4GXRA

Structure of atp bound rpmatb-bxbclm chimera b3
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
502
structure length
475
Chain Sequence
MNANLFARLFDLDDPHLAIETAAGDISYAELVARAGRVANVLVARGLQVGDRVAAQTESVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPIVVCDPSRDGIAAIAAVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSGTTGRSGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPFDPDILDLMARATVLMGVPTFYTRLLQSPRLTETTGHMRLFISGSAPLLADTHREWSATGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGELPRGDIGMIEVGPNVFGYWRMPETSEFRDDGFFITGDLGIDERGYVHILGRGDLVITGGFNVYPEIESEIDAMPGVVESAVIGVPHADFGEGVTAFVVLREFAPSEAQVLHGLDGQLAFMPVIFVDDLPRNTMGAVQNVLRETYDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malonyl CoA synthetase, Benzoate-CoA ligase Chimeric protein
publication title Structural Insights into the Substrate Specificity of the Rhodopseudomonas palustris Protein Acetyltransferase RpPat: IDENTIFICATION OF A LOOP CRITICAL FOR RECOGNITION BY RpPat.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Ligase
total genus 142
structure length 475
sequence length 502
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gxrA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gxrA01
4GR4A 2P2JA 4LGCA 2VSQA 4RLQA 4RVNA 3G7SA 4DG9A 3IVRA 3WVNA 5BSVA 3VNSA 5D6NA 3A9VA 2D1QA 2QVYX 3LAXA 4GR5A 5K8FA 3ITEA 5GTDA 4D4GA 1MDBA 3B7WA 2P20A 4G36A 4R0MA 1V26A 3O83A 2Y27A 4G37A 5BSRA 5DV9A 1YJ7A 4RVOA 3U17A 3DHVA 1T5DX 4GXRA 3LNVA 5JRHA 5DWVA 4D56A 3R44A 3RIXA 3WV4A 1PG3A 2P2BA 4ZJZA 4GXQA 3E53A 3NYRA 4DG8A 1BA3A 2P2MA 3NI2A 5BSUA 3O82A 2VZEA 3E7XA 3VNRA 2Y4NA 4ISBA 4RM2A 3C5EA 4FUQA 3WV5A 1T5HX 5BURA 4D4HA 2P2QA 2WD9A 3DAYA 4U5YD 5K85A 5KEIA 3LGXA 3GPCA 1PG4A 4R1LA 4D57A 3L8CA 3IESA 3VNQA 4IZ6A 3U16A 4IR7A 4GS5A 4RM3A 3ETCA 3IPLA 2D1TA 4OYCA 1MD9A 4OXIA 3IEPA 3T5BA 3RG2A 4RMNA 5E7QA 1LCIA 3QYAA 3FCEA 4R1MA 4EATA 3IERA 3KXWA 4D4IA 3FCCA 5KYTA 2Y4OA 1ULTA 3T5CA 3DLPX 5KYVA 3E7WA 4FUTA 3TSYA 3EQ6A 3T5AA 1AMUA 1MDFA 2D1RA 3PBKA 5IFIA 5BSTA 2QVXX 4W8OA 5BSWA 2QVZX 2V7BA 4WV3A 3A9UA 5BSMA 5BUSA 3NYQA 3O84A 4PZPA 1RY2A 5BUQA 4E5DA 3CW9A 3CW8X 4M46A 2D1SA 2QW0X 1V25A 4RLFA 2P2FA
chains in the Genus database with same CATH superfamily
1VYUA 2GX6A 1UT8A 3Q15C 3BBLA 5MN6A 3DC7A 4YQEA 2E87A 2GM4A 3B3FA 1C2TA 1FFWA 3EHDA 4TRNA 5ALGA 5E1OA 3J81k 2IZ1A 1Z6TA 2C7RA 3RVBA 5JOQA 1NKTA 5IMBA 2A9JA 2HRDA 3CPEA 1YCFA 4RKEA 3LTEA 3I5MA 3IAEA 2VNHA 3EPPA 4RPCA 3L7MA 3IAM6 4BX0A 3NIDB 5M7EA 4I0WB 3CMMA 4RV4A 3ST7A 5T8SA 3JYOA 4IIXA 2OKCA 1HZZA 1VCMA 2QM8A 3EC7A 4RD0A 1XALA 3IBYA 5AI9A 2PZKA 5AOAA 1CEEA 1ORRA 3PROC 1VCOA 1YR7A 2Q46A 1IHYA 4FFVA 5AW6A 1GKUB 5E1MA 5BMVA 1B16A 4GRIA 3TLCA 3PKJA 2V4UA 5LYYA 3NGMA 2FWJA 2BWJA 4G1BA 4XWOA 4YMUA 1OI7A 3KYIB 4UXIA 1ZBQA 3DFMA 1B2RA 1TC2A 1T5LA 2P78A 4GZ6A 2I66A 1BS2A 3EPRA 3V7YA 4XA8A 3V97A 1ODSA 4JJ8A 4R6WA 4DNQA 2LWIA 3IT3A 2BEVA 4RY2A 2H9IA 3O8CA 3I01M 4P86A 1OKKD 4E4TA 3HXLA 5HK9A 2CJXA 4LF6B 4P3NA 2OTCA 3GCDA 2ANCA 4A73A 4F9EA 3RRBA 2QE6A 4PC2A 1DRKA 4QDKA 4BNWA 4ND2A 3REQA 5G1NA 1LV7A 4K3UA 3E1SA 4LYEA 3E1GA 5JTTA 1Z33A 2WKWA 4S05A 1NF8A 4JYAB 1NJ6A 4DMLA 2WSSD 3PT9A 1ELOA 1TJ4A 2WTXA 4JC8A 1MJGM 4R4JA 1A72A 4HQKA 5THQA 3HUFA 3GELA 5IHPA 