 
#chains in the Genus database with same CATH homology
 4UB2 A;  1ZQW A;  4I2C A;  2ZH3 A;  2P6U A;  1FA0 A;  2VA3 A;  3JPT A;  1BPY A;  4DO9 A;  3RB4 A;  4AT7 A;  2PFO A;  2PFQ A;  4E80 A;  4RQ6 A;  8ICB A;  2HW3 A;  5DGB A;  5J0Y A;  2ISP A;  5KFY A;  5HRD A;  4TUQ A;  3C2K A;  1XWL A;  4QWE A;  4GXJ A;  5KFL A;  4MFF A;  7ICN A;  5J2H A;  1TK8 A;  5HRG A;  4ED1 A;  4YR3 A;  1ZQU A;  5HHI A;  5D4B A;  2FLL A;  3Q8K A;  1TFW A;  4I2B A;  9ICJ A;  4RWO A;  5CA7 A;  3M9N B;  4F2R A;  9ICK A;  1ZQQ A;  1UA0 A;  3SI8 A;  7ICJ A;  3SYZ A;  1U48 A;  1R8B A;  2HHX A;  3G6Y A;  4F4W A;  2V4R A;  1S77 D;  4Z6D A;  3LWM A;  3EPI A;  4NLN A;  2RDJ A;  4YFK A;  1ZET A;  3EWA A;  3PR4 A;  4AT9 B;  5HHH A;  3AU2 A;  4GC6 A;  3Q8L A;  3UQ0 A;  4JWM A;  2JEI A;  2KZM A;  2ZH2 A;  4S3N A;  4F92 B;  3C1Y A;  2HVH A;  4F93 B;  8ICA A;  1K1Q A;  2J6U A;  4O5E A;  5KG2 A;  7ICV A;  8ICM A;  2JZB A;  2DRB A;  3AQL A;  3EW9 A;  4QWC A;  3G6V A;  1ZQP A;  1XO1 A;  5EWE A;  4RT3 A;  5KG1 A;  4EZ9 A;  4X4S A;  3K75 D;  4KLJ A;  5DEC A;  1KFD A;  4GXI A;  3RB3 A;  1ZYQ A;  3PW7 A;  1LV5 A;  4I28 A;  2DPJ A;  3PW2 A;  2UVU A;  5DDY A;  4DL4 A;  7ICM A;  4B9L A;  3UXP A;  1MC8 A;  5KTQ A;  1JN3 A;  3ZDE A;  4M9G A;  1ZQE A;  8ICV A;  1Y88 A;  5DED A;  3RH6 A;  5L1I A;  3KHG A;  4FS1 A;  4I2I A;  5KFC A;  1X2I A;  3PX4 A;  1CUK A;  4TUR A;  3HPO A;  2R8K A;  1A77 A;  3PO4 A;  2V4Q A;  2W9M A;  2W9C B;  1UEV A;  4X4P A;  4YR2 A;  4TQR A;  4DLE A;  2ZUC A;  1ZQB A;  1DGS A;  1PX5 A;  5KFK A;  2BE3 A;  1BPZ A;  2ZH1 A;  2J6S A;  2ZJ5 A;  5KT5 A;  5J2B A;  4ECV A;  5J2G A;  5J2C A;  4DQS A;  4BDP A;  1UEU A;  3T5J A;  2DR5 A;  3N4M B;  1TAQ A;  4RQ5 A;  4FS2 A;  1NK4 A;  2M2T A;  2DR9 A;  4DL6 A;  2BCQ A;  4FH3 A;  5HRK A;  5HMM A;  4FBU A;  2ZJA A;  3GQC A;  3KHL A;  3JPQ A;  1U49 A;  2BR0 A;  1NKC A;  2R8I A;  2BPG A;  4XRH A;  3OHA A;  1H38 A;  4TQS A;  4Z6E A;  3EYZ A;  2KN7 A;  2PXI A;  4PPX A;  5HRB A;  3H7I A;  2HVI A;  3BQT A;  4P4M A;  3Q8P B;  1MIY A;  3QE9 Y;  3RH5 A;  4QW9 A;  4PHP A;  2ZHB A;  4ECR A;  3JPR A;  4UAZ A;  1D9F A;  4PGQ A;  1TKD A;  4ECT A;  2F1I A;  9ICC A;  4UAW A;  2MAX A;  1Z00 B;  1S0O A;  2A1J A;  8ICI A;  3JYY A;  4BWM A;  4O3R A;  5III A;  5KG6 A;  