4GXRA

Structure of atp bound rpmatb-bxbclm chimera b3
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
502
structure length
475
Chain Sequence
MNANLFARLFDLDDPHLAIETAAGDISYAELVARAGRVANVLVARGLQVGDRVAAQTESVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPIVVCDPSRDGIAAIAAVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSGTTGRSGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPFDPDILDLMARATVLMGVPTFYTRLLQSPRLTETTGHMRLFISGSAPLLADTHREWSATGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGELPRGDIGMIEVGPNVFGYWRMPETSEFRDDGFFITGDLGIDERGYVHILGRGDLVITGGFNVYPEIESEIDAMPGVVESAVIGVPHADFGEGVTAFVVLREFAPSEAQVLHGLDGQLAFMPVIFVDDLPRNTMGAVQNVLRETYDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Substrate Specificity of the Rhodopseudomonas palustris Protein Acetyltransferase RpPat: IDENTIFICATION OF A LOOP CRITICAL FOR RECOGNITION BY RpPat.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Ligase
molecule keywords Malonyl CoA synthetase, Benzoate-CoA ligase Chimeric protein
total genus 142
structure length 475
sequence length 502
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gxrA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gxrA01
3PBKA 2Y4OA 1V26A 3O84A 4ISBA 2QVYX 1T5HX 4GXRA 3ITEA 3DAYA 5GTDA 3O82A 2P2FA 5BSRA 1MDBA 3E7XA 2QW0X 5K8FA 2P2QA 1MDFA 3WVNA 4OYCA 5D6NA 2QVZX 2P2MA 3R44A 1V25A 3T5AA 2WD9A 4IR7A 5KYVA 2D1TA 4RLQA 1PG4A 3IERA 1YJ7A 4RVNA 3RIXA 1MD9A 3E53A 4OXIA 3NI2A 3WV4A 4E5DA 3U16A 5BUSA 3IEPA 2P2JA 4FUQA 4GR5A 3A9UA 3E7WA 4R1MA 4D4IA 3C5EA 1RY2A 4FUTA 2Y4NA 4EATA 4ZJZA 3FCCA 4R0MA 3IVRA 5BSTA 4PZPA 3CW9A 3CW8X 4G36A 5KEIA 3DLPX 4GXQA 4RM2A 5DWVA 4R1LA 4LGCA 3FCEA 3LAXA 3IPLA 3T5CA 3KXWA 3LGXA 4W8OA 1LCIA 4DG9A 5IFIA 3NYQA 3G7SA 4D57A 5DV9A 5KYTA 1AMUA 5BURA 3EQ6A 3QYAA 3RG2A 4RMNA 1T5DX 5JRHA 2D1QA 5BUQA 2D1SA 2P2BA 3WV5A 3DHVA 5E7QA 3T5BA 3VNRA 2Y27A 5K85A 4D56A 3GPCA 3TSYA 3B7WA 3L8CA 4GS5A 5BSMA 2P20A 2VZEA 3LNVA 4G37A 4RM3A 3VNQA 2D1RA 5BSWA 1BA3A 1ULTA 4DG8A 4D4HA 4RVOA 4U5YD 4WV3A 4GR4A 3U17A 4D4GA 4RLFA 3A9VA 2QVXX 2VSQA 5BSVA 3NYRA 3IESA 1PG3A 4IZ6A 3ETCA 4M46A 5BSUA 3VNSA 2V7BA 3O83A
chains in the Genus database with same CATH superfamily
2VNAA 3DTVD 3HBJA 4CIDA 2C3OA 2HQBA 3E61A 2AMFA 4TS3A 2WYUA 1P3JA 4RL4A 4ECEA 4R83A 2RJNA 4ZU1X 3WYAA 1WHSB 2O2IA 2GZSA 4OHOA 3FWNA 2YWCA 2FPIA 2QXTA 4M7OA 4DZTA 5B57C 2QMZA 3HJAA 1VKRA 1G6HA 4GGPA 4C06A 4D9MA 1HNZC 2XDQA 3KV3O 1ZZEA 3DT8A 3ICOA 4GZ6A 1NP3A 2D2IA 1FXSA 3HE3A 4CM9D 1WB5A 2RH9B 4JLPA 5DK4A 4BLSA 2JAPA 4ZDIA 3NFYA 4RO0A 3U0BA 3ENNA 3NU1A 3VYSB 1BVHA 1W0KD 2R4UA 1JA0A 1T25A 2PRKA 2XKBA 3H2BA 4HMPA 3TL6A 5H9WA 4CKWA 2NP7A 2YX1A 1OLOA 3P97A 1P74A 2CHVA 5K1ZA 3NC0C 4XDZA 5KPJA 2QRJA 4LYHA 3SE7A 1SVSA 4NYMQ 3ZY5A 1YE3A 3GIDA 4YIHA 2I7VA 1PNRA 4K6CA 2I9PA 3CZ9A 5HF6A 4Q05A 5C2JB 1X9HA 3BCUA 3KVYA 3PWKA 4I4TA 4J7XA 4AFNA 5A04A 3GLFB 1IQ0A 1SJ9A 2MOKA 3BYZA 2W2PA 1OHHD 4ACBA 5EP2A 4CKEB 5BXYA 3BXEA 3N7AA 2G72A 2SKCA 3ZC3A 3T61A 4B85A 4ZEMA 3OQPA 2E49A 1ENOA 4RENA 1FP4A 3AERA 5C4GB 1UL1X 3ZI0A 4BO8A 4DV2C 1HTTA 1ZGGA 1E3SA 1C3XA 4F86A 3OUUA 4HZIA 4FHDA 3K92A 5BWBA 1EK0A 4YK7A 3T0IA 3AFIA 1MR3F 4JBGA 1GZUA 5DP2A 4OP3A 2VTBB 2EFCB 4PC6A 2NYRA 2W6JA 1KHTA 1KKLA 3KDPA 4XR4A 5AM5A 4KEAA 3PIRA 1Q3TA 5I4CA 4R2HA 2MYNA 4GAEA 3HJHA 3QEBZ 5AVZA 3O0DA 5BW4A 4DMLA 1FCJA 2HKIA 1SZDA 4H0FA 3ZHUA 1T8UA 1N2OA 2AG5A 2XNSA 4TS4A 2O3JA 3L4KA 1UCFA 3DKKA 3EZFA 1KKGA 1WUJS 4ZP1A 1HH2P 4ZVQA 1JHMA 3BMQB 1OB2A 4K88A 4X24A 1DJOA 1PR0A 5A1JA 3R77A 1G5IA 3RS5A 1S3FA 2OK8A 1KYYA 5BYAA 2IYFA 2D5IA 4O3FA 2N75A 4YTEA 3QVLA 2HNKA 3BA6A 3PNQA 3PGJA 4Q4HB 5DSTA 1FFBA 4DPMA 1U0SY 1L5KA 2HFKA 3E9YA 3NIBA 2P20A 1HR0C 1ZY2A 2IFTA 1ZGAA 2NPIA 3GDWA 5AJWA 4J3NA 3U13A 4XUEA 1YKFA 1JR3E 1B73A 2VQFC 1SA0B 3PQEA 4JL6A 2ZR8A 2GRJA 2IT1A 1BXRA 2CFSA 4RGVA 4WCFC 1MTZA 4YAWA 1PYGA 5G4LA 1DKNA 3SS9X 1JHUA 2RHRA 2XUGA 3MAAC 3N05A 4YJ2F 4AU1A 1TVMA 4O5OA 1XQVA 4O6VA 3WMEA 1H0KA 4CV1A 2IQIA 2IU6A 5CYOA 4HB3A 2BFCB 5DHFA 2M6KA 2JIBA 4EB0A 1NXOA 2QVXX 4EMUA 4LYEA 2GZHA 4IKEA 4JL5A 4JWTA 4V24A 2ECFA 1L5LA 4BUZA 5A9SA 5AQ1A 3A1FA 5EVJA 3SF8A 1D6NA 2ZRDA 3VX4A 2PBZA 4INAA 4DT1B 5A4AA 2BZSA 1H5UA 3BDIA 3QP9A 3U4DA 1DDIA 2WTUA 1SXPA 2WWWA 3SK0A 2CJWA 2FXVA 1Q77A 3EDQA 3IIMA 2Q4BA 4LA4A 1KMHB 1ORRA 3PT5A 4G0PA 1PA4A 3IBYA 4KAFA 1Z2NX 3KJZA 2JHCA 2J0EA 1TKCA 3AEQB 4ZYVA 2H2IA 1I94C 4IDPA 4M6WB 4AP5A 5E7MA 1BDJA 3EDRA 5REQA 5LJIA 1BJTA 3X1ZA 1K7YA 1D1PA 2FAXA 2QHXA 1VJGA 2R5WA 3CTMA 4EW6A 3DOCA 1PE0A 2IXTA 1FSFA 2ATIA 4UULA 3AY6A 1ECBA 4H4DA 2J3QA 2IHYA 1EP3B 4AF6A 1Z2OX 2VYFA 1M1YA 1W49A 5AW5A 1JOSA 1KS2A 5TB5A 2PSFA 4FR5A 2C9DA 3HCRA 1GCGA 4L7IA 1YONA 4I2NA 4MWBA 5ESRA 3CNQS 1H2BA 2HSJA 2R1ZA 4RS4A 4LTDA 5AVJA 3DZIA 3ZXSA 4HATA 4MW2A 2JJ1A 4L7VA 3IEMA 4DJ5X 5BV8A 1USIA 2BFEB 2GWHA 5EKDA 4EW2A 3EIWA 1AZTA 3ABSB 2GZDA 3MWKA 3GCXA 3UWDA 1VL1A 3SMVA 3CONA 3TIXB 1RYBA 3U56A 1UWDA 3T54A 1RLIA 3KTAB 4ND6A 3I58A 1XMPA 3ZOZA 3NR2A 2J30A 1CWUA 2BDUA 4CLEA 5T41A 4EL5A 1E9FA 2VS1A 4O2BF 4XEUA 1GITA 3T1VA 2O05A 4C6HA 4QD3A 3WLLA 4D99A 4DC1A 1W75A 1ISRA 3A31A 5LBTA 1EA5A 2JA1A 5CXQA 2CFOA 4LOAA 