4GXJA

R283k dna polymerase beta ternary complex with a templating 8og and incoming dctp analog
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
326
structure length
315
Chain Sequence
b'TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPLAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title DNA polymerase minor groove interactions modulate mutagenic bypass of a templating 8-oxoguanine lesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 116
structure length 315
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4gxjA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4gxjA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4gxjA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4gxjA03
2NRXA 4I2JA 1SL0A 5HHHA 3BQ0A 4M2YA 3E2EA 2M2WA 4K4GA 4ECSA 4DFMA 1N48A 2RDIA 5J2GA 4F4KA 7ICSA 4F5QA 4JV1A 2NRVA 2R8GA 7ICQA 2AJQA 4UB5A 1WCNA 4M9NA 3MFIA 4BWJA 4KITB 8ICWA 3EYZA 2DR7A 4BGDA 5EWGA 1ZQYA 3RTVA 4ECXA 1T8EA 3H37A 1ZQFA 3IM1A 9ICCA 1IM4A 1NK0A 1ZQDA 3G6XA 4I2EA 4NLZA 7ICLA 1UETA 3NTUA 2XC9A 4QW8A 4B9TA 4M04A 5DG8A 1VFGA 4DL6A 2P66A 4E8FA 4I2DA 4Z6CA 4QWCA 4I2GA 2AU0A 5KT2A 4J9SA 5HRHA 2HHQA 4F5OA 4RPXA 4AT8B 2ZH4A 4MFCA 4KLUA 3H40A 3EZ5A 1K1SA 1SKRA 1Z00A 1KNYA 2W9BA 4YMOA 5KT3A 5IIIA 4P4OA 4DL3A 9ICMA 3GILA 1ZQBA 5KG0A 1JIHA 5KFZA 3OHAA 3M8SA 2ZHAA 5KG7A 1V9PA 3PR4A 4LZDA 4BDPA 2IA6A 2R8IA 4M5DA 2MAXA 8ICSA 3JPOA 5IILA 1Q78A 5KT5A 9ICEA 2HHPA 1T4GA 3QZ8A 1L3UA 2M9NA 4M6WA 1S0MA 9ICPA 4PHDA 4DEZA 2XGPA 3TFRA 3SZ2A 4ECRA 3V6JA 4DQIA 1D8YA 3GIIA 3TFSA 2XY7A 2R8JA 1RXWA 1D9DA 4WC4A 5KFBA 2DR9A 3PO4A 9ICJA 1MSWD 3V6KA 5DGBA 3BJYA 5J2DA 5KG6A 3SYZA 3ZDAA 1DGSA 3OHBA 3RJGA 3EPGA 4J9RA 4QZBA 4O0IA 3JPPA 2J6UA 4DQRA 4YQWA 4Z6EA 3PVXA 3RAXA 2FMSA 3ZDDA 4O3RA 1NKEA 5J29A 2BKEA 3V6HA 4Q8EA 9ICOA 5F2VO 4WC5A 3Q8PB 2ALZA 5KFOA 4ELUA 3V7JA 1C7YA 4KLFA 1B43A 2C2EA 4KLTA 5J0RA 3MR6A 4RUAA 1QTMA 3AQMA 4JWMA 2F1IA 4RPYA 1MC8A 5EWFA 2Y1JA 3JZ0A 4GC6A 2NRZA 8ICRA 4QZEA 2ASJA 1TK8A 5KFGA 2HHSA 5KFNA 1BPBA 4FH3A 3SV3A 2MUTB 5DEDA 2I9GA 3PX6A 4J9PA 4B9UA 1ZQNA 5EWEA 2FLLA 3GDXA 1RZTA 2BGWA 4RQ6A 4AT7A 1S0OA 5J2BA 8ICCA 1NK5A 4RQ0A 4RNMA 4WC0A 4ECYA 1WCLA 4KLGA 2UVVA 4RPZA 4HYKA 2BCUA 4UD4A 3G6VA 4MEYA 2ZUDA 4RT2A 1S10A 7ICEA 1D8LA 4FS2A 3AUOA 4QZHA 2VA2A 4XUSA 4QZGA 2VANA 2C22A 1BPZA 3RB6A 1TV9A 3RJHA 2UVUA 4C8NA 3ORYA 3SI8A 7ICIA 5HRLA 5D49A 3PNCA 3ISBA 1AROP 2XGQA 2DVIA 2BPFA 4DL2A 3RR7A 2W9CA 4ELVA 2KZ3A 4F5NA 1NK8A 8ICBA 5HRIA 7ICNA 3HX0A 4ECZA 4ECWA 4B9SA 1JX4A 3LQCB 5KT6A 2BE3A 2ZHBA 3H4DA 4DWIA 3ETLA 2PFOA 4RU9A 5J2HA 3B0XA 4KLDA 1YLQA 3MGHA 9ICBA 5DG9A 5F9LA 7ICFA 2JEJA 1U4BA 2KZMA 4LT6A 3OUYB 3M9OB 5KG5A 2KFNA 3PO5A 3JPQA 9ICGA 3MBYA 4KLQA 1CEZA 4UD5A 4M0AA 3RBEA 2VA3A 8ICGA 2JZBB 5KFVA 1S76D 1ZQQA 5KFAA 7ICJA 8ICLA 4ATBA 3H8SA 5L9XA 4EBKA 4IQWA 3ISDA 5IIKA 5KFMA 4AT9A 3WFQE 3QZ7A 1BNPA 4C8OA 8ICVA 4YVZA 4WC3A 8ICZA 3QEAZ 1JMSA 4EBEA 4DL5A 1X9WA 1JN3A 5DBBA 4IR9A 3V7KA 1HUZA 1NK9A 1ZQKA 1TAUA 4X4QA 4M9JA 2PBEA 3RAQA 1TK5A 9ICQA 4RNNA 4R8UA 1ZQGA 1ZQRA 1UEUA 3RB0A 1WOTA 7ICMA 4XRHA 4RT3A 3OJSA 3PW5A 4IQVA 1JXEA 4UB1A 1MIWA 7ICRA 4X4VA 1D9FA 1RPLA 3QEBZ 2Q66A 3UXNA 3V72A 1MIVA 4O3QA 4E0DA 4ECVA 1L3VA 9ICHA 2I1QA 4FHPA 4YG2A 4YD2A 4EYIB 8ICXA 1BVSA 4TUPA 1XU4A 1Z3EB 4O5CA 5DDYA 4DSFA 4QZIA 4DQPA 4I2HA 3H38A 5J0YA 8ICHA 2KP7A 1XWLA 4DOBA 4IR1A 1NOMA 4QZDA 4Q45A 2P6RA 3AQKA 9ICLA 3Q8MA 3OV7A 3OVBA 4ED2A 4IRCA 3GIKA 3C21A 1TVAA 2BPGA 4JV0A 3GIJA 1JQRA 1ZQXA 4NM1A 4E80A 2ZJ8A 3HT3A 4KN7A 3RJIA 3RB4A 2NRKA 1KEJA 4ED3A 2W9MA 4O3NA 4F2SA 1V4AA 3PW7A 1TFWA 1XO1A 5HMMA 5F9NA 5D46A 3C18A 4B9VA 2ZJAA 4WC1A 4AT8A 5J0QA 4EZ9A 1MIYA 3AU2A 4TQRA 4PHPA 1ZETA 1ZQTA 2XY5A 1ZJNA 4X5VA 2PFNA 2A1JA 4NY8A 5KFWA 4O9MA 1Z00B 1S0NA 2W9BB 4DL4A 4X4UA 3MGIA 5IIJA 2HHVA 3MDAA 4FHVA 3EPIA 3OVAA 4X0BA 2XCPA 2F1JA 5KFCA 3ZDBA 1IXRA 4ED7A 1PZNA 4EZ6A 1PX5A 2ZH2A 3KHGA 4C8KA 4KLJA 3HW8A 7ICOA 4RQ5A 5CJ7A 5DB8A 1NKBA 3NYBA 5KFFA 5KG3A 5D4BA 4GXIA 1T3NA 3RH6A 1NK6A 5CA7A 1S97A 3RJJA 2PI4A 1N56A 1HUOA 3MR5A 3GFKB 8ICIA 9ICUA 4RNOA 4F4YA 4X4SA 2ZH9A 5DLGA 2HHWA 1FA0A 5KT7A 3AQNA 2DR5A 4RWNA 4DSLA 4WBZA 4RQ7A 4GXJA 5HHIA 3PX0A 5DQIA 4I29A 4NKUA 4F2RA 3C5GA 1ZQOA 3RJKA 2O5AA 1U9LA 4IG8A 4JUZA 4MEXA 2DRAA 3JPRA 1H38A 3GV5B 1CUKA 3KHLA 3TQ1A 1NJXA 1UEVA 1NK4A 3SV4A 4EP7A 5C5JA 5DG7A 1X9MA 2HVIA 1TFYA 3KTQA 9ICFA 7ICPA 4DLEA 2V4RA 3N97B 4JV2A 4YD1A 2ZH5A 4O3PA 5JUMA 3C5FA 4GLXA 3C66A 1ZQMA 2V9WA 4DLGA 4FBTA 4RQ2A 4EEYA 3N4MB 4IQUA 4PGXA 5KFSA 5DGAA 2BQ3A 3LWMA 3T5KA 3HP6A 2WTFA 3ZD8A 4FHYA 1ZQCA 2KZZA 5IIOA 4X4TA 5KFTA 2PFQA 4K4IA 9ICNA 4ED8A 1U45A 2BQRA 1COOA 4UB3A 4F91B 1BPYA 5HMLA 2NRTA 1X2IA 4Z6DA 2R8HA 2Q0ZX 4QWBA 4F5RA 3K75D 4F4WA 4FO6A 4NXZA 4TUSA 4I28A 4M9GA 2HHUA 4RWQA 4KN4A 9ICRA 2FPKA 8ICMA 4QW9A 2XY6A 3PY8A 4PGYA 3H8WA 2FLNA 4O3OA 1TKDA 5KFRA 4RWPA 2LYHA 4UB2A 4UB4A 5DQHA 1T7PA 2BCSA 4BXOA 2JEIA 9ICVA 3T5LA 8ICUA 3ZD9A 3L9DA 1ZQJA 3UXPA 3EW9A 4F4XA 1U47A 3UQ2A 2AQ0A 4FHWA 2HW3A 3LK9A 4YXMA 3MR3A 5KFDA 5KTQA 3TANA 2NRWA 2BQUA 1SZPA 5KFYA 3GIMA 3JPTA 4DF8A 4B9MA 5DDMA 8ICTA 3OUYA 3LDAA 2AGPA 2HHTA 1R89A 4QZ8A 4RUCA 8ICFA 2Y1IA 2DPIA 3RR8A 4TUQA 5L1JA 1MQ2A 4DSJA 1ZQVA 9ICKA 3NGDA 1NJYA 1QSYA 2M2UA 4YMNA 2ASLA 8ICPA 4J9QA 2DFLA 1ZQLA 4DL7A 5J2EA 2ZTEA 5L1KA 4ATBB 4YN4A 3C2MA 1KTQA 4F93B 4DS4A 3M9MB 4X4PA 5HC9A 2ZUBA 1RXVA 4LVSA 4AT9B 4DSEA 1L5UA 3BQ2A 4DF4A 1UA0A 3OGUA 3BDPA 4DFJA 1KDHA 5L1LA 4DOAA 2UVRA 3QE9Y 9ICTA 5HRGA 3UPSA 2BPCA 2DR8A 2GWSA 4KLLA 5DBCA 2KN7A 4XQ7A 3Q8RB 4QZ9A 2J6TA 3C2LA 1NJWA 4P4PA 2DRBA 1BGXT 3KHHA 2FMQA 3MR2A 2W8LA 5CB1A 1BPEA 3UQ0A 4DFPA 5HP4A 2ISOA 3OSNA 3RRGA 4I2AA 7ICGA 4MFFA 4J9NA 4DFKA 1S9FA 1KSPA 4KLHA 2ZH1A 4QZCA 5KFUA 4IRDA 1NKCA 4O3SA 2FPLA 3RB3A 1KFDA 4QWDA 1SL2A 1B22A 1DK3A 4E7XA 2UVWA 4TQSA 3HJ1A 3ISCA 3C23A 3WFSC 4ECQA 2M2TA 4O5EA 9ICAA 5BPCA 5KFPA 5KT4A 2RDJA 1R8BA 3KHRA 7ICTA 5J0UA 4WC6A 4Q44A 3RJFA 4KTQA 1KRPA 4I2BA 2ZH7A 2B21A 2BCVA 2BCQA 1S77D 2FMPA 1Q79A 4FBUA 3Q8KA 1TAQA 3T3FA 5CWRA 4KMUA 3PX4A 2H5XA 4BWMA 4JWNA 9ICIA 4WBYA 4B9LA 5J0XA 1OU5A 1KFSA 3PW0A 2BCRA 2ZUCA 1LB2B 4JK1A 2J6SA 4M47A 4IQTA 3FYHA 5TZVA 4J9OA 2VA8A 4GXKA 5HR9A 1F5AA 5KFXA 3HPOA 4RQ1A 3UXOA 3OJUA 4YXJA 3PV8A 3MDCA 1U49A 3Q8SB 5HNKA 4DOCA 2P6UA 4I27A 1QSSA 2ZH6A 3RBDA 4X4NA 4G3IA 3WFOA 2A1JB 5DB9A 4C8MA 5HRDA 4WCWA 4XQ8A 3PMLA 4EBCA 4Q43A 3G6YA 4UQGA 1UA1A 1L3SA 1SKWA 4Q8FA 3PW2A 3RH4A 5EOZA 4PGQA 5CHGA 4M6WB 3M9NB 5J0SA 4PPXA 1MQ3A 4RWOA 4F3OA 5HRKA 2HVHA 8ICQA 5BOLA 4P2HA 1SL1A 2XCAA 9ICSA 3K4GA 5IINA 4UBBA 4EBDA 4X0AA 3H7IA 3FDSA 3OSPA 2W9AA 3M8RA 3T5HA 3RJEA 2RFFA 1A76A 4K4HA 5KG2A 5CR0A 5DB6A 3BQTA 4ED6A 4IRKA 4EYHB 3ZDEA 3TI0A 2IHMA 2O1PA 1BNOA 3T5JA 1JAJA 5KFEA 5DLFA 3JPSA 4B9NA 3Q8LA 1BPDA 2FPMA 3GV7B 3C2KA 3AQLA 1ZQZA 1ZQPA 4I2CA 1ZQUA 4DS5A 5DBAA 2KFZA 2ZJ5A 1RYRA 5J0WA 1DOQA 5L1IA 4PHAA 5KFQA 4FHXA 4ECUA 4QWAA 4QZFA 3C1YA 3RH5A 1R8AA 2ZTDA 5KFJA 3WFPA 2AGQA 1UT5A 4FH5A 3ZDCA 1QLNA 1ZQHA 4R66A 8ICKA 3OVSA 2MUTA 2ID1A 5J2JA 1L3TA 2V4QA 4J9LA 4DQQA 4NLGA 1ZQWA 4I2FA 2HHXA 7ICHA 2M2VA 1ZQSA 3H39A 5KFHA 5DB7A 3LWLA 1ZQAA 2IMWP 3TAPA 2IHNA 3PMNA 4R65A 4MF2A 4AT7B 2ZTCA 8ICOA 1Y88A 7ICVA 3JYYA 4F4ZA 4QZAA 2R8KA 4YP3A 4YFKA 4YR2A 2ATLA 2W8KA 8ICYA 1DK2A 5DECA 1NZPA 5HRBA 4F50A 4UAWA 4EBJA 3RRHA 1K1QA 3HWTA 4ZH4A 3PW4A 2C2DA 2C28A 1XSPA 3MFHA 4J9KA 3Q8QB 1SKSA 1LV5A 2ASDA 3C1ZA 4RZRA 4XA5A 4YCXA 3H3AA 5CP2A 4KLOA 5KFKA 1KLNA 4LZGA 5J2CA 4UBCA 1XS9D 4KLSA 4F5PA 5J2KA 3EWAA 4WC2A 4F92B 3MABA 2W9CB 4DQSA 4CCHA 4WC7A 5J2IA 4Z6FA 1S0VA 5J0TA 1BPXA 2FLPA 4UAYA 1KFTA 4NKTA 1JXLA 1VJ7A 1A77A 3HJ4A 4I2IA 8ICEA 4NLKA 2BR0A 5BOMA 1XC9A 1TK0A 4BXOB 4KLMA 1EXNA 5DQGA 4P4MA 5KG4A 4GC7A 4YR0A 2XO7A 2BHNA 1ZQEA 2BDPA 4DSIA 5KFIA 3GV8B 5J2AA 2AGOA 5KFLA 2JZBA 7ICKA 4R63A 4R64A 4ED1A 2OWOA 4KLEA 5HREA 2ZH3A 2DPJA 4F8RA 2JEGA 4M9LA 4ED0A 3BQ1A 3IHQB 2ISPA 8ICAA 4S3NA 2ZH8A 3TAQA 4C8LA 2KTQA 5KG1A 3JPNA 4ELTA 5J0OA 4MFAA 3PR5B 9ICXA 3HIYA 1HJPA 3AU6A 5IIMA 1X9SA 2F1HA 4O5KA 4KLIA 4PHEA 4TURA 4DO9A 3B0YA 2PI5A 4DSKA 4RQ4A 8ICJA 8ICNA 2JEFA 3GQCA 2PXIA 2PFPA 3V7LA 1U48A 1R8CA 4J9MA 2IBKA 3TARA 5DKWA 1ZYQA 4UAZA 1NO5A 3H4BA 5HRFA 4M9HA 4RQ8A 1TFRA 1NK7A 4X4RA 3WFRE 5J2FA 1NJZA 4MF8A 1QSLA 4R8UB 1ZJMA 4NLNA 1XSLA 7ICUA 4ECTA 2AQ4A 4RQ3A 5J0PA 4X4OA 4FS1A 1RYSA 3THVA 9ICWA 1ZQIA 4NM2A 4PH5A 1UT8A 3H8JA 4YMMA 4YR3A 4QWEA 1XSNA 3UPQA 2C2RA
chains in the Genus database with same CATH superfamily