1ZQZ A;  3RJF A;  4WBZ A;  4YR0 A;  2P66 A;  4ECZ A;  2ZHA A;  4KIT B;  5J2F A;  3MBY A;  2ATL A;  1ZQJ A;  2M2U A;  1NK6 A;  4M47 A;  4DL3 A;  1XC9 A;  2MUT A;  4IR9 A;  5KFU A;  4F5P A;  3QEA Z;  1DK3 A;  3OV7 A;  2ZTD A;  4O5K A;  3OVB A;  1S97 A;  1X9S A;  2JEF A;  5HRE A;  4PGY A;  8ICO A;  3T5H A;  5DBB A;  4DSF A;  4DQI A;  4ECQ A;  4KLI A;  4RQ1 A;  2AGP A;  4FHX A;  2OWO A;  4DFK A;  3KHR A;  4I2H A;  4I2A A;  4RUC A;  8ICT A;  2IHN A;  3EZ5 A;  4JV2 A;  4WBY A;  4NKU A;  1KSP A;  2ZTC A;  5IIM A;  2R8H A;  4F2S A;  4EBJ A;  2IMW P;  4EYH B;  1ZQF A;  3OSN A;  1R89 A;  4UD4 A;  3BQ1 A;  4B9M A;  5KT2 A;  4DSL A;  3OSP A;  3T5L A;  4X4V A;  3H8W A;  3ORY A;  3SZ2 A;  1DOQ A;  3H4B A;  4P4P A;  4QWD A;  3H40 A;  4PH5 A;  5KFE A;  2ZH5 A;  3BJY A;  2XY6 A;  4YMO A;  3UXO A;  3GIM A;  1RZT A;  3GV8 B;  1HUO A;  2FMS A;  3JPN A;  4ATB B;  5KFB A;  4Q43 A;  3V7J A;  3Q8Q B;  2ASL A;  2DR8 A;  2ZH7 A;  2AU0 A;  1NK5 A;  4KLL A;  5JUM A;  5J2E A;  3ISB A;  4KLS A;  1B43 A;  8ICC A;  4O3N A;  2XGQ A;  2J6T A;  5J2D A;  4RPY A;  4M6W B;  4DS4 A;  3PW4 A;  3M8R A;  2Q66 A;  3ISD A;  5CP2 A;  4WC1 A;  4ECU A;  2DVI A;  4DSE A;  5EWG A;  1U4B A;  5IIJ A;  7ICE A;  2NRW A;  4R65 A;  4J9N A;  4LZG A;  2UVV A;  4IRK A;  3RAX A;  4KTQ A;  5DKW A;  4ZH4 A;  5J0S A;  4UQG A;  7ICS A;  2KZ3 A;  2O5A A;  5KFM A;  5J0P A;  5J0W A;  1QSL A;  2ZH6 A;  1SZP A;  1LB2 B;  4DOA A;  2XCP A;  1EXN A;  4P2H A;  4RPZ A;  4DL7 A;  4QWB A;  5KFZ A;  8ICN A;  4KN7 A;  2W8K A;  3AU6 A;  2M9N A;  4B9U A;  2KP7 A;  1UET A;  4O3Q A;  4YN4 A;  4TUS A;  8ICU A;  5KG5 A;  1N56 A;  9ICU A;  4PHE A;  5J0T A;  5DQH A;  3B0Y A;  1ZQH A;  1BGX T;  1XSP A;  1VJ7 A;  5KFN A;  9ICG A;  4JWN A;  1XU4 A;  5KFR A;  2BPF A;  1NKE A;  4G3I A;  4WC4 A;  4Z6C A;  2W9C A;  3NYB A;  2RFF A;  3ZD8 A;  5IIO A;  1X9W A;  4IRC A;  1C7Y A;  4FH5 A;  4J9M A;  5KT7 A;  4QZA A;  1MQ3 A;  4ED6 A;  7ICR A;  4RWN A;  1RYS A;  4M9J A;  3LDA A;  4ED8 A;  4I2E A;  2FMP A;  1V4A A;  2XC9 A;  2XCA A;  4FHV A;  4E7X A;  4ECX A;  4ECY A;  3BDP A;  3GFK B;  4NXZ A;  4RQ4 A;  3N97 B;  2W9B B;  2HHT A;  4DFM A;  5D46 A;  2ZH4 A;  3EPG A;  2A1J B;  4R8U A;  3ETL A;  1BNP A;  2NRV A;  3G6X A;  2BCV A;  5KG0 A;  3KHH A;  3H38 