3MBIA 1JLSA 1KY3A 1KU6A 2CXQA 4UNRA 2AKEA 3TLYA 4UZEA 5T67A 3M6VA 3OE1A 1HDIA 4HK4A 1QS0A 3C3DA 4M9ZA 1O95A 4GEKA 5LP6A 2RB4A 5LYJA 4QFCA 1GQYA 1NV8A 2ATXA 3VHXB 4EG4A 3EWNA 1CVRA 3SQLA 1F60A 1EX7A 1F8XA 2BEWB 4QUJA 1O6FA 1L4EA 2BTEA 2O8BA 2H00A 4OHZA 3EB9A 1QCYA 2OB1A 1MN6A 3OF5A 4L8VA 4NAVA 1T0BA 1A71A 1ZJWA 3KKOA 4B3GA 4J49A 1TM7E 4O4JB 3CNBA 1U90A 1DBQA 1B8UA 4CQLA 2V3WA 4P36A 2FUEA 4IQFA 4RPGA 1I4EB 4ER6A 3K0SA 1TIKA 2W11A 3KJGA 3ZHCA 4ZOCA 4BKRA 3ETDA 2IX9A 2AE1A 3O91A 3B6IA 2OECA 5KOJA 2PUGA 4QXOA 4GG1A 3RGWS 3S55A 4RJJA 2C4MA 5HZMA 4YJDA 1R9NA 3DO5A 3KSMA 5JZVA 1HYHA 4JK3A 3FNFA 1OLSB 3KK0A 3H1TA 4UTVA 3EUWA 5TSDA 4D4JA 2WJGA 4MXDA 1N6KA 1WG8A 1WW2A 2X0RA 3UJBA 5CX4A 3TPCA 4RIGA 5CDTA 4TKUA 5BO5A 2C00A 4UJ5A 2QU8A 3DAPA 4JGIA 3C6BA 3EARA 5JUWA 1P3Y1 3H9EO 4Y6QA 1T6YA 4EWLA 1WQ3A 4P81A 4QICA 4FMCF 3ET5A 4LHXA 3L77A 1L8XA 3EXHB 1X39A 1ZO8A 3ZTYA 4NZNA 1QX3A 1QRDA 1M5RA 3GEGA 3OH8A 2ORWA 5GWXA 2QS9A 3PQ7A 5FPHA 5C4MA 4HGPA 3UA3A 5LDDC 2ZSHA 4R98A 4BPBA 1T36A 2P27A 1G18A 2WU3A 4LFCB 3D8HA 4BMCA 3P52A 3UWSA 2FG6C 2R8XA 3PNVA 3L07A 1CUSA 1AMNA 5THXA 1O6CA 2ENWA 2EF1A 2Q99A 3QFSA 1JBKA 2B37A 3LFHA 3PKZA 5L7YA 3QU4A 3V1UA 1DG3A 1X19A 1EXDA 4PPYA 4R7TA 5KQGA 4DREA 3E8SA 5E3HA 4DDMA 1M73E 3W5DA 3ELWA 5CHEA 1TPYA 2W43A 1SEVA 2ZATA 5HBRA 4A7PA 3D8RA 5EWMA 1B6RA 1SUEA 2HHHB 2JASA 2JFGA 3D3JA 3VR0A 2HA0A 5B1IA 4NC9A 4KQ1A 4PZ0A 4F6LA 2FCRA 3H1BA 2INGX 4LSMA 4Q9HA 4NSNA 4DB2A 4JV5B 2CLIB 1A7UA 2JFUA 1K6MA 3HC7A 3U37A 1RXWA 2LWIA 2QN3A 4HPJB 2GJ4A 3T5PA 3H5IA 3M4ZA 2CXNA 4TYNA 1TUBA 2ES4A 1XZEA 1JB1A 1JJ7A 2VT6A 1O1YA 3D3NA 1C1XB 3O73A 4R6XA 4YV2A 1B6GA 3RRFA 5B1HA 3W06A 4U6QA 4NBVA 1L5QA 2P2SA 1XXHA 2Q9CA 2O14A 2XIJA 3FJ1A 3BE6A 1MH9A 3PGXA 1A4IA 1PZNA 3AETA 3COZA 1NPTO 2E18A 4MV6A 2J9GA 4DRYA 1HE2A 4KBGA 3RUEA 2O2DA 4ETWA 1L9XA 3UAZA 3Q8LA 1X7DA 3G1UA 4LZNA 4AP9A 1NN1A 4RF3A 2B99A 1SC3A 1U1GA 4Q01A 3SC3A 3R09A 4WVFA 3BORA 4QX6A 3PNLA 5BV2P 5JNVA 1LCIA 2R4QA 3D6TB 2R96A 4ZT4A 1ZB9A 1I3CA 3KR2A 3WA7A 3BZWA 1ADCA 5I9BA 5JD3A 1QIMA 1Z28A 2P7HA 3DPSA 5AHOA 5AI8A 3TLGA 4NCAA 4PGGA 4B45A 1L4HA 1JFTA 4OX9Y 1XVVA 1NT4A 1ES9A 1W35A 3H8JA 1J07A 1JSCA 4YJ3B 3VHXA 4R9NA 5J40A 1NSYA 1Z0IA 2BHNA 2JAQA 3LY7A 4JUBA 4MLZA 2VVTA 2VJLA 2JZCA 1NXSA 3A14A 3JQ9A 1T8RA 2CSXA 2AV6A 4RK7A 1UOEA 1XWIA 4OAQA 1NBEA 3U6KA 3FPKA 1T29A 2FPLA 3K8YA 3O6VA 1O77A 2EERA 5CD1A 1AKYA 1GZ5A 1MC8A 3A4MA 4LYFA 6LDHA 4ZYYA 5A4FS 1V16A 3QRWA 3WGOA 1UKZA 4YY3B 2V5UA 3BL6A 4JC0A 3TMKA 1CQIB 1BHSA 3AFGA 4QQRA 1ID8A 3DBOB 1I2ZA 5I7VA 5IKPA 2SCUA 4HAOA 3BXGA 3I9JA 4REOA 3GLFE 3K9NA 3U09A 2ZSEA 4R1PA 4C4TA 5KDLA 3KTAA 1JDJA 3NV9A 3L0CA 4CWAA 2J9FB 3GEPA 3HJBA 4RFVA 4ZOBA 3GVXA 3IO3A 2P5TB 1GPLA 1SUWA 4RPCA 4XD7A 5ALRA 5JU6A 4ZEOA 2CXOA 4YFYA 2HK6A 3HSSA 2ZVDA 4L57A 2Q29A 2WTBA 4LCEA 1E1LA 1GFIA 3UJPA 4MUAA 1KFEB 4ZO9A 3O84A 4CUZA 4GXRA 4TMFA 1I1HA 2Q9BA 3JD4A 3BMNA 4YP5A 4K7JA 4XIIA 5FF9A 1FW8A 3BGDA 3R6WA 1N3IA 5L6MB 2X4IA 4RPIA 4RD2A 4Q9LA 1YF3A 1KS9A 3BSWA 2W6NA 5K8FA 1D2AA 1ZA2A 2WHPA 4CLRA 4YI3A 1QH0A 3X1WA 1O54A 1XA0A 2XQJA 1G7TA 5FOSA 1XAGA 5CB4B 1EFRA 3L0DA 4FEGA 4RXUA 2PA3A 2G9VA 2VRNA 2Z58A 4DXHA 1PVOA 1U1CA 5HE8A 4E0BA 1WCIB 5KAPA 3NRCA 4KR0A 3R0VA 5FJIA 1B0UA 1FUYB 2FEMA 2MSEB 1F2UB 4G0NA 4L6CA 5G3ZA 3BZBA 2ZUTA 3RV3A 4BMSA 4MQ4A 2HQSA 2RGYA 4LQCA 3MOSA 4RY8A 4BVGA 1II8A 2I5PO 3FWYA 1O57A 2VK2A 4M1MA 4I6EA 4QQNA 2O3QA 2Z5VA 1G6Q1 1GTVA 2IZ5A 4KPGA 4MKIA 3MSCA 5FLXD 1P6QA 4S2UA 1RI3A 1KR2A 2ROQA 2ERCA 1BA2A 2NSJA 2RB5A 2XQFA 4G5OA 2LIPA 3EBOA 1NXTA 1YR2A 1P4GA 4KLZA 4MR8B 5FTNA 3VVLA 2W6OA 4YCAA 4DV6C 2IZ7A 2OQIA 5K0NA 1SA0A 3NGXA 4DJJA 1U3GA 4I3FA 2C7RA 3BWBA 4PPGA 4TXLA 4M88A 2MMGA 4YPOA 1TT7A 2M6RA 3AEKB 1UBCA 2O3TA 5KINB 3R9IA 5A6VA 4AIIA 1GDTA 5LUAA 3LBIA 4HXEB 4NV3A 1CJBA 1TTHA 5LIRA 1LH0A 1E4YA 1DNPA 2JHFA 3IQIX 5CNMA 3DOEA 2AG8A 1VXOA 2W8BA 3TZQA 3FMPB 5AESA 4OBEA 3X1KA 4B8WA 3NXKA 1Q0ZA 3NUGA 3EXAA 1KOFA 1T9BA 2PO5A 5KKAA 5JFGA 5LL6P 1X2EA 2QI9C 4K81B 3U4MA 5LZ8A 4RTNA 3OETA 2NVWA 4ND8A 2VAWA 1HFKA 2O2XA 2PX2A 3HL0A 4J2TA 3VSEA 3K70D 2AHOA 1JKXA 4JEIA 3COSA 1L5SA 1GGEA 3F6YA 1Q19A 3NDIA 2A5GA 4ALMA 2QIOA 4DMRA 1YJ8A 2PXHA 4QC2A 4BVEA 2EKBA 4CLRB 5CDGA 2H1OA 5KYKA 3BK2A 3NHUA 5HTOA 1GZ4A 4GBGA 4LE1A 3CNHA 4BKUA 1QQTA 4ZWNA 5CLJA 5JPDA 3R6TA 2PM8A 4MJLA 5JIBA 4IHJB 4QDUA 2L0XA 5K0TA 2C7PA 1U0GA 1GPH1 2B4YA 3EFOA 4YJGA 3TKAA 1D8AA 2ON6A 5MGBA 1W47A 4OKSA 4BJ1A 1GT6A 2JDID 3ROMA 4CXMA 2QRLA 4V0ME 1N34B 3ND6A 3B7GA 2Q27A 1KH1A 4HVAA 4HWSA 4PYOA 5KVVA 3EXFA 1YIOA 4RC9A 1W19A 4EJ6A 2D5AA 5K8CA 1MC1A 2XRYA 3HKEB 3ZCPA 3DR3A 3DAYA 2WV9A 2QGNA 2CMKA 1KAQA 1H6AA 1WB4A 3D4OA 3QUCA 3SG0A 2CZCA 1BCRB 4D9NA 4AP6A 3EPPA 1DE0A 4ZANA 3GR6A 5D86A 4YUAA 4ZV4A 1QGZA 2W2LD 1NBIA 1PQPA 3BX1A 1P4JA 4EKIA 3AOEC 2FP4B 5I9IA 3DM5A 2AOTB 3LS2A 4KX3A 3K6SB 4TYMA 1FNSA 1MMFB 5EIHA 1C0PA 1QIIA 2JIPA 3EUAA 2ADMA 2VJKA 1IE3A 1ID1A 1N2HA 1OBOA 1CZKA 1PJLA 2W4IA 3RF6A 3THOA 1ZMOA 4RZ2A 4PLGA 4I8XA 1PG5A 4YJ3A 2JFFA 4DDUA 5C7OO 3EGDB 4Z2YA 3DTNA 3PCRB 5JNTA 4M8SA 1ZYUA 3TJMA 1KI3A 3KYCB 2OCYC 3L4EA 1N8SA 1ULSA 4PPQA 4TZKA 1Z7WA 2W8ZA 2KSQA 1C4OA 1D4FA 2XGOA 4ND7A 4QAJA 1F38A 