2NRXA 4I2JA 2M2WA 5J2GA 2G5IB 3H8MA 4M9NA 3U26A 2AJQA 4ECXA 1NK0A 1ZQDA 3NASA 4OCZA 4E8FA 4I2DA 4QWCA 4EV6A 4K97A 5HRHA 2HHQA 2W03A 4F5OA 2ZH4A 5KT3A 5IIIA 1SIJA 9ICMA 5AKXA 1JIHA 2LYBA 3ED5A 5HR7A 2IA6A 2D6FC 4M5DA 8ICSA 2MA1A 9ICEA 3NVWA 1PVQA 1S0MA 2PMZC 4DEZA 3SZ2A 3V6JA 2KOBA 1D8YA 2DBYA 2R8JA 2HBKA 3ERCC 2H3FA 1N5XA 3V6KA 2VJ5A 3EPGA 3WKBA 4C7YA 2EZYA 2GAFD 5GTIU 2J6UA 2KMDA 4YQWA 4KM5A 1IV8A 1OW5A 4EX7A 5KFOA 4USAA 4ELUA 3QUQA 4P0PB 3AQMA 1N61A 2F1IA 1YZ6A 5EWFA 2Y1JA 3JZ0A 1N2XA 1FIQA 2GH1A 4QZEA 5AI0A 2QARB 5CEHA 1BPBA 5ALWA 1ZQNA 2BGWA 4BJQA 1S0OA 5C0YA 4RNMA 4BX9C 4K8VA 5ALYA 4UD4A 4X4TA 2ZUDA 2RP5A 1ZD2P 4FS2A 4XUSA 1JROA 1TV9A 4RQMA 3ORYA 3SI8A 5HRLA 5D49A 3ISBA 1AROP 2XGQA 5AKLA 5AKYA 2BPFA 1DRGA 3RR7A 3WK7A 5AM1A 2W55A 5AK4A 4UAVA 4ECWA 4B9SA 5ALFA 3ETLA 3MGHA 3M6KA 3AL0B 1U4BA 3OUYB 3M9OB 2YMPA 3JPQA 3MBYA 2KNJA 2KE7A 2LPEA 1S76D 8ICLA 1NZBA 1Z1VA 3WKAA 5IIKA 3WFQE 4FZNA 4AT9A 3QZ7A 4WQKA 1PUZA 1KW4A 4YVZA 1JMSA 4EBEA 4KB6A 1X40A 1NK9A 1ZQKA 4M9JA 9ICQA 3PSIA 1WOTA 3RB0A 3M6ZA 1O03A 4XRHA 3HILA 4IQVA 1JXEA 7ICRA 2GA9D 3QEBZ 5AM2A 3V72A 4EELA 4ECVA 5G5HA 2JHDA 2WAQC 5DDYA 4DSFA 4QZIA 3H38A 1ZXIA 1XWLA 4CE6A 2MU2A 2RHFA 3AQKA 2ODGA 5ALOA 4IRCA 3C21A 1TVAA 4NM1A 2D8CA 3RB4A 2NRKA 1KEJA 2GO7A 1J2MA 1ZD3A 3C18A 4B9VA 1ZRMA 4EZ9A 4TQRA 2A1JA 2LKYA 1S0NA 3LVWA 2YMQA 3EPIA 2F1JA 1IXRA 1PX5A 4C8KA 1V38A 5DB8A 3AMZA 1S97A 4C7ZA 2PI4A 3JCFA 3GFKB 9ICUA 4RNOA 4F4YA 2OCEA 5DLGA 2HHWA 1FA0A 3AQNA 3DEEA 5D63A 4WBZA 2B51A 3PX0A 5CFUA 3C5GA 1ZQOA 4CGZA 3N7SC 2O5AA 4IG8A 4JB3A 1H38A 1F5SA 4P0PA 3TQ1A 1NJXA 1NK4A 3H0MB 2KHQA 5AM4A 1X9MA 2EAOA 5EE9A 9ICFA 2QB0B 3PSPA 5JUMA 3C5FA 4GLXA 1ZQMA 5ALNA 4IQUA 4PGXA 5DGAA 3T5KA 4U6PA 4K4IA 9ICNA 4NL9A 2EAMA 4CF5A 2BQRA 4F91B 5HMLA 3NVYA 2NRTA 4F4WA 3IN5A 4UW9A 5ALTA 4LEYA 4UB4A 1B4FA 5ALZA 4O68A 3SAFA 1ZQJA 4JLXA 2AQ0A 2D3DA 4MHVA 3TANA 2BQUA 3OUYA 4DF8A 1AQ6A 3MC1A 4RUCA 1FEZA 2Y1IA 2DPIA 1ZQVA 9ICKA 5EE3A 4YMNA 2HDOA 5J8YA 5J2EA 2ZTEA 4YN4A 4DS4A 2ZIVA 2HOIA 3M9MB 2ZUBA 4DSEA 3BQ2A 5ALLA 3N7RC 5L1LA 2UVRA 2GWSA 4KLLA 5DBCA 2YX8A 2G0AA 2DRBA 3KHHA 3MR2A 2W8LA 5CB1A 4DFPA 1L8LA 3RRGA 2M2VA 2Q66A 1Q3UA 3D6JA 1S9FA 4UATA 1PK1B 4QZCA 2AH5A 4O3SA 2FPLA 1KFDA 3EF2A 3VCBA 5AM5A 2N1RA 3WFSC 4ECQA 2KEYA 4OAIZ 5KFPA 4CRXA 3RJFA 5ALJA 2BCQA 2EDUA 4QIWC 1Q79A 3T3FA 5CWRA 3PX4A 9ICIA 4BWMA 4US8A 3PW0A 2J6SA 4M47A 5TZVA 2W3RA 4GXKA 2VA8A 2ES6A 5KFXA 3OJUA 4YXJA 3PV8A 2HBLA 2Y9UA 2P6UA 2ZH6A 2LM4A 4G3IA 4GIBA 5HRDA 5ALRA 4XQ8A 3PMLA 3HJEA 3G6YA 5EOZA 5CHGA 5J0SA 5HRKA 8ICQA 2A3VA 5BOLA 4P2HA 3PHZA 2ZIUB 4UBBA 3FDSA 2YMLA 2W9AA 3M8RA 5AHXA 5KG2A 3T5JA 4LJXA 1A0PA 4B9NA 3C2KA 4DS5A 2ZJ5A 1DOQA 4PHAA 4FHXA 3ICXA 4ECUA 4QZFA 3KFUF 5KFJA 3WKEA 2BZFA 3WK5A 5D61A 3KBBA 4R66A 3OVSA 4DQQA 2ZH7A 1ZQWA 2QB0A 2IHNA 1JI7A 2XVTA 4PZOA 4AT7B 1Y88A 2R8KA 4YP3A 4YR2A 2ATLA 1DK2A 2IUBA 5DECA 4EBJA 2ZG6A 2C2DA 1SV0C 3Q8QB 2ASDA 1LKYA 1KLNA 4UBCA 2IOFA 2FJ6A 2W9CB 4WC7A 2OM6A 1GPJA 4NKTA 1SZHA 3HJ4A 4NLKA 1XC9A 1TK0A 5KG4A 5HC9A 3PZPA 2XO7A 5KFIA 7ICKA 5KFLA 4R63A 4KLEA 4ED0A 1S8OA 2ZH8A 3JYYA 5KG1A 3JPNA 9ICXA 3HIYA 1OXJA 1HJPA 1X9SA 4TURA 2JEFA 3QU9A 2PFPA 1R8CA 1U48A 2Q4TA 5DKWA 4O3MA 1PVPA 2HN1A 3FM9A 5HRFA 1TFRA 1NK7A 2WF9A 2EANA 1QSLA 1XSLA 4GFJA 1NNLA 1UT8A 4QWEA 3UPQA 2HMXA 3BQ0A 4ECSA 1N48A 4F5QA 1PK1A 4JV1A 3MFIA 4RQNA 3RTVA 4JLZA 1T8EA 4QW8A 1VFGA 3N7PD 2KK0A 1V97A 3WK4A 4RPXA 4DCCA 3ER8C 4MFCA 1K1SA 1Z00A 4NV0A 2W9BA 2FE9A 4DL3A 1M6YA 1FO4A 4NXWA 3M8SA 4Y2JA 5KG7A 4LZDA 4BDPA 2R8IA 2OH2A 1JUDA 4PZNA 3JPOA 2CRXA 2F8KA 3QZ8A 1NI3A 1WUDA 1ZD5A 3D2SA 4PHDA 2XGPA 4DQIA 2XY7A 2E3TA 5AI9A 3PO4A 5DGBA 3BJYA 5KG6A 3KOOA 4J9RA 4O0IA 4DQRA 4Z6EA 4Q8EA 9ICOA 1NKEA 3V6HA 4FE3A 3Q8PB 4KLFA 3HKZF 4KLTA 5HR6A 2W54A 4RUAA 3SENA 2W43A 4XJEA 4RPYA 4GC6A 2NRZA 8ICRA 2ASJA 2HHSA 3SV3A 2MUTB 2EZZA 1XO0A 5CRXA 4J9PA 5DEDA 4RQ6A 4AT7A 4J03A 5AK5A 1NK5A 1WCLA 2JR5A 2CXYA 4HYKA 2BCUA 3A0HU 7ICEA 1D8LA 1N63A 4AYBF 2VANA 2C22A 4IS7A 2WF8A 2KJ8A 3WK8A 2BBHA 5AKIA 4DL2A 2WHEA 2W9CA 2DQNB 8ICBA 4Y2YA 7ICNA 3F2DA 3BS7A 4ECZA 3H4DA 2PFOA 5J2HA 4KLDA 1YLQA 9ICBA 3QUCA 5F9LA 4UB6U 2DWQA 5AKHA 2JEJA 1KBUA 7ICFA 3PO5A 9ICGA 2LBOA 2VA3A 8ICGA 2JZBB 3D2QA 4ATBA 3H8SA 2WF5A 4IQWA 1IIPA 5KFMA 4DL5A 2B6GA 5ALDA 1TAUA 2YB4A 2PBEA 1TK5A 1L7MA 4UD5A 4FFDA 7ICMA 3NVOA 1MIWA 5K4LA 2RLTA 5EE0A 1YT3A 2I1QA 2KJ9A 1XNSA 1BVSA 4O5CA 4DQPA 3LYSA 2W7OA 8ICHA 4DOBA 4P0QB 1SV0A 2P6RA 1B0XA 9ICLA 3Q8MA 3OVBA 2M0NA 4Y2TA 1JQRA 4JV0A 3GIJA 1ZQXA 3HT3A 4KN7A 3RJIA 4F2SA 1V4AA 5JTGA 2VJ4A 1URJA 1MIYA 1QQ7A 1ZQTA 2PFNA 2XI9A 4KX5A 4ZOHC 4O9MA 4F71A 4DL4A 3CP8A 3MDAA 4K98A 1X66A 1PZNA 3ETRA 4KLJA 3HW8A 4Y2XA 4PL2A 1NKBA 3KKAC 2B0CA 2E1EA 3VC8A 1T3NA 1N56A 1HUOA 3MR5A 8ICIA 2E1FA 3IP4B 2DR5A 3QU4A 4DSLA 4RQ7A 4GXJA 4I29A 4NKUA 3RJKA 4MEXA 3GZFA 4NJ8A 1CUKA 4EP7A 5C5JA 2HVIA 3KTQA 2F2AB 4JV2A 2V4RA 4O3PA 3B9JA 2V9WA 3L5KA 3PSFA 2IOFK 4RQ2A 3N4MB 3M1YA 1ZQCA 2HSZA 4ED8A 2ESEA 2K4EA 4UB3A 2YN4A 1ZQ1C 2Q0ZX 4NXZA 4KN4A 4QW9A 2KVSA 5AKJA 4O3OA 5JRTA 1O08A 1TKDA 3OPXA 1T7PA 2K8BB 3R9KA 1SB3C 2JEIA 3T5LA 5B66U 8ICUA 3ZD9A 4PL1A 3UQ2A 1WWVA 4EEKA 2MSNA 4NLBA 2NRWA 8ICTA 5ALEA 3LDAA 4C4SA 2HHTA 4TUQA 5L1JA 1ZD4A 4J9QA 1ZQLA 2KKPA 4DL7A 5L1KA 3C2MA 4QJFB 4DF4A 3N28A 2A1AA 4OJ5A 3CK6A 4XQ7A 4NWIA 2J6TA 4C4RA 1BGXT 3NRWA 1HEKA 1BPEA 2ISOA 3SR6A 3OSNA 4KLHA 2ZH1A 5H2FU 5KFUA 2UVWA 2LYAA 4TQSA 3HJ1A 2FI1A 3ISCA 5AIAA 4O5EA 3IG5A 2RDJA 2K4IA 7ICTA 4WC6A 5J0UA 1KRPA 2E8OA 2KHVA 4KMUA 2H5XA 3BS5B 5G5GA 4C4TA 2BCRA 2ZUCA 4JK1A 1X9XA 5A0LA 1U49A 5HNKA 4DOCA 4I27A 4WQLA 4CF4A 3PSTA 1QQ5A 4EBCA 4Q43A 4Q8FA 3RH4A 4PPXA 2HVHA 2AHOB 1UCVA 2NO5A 3O0FA 3H7IA 2E8NA 3OWGA 2H3IA 3T5HA 5DB6A 1PVRA 1MN8A 2R18A 5KFEA 3JPSA 3Q8LA 2LI6A 1ZQPA 1VLBA 1ZQUA 2KFZA 5J0WA 4QWAA 2JMGA 3BQ7A 3K7DA 3FC4A 2QARA 4FH5A 3ZDCA 3UM9A 2KV2A 1YZ7A 2ID1A 3H39A 7ICHA 5DB7A 1ZQAA 2IMWP 1KL9A 2KIVA 3PMNA 4R65A 2RQ5A 4F4ZA 3KZXA 4QZAA 2KSOB 4YFKA 2W8KA 2RRDA 2Z7JA 5CFTA 4F50A 4UAWA 3RRHA 3MFHA 4J9KA 1LV5A 3H3AA 5CP2A 2G08A 4WC2A 3WK6A 2W7PA 4F92B 2ZIXB 4CCHA 2W04A 1F44A 4Z6FA 2FLPA 1SWWA 1JXLA 4B6JA 1VJ7A 2B56A 4IL6U 8ICEA 4WH5A 2BR0A 4BXOB 4P4MA 2BDPA 3H37A 2NV3A 3GV8B 1L7PA 2ZH3A 2JEGA 8ICAA 3T79A 3BQ1A 3TAQA 2QKQA 4C8LA 3I76A 4MFAA 2HCFA 5AK6A 4O67A 2PXIA 1WWUA 2IBKA 3UMCA 1NO5A 4RQ8A 5J2FA 1NJZA 4MF8A 1SGGA 4ECTA 5J0PA 4FS1A 1RYSA 4PH5A 4YR3A 3H8JA 3MCRA 2C2RA 5HHHA 3E2EA 4DFMA 2RDIA 7ICSA 2NRVA 2R8GA 7ICQA 4UB5A 8ICWA 4KITB 1KQQA 3TADC 4FO1A 2DR7A 1ZQYA 3CYMA 3I1YA 9ICCA 4NLZA 4I2EA 1UETA 3NTUA 2XC9A 4HX0A 1ED1A 4B9TA 1CI4A 4I2GA 5KT2A 2H3QA 1QCKA 1N5WA 4KLUA 3EZ5A 3AN1A 1SKRA 4YMOA 4P4OA 3GILA 1ZQBA 5KG0A 2HOFA 3OHAA 5KFZA 3PR4A 1UHUA 2MAXA 1Q78A 2HBMA 3NKUA 2VIXA 3CW2C 2M9NA 4QNLA 4Y2QA 9ICPA 3GIIA 3TFSA 1T3QA 3E0FA 5JTIA 1RXWA 1D9DA 2DR9A 9ICJA 2YB1A 3FAHA 5F3XB 4Y2RA 3RJGA 2XIDA 3PVXA 4O3RA 2BKEA 5F2VO 4DFDA 2ZXIA 2K4HA 2LM1A 5J0RA 3MR6A 4JWMA 5KFGA 5KFNA 4FH3A 1UPHA 2I9GA 2FLLA 3GDXA 1RZTA 5T14A 4JMUA 5J2BA 8ICCA 2KSOA 4KLGA 2UVVA 4RPZA 3L4PA 4MEYA 1S10A 3AUOA 4QZHA 3OTQA 2QLTA 2VKQA 1BPZA 2UVUA 4K9AA 3WK9A 7ICIA 2DVIA 3CNHA 5AK3A 2P35A 4F5NA 1NK8A 1ZOLA 2K4PA 3HX0A 2ZHBA 5KT6A 5ALGA 4DWIA 4RU9A 3B0XA 3D2NA 5DG9A 1Z4NA 4KX3A 2KFNA 1CEZA 2IHOA 2A19A 2EH9A 5KFVA 1ZQQA 5KFAA 4HAIA 2JRZA 4EBKA 1K5OA 3ISDA 1QH9A 4Y2SA 3NWIA 3ZI4A 3SD7A 2PKEA 1L8OA 8ICVA 8ICZA 3QEAZ 3MGVA 5KNIA 4OAGA 1JN3A 5DBBA 4IR9A 2HI0A 3V7KA 4X4QA 1QQ6A 5ALHA 4RNNA 2I5HA 4RT3A 5AI4A 2CN1A 2BBJA 2WFAA 1RPLA 1D9FA 4NXXA 3UXNA 1MIVA 4O3QA 3DV9A 1L3VA 4FHPA 1V85A 4YD2A 4EYIB 8ICXA 1Q3VA 4TUPA 1X6JA 4I2HA 2KP7A 2JGAA 1NOMA 2B4VA 4ED2A 1TAMA 4E80A 2ZJ8A 5AIBA 4OO1J 2W9MA 2FDRA 3PW7A 5D46A 4WC1A 5F9NA 2ZJAA 3TKAA 4X4VA 3AU2A 4PHPA 1ZETA 2XY5A 1ZJNA 2W3SA 2G09A 4F72A 4X4UA 3QU2A 5IIJA 4FHVA 4X0BA 5AICA 2XCPA 5KFCA 4ED7A 5TISU 2ZIUA 7ICOA 1KN5A 2G5HB 3NYBA 5KFFA 5KG3A 4ACOA 4GXIA 1NK6A 5CA7A 3RJJA 4CF3A 4RWNA 5HHIA 1U9LA 4JUZA 5ALVA 3JPRA 3KHLA 4Y2VA 3NVVA 1TFYA 2LHTA 7ICPA 5CHEA 3N97B 2ZH5A 1SXDA 3C66A 1DGJA 5KFSA 1T94A 1F0MA 3LWMA 4OJPA 3ONNA 2WTFA 2KZZA 1RM6C 3WKDA 1ECWA 5IIOA 5KFTA 2PFQA 1U45A 1COOA 1BPYA 3NVZA 1JAJA 4QWBA 4NLCA 4M9GA 2HHUA 9ICRA 3PY8A 3H8WA 4FZMA 4RWPA 3NS1A 2BCSA 3IDWA 9ICVA 3L9DA 4F4XA 3EW9A 2HW3A 3LK9A 3QX7A 4YXMA 5KTQA 4C80A 1SZPA 5ALUA 2AGPA 1R89A 4Y2PA 1MQ2A 2I6XA 3K1RB 3NGDA 1NJYA 1QSYA 2M2UA 2DL0A 8ICPA 2DFLA 3H0RB 2K8CB 5B3PA 1VJ5A 3K1ZA 4AT9B 1L5UA 1UA0A 3BDPA 4DFJA 4DOAA 3QE9Y 9ICTA 5HRGA 2HOQA 3Q8RB 5KAFU 2WF6A 3UQ0A 5HP4A 2AXTU 4I2AA 4MFFA 4DFKA 3QUTA 4NXVA 3J81j 3AQFA 1DK3A 4IRDA 3RB3A 4E7XA 1FFUA 1A6SA 5CFSA 3F2CA 1HIWA 5KT4A 1R8BA 4Q44A 3UMGA 1J2NA 2BCVA 1S77D 2FMPA 4K96A 4FBUA 3Q8KA 4JWNA 4WOYA 2HBJA 4NL9C 4NXTA 3NRZA 1OU5A 1KFSA 1LB2B 1SV4A 1SWVA 3FYHA 5HR9A 4RQ1A 3MDCA 3AQEA 1Z1BA 4OJOA 2DKZA 5AI8A 4EX6A 2A1JB 4OJLA 4UQGA 3ALRA 1SKWA 3PW2A 4PGQA 4M6WB 5AI5A 1L7OA 3M9NB 4RWOA 4N7RA 2F3NA 4OJ6A 1SL1A 2XCAA 3F53A 3K4GA 4X0AA 2DKXA 3OSPA 5JU5A 1A76A 4K4HA 4ED6A 4IRKA 3TI0A 2O1PA 4O6AA 5DLFA 2XICA 1RG6A 1BPDA 3AQLA 1ZQZA 5J8YC 5DBAA 1RYRA 3S6JA 5KFQA 3RH5A 1R8AA 2ZTDA 3WFPA 5ALPA 1UT5A 2OYYA 1WG8A 5AKZA 2MUTA 5J2JA 4J9LA 4NLGA 2DR8A 4OD0A 4I2FA 3LWLA 2G07A 3TAPA 1RQNA 4FZLA 3NUQA 1J97A 7ICVA 4EGWA 4U7CA 8ICYA 1NZPA 5HRBA 1K1QA 1FFVA 3PW4A 9ICAA 2C28A 4G9BA 4RZRA 4YCXA 5B5EU 4KLOA 5KFKA 1P7DA 4LZGA 5J2CA 1XS9D 4F5PA 1MA7A 4DQSA 5J2IA 1S0VA 