1FYXA 2X86A 3Q2OA 1LY1A 1TCAA 2XVMA 1MX9A 4BKQA 3QVUA 5GV7A 2CK3A 3VXKA 5DGHA 1YS9A 4Q1CA 1N6IA 3ILSA 3QNMA 4Q7LA 4ZQHA 1MFPA 2B7CA 1Y42X 2LZ0A 4FCWA 2W2QA 4YQZA 3HA7A 4AZ0A 2O20A 4KSYA 1ARZA 4DS3A 1E1CA 3OX4A 3RU9A 2A3RA 1DAFA 4J7CA 4E88A 2IH4A 3MM4A 4Y7CA 4Y9SA 1LBEA 2VHVA 2QLMA 2ZQYA 3NOQA 3PC8A 4QQKA 3UAXA 4RHXA 5K09A 1RG9A 1WMEA 3H2YA 2G25A 1EYZA 4ZOBA 3BGIA 1F2DA 2NYAA 3EBPA 4BZQA 3M1YA 5E3JA 3JVUA 2ZUBA 3PBKA 2IHBA 4N9QA 3E2IA 3NTVA 3IIEA 4YNBA 1Z4JA 2CLLB 3T35A 3GQBA 4ZMBA 1ODKA 4S12A 3JVEA 1V5IA 1DXOA 1XRSB 3RK0A 4ZI7A 5EMJA 1JBEA 4BE7B 5KVAA 4XPZA 3JSXA 2W71A 3T3PB 2MYNA 4CG3A 5LD2B 1T6NA 5B58T 3T1HC 1FNBA 2WWRA 5BNWA 3VNBA 3P4YA 2HIGA 2I7CA 2UUAB 1R6BX 2QVBA 2CXXA 5LMZA 3H42B 1A96A 2FZKA 5HZKA 1SQ5A 2TMYA 2Q8NA 2QMOA 2WJAA 4M46A 1QYDA 3O8QA 5HKKD 4BRUA 1V25A 1E5XA 1YXMA 2I1LA 3QKSA 4B9EA 4R41A 1A95A 2VHZA 2YW2A 1J24A 1KKMA 1NPDA 3LSYA 4RENA 1VHDA 1K75A 1OPXA 2LBPA 1Q3HA 4JT9A 1E1LA 3HEBA 3S8EA 3FTDA 3ND8A 3LQYA 3WWYA 2C7QA 4Q03A 2FQ1A 3ZVKA 3UAWA 4FOOA 1HFWA 1P4JA 2FMFA 1E9VA 3I3OA 1OBOA 3FR7A 2RAUA 3V7NA 1LQUA 1Y8AA 3JQ9C 1PBTA 4FE4A 3KCQA 1N32B 4EHJA 4OLBA 4YALA 5JG7A 1YAJA 1R8SA 5EUMA 2CCGA 2GRJA 2WC1A 4BLPA 2PRZA 3NC1C 3Q87B 2JA2A 4G0QA 4RTOA 3LWNA 4G37A 2GJ4A 4RXTA 4YJGA 1LH0A 1FU7A 4J8PA 5E8JA 2XECA 3RV4A 3VDRA 4AUEA 4BDTA 1M6NA 3DMFA 1CLEA 1YB7A 2BGLA 2X9VA 3UUGA 3G82C 3UBMA 3KR2A 2YY6A 1OIXA 1QUEA 2QPOA 4RJIA 4XVQA 3QMPA 2C84A 1U9JA 4ED9A 4Y0NA 1OTYA 2VJMA 3BWCA 2HD4A 3JZAA 4R1QA 1GPDG 3DQZA 2OHXA 2J3MA 3OCUA 2G6BA 1GD1O 4G01B 2NZ8A 1FTWA 4YWJA 1T9AA 2ASVA 3BWVA 2BDEA 1WPQA 4V2UA 3PRKE 3PHLA 1XDSA 5EE0A 4ZVUA 4DPLA 4DRXA 3VZPA 1ORWA 1SM4A 1CJBA 4ISBA 2LP4Y 3JQGA 3IA7A 1GUDA 2PXXA 4G0NA 4KX5A 4Q3OA 4ZO6A 3TW0A 4EW1A 2Y68A 1BOOA 4MW6A 4HDRB 4XH9B 1VKZA 8GPBA 3ZVNA 2P6OA 2PGOA 1NYEA 1NDQA 1UMDB 2BCGY 3H05A 4C0WA 3OFSA 1AG9A 3HHEA 3M1LA 4CIXA 2VQDA 2OAP1 1RWVA 3FB1A 4TKUA 3KVOA 3H2JA 4OYCA 3R3YA 4JJAA 4KQ2A 2ZI3A 2AMLA 4Q37A 1VG9B 4ZAYA 3YASA 5C1OA 2GNAA 1YI0A 4OI4A 5JISA 3I2YX 1MB2A 1TQHA 2IHVA 4NZMA 3U7HB 1V7ZA 1HLDA 1XBTA 5M5BA 4LJRA 3DUWA 3AF0A 5CA1B 1BKDR 3HI4A 7REQB 1E6MA 4D4IA 4TYWA 2I1VB 3QF7A 1J7KA 3Q7QA 4ENWA 4BL5A 4QVKA 1DQZA 3M6WA 2I22A 1GILA 1PS9A 2JEOA 2NV6A 5I8WA 3K35A 1CZUA 2CVOA 2QP4A 4LZPA 1FUIA 4ID9A 4R1UA 4RK6A 4RF5A 3WY9A 5B1EA 1J42A 1XMSA 1GGEA 1RXCA 1OAKA 3PYMA 4RYDA 5EE3A 4JB2A 3ERCA 2VJOA 1V5FA 1G18A 1EWRA 2KMLA 3ESQA 3WDSA 3WOVA 2Q27A 2QUAA 5K8JB 1C7QA 2BSAA 1Z7YA 4EIWA 3X44A 1RC1A 3AVWA 1FXSA 4N01A 1ZUNA 3E48A 5FWDA 2N75A 1QHSA 1RM0A 1X1RA 3N8DA 2R6JA 2C5GA 4OHYA 5B6IA 1GCAA 4DUYC 1NT4A 2OGZA 4IOJA 4PE5B 2OVFA 1C8VB 1E2KA 5K3EA 3VR6H 2PUDA 1M0SA 3UXMA 3C48A 4Q66C 5K3CA 3SZRA 1HE8B 3Q7TA 2FRDA 4M3NA 4X6XA 2VDKB 1IVNA 2GYVA 2R6FA 4E3WA 1IBMC 4Q4CA 3IIJA 3GJ4A 2I2CA 2QP3A 2BP7B 3FZGA 3KOZA 4RZUA 2VZLA 4KOAA 3KEMA 4I4TB 4QELA 1MG5A 4RPIA 1Y0BA 1HDGO 4OIFA 5LB4A 3V32A 4B9AA 4HDMA 1L3IA 4CFSA 4YV0A 1ZVVA 2VDQB 2PUJA 4HL6A 3PFBA 1G5IA 4UULA 4C6TB 5F78A 2QN2A 1E7WA 1A9TA 1OGIA 1E66A 3AR7A 1OZFA 1YDMA 4POAA 4EYKA 2PKCA 3L5OA 4BMCA 2RHRA 5H0IA 4LPKA 1UBEA 4ATNA 1HWYA 2P3QA 2QZSA 4HXFB 3UHPA 3R9XB 2VCYA 3H5OA 3UKOA 2JK0A 4V0LA 3GH1A 2NT4A 4C5CA 2AOWA 1MU0A 2AT1A 3M5PA 2NOAA 3KZMA 4W63A 4YQYA 3PWZA 4KQ1A 2MYUA 