4C4YA 1Z0SA 5E4YA 2UVPA 3V2IA 4PG7A 3R7LA 4PBRA 1PF7E 3SXUB 4MYRA 1A69A 4TTAA 2JANA 3BHNA 5IMBA 4IJWA 4WFJA 3QPAA 3AF2A 4HN9A 2OENG 3R41A 3RVQA 4KRYA 4KREA 2CHGA 2PBRA 3H4MA 1HLFA 3VHLB 2Z4TA 5M34A 2DR2A 4OQMA 1LV7A 2P75A 4EUSA 3HB0A 3JVDA 1AS3A 1MB2A 3PIIA 1FJHA 5SZKB 3IUBA 3K2EA 1MVNA 2H4FA 4PFKA 4E5SA 1S02A 1M2HA 4JQSA 3WISA 2COEA 2CYBA 3HDTA 3NYIA 4F5EA 1QHFA 5MN5A 2GBGA 3HM9A 2F55A 1SD2A 1V4NA 2FV8A 2RHLA 2D2EA 3CRW1 3I9MA 4ENSA 3R75A 5JBQA 3RSFA 2VPQA 1JJFA 3EQ6A 5FBWB 4DIUA 3FTDA 5FYQA 3WJAA 4RMNA 3WS7A 4KE6A 1P1JA 4H4CA 4KNYA 1O93A 1C0EA 3DLAA 1CF4A 4B17A 1JHAA 3ZK8A 4MA4A 1HGXA 4QWMA 1E5LA 3C5VA 5K51A 1UMBA 2EJWA 1OD6A 1YZNA 4LSGA 4N76A 3MBKA 3VC1A 3QWFA 4MKZA 5I5GA 1COWA 1EUDA 3T3EA 4RA6A 3N6XA 1XMVA 5CAEB 3TN7A 3PDIB 4C89A 1RWNA 4PFSA 3KT8A 3AVVA 2FETA 4QL3A 2DUWA 3CPHA 4PRLA 5H81A 4RVOA 2RAUA 1B1CA 2GHQA 5JZSA 2FZ4A 2LIVA 2J7PD 3S2ZA 4F45A 4BNYA 4DLNA 2QRMA 5CIWA 3DB2A 1J39A 1N75A 3N3BC 3U7EB 1GAXA 2VDKB 2AC7A 4QM7A 4MAFA 1EH5A 1PUXA 2DFKB 1E3MA 3I07A 1WD7A 4RGYA 5EHIA 1OU4A 2BFBA 2BKLA 2QXUA 5DCLA 1G0OA 2Y92A 1FP1D 2HLPA 3CKYA 3GJ5A 4N5IX 3TLCA 3UYKA 5A62A 1HORA 1F20A 2PVPA 3TTXA 3Q7PA 4H35A 3K15A 1K1EA 4HEJA 4UXHA 1A8PA 1Y5NA 4YAOA 1U0TA 2Y0DA 4OATA 4BTLA 4CEIA 3GJ4A 1E9VA 3IQHX 4J1SA 3DOHA 2FPGB 3K8OE 4QREA 3HS3A 3U60B 3MGKA 4MV9A 4X0EA 2HJGA 1KDRA 4ZEXA 1XR3A 1CYDA 1EVIA 3A1NA 3L92A 4ZO8A 1MXAA 1VYUA 2P0EA 2RG1A 2PIAA 3RRYA 1MJFA 4GKJC 4HS4A 4H3SA 2CLEB 5BSEA 2GEBA 4OK5A 5ABPA 5BY2A 2YIJA 2AZDA 3EPRA 4QPCA 4MH0R 3TOXA 2R1TB 3ZHBA 1B4DA 1AF4A 4KRFA 4E5DA 2BH9A 3GCWA 3NWBA 4MUKA 1M1ZA 2VRWA 1D09A 4Q7LA 3W90A 4CDRA 3EZGA 1CFZA 3NAZA 1JI3A 2WWIA 4NF2A 2KDNA 3UXEA 2I3BA 4YMVA 5AVQA 3LCMA 2Y67A 4HGRA 2CWDA 2I1LA 4ZQBA 4UEKA 4JYBA 1W4BA 5A5GA 2ZYRA 2RHMA 2NU8A 2CLHB 4GWLA 3NATA 3RK1A 4GX0A 1SR8A 2QX7A 1ZAKA 4HLDA 4U8HA 3K70B 4MVJH 3UMCA 1J23A 3DDNA 3QTBA 5M3BA 2GB4A 4J8PA 5TJHA 3JWGA 1D04A 4IBOA 3GX1A 1YUNA 4JB3A 1AKRA 5H4HA 4BFTA 1RYYA 2HIAA 3I05A 2QTGA 4EY5A 5JXWA 2XOXA 1NI3A 2PZFA 1L5NA 4BFLA 1EUQA 1CT9A 3A6KA 4PROC 3C3JA 3TGWA 4QBGB 4LMPA 5EP3A 1OC4A 2ZG6A 1S2OA 2WJYA 4G9GA 2BDTA 4X6UA 4OFXA 4EPTA 2IZZA 2VAVA 2JI6A 1YDEA 3ITDA 4LVUA 3EGDA 4BYGA 5D1NA 3W04A 2BFEA 2EBFX 3WSTA 2WMOB 4EGJA 4MV7A 3V97A 4EQ6B 1A2KC 2B7LA 2X58A 2HCFA 4E11A 2GMWA 2I87A 2FJ0A 1D0SA 2D1SA 1KKMA 4RF4A 3I61A 2DHEA 1IWPB 1HYBA 2LCQA 2XJ4A 4EYGA 1E6EA 4X92A 4DM4A 4UMVA 5D8DA 2AUMA 1N0VC 3I9OA 1RC8A 1TQHA 3H0CA 4YDSA 2H7VA 1C9NA 4QQFA 2HU8A 3EW9A 1KI1A 2Q5FA 1RBMA 1U0JA 3RO7A 3REGA 1UZUA 1PNVA 3HDJA 3UJ3X 2ECOA 2XKAA 2A9KA 4G0OA 3F4LA 4R0VA 1D6SA 1KQNA 3OP4A 5KZMB 5FOXA 2AVNA 3DUFA 4LJRA 2E4WA 1FX0A 3HUUA 1DWOA 3PA8A 4XPIB 4RTLA 5CGZA 4IV8A 4IWNA 4DIFA 1DQRA 1UT8A 1ZUHA 3C8MA 1OFUX 1H66A 1YZQA 1IULA 3S8MA 3TRDA 5BOSB 1YVPA 3EXG1 4AL4A 2XECA 5A9SB 1XLWA 3SYNA 4F8JA 2XUOA 3V3TA 3ETCA 3Q9LA 1IY8A 4TSFD 4UDYX 2ZJ5A 1GAWA 1Z18A 2UYYA 2MT9A 4UU1A 2VTDA 2PRZA 3E4DA 4ZOLB 4ZGWA 2OESA 1X9IA 5SY9A 4DCVA 3ZE1B 5JO0A 4AW9A 3RLIA 1AN9A 2OZVA 1AUPA 3FSGD 1NQUA 3R3ZA 4R2KA 4UEWA 4H7PA 1DLIA 3STTA 1PFGA 1JEYB 1KJQA 1JKJB 3R8XA 2P4EA 1FC0A 4TYYA 2K2WA 2HMAA 1BCSA 1NR7A 1AXRA 5L7TA 1UBMS 2RH8A 3RS7A 3VPSA 1SKAA 1L4UA 2OMKA 1O96B 1IOLA 5F7ZA 4L2IB 4EMTA 3GRKA 1YOVA 4K87A 4F2GA 2W5UA 1PQWA 2M1XA 2A3NA 2I6TA 3U7RA 1ZCBA 2QOEA 1EFTA 3TL3A 4YUZA 4DA6A 3TR3A 5T4HA 3TFQA 3DDZX 5LQRA 1LFDB 1M7HA 1VDMA 1EFLA 2Q3BA 4KE7A 1XTPA 2C2WA 5AKLA 4C01A 3FPFA 3H65A 5CVCA 1NVEA 3RYFB 3DMNA 3LIPA 2G8NA 4KXWA 4YMWA 1YE8A 5JVDA 3C4VA 1Z4JA 3O38A 3AGPA 2FEKA 4DJFC 1EX1A 2DFNA 1TD1A 3OTIA 2YYAA 3PFBA 5GAJA 2ZW9A 2PUBA 1V43A 2LZ0A 3NXSA 2YRXA 3ZXIA 5MGNA 1P60A 5ERGB 1X7WB 2VP0A 3ENKA 4MRNA 3W8EA 5AD1A 1KI8A 1N2CA 1TMKA 3OQNA 1KIFA 4A8JC 1JQAA 3DDSA 4EMBA 3VH2A 2WD7B 2FPPA 3ZUGA 5C8YF 3KZXA 4ZCRA 3TUIC 2YOGA 3DVAA 1DQZA 3DEZA 4K0KC 1QO9A 3H13A 4S1PA 1WXXA 4ITUA 1R74A 2NUPB 1JQLB 2JG3A 3DD1A 2RIRA 3NJ8A 2Z83A 3ZLJA 2QUJA 1ZN7A 2QL7A 2XA2A 1YI0A 4H15A 4MRMA 3AXSA 3LY9A 3E5RA 3TIVA 4EYSA 3PHCA 2W98A 2IGBA 1Z36A 4AZ0A 4RSGA 2I3DA 1VSTA 3IALA 3H6HA 1GRCA 3FFAA 1QVRA 4XRGA 1G64A 1IG0A 1ZVQA 1H1LA 4XSVA 1N8NA 2Z9CA 3U31A 4BNWA 4NBRA 5MDHA 1IEWA 5LLDA 5DHUA 4PUGA 1V2GA 1P1CA 3WAGA 1DBSA 1T0UA 4OXXA 4V0NA 4R2JA 1UFKA 1BD4A 2Q49A 1YB6A 1G8PA 4GPD1 1KOLA 5AJVB 3L04A 4WZZA 3SHTA 2X5KO 2R1VB 4OAOA 5JAZA 1CHNA 1CUUA 5K01A 3D4PA 3B1XA 1Q2XA 4WCFA 1KJNA 3ER6A 2VFAA 2GXUA 4BP8A 1NN5A 3NUZA 1R9GA 1XKXA 3JQBA 1V5WA 4OEHA 4Q5IA 5SY4A 4ASUD 5EJ4A 2OXFA 2GCPA 2E5LB 2PV7A 4ILKA 4O8ZA 2GD1O 1MAAA 2O5RA 2FSVC 3DM9B 5B4UA 2BBWA 1MC5A 4PLZA 3TRFA 4ZI7A 2P2GA 5JJIA 3G5AA 2AKYA 2CXHA 2IEBA 1EFKA 2JFHA 2ODBA 3PUWA 4GQIA 4NNJA 5FPQA 2HDWA 5I9TA 1RAEA 2LNDA 3PEWA 3I83A 1XC7A 4REQB 3ZDBA 4MYUA 1JP7A 1ZS9A 2VT2A 3N6RA 1XZFA 2RARA 2NYUA 5CXSA 3AR2A 4OREX 2IHVA 5FUBA 5AW9A 1Z8NA 2IS4A 1FMTA 3AL2A 5GONB 1AO0A 4GXTA 1NX6A 1N2CE 3SZMA 1BXGA 1KVTA 5K8IA 1P5JA 2J3IA 3BTOA 3HYNA 3IBTA 4NFYA 1MLDA 1QYWA 4G84A 4HLUC 4MUNA 4DR1C 1QE0A 4DAOA 4RCVA 1SVNA 1A9XA 4KE9A 3QXJA 5K20A 1WBDA 2KHZA 3EIOA 1R66A 3GJ0A 3PEVA 3AB7A 1G59A 1ILEA 3L6RA 5H70A 4Z4EA 4Y30A 2B1IA 3C43A 4DYHA 2NV6A 3P45A 3WWPA 4BAGA 1IYZA 1CUXA 4JA0A 4CCWA 3PB3A 4MK4A 2PKQP 4ZRDA 3ET4A 4DLYA 1FUIA 5F64A 1EINA 1W4LA 2EGHA 5AR1A 4AJ4A 7YASA 5FNVA 1UMCA 3O7WA 3ZZUA 3ANMA 3P4YA 4OG2A 4YDRA 3V2UA 4DM3A 1DRJA 1KI9A 3KJXA 2NSDA 2XX3A 3KPWA 2HR1A 2R3SA 5E1DA 1SHKA 4PANA 4UE6A 4MRPA 4Z9XA 1QHXA 1U4SA 4IDAA 3HTXA 4K6MA 4P4LA 2HW8A 4OLFA 2R62A 3AEZA 3GAFA 3KQTA 3KB6A 4JI5B 1VL8A 2YZMA 4JJKA 3EVDA 3G2IA 3CW8X 1BCRA 4E6PA 2CN1A 2C97A 1QU2A 2GFQA 3N2LA 2IUSA 1N6IA 1SKQA 1JGTA 2V7PA 1R9MA 4R9SA 2FR0A 3D5QA 1B0AA 1S8NA 4UAVA 5L4NA 3D5TA 1JHPA 7REQA 4Y1RA 3L0BA 1Y7HA 1OWPA 1QV9A 3H42B 3F3KA 2HI0A 2HMWA 4IOLA 1O9HA 1ZJZA 3M6AA 2PWAA 3CRVA 1NRJB 4AQDA 4NAUA 4TSRA 4WCFB 1ODTC 2PXAA 2GZ2A 5ITVA 4RVDA 3E5NA 1X1AA 3NH9A 4EYQA 5JCXA 4LXUA 1JYEA 4TRRA 3WDLA 3EOAI 3LPDA 1TCUA 2R8BA 1LVHA 3GLVA 3QY9A 3UZ0A 3GXOA 2JIZD 4YAFA 2UUCB 3EDMA 3QEMA 3NHRA 3IHKA 2QA5A 2HSZA 3FYSA 3WSWA 4EHNA 1QHNA 1LSUA 1HSZA 2WNSA 4ZOEA 2VDJA 3VZQA 1XKTA 2QQFA 1W2GA 2CNNA 2JIZA 4D98A 4FFBA 4BQSA 1I7DA 4NAHA 3IJRA 1QB7A 5DGHA 3WK5A 3KWLA 5F77A 4CL8A 2G88A 1QK3A 3QFCA 5DCUA 3CRQA 2GAFA 2IYOA 1JR3D 2PR7A 3V6MA 2OHFA 1JA9A 3L84A 3LUHA 2QLTA 3ENZA 1V95A 1U3UA 4TV8A 4HWGA 5J4KA 4GBJA 1T3SA 4AUNA 1F5SA 5KTKA 4R2MA 1P7CA 4MA0A 4NFSA 3VAYA 1UP6A 5KCMA 4IOJA 4CMCA 2X7JA 4FFDA 1Y6FA 5K0EA 4N5MA 4MW5A 5H68A 3WMXA 1UBOS 5LQKA 3HZOA 1XTKA 2R7MA 4NOJA 1DEXA 2GNAA 3CQ1A 3EIFA 3Q5EA 4LE5A 2R6DA 4N47A 3SZ3A 5BR1A 2YW9A 3BQMB 5CA0F 1CUFA 1C9EA 4PZYA 2CHFA 3CE9A 1PR9A 1YS6A 2HDNB 3VZCA 1F0YA 4KN6A 3VU3A 1E3TA 1RZ3A 4RWEA 2O23A 3D7RA 3W77A 3B70A 2IIQA 3WJ7A 4G09A 3ZDEA 5IDYA 1C3OB 1YDFA 2D5CA 1CB7A 1G2QA 1M1UA 2OZEA 2PZMA 3HBLA 1CUZA 1PZHA 3LUCA 3AYZB 4ZT5A 5TS2A 3RAFC 2CMHA 3IPYA 3W2FA 1N0WA 1G291 1X7GA 3IUEA 4LGVA 3L8HA 3K9FC 5AXDA 4MSUA 2X0FA 2PRIA 1H2HA 2H1RA 1EK6A 4Z49A 4FGWA 3PYMA 4Y2GA 2A9JA 3S1AA 3WK7A 2KM1A 4E5KA 1LB1B 2F8MA 2PS0A 1KF0A 3FDZB 3EWSA 4LOKA 4JBXA 4MGYR 1MIOA 4J1TC 3PC8A 2E7ZA 3D7LA 3R6LA 2Q1XA 1XU7A 5T5QA 3ONNA 3VOSA 3A2KA 1JFFA 1XD2B 1MHPA 2QZSA 1GLNA 2BV3A 4M53A 3CUTA 5T64A 4LSZA 4NCBA 4BLOA 1N9ZA 4BMZA 4O5AA 3OQBA 2I3ZA 4J4HA 2QVGA 4ZEVA 2R6GA 2WMNB 3TNYA 3VDNB 1XZBA 3MYRA 1Q50A 3ISVA 4I5FA 2BGUA 2VT7A 2A9RA 1DV2A 4XAQA 3RNOA 5J4VA 4B4OA 3TQHA 4IKOA 4KTVA 4AJ9A 2XMDA 3B6KA 1RHQA 1UKEA 1ZN8A 1ZRMA 2OCDA 3L6BA 4GMDA 4KVGA 4KXUA 1A7JA 1ULBA 2OZLA 2PANA 4RV5A 3SBEA 3HB9A 5TIIA 5DTJA 1F9EA 5KTRA 1XQ9A 4CTKA 4D9FA 3JZIA 4P3KA 3Q7TA 2ZI3A 4UPVA 3GMSA 3NALA 1XT6A 1WSAA 2C3MA 3AOGA 1LW6E 1RVDA 4BO2A 4AJ1A 1RRCA 1REQA 5FWXB 3UYLA 3M5DA 4GOMD 2WC1A 1PLJA 3RHTA 1BVUA 1C1HA 3CZPA 1ZHOA 5ED4A 2NO0A 1YJBA 2F6RA 4PZUA 3TL2A 2VHQA 2G0AA 3PICA 1L4GA 2O0LA 1QHEA 3SHQA 9ATCA 1L7MA 2G9QA 3H3XA 4OB6A 1BOFA 3URKA 4RCZA 1GGNA 1YBMA 2QUAA 3WKAA 1SNYA 2XUQA 5LZ9A 2HK7A 2CUZA 3NCHA 5FPTA 2XYRA 5REQB 3W2EA 4CEHB 3VKWA 1R6XA 5CYPA 1EVLA 1QVWA 1VE3A 1NUAA 1TD9A 5A19A 4E3ZA 1R6BX 2ERYA 1A5SB 2IPOA 3TOCA 3F73A 1G6KA 4KZKA 2ZAIA 1XEXB 5HKOA 4KUGA 3BIJA 1C8KA 1QG6A 3MMNA 1NQOA 2FMXA 2QPTA 2X9NA 2CBXA 2I22A 4X7RA 4WV3A 2VH2A 1T9HA 1YZLA 1FK8A 2ZUCA 3HDYA 1KC1A 4JASB 1VECA 4CLOB 1DEHA 2QN7A 3T5TA 2HMYB 2EHDA 3L9XA 4LI3X 1JJBA 3GR1A 3OTQA 4KNVA 2PSDA 4OFZA 1G8SA 3G2OA 4PC3A 4ABYA 4P5DA 4KACA 1XD8A 5T8KA 4OHPA 4EJ2A 3ZJYA 5J23A 5C9ZA 1PR5A 4KW7A 1ZC4A 2FZWA 1PTJA 4M76B 3MBOA 2ZKLA 1FSGA 3WKCA 2C2KA 2VJMB 2H85A 2WDPA 1SBYA 2VDQB 3QSYA 1CJKC 3QVKA 1T10A 2DBRA 5C1IA 4EY3A 2WM8A 3FAKA 2OCBA 2YY7A 3QMPA 4UW9A 3TZEA 2LCIA 1UT5A 4QOHA 3NM4A 3D3WB 1TMYA 3ZQKA 1EFDN 3NP7A 1VE7A 3DLBA 2WIDA 3AZPA 3KKQA 2QRHA 3CG0A 5IT5A 4NXMB 2PA0A 3R44A 1KXJA 5EWJB 4AJKA 1YI8A 5LBUA 2NU6B 3ZEAA 1Z83A 2JGDA 4BQOA 3AI1A 4OYYA 5B5SA 2IXBA 1YE5A 2QL9A 1WBJB 2Y2UA 4MQ6A 3S1SA 3JQFC 1DELA 1X14A 4ABTA 1VPEA 4IQ4A 4LF8B 2FQQA 2BEKA 1HZJA 1ZL0A 1QXSA 1S0UA 1SB9A 1X87A 2F1IA 2GTPA 2GCOA 3GEEA 3SYRA 4PZAA 2ISQA 5K8VA 1IBCA 4KHPB 1Z5NA 1MNQA 3CJRA 3VA7A 2O8DA 5NULA 5P8WA 2EG5A 1EX6A 2BFNA 3UICA 4A3SA 1EXVA 4D92A 3CX3A 4L0QA 1CE8B 1G63A 1SIUA 3MELA 3CLSC 4S12A 4WINA 5EWMB 3RSSA 3TQFA 4AXXA 4QKQA 5ISMA 4JLSA 2NTVA 2IH4A 3WGIA 5LNK6 5HZKA 3JPYA 5KNBD 3WO1A 1KP3A 2WHEA 1AZWA 4BLWA 4RTSA 4MVJI 3EGCA 3VNBA 5BMVA 3MB8A 4D42A 4EX6A 2YJTD 1ZA1A 3AR9A 5LBIA 3FXAA 3H18A 3K96A 3BRQA 3BIFA 3GRRA 2GK4A 4FWBA 4YJKA 5CU7A 3VO8A 5C8DA 2JAWA 3GFPA 3UW1A 3HSYA 2A5LA 3GXBA 3JWEA 1ABEA 1W6RA 3A8TA 4OX9C 2YXPX 4OXNA 4MRVA 5EXEA 5T3UA 3OIYA 4ZDKA 5TARA 1P5RA 4G0VA 2FE4A 4RV4A 2BHTA 1G8KA 4ZK2A 1IOVA 1N8TA 3JVEA 1ISJA 5IULC 1P8JA 1DFHA 1N9GA 1W4RA 1W0JD 1U8TA 2A14A 2IL1A 3I9NA 1W2HA 2EFHB 2GEVA 4GR9A 3ES9A 4P4TA 2PLRA 3PDWA 5F2NA 1Q44A 5J4YA 1J33A 1OLSA 4LRTB 3VR6D 1M2FA 4A36A 3MUNA 4G56A 4EP1A 1O08A 2QN8A 3EISA 4J0KA 2UXCC 2P65A 3IJ5A 3IPXA 3LDFA 4MYTA 3ZPXA 1W5BA 5E6SA 1CUWA 1KMCA 3FYCA 2H2GA 4XIFA 2W2LA 4X44A 1GKLA 5AK0A 1HZZA 2J5XA 3FPAA 3K8QA 4RQUA 3TRIA 4EO9A 5HILA 3GPDG 3X1YA 4PVCA 3OX1A 1F14A 4RNCA 1DEKA 3PFGA 3SZOA 1P9LA 3AU9A 2XMQA 4PPFA 2IUUA 1G17A 2JC3A 5AXCA 1SXJE 4C0WA 3HCNA 1W1UA 2VQ3A 4U5QA 1TTPB 2A30A 1F1BA 2HHLA 3HDQA 3NHMA 4U63A 2V55B 2J3EA 1QVVA 4MH4A 1U0LA 4MVYA 3IKLA 1LEHA 3QFRA 2QB5A 3B52X 3C6KA 2RGNC 4AMUA 2EJCA 2W6QA 2ZB8A 3B1YA 1CKEA 4NARA 3E7DA 1NYEA 1G21B 2YY5A 3RYHA 3LKBA 