1BPXA 1L6NA 1KFTA 1A77A 4UAUA 3HRDD 3IG8A 4KLMA 2O6KA 1ZQEA 4DSIA 5J2AA 2AGOA 2JZBA 3HKZC 4F8RA 4M9LA 3IHQB 4QIWF 2NYVA 4ELTA 3PR5B 3AU6A 4KLIA 2KD1A 4PHEA 2PI5A 3B0YA 3WKCA 1PK3A 4RQ4A 8ICNA 3GQCA 3V7LA 1X42A 3TARA 4UB8U 5AM0A 4K9BA 2ZIWB 3WFRE 4X4RA 4M9HA 2JV3A 2ZIVB 4R8UB 1X6IA 1ZJMA 4AYBC 2JH7A 5GTHU 4NM2A 4YMMA 3OJSA 2G06A 5ALKA 2WB1F 1SL0A 4M2YA 3SMVA 4K4GA 5B3QA 4F4KA 1WCNA 4P0QA 1WYGA 4BWJA 3EYZA 3A0BU 1JALA 4BGDA 5EWGA 5AKEA 1RQLA 1ZQFA 3IM1A 1IM4A 7ICLA 3G6XA 2KG5A 4M04A 5DG8A 4ICAA 4DL6A 2P66A 4Z6CA 2AU0A 4J9SA 4AT8B 3H40A 1KNYA 2F44A 1Q8KA 2ZHAA 3TACB 1V9PA 5IILA 5KT5A 2HHPA 2Y0SF 3IV6A 1T4GA 5ALSA 1L3UA 4M6WA 3WU2U 2CPRA 3TFRA 4ECRA 4WC4A 5KFBA 1D8BA 1MSWD 5J2DA 3SYZA 3ZDAA 1DGSA 5ALXA 3OHBA 4EENA 2DF4B 4QZBA 3JPPA 3RAXA 3ZDDA 2FMSA 4EEDA 5J29A 4WC5A 2KJ5A 3L3FX 2ALZA 3V7JA 1C7YA 1B43A 2C2EA 1QTMA 3RFAA 1MC8A 1TK8A 3DDHA 3PX6A 4B9UA 3BZKA 5EWEA 2W11A 4RQ0A 4WC0A 4C0ZA 4ECYA 3G6VA 4RT2A 4KMOB 4NXUA 2VA2A 4QZGA 3RB6A 2K60A 3RJHA 3UMBA 4C8NA 4Y2UA 4OAFA 3PNCA 1LKYB 2K8AA 4ELVA 2KZ3A 5HRIA 3LQCB 2YY6A 2BE3A 1JX4A 1S5LU 3KKAA 4MKPA 4LT6A 3RF9A 3AEVA 2KZMA 5KG5A 4KLQA 4M0AA 3RBEA 4BUGA 7ICJA 1JRPA 1RYUA 5L9XA 2KIWA 1BNPA 1Z4OA 4C8OA 2MRLA 4WC3A 1X9WA 2ZIWA 1L7NA 1HUZA 3RAQA 4R8UA 1ZQGA 1ZQRA 3AM9A 1UEUA 3KZIU 3PW5A 1LVHA 2F77X 4UB1A 1RDFA 3E58A 1KKXA 4E0DA 5KL8B 9ICHA 4YG2A 2FCLA 1XU4A 1Z3EB 3F5AA 5J0YA 4IR1A 4QZDA 4Q45A 3OV7A 3EUB2 3F2BA 2H3ZA 4EEBA 3GIKA 3BS5A 2BPGA 4ED3A 4O3NA 1TFWA 1XO1A 5HMMA 4US9A 5D62A 4AT8A 3QYPA 5J0QA 1N60A 2JH1A 4X5VA 4NY8A 5KFWA 3SQIA 1Z00B 2W9BB 3MGIA 5AM3A 4OAHA 2HHVA 4O69A 3OVAA 3ZDBA 4EZ6A 2ZH2A 3KHGA 2QB1A 4RQ5A 5CJ7A 3QUBA 5D4BA 3RH6A 2ZH9A 4X4SA 2WB1C 2OXOA 5KT7A 4LEWA 3C28A 1OUQA 2DUYA 2YTUA 5DQIA 5EE1A 4F2RA 5E79U 2DRAA 1COKA 3GV5B 1UQVA 1UEVA 3SV4A 5DG7A 1DXSA 4IC9A 5FP0A 4DLEA 4YD1A 3C29A 2KVCA 2H3VA 4DLGA 4FBTA 4EEYA 2BQ3A 3HP6A 3ZD8A 4FHYA 5ALIA 1Q46A 2R8HA 1X2IA 4Z6DA 4F5RA 4FHWA 4RWQA 3K75D 2ZIXA 3I28A 4FO6A 4TUSA 4I28A 2FPKA 8ICMA 2XY6A 2Y9TA 4PGYA 2FLNA 4I0UA 2Y0SC 5KFRA 2LYHA 4UB2A 5DQHA 3QU7A 4BXOA 2GLEA 3UXPA 1U47A 2BDUA 4CDGA 5KAIU 3MR3A 5KFDA 3GIMA 5KFYA 4B9MA 3JPTA 5DDMA 4QZ8A 8ICFA 3RR8A 4DSJA 2IOHA 2ASLA 3BZCA 4ATBB 1KTQA 4F93B 4X4PA 1RXVA 4LVSA 1VDVA 3IRUA 2F76X 3OGUA 1KDHA 3UPSA 2BPCA 2PMZF 2KN7A 4QZ9A 3C2LA 1NJWA 4P4PA 2GOLA 2FMQA 7ICGA 4A8EA 1TE2A 3M7DA 4J9NA 1KSPA 1NKCA 1B22A 4WJ3B 4QWDA 1SL2A 3H0LB 3QXGA 3CRXA 3C23A 2M2TA 3F5EA 5BPCA 3KHRA 2EAPA 4KTQA 4I2BA 3SAHA 2B21A 4UASA 1TAQA 4K99A 4WBYA 4B9LA 5J0XA 4LEVA 2LMRA 4IQTA 4J9OA 1F5AA 2NO4A 3HPOA 3UXOA 3Q8SB 1QSSA 4X4NA 3RBDA 1ZRNA 3WFOA 5DB9A 4C8MA 4WCWA 5AI6A 1UA1A 1L3SA 3SEIA 1MQ3A 4F3OA 4PJ0U 2EQYA 9ICSA 2E8PA 5IINA 4EBDA 2DGZA 3RJEA 2RFFA 5CR0A 3BQTA 4UARA 4EYHB 3ZDEA 2IHMA 1BNOA 2FPMA 3GV7B 4I2CA 1GO3F 5L1IA 3QNMA 2EWRA 5AKGA 3C1YA 2YQEA 3SAGA 1CRXA 2AGQA 1QLNA 3TADA 2E8MA 5KL1B 1ZQHA 8ICKA 1L3TA 2V4QA 2HHXA 2KKVA 1ZQSA 5AKKA 5KFHA 3ER9B 4MF2A 2ZTCA 8ICOA 3QU5A 2OEHA 2JXJA 3HWTA 1SKSA 4ZH4A 5L1MA 1Z19A 1XSPA 3C1ZA 4XA5A 4KLSA 5J2KA 3EWAA 2WAQF 3MABA 1IG6A 1C20A 2HN2A 5J0TA 2KICA 5ALQA 4UAYA 2K89A 4I2IA 4LEZA 2ZXHA 5BOMA 1SXEA 1EXNA 5DQGA 4GC7A 4YR0A 2BHNA 1N62A 4R64A 4ED1A 2OWOA 5HREA 2F8LA 4AP9A 2DPJA 2ISPA 5ALMA 4S3NA 2KTQA 3GU3A 4CNQA 5J0OA 4O5KA 5IIMA 2F1HA 4DO9A 4DSKA 8ICJA 4J9MA 2EZXA 1ZYQA 4UAZA 3H4BA 2OHFA 2L5YA 3LVVA 3KD3A 2E5SA 2YMMA 7ICUA 4NLNA 2AQ4A 4RQ3A 4X4OA 3THVA 9ICWA 1ZQIA 1XSNA 2WF7A
chains in the Genus database with same CATH topology
2NRXA 4I2JA 1SL0A 5HHHA 3BQ0A 4M2YA 3E2EA 2M2WA 4K4GA 4ECSA 4DFMA 1N48A 2RDIA 5J2GA 4F4KA 7ICSA 4F5QA 4JV1A 2NRVA 2R8GA 7ICQA 2AJQA 4UB5A 1WCNA 4M9NA 3MFIA 4BWJA 4KITB 8ICWA 3EYZA 2DR7A 4BGDA 5EWGA 1ZQYA 3RTVA 4ECXA 1T8EA 3H37A 1ZQFA 3IM1A 9ICCA 1IM4A 1NK0A 1ZQDA 3G6XA 4I2EA 4NLZA 7ICLA 1UETA 3NTUA 2XC9A 4QW8A 4B9TA 4M04A 5DG8A 1VFGA 4DL6A 2P66A 4E8FA 4I2DA 4Z6CA 4QWCA 4I2GA 2AU0A 5KT2A 4J9SA 5HRHA 2HHQA 4F5OA 4RPXA 4AT8B 2ZH4A 4MFCA 4KLUA 3H40A 3EZ5A 1K1SA 1SKRA 1Z00A 1KNYA 2W9BA 4YMOA 5KT3A 5IIIA 4P4OA 4DL3A 9ICMA 3GILA 1ZQBA 5KG0A 1JIHA 5KFZA 3OHAA 3M8SA 2ZHAA 5KG7A 1V9PA 3PR4A 4LZDA 4BDPA 2IA6A 2R8IA 4M5DA 2MAXA 8ICSA 3JPOA 5IILA 1Q78A 5KT5A 9ICEA 2HHPA 1T4GA 3QZ8A 1L3UA 2M9NA 4M6WA 1S0MA 9ICPA 4PHDA 4DEZA 2XGPA 3TFRA 3SZ2A 4ECRA 3V6JA 4DQIA 1D8YA 3GIIA 3TFSA 2XY7A 2R8JA 1RXWA 1D9DA 4WC4A 5KFBA 2DR9A 3PO4A 9ICJA 1MSWD 3V6KA 5DGBA 3BJYA 5J2DA 5KG6A 3SYZA 3ZDAA 1DGSA 3OHBA 3RJGA 3EPGA 4J9RA 4QZBA 4O0IA 3JPPA 2J6UA 4DQRA 4YQWA 4Z6EA 3PVXA 3RAXA 2FMSA 3ZDDA 4O3RA 1NKEA 5J29A 2BKEA 3V6HA 4Q8EA 9ICOA 5F2VO 4WC5A 3Q8PB 2ALZA 5KFOA 4ELUA 3V7JA 1C7YA 4KLFA 1B43A 2C2EA 4KLTA 5J0RA 3MR6A 4RUAA 1QTMA 3AQMA 4JWMA 2F1IA 4RPYA 1MC8A 5EWFA 2Y1JA 3JZ0A 4GC6A 2NRZA 8ICRA 4QZEA 2ASJA 1TK8A 5KFGA 2HHSA 5KFNA 1BPBA 4FH3A 3SV3A 2MUTB 5DEDA 2I9GA 3PX6A 4J9PA 4B9UA 1ZQNA 5EWEA 2FLLA 3GDXA 1RZTA 2BGWA 4RQ6A 4AT7A 1S0OA 5J2BA 8ICCA 1NK5A 4RQ0A 4RNMA 4WC0A 4ECYA 1WCLA 4KLGA 2UVVA 4RPZA 4HYKA 2BCUA 4UD4A 3G6VA 4MEYA 2ZUDA 4RT2A 1S10A 7ICEA 1D8LA 4FS2A 3AUOA 4QZHA 2VA2A 4XUSA 4QZGA 2VANA 2C22A 1BPZA 3RB6A 1TV9A 3RJHA 2UVUA 4C8NA 3ORYA 3SI8A 7ICIA 5HRLA 5D49A 3PNCA 3ISBA 1AROP 2XGQA 2DVIA 2BPFA 4DL2A 3RR7A 2W9CA 4ELVA 2KZ3A 4F5NA 1NK8A 8ICBA 5HRIA 7ICNA 3HX0A 4ECZA 4ECWA 4B9SA 1JX4A 3LQCB 5KT6A 2BE3A 2ZHBA 3H4DA 4DWIA 3ETLA 2PFOA 4RU9A 5J2HA 3B0XA 4KLDA 1YLQA 3MGHA 9ICBA 5DG9A 5F9LA 7ICFA 2JEJA 1U4BA 2KZMA 4LT6A 3OUYB 3M9OB 5KG5A 2KFNA 3PO5A 3JPQA 9ICGA 3MBYA 4KLQA 1CEZA 4UD5A 4M0AA 3RBEA 2VA3A 8ICGA 2JZBB 5KFVA 1S76D 1ZQQA 5KFAA 7ICJA 8ICLA 4ATBA 3H8SA 5L9XA 4EBKA 4IQWA 3ISDA 5IIKA 5KFMA 4AT9A 3WFQE 3QZ7A 1BNPA 4C8OA 8ICVA 4YVZA 4WC3A 8ICZA 3QEAZ 1JMSA 4EBEA 4DL5A 1X9WA 1JN3A 5DBBA 4IR9A 3V7KA 1HUZA 1NK9A 1ZQKA 1TAUA 4X4QA 4M9JA 2PBEA 3RAQA 1TK5A 9ICQA 4RNNA 4R8UA 1ZQGA 1ZQRA 1UEUA 3RB0A 1WOTA 7ICMA 4XRHA 4RT3A 3OJSA 3PW5A 4IQVA 1JXEA 4UB1A 1MIWA 7ICRA 4X4VA 1D9FA 1RPLA 3QEBZ 2Q66A 3UXNA 3V72A 1MIVA 4O3QA 4E0DA 4ECVA 1L3VA 9ICHA 2I1QA 4FHPA 4YG2A 4YD2A 4EYIB 8ICXA 1BVSA 4TUPA 1XU4A 1Z3EB 4O5CA 5DDYA 4DSFA 4QZIA 4DQPA 4I2HA 3H38A 5J0YA 8ICHA 2KP7A 1XWLA 4DOBA 4IR1A 1NOMA 4QZDA 4Q45A 2P6RA 3AQKA 9ICLA 3Q8MA 3OV7A 3OVBA 4ED2A 4IRCA 3GIKA 3C21A 1TVAA 2BPGA 4JV0A 3GIJA 1JQRA 1ZQXA 4NM1A 4E80A 2ZJ8A 3HT3A 4KN7A 3RJIA 3RB4A 2NRKA 1KEJA 4ED3A 2W9MA 4O3NA 4F2SA 1V4AA 3PW7A 1TFWA 1XO1A 5HMMA 5F9NA 5D46A 3C18A 4B9VA 2ZJAA 4WC1A 4AT8A 5J0QA 4EZ9A 1MIYA 3AU2A 4TQRA 4PHPA 1ZETA 1ZQTA 2XY5A 1ZJNA 4X5VA 2PFNA 2A1JA 4NY8A 5KFWA 4O9MA 1Z00B 1S0NA 2W9BB 4DL4A 4X4UA 3MGIA 5IIJA 2HHVA 3MDAA 4FHVA 3EPIA 3OVAA 4X0BA 2XCPA 2F1JA 5KFCA 3ZDBA 1IXRA 4ED7A 1PZNA 4EZ6A 1PX5A 2ZH2A 3KHGA 4C8KA 4KLJA 3HW8A 7ICOA 4RQ5A 5CJ7A 5DB8A 1NKBA 3NYBA 5KFFA 5KG3A 5D4BA 4GXIA 1T3NA 3RH6A 1NK6A 5CA7A 1S97A 3RJJA 2PI4A 1N56A 1HUOA 3MR5A 3GFKB 8ICIA 9ICUA 4RNOA 4F4YA 4X4SA 2ZH9A 5DLGA 2HHWA 1FA0A 5KT7A 3AQNA 2DR5A 4RWNA 4DSLA 4WBZA 4RQ7A 4GXJA 5HHIA 3PX0A 5DQIA 4I29A 4NKUA 4F2RA 3C5GA 1ZQOA 3RJKA 2O5AA 1U9LA 4IG8A 4JUZA 4MEXA 2DRAA 3JPRA 1H38A 3GV5B 1CUKA 3KHLA 3TQ1A 1NJXA 1UEVA 1NK4A 3SV4A 4EP7A 5C5JA 5DG7A 1X9MA 2HVIA 1TFYA 3KTQA 9ICFA 7ICPA 4DLEA 2V4RA 3N97B 4JV2A 4YD1A 2ZH5A 4O3PA 5JUMA 3C5FA 4GLXA 3C66A 1ZQMA 2V9WA 4DLGA 4FBTA 4RQ2A 4EEYA 3N4MB 4IQUA 4PGXA 5KFSA 5DGAA 2BQ3A 3LWMA 3T5KA 3HP6A 2WTFA 3ZD8A 4FHYA 1ZQCA 2KZZA 5IIOA 4X4TA 5KFTA 2PFQA 4K4IA 9ICNA 4ED8A 1U45A 2BQRA 1COOA 4UB3A 4F91B 1BPYA 5HMLA 2NRTA 1X2IA 4Z6DA 2R8HA 2Q0ZX 4QWBA 4F5RA 3K75D 4F4WA 4FO6A 4NXZA 4TUSA 4I28A 4M9GA 2HHUA 4RWQA 4KN4A 9ICRA 2FPKA 8ICMA 4QW9A 2XY6A 3PY8A 4PGYA 3H8WA 2FLNA 4O3OA 1TKDA 5KFRA 4RWPA 2LYHA 4UB2A 4UB4A 5DQHA 1T7PA 2BCSA 4BXOA 2JEIA 9ICVA 3T5LA 8ICUA 3ZD9A 3L9DA 1ZQJA 3UXPA 3EW9A 4F4XA 1U47A 3UQ2A 2AQ0A 4FHWA 2HW3A 3LK9A 4YXMA 3MR3A 5KFDA 5KTQA 3TANA 2NRWA 2BQUA 1SZPA 5KFYA 3GIMA 3JPTA 4DF8A 4B9MA 5DDMA 8ICTA 3OUYA 3LDAA 2AGPA 2HHTA 1R89A 4QZ8A 4RUCA 8ICFA 2Y1IA 2DPIA 3RR8A 4TUQA 5L1JA 1MQ2A 4DSJA 1ZQVA 9ICKA 3NGDA 1NJYA 1QSYA 2M2UA 4YMNA 2ASLA 8ICPA 4J9QA 2DFLA 1ZQLA 4DL7A 5J2EA 2ZTEA 5L1KA 4ATBB 4YN4A 3C2MA 1KTQA 4F93B 4DS4A 3M9MB 4X4PA 5HC9A 2ZUBA 1RXVA 4LVSA 4AT9B 4DSEA 1L5UA 3BQ2A 4DF4A 1UA0A 3OGUA 3BDPA 4DFJA 1KDHA 5L1LA 4DOAA 2UVRA 3QE9Y 9ICTA 5HRGA 3UPSA 2BPCA 2DR8A 2GWSA 4KLLA 5DBCA 2KN7A 4XQ7A 3Q8RB 4QZ9A 2J6TA 3C2LA 1NJWA 4P4PA 2DRBA 1BGXT 3KHHA 2FMQA 3MR2A 2W8LA 5CB1A 1BPEA 3UQ0A 4DFPA 5HP4A 2ISOA 3OSNA 3RRGA 4I2AA 7ICGA 4MFFA 4J9NA 4DFKA 1S9FA 1KSPA 4KLHA 2ZH1A 4QZCA 5KFUA 4IRDA 1NKCA 4O3SA 2FPLA 3RB3A 1KFDA 4QWDA 1SL2A 1B22A 1DK3A 4E7XA 2UVWA 4TQSA 3HJ1A 3ISCA 3C23A 3WFSC 4ECQA 2M2TA 4O5EA 9ICAA 5BPCA 5KFPA 5KT4A 2RDJA 1R8BA 3KHRA 7ICTA 5J0UA 4WC6A 4Q44A 3RJFA 4KTQA 1KRPA 4I2BA 2ZH7A 2B21A 2BCVA 2BCQA 1S77D 2FMPA 1Q79A 4FBUA 3Q8KA 1TAQA 3T3FA 5CWRA 4KMUA 3PX4A 2H5XA 4BWMA 4JWNA 9ICIA 4WBYA 4B9LA 5J0XA 1OU5A 1KFSA 3PW0A 2BCRA 2ZUCA 1LB2B 4JK1A 2J6SA 4M47A 4IQTA 3FYHA 5TZVA 4J9OA 2VA8A 