4YMGA 1H4TA 4V0RA 3OKPA 3KM0A 5HF8A 3KKLA 4E70A 3TSZA 5A5GA 1HV8A 1XQVA 2JIRA 3EIHA 3REFA 1P5HA 3TLXA 3GVPA 3W3AH 2BJVA 4OHBA 1S2OA 1P75A 1JKXA 1Q1BA 4R7ZA 4BB5A 1G6KA 2V58A 1CUXA 3K6RA 3AKYA 4ML3A 3VOBA 1Q0QA 4B17A 4QULA 3MCAA 4MCIA 2Z9DA 4YJFB 1PLJA 2PH7A 2WILA 3ZH2A 4BNUA 4HN4B 3H2ZA 5BW8A 1M34B 2DR3A 3ELUA 3SG0A 3PX7A 3N0RA 3TR3A 1OFVA 1S1CA 4TMTA 1GKIA 4I55F 1U2GA 1U9CA 4UTZA 1NW5A 3RVQA 1KO4A 1JUDA 4B3HA 3WV5A 2CHFA 2VJQA 4XX0B 2XRFA 4A6EA 4CQMB 5GADl 1UEIA 3SX2A 2C88A 2WYWA 3JQ8A 4NYIQ 4ZODA 3CE6A 4MS1B 3SZUA 1J2RA 4IX9A 1IULA 4F46A 1V5WA 2F43B 2P5SA 4ENRA 4EFKA 3EBLA 3VHLB 1WSWA 5AM3A 1L6RA 2H4JA 3AONB 4U8HA 4UVGA 4G0UA 3B7PA 4CMEA 2VH2A 3LWDA 2DQZA 2NZYA 4YA6A 4S0XA 4DWWA 5J3JA 3QLEA 4TTQA 2DWOA 1JFFB 1M1YA 1OX4B 4PONA 5FBQB 3D2LA 4B48A 1P62B 4P2GA 4H7DA 3IPXA 3FPGA 4NXNB 3GRYA 1DQYA 2BGWA 3WLQA 1EQ2A 4TLAA 3TE7A 1OH6A 2GR9A 1M10A 1EFPB 1PR9A 2FEKA 3C5VA 3LZ6A 1AGYA 3ZGNA 3VU1A 1XDZA 4WWHA 4PHTA 1XP8A 3OQBA 2O4UX 4RESA 2FWNA 2PLFA 1T0UA 3WAJA 2XCSB 3F67A 1ZHHA 3TTVA 4HB4A 1IXRC 2FDXA 2CY1A 1GL3A 5ED0A 4LFAB 3CVYA 3KDPA 3RYHB 4ZU3A 1XLVA 5KNCA 3SIXA 1Z68A 2VXCA 3H4MA 2P6PA 4FYJA 3WGGA 1O5OA 1XTBA 4MITA 1ILEA 4HVCA 2PBZA 4PAMA 4MS3B 2AQHA 2Z8YM 3GR6A 1RSZA 2R5FA 5HDBB 1R0LA 2P65A 4M4SA 3IX7A 3NRJA 1N2GA 1IZ7A 3VX4A 1P72A 4AT1A 4LEIA 2XMBA 4IJMA 4B3IA 4BP8A 5FV4A 1T5BA 4KMSA 1EUDB 3RUEA 2F4VC 1JJ7A 4C1BA 4P3KA 4MIYA 1DTWB 5AW8A 3M6MD 4A10A 1C2YA 2GJSA 2HGSA 5BOSA 5I7UA 1EDEA 3BC1A 4D4KA 4JU8A 5CFRA 4Q4AA 3ZLBA 4JAVC 2XYPA 1XL1A 4JI0C 5EQDA 1N5RA 2DULA 3L1HA 1PQWA 1RZRD 1WW3A 3QEAZ 1SD5A 3IGFA 3LV8A 2C3PA 1T2AA 1X94A 4LHVA 2C00A 2DAPA 4OFXA 5CGQB 2JIBA 1NGSA 2QM0A 5BP7A 3WLRA 1RC8A 4ZC8A 1DEKA 1QIIA 4KE6A 4RUKA 4N1AA 4AK9A 1RAAA 5LCIA 3KQKA 2XWQA 3LUHA 4XZ3A 2REXB 3KZCA 1VJRA 4CEJA 5ALWA 4KR7A 1SXPA 1R4AA 2OYRA 3RJZA 3BHMA 1QO7A 1JQDA 3DONA 4UMVA 4YASA 4BQRA 1WP9A 1L2FA 1Y1RA 5C1IA 3JAMA 3A1DA 4EAAA 4PSVA 1RXUA 1GV0A 4ZZ0A 5TMPA 4GI5A 4FYHA 4PX5A 4RLSA 2Z30A 2XA2A 3SC3A 3ZDZB 3USES 2GPSA 3B9PA 3PPWA 2FQYA 4G8BA 1F2VA 3R7DA 4D9HA 2F7SA 3CVVA 4E5UA 1LW6E 5EFOA 2VP2A 3CKLA 1T8PA 4TTPA 2OEPA 1PVVA 3VU8A 1ADFA 2VG8A 2DP4E 4YRJA 4B3GA 5B7QA 1DO2A 2PD6A 3F7OA 5JECA 2CF6A 4P22A 1WXWA 2JAXA 3KJXA 3OJXA 2FSVC 3N59A 3RUDA 1NQUA 4R3WA 3MBOA 4KXLA 4A92A 3E4CA 4IMIB 5JCJD 3PFCA 3URMA 3SQLA 3OT1A 2P41A 1PJQA 1LPSA 1QANA 2HGZA 1DG9A 5EJ5A 5JD6A 2IKSA 3DTYA 3GARA 4MROA 5EIOA 1VKOA 3GJ8A 1GCGA 3HBAA 1SNYA 2X6QA 3ZPXA 4CR6A 2PYDA 2ZIGA 1J5PA 3IRVA 4RDHA 4M9ZA 5AKJA 5F3WB 2WHYA 3LFUA 1IM8A 1XZCA 3P32A 1P9WA 4K9SA 1TIBA 3QBJA 3IBCA 3ABZA 2FUCA 4ZEWA 1AO0A 2F17A 4NHOA 2GPYA 3C3KA 1AXGA 2JRLA 4I9HA 3ZJ4A 4AJ2A 4DZTA 2JFBA 4Y2UA 2G7ZA 1DC7A 4NKRA 2MYPA 5FTMA 3W2HA 1ADJA 1U3WA 5FWYB 4UQOA 1I3MA 2WHPB 3HJTA 1GGHA 3DXYA 3ISTA 1YZNA 2KBEA 2Y0DA 4ZALA 1V4NA 1JH9A 1XXHB 1ULHA 3O75A 4MGYR 1DCKA 4Z7OB 2EJTA 2H48A 3IOCA 4UTRA 5CW1A 4Q3BA 2ODBA 3DFKA 2R6AA 4KKXB 5FTLA 1IM5A 3IQFA 2WUDA 2BN4A 3ESCA 4BB9A 4YV1A 3GZJA 3HLTA 3TOVA 1B8PA 3PUJA 1PWXA 2NUTA 4QFMA 3BFXA 5C80A 1A2KC 3FZQA 4TM8A 4B6PA 2XUOA 3LC1O 1E3WB 5KKCA 1WUHS 1U5CA 1TL7C 3QKRA 4H1TA 4KQHA 4PCUA 5E4FA 4DCUA 2XWSA 3N2GB 5H4GA 3ZIUA 4NF2A 4JNKA 3GD7A 4WDQA 2ZBRA 4A2CA 4CLEA 3THWB 3AOGA 2YWHA 1D2EA 3QOYA 1PGQA 5KQRA 