5AMXA 3ONEA 4WE3A 3UATA 4RHYA 4CV3A 5BR4A 5KNDD 3TW6A 4OIFA 4DR7B 1VI2A 2HCTA 5CP8A 2X4DA 3UPDA 3SIPA 1KEEB 1L5FA 1YJXA 2CFRA 4UNIA 4XX0B 3TQSA 4INJA 1RKBA 1U5BB 2N42A 4GGOA 4XM1A 4U3JB 3EOZA 1NGSA 1N9GB 2ZIXB 3LBAA 4PYLA 5TLSA 1LJLA 3EAFA 4UXJA 3SNHA 3UB4A 1I14A 1JDSA 5E6RA 2GK6A 3I6ZA 2BONA 2VHUA 3D5EA 3BEOA 3K0CC 3PNOA 2NXJA 1JIXA 3Q0IA 4OK3A 5EE1A 3RVLA 3BDAA 1NLZA 3MILA 3R5FA 1YMVA 1BRTA 3HO8A 3Q3CA 4M7PA 3RIGA 5L4LA 2HJWA 5CT9A 2EJTA 1JIVA 2N3ZA 4E09A 3IQGX 4P2BA 2Q5EA 3A4LA 1MGPA 3HN6A 3NHAA 3BILA 3IE2A 5LZ7A 4E4TA 2PKYX 3D4BA 1V7PC 3PFFA 3MCWA 16PKA 3KPUA 3ZU5A 4CKCA 4P53A 4U6NA 3FW1A 2P69A 2XUFA 3I01A 1KJYA 2AF4C 4DJEC 2C8KA 2CZQA 4BN4A 1EESA 3UAWA 4YAIA 1RIIA 1G7RA 1T3ZA 2OLKA 1PZMA 2BGTA 5IF3A 1PFVA 4RTKA 5H4GA 2Q1TA 2QTBA 4IIXA 4KO4S 2J09A 3KSBC 2OOSA 1A3CA 1Q20A 4HWRA 1US8A 2JBAA 1FMFA 4X62C 5F9FA 2D54A 2BOVA 3ICQB 1QHHA 2YQ4A 5A0VA 2PWPA 5ECWA 3LZ6A 5A03A 1PKXA 2C3PA 3KL2A 2E6KA 4FVTA 4XUDA 3MLAA 4N40A 2A9OA 3FYHA 1KI4A 1GCAA 2JGDB 2MIIA 4XKJA 3M6MD 2BHSA 4F2HA 5H9UA 3AU8A 1JR6A 2V03A 4HDQB 3EZ9A 2OCKA 1PQYA 1HE1C 1YL6A 1E77A 2D1FA 2GZ3A 4RWZA 3WQSB 1U3TA 4RMIA 1H5QA 2OCAA 1XVLA 3KPVA 4J0GA 3SAJA 1Z6QA 2FG5A 2OY0A 4HNSA 5JG7A 5KYTA 2ILVA 2ANBA 4FFMA 4ZMSA 4BJ3A 5KJ6A 1GGJA 2PUCA 4TLEA 5KSZA 1JG4A 4IG9A 5JNSA 1SKMA 3AF1A 3A9TA 2MM9A 2IOYA 3CT6A 3DZDA 1RW4A 3OPXA 4NPAA 3TD6A 2YNMA 5BVHB 1N5KA 3MEQA 3QPBA 4D4MA 2FX3A 3A3KA 4QBIA 5I4KA 2DULA 3FMOB 4X71A 4UBNA 4FFSA 2O07A 4J0QA 2BMEA 3IA7A 3M5WA 5G0WA 3OC6A 4EI2A 3TUFA 2H6EA 3K1JA 4BEBA 4ERNA 5C51B 2ZIGA 3WC4A 1IHUA 4O02B 3KB8A 2QDKA 2HLHA 4C7MA 3TCNA 3FTFA 1WDWB 2KI5A 1CDDA 3T1YC 1ZX1A 3NWPA 2IHBA 5EKTA 5ERYA 1JTFA 4ASUA 3CLRC 4HQNA 2LR0A 1PZEA 1U0NA 3Q9SA 3CCFA 4B6RA 4M9QA 3VU8A 1H2EA 1CY6A 2D13A 3GJXC 1VLVA 4KPUA 1YOVB 5KQPA 3UGJA 2PQMA 2ZE5A 5G0VA 1V8BA 3GNSA 2FLVA 2V4MA 1PW7A 5AVWA 4LN1A 3WK4A 4R40A 1NU8A 2FPKA 4RHUA 3JWJA 3JZDA 4FI3F 4REMA 1RTTA 4TTQA 4UHKA 4ARBA 3DC2A 1YHZA 4GKVA 1KAGA 4L9AA 4UZFA 1B23P 1NVMB 3L5OA 3OT1B 5FDFA 1ZKDA 4Q3AA 1FFYA 3EG9B 2I03A 2HPAA 3BWCA 5TQ0A 2XKJE 3WBJA 721PA 3AHDA 4NULA 4J76A 3KVVA 1TEXA 4MIOA 2QTVB 3NONA 4WUVA 5AI6A 1R1DA 2A7XA 4IJQA 3B8EA 2FPXA 3GT3A 2XAAA 4FK8A 1OI2A 1JJIA 4P4NA 2YZ2A 3NRBA 4IMRA 4AY4A 5JJLA 2JKYA 3CVXA 4FR2A 5JH7F 1ZFNA 3QPVA 4JJZA 2BZ1A 3NZEA 3IIJA 3PK0A 3WB2A 2CLCX 2FMIA 2NWQA 3OZUA 4XUGB 3V5NA 3RVRA 5JRJA 4MI3A 1QB8A 3I5YA 2WZDA 3L7OA 3L3BA 4YR7A 2B8JA 1N34C 3I3OA 4H59A 1C3LA 3TQTA 1HG1A 1KR5A 3VZRA 4AKSA 1VTKA 1N2XA 4K9MA 1GPDG 1XDBA 1LWNA 1K7SN 1ONBA 1MF7A 2IYTA 2BHLA 4LXQA 4UCFA 5DASA 3GBVA 3K2IA 3UIEA 4E94A 4EFMA 2A88A 3LU1A 3RBZA 2UKDA 4QUAA 3ESYA 3OEYA 1SU4A 4JGGA 4YJHB 1TA0A 5LWQA 2E3JA 2Q2NA 4EA8A 4PW0A 3FKJA 2AOXA 3T7RA 2RC5A 1DXOA 2FDXA 2QRZA 2YDYA 4OHCA 3R4CA 4G9EA 5AKEA 1U5AA 2W2MA 3C7KA 3LVBA 4BWGA 3T3IA 2Q28A 3PXCX 1EZZA 3N9IA 4WLEA 2FQWA 1FYVA 4E2WA 4BV8A 2ZJ0A 3SXJA 1CY8A 1KEKA 2OGTA 4F21A 2JBAB 4CU5A 4GVPA 1Y3IA 2W2QA 3LPLA 2X0JA 3AT1A 4LHVA 1V1MA 3BE5A 2EATA 3C41J 2GRAA 1YU9A 3E35A 4WWHA 3IPLA 4WN9A 1F7UA 4YRNA 3NOOA 3FCOA 2VYND 1EG2A 3IIIA 3HZRA 3D8UA 1GUDA 3E0QA 1M2KA 3DVQX 5IYZF 2CDAA 1GCOA 4A82A 4FEYA 4BMOB 3VGJA 4D0LB 5J2UF 3SHOA 2VOJA 5EJIA 3W2HA 3LUAA 5BXQC 1K98A 1P1HA 4UHHA 3DFKA 3EJ6A 4HRYA 3SC6A 1GPKA 2H1IA 1GAQA 3O1LA 3YASA 2PMEA 4JELA 5EWLA 3FZNA 4JENA 1QQ7A 5AW2A 4Z3OA 4GRIA 2NQTA 3S40A 1R0SA 3MLEA 2AA3A 2ECPA 3WV5A 4HWOA 5TGZA 3TBFA 2OORA 2OAQ1 4G1UC 2DY1A 1OAOA 1FYEA 3KR9A 3VU9A 1A2BA 1TO2E 3W7VA 1VKOA 2A1TR 3TUZC 5COBA 1IQPA 1NF9A 1X1RA 2OC9A 3KTFA 3OICA 4RKEA 1AUXA 4JFRA 1U2ZA 2WICA 3FH0A 1IEXA 4XB2A 5AWFC 1P2TA 3JW8A 3VZBA 1SBZA 1J24A 1VPDA 1YZVA 3P27A 4TXHA 4QBFA 3EEQA 5E1OA 3RC1A 4JOCA 3T15A 2PXXA 3DMGA 3OU7A 3GFFA 2ZBDA 4WXYB 4YV1A 3A9VA 2ZBRA 4FFBB 3HWRA 2ZT6A 1B2LA 5JD4A 3DXYA 1SOVA 2AJCA 5IWAB 2HZBA 4BCCA 3V55A 3AWDA 4EPRA 3MUOA 5KYUB 2D4HA 5AI0A 4QODA 1RQXA 2XE6A 4YRTA 3PD1A 2GGSA 5CFOA 4ZZ3A 1M6EX 4ZT3A 3IO5A 5FTLA 3OZBA 3ROXA 2ID8A 4KWIA 5B3AA 1AKWA 1NJFA 2YVLA 5LU8A 5IX8A 4ISCA 3ZCVA 1SGWA 2VSOA 5JDIA 2JFQA 2WFAA 1UDCA 1SWVA 3GI1A 4ZHQA 4NMLA 4FFOA 1SC9A 1FDTA 3IMKA 3AH8A 5EXPA 4E03A 5IVIA 3W8DA 1F0KA 3PITA 5B12A 4LECA 2ZRFA 5DNEA 3AUSA 5DU2A 3QH4A 4A0RA 1UQRA 2D0IA 3WFJA 5SY6A 4AJIA 2XWBF 3IERA 3NIFB 4TYQA 3HP4A 1ATIA 1VL6A 2ZQYA 1FY2A 1QCDA 3GFOA 2PQ6A 5CEFA 1A8QA 4RJIA 5BNFA 5HFNA 2R8EA 2OYSA 4US0R 3F67A 2JIDA 1TDJA 3OTWA 1Q6YA 5KI6A 5J5VA 2IYQA 1VDZA 3ODPA 4N82A 3HM2A 4Q3BA 3ZCSA 3TTUA 4CNBA 3MWLA 2IYYA 5HE9A 1OX5A 4D0GA 1IVNA 1DAOA 3N54B 2C57A 2GVZC 3ZE0B 4BFXA 1DSSG 4CUJA 3K0KA 4J16C 5HK8A 4WBNA 2RGUA 3E9MA 4IJVA 4LDQA 4ZPXA 3FUWA 4BIIA 3JQQA 4LJAA 3AEUA 5THQA 5HZHA 5HBGA 4JR1A 3ED1A 3CFYA 3P9PA 4ONEA 3AIKA 4DXAA 2EU8A 3NDJA 4EA7A 3SHWA 4KXQA 2W90A 3GJTA 3EZ7A 3SZUA 1LFAA 5FAKA 4EF6A 2IVFA 3PROC 4P08A 4LZOA 2YJ4A 3B89A 4RSRA 4TVBA 5EJGA 2B30A 5AOAA 2VNKA 4PYQA 4Y2TA 121PA 4L4QA 1HDGO 1RZUA 2OWDA 4WVLA 2BKEA 1KDZA 4JZKA 4WASA 4CIVA 1UBKS 3GA0A 1NATA 2VNHA 2YOFA 3INTA 1FFGA 3B9PA 3OZSA 1PWYE 4LYAA 2FQYA 4XASA 2ZYDA 2C8JA 2PROA 1U2GA 2FUG1 3KAPA 1B8PA 5K6AA 1BKYA 3MXTA 4XD2A 2CK3A 1X7YB 3R3UA 4ZI7B 3KQPA 1L3CA 3BICA 2APJA 1P0FA 2IQ5A 