4GXKA 5HR9A 1F5AA 5KFXA 3HPOA 4RQ1A 3UXOA 3OJUA 4YXJA 3PV8A 3MDCA 1U49A 3Q8SB 5HNKA 4DOCA 2P6UA 4I27A 1QSSA 2ZH6A 3RBDA 4X4NA 4G3IA 3WFOA 2A1JB 5DB9A 4C8MA 5HRDA 4WCWA 4XQ8A 3PMLA 4EBCA 4Q43A 3G6YA 4UQGA 1UA1A 1L3SA 1SKWA 4Q8FA 3PW2A 3RH4A 5EOZA 4PGQA 5CHGA 4M6WB 3M9NB 5J0SA 4PPXA 1MQ3A 4RWOA 4F3OA 5HRKA 2HVHA 8ICQA 5BOLA 4P2HA 1SL1A 2XCAA 9ICSA 3K4GA 5IINA 4UBBA 4EBDA 4X0AA 3H7IA 3FDSA 3OSPA 2W9AA 3M8RA 3T5HA 3RJEA 2RFFA 1A76A 4K4HA 5KG2A 5CR0A 5DB6A 3BQTA 4ED6A 4IRKA 4EYHB 3ZDEA 3TI0A 2IHMA 2O1PA 1BNOA 3T5JA 1JAJA 5KFEA 5DLFA 3JPSA 4B9NA 3Q8LA 1BPDA 2FPMA 3GV7B 3C2KA 3AQLA 1ZQZA 1ZQPA 4I2CA 1ZQUA 4DS5A 5DBAA 2KFZA 2ZJ5A 1RYRA 5J0WA 1DOQA 5L1IA 4PHAA 5KFQA 4FHXA 4ECUA 4QWAA 4QZFA 3C1YA 3RH5A 1R8AA 2ZTDA 5KFJA 3WFPA 2AGQA 1UT5A 4FH5A 3ZDCA 1QLNA 1ZQHA 4R66A 8ICKA 3OVSA 2MUTA 2ID1A 5J2JA 1L3TA 2V4QA 4J9LA 4DQQA 4NLGA 1ZQWA 4I2FA 2HHXA 7ICHA 2M2VA 1ZQSA 3H39A 5KFHA 5DB7A 3LWLA 1ZQAA 2IMWP 3TAPA 2IHNA 3PMNA 4R65A 4MF2A 4AT7B 2ZTCA 8ICOA 1Y88A 7ICVA 3JYYA 4F4ZA 4QZAA 2R8KA 4YP3A 4YFKA 4YR2A 2ATLA 2W8KA 8ICYA 1DK2A 5DECA 1NZPA 5HRBA 4F50A 4UAWA 4EBJA 3RRHA 1K1QA 3HWTA 4ZH4A 3PW4A 2C2DA 2C28A 1XSPA 3MFHA 4J9KA 3Q8QB 1SKSA 1LV5A 2ASDA 3C1ZA 4RZRA 4XA5A 4YCXA 3H3AA 5CP2A 4KLOA 5KFKA 1KLNA 4LZGA 5J2CA 4UBCA 1XS9D 4KLSA 4F5PA 5J2KA 3EWAA 4WC2A 4F92B 3MABA 2W9CB 4DQSA 4CCHA 4WC7A 5J2IA 4Z6FA 1S0VA 5J0TA 1BPXA 2FLPA 4UAYA 1KFTA 4NKTA 1JXLA 1VJ7A 1A77A 3HJ4A 4I2IA 8ICEA 4NLKA 2BR0A 5BOMA 1XC9A 1TK0A 4BXOB 4KLMA 1EXNA 5DQGA 4P4MA 5KG4A 4GC7A 4YR0A 2XO7A 2BHNA 1ZQEA 2BDPA 4DSIA 5KFIA 3GV8B 5J2AA 2AGOA 5KFLA 2JZBA 7ICKA 4R63A 4R64A 4ED1A 2OWOA 4KLEA 5HREA 2ZH3A 2DPJA 4F8RA 2JEGA 4M9LA 4ED0A 3BQ1A 3IHQB 2ISPA 8ICAA 4S3NA 2ZH8A 3TAQA 4C8LA 2KTQA 5KG1A 3JPNA 4ELTA 5J0OA 4MFAA 3PR5B 9ICXA 3HIYA 1HJPA 3AU6A 5IIMA 1X9SA 2F1HA 4O5KA 4KLIA 4PHEA 4TURA 4DO9A 3B0YA 2PI5A 4DSKA 4RQ4A 8ICJA 8ICNA 2JEFA 3GQCA 2PXIA 2PFPA 3V7LA 1U48A 1R8CA 4J9MA 2IBKA 3TARA 5DKWA 1ZYQA 4UAZA 1NO5A 3H4BA 5HRFA 4M9HA 4RQ8A 1TFRA 1NK7A 4X4RA 3WFRE 5J2FA 1NJZA 4MF8A 1QSLA 4R8UB 1ZJMA 4NLNA 1XSLA 7ICUA 4ECTA 2AQ4A 4RQ3A 5J0PA 4X4OA 4FS1A 1RYSA 3THVA 9ICWA 1ZQIA 4NM2A 4PH5A 1UT8A 3H8JA 4YMMA 4YR3A 4QWEA 1XSNA 3UPQA 2C2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRX A;  4I2J A;  1SL0 A;  5HHH A;  3BQ0 A;  4M2Y A;  3E2E A;  2M2W A;  4K4G A;  4ECS A;  4DFM A;  1N48 A;  2RDI A;  5J2G A;  4F4K A;  7ICS A;  4F5Q A;  4JV1 A;  2NRV A;  2R8G A;  7ICQ A;  2AJQ A;  4UB5 A;  1WCN A;  4M9N A;  3MFI A;  4BWJ A;  4KIT B;  8ICW A;  3EYZ A;  2DR7 A;  4BGD A;  5EWG A;  1ZQY A;  3RTV A;  4ECX A;  1T8E A;  3H37 A;  1ZQF A;  3IM1 A;  9ICC A;  1IM4 A;  1NK0 A;  1ZQD A;  3G6X A;  4I2E A;  4NLZ A;  7ICL A;  1UET A;  3NTU A;  2XC9 A;  4QW8 A;  4B9T A;  4M04 A;  5DG8 A;  1VFG A;  4DL6 A;  2P66 A;  4E8F A;  4I2D A;  4Z6C A;  4QWC A;  4I2G A;  2AU0 A;  5KT2 A;  4J9S A;  5HRH A;  2HHQ A;  4F5O A;  4RPX A;  4AT8 B;  2ZH4 A;  4MFC A;  4KLU A;  3H40 A;  3EZ5 A;  1K1S A;  1SKR A;  1Z00 A;  1KNY A;  2W9B A;  4YMO A;  5KT3 A;  5III A;  4P4O A;  4DL3 A;  9ICM A;  3GIL A;  1ZQB A;  5KG0 A;  1JIH A;  5KFZ A;  3OHA A;  3M8S A;  2ZHA A;  5KG7 A;  1V9P A;  3PR4 A;  4LZD A;  4BDP A;  2IA6 A;  2R8I A;  4M5D A;  2MAX A;  8ICS A;  3JPO A;  5IIL A;  1Q78 A;  5KT5 A;  9ICE A;  2HHP A;  1T4G A;  3QZ8 A;  1L3U A;  2M9N A;  4M6W A;  1S0M A;  9ICP A;  4PHD A;  4DEZ A;  2XGP A;  3TFR A;  3SZ2 A;  4ECR A;  3V6J A;  4DQI A;  1D8Y A;  3GII A;  3TFS A;  2XY7 A;  2R8J A;  1RXW A;  1D9D A;  4WC4 A;  5KFB A;  2DR9 A;  3PO4 A;  9ICJ A;  1MSW D;  3V6K A;  5DGB A;  3BJY A;  5J2D A;  5KG6 A;  3SYZ A;  3ZDA A;  1DGS A;  3OHB A;  3RJG A;  3EPG A;  4J9R A;  4QZB A;  4O0I A;  3JPP A;  2J6U A;  4DQR A;  4YQW A;  4Z6E A;  3PVX A;  3RAX A;  2FMS A;  3ZDD A;  4O3R A;  1NKE A;  5J29 A;  2BKE A;  3V6H A;  4Q8E A;  9ICO A;  5F2V O;  4WC5 A;  3Q8P B;  2ALZ A;  5KFO A;  4ELU A;  3V7J A;  1C7Y A;  4KLF A;  1B43 A;  2C2E A;  4KLT A;  5J0R A;  3MR6 A;  4RUA A;  1QTM A;  3AQM A;  4JWM A;  2F1I A;  4RPY A;  1MC8 A;  5EWF A;  2Y1J A;  3JZ0 A;  4GC6 A;  2NRZ A;  8ICR A;  4QZE A;  2ASJ A;  1TK8 A;  5KFG A;  2HHS A;  5KFN A;  1BPB A;  4FH3 A;  3SV3 A;  2MUT B;  5DED A;  2I9G A;  3PX6 A;  4J9P A;  4B9U A;  1ZQN A;  5EWE A;  2FLL A;  3GDX A;  1RZT A;  2BGW A;  4RQ6 A;  4AT7 A;  1S0O A;  5J2B A;  8ICC A;  1NK5 A;  4RQ0 A;  4RNM A;  4WC0 A;  4ECY A;  1WCL A;  4KLG A;  2UVV A;  4RPZ A;  4HYK A;  2BCU A;  4UD4 A;  3G6V A;  4MEY A;  2ZUD A;  4RT2 A;  1S10 A;  7ICE A;  1D8L A;  4FS2 A;  3AUO A;  4QZH A;  2VA2 A;  4XUS A;  4QZG A;  2VAN A;  2C22 A;  1BPZ A;  3RB6 A;  1TV9 A;  3RJH A;  2UVU A;  4C8N A;  3ORY A;  3SI8 A;  7ICI A;  5HRL A;  5D49 A;  3PNC A;  3ISB A;  1ARO P;  2XGQ A;  2DVI A;  2BPF A;  4DL2 A;  3RR7 A;  2W9C A;  4ELV A;  2KZ3 A;  4F5N A;  1NK8 A;  8ICB A;  5HRI A;  7ICN A;  3HX0 A;  4ECZ A;  4ECW A;  4B9S A;  1JX4 A;  3LQC B;  5KT6 A;  2BE3 A;  2ZHB A;  3H4D A;  4DWI A;  3ETL A;  2PFO A;  4RU9 A;  5J2H A;  3B0X A;  4KLD A;  1YLQ A;  3MGH A;  9ICB A;  5DG9 A;  5F9L A;  7ICF A;  2JEJ A;  1U4B A;  2KZM A;  4LT6 A;  3OUY B;  3M9O B;  5KG5 A;  2KFN A;  3PO5 A;  3JPQ A;  9ICG A;  3MBY A;  4KLQ A;  1CEZ A;  4UD5 A;  4M0A A;  3RBE A;  2VA3 A;  8ICG A;  2JZB B;  5KFV A;  1S76 D;  1ZQQ A;  5KFA A;  7ICJ A;  8ICL A;  4ATB A;  3H8S A;  5L9X A;  4EBK A;  4IQW A;  3ISD A;  5IIK A;  5KFM A;  4AT9 A;  3WFQ E;  3QZ7 A;  1BNP A;  4C8O A;  8ICV A;  4YVZ A;  4WC3 A;  8ICZ A;  3QEA Z;  1JMS A;  4EBE A;  4DL5 A;  1X9W A;  1JN3 A;  5DBB A;  4IR9 A;  3V7K A;  1HUZ A;  1NK9 A;  1ZQK A;  1TAU A;  4X4Q A;  4M9J A;  2PBE A;  3RAQ A;  1TK5 A;  9ICQ A;  4RNN A;  4R8U A;  1ZQG A;  1ZQR A;  1UEU A;  3RB0 A;  1WOT A;  7ICM A;  4XRH A;  4RT3 A;  3OJS A;  3PW5 A;  4IQV A;  1JXE A;  4UB1 A;  1MIW A;  7ICR A;  4X4V A;  1D9F A;  1RPL A;  3QEB Z;  2Q66 A;  3UXN A;  3V72 A;  1MIV A;  4O3Q A;  4E0D A;  4ECV A;  1L3V A;  9ICH A;  2I1Q A;  4FHP A;  4YG2 A;  4YD2 A;  4EYI B;  8ICX A;  1BVS A;  4TUP A;  1XU4 A;  1Z3E B;  4O5C A;  5DDY A;  4DSF A;  4QZI A;  4DQP A;  4I2H A;  3H38 A;  5J0Y A;  8ICH A;  2KP7 A;  1XWL A;  4DOB A;  4IR1 A;  1NOM A;  4QZD A;  4Q45 A;  2P6R A;  3AQK A;  9ICL A;  3Q8M A;  3OV7 A;  3OVB A;  4ED2 A;  4IRC A;  3GIK A;  3C21 A;  1TVA A;  2BPG A;  4JV0 A;  3GIJ A;  1JQR A;  1ZQX A;  4NM1 A;  4E80 A;  2ZJ8 A;  3HT3 A;  4KN7 A;  3RJI A;  3RB4 A;  2NRK A;  1KEJ A;  4ED3 A;  2W9M A;  4O3N A;  4F2S A;  1V4A A;  3PW7 A;  1TFW A;  1XO1 A;  5HMM A;  5F9N A;  5D46 A;  3C18 A;  4B9V A;  2ZJA A;  4WC1 A;  4AT8 A;  5J0Q A;  4EZ9 A;  1MIY A;  3AU2 A;  4TQR A;  4PHP A;  1ZET A;  1ZQT A;  2XY5 A;  1ZJN A;  4X5V A;  2PFN A;  2A1J A;  4NY8 A;  5KFW A;  4O9M A;  1Z00 B;  1S0N A;  2W9B B;  4DL4 A;  4X4U A;  3MGI A;  5IIJ A;  2HHV A;  3MDA A;  4FHV A;  3EPI A;  3OVA A;  4X0B A;  2XCP A;  2F1J A;  5KFC A;  3ZDB A;  1IXR A;  4ED7 A;  1PZN A;  4EZ6 A;  1PX5 A;  2ZH2 A;  3KHG A;  4C8K A;  4KLJ A;  3HW8 A;  7ICO A;  4RQ5 A;  5CJ7 A;  5DB8 A;  1NKB A;  3NYB A;  5KFF A;  5KG3 A;  5D4B A;  4GXI A;  1T3N A;  3RH6 A;  1NK6 A;  5CA7 A;  1S97 A;  3RJJ A;  2PI4 A;  1N56 A;  1HUO A;  3MR5 A;  3GFK B;  8ICI A;  9ICU A;  4RNO A;  4F4Y A;  4X4S A;  2ZH9 A;  5DLG A;  2HHW A;  1FA0 A;  5KT7 A;  3AQN A;  2DR5 A;  4RWN A;  4DSL A;  4WBZ A;  4RQ7 A;  4GXJ A;  5HHI A;  3PX0 A;  5DQI A;  4I29 A;  4NKU A;  4F2R A;  3C5G A;  1ZQO A;  3RJK A;  2O5A A;  1U9L A;  4IG8 A;  4JUZ A;  4MEX A;  2DRA A;  3JPR A;  1H38 A;  3GV5 B;  1CUK A;  3KHL A;  3TQ1 A;  1NJX A;  1UEV A;  1NK4 A;  3SV4 A;  4EP7 A;  5C5J A;  5DG7 A;  1X9M A;  2HVI A;  1TFY A;  3KTQ A;  9ICF A;  7ICP A;  4DLE A;  2V4R A;  3N97 B;  4JV2 A;  4YD1 A;  2ZH5 A;  4O3P A;  5JUM A;  3C5F A;  4GLX A;  3C66 A;  1ZQM A;  2V9W A;  4DLG A;  4FBT A;  4RQ2 A;  4EEY A;  3N4M B;  4IQU A;  4PGX A;  5KFS A;  5DGA A;  2BQ3 A;  3LWM A;  3T5K A;  3HP6 A;  2WTF A;  3ZD8 A;  4FHY A;  1ZQC A;  2KZZ A;  5IIO A;  4X4T A;  5KFT A;  2PFQ A;  4K4I A;  9ICN A;  4ED8 A;  1U45 A;  2BQR A;  1COO A;  4UB3 A;  4F91 B;  1BPY A;  5HML A;  2NRT A;  1X2I A;  4Z6D A;  2R8H A;  2Q0Z X;  4QWB A;  4F5R A;  3K75 D;  4F4W A;  4FO6 A;  4NXZ A;  4TUS A;  4I28 A;  4M9G A;  2HHU A;  4RWQ A;  4KN4 A;  9ICR A;  2FPK A;  8ICM A;  4QW9 A;  2XY6 A;  3PY8 A;  4PGY A;  3H8W A;  2FLN A;  4O3O A;  1TKD A;  5KFR A;  4RWP A;  2LYH A;  4UB2 A;  4UB4 A;  5DQH A;  1T7P A;  2BCS A;  4BXO A;  2JEI A;  9ICV A;  3T5L A;  8ICU A;  3ZD9 A;  3L9D A;  1ZQJ A;  3UXP A;  3EW9 A;  4F4X A;  1U47 A;  3UQ2 A;  2AQ0 A;  4FHW A;  2HW3 A;  3LK9 A;  4YXM A;  3MR3 A;  5KFD A;  5KTQ A;  3TAN A;  2NRW A;  2BQU A;  1SZP A;  5KFY A;  3GIM A;  3JPT A;  4DF8 A;  4B9M A;  5DDM A;  8ICT A;  3OUY A;  3LDA A;  2AGP A;  2HHT A;  1R89 A;  4QZ8 A;  4RUC A;  8ICF A;  2Y1I A;  2DPI A;  3RR8 A;  4TUQ A;  5L1J A;  1MQ2 A;  4DSJ A;  1ZQV A;  9ICK A;  3NGD A;  1NJY A;  1QSY A;  2M2U A;  4YMN A;  2ASL A;  8ICP A;  4J9Q A;  2DFL A;  1ZQL A;  4DL7 A;  5J2E A;  2ZTE A;  5L1K A;  4ATB B;  4YN4 A;  3C2M A;  1KTQ A;  4F93 B;  4DS4 A;  3M9M B;  4X4P A;  5HC9 A;  2ZUB A;  1RXV A;  4LVS A;  4AT9 B;  4DSE A;  1L5U A;  3BQ2 A;  4DF4 A;  1UA0 A;  3OGU A;  3BDP A;  4DFJ A;  1KDH A;  5L1L A;  4DOA A;  2UVR A;  3QE9 Y;  9ICT A;  5HRG A;  3UPS A;  2BPC A;  2DR8 A;  2GWS A;  4KLL A;  5DBC A;  2KN7 A;  4XQ7 A;  3Q8R B;  4QZ9 A;  2J6T A;  3C2L A;  1NJW A;  4P4P A;  2DRB A;  1BGX T;  3KHH A;  2FMQ A;  3MR2 A;  2W8L A;  5CB1 A;  1BPE A;  3UQ0 A;  4DFP A;  5HP4 A;  2ISO A;  3OSN A;  3RRG A;  4I2A A;  7ICG A;  4MFF A;  4J9N A;  4DFK A;  1S9F A;  1KSP A;  4KLH A;  2ZH1 A;  4QZC A;  5KFU A;  4IRD A;  1NKC A;  4O3S A;  2FPL A;  3RB3 A;  1KFD A;  4QWD A;  1SL2 A;  1B22 A;  1DK3 A;  4E7X A;  2UVW A;  4TQS A;  3HJ1 A;  3ISC A;  3C23 A;  3WFS C;  4ECQ A;  2M2T A;  4O5E A;  9ICA A;  5BPC A;  5KFP A;  5KT4 A;  2RDJ A;  1R8B A;  3KHR A;  7ICT A;  5J0U A;  4WC6 A;  4Q44 A;  3RJF A;  4KTQ A;  1KRP A;  4I2B A;  2ZH7 A;  2B21 A;  2BCV A;  2BCQ A;  1S77 D;  2FMP A;  1Q79 A;  4FBU A;  3Q8K A;  1TAQ A;  3T3F A;  5CWR A;  4KMU A;  3PX4 A;  2H5X A;  4BWM A;  4JWN A;  9ICI A;  4WBY A;  4B9L A;  5J0X A;  1OU5 A;  1KFS A;  3PW0 A;  2BCR A;  2ZUC A;  1LB2 B;  4JK1 A;  2J6S A;  4M47 A;  4IQT A;  3FYH A;  5TZV A;  4J9O A;  2VA8 A;  4GXK A;  5HR9 A;  1F5A A;  5KFX A;  3HPO A;  4RQ1 A;  3UXO A;  3OJU A;  4YXJ A;  3PV8 A;  3MDC A;  1U49 A;  3Q8S B;  5HNK A;  4DOC A;  2P6U A;  4I27 A;  1QSS A;  2ZH6 A;  3RBD A;  4X4N A;  4G3I A;  3WFO A;  2A1J B;  5DB9 A;  4C8M A;  5HRD A;  4WCW A;  4XQ8 A;  3PML A;  4EBC A;  4Q43 A;  3G6Y A;  4UQG A;  1UA1 A;  1L3S A;  1SKW A;  4Q8F A;  3PW2 A;  3RH4 A;  5EOZ A;  4PGQ A;  5CHG A;  4M6W B;  3M9N B;  5J0S A;  4PPX A;  1MQ3 A;  4RWO A;  4F3O A;  5HRK A;  2HVH A;  8ICQ A;  5BOL A;  4P2H A;  1SL1 A;  2XCA A;  9ICS A;  3K4G A;  5IIN A;  4UBB A;  4EBD A;  4X0A A;  3H7I A;  3FDS A;  3OSP A;  2W9A A;  3M8R A;  3T5H A;  3RJE A;  2RFF A;  1A76 A;  4K4H A;  5KG2 A;  5CR0 A;  5DB6 A;  3BQT A;  4ED6 A;  4IRK A;  4EYH B;  3ZDE A;  3TI0 A;  2IHM A;  2O1P A;  1BNO A;  3T5J A;  1JAJ A;  5KFE A;  5DLF A;  3JPS A;  4B9N A;  3Q8L A;  1BPD A;  2FPM A;  3GV7 B;  3C2K A;  3AQL A;  1ZQZ A;  1ZQP A;  4I2C A;  1ZQU A;  4DS5 A;  5DBA A;  2KFZ A;  2ZJ5 A;  1RYR A;  5J0W A;  1DOQ A;  5L1I A;  4PHA A;  5KFQ A;  4FHX A;  4ECU A;  4QWA A;  4QZF A;  3C1Y A;  3RH5 A;  1R8A A;  2ZTD A;  5KFJ A;  3WFP A;  2AGQ A;  1UT5 A;  4FH5 A;  3ZDC A;  1QLN A;  1ZQH A;  4R66 A;  8ICK A;  3OVS A;  2MUT A;  2ID1 A;  5J2J A;  1L3T A;  2V4Q A;  4J9L A;  4DQQ A;  4NLG A;  1ZQW A;  4I2F A;  2HHX A;  7ICH A;  2M2V A;  1ZQS A;  3H39 A;  5KFH A;  5DB7 A;  3LWL A;  1ZQA A;  2IMW P;  3TAP A;  2IHN A;  3PMN A;  4R65 A;  4MF2 A;  4AT7 B;  2ZTC A;  8ICO A;  1Y88 A;  7ICV A;  3JYY A;  4F4Z A;  4QZA A;  2R8K A;  4YP3 A;  4YFK A;  4YR2 A;  2ATL A;  2W8K A;  8ICY A;  1DK2 A;  5DEC A;  1NZP A;  5HRB A;  4F50 A;  4UAW A;  4EBJ A;  3RRH A;  1K1Q A;  3HWT A;  4ZH4 A;  3PW4 A;  2C2D A;  2C28 A;  1XSP A;  3MFH A;  4J9K A;  3Q8Q B;  1SKS A;  1LV5 A;  2ASD A;  3C1Z A;  4RZR A;  4XA5 A;  4YCX A;  3H3A A;  5CP2 A;  4KLO A;  5KFK A;  1KLN A;  4LZG A;  5J2C A;  4UBC A;  1XS9 D;  4KLS A;  4F5P A;  5J2K A;  3EWA A;  4WC2 A;  4F92 B;  3MAB A;  2W9C B;  4DQS A;  4CCH A;  4WC7 A;  5J2I A;  4Z6F A;  1S0V A;  5J0T A;  1BPX A;  2FLP A;  4UAY A;  1KFT A;  4NKT A;  1JXL A;  1VJ7 A;  1A77 A;  3HJ4 A;  4I2I A;  8ICE A;  4NLK A;  2BR0 A;  5BOM A;  1XC9 A;  1TK0 A;  4BXO B;  4KLM A;  1EXN A;  5DQG A;  4P4M A;  5KG4 A;  4GC7 A;  4YR0 A;  2XO7 A;  2BHN A;  1ZQE A;  2BDP A;  4DSI A;  5KFI A;  3GV8 B;  5J2A A;  2AGO A;  5KFL A;  2JZB A;  7ICK A;  4R63 A;  4R64 A;  4ED1 A;  2OWO A;  4KLE A;  5HRE A;  2ZH3 A;  2DPJ A;  4F8R A;  2JEG A;  4M9L A;  4ED0 A;  3BQ1 A;  3IHQ B;  2ISP A;  8ICA A;  4S3N A;  2ZH8 A;  3TAQ A;  4C8L A;  2KTQ A;  5KG1 A;  3JPN A;  4ELT A;  5J0O A;  4MFA A;  3PR5 B;  9ICX A;  3HIY A;  1HJP A;  3AU6 A;  5IIM A;  1X9S A;  2F1H A;  4O5K A;  4KLI A;  4PHE A;  4TUR A;  4DO9 A;  3B0Y A;  2PI5 A;  4DSK A;  4RQ4 A;  8ICJ A;  8ICN A;  2JEF A;  3GQC A;  2PXI A;  2PFP A;  3V7L A;  1U48 A;  1R8C A;  4J9M A;  2IBK A;  3TAR A;  5DKW A;  1ZYQ A;  4UAZ A;  1NO5 A;  3H4B A;  5HRF A;  4M9H A;  4RQ8 A;  1TFR A;  1NK7 A;  4X4R A;  3WFR E;  5J2F A;  1NJZ A;  4MF8 A;  1QSL A;  4R8U B;  1ZJM A;  4NLN A;  1XSL A;  7ICU A;  4ECT A;  2AQ4 A;  4RQ3 A;  5J0P A;  4X4O A;  4FS1 A;  1RYS A;  3THV A;  9ICW A;  1ZQI A;  4NM2 A;  4PH5 A;  1UT8 A;  3H8J A;  4YMM A;  4YR3 A;  4QWE A;  1XSN A;  3UPQ A;  2C2R A; 
#chains in the Genus database with same CATH topology
 2NRX A;  4I2J A;  2M2W A;  5J2G A;  2G5I B;  3H8M A;  4M9N A;  3U26 A;  2AJQ A;  4ECX A;  1NK0 A;  1ZQD A;  3NAS A;  4OCZ A;  4E8F A;  4I2D A;  4QWC A;  4EV6 A;  4K97 A;  5HRH A;  2HHQ A;  2W03 A;  4F5O A;  2ZH4 A;  5KT3 A;  5III A;  1SIJ A;  9ICM A;  5AKX A;  1JIH A;  2LYB A;  3ED5 A;  5HR7 A;  2IA6 A;  2D6F C;  4M5D A;  8ICS A;  2MA1 A;  9ICE A;  3NVW A;  1PVQ A;  1S0M A;  2PMZ C;  4DEZ A;  3SZ2 A;  3V6J A;  2KOB A;  1D8Y A;  2DBY A;  2R8J A;  2HBK A;  3ERC C;  2H3F A;  1N5X A;  3V6K A;  2VJ5 A;  3EPG A;  3WKB A;  4C7Y A;  2EZY A;  2GAF D;  5GTI U;  2J6U A;  2KMD A;  4YQW A;  4KM5 A;  1IV8 A;  1OW5 A;  4EX7 A;  5KFO A;  4USA A;  4ELU A;  3QUQ A;  4P0P B;  3AQM A;  1N61 A;  2F1I A;  1YZ6 A;  5EWF A;  2Y1J A;  3JZ0 A;  1N2X A;  1FIQ A;  2GH1 A;  4QZE A;  5AI0 A;  2QAR B;  5CEH A;  1BPB A;  5ALW A;  1ZQN A;  2BGW A;  4BJQ A;  1S0O A;  5C0Y A;  4RNM A;  4BX9 C;  4K8V A;  5ALY A;  4UD4 A;  4X4T A;  2ZUD A;  2RP5 A;  1ZD2 P;  4FS2 A;  4XUS A;  1JRO A;  1TV9 A;  4RQM A;  3ORY A;  3SI8 A;  5HRL A;  5D49 A;  3ISB A;  1ARO P;  2XGQ A;  5AKL A;  5AKY A;  2BPF A;  1DRG A;  3RR7 A;  3WK7 A;  5AM1 A;  2W55 A;  5AK4 A;  4UAV A;  4ECW A;  4B9S A;  5ALF A;  3ETL A;  3MGH A;  3M6K A;  3AL0 B;  1U4B A;  3OUY B;  3M9O B;  2YMP A;  3JPQ A;  3MBY A;  2KNJ A;  2KE7 A;  2LPE A;  1S76 D;  8ICL A;  1NZB A;  1Z1V A;  3WKA A;  5IIK A;  3WFQ E;  4FZN A;  4AT9 A;  3QZ7 A;  4WQK A;  1PUZ A;  1KW4 A;  4YVZ A;  1JMS A;  4EBE A;  4KB6 A;  1X40 A;  1NK9 A;  1ZQK A;  4M9J A;  9ICQ A;  3PSI A;  1WOT A;  3RB0 A;  3M6Z A;  1O03 A;  4XRH A;  3HIL A;  4IQV A;  1JXE A;  7ICR A;  2GA9 D;  3QEB Z;  5AM2 A;  3V72 A;  4EEL A;  4ECV A;  5G5H A;  2JHD A;  2WAQ C;  5DDY A;  4DSF A;  4QZI A;  3H38 A;  1ZXI A;  1XWL A;  4CE6 A;  2MU2 A;  2RHF A;  3AQK A;  2ODG A;  5ALO A;  4IRC A;  3C21 A;  1TVA A;  4NM1 A;  2D8C A;  3RB4 A;  2NRK A;  1KEJ A;  2GO7 A;  1J2M A;  1ZD3 A;  3C18 A;  4B9V A;  1ZRM A;  4EZ9 A;  4TQR A;  2A1J A;  2LKY A;  1S0N A;  3LVW A;  2YMQ A;  3EPI A;  2F1J A;  1IXR A;  1PX5 A;  4C8K A;  1V38 A;  5DB8 A;  3AMZ A;  1S97 A;  4C7Z A;  2PI4 A;  3JCF A;  3GFK B;  9ICU A;  4RNO A;  4F4Y A;  2OCE A;  5DLG A;  2HHW A;  1FA0 A;  3AQN A;  3DEE A;  5D63 A;  4WBZ A;  2B51 A;  3PX0 A;  5CFU A;  3C5G A;  1ZQO A;  4CGZ A;  3N7S C;  2O5A A;  4IG8 A;  4JB3 A;  1H38 A;  1F5S A;  4P0P A;  3TQ1 A;  1NJX A;  1NK4 A;  3H0M B;  2KHQ A;  5AM4 A;  1X9M A;  2EAO A;  5EE9 A;  9ICF A;  2QB0 B;  3PSP A;  5JUM A;  3C5F A;  4GLX A;  1ZQM A;  5ALN A;  4IQU A;  4PGX A;  5DGA A;  3T5K A;  4U6P A;  4K4I A;  9ICN A;  4NL9 A;  2EAM A;  4CF5 A;  2BQR A;  4F91 B;  5HML A;  3NVY A;  2NRT A;  4F4W A;  3IN5 A;  4UW9 A;  5ALT A;  4LEY A;  4UB4 A;  1B4F A;  5ALZ A;  4O68 A;  3SAF A;  1ZQJ A;  4JLX A;  2AQ0 A;  2D3D A;  4MHV A;  3TAN A;  2BQU A;  3OUY A;  4DF8 A;  1AQ6 A;  3MC1 A;  4RUC A;  1FEZ A;  2Y1I A;  2DPI A;  1ZQV A;  9ICK A;  5EE3 A;  4YMN A;  2HDO A;  5J8Y A;  5J2E A;  2ZTE A;  4YN4 A;  4DS4 A;  2ZIV A;  2HOI A;  3M9M B;  2ZUB A;  4DSE A;  3BQ2 A;  5ALL A;  3N7R C;  5L1L A;  2UVR A;  2GWS A;  4KLL A;  5DBC A;  2YX8 A;  2G0A A;  2DRB A;  3KHH A;  3MR2 A;  2W8L A;  5CB1 A;  4DFP A;  1L8L A;  3RRG A;  2M2V A;  2Q66 A;  1Q3U A;  3D6J A;  1S9F A;  4UAT A;  1PK1 B;  4QZC A;  2AH5 A;  4O3S A;  2FPL A;  1KFD A;  3EF2 A;  3VCB A;  5AM5 A;  2N1R A;  3WFS C;  4ECQ A;  2KEY A;  4OAI Z;  5KFP A;  4CRX A;  3RJF A;  5ALJ A;  2BCQ A;  2EDU A;  4QIW C;  1Q79 A;  3T3F A;  5CWR A;  3PX4 A;  9ICI A;  4BWM A;  4US8 A;  3PW0 A;  2J6S A;  4M47 A;  5TZV A;  2W3R A;  4GXK A;  2VA8 A;  2ES6 A;  5KFX A;  3OJU A;  4YXJ A;  3PV8 A;  2HBL A;  2Y9U A;  2P6U A;  2ZH6 A;  2LM4 A;  4G3I A;  4GIB A;  5HRD A;  5ALR A;  4XQ8 A;  3PML A;  3HJE A;  3G6Y A;  5EOZ A;  5CHG A;  5J0S A;  5HRK A;  8ICQ A;  2A3V A;  5BOL A;  4P2H A;  3PHZ A;  2ZIU B;  4UBB A;  3FDS A;  2YML A;  2W9A A;  3M8R A;  5AHX A;  5KG2 A;  3T5J A;  4LJX A;  1A0P A;  4B9N A;  3C2K A;  4DS5 A;  2ZJ5 A;  1DOQ A;  4PHA A;  4FHX A;  