4F71A 1BX1A 3CNQS 4OJNA 1I32A 1IJFA 1KY2A 4BMYA 4BO8A 4BEBA 1OIWA 2NAFA 5LA6F 3GA0A 2BKVA 4MQ5A 1LU9A 1XTTA 4GICA 4BZPA 5IEJA 2P62A 3BWYA 4M1TA 3PKIA 3WYAA 2XUIA 3WZ2A 2E7GA 2Q4RA 4FS8A 2XXJA 1OLXB 1YJQA 2ZYHA 3AFGA 4E03A 3RYCB 2PGXA 1EHIA 1RWKA 2QAJA 5AM4A 4D9EA 3PHHA 5J59A 4GH5A 1QPBA 4CMGA 1HSZA 2BM8A 4X61A 1PYOA 3CX4A 4FIZA 1Z83A 2BGGA 3ZQUA 2CZCA 2WWIA 4FC6A 2NN3C 3VO1A 5DCLA 4R54A 5ER6A 3QPUA 5U1PA 4AYTA 2P9QA 3LDUA 4JENA 4BE9A 3HP4A 5KOHB 5EUQB 3QOXA 4D9NA 3MIZA 4IKEA 2O7NA 3EVNA 4LV5B 4UNQA 2FSSA 2CVFA 2OBNA 5J4YA 1KI7A 3CFYA 1T5DX 2NIPA 2LRHA 2ZEJA 4DSAA 2NP7A 3NVAA 4GE3A 1RBYA 4COOA 1A27A 1DIAA 4ETWA 4GGOA 3CX7A 2IYSA 4ZYLA 2AFHA 2YZMA 2NAPA 1PJ4A 4WJLA 3FGNA 5DVZA 1E1QA 4I81A 1SIOA 1M1NA 1KMQA 2P2MA 4HX9A 4ND5A 5F3DA 4CI0B 3D3QA 3MGGA 4G1VA 2WQ6A 2RC5A 4MYRA 1JB9A 2FOIA 2G09A 2YASA 3H9GA 2VH1A 3PC3A 3ETNA 5M34A 3CEPB 3B85A 2RGGA 1QIGA 3K09A 1QRRA 2XZDA 4LXIA 4D4HA 1E6WA 3K6SA 4X1OA 2DEUA 2EZ8A 1GADO 2TECE 3U40A 3SXJA 3UOAB 3DB1A 3RTDA 4WZAB 3G9ZA 5KVQA 4Y9UA 1IL0A 1ZH0A 4XIGS 3RHTA 4JI4B 1RHJA 3RC7A 3EGOA 3HYLA 3WQQA 2GCOB 3PX2A 5FDFA 4EGSA 4QQRA 4QBGB 5CYGA 1ENYA 3P2KA 1KFEB 3H86A 4HFJA 4YROA 3KXIA 4XIYA 2OT3B 2IY9A 1I4OA 4MQ6A 3G3EA 1STOA 3G5LA 3NETA 3GR1A 4LJ5A 4R9RA 1O57A 1V2HE 3CXRA 4OJQA 2G5CA 3VR6A 3I4FA 4YJHA 3DH0A 2B34A 1U98A 4G5HA 4BIIA 1F12A 1MC4A 1RACA 3EDRA 4P0TA 3V8BA 1QP4A 3DLPX 1CY4A 2QRNA 2B0JA 2GPAA 4NJEB 3K0AB 4IHKA 1BDIA 2IH5A 2ES4A 1XX6A 2QMUA 1JAZA 1OB2A 2JI7A 3ZWMA 1A9OA 4CQJA 2I87A 2SBTA 2B4QA 3X1DA 5ITZA 1GDHA 3W04A 4IXWA 2ZB7A 5KJ1A 3KTAA 2NCLA 4YP7A 1R16A 9MHTA 5AVSA 5FUQA 4QOGA 1SHLA 4J90A 4GOLD 1H2YA 1HE4A 2D7CA 1K7YA 3W5DA 4NJMA 4ZT5A 3SKYA 4ZTUB 4BLQA 3PXXA 1ZSVA 4E6PA 3RW9A 1Z75A 1M0WA 4U63A 5DBFA 5D00A 1DPFA 2POQX 3CRRA 1U8EA 4WY2A 1Y5NA 1EGMB 5EQTA 3BTSA 3DMHA 1FLVA 1VG8A 1P8JA 1VC2A 2PO7A 1JIIA 3G23A 3Q3GE 3GRZA 4MZXA 1BEEA 2NSLA 2JAPA 2VN8A 4HMQA 3UANA 3ZGOA 2R1ZA 1Y6RA 1EGVB 2GETA 1X0XA 4FFWA 3W3AA 4G5YA 5DTIA 3VSAA 3L4BC 1VBKA 4B4UA 3ZBPA 1I33A 4HVTA 5HIJA 1WD5A 3IOMA 4KN8A 3OLZA 4W7HA 4ETNA 3MRXA 5AJZA 3W5JA 2OC4A 3P9NA 3QEOA 4ZVMA 2W8BA 1BE1A 2YX1A 1KMMA 1UMBB 2FW6A 1Y3HA 1I0IA 2IUFA 5BUCA 3BBPA 3GRFA 3SYRA 2HBQA 2GM5A 1YZUA 1XMVA 4LKOA 3WWZA 1E8NA 3WICA 2X8JB 3JQAB 4B6OA 2HA5A 1THTA 1XPRA 4DUZC 4ACBA 4KWTA 4FS3A 1SHUX 4P1ZA 1V0JA 3EGDA 2WMNB 1WHSB 2GRUA 3EQ2A 3OE7A 4LGMA 3D7NA 2A67A 4O2AB 3G1UA 4LSZA 3GLIB 4RHYA 1RQRA 1ZCJA 3I2GA 4BAZA 5LVAA 3F1LA 1WDLA 4B6SA 3C6MA 3HY6A 3B3JA 4MYTA 4ZCIA 4B0PA 5IULC 3WV4A 1I2ZA 5K2MA 1B4DA 1DCMA 3MS7A 5FWNA 1G8KA 4EBFA 3FSJX 4GXQA 3LUPA 1B1CA 1KKUA 4O4HA 2X8LA 1WX1A 4LFCC 4OUDB 2HJSA 1ZH4A 3Q98A 4U7HA 1LA2A 4NK4A 3M9LA 4XYEA 4RIGA 1JDUA 1M1ZA 3PFFA 5TGDA 2B7LA 4DN6A 2VWQA 3OC0A 3IDZA 1E2UA 3AUAA 1CQJB 4RZXA 2YFQA 1OREA 5ENVA 3I08A 2PU7A 3DFIA 4GOMD 2HN9A 4UOQA 2MM9A 3F3MA 1W5AA 3VMMA 4ECAA 1E0JA 3A9TA 4WOPA 4CODB 4EMUA 3BB4A 2HBYA 4WX2B 2INGX 5CEFA 4KR3A 1AA9A 2I6QA 3C45A 1MA0A 3ZXSA 4WS9A 1KK2A 1MO5A 2GN1A 2QNRA 2ZSEA 4QU0A 2VCHA 2AI2A 3BPSA 2BFCB 1VBMA 4LZJA 5LP1A 4XW2A 5JVDF 3GOHA 2BL4A 3CRZA 4FDVA 1SHKA 5U4XA 1ZU4A 3AB8A 4BAUA 3HKBB 4XEHA 5TQ0A 2GK3A 5KYNA 4U7DA 3EGEA 4HNAA 3O1LA 4OSOA 2ZOSA 4QUHA 4AC9A 4F93B 2E5LB 3HRHA 3B48A 1EE9A 2AA3A 1JHOA 4C4OA 3ZHRA 