2OHGA 5JQWA 2GAJA 2I2BA 5A9RA 2KBFA 2XCUA 1Y9EA 3HN7A 1QTQA 3ADKA 4NECA 3PG5A 5KMGA 1BEEA 1GQOA 1L5RA 1U4NA 2QT9A 2C4VA 4FNOA 4II3A 2WIJA 2IWRA 1CZLA 1Y3FE 2N47A 5JJKA 1PR4A 4YRFA 4TLMB 1KYZA 1V3QE 2H1FA 2WPDD 4V0RA 1OYYA 1GTG1 1J20A 3UCFA 5I51A 3AHFA 3H9QA 3ZWNA 1PJQA 3HSKA 4DSTA 4JB0A 3EH1A 1QP7A 2K6GA 1OE0A 3ZWDA 1BVRA 4C5BA 1EVJA 3TPZA 2TRSB 2PUAA 3NJ4A 5EJ8A 3ZD6A 3FIJA 1Q0UA 2QP3A 3WZ2A 4MQLA 1NG1A 2H7YA 2V8OA 3N2QA 2E5LC 5DTIA 2BMVA 4NEQA 5F12A 3TXXA 1AKTA 4B6OA 4YJFA 3UH1A 4F93B 3CGWA 3NDRA 2PJDA 3KQUA 3I2KA 3WBBA 2ZTLA 4RQAA 4Q21A 5BOVA 3GGOA 5HQ3B 2QUHA 3G79A 3L6OO 4N0QA 2BI8A 2HF2A 2PFGA 2DKFA 3OEWA 4PTZA 1XQ1A 2D59A 2MYTA 4S1TA 1WY5A 1IG3A 1L2TA 5JPIA 4B43A 5A3JA 5IT9A 3FCAA 3JQ8B 5EZYF 5D3KA 3HKEA 1OGYA 1RRPA 1VHTA 4X1IB 4RELA 2ZJ7A 3V1LA 1EIWA 1YKGA 2BI4A 2PRJA 1PNTA 3WRWA 1BS9A 2P2MA 4R1QA 5EJ7A 3CR7A 4RE5A 3TB6A 5GVSA 1HQKA 2E1RA 1I6KA 3RVSA 2OHVA 1QF9A 5BQ3A 2WFMA 5KQMA 3TTWA 3KUUA 4PU0A 1TZJA 4UCXA 1N2GA 2CMGA 5ERXA 2DPXA 4FQ8A 4KXXA 1TYEB 2FW9A 2UVQA 3H75A 2ZYHA 5IJWA 2LE0A 5CT8A 4H3VA 1DX6A 4L3WA 3CSUA 1DAIA 1JALA 4B44A 4H4EA 2MMCA 1M6WA 1JLLB 1Y7TA 2HBYA 3QE3A 2JJMA 4GSLA 1YR8A 5KSPA 2XNKA 4GICA 4EYKA 4QO8A 4ZAZA 4N12A 3CQ3A 1QP4A 4E5NA 5EE3A 4DLBA 2PMKA 1T1IA 1AKUA 3TW4A 2PKQO 5HGXA 1N0HA 4RH1A 4M6WA 4AVYA 3CLRD 2NZ2A 1HQYE 5TF0A 4URYR 3ZNQA 1U8FO 3HYSA 5T8TA 1LRLA 4LOJA 4BC0A 2F8SA 5JSKA 2DHDA 3DLIA 4IZOA 1B00A 3QE4A 1RHUA 1BFKA 3EDOA 1LBSA 2VDWA 2MJLA 4OLBA 3TQIA 2ZQ5A 5GGYA 1NVFA 2GUWA 5AM4A 5T4EA 4YRAA 5DEOA 2JI9A 5L3QB 2G67A 5J2UB 3GF4A 1N8KA 3NNDA 1DC6A 2UZIR 2YWEA 3UUEA 2FN8A 3W1VA 1ZSYA 2CYAA 2LTAA 1IB8A 4MRAA 4AX8A 5CEEA 1PK9A 5KYWB 2N1BA 2ZRIA 1ZN2A 2PZLA 3IUJA 5LB2A 3F6CA 3G89A 3KQQA 5BUQA 3MCVA 4Q3KA 3SN6A 4BGDA 1A1VA 1IHXA 4FLFA 2Z9BA 3PUHA 3NWEA 4MYSA 4WADA 1DBVO 1SKYB 4XLTA 1NIPA 4UTNA 5AJYA 1E5DA 3KQWA 5B1YA 3PC3A 1LQ2A 1O8CA 1JSLA 5TJ9A 4PSVA 5LZ4A 2HB6A 4IDCA 4W8HA 1I2MA 1TVEA 4BASA 3KYBA 1DARA 5KIAA 1Y81A 1IN8A 3A2NA 3RC7A 4N01A 2GILA 4A0GA 2IOHA 4BP1A 1Q0HA 4CIBA 3BHMA 4K9DA 2C7QA 1TO6A 3A04A 2AGVA 1RAHA 2HWWA 4L02A 4CEJA 3KAQA 4HNGA 3QVUA 1JFRA 2QNBA 3K0FB 5J5AA 1XP5A 4OKNA 4PPNA 5DLYA 5I9LA 1F48A 1IZYA 2I8AA 2YW2A 3L1VA 3RRMA 4WOCA 4D0NA 5I9NA 3EZ6A 4QTUB 1XCLA 2ATVA 2G71A 2WF7A 4NYJR 1KDTA 1T5LA 4CM3A 5I7SA 4JBYA 4MKGA 5JI3E 2G82A 1DHTA 1DQYA 3I6YA 1VLHA 5K3FB 2VG8A 2NV2B 1E69A 2DR0A 3VVBA 2I8CA 3KU4A 2RI6A 2HIGA 4WLUA 3OHMA 4ZQIA 1GY8A 4WNYA 4MWEA 3GH3A 3DLTA 3M9XA 4MEBA 5AHXA 3PX2A 3T3HA 2BEUA 3VBCA 3WY9A 3KJEA 3GNLA 4QJ3A 5KOIA 3BGOS 2NVBA 1KZ4A 1CDEA 1W1IA 1ZJYA 2P1ZA 2AXQA 2FW1A 2Q3HA 4JKOA 4Q1BA 2PT9A 5F4BA 5I9MA 4JI1B 3WNQA 2R86A 1Y5LA 1SCJA 3GGGA 1JB9A 4FI3C 4J9VA 2B9EA 3DAHA 4F9EA 1KYQA 3PXXA 1GCUA 2I3AA 5KS2A 1EWYA 2JGKA 1U65A 3PPYA 4NOLA 2WYOA 2E89A 3B1FA 3CZ5A 4JP8A 4RL6A 4ZVVA 3FTNA 2EFDB 2O8FA 1I7NA 3TQCA 2NYVA 4OXYA 1HY3A 1K7CA 2GDZA 1U8CB 3H7IA 2FTKE 1NFFA 3OZAA 5ITZB 1MT0A 1KK0A 2Z30A 4WK0B 3L41A 3LXRA 3SEAA 2P11A 4BBPA 5F9HA 3S2SA 1E9AA 5HNKA 1K75A 3U7HB 1WP4A 1Y34E 4FONA 4QUDA 2JEYA 3J80D 1K63A 4GXNA 5DYGA 3MERA 1RXVA 3LM8A 2WU1A 2XDQB 1XYGA 2VJBA 3GT0A 2Y0CA 3LQQA 2HYIC 1IHOA 1Z2EA 3PXAA 2Y8EA 4B3TC 5HF9A 1P91A 1T2FA 1KYTA 1XDGA 1Z0ZA 2P1RA 4Y2UA 3BAZA 2AD5A 1S5PA 1BE8A 1GQFA 2QLMA 3H3JA 3I09A 3OQIB 5CRIA 5F1KA 5YASA 5DI9A 2F00A 4KXFB 1ZCFA 4OF4A 2G06A 2DXIA 3A6DA 4U7FA 2QVLA 3AHGA 2D1YA 3EVTA 3C3YA 3PXEA 4IF4A 4F38A 3AVYA 1KRXA 3VR6A 1DJNA 3P20A 2OFOA 2Z6VA 4LJLA 4TL9A 4A6PA 4E3WA 4I4LA 3RFTA 4XTRA 2P68A 2V6BA 1Q1EA 2WFZA 2WYVA 3O26A 1LDMA 3G8DA 5G40A 3P9SA 1QO0D 1JWAB 1Z6AA 2HIMA 4MROA 4W5RA 5TR9A 2W4QA 3C7CB 1TC1A 4HVTA 1A5BB 1NVXQ 1CW2B 3QVWA 4A8JA 4D9BA 2Z6UA 4X64C 1P81A 1XNHA 4BQFA 1A5ZA 1PX0A 4QJ4A 3QUSA 4HWTA 4WLVA 4JUFA 2WINI 4AYXA 4X3OA 3OZ7A 1THGA 1KQOA 2P4UA 2B8NA 4K9OA 4AMVA 2AN9A 2GI4A 3C6XA 4Z4GA 3DE2X 3T5BA 2A4KA 3MXOA 3CF6R 3ZGYA 1SCNE 2GPYA 4FBMA 4FTWA 4NK5A 4DLZA 6NULA 2FLKA 1C8VB 5U4QA 1Y1PA 3O4JA 1RC0A 1KZ1A 5EUMA 4E13A 5BUCA 1U8ZA 4MQEA 5IJ0A 1Z6ZA 5D51S 4R31A 2GN8A 1E1RA 3R3VA 3DDUA 5FTMA 4HTFB 2M32A 3NNSA 5GADl 1EGHA 4HX5A 1KHHA 1EVEA 3ZCQA 1PK8A 5CAEA 5IPFA 4CTJA 4UPEA 1WHTB 3LRPA 4C1BA 1S3IA 3HPQA 4B6JA 2Q0HA 1DI0A 4M0UA 5CLQA 3TR6A 2O8FB 2JLBA 1XE3A 3DC7A 3PHJA 2W6JD 3P0EA 5EQFA 5LQCA 4ND5A 2I76A 2RHOA 4TKVA 1X80A 3AF6A 1DV1A 1KORA 3CNEA 1V1MB 4J9UE 2XHEA 2YVAA 1RS0A 4DDKA 4JYAB 1RI5A 1TJ5A 2XSZA 1RKXA 2R1VA 2ZYUX 3C24A 4N5NA 4TMVA 2VK1A 4TYPA 4YVFA 3WK6A 3EVCA 1GILA 5ALLA 2YJNA 2ZJAA 3K32A 1GG9A 1FUGA 1MJNA 1MX1A 3QZUA 4QO7A 4B3HA 5AFSA 3HVIA 1I1NA 1J1UA 5DSZA 2VH5R 1ODJA 3OT5A 1Y3BE 5FP0A 4NH0A 4YLEA 1MNAA 3KE8A 4R2WA 1P7YA 3IB3A 4FOOA 1KMNA 1ZMTA 1JE0A 1E1YA 4IDNA 3ETJA 4DIBA 4F7WA 3TGPA 4Q7QA 1MENA 1K5PA 4RHXA 4WNAA 5HVNA 5HIJA 3EZNA 3LHKA 1YH3A 3DMYA 5JQGA 4OI4A 3INYA 1JT9A 5TMDA 3KSRA 4NZPA 2XUZA 4UE3S 5EJFA 1WZEA 2VUTA 1NZFA 1XEWY 3RS0A 4CM9A 3VJMA 4ZYLA 4KQCA 4TWAA 4PZEA 3BD8A 4PNEA 5JSFA 4FHCA 3IL2A 5E9JA 2DTEA 3DPIA 4EGSA 1JV2B 4DCUA 1UOPA 5D7BA 1PS8A 5BSFA 4FYWA 3H5TA 3IVXA 3KS9A 4X60A 4D3DA 2BUCA 1RABA 4ESEA 1B6TA 4OBXA 1MEOA 2YC2C 3PGKA 2FSIA 4ALLA 5AH0A 2GM9A 3UJNA 3MT8A 4WZAE 1H6CA 3RSOA 5IHXA 5C80A 