A;  1KTQ A;  5KFJ A;  3RR7 A;  3PV8 A;  3C2M A;  2DFL A;  1ZQX A;  2C2E A;  2BPC A;  1ZQS A;  3WFQ E;  5L1L A;  4GLX A;  2KZZ A;  2VA8 A;  9ICN A;  2R8J A;  1QLN A;  3PY8 A;  4MEY A;  1ZQY A;  3FYH A;  3RBE A;  2W9A A;  1ZQO A;  5KFF A;  4IQW A;  1K1S A;  1X9M A;  9ICE A;  4BXO B;  3H39 A;  5KFI A;  1ZQM A;  4X4R A;  2LYH A;  4O0I A;  1MSW D;  1N48 A;  3OHB A;  8ICK A;  4UAY A;  4RU9 A;  4FHW A;  4F5O A;  3V6H A;  3MR3 A;  4QZB A;  4I2J A;  4RQ3 A;  4FBT A;  1NZP A;  8ICZ A;  4ED2 A;  1Q78 A;  3E2E A;  1ZJN A;  3HP6 A;  1Z00 A;  7ICO A;  1U9L A;  3MDC A;  8ICS A;  4PHA A;  4CCH A;  3HIY A;  4X4Q A;  1T4G A;  4RQ8 A;  4DWI A;  3T3F A;  4KLO A;  1NO5 A;  8ICG A;  8ICR A;  3MFI A;  4YXJ A;  5EOZ A;  5DGA A;  2V9W A;  2ZJ8 A;  4QZ9 A;  3RR8 A;  2I1Q A;  4UB4 A;  2NRK A;  1A76 A;  1NOM A;  5KFD A;  4J9P A;  1TV9 A;  3RJG A;  4K4G A;  4M2Y A;  2KTQ A;  1CEZ A;  4M0A A;  4YMN A;  1U47 A;  2F1H A;  4DOB A;  4X4O A;  4O3O A;  5DB7 A;  2XGP A;  4DQR A;  2ZTE A;  1YLQ A;  2ISO A;  1D8L A;  3HWT A;  2W9B A;  3OJS A;  4DOC A;  3UXN A;  1S0V A;  1PZN A;  4RQ2 A;  2FPM A;  1L3T A;  1MIW A;  1SKW A;  4UB3 A;  1ZQT A;  2DRA A;  1L3S A;  1F5A A;  4F3O A;  3GIL A;  4RNM A;  3OJU A;  5KT3 A;  3UPS A;  4RNO A;  3MR2 A;  1L5U A;  4BXO A;  4I2F A;  3UPQ A;  4AT9 A;  3OVS A;  1RPL A;  2BDP A;  2HHS A;  2C28 A;  2HHU A;  1S10 A;  4EBC A;  9ICR A;  4K4H A;  5DG9 A;  2ASD A;  5CHG A;  4LVS A;  4EBD A;  5DBC A;  5KG3 A;  2AGQ A;  2KFZ A;  5J0O A;  9ICB A;  2PBE A;  3AQK A;  2ALZ A;  4MF2 A;  5HRL A;  1TFR A;  1L3U A;  3PX6 A;  7ICF A;  4DSK A;  1JMS A;  2Y1I A;  3V6K A;  5L1K A;  4F4Y A;  3H8S A;  4R66 A;  1NK0 A;  2Y1J A;  5HRH A;  2HHW A;  2O1P A;  4WC0 A;  3C21 A;  1ZQV A;  4C8N A;  5CWR A;  5J2K A;  1UA1 A;  4YVZ A;  3AQN A;  4DF4 A;  3C5F A;  4BGD A;  1HJP A;  1UT5 A;  5KG7 A;  4YQW A;  3MDA A;  3HX0 A;  4DF8 A;  4Q45 A;  2BQR A;  5DG8 A;  3TI0 A;  3AQM A;  5DB9 A;  3H8J A;  4J9R A;  2BKE A;  3TAR A;  8ICF A;  5J0Q A;  7ICQ A;  1Q79 A;  9ICW A;  5CR0 A;  4X5V A;  3AUO A;  3RRG A;  2H5X A;  4P4O A;  3WFO A;  2ASJ A;  4KLQ A;  1ZQG A;  4F4Z A;  4J9L A;  4R63 A;  4RUA A;  3C1Z A;  4ED0 A;  4WC5 A;  3PR5 B;  5TZV A;  1KFS A;  9ICM A;  3H4D A;  3ISC A;  4LZD A;  3Q8R B;  4ECW A;  