2ZXUA 2ZAMA 5KYVA 4JQCA 1XQYA 2GXAA 4DV3C 3MRVA 3PNBA 3EUFA 1RXEA 1LDEA 1NVVR 5GY7A 1P31A 5C31A 4URUR 5ITWA 2ATVA 3RC1A 1R3UA 4WESA 2QUHA 5A6VA 4F5ZA 3CF4A 3E2PA 4O4IF 1E5VA 4L3WA 1RJFA 4YRNA 1Y63A 4HYYA 4YCAA 1WCV1 1KAOA 2UZ0A 2F1KA 4LF9C 1Z3IX 4PC6A 3I4LA 2AN1A 3M82A 1QCCA 3GBPA 3V55A 1R4NA 1BE0A 4BY9E 5IAAA 2L42A 4CKCA 3NT2A 1KP9A 2DBRA 5AVYA 4OAQA 5A3RA 2O2SA 1SUSA 2QORA 3PUYA 1CB7A 2C9BA 3U60B 2CJWB 3FGOA 2AOTA 4YAWA 4FEAA 2CNBA 3D6JA 1RHRA 2BJHA 3TUFA 2G80A 3GEBA 3DFFA 2FN9A 1I0LA 3AVQA 2JF0A 2I4RA 3G8DA 4ROTA 5EWMB 1KEEB 2PX6A 3NAZA 1H23A 4RVHA 2WMYA 1ISGA 1PQ4A 1PJRA 1VJGA 3BDAA 3FMOB 4KDRA 4LDQA 5LZ5A 3RSOA 1M2VB 3ZHBA 1A7AA 3PSAA 4NCBA 3E22A 3H9BA 1N2CB 2UZ1A 4WNCA 4ZT7A 1TAUA 3ETHA 4YMIA 2ZAGA 3DO6A 3V80A 2PL5A 1XRBA 3GUUA 3FTQA 4URHA 5L53A 5BQFA 2FHPA 1KQOA 2O3QA 5THKA 4L4YA 3MQFA 4AZVA 4AUNA 4XQEA 3THXA 4R0MA 2UVPA 2XDWA 4X66C 2B2NA 4YRCA 3OIUA 2ZRMA 1KDRA 1MAAA 1OI3A 2HQOA 4XYLA 1UJBA 4GWLA 2A5FA 4FMDB 5EQJB 5A1TA 1NE7A 4HEA6 2PQ2A 2UZ3A 3HO8A 1VCIA 3I04A 4QXPA 2J67A 2VOEA 4HMPA 1NFQA 3IMKA 1ZRNA 3KJZA 4U7FA 5D85A 3SE0A 3BZUA 4FZJA 1N4AA 1T1EA 2B3DA 1YJAA 3BMQB 3PQ3A 1D8TA 5K0CA 1D6NA 1XEFA 1ZN9A 4IDEA 4KIJA 1M6HA 1F2TB 1XZPA 5B3AA 2E5WA 2QN7A 4B34A 4EY8A 3RYIA 4D8WA 4ZOLB 3TZHA 3ZNPA 1NL3A 4NS4A 1MV5A 4CLOB 5HVNA 2C4KA 1Y5RA 1TEZA 1AUOA 1JEDA 1VJCA 2E4YA 2HAEA 3H1TA 1XJCA 4V0KA 2I4MA 4HX5A 2OMEA 4ID3A 5B4VA 1XJQA 1VLJA 1AGPA 3G02A 4BWGA 3JQ9A 3QFHA 1I4WA 3NAQA 4DR6B 2L82A 2ZKIA 5A4AA 3LP8A 3HDTA 1JYFA 1C1XA 4KQ6A 3BG5A 5H68A 2M6SA 2KZFA 4MRVA 4RCYA 5LR6A 1WXDA 2X4DA 2OV6A 4MVJF 5E8RA 3KB6A 3ND5A 1I7SB 4BQSA 1C30B 4XIFA 1J9EA 3H11A 1QQBA 2AXEA 4XQ9A 3MXOA 1FVXA 1SEVA 3DBLA 5BR4A 5DIFA 4YRBA 3LPDA 1W4AA 2B1QA 4PTYA 4CMHA 3OFJA 2PG3A 4FLMA 2XUFA 3PPYA 1LVUA 4KTVE 1EAYA 3FZYA 3ZHOA 1U0SY 1C4WA 3DHEA 3ETJA 4K2AA 1UBKS 2O5VA 1AS2A 2PS0A 4M7PA 4CUZA 3O8OA 2GCGA 4EGJA 1NLZA 1Q6ZA 4FKZA 3HYRA 4LX8A 4HDSB 2JKVA 5HF5A 4BO3A 3BIFA 2FP3A 3GEDA 1JXAA 3A37A 3ANYB 3WKEA 1P19A 2Z5FA 2HJHA 4JBNA 4N7JA 5K0BA 2ZCJA 3UMVA 1FSPA 2IHTA 3LVBA 4X20A 1DPGA 2HF7A 3CRMA 3FHOA 1T9KA 1T8RA 1WCIA 2SKEA 3MLAA 3N2YA 3PQFA 1ZCZA 4EG6A 4F92B 1FP1D 5CUQA 1A9XB 2C9OA 3JYQA 2EX1A 2BUAA 1ABFA 1EU1A 2HA6A 4HBGA 1O4WA 3CKYA 3OOHA 3QX7A 4E12A 3T8YA 2H7XA 5JNWA 5IWAC 1DAOA 4CCSA 1QPZA 1EWQA 2A5YB 2ZTHA 3RT9A 5HPYB 4CM6A 3V6LA 4F04A 4XVCA 1SOWA 4RIHA 1BXRA 1IH8A 2WG1A 4DWVA 1B0ZA 4L9RA 3MW8A 2HM7A 3NM5A 3RYTC 6LDHA 4PUHA 4YCSA 4RVNA 4KXQA 2JARA 3MCVA 4DIUA 2WG0A 3LRTA 5JD4A 1Y8RB 4IMPA 4TWIA 5G3ZA 1Z12A 2Q4DA 4C7OB 2WWYA 1G42A 1GPWB 1GG9A 1O93A 3K8QA 2WFLA 4H4EA 3BIOA 4O4JF 2XUGA 4XB2A 5TQ2B 1HE5A 3ROPA 3RS8A 4B4KA 3MUOA 1A8QA 2PZBA 3N2LA 4TSRA 2QVYX 3A28A 1K6EA 2PGLA 4GR5A 4H9GA 3U44B 2WYOA 4J6EA 5BVGB 2CLCX 1RM4A 2PXHA 3MVEA 3RREA 4E07A 3PEFA 4KITB 5LJLA 1QR2A 3P4XA 1TW3A 4RVSA 4G36A 5ESWA 4ESVA 1QG4A 2J3LA 3PHIA 2OBFA 3LY9A 1GTJ1 5REQB 1SVSA 3EH2A 4ZOCA 3N5KA 5IG2A 1GNPA 4L0QA 1QRUA 2RIPA 3PZBA 3R3WA 3ZK9A 4LYJA 5FADA 2R65A 3H2GA 3QI7A 1ZONA 1K89A 2JFXA 4IIGA 5JATA 4LSGA 3U3XA 2FQXA 3I6YA 5F98A 5B6JA 1EZ4A 5JXIA 3VYTB 1F1BA 2I0FA 4LDAA 2YZKA 3T7IA 1IEQA 3HWWA 2GO7A 4JC5A 2LCQA 5I48A 3Q3CA 4JBGA 2XB6A 5JZBA 1HBJA 1X7XB 5IDXA 3IEIA 4EVIA 3IAM1 1FQKA 3COVA 3GLVA 2P3OA 