1D9ZA 1XDSA 2IZ0A 4K3VA 3CO5A 4QT0A 5TQ0B 3VOAA 3EPJA 4G5GA 4KV7A 4M0PA 2YFKA 2I3GA 1U81A 4B83A 3RYCA 3D1LA 2ZBUA 1U7XA 3I53A 3W2GA 1E1RD 3CT4A 4KWTA 1E2MA 5K6TA 5I7UA 5FTWA 3LGXA 2YNMD 2YDXA 3Q85A 3L1IA 4AG6A 3DXZA 2OD7A 5JAPA 4P6VF 3L46A 5JSQA 1KQFA 3QEKA 1HR0B 1Y48E 3MIZA 3LQKA 1K08A 2YN4A 1QO0A 3KJNA 2NNWB 2H5EA 4HGQA 4JQZA 4U7WA 4ZCQA 3SMQA 2ORYA 1JKJA 1N4DA 3C5CA 1P8AA 3LZCA 2CE7A 3DNPA 3KKMA 4M36A 3WWOA 4F5YA 2O50A 2BTQA 3WAKA 3TIFA 1JTEA 1SBHA 2FWJA 3A36A 3NS7A 4WLNA 5HUQA 3AHJA 3M6UA 4JI8B 2CV2A 8MHTA 1AX9A 5D2CA 3ZHSA 2OHIA 5C8VA 1GHTA 4JKYA 2CBZA 3U4IA 1BVYF 2BUBA 3LDGA 4TPKA 4MDFA 3AUTA 2IODA 2WWHA 1MRZA 1TAQA 1EFCA 4IFBA 4IHJA 2OSVA 3HGQA 3MMZA 2XBMA 3QLUC 4F85A 1XTJA 1DCTA 1PN3A 3M5PA 1M0SA 1B2RA 1OU0A 2ZUFA 1V8DA 3RTGA 3B3GA 4MS1A 2XCSB 5LQAA 3GP8A 2F7SA 4CG1A 1K9SA 1Q7EA 3MJSA 1D5CA 5DBGA 2ZE7A 2OEPA 3HEBA 3PVCA 2JCSA 3ANNA 5DDIP 4ENRA 1EHCA 1OX6A 2QM7A 3BCRA 4BMXA 2XMSA 2OCPA 5BOSA 1J25A 4CIXA 4ETIA 3D43A 5CM2Z 2CFCA 5JJCA 4R68A 4JXXA 4KO1S 1EK1A 2E21A 1NW7A 2DBVO 2JCGA 3R5KA 3ZU3A 2C94A 3MCAA 4AZSA 3BCSA 3BSFA 4RU1A 2WT4A 2EWWA 2FDCA 4GX1A 4HXYA 5IKXA 1JJVA 3AM5A 5LA6F 1WA5A 1XJ5A 1RQGA 5LPNA 4QDOA 5JJBA 2QVYX 4XIJA 2CEAA 5AJTA 1QIKA 2GJKA 3HUDA 3DR5A 3MD0A 4GSYA 3VUFA 1HFWA 4BZWA 4R9VA 4DV0B 2YWFA 1GNVA 3A2MA 3QKIA 5HCIA 4LRQA 2ZITA 1QP8A 1D5WA 4BO6A 3M6IA 3MJ4A 4LX0A 4Q02A 1O90A 1JXQA 3AVUA 1NJ5A 1EA7A 4QDTA 4XOIA 1HPLA 2AW3A 1QK5A 3K0CA 5EC8A 4FP9A 1NJ8A 1LWOA 3FVQA 1YMUA 3QG1A 1TLLA 4H27A 3IOBA 4MVJE 2KB0A 4WFIA 1XNQC 2ODNA 2R6R1 2QSZA 3EFEA 3E1GA 3GAAA 1QNLA 3ZHRA 4I1IA 4PCLA 4TLLB 3KQSA 4Z5XA 3HCCA 1XQWA 1XTIA 3EGIA 3ETNA 4B3BA 4AD8A 3UJCA 2O2HA 1E1QA 3AC0A 3GUCA 1GZSA 2PNFA 3ZWWA 1MA0A 4GP6A 2XBLA 3TM5A 4Q3LA 3DT6A 3D4LA 3CEPB 4D43A 4PZCA 4J3JA 4NK4A 4X3CA 5H3LA 3D0QA 1I7LA 1I2BA 1VOTA 2HJSA 2Z6AA 1W4ZA 3KKKA 4K1XA 4MO9A 4G1CA 2D0PB 4LAFA 1G8JA 1HV8A 3O4IA 3TGLA 1A2QA 1GA4A 5HKBA 1S6YA 3FUTA 1TM2A 1SXGA 5BWCA 2G28A 1F8YA 1IZ8A 1HT0A 1JVBA 1SG6A 2FK8A 3F8SA 3F1LA 3GH1A 4B73A 4EGFA 3ESQA 4RY2A 1M3SA 1TKAA 2JIMA 2ZRHA 3L40A 1KJZA 4NOMA 1U1EA 4UU7A 5CMLA 5H83A 1PUJA 4A0FA 1W2WB 1WCXA 3DGEC 3NEPX 1GL7A 3CVUA 1E2QA 2WHXA 1NVGA 1VJ5A 2E4ZA 2V9PA 1G42A 1GNLA 3N28A 3I6IA 4LJ8A 1U2DC 3AP2A 3IC5A 4W99A 2AWOA 4P7GA 3T4XA 2CLOB 1P4HA 2C5FA 1RJDA 2HX1A 4WTOA 4LF5C 4O1MA 1JIKA 4DR2B 3ZK9A 3RIYA 2BGKA 3GNTA 1YQXA 1H2RS 3KNZA 2JD2A 4BRZA 4XYMA 3K2QA 3QYAA 3RJZA 1JT2A 4NBKA 1P7LA 4S1VA 1G8FA 5DPMA 1T5DX 4US1R 4C0BA 4HVCA 1DP4A 1TA9A 1XD9A 1A4RA 1R6DA 4RKYA 1QIGA 2C77A 4XGRA 3DTYA 4YRQA 3QWAA 5I47A 5K4GA 1WH9A 2P2BA 5COQA 4J2OA 4KLAA 5P21A 3WRXA 2AFHB 2PMFA 3NBYC 4HNQA 4IIJB 5F35A 4ZU3A 1EGVB 2H29A 5F9MA 3I23A 5ALHA 1XZMA 2CNOA 2CL6X 3S1LA 3SWWA 1UJMA 2AI2A 1EFPA 2FF5A 3ADOA 4L73A 3UJ7A 1AUOA 4HAVA 3X44A 3Q3HA 5IEJA 2HWUA 2FFQA 1NLUA 2PGNA 5LA6B 2YWRA 4HAXA 5IM4A 1VL0A 4Z53A 1EBUA 5IVKA 3EUEA 2W2KA 2XF8A 1TU4A 2WZQA 1CR0A 3EY9A 2E55A 1L7DA 3RUHA 1QOQB 4X8MA 1VGVA 3C0KA 2C9BA 2A33A 2HU2A 4XDGA 3G0CA 2Y1XA 3TLKA 3Q7RA 3QF7A 1A76A 4AB1A 3RSGA 2WV7A 3RIMA 1P0MA 1CRZA 5HOEA 3WRXC 1T9ZA 2GUGA 1NOJA 4H0CA 5FNVB 3KQOA 5BSUA 2DECA 3PE6A 1O97C 1XZQA 2Y0BA 4C05A 3SKVA 3TE7A 1VPLA 2FVXA 3RNLA 4RUKA 4BMYA 1VRCA 2PLFA 4X61A 1NONA 3PDIA 4UBJA 1PBNA 4DQ0A 4ZIRB 1IBSA 4GM1A 2MR5A 4DE5A 1CULC 1NW4A 1KC3A 2DU8A 4NXMC 3PLRA 4OHXA 4ZVKA 4LJ6A 4LE0A 5E6UA 4M1QA 4Y9SA 4DWVA 1KBQA 4WBSA 3FWKA 5EE9A 3VXKA 1Z0KA 1Q7BA 5EEHA 4NHOA 1WPXA 3E9RA 3L7DA 1ZMRA 2AI1A 3HGTA 3STVA 3UC9A 1HEUA 1DUSA 1JEQB 1BTOA 5WRFA 3AI3A 3H9CA 4REQA 3IXQA 1S01A 1UDBA 1Z4MA 2GYUA 3TVDA 2J3KA 1WEHA 5A1GA 5CT6A 5FADA 4H08A 2IUTA 5L9AA 3OQOA 1SVLA 4P80A 1R0RE 1E64A 2JK0A 3PP8A 3EE6A 4RCYA 3RC3A 4CT5A 1AVTA 2WMDA 5KKCA 2P02A 3ZD8A 4NZOA 3S44A 5KU1A 2V3CC 5AHWA 1YWGO 3QHPA 3GHYA 3D2AA 5JWRA 3C5EA 2LPMA 4DVGA 3G68A 4BATA 4R1OA 1SOMA 1R4ZA 2HIHA 2VWGA 3CF4A 3PEFA 3KXDA 4DF3A 5CFPA 5JVDF 4BXOA 3KTOA 4BAUA 2F1HA 3SOZA 3SE0A 4XH9B 1CZUA 3UNXA 4OOEA 2AYXA 2RIPA 3BHIA 3V4PB 3EVZA 4CLDA 4TQAA 4MI1A 1K2WA 3UMVA 1UWCA 2W2NA 3VR1A 1ULZA 1QDEA 4WKCA 3AYXB 3T9AA 1J1ZA 1EE1A 3WYFA 4E4RA 3OA0A 2GXAA 2EAUA 4CM7A 1DIAA 2AH5A 4LX8A 5ICEA 1ZITA 2CNWA 4X93A 2WAYA 3MVEA 1U5CA 4FKBA 3SLRA 3QVJA 2Z6QA 3OTOB 1IQUA 5LLTA 2LBPA 3HJTA 3KOZA 3O2JA 1YACA 4JEUA 4JC8A 4Q00A 4YT2A 5AW8A 3N2IA 4O2BA 5CDYA 2UUBB 4D0SA 1K4MA 2D7CA 3RG2A 2R8ZA 4MO2A 4X85A 4V0QA 1TKRA 1QYCA 1AH2A 2DSNA 4K3UA 4JI2C 1Z6TA 4INPA 4PBSA 1RACA 3CUWA 4ECAA 3OA2A 4NBWA 3VOBA 2GKGA 3IH5A 4ZV7A 1Y0BA 4IIDA 2ZANA 5AVUA 2EJUA 1HYEA 4OQYA 2UV8A 1N0UA 1D2HA 5FL7D 3UCXA 1W5EA 4UFPA 1JIUA 3AI2A 3BFJA 2HM7A 1DAGA 4LF7B 3IUPA 1FRZA 1OREA 3HFRA 1WF6A 1E2DA 3CRNA 4C29A 5IXSA 1MQSA 2QYTA 4B46A 4MR9A 4POAA 4CT0A 5IAGA 2FGKA 1RP7A 5A0TA 3O3NB 3P4XA 3VFDA 3ZD7A 4F5WA 4I66A 4MUXA 4MVJP 3CCCA 5DGCA 2J9YB 2XE7A 3NYRA 5DHPA 4O4JA 5ENDA 1WV1A 5DN6D 3WL4A 3U4QA 1C3VA 2UAGA 3HCPA 2VYVD 4J6EA 2PPVA 1I8TA 3F0TA 4UHJA 4V02A 4PCVA 1UKKA 1AGYA 4LC1A 4BQQA 1C2YA 2XB9A 3PRKE 3A11A 2Z3WA 3AM4A 3SD7A 3VDXA 1RI4A 4JT4A 4DCJA 3OM8A 5E3IA 2EFGA 5GINE 3G0IA 2SHKA 4URZR 4OU4A 5KSOA 1OLUB 3I04A 1CLUA 2NUBA 1D6JA 4MUBA 3CBQA 3TQQA 4DV1B 3EZYA 4G8CA 4UNSA 3WOHA 