5EWF A;  4KLD A;  3C66 A;  3ZDB A;  3HJ4 A;  9ICX A;  4RPX A;  1JAJ A;  5IIL A;  4RWQ A;  3PW0 A;  1D8Y A;  5J0X A;  4M04 A;  3V7L A;  3RAQ A;  3IM1 A;  4IQU A;  4M9L A;  7ICK A;  8ICW A;  4WC6 A;  1TFY A;  4DLG A;  4B9S A;  2RDI A;  1UT8 A;  9ICO A;  5KFO A;  4FHP A;  4WC7 A;  4RNN A;  3RH4 A;  5J29 A;  1KDH A;  2HHV A;  5KFT A;  3FDS A;  1NK9 A;  2FLP A;  1KFT A;  1XS9 D;  4GC7 A;  1JX4 A;  4KLE A;  4EBK A;  3GV5 B;  4B9N A;  4C8K A;  4RWP A;  2FPL A;  1B22 A;  1NJX A;  1QTM A;  2GWS A;  3LQC B;  5F9N A;  2JZB B;  5KFQ A;  4IQV A;  1D9D A;  2IA6 A;  9ICI A;  4GXK A;  4JUZ A;  5J0U A;  4DQQ A;  9ICH A;  1NJW A;  1BNO A;  2P6R A;  1OU5 A;  4ELT A;  1IM4 A;  4XA5 A;  3GDX A;  7ICH A;  2M2V A;  4EYI B;  3T5K A;  3OUY B;  2MUT B;  2PFN A;  2VAN A;  5KFA A;  2DR7 A;  4WC3 A;  3PVX A;  1R8C A;  5J2I A;  3ZDD A;  5KFX A;  2BCR A;  3GV7 B;  3MGI A;  1ZQI A;  4JK1 A;  2C2R A;  5CB1 A;  4WC2 A;  1XSL A;  1JQR A;  4JV0 A;  1RXV A;  2ID1 A;  1RYR A;  4NKT A;  5HNK A;  2BQ3 A;  4XQ7 A;  4F91 B;  1ZQD A;  3GIJ A;  1ZQA A;  3PML A;  1BVS A;  4UB1 A;  4F5Q A;  1XSN A;  4MEX A;  1DK2 A;  2C22 A;  9ICT A;  9ICQ A;  1MIV A;  4M5D A;  1NKB A;  2ZH8 A;  5IIN A;  4DL2 A;  2PI4 A;  5HRI A;  4LT6 A;  5DB6 A;  3OVA A;  3RRH A;  4J9O A;  2JEJ A;  5KFG A;  3LK9 A;  4AT7 B;  3PO5 A;  4X4U A;  8ICH A;  4X4N A;  2WTF A;  1BPE A;  4J9S A;  4K4I A;  4ELU A;  8ICJ A;  3HJ1 A;  4I27 A;  3H3A A;  3QZ7 A;  3Q8S B;  1WCL A;  3C5G A;  1TK0 A;  4KLU A;  1S0M A;  1QSY A;  7ICU A;  4NY8 A;  1SKS A;  4J9K A;  5F2V O;  3M9O B;  4QZH A;  4HYK A;  9ICV A;  1TAU A;  2BCU A;  3RB0 A;  4QW8 A;  4M6W A;  3HT3 A;  3M9M B;  4DFJ A;  3QEB Z;  1TVA A;  1T8E A;  4FO6 A;  4X0B A;  5HML A;  2ZUD A;  3MFH A;  2W8L A;  4C8O A;  3RJJ A;  4QZC A;  5HP4 A;  1SL2 A;  4ECS A;  5HR9 A;  3TFR A;  2JEG A;  1BPX A;  3H37 A;  3SV3 A;  4MF8 A;  1S0N A;  4I29 A;  3WFP A;  5KG4 A;  1IXR A;  3RJK A;  4YD1 A;  3OGU A;  5DQG A;  3RJE A;  4F5N A;  5HC9 A;  2ZUB A;  4QZI A;  4R64 A;  3LWL A;  3TAN A;  1TK5 A;  2AJQ A;  2XY7 A;  2UVW A;  3MAB A;  1HUZ A;  4MFC A;  5DLF A;  3ZDA A;  4EEY A;  4R8U B;  5L9X A;  4Q44 A;  1MQ2 A;  4E0D A;  2AQ4 A;  4C8M A;  3V72 A;  3BQ0 A;  4QZF A;  5KFH A;  4PGX A;  3TAQ A;  4F5R A;  2BQU A;  