3EA0A 3EZ2A 2HY7A 1KA9H 2JGDA 1OT3A 4FDMA 5DOZA 2PUHA 1NJ8A 3K9QO 4Q48A 4X41A 3T7RA 1DO0A 2XUHA 1ZVMA 2X6RA 4B8YA 2MSDB 1OILA 4BNKA 1N34B 4RTKA 4OLFA 4R1TA 4KO8A 3C98A 3LUAA 4ZRDA 3DD1A 4RD1A 4UE6A 4HDNB 4WCFB 3VJLA 2WJYA 3QG5A 4Y3UA 4UFOA 5CYFA 5GQSA 3VKFA 1D4AA 3ONFA 1MIOB 3RFXA 4OHCA 2VPWA 4V0MA 3MGBA 3T95A 5LQNA 4G8JA 4IO0A 4I6EA 3RRJA 3IHKA 3MCZA 1V48A 3FOBA 3GYBA 3BWXA 2PYZA 3D7RA 4TYPA 4TPSB 2JAOA 2OPLB 2X5JO 3AX6A 5HJ2A 2QN8A 3I37X 1Q1QA 1VLMA 4W5QA 1ISMA 3SJCA 3VR2A 5IVPA 4QPNA 3M3DA 1UQRA 4QBKA 5CG2A 4QVGA 1Z0FA 5K8CA 2BGMA 5HM6A 4G81A 2A7XA 2ECOA 2GXUA 1T3HA 3JAWB 3QYFA 4OMUA 1E94E 2D1RA 2VXBA 2XMGA 2YIDA 4RW0A 5I4IA 2QOEA 2GAIA 3E2MA 3LUCA 4V02A 4JBHA 4P5DA 1AVTA 4WGFA 3I2HA 1WQ4A 4MPDA 3I9OA 2YKGA 4NZNA 1J49A 5EIXA 2YWBA 1GQ2A 3MNFA 2AXPA 5AOCA 4DR1C 4A6DA 2RHHA 3VHXA 4CDNA 3UG7A 4EMSA 1KDTA 1E1RA 5AOBA 2ACEA 1JJFA 3UEBA 1SUEA 2RHTA 2CMDA 3GUVA 3Q88A 5KQPA 1AY0A 3A06A 1BVUA 4WNYA 2EDCA 5C51B 4W7SA 3A1FA 3ZZ1A 1XYYA 5CT9A 1HL3A 4C4TA 4RK0A 2FPUA 3H3FA 4YRSA 3DEAA 1BW9B 4PPQA 1YIAA 4S2EA 2JD2A 2BAGA 2ZIUB 5BSVA 2XWJI 3O8NA 4HWPA 4ZP1A 1AGRA 2VL7A 3IHWA 4K9PA 5K9ZA 3ZY3A 2R4UA 3QKWA 1AKNA 3SHOA 4DYHA 4ZOQI 3A9VA 3N0TA 2FRVA 3OHPA 4RPKA 5I8PA 1YASA 4Q3NA 5CFPA 1X7ZA 2HV8A 4HDAA 2OE2A 5BV8A 1CQIA 1EZZA 1GNTA 5EVCA 1TYBE 3T38A 1TAGA 2F2TA 1YJ7A 4GX5A 4M0KA 3HP1A 2J3KA 1EM8B 2X2PA 2ORED 2QMHA 1FC0A 2ZSFA 3HB4X 1YRWA 3MWJA 4W7IA 1JPUA 1BD3A 1NVBA 4EB6A 4E7PA 3ZJTA 4JXZA 1Y3FE 2ZR0A 1KC1A 3L7DA 3VBCA 2A0FA 1SUPA 5EZ5A 1NP6A 2ZS8A 5GMOA 1GRRA 3ES9A 1DARA 1GUYA 3UM9A 1DSSG 5CR9A 1KRXA 3ITNA 1PNRA 5CLGA 4CMBA 4EF4A 4DBLE 1JS1X 2QENA 4CEIB 3P71T 5I9IA 1CUIA 4ZEMA 1NBIA 5E38A 3TL6A 2YOGA 5E2IA 4RM2A 1CT9A 3ZLUA 3JTMA 4LQDA 2BZ1A 3KFLA 1N8SA 1MQSA 3AKCA 4H7PA 2HJVA 2JHCA 2P2QA 1F5SA 3ORYA 3WLPA 4D8XA 1I94C 1CFZA 2JRCA 4NABA 1Z47A 3HSKA 3LT4A 4LC1A 3VNQA 3EQZA 3OQJA 4Y9RA 3SD7A 2RGAA 2X5XA 3H5RA 3KT8A 1K27A 2FFBA 1EFVA 2JATA 5CRIA 2Q7DA 3LQ4A 4PHHA 1AMOA 2BR3A 5AKIA 4G5FA 4J0HA 2GCEA 2B78A 2YJ4A 3I8SA 1G9TA 4HOYA 2F1RA 3FNFA 4QYIB 1U04A 1RRFA 1JXOA 3RWMB 4AWXA 1BXKA 2R8PA 1I6KA 1CZOA 1OX5A 1P1HA 2I78A 2XLCA 1QRDA 2C3YA 1DJLA 1FRQA 3AHJA 3Q9SA 3NWJA 4BN4A 3DOCA 3QVVA 1ZK1A 5HMLA 3AU8A 2DVMA 1XA3A 1SCNE 1FRZA 5CZXA 2O3TA 4HRXA 4L07A 4PG6A 2HQBA 1MRNA 2EJWA 3C7DB 1U0GA 2FSVA 3G2OA 4DY4A 2HIHA 1Y1KE 3C8DA 3GEHA 3WLSA 4UHJA 3TZLA 5JNRA 5ADWA 1TD1A 1QH1B 5KNDD 1TK9A 2PRYA 2V7TA 1E3IA 3PDIB 3FKJA 3H0CA 2YHSA 2NU6A 2PNFA 3A1UA 2ZM6C 2FG6C 2DH5A 1PT8A 1VHLA 3OE4A 4A2QA 1LKZA 2BKAA 3AR2A 2NNLD 3IDOA 1EVKA 2DKFA 3QRWA 4ZVKA 4M36A 2IIQA 3NS7A 3DKVA 1BEUB 2CVQA 3U48A 3IAXA 1WF6A 2OCDA 4UNPA 4KHPB 1MFZA 2PKEA 2QD2A 2IYWA 3Q1KA 4DLNA 4UZSA 4MR8B 1T2UA 3WK5A 3QWBA 1DWUA 2C5AA 1ECCA 1O6ZA 4IGFA 4GM0A 3HNPA 5C7IO 1UEXC 2I4LA 3A6HA 3I32A 4MPRA 4WK6A 5FI1B 1FFXB 3V3TA 3FUUA 1FK8A 3M6XA 1YKSA 3GCXA 3U3JA 3T3EA 1VPWA 4L9WA 1Q92A 1UBGA 4F2WA 2FF7A 1VB3A 3FDZA 2GO1A 1PNQA 5KWSA 3Q4GA 3T6KA 4OOFA 4RMGA 3WRYC 4ZYZA 1NU6A 4L4QA 1CPYA 3G89A 1SHZA 1U1GA 5F9HA 5A1GA 1O87A 3RUIA 5T8TA 3WLEA 2W9XA 1YD7A 4JI8C 3H75A 3IELA 3T3IA 3ZHTA 2XUJA 2YMPA 2SECE 3S3TA 1N57A 1U2PA 2VT3A 2X0JA 1WRBA 2FEMA 3NTUA 2UU9C 1GIAA 1TTPB 3SQWA 1DXQA 3HLKA 1M2OA 2OFWA 1L5OA 2QJWA 2QLBA 3EY4A 2IV2X 3L6EA 