3ICX A;  4ECU A;  4QZF A;  3KFU F;  5KFJ A;  3WKE A;  2BZF A;  3WK5 A;  5D61 A;  3KBB A;  4R66 A;  3OVS A;  4DQQ A;  2ZH7 A;  1ZQW A;  2QB0 A;  2IHN A;  1JI7 A;  2XVT A;  4PZO A;  4AT7 B;  1Y88 A;  2R8K A;  4YP3 A;  4YR2 A;  2ATL A;  1DK2 A;  2IUB A;  5DEC A;  4EBJ A;  2ZG6 A;  2C2D A;  1SV0 C;  3Q8Q B;  2ASD A;  1LKY A;  1KLN A;  4UBC A;  2IOF A;  2FJ6 A;  2W9C B;  4WC7 A;  2OM6 A;  1GPJ A;  4NKT A;  1SZH A;  3HJ4 A;  4NLK A;  1XC9 A;  1TK0 A;  5KG4 A;  5HC9 A;  3PZP A;  2XO7 A;  5KFI A;  7ICK A;  5KFL A;  4R63 A;  4KLE A;  4ED0 A;  1S8O A;  2ZH8 A;  3JYY A;  5KG1 A;  3JPN A;  9ICX A;  3HIY A;  1OXJ A;  1HJP A;  1X9S A;  4TUR A;  2JEF A;  3QU9 A;  2PFP A;  1R8C A;  1U48 A;  2Q4T A;  5DKW A;  4O3M A;  1PVP A;  2HN1 A;  3FM9 A;  5HRF A;  1TFR A;  1NK7 A;  2WF9 A;  2EAN A;  1QSL A;  1XSL A;  4GFJ A;  1NNL A;  1UT8 A;  4QWE A;  3UPQ A;  2HMX A;  3BQ0 A;  4ECS A;  1N48 A;  4F5Q A;  1PK1 A;  4JV1 A;  3MFI A;  4RQN A;  3RTV A;  4JLZ A;  1T8E A;  4QW8 A;  1VFG A;  3N7P D;  2KK0 A;  1V97 A;  3WK4 A;  4RPX A;  4DCC A;  3ER8 C;  4MFC A;  1K1S A;  1Z00 A;  4NV0 A;  2W9B A;  2FE9 A;  4DL3 A;  1M6Y A;  1FO4 A;  4NXW A;  3M8S A;  4Y2J A;  5KG7 A;  4LZD A;  4BDP A;  2R8I A;  2OH2 A;  1JUD A;  4PZN A;  3JPO A;  2CRX A;  2F8K A;  3QZ8 A;  1NI3 A;  1WUD A;  1ZD5 A;  3D2S A;  4PHD A;  2XGP A;  4DQI A;  2XY7 A;  2E3T A;  5AI9 A;  3PO4 A;  5DGB A;  3BJY A;  5KG6 A;  3KOO A;  4J9R A;  4O0I A;  4DQR A;  4Z6E A;  4Q8E A;  9ICO A;  1NKE A;  3V6H A;  4FE3 A;  3Q8P B;  4KLF A;  3HKZ F;  4KLT A;  5HR6 A;  2W54 A;  4RUA A;  3SEN A;  2W43 A;  4XJE A;  4RPY A;  4GC6 A;  2NRZ A;  8ICR A;  2ASJ A;  2HHS A;  3SV3 A;  2MUT B;  2EZZ A;  1XO0 A;  5CRX A;  4J9P A;  5DED A;  4RQ6 A;  4AT7 A;  4J03 A;  5AK5 A;  1NK5 A;  1WCL A;  2JR5 A;  2CXY A;  4HYK A;  2BCU A;  3A0H U;  7ICE A;  1D8L A;  1N63 A;  4AYB F;  2VAN A;  2C22 A;  4IS7 A;  2WF8 A;  2KJ8 A;  3WK8 A;  2BBH A;  5AKI A;  4DL2 A;  2WHE A;  2W9C A;  2DQN B;  8ICB A;  4Y2Y A;  7ICN A;  3F2D A;  3BS7 A;  4ECZ A;  3H4D A;  2PFO A;  5J2H A;  4KLD A;  1YLQ A;  9ICB A;  3QUC A;  5F9L A;  4UB6 U;  2DWQ A;  5AKH A;  2JEJ A;  1KBU A;  7ICF A;  3PO5 A;  9ICG A;  2LBO A;  2VA3 A;  8ICG A;  2JZB B;  3D2Q A;  4ATB A;  3H8S A;  2WF5 A;  4IQW A;  1IIP A;  5KFM A;  4DL5 A;  2B6G A;  5ALD A;  1TAU A;  2YB4 A;  2PBE A;  1TK5 A;  1L7M A;  4UD5 A;  4FFD A;  7ICM A;  3NVO A;  1MIW A;  5K4L A;  2RLT A;  5EE0 A;  1YT3 A;  2I1Q A;  2KJ9 A;  1XNS A;  1BVS A;  4O5C A;  4DQP A;  3LYS A;  2W7O A;  8ICH A;  4DOB A;  4P0Q B;  1SV0 A;  2P6R A;  1B0X A;  9ICL A;  3Q8M A;  3OVB A;  2M0N A;  4Y2T A;  1JQR A;  4JV0 A;  3GIJ A;  1ZQX A;  3HT3 A;  4KN7 A;  3RJI A;  4F2S A;  1V4A A;  5JTG A;  2VJ4 A;  1URJ A;  1MIY A;  1QQ7 A;  1ZQT A;  2PFN A;  2XI9 A;  4KX5 A;  4ZOH C;  4O9M A;  4F71 A;  4DL4 A;  3CP8 A;  3MDA A;  4K98 A;  1X66 A;  1PZN A;  3ETR A;  4KLJ A;  3HW8 A;  4Y2X A;  4PL2 A;  1NKB A;  3KKA C;  2B0C A;  2E1E A;  3VC8 A;  1T3N A;  1N56 A;  1HUO A;  3MR5 A;  8ICI A;  2E1F A;  3IP4 B;  2DR5 A;  3QU4 A;  4DSL A;  4RQ7 A;  4GXJ A;  4I29 A;  4NKU A;  3RJK A;  4MEX A;  3GZF A;  4NJ8 A;  1CUK A;  4EP7 A;  5C5J A;  2HVI A;  3KTQ A;  2F2A B;  4JV2 A;  2V4R A;  4O3P A;  3B9J A;  2V9W A;  3L5K A;  3PSF A;  2IOF K;  4RQ2 A;  3N4M B;  3M1Y A;  1ZQC A;  2HSZ A;  4ED8 A;  2ESE A;  2K4E A;  4UB3 A;  2YN4 A;  1ZQ1 C;  2Q0Z X;  4NXZ A;  4KN4 A;  4QW9 A;  2KVS A;  5AKJ A;  4O3O A;  5JRT A;  1O08 A;  1TKD A;  3OPX A;  1T7P A;  2K8B B;  3R9K A;  1SB3 C;  2JEI A;  3T5L A;  5B66 U;  8ICU A;  3ZD9 A;  4PL1 A;  3UQ2 A;  1WWV A;  4EEK A;  2MSN A;  4NLB A;  2NRW A;  8ICT A;  5ALE A;  3LDA A;  4C4S A;  2HHT A;  4TUQ A;  5L1J A;  1ZD4 A;  4J9Q A;  1ZQL A;  2KKP A;  4DL7 A;  5L1K A;  3C2M A;  4QJF B;  4DF4 A;  3N28 A;  2A1A A;  4OJ5 A;  3CK6 A;  4XQ7 A;  4NWI A;  2J6T A;  4C4R A;  1BGX T;  3NRW A;  1HEK A;  1BPE A;  2ISO A;  3SR6 A;  3OSN A;  4KLH A;  2ZH1 A;  5H2F U;  5KFU A;  2UVW A;  2LYA A;  4TQS A;  3HJ1 A;  2FI1 A;  3ISC A;  5AIA A;  4O5E A;  3IG5 A;  2RDJ A;  2K4I A;  7ICT A;  4WC6 A;  5J0U A;  1KRP A;  2E8O A;  2KHV A;  4KMU A;  2H5X A;  3BS5 B;  5G5G A;  4C4T A;  2BCR A;  2ZUC A;  4JK1 A;  1X9X A;  5A0L A;  1U49 A;  5HNK A;  4DOC A;  4I27 A;  4WQL A;  4CF4 A;  3PST A;  1QQ5 A;  4EBC A;  4Q43 A;  4Q8F A;  3RH4 A;  4PPX A;  2HVH A;  2AHO B;  1UCV A;  2NO5 A;  3O0F A;  3H7I A;  2E8N A;  3OWG A;  2H3I A;  3T5H A;  5DB6 A;  1PVR A;  1MN8 A;  2R18 A;  5KFE A;  3JPS A;  3Q8L A;  2LI6 A;  1ZQP A;  1VLB A;  1ZQU A;  2KFZ A;  5J0W A;  4QWA A;  2JMG A;  3BQ7 A;  3K7D A;  3FC4 A;  2QAR A;  4FH5 A;  3ZDC A;  3UM9 A;  2KV2 A;  1YZ7 A;  2ID1 A;  3H39 A;  7ICH A;  5DB7 A;  1ZQA A;  2IMW P;  1KL9 A;  2KIV A;  3PMN A;  4R65 A;  2RQ5 A;  4F4Z A;  3KZX A;  4QZA A;  2KSO B;  4YFK A;  2W8K A;  2RRD A;  2Z7J A;  5CFT A;  4F50 A;  4UAW A;  3RRH A;  3MFH A;  4J9K A;  1LV5 A;  3H3A A;  5CP2 A;  2G08 A;  4WC2 A;  3WK6 A;  2W7P A;  4F92 B;  2ZIX B;  4CCH A;  2W04 A;  1F44 A;  4Z6F A;  2FLP A;  1SWW A;  1JXL A;  4B6J A;  1VJ7 A;  2B56 A;  4IL6 U;  8ICE A;  4WH5 A;  2BR0 A;  4BXO B;  4P4M A;  2BDP A;  3H37 A;  2NV3 A;  3GV8 B;  1L7P A;  2ZH3 A;  2JEG A;  8ICA A;  3T79 A;  3BQ1 A;  3TAQ A;  2QKQ A;  4C8L A;  3I76 A;  4MFA A;  2HCF A;  5AK6 A;  4O67 A;  2PXI A;  1WWU A;  2IBK A;  3UMC A;  1NO5 A;  4RQ8 A;  5J2F A;  1NJZ A;  4MF8 A;  1SGG A;  4ECT A;  5J0P A;  4FS1 A;  1RYS A;  4PH5 A;  4YR3 A;  3H8J A;  3MCR A;  2C2R A;  5HHH A;  3E2E A;  4DFM A;  2RDI A;  7ICS A;  2NRV A;  2R8G A;  7ICQ A;  4UB5 A;  8ICW A;  4KIT B;  1KQQ A;  3TAD C;  4FO1 A;  2DR7 A;  1ZQY A;  3CYM A;  3I1Y A;  9ICC A;  4NLZ A;  4I2E A;  1UET A;  3NTU A;  2XC9 A;  4HX0 A;  1ED1 A;  4B9T A;  1CI4 A;  4I2G A;  5KT2 A;  2H3Q A;  1QCK A;  1N5W A;  4KLU A;  3EZ5 A;  3AN1 A;  1SKR A;  4YMO A;  4P4O A;  3GIL A;  1ZQB A;  5KG0 A;  2HOF A;  3OHA A;  5KFZ A;  3PR4 A;  1UHU A;  2MAX A;  1Q78 A;  2HBM A;  3NKU A;  2VIX A;  3CW2 C;  2M9N A;  4QNL A;  4Y2Q A;  9ICP A;  3GII A;  3TFS A;  1T3Q A;  3E0F A;  5JTI A;  1RXW A;  1D9D A;  2DR9 A;  9ICJ A;  2YB1 A;  3FAH A;  5F3X B;  4Y2R A;  3RJG A;  2XID A;  3PVX A;  4O3R A;  2BKE A;  5F2V O;  4DFD A;  2ZXI A;  2K4H A;  2LM1 A;  5J0R A;  3MR6 A;  4JWM A;  5KFG A;  5KFN A;  4FH3 A;  1UPH A;  2I9G A;  2FLL A;  3GDX A;  1RZT A;  5T14 A;  4JMU A;  5J2B A;  8ICC A;  2KSO A;  4KLG A;  2UVV A;  4RPZ A;  3L4P A;  4MEY A;  1S10 A;  3AUO A;  4QZH A;  3OTQ A;  2QLT A;  2VKQ A;  1BPZ A;  2UVU A;  4K9A A;  3WK9 A;  7ICI A;  2DVI A;  3CNH A;  5AK3 A;  2P35 A;  4F5N A;  1NK8 A;  1ZOL A;  2K4P A;  3HX0 A;  2ZHB A;  5KT6 A;  5ALG A;  4DWI A;  4RU9 A;  3B0X A;  3D2N A;  5DG9 A;  1Z4N A;  4KX3 A;  2KFN A;  1CEZ A;  2IHO A;  2A19 A;  2EH9 A;  5KFV A;  1ZQQ A;  5KFA A;  4HAI A;  2JRZ A;  4EBK A;  1K5O A;  3ISD A;  1QH9 A;  4Y2S A;  3NWI A;  3ZI4 A;  3SD7 A;  2PKE A;  1L8O A;  8ICV A;  8ICZ A;  3QEA Z;  3MGV A;  5KNI A;  4OAG A;  1JN3 A;  5DBB A;  4IR9 A;  2HI0 A;  3V7K A;  4X4Q A;  1QQ6 A;  5ALH A;  4RNN A;  2I5H A;  4RT3 A;  5AI4 A;  2CN1 A;  2BBJ A;  2WFA A;  1RPL A;  1D9F A;  4NXX A;  3UXN A;  1MIV A;  4O3Q A;  3DV9 A;  1L3V A;  4FHP A;  1V85 A;  4YD2 A;  4EYI B;  8ICX A;  1Q3V A;  4TUP A;  1X6J A;  4I2H A;  2KP7 A;  2JGA A;  1NOM A;  2B4V A;  4ED2 A;  1TAM A;  4E80 A;  2ZJ8 A;  5AIB A;  4OO1 J;  2W9M A;  2FDR A;  3PW7 A;  5D46 A;  4WC1 A;  5F9N A;  2ZJA A;  3TKA A;  4X4V A;  3AU2 A;  4PHP A;  1ZET A;  2XY5 A;  1ZJN A;  2W3S A;  2G09 A;  4F72 A;  4X4U A;  3QU2 A;  5IIJ A;  4FHV A;  4X0B A;  5AIC A;  2XCP A;  5KFC A;  4ED7 A;  5TIS U;  2ZIU A;  7ICO A;  1KN5 A;  2G5H B;  3NYB A;  5KFF A;  5KG3 A;  4ACO A;  4GXI A;  1NK6 A;  5CA7 A;  3RJJ A;  4CF3 A;  4RWN A;  5HHI A;  1U9L A;  4JUZ A;  5ALV A;  3JPR A;  3KHL A;  4Y2V A;  3NVV A;  1TFY A;  2LHT A;  7ICP A;  5CHE A;  3N97 B;  2ZH5 A;  1SXD A;  3C66 A;  1DGJ A;  5KFS A;  1T94 A;  1F0M A;  3LWM A;  4OJP A;  3ONN A;  2WTF A;  2KZZ A;  1RM6 C;  3WKD A;  1ECW A;  5IIO A;  5KFT A;  2PFQ A;  1U45 A;  1COO A;  1BPY A;  3NVZ A;  1JAJ A;  4QWB A;  4NLC A;  4M9G A;  2HHU A;  9ICR A;  3PY8 A;  3H8W A;  4FZM A;  4RWP A;  3NS1 A;  2BCS A;  3IDW A;  9ICV A;  3L9D A;  4F4X A;  3EW9 A;  2HW3 A;  3LK9 A;  3QX7 A;  4YXM A;  5KTQ A;  4C80 A;  1SZP A;  5ALU A;  2AGP A;  1R89 A;  4Y2P A;  1MQ2 A;  2I6X A;  3K1R B;  3NGD A;  1NJY A;  1QSY A;  2M2U A;  2DL0 A;  8ICP A;  2DFL A;  3H0R B;  2K8C B;  5B3P A;  1VJ5 A;  3K1Z A;  4AT9 B;  1L5U A;  1UA0 A;  3BDP A;  4DFJ A;  4DOA A;  3QE9 Y;  9ICT A;  5HRG A;  2HOQ A;  3Q8R B;  5KAF U;  2WF6 A;  3UQ0 A;  5HP4 A;  2AXT U;  4I2A A;  4MFF A;  4DFK A;  3QUT A;  4NXV A;  3J81 j;  3AQF A;  1DK3 A;  4IRD A;  3RB3 A;  4E7X A;  1FFU A;  1A6S A;  5CFS A;  3F2C A;  1HIW A;  5KT4 A;  1R8B A;  4Q44 A;  3UMG A;  1J2N A;  2BCV A;  