4ELV A;  3GII A;  4RQ7 A;  4NM1 A;  3C18 A;  1SL0 A;  4Q8F A;  4I2G A;  3HW8 A;  3BQ2 A;  4DL5 A;  1NK8 A;  5KFP A;  3V7K A;  4IR1 A;  7ICI A;  8ICY A;  4IQT A;  3WFR E;  2NRZ A;  1ZQR A;  1QSS A;  4KMU A;  4QWA A;  1S76 D;  4KLF A;  4DSI A;  4RT2 A;  4KLT A;  4O9M A;  4AT8 B;  3MR6 A;  1T7P A;  5L1J A;  1WOT A;  2FLN A;  4DSJ A;  2DPI A;  2PI5 A;  4Z6F A;  5DLG A;  4NM2 A;  4MFA A;  4KN4 A;  4AT8 A;  2C2D A;  4YXM A;  4FHY A;  4QZ8 A;  4IG8 A;  5J2A A;  5BOL A;  2F1J A;  3B0X A;  4XQ8 A;  7ICG A;  3PX0 A;  3JPS A;  2PFP A;  2ZH9 A;  4C8L A;  3PNC A;  3L9D A;  3TAP A;  1JXE A;  3RTV A;  5C5J A;  4J9Q A;  3RBD A;  2FMQ A;  4Q8E A;  4QZD A;  1T3N A;  2IHM A;  2VA2 A;  3ZDC A;  4F4K A;  3JZ0 A;  1BPB A;  3GIK A;  2M2W A;  3K4G A;  4TUP A;  4IRD A;  3MGH A;  4X0A A;  4I2D A;  5DG7 A;  3KTQ A;  4F4X A;  5D49 A;  5KFV A;  4O3S A;  1NJY A;  9ICS A;  4UD5 A;  9ICA A;  5F9L A;  4QZG A;  3WFS C;  2R8G A;  4YCX A;  5BPC A;  8ICP A;  4KLH A;  1JIH A;  4DQP A;  5KFW A;  4NLK A;  5KFS A;  2Q0Z X;  4PHD A;  4KLM A;  4F8R A;  4WCW A;  3RB6 A;  1ZJM A;  3C2L A;  4M9H A;  3IHQ B;  1NK7 A;  2XY5 A;  4YG2 A;  1Z3E B;  3PMN A;  2UVR A;  4YP3 A;  5DB8 A;  5KT4 A;  3RJH A;  2B21 A;  3ZD9 A;  2IBK A;  5BOM A;  3Q8M A;  9ICF A;  7ICT A;  3RJI A;  1ARO P;  4RQ0 A;  3MR5 A;  4JV1 A;  3C23 A;  4E8F A;  1SKR A;  4ATB A;  3THV A;  4NLZ A;  5DDM A;  3TQ1 A;  4UB5 A;  1COO A;  1NJZ A;  1ZQC A;  1S9F A;  1KNY A;  4YMM A;  4DS5 A;  1JXL A;  4M9N A;  4NLG A;  7ICL A;  2BGW A;  2AGO A;  4KLG A;  2BHN A;  5CJ7 A;  2HHQ A;  9ICL A;  4O5C A;  4QZE A;  3NTU A;  4F50 A;  1SL1 A;  8ICQ A;  4YD2 A;  3V6J A;  4XUS A;  4ED3 A;  3PW5 A;  5DQI A;  1ZQN A;  5HRF A;  3JPP A;  4DFP A;  1KLN A;  4O3P A;  4EP7 A;  2FPK A;  2NRX A;  8ICX A;  4RZR A;  1KRP A;  3NGD A;  3TFS A;  1ZQL A;  3OUY A;  4UBB A;  5J0R A;  3QZ8 A;  5IIK A;  5J2J A;  1R8A A;  3JPO A;  1VFG A;  4BWJ A;  4EBE A;  1WCN A;  4ED7 A;  7ICP A;  2HHP A;  1ZQK A;  1V9P A;  9ICP A;  4UBC A;  1L3V A;  1RXW A;  1BPD A;  2I9G A;  3UQ2 A;  8ICE A;  1KEJ A;  4B9T A;  3SV4 A;  2NRT A;  2AQ0 A;  8ICL A;  4DEZ A;  2KFN A;  4EZ6 A;  4X4T A;  5KT6 A;  3M8S A;  5DBA A;  2XO7 A;  2BCS A;  1U45 A;  4B9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...