3V8PA 1K6JA 1TO6A 2QTTA 3ILHA 2OUIA 3IQWA 4RVOA 3QUCA 2YWRA 1G9XA 2R8OA 3GDWA 4P3OA 3CR7A 3RUAA 4YT4A 5DX8A 4AULA 1ORHA 3BXPA 3WWPA 2ZT7A 5H3HA 5ILQA 2I9PA 3PR2B 5HWSA 2ZTVA 3UJ3X 3V4SA 1HDRA 4WHMA 2QX8A 2IPNA 4G5XA 1ZM4A 4MUFA 5NLLA 3STUA 4B7AA 4EY5A 3FNRA 1OTHA 4Y18A 2V9PA 1XB2A 4ROSA 4FJ0A 1V45E 2HDHA 5ITVA 4BGEA 4W1QA 4EWLA 1E4OA 2WWHA 10MHA 4LVNA 3ONEA 3PTZA 4DNXA 3T7AA 2I3DA 4Q1AA 4B45A 2NNWB 1FFBA 2B30A 2NU9A 1CIJA 1LLQA 3BERA 3OEHD 4EJ6A 1QQ6A 4ZGBA 5JW6A 4ZYXA 3L8CA 1HKHA 1TA9A 5JYBA 3RI3A 3KQYA 4ZGWA 4CM3A 1FXWA 1GZ3A 1TYCA 3U7IA 3ASVA 1U8CB 2CXRA 2B5WA 3R0QA 3SIRA 2X58A 2QBYA 2BEWB 1V1MA 2NVBA 4CQLA 1M33A 4UD6A 3DV2A 1YS7A 1GA1A 4KU4A 1L5HB 5LWHA 3FG9A 1OX6A 1RLIA 3CQ3A 4U0KA 4QUEA 4KVFA 4TVOA 5AJHA 1RJWA 4BU0A 3TTWA 2J41A 3ZVRA 3KNZA 4MV3A 1USPB 1DWQA 2NZUG 4P7FA 4IDAA 4NG5A 5CHYA 3DLIA 3GA5A 1EKXA 2JVKA 3NOXA 4BCCA 4AMZA 5HBRA 2D74A 4U2DA 3LA8A 4BMDA 2YHIB 5CVUA 1F06A 3JD4A 4C4SA 1Z18A 2QVZX 1I5EA 5BMVF 1UBNA 1WUKS 3DWGA 4JD5A 4M0FA 2QRUA 5ADHA 1BX3A 1R9GA 2IEDA 5DLDA 3RK1A 4AMGA 3HXMA 5P21A 6REQB 3WLMA 3OQMA 2HHHB 2CZQA 2LDXA 4IWYA 3ZTWA 4LXXA 2O1EA 2RB4A 3EODA 5H3LA 3KEOA 3KETA 3CW8X 3WGTA 4ZXFA 4Q21A 3M6FA 4QHTA 5EPEA 4JOBA 2C5SA 4EW6A 2I3GA 2IS4A 4N49A 4MEBA 3WYEA 3RFCA 1B3RA 2JLAA 5ERXA 3ZVLA 2GN6A 1PJ8A 4BAGA 3RHSA 1P91A 4B6RA 2BBTA 2UYOA 5F73A 1KSHA 2G9ZA 1RHUA 3KQPA 3TGLA 4M8SA 4E94A 1Q22A 2VH5R 1XQXA 1NNI1 3HM2A 3TOSA 1H2AS 2JFZA 4UU7A 5AHXA 2XITA 2YVLA 5L51A 1N36B 4UEOA 3THYB 2ZB2A 3U37A 5COBA 1QLJA 2NYVA 4HLCA 4Q1BA 3FHCB 4O25A 1XD2A 1PEDA 1XTQA 3IE2A 1U3VA 1K6IA 4NZZA 4WD3A 3ZQJA 3NWPA 1T4MA 3WB0A 2AR0A 3HKCA 1Q3TA 3EMBA 4GQBA 1OC4A 3MS2A 4X63A 1CVLA 2RONA 3O83A 2OCAA 1PR0A 3FA2A 3GD5A 3W2GA 3GJRA 2O8EA 3GR0A 3NDJA 1H9BA 4QFBA 4GKKC 1VMAA 1Z25A 3E3LA 1TEHA 1TM4E 3QW4B 3VYWA 3FKSA 4D56A 2G82A 2SKDA 1QIHA 2WFZA 3I5AA 4GP6A 4H6WA 4HDKB 5DFAA 1U0FA 1WVMA 5MN4A 5ALNA 3KYCB 3F7TA 5ISMA 2Z6AA 4MCHA 1YNSA 2BFDA 1XPOA 4D3ZA 3D8BA 2VTKA 4JI3C 4DIEA 3L4BA 2ZJ3A 4OK5A 4BV3A 5KSYA 1J39A 1U8AA 1HC7A 2DFLA 1RWPA 1QDLB 1B93A 2WYHA 3BMOA 3KZNA 4QU8A 4WE3A 1HNWC 4O1HA 5JHGB 1EG2A 1H05A 3AT1A 4KIFA 4P3YA 4UTNA 5IASA 4A8TA 1D9XA 2V98A 5LMNB 1Y6ZA 4F2HA 1WCJA 4KZPA 4PYOA 2E9SA 3C6QA 5IZCC 4MPJA 1AK9A 4BHTA 1LEHA 1QKJA 2Q9CA 4G1EB 1DXYA 1T1JA 2QTFA 4CF3A 3INRA 2VJNA 3GG9A 4BBAA 3RG2A 3CJTA 4EI9A 4BX9A 3E3AA 2JIMA 3QMVA 2Z8YA 1ORDA 3EMVA 5H9VA 2HWXA 1VB5A 5CJ2A 4F5YA 5BT8A 3FLBA 3Q9UA 1WH9A 2IELA 3FMFA 1JKMA 3UPDA 2P90A 4PPNA 3SDBA 4MIOA 2D8MA 3OPYB 1KK3A 1ZR2A 2PTGA 1E4VA 4UE3S 2CCJA 3BHNA 5FPHA 4BQEA 3VVMA 2G0NA 1CERA 1JA0A 2R7NA 2RGRA 3S29A 1XEXB 1GPYA 1GVHA 1NLUA 2QQ0A 3NORA 3FCUB 4KO1S 2REOA 3T15A 2FPGA 5AI6A 1TGVA 3O7MA 4QOSA 1ZU5A 2GDJA 2ZB8A 1PSZA 2R87A 5JRDS 4N18A 3V8NA 1Z73A 1T13A 1DAIA 2LCIA 3VISA 4BRWA 1A8IA 3L8EA 2YBDA 1YE3A 1QR6A 1U02A 4GGMX 4Z1MD 3NDIA 3CW9A 3N2ZB 4B75A 3PJRA 4EAQA 3I07A 1ZLXA 5BSHA 1JRLA 1GRVA 3H13A 4WQMA 5EMLA 3QLUA 3P45A 3ZHYA 4IM7A 1I2DA 2Q5JA 3EIWA 1VLQA 1PUXA 3QJYA 4R2LA 1JT9A 1QP8A 1RI1A 2IGBA 4ZTZB 2R1VA 4FKMA 5JS8A 3DDCA 2R7KA 1TMOA 1ULAA 1RJGA 1ZNQO 2OD9A 2ZSDA 3A4NA 3L7YA 1FTSA 1Q2UA 4GZLA 3WQRA 5B3JC 3W5VA 2V8OA 2M6KA 4X8LA 4O2BA 4DBLC 2E2WA 4KWEA 4DAEA 5AESA 1VRVA 4R8KA 1OI4A 5EKUA 1UFVA 1ZS9A 3B1XA 