1ZWLA 1BCSB 1NAIA 1PI3A 1Z7YA 2ZJ4A 4ZVPA 3K05A 2G9ZA 5F7XA 5K8LA 4XVHA 4B6PA 2H65A 1CIPA 1HI9A 2HHHC 3LXMA 1KO8A 2WJPA 2GBPA 3AEKA 3L8ZA 1E6WA 1EK5A 2Z2JA 1AQJA 4WESA 2CF5A 5CJPA 1QH9A 1ACLA 5ALDA 4J1QA 2C82A 5LXTF 3WR5A 1J8MF 5LQJA 3GPLA 3PUJA 1CCWA 2PL5A 2Q6VA 2IELA 3H5WA 3D3QA 1DFIA 2BW0A 3I2JA 3GVIA 5DHAA 3R7FA 1ZISA 4XA8A 2XQIA 4QZVA 5DNVA 5IDQA 3PWSA 1KZ9A 4MPJA 4ARAA 1EB8A 1K8RA 5DTRA 3Q3GE 4BWFB 4CLHA 5FR1A 5IXYA 2XZLA 5BRAA 2HBQA 2OO5A 2QD4A 3BN3A 3D2LA 4JBWA 4ZQEA 3LDAA 2XRMA 4IGAA 4YQYA 3IVAA 3BTVA 3VSCA 1O7JA 3EVGA 3BKWA 1I5OA 2DBZA 4GMKA 5EG5A 4G1FA 1SOAA 1UKVY 2A0XA 1P4AA 4HPXB 3PNMA 4OUDA 1YV9A 4NMMA 5KNBH 1QCCA 1SUCA 4DY6A 1P5FA 1QPZA 1T5TA 1L5VA 3FPJA 4GDMA 2NXNA 4FDVA 4OGKA 5TY0A 3TIGA 4IJ5A 2OG1A 4URFA 5KWVA 1AN0A 5LKRA 2ZE8A 4HZUB 4XM2A 3NHFA 2QMUA 1L8OA 1JSZA 4LNUB 4YRRA 5TQ2A 3VMFA 4C4SA 2V7XA 2VUSA 3PFKA 4GOJA 5FFMA 3ACBA 1WMAA 2Z2ZA 3R5JA 1OF1A 1DZIA 1XMQC 3N3AC 3TW8A 2ZCVA 3S29A 4TV8B 3TZLA 2K87A 2OHXA 3PTZA 2Z3ZA 4X65C 5BURA 1L9KA 1VJTA 2BR5A 2B3TA 3LRTA 4G07A 4L0MA 1Q16A 2WSYB 4V0OA 5KVAA 1A27A 4MZXA 4TKMA 4DBZA 3Q8KA 4PYRA 2A6PA 5ALWA 4S1WA 4YAUA 3HR4A 3W5AA 1T13A 3B5EA 3AUAA 5IT4A 3BWYA 1Z3CA 1YS1X 2PL1A 1NMSA 5CB4A 1G8GA 2G4VA 2HBRA 2UVDA 4HB0A 1FOEB 2OFFA 3WB9A 1H3FA 3GPBA 1X80B 3QXGA 5IDVA 1CY0A 4DUGD 3JWIA 3N1UA 4FKZA 1LQUA 1W8IA 1ADBA 2NO1A 3N8GA 1AD2A 4LY3A 3UG7A 4KQKA 3GLIB 4LRXA 3U7IA 1O6BA 4W5QA 1L1RA 3ZY4A 4WGFA 2EHJA 3MJVA 4JHXA 2HF9A 3GQBA 4BXOB 2FKNA 1X1SA 1ONNA 2YMMA 2Q8PA 4ZCTA 1G20B 3N87A 2FGJA 3LUGA 2GAAA 4TSKA 2V54A 3I30X 4HBZA 2XNDA 4TUYF 3N53A 3I0MA 3O8QA 4C7VA 1L7BA 3SDSA 1JIJA 4YQFA 4TXNA 4O29A 3Q3VA 1TCVA 2VPTA 4D2IA 5MF6A 2DMRA 4X6LA 2FQ1A 2R4TA 2Z56A 5A71A 4EEXA 3JAWB 2VA8A 3IE1A 1ZK2A 2VAMA 3MIIA 3FTQA 5CA0A 2X0DA 2DTXA 4H7DA 3NTUA 4UUOA 2NTEA 2I4TA 3OQ1A 3FSRA 2IDZA 5E1BA 5FWAA 5MN4A 3OTHA 2LP4Y 5EPOA 2FJUA 4Z1MA 1E7YA 2F3PA 4K2HA 1RD4A 1R5NA 2A67A 4Y7CA 3ZHOA 4E2FA 3UA4A 3IQXA 4OQLA 4Q3EA 4X3PA 2GN9A 1UMCB 4HDKB 4A73A 3PNYA 4MGEA 2GM4A 4QU0A 3FDFA 1YHNA 3PXUA 3Q12A 1ZAYA 4ENPA 1XVUA 3DBLB 3BL8A 1NUSA 5D84A 4B4KA 5C5EA 4HH0A 1J56A 3A6HA 5K9ZA 1R5OA 3P2KA 3T0GA 1K8YB 2WUWE 3DMTC 4WECA 5ALIA 4DWOA 2P9TA 2HWXA 2EEZA 4GPZA 1H22A 1GNSA 2QY9A 2OL4A 2ZP1A 3AETB 5AW7A 3B9QA 1H2XA 4N6GA 3ORFA 4TWRA 4PX5A 1Q3HA 4FZ5A 1XAJA 2ABWA 5G4KB 2FSVA 4P82A 2FZKA 1B14A 5TS3A 1WXIA 2D00A 2GEJA 3SU8A 2VNIA 4D80A 2WOOA 3LG2A 3LHFA 1RYHA 4HDOB 1C9MA 3L79A 5KUTA 4ZO7A 4DSNA 4PZPA 3PWZA 1ZU4A 2OLJA 4MW0A 3I6MA 3OFKA 4KGZA 1Z4NA 4RPKA 1WSWA 4AZWA 4HC4A 3DE1X 3F5QA 1RCFA 1II9A 3CJEA 2PK3A 5EJ6A 2HRZA 1ISSA 2JATA 3AF0A 3WQHA 2PGLA 1U28C 2NYAA 5I7WA 1FYFA 4D6YA 5LMUC 1XRQA 3CWQA 1Q0LA 1AY0A 4EG3A 1VBFA 4IDFA 8GPBA 4KG7A 3S2IA 2QX4A 3FKQA 4EJ0A 5I7RA 4DY4A 4R51A 4AZVA 1MW9X 3HA2A 3KPJA 2C1XA 4JVMA 4D8WA 1BEZA 3R8FA 3LSTA 3LO5A 3K5HA 1A9QA 3TBKA 1IHDA 5F5NA 4RIFA 3LCJA 3RJMA 4MV3A 1M2EA 4O8CA 4XGNA 3A6EA 3QNWA 3RUDA 4EFDA 1UADA 4OA5A 3W9UA 4IY1A 1YK0A 3KRTA 5K8TA 3EXHA 2X7HA 4MWTA 5K85A 3TXAA 5AKKA 4IH4A 5IAKA 5HRCA 4AJJA 2BKXA 2FZEA 5I48A 2HK9A 2P2CA 1LBIA 3E81A 4GPIB 4HDKA 4TLDA 3RB8A 3U0VA 4D45A 1COWD 2I6XA 5A4IS 1I33A 2PG3A 3JARB 1MJ5A 2ID7A 4V03A 4M37A 3PR3A 4PRKA 1WPRA 3WG9A 4NCIA 3EXIB 4QUEA 1NMXA 5DN9A 5KBYA 5IABA 3DMFA 1E7RA 4GP7A 2WQZA 3ESBA 2OD9A 3HFSA 3MMPA 1LK7A 5C53B 1MOPA 1C4XA 3IHLA 2YBDA 3DXXA 1IN4A 1HA3A 2PH1A 5C5DA 2GYYA 4QOIA 2A8YA 2IYNA 3JYLA 1WU8A 4XQEA 3AINA 1IAVA 1Z17A 1QR6A 4NBLA 3OIGA 1FTGA 1W9HA 4ZJYA 4KUEA 1ORTA 1PG0A 1X7ZB 3KYCA 1WXWA 3P94A 4W1PA 1PNQA 2JIQA 2ECKA 3AL3A 4BHTA 2IBTA 3AUKA 1U9ZA 3MTIA 3RBVA 4GLOA 3EIQA 2HRCA 5ALFA 3GQBB 1S2IA 5JXJA 3C3PA 2C2BA 4CT4B 2Z2IA 2ZWMA 1ZD2P 1XTQA 4YP1A 4TZ0A 1E89A 4M7RA 4KQJA 4DCTA 2RBKA 3I04M 4MIEA 4OMFG 1HX7A 3O2NA 4I9UA 4AF8A 2ZS8A 4K03A 1OC2A 3OOYA 1TX4B 2ZGVA 3IUSA 1E9RA 4RSHA 4Y1EA 2A5DA 4ZOQI 4BECA 2GK7A 3GUZA 5FL3A 5IYZA 1HETA 4KSCA 4DHEA 4BCAA 3M1LA 1HDYA 1C4WA 3D2BA 1XWFA 2WD9A 2JS7A 5J2UA 3KWJA 2J6CA 3KQMA 5DYYA 3VTZA 1KH3A 1RKUA 3KKEA 4IVRA 3JQBC 4AAYA 3UW3A 2BSXA 3LIIA 2PMDA 1I5RA 2FWIA 4X7PA 3DHYA 1J2YA 4ZAXA 1EUYA 1BRMA 3BD7A 1FLNA 2QD2A 4HYTA 3TIIA 1O6GA 3OMWA 1ILWA 1H3NA 1QK4A 3OIUA 4F06A 1TTTA 3UHOA 2BYTA 1G38A 3IMCA 1R7RA 1CUGA 2AT1A 4OFWA 3ZCUA 2IUFA 2UUPA 3S2YA 3MWJA 1PSWA 1ZSNA 2VF5X 2YOHA 3BSYA 3G2LA 4K6GA 1O5TA 3G5MA 4PICA 2VJCA 2PGOA 4F60A 2CT8A 3TEFA 2QRPA 1XU4A 4NMWA 5AKGA 5LZ2A 3UMYA 1H93A 2CSUA 3I4LA 4RVHA 1SU8A 4PE5B 2G9UA 1M8FA 1WL8A 4I0WB 2ZJOA 5FBLB 2BBSA 4C5AA 3IGFA 5BSTA 1YR3A 4UVIA 1VMDA 1CY4A 1JLLA 2NTYC 4RESA 4BNNA 1TF5A 1XALA 2I6QA 5HJ7A 1FP6A 2QD5A 3TRHA 4HEA1 3JAMD 1AQYA 4AMZA 3CCBA 2ONFA 3DEHA 4E32A 4BTEA 3HV0A 4JMPA 2AXPA 1UC4B 4NFLA 3VYRB 3T5MA 4F3YA 4F1WA 3T5CA 5IH7A 2OCLA 2FCAA 2NUTA 3TLEA 1LPNA 2JI7A 4CMHA 4QU9A 4YROA 1UEIA 4KAXA 1GUAA 3H16A 3VJRA 2HHAA 3WLIA 1Y1QA 4JZYA 3VVCA 3TPFA 1L5WA 3K20A 2AJTA 1DKPA 3KXIA 4YB8A 5F4ZA 1RWOA 5IANA 1PGQA 1QRTA 3EIEA 4MQBA 3OQVA 1KMHA 2B35A 2XCOA 3IT2A 1T9CA 3MJEA 3RSLA 3A27A 4CQMA 1F1JA 4S0ZA 1DZ3A 5DHQA 4IZHA 3ZU6A 4Q6WA 1A7KA 2GQ0A 1WJGA 4ZCSA 5A3VA 4C0HA 4PLWA 2CNLA 2ZB2A 1DJPA 2EL9A 2X2OA 3PJDA 4GZMA 4D56A 3CUEF 1MOQA 4DN6A