1S77 D;  2FMP A;  4K96 A;  4FBU A;  3Q8K A;  4JWN A;  4WOY A;  2HBJ A;  4NL9 C;  4NXT A;  3NRZ A;  1OU5 A;  1KFS A;  1LB2 B;  1SV4 A;  1SWV A;  3FYH A;  5HR9 A;  4RQ1 A;  3MDC A;  3AQE A;  1Z1B A;  4OJO A;  2DKZ A;  5AI8 A;  4EX6 A;  2A1J B;  4OJL A;  4UQG A;  3ALR A;  1SKW A;  3PW2 A;  4PGQ A;  4M6W B;  5AI5 A;  1L7O A;  3M9N B;  4RWO A;  4N7R A;  2F3N A;  4OJ6 A;  1SL1 A;  2XCA A;  3F53 A;  3K4G A;  4X0A A;  2DKX A;  3OSP A;  5JU5 A;  1A76 A;  4K4H A;  4ED6 A;  4IRK A;  3TI0 A;  2O1P A;  4O6A A;  5DLF A;  2XIC A;  1RG6 A;  1BPD A;  3AQL A;  1ZQZ A;  5J8Y C;  5DBA A;  1RYR A;  3S6J A;  5KFQ A;  3RH5 A;  1R8A A;  2ZTD A;  3WFP A;  5ALP A;  1UT5 A;  2OYY A;  1WG8 A;  5AKZ A;  2MUT A;  5J2J A;  4J9L A;  4NLG A;  2DR8 A;  4OD0 A;  4I2F A;  3LWL A;  2G07 A;  3TAP A;  1RQN A;  4FZL A;  3NUQ A;  1J97 A;  7ICV A;  4EGW A;  4U7C A;  8ICY A;  1NZP A;  5HRB A;  1K1Q A;  1FFV A;  3PW4 A;  9ICA A;  2C28 A;  4G9B A;  4RZR A;  4YCX A;  5B5E U;  4KLO A;  5KFK A;  1P7D A;  4LZG A;  5J2C A;  1XS9 D;  4F5P A;  1MA7 A;  4DQS A;  5J2I A;  1S0V A;  1BPX A;  1L6N A;  1KFT A;  1A77 A;  4UAU A;  3HRD D;  3IG8 A;  4KLM A;  2O6K A;  1ZQE A;  4DSI A;  5J2A A;  2AGO A;  2JZB A;  3HKZ C;  4F8R A;  4M9L A;  3IHQ B;  4QIW F;  2NYV A;  4ELT A;  3PR5 B;  3AU6 A;  4KLI A;  2KD1 A;  4PHE A;  2PI5 A;  3B0Y A;  3WKC A;  1PK3 A;  4RQ4 A;  8ICN A;  3GQC A;  3V7L A;  1X42 A;  3TAR A;  4UB8 U;  5AM0 A;  4K9B A;  2ZIW B;  3WFR E;  4X4R A;  4M9H A;  2JV3 A;  2ZIV B;  4R8U B;  1X6I A;  1ZJM A;  4AYB C;  2JH7 A;  5GTH U;  4NM2 A;  4YMM A;  3OJS A;  2G06 A;  5ALK A;  2WB1 F;  1SL0 A;  4M2Y A;  3SMV A;  4K4G A;  5B3Q A;  4F4K A;  1WCN A;  4P0Q A;  1WYG A;  4BWJ A;  3EYZ A;  3A0B U;  1JAL A;  4BGD A;  5EWG A;  5AKE A;  1RQL A;  1ZQF A;  3IM1 A;  1IM4 A;  7ICL A;  3G6X A;  2KG5 A;  4M04 A;  5DG8 A;  4ICA A;  4DL6 A;  2P66 A;  4Z6C A;  2AU0 A;  4J9S A;  4AT8 B;  3H40 A;  1KNY A;  2F44 A;  1Q8K A;  2ZHA A;  3TAC B;  1V9P A;  5IIL A;  5KT5 A;  2HHP A;  2Y0S F;  3IV6 A;  1T4G A;  5ALS A;  1L3U A;  4M6W A;  3WU2 U;  2CPR A;  3TFR A;  4ECR A;  4WC4 A;  5KFB A;  1D8B A;  1MSW D;  5J2D A;  3SYZ A;  3ZDA A;  1DGS A;  5ALX A;  3OHB A;  4EEN A;  2DF4 B;  4QZB A;  3JPP A;  3RAX A;  3ZDD A;  2FMS A;  4EED A;  5J29 A;  4WC5 A;  2KJ5 A;  3L3F X;  2ALZ A;  3V7J A;  1C7Y A;  1B43 A;  2C2E A;  1QTM A;  3RFA A;  1MC8 A;  1TK8 A;  3DDH A;  3PX6 A;  4B9U A;  3BZK A;  5EWE A;  2W11 A;  4RQ0 A;  4WC0 A;  4C0Z A;  4ECY A;  3G6V A;  4RT2 A;  4KMO B;  4NXU A;  2VA2 A;  4QZG A;  3RB6 A;  2K60 A;  3RJH A;  3UMB A;  4C8N A;  4Y2U A;  4OAF A;  3PNC A;  1LKY B;  2K8A A;  4ELV A;  2KZ3 A;  5HRI A;  3LQC B;  2YY6 A;  2BE3 A;  1JX4 A;  1S5L U;  3KKA A;  4MKP A;  4LT6 A;  3RF9 A;  3AEV A;  2KZM A;  5KG5 A;  4KLQ A;  4M0A A;  3RBE A;  4BUG A;  7ICJ A;  1JRP A;  1RYU A;  5L9X A;  2KIW A;  1BNP A;  1Z4O A;  4C8O A;  2MRL A;  4WC3 A;  1X9W A;  2ZIW A;  1L7N A;  1HUZ A;  3RAQ A;  4R8U A;  1ZQG A;  1ZQR A;  3AM9 A;  1UEU A;  3KZI U;  3PW5 A;  1LVH A;  2F77 X;  4UB1 A;  1RDF A;  3E58 A;  1KKX A;  4E0D A;  5KL8 B;  9ICH A;  4YG2 A;  2FCL A;  1XU4 A;  1Z3E B;  3F5A A;  5J0Y A;  4IR1 A;  4QZD A;  4Q45 A;  3OV7 A;  3EUB 2;  3F2B A;  2H3Z A;  4EEB A;  3GIK A;  3BS5 A;  2BPG A;  4ED3 A;  4O3N A;  1TFW A;  1XO1 A;  5HMM A;  4US9 A;  5D62 A;  4AT8 A;  3QYP A;  5J0Q A;  1N60 A;  2JH1 A;  4X5V A;  4NY8 A;  5KFW A;  3SQI A;  1Z00 B;  2W9B B;  3MGI A;  5AM3 A;  4OAH A;  2HHV A;  4O69 A;  3OVA A;  3ZDB A;  4EZ6 A;  2ZH2 A;  3KHG A;  2QB1 A;  4RQ5 A;  5CJ7 A;  3QUB A;  5D4B A;  3RH6 A;  2ZH9 A;  4X4S A;  2WB1 C;  2OXO A;  5KT7 A;  4LEW A;  3C28 A;  1OUQ A;  2DUY A;  2YTU A;  5DQI A;  5EE1 A;  4F2R A;  5E79 U;  2DRA A;  1COK A;  3GV5 B;  1UQV A;  1UEV A;  3SV4 A;  5DG7 A;  1DXS A;  4IC9 A;  5FP0 A;  4DLE A;  4YD1 A;  3C29 A;  2KVC A;  2H3V A;  4DLG A;  4FBT A;  4EEY A;  2BQ3 A;  3HP6 A;  3ZD8 A;  4FHY A;  5ALI A;  1Q46 A;  2R8H A;  1X2I A;  4Z6D A;  4F5R A;  4FHW A;  4RWQ A;  3K75 D;  2ZIX A;  3I28 A;  4FO6 A;  4TUS A;  4I28 A;  2FPK A;  8ICM A;  2XY6 A;  2Y9T A;  4PGY A;  2FLN A;  4I0U A;  2Y0S C;  5KFR A;  2LYH A;  4UB2 A;  5DQH A;  3QU7 A;  4BXO A;  2GLE A;  3UXP A;  1U47 A;  2BDU A;  4CDG A;  5KAI U;  3MR3 A;  5KFD A;  3GIM A;  5KFY A;  4B9M A;  3JPT A;  5DDM A;  4QZ8 A;  8ICF A;  3RR8 A;  4DSJ A;  2IOH A;  2ASL A;  3BZC A;  4ATB B;  1KTQ A;  4F93 B;  4X4P A;  1RXV A;  4LVS A;  1VDV A;  3IRU A;  2F76 X;  3OGU A;  1KDH A;  3UPS A;  2BPC A;  2PMZ F;  2KN7 A;  4QZ9 A;  3C2L A;  1NJW A;  4P4P A;  2GOL A;  2FMQ A;  7ICG A;  4A8E A;  1TE2 A;  3M7D A;  4J9N A;  1KSP A;  1NKC A;  1B22 A;  4WJ3 B;  4QWD A;  1SL2 A;  3H0L B;  3QXG A;  3CRX A;  3C23 A;  2M2T A;  3F5E A;  5BPC A;  3KHR A;  2EAP A;  4KTQ A;  4I2B A;  3SAH A;  2B21 A;  4UAS A;  1TAQ A;  4K99 A;  4WBY A;  4B9L A;  5J0X A;  4LEV A;  2LMR A;  4IQT A;  4J9O A;  1F5A A;  2NO4 A;  3HPO A;  3UXO A;  3Q8S B;  1QSS A;  4X4N A;  3RBD A;  1ZRN A;  3WFO A;  5DB9 A;  4C8M A;  4WCW A;  5AI6 A;  1UA1 A;  1L3S A;  3SEI A;  1MQ3 A;  4F3O A;  4PJ0 U;  2EQY A;  9ICS A;  2E8P A;  5IIN A;  4EBD A;  2DGZ A;  3RJE A;  2RFF A;  5CR0 A;  3BQT A;  4UAR A;  4EYH B;  3ZDE A;  2IHM A;  1BNO A;  2FPM A;  3GV7 B;  4I2C A;  1GO3 F;  5L1I A;  3QNM A;  2EWR A;  5AKG A;  3C1Y A;  2YQE A;  3SAG A;  1CRX A;  2AGQ A;  1QLN A;  3TAD A;  2E8M A;  5KL1 B;  1ZQH A;  8ICK A;  1L3T A;  2V4Q A;  2HHX A;  2KKV A;  1ZQS A;  5AKK A;  5KFH A;  3ER9 B;  4MF2 A;  2ZTC A;  8ICO A;  3QU5 A;  2OEH A;  2JXJ A;  3HWT A;  1SKS A;  4ZH4 A;  5L1M A;  1Z19 A;  1XSP A;  3C1Z A;  4XA5 A;  4KLS A;  5J2K A;  3EWA A;  2WAQ F;  3MAB A;  1IG6 A;  1C20 A;  2HN2 A;  5J0T A;  2KIC A;  5ALQ A;  4UAY A;  2K89 A;  4I2I A;  4LEZ A;  2ZXH A;  5BOM A;  1SXE A;  1EXN A;  5DQG A;  4GC7 A;  4YR0 A;  2BHN A;  1N62 A;  4R64 A;  4ED1 A;  2OWO A;  5HRE A;  2F8L A;  4AP9 A;  2DPJ A;  2ISP A;  5ALM A;  4S3N A;  2KTQ A;  3GU3 A;  4CNQ A;  5J0O A;  4O5K A;  5IIM A;  2F1H A;  4DO9 A;  4DSK A;  8ICJ A;  4J9M A;  2EZX A;  1ZYQ A;  4UAZ A;  3H4B A;  2OHF A;  2L5Y A;  3LVV A;  3KD3 A;  2E5S A;  2YMM A;  7ICU A;  4NLN A;  2AQ4 A;  4RQ3 A;  4X4O A;  3THV A;  9ICW A;  1ZQI A;  1XSN A;  2WF7 A; 
#chains in the Genus database with same CATH homology
 2NRX A;  4I2J A;  1SL0 A;  5HHH A;  3BQ0 A;  4M2Y A;  3E2E A;  2M2W A;  4K4G A;  4ECS A;  4DFM A;  1N48 A;  2RDI A;  5J2G A;  4F4K A;  7ICS A;  4F5Q A;  4JV1 A;  2NRV A;  2R8G A;  7ICQ A;  2AJQ A;  4UB5 A;  1WCN A;  4M9N A;  3MFI A;  4BWJ A;  4KIT B;  8ICW A;  3EYZ A;  2DR7 A;  4BGD A;  5EWG A;  1ZQY A;  3RTV A;  4ECX A;  1T8E A;  3H37 A;  1ZQF A;  3IM1 A;  9ICC A;  1IM4 A;  1NK0 A;  1ZQD A;  3G6X A;  4I2E A;  4NLZ A;  7ICL A;  1UET A;  3NTU A;  2XC9 A;  4QW8 A;  4B9T A;  4M04 A;  5DG8 A;  1VFG A;  4DL6 A;  2P66 A;  4E8F A;  4I2D A;  4Z6C A;  4QWC A;  4I2G A;  2AU0 A;  5KT2 A;  4J9S A;  5HRH A;  2HHQ A;  4F5O A;  4RPX A;  4AT8 B;  2ZH4 A;  4MFC A;  4KLU A;  3H40 A;  3EZ5 A;  1K1S A;  1SKR A;  1Z00 A;  1KNY A;  2W9B A;  4YMO A;  5KT3 A;  5III A;  4P4O A;  4DL3 A;  9ICM A;  3GIL A;  1ZQB A;  5KG0 A;  1JIH A;  5KFZ A;  3OHA A;  3M8S A;  2ZHA A;  5KG7 A;  1V9P A;  3PR4 A;  4LZD A;  4BDP A;  2IA6 A;  2R8I A;  4M5D A;  2MAX A;  8ICS A;  3JPO A;  5IIL A;  1Q78 A;  5KT5 A;  9ICE A;  2HHP A;  1T4G A;  3QZ8 A;  1L3U A;  2M9N A;  4M6W A;  1S0M A;  9ICP A;  4PHD A;  4DEZ A;  2XGP A;  3TFR A;  3SZ2 A;  4ECR A;  3V6J A;  4DQI A;  1D8Y A;  3GII A;  3TFS A;  2XY7 A;  2R8J A;  1RXW A;  1D9D A;  4WC4 A;  5KFB A;  2DR9 A;  3PO4 A;  9ICJ A;  1MSW D;  3V6K A;  5DGB A;  3BJY A;  5J2D A;  5KG6 A;  3SYZ A;  3ZDA A;  1DGS A;  3OHB A;  3RJG A;  3EPG A;  4J9R A;  4QZB A;  4O0I A;  3JPP A;  2J6U A;  4DQR A;  4YQW A;  4Z6E A;  3PVX A;  3RAX A;  2FMS A;  3ZDD A;  4O3R A;  1NKE A;  5J29 A;  2BKE A;  3V6H A;  4Q8E A;  9ICO A;  5F2V O;  4WC5 A;  3Q8P B;  2ALZ A;  5KFO A;  4ELU A;  3V7J A;  1C7Y A;  4KLF A;  1B43 A;  2C2E A;  4KLT A;  5J0R A;  3MR6 A;  4RUA A;  1QTM A;  3AQM A;  4JWM A;  2F1I A;  4RPY A;  1MC8 A;  5EWF A;  2Y1J A;  3JZ0 A;  4GC6 A;  2NRZ A;  8ICR A;  4QZE A;  2ASJ A;  1TK8 A;  5KFG A;  2HHS A;  5KFN A;  1BPB A;  4FH3 A;  3SV3 A;  2MUT B;  5DED A;  2I9G A;  3PX6 A;  4J9P A;  4B9U A;  1ZQN A;  5EWE A;  2FLL A;  3GDX A;  1RZT A;  2BGW A;  4RQ6 A;  4AT7 A;  1S0O A;  5J2B A;  8ICC A;  1NK5 A;  4RQ0 A;  4RNM A;  4WC0 A;  4ECY A;  1WCL A;  4KLG A;  2UVV A;  4RPZ A;  4HYK A;  2BCU A;  4UD4 A;  3G6V A;  4MEY A;  2ZUD A;  4RT2 A;  1S10 A;  7ICE A;  1D8L A;  4FS2 A;  3AUO A;  4QZH A;  2VA2 A;  4XUS A;  4QZG A;  2VAN A;  2C22 A;  1BPZ A;  3RB6 A;  1TV9 A;  3RJH A;  2UVU A;  4C8N A;  3ORY A;  3SI8 A;  7ICI A;  5HRL A;  5D49 A;  3PNC A;  3ISB A;  1ARO P;  2XGQ A;  2DVI A;  2BPF A;  4DL2 A;  3RR7 A;  2W9C A;  4ELV A;  2KZ3 A;  4F5N A;  1NK8 A;  8ICB A;  5HRI A;  7ICN A;  3HX0 A;  4ECZ A;  4ECW A;  4B9S A;  1JX4 A;  3LQC B;  5KT6 A;  2BE3 A;  2ZHB A;  3H4D A;  4DWI A;  3ETL A;  2PFO A;  4RU9 A;  5J2H A;  3B0X A;  4KLD A;  1YLQ A;  3MGH A;  9ICB A;  5DG9 A;  5F9L A;  7ICF A;  2JEJ A;  1U4B A;  2KZM A;  4LT6 A;  3OUY B;  3M9O B;  5KG5 A;  2KFN A;  3PO5 A;  3JPQ A;  9ICG A;  3MBY A;  4KLQ A;  1CEZ A;  4UD5 A;  4M0A A;  3RBE A;  2VA3 A;  8ICG A;  2JZB B;  5KFV A;  1S76 D;  1ZQQ A;  5KFA A;  7ICJ A;  8ICL A;  4ATB A;  3H8S A;  5L9X A;  4EBK A;  4IQW A;  3ISD A;  5IIK A;  5KFM A;  4AT9 A;  3WFQ E;  3QZ7 A;  1BNP A;  4C8O A;  8ICV A;  4YVZ A;  4WC3 A;  8ICZ A;  3QEA Z;  1JMS A;  4EBE A;  4DL5 A;  1X9W A;  1JN3 A;  5DBB A;  4IR9 A;  3V7K A;  1HUZ A;  1NK9 A;  1ZQK A;  1TAU A;  4X4Q A;  4M9J A;  2PBE A;  3RAQ A;  1TK5 A;  9ICQ A;  4RNN A;  4R8U A;  1ZQG A;  1ZQR A;  1UEU A;  3RB0 A;  1WOT A;  7ICM A;  4XRH A;  4RT3 A;  3OJS A;  3PW5 A;  4IQV A;  1JXE A;  4UB1 A;  1MIW A;  7ICR A;  4X4V A;  1D9F A;  1RPL A;  3QEB Z;  2Q66 A;  3UXN A;  3V72 A;  1MIV A;  4O3Q A;  4E0D A;  4ECV A;  1L3V A;  9ICH A;  2I1Q A;  4FHP A;  4YG2 A;  4YD2 A;  4EYI B;  8ICX A;  1BVS A;  4TUP A;  1XU4 A;  1Z3E B;  4O5C A;  5DDY A;  4DSF A;  4QZI A;  4DQP A;  4I2H A;  3H38 A;  5J0Y A;  8ICH A;  2KP7 A;  1XWL A;  4DOB A;  4IR1 A;  1NOM A;  4QZD A;  4Q45 A;  2P6R A;  3AQK A;  9ICL A;  3Q8M A;  3OV7 A;  3OVB A;  4ED2 A;  4IRC A;  3GIK A;  3C21 A;  1TVA A;  2BPG A;  4JV0 A;  3GIJ A;  1JQR A;  1ZQX A;  4NM1 A;  4E80 A;  2ZJ8 A;  3HT3 A;  4KN7 A;  3RJI A;  3RB4 A;  2NRK A;  1KEJ A;  4ED3 A;  2W9M A;  4O3N A;  4F2S A;  1V4A A;  3PW7 A;  1TFW A;  1XO1 A;  5HMM A;  5F9N A;  5D46 A;  3C18 A;  4B9V A;  2ZJA A;  4WC1 A;  4AT8 A;  5J0Q A;  4EZ9 A;  1MIY A;  3AU2 A;  4TQR A;  4PHP A;  1ZET A;  1ZQT A;  2XY5 A;  1ZJN A;  4X5V A;  2PFN A;  2A1J A;  4NY8 A;  5KFW A;  4O9M A;  1Z00 B;  1S0N A;  2W9B B;  4DL4 A;  4X4U A;  3MGI A;  5IIJ A;  2HHV A;  3MDA A;  4FHV A;  3EPI A;  3OVA A;  4X0B A;  2XCP A;  2F1J A;  5KFC A;  3ZDB A;  1IXR A;  4ED7 A;  1PZN A;  4EZ6 A;  1PX5 A;  2ZH2 A;  3KHG A;  4C8K A;  4KLJ A;  3HW8 A;  7ICO A;  4RQ5 A;  5CJ7 A;  5DB8 A;  1NKB A;  3NYB A;  5KFF A;  5KG3 A;  5D4B A;  4GXI A;  1T3N A;  3RH6 A;  1NK6 A;  5CA7 A;  1S97 A;  3RJJ A;  2PI4 A;  1N56 A;  1HUO A;  3MR5 A;  3GFK B;  8ICI A;  9ICU A;  4RNO A;  4F4Y A;  4X4S A;  2ZH9 A;  5DLG A;  2HHW A;  1FA0 A;  5KT7 A;  3AQN A;  2DR5 A;  4RWN A;  4DSL A;  4WBZ A;  4RQ7 A;  4GXJ A;  5HHI A;  3PX0 A;  5DQI A;  4I29 A;  4NKU A;  4F2R A;  3C5G A;  1ZQO A;  3RJK A;  2O5A A;  1U9L A;  4IG8 A;  4JUZ A;  4MEX A;  2DRA A;  3JPR A;  1H38 A;  3GV5 B;  1CUK A;  3KHL A;  3TQ1 A;  1NJX A;  1UEV A;  1NK4 A;  3SV4 A;  4EP7 A;  5C5J A;  5DG7 A;  1X9M A;  2HVI A;  1TFY A;  3KTQ A;  9ICF A;  7ICP A;  4DLE A;  2V4R A;  3N97 B;  4JV2 A;  4YD1 A;  2ZH5 A;  4O3P A;  5JUM A;  3C5F A;  4GLX A;  3C66 A;  1ZQM A;  2V9W A;  4DLG A;  4FBT A;  4RQ2 A;  4EEY A;  3N4M B;  4IQU A;  4PGX A;  5KFS A;  5DGA A;  2BQ3 A;  3LWM A;  3T5K A;  3HP6 A;  2WTF A;  3ZD8 A;  4FHY A;  1ZQC A;  2KZZ A;  5IIO A;  4X4T A;  5KFT A;  2PFQ A;  4K4I A;  9ICN A;  4ED8 A;  1U45 A;  2BQR A;  1COO A;  4UB3 A;  4F91 B;  1BPY A;  5HML A;  2NRT A;  1X2I A;  4Z6D A;  2R8H A;  2Q0Z X;  4QWB A;  4F5R A;  3K75 D;  4F4W A;  4FO6 A;  4NXZ A;  4TUS A;  4I28 A;  4M9G A;  2HHU A;  4RWQ A;  4KN4 A;  9ICR A;  2FPK A;  8ICM A;  4QW9 A;  2XY6 A;  3PY8 A;  4PGY A;  3H8W A;  2FLN A;  4O3O A;  1TKD A;  5KFR A;  4RWP A;  2LYH A;  4UB2 A;  4UB4 A;  5DQH A;  1T7P A;  2BCS A;  4BXO A;  2JEI A;  9ICV A;  3T5L A;  8ICU A;  3ZD9 A;  3L9D A;  1ZQJ A;  3UXP A;  3EW9 A;  4F4X A;  1U47 A;  3UQ2 A;  2AQ0 A;  4FHW A;  2HW3 A;  3LK9 A;  4YXM A;  3MR3 A;  5KFD A;  5KTQ A;  3TAN A;  2NRW A;  2BQU A;  1SZP A;  5KFY A;  3GIM A;  3JPT A;  4DF8 A;  4B9M A;  5DDM A;  8ICT A;  3OUY A;  3LDA A;  2AGP A;  2HHT A;  1R89 A;  4QZ8 A;  4RUC A;  8ICF A;  2Y1I A;  2DPI A;  3RR8 A;  4TUQ A;  5L1J A;  1MQ2 A;  4DSJ A;  1ZQV A;  9ICK A;  3NGD A;  1NJY A;  1QSY A;  2M2U A;  4YMN A;  2ASL A;  8ICP A;  4J9Q A;  2DFL A;  1ZQL A;  4DL7 A;  5J2E A;  2ZTE A;  5L1K A;  4ATB B;  4YN4 A;  3C2M A;  1KTQ A;  4F93 B;  4DS4 A;  3M9M B;  4X4P A;  5HC9 A;  2ZUB A;  1RXV A;  4LVS A;  4AT9 B;  4DSE A;  1L5U A;  3BQ2 A;  4DF4 A;  1UA0 A;  3OGU A;  3BDP A;  4DFJ A;  1KDH A;  5L1L A;  4DOA A;  2UVR A;  3QE9 Y;  9ICT A;  5HRG A;  3UPS A;  2BPC A;  2DR8 A;  2GWS A;  4KLL A;  5DBC A;  2KN7 A;  4XQ7 A;  3Q8R B;  4QZ9 A;  2J6T A;  3C2L A;  1NJW A;  4P4P A;  2DRB A;  1BGX T;  3KHH A;  2FMQ A;  3MR2 A;  2W8L A;  5CB1 A;  1BPE A;  3UQ0 A;  4DFP A;  5HP4 A;  2ISO A;  3OSN A;  3RRG A;  4I2A A;  7ICG A;  4MFF A;  4J9N A;  4DFK A;  1S9F A;  1KSP A;  4KLH A;  2ZH1 A;  4QZC A;  5KFU A;  4IRD A;  1NKC A;  4O3S A;  2FPL A;  3RB3 A;  1KFD A;  4QWD A;  1SL2 A;  1B22 A;  1DK3 A;  4E7X A;  2UVW A;  4TQS A;  3HJ1 A;  3ISC A;  3C23 A;  3WFS C;  4ECQ A;  2M2T A;  4O5E A;  9ICA A;  5BPC A;  5KFP A;  5KT4 A;  2RDJ A;  1R8B A;  3KHR A;  7ICT A;  5J0U A;  4WC6 A;  4Q44 A;  3RJF A;  4KTQ A;  1KRP A;  4I2B A;  2ZH7 A;  2B21 A;  2BCV A;  2BCQ A;  1S77 D;  2FMP A;  1Q79 A;  4FBU A;  3Q8K A;  1TAQ A;  3T3F A;  5CWR A;  4KMU A;  3PX4 A;  2H5X A;  4BWM A;  4JWN A;  9ICI A;  4WBY A;  4B9L A;  5J0X A;  1OU5 A;  1KFS A;  3PW0 A;  2BCR A;  2ZUC A;  1LB2 B;  4JK1 A;  2J6S A;  4M47 A;  4IQT A;  3FYH A;  5TZV A;  4J9O A;  2VA8 A;  4GXK A;  5HR9 A;  1F5A A;  5KFX A;  3HPO A;  4RQ1 A;  3UXO A;  3OJU A;  4YXJ A;  3PV8 A;  3MDC A;  1U49 A;  3Q8S B;  5HNK A;  4DOC A;  2P6U A;  4I27 A;  1QSS A;  2ZH6 A;  3RBD A;  4X4N A;  4G3I A;  3WFO A;  2A1J B;  5DB9 A;  4C8M A;  5HRD A;  4WCW A;  4XQ8 A;  3PML A;  4EBC A;  4Q43 A;  3G6Y A;  4UQG A;  1UA1 A;  1L3S A;  1SKW A;  4Q8F A;  3PW2 A;  3RH4 A;  5EOZ A;  4PGQ A;  5CHG A;  4M6W B;  3M9N B;  5J0S A;  4PPX A;  1MQ3 A;  4RWO A;  4F3O A;  5HRK A;  2HVH A;  8ICQ A;  5BOL A;  4P2H A;  1SL1 A;  2XCA A;  9ICS A;  3K4G A;  5IIN A;  4UBB A;  4EBD A;  4X0A A;  3H7I A;  3FDS A;  3OSP A;  2W9A A;  3M8R A;  3T5H A;  3RJE A;  2RFF A;  1A76 A;  4K4H A;  5KG2 A;  5CR0 A;  5DB6 A;  3BQT A;  4ED6 A;  4IRK A;  4EYH B;  3ZDE A;  3TI0 A;  2IHM A;  2O1P A;  1BNO A;  3T5J A;  1JAJ A;  5KFE A;  5DLF A;  3JPS A;  4B9N A;  3Q8L A;  1BPD A;  2FPM A;  3GV7 B;  3C2K A;  3AQL A;  1ZQZ A;  1ZQP A;  4I2C A;  1ZQU A;  4DS5 A;  5DBA A;  2KFZ A;  2ZJ5 A;  1RYR A;  5J0W A;  1DOQ A;  5L1I A;  4PHA A;  5KFQ A;  4FHX A;  4ECU A;  4QWA A;  4QZF A;  3C1Y A;  3RH5 A;  1R8A A;  2ZTD A;  5KFJ A;  3WFP A;  2AGQ A;  1UT5 A;  4FH5 A;  3ZDC A;  1QLN A;  1ZQH A;  4R66 A;  8ICK A;  3OVS A;  2MUT A;  2ID1 A;  5J2J A;  1L3T A;  2V4Q A;  4J9L A;  4DQQ A;  4NLG A;  1ZQW A;  4I2F A;  2HHX A;  7ICH A;  2M2V A;  1ZQS A;  3H39 A;  5KFH A;  5DB7 A;  3LWL A;  1ZQA A;  2IMW P;  3TAP A;  2IHN A;  3PMN A;  4R65 A;  4MF2 A;  4AT7 B;  2ZTC A;  8ICO A;  1Y88 A;  7ICV A;  3JYY A;  4F4Z A;  4QZA A;  2R8K A;  4YP3 A;  4YFK A;  4YR2 A;  2ATL A;  2W8K A;  8ICY A;  1DK2 A;  5DEC A;  1NZP A;  5HRB A;  4F50 A;  4UAW A;  4EBJ A;  3RRH A;  1K1Q A;  3HWT A;  4ZH4 A;  3PW4 A;  2C2D A;  2C28 A;  1XSP A;  3MFH A;  4J9K A;  3Q8Q B;  1SKS A;  1LV5 A;  2ASD A;  3C1Z A;  4RZR A;  4XA5 A;  4YCX A;  3H3A A;  5CP2 A;  4KLO A;  5KFK A;  1KLN A;  4LZG A;  5J2C A;  4UBC A;  1XS9 D;  4KLS A;  4F5P A;  5J2K A;  3EWA A;  4WC2 A;  4F92 B;  3MAB A;  2W9C B;  4DQS A;  4CCH A;  4WC7 A;  5J2I A;  4Z6F A;  1S0V A;  5J0T A;  1BPX A;  2FLP A;  4UAY A;  1KFT A;  4NKT A;  1JXL A;  1VJ7 A;  1A77 A;  3HJ4 A;  4I2I A;  8ICE A;  4NLK A;  2BR0 A;  5BOM A;  1XC9 A;  1TK0 A;  4BXO B;  4KLM A;  1EXN A;  5DQG A;  4P4M A;  5KG4 A;  4GC7 A;  4YR0 A;  2XO7 A;  2BHN A;  1ZQE A;  2BDP A;  4DSI A;  5KFI A;  3GV8 B;  5J2A A;  2AGO A;  5KFL A;  2JZB A;  7ICK A;  4R63 A;  4R64 A;  4ED1 A;  2OWO A;  4KLE A;  5HRE A;  2ZH3 A;  2DPJ A;  4F8R A;  2JEG A;  4M9L A;  4ED0 A;  3BQ1 A;  3IHQ B;  2ISP A;  8ICA A;  4S3N A;  2ZH8 A;  3TAQ A;  4C8L A;  2KTQ A;  5KG1 A;  3JPN A;  4ELT A;  5J0O A;  4MFA A;  3PR5 B;  9ICX A;  3HIY A;  1HJP A;  3AU6 A;  5IIM A;  1X9S A;  2F1H A;  4O5K A;  4KLI A;  4PHE A;  4TUR A;  4DO9 A;  3B0Y A;  2PI5 A;  4DSK A;  4RQ4 A;  8ICJ A;  8ICN A;  2JEF A;  3GQC A;  2PXI A;  2PFP A;  3V7L A;  1U48 A;  1R8C A;  4J9M A;  2IBK A;  3TAR A;  5DKW A;  1ZYQ A;  4UAZ A;  1NO5 A;  3H4B A;  5HRF A;  4M9H A;  4RQ8 A;  1TFR A;  1NK7 A;  4X4R A;  3WFR E;  5J2F A;  1NJZ A;  4MF8 A;  1QSL A;  4R8U B;  1ZJM A;  4NLN A;  1XSL A;  7ICU A;  4ECT A;  2AQ4 A;  4RQ3 A;  5J0P A;  4X4O A;  4FS1 A;  1RYS A;  3THV A;  9ICW A;  1ZQI A;  4NM2 A;  4PH5 A;  1UT8 A;  3H8J A;  4YMM A;  4YR3 A;  4QWE A;  1XSN A;  3UPQ A;  2C2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...