4RORA 5CVTA 5LZ9A 1MJ5A 3SC6A 3RVPA 1FZTA 5AXAA 2OBMA 2IRWA 2PAAA 4W8GA 5K8FA 1DQPA 1N1GA 1MW8X 4AZWA 5EZSA 4FM9A 1P1RA 1ZD3A 1OLSB 1SOVA 2H5EA 3HJGA 4K0RA 4O2RA 3PDWA 4PLCA 4ISCA 1NMEA 1QV6A 1T8SA 2GAJA 2QZ9A 5KOYA 3F6SA 2R48A 1L5RA 4A6PA 5U9CA 3FOEC 3CZMA 2E6KA 2Q5IA 3DG9A 3KHSA 3GUYA 5JCZA 1WIWA 3AFHA 3KWFA 3SLRA 1FJXA 1E9EA 4MWBA 3VZSA 3Q3IA 5EWLA 1MH1A 4PLWA 4K9DA 2ST1A 4YIKA 3IQIX 4G1CA 3FUWA 4Y2PA 3VR0A 3DBHA 1GZ5A 2VI5A 1PG3A 1JZQA 4PFQA 5HQJA 2EV9A 3SIPA 3TAUA 5HZGA 3WLKX 5LP6F 4QFDA 3RTAA 1UMKA 1NW9B 3DO5A 5NULA 4XR4A 3GROA 2QQ5A 2Z58A 5ALVA 3DWEX 2AUMA 5JNTA 3IAUA 5CW2A 3H2TA 2QI9C 3EJWA 2GAFA 4BNDB 1MAUA 2CL7X 1Z8HA 3N6VA 3FOCA 5FPYA 4D3XA 4E1VA 1Z6QA 1ZR4A 1ECJA 5IMSA 3UV3A 1HQYE 4F85A 1ECFA 1ZOSA 3A04A 3EK2A 4C6SA 4XD2A 5GJCA 1DCFA 2GB4A 3UB4A 2VR1A 1RHKA 1DTSA 4HRAA 13PKA 5C3UA 3LDHA 4GWKA 1JFTA 1SWWA 1QHEA 2Z56A 3OU6A 4Q3LA 3SYMA 4W5NA 1IHXA 4G56A 2XQJA 3HU1A 2EEZA 4YONB 4MUJA 1PU2A 2EKDA 2QRHA 3I9V6 4MR9A 5CDFA 1QLWA 1W6RA 1WXFA 4DANA 4B80A 3JASA 2I7XA 1TIPA 3AIKA 3KEQA 1M1UA 3A4IA 1G2IA 2WD7B 4TX1A 5CH8A 3VTZA 2Z04A 1IBLC 3BE5A 3L9XA 3K0BA 5CAEB 2XCRB 1P7VA 2GKOA 3NHRA 4MCJA 2JNVA 5H16A 3CF0A 1C7EA 5HCIA 5KHAA 4CXMA 1Z0UA 1O9BA 2PSFA 1DUSA 1EEHA 1HDEA 1XRMA 1BDMA 1NWHA 5B1SA 3QA9A 1ZMBA 2QZ4A 1T4DA 3W6ZA 1V3UA 5BQXA 2R60A 5I7HA 1PFGA 2YICA 1QCDA 5H7XA 2X40A 4AX8A 4WV3A 1JDTA 5CHEA 5DHRA 5FTKA 3MELA 3J80A 4BXOA 4BPBA 1NRIA 2AEMA 1OLUA 3E03A 2WIFA 4V3BA 4X1YB 3TAXA 3WGKA 5C4MA 3SN6A 1KI4A 1LGYA 1RRKA 3TL2A 1PW5A 4Q7EA 2QEQA 4CKEA 3P20A 2C83A 2V6BA 3TR0A 4HV4A 4MV1A 4EJ0A 5IVKA 3B13B 4YCBA 4URZR 5IC5A 2IYVA 2QZPA 3KKZA 5LA6B 3V34A 4PAWA 2ZANA 1MQAA 2AZMA 2GUWA 1W88A 4KP7A 3W9BA 5BN4A 2FPOA 3HL0A 4GYWA 5FB3A 2HRZA 3LI2A 1ZQ9A 1A5BB 4TTVA 2P68A 1XDBA 2G5GX 1CEXA 3KPYA 4GPAA 3LM8A 2DXIA 1CUAA 2OKGA 2IBMA 3FTFA 3RK4A 2YL2A 1QRAA 1F3OA 1FFCA 2EFJA 5HR5A 4QXRA 1A50B 2JJ8A 2Z5VA 3K9NA 3A1TA 3LHKA 4TV9A 4Y1RA 5DN9A 3EA5A 1PUIA 2QQEA 2XTMA 1KJ8A 2O07A 1RI4A 3B53X 1DBWA 4O5OA 1GAQA 4HLDA 4R0VA 1R0BA 4M0DA 1F8GA 2C9MA 4MQMA 1J8MF 1DC8A 4NMLA 5CVVA 4TYQA 2AEFA 3RWBA 3UF0A 3LHFA 2PRKA 3B51X 5J4HA 1JLLA 2QGZA 4YBZA 1ENOA 2VYFA 3C6YA 2VDMB 1MORA 3H1PA 4TL9A 3S5UA 2ZRNA 2FV8A 3SXUB 4FILA 4RK4A 1SC6A 2VTBA 5DIZA 3P2YA 2GYUA 4M9CA 3PQDA 2NUPA 5JXJA 1E7QA 2YXPX 4L0MA 2WU4A 3QXSA 2IWRA 1M83A 4I46A 2AKEA 1NKVA 1Q2XA 1RYZA 4CG2A 2I4NA 2UVDA 3GPBA 3EXIA 1OAOC 3JAKB 2RJOA 1SG6A 1ZN8A 3B2EA 3MJVA 4DMKA 3PX3A 2ISSD 3ZIAD 1V8ZA 2AZTA 5EXPA 4UFPA 4QHYA 2WAAA 1NMZA 3MCUA 1RTTA 4DMUB 5KEIA 1YFJA 1IHUA 2QU7A 5FQNA 2VWGA 4CKWB 4P7GA 2P40A 2VJBA 4DC9A 5KDLA 2GBLC 1A8HA 3GK3A 5EI5A 4Q3DA 1QC5B 2IUEA 4V24A 1E99A 1MG0A 3STWA 5HIAA 2FSPA 1F8YA 3A26A 2HWKA 3D3EA 3B5IA 2R1TA 3PXGA 5AVRA 1G38A 3JARB 3FROA 2P7IA 1SH7A 1Y5LA 3G1TA 4IHJB 4X7BA 1H2ZA 1HNZC 1FNMA 1MC1A 4L8FA 1ETHA 3LCUA 3TEJA 1PX2A 1UXHA 1L5VA 3GRRA 4AY2A 2A1UB 1IZ0A 3BX1A 3HVJA 4ZYVA 4KN9S 1DX4A 3C1UA 4WZBE 3UYLA 3JWIA 1YDHA 5BUZA 5JAIA 1QQAA 5LD2C 4EPYA 2HK8A 2D1FA 1LLDA 5FTJA 1C9EA 4G2NA 3LPLA 1NT2A 1UKBA 1N7HA 2C5HA 5A2QD 1MF7A 3QLTA 1IXKA 4YHHC 4INJA 2O2JA 2NUBA 2Q7XA 4PBTA 3RKSA 1ADCA 1J7JA 1QX3A 3DMYA 2YHAA 5DYGA 4YCLA 3CBGA 2V03A 2ET6A 1D2HA 1A7UA 1MA3A 1E5LA 2FPIA 3CLTC 2JHPA 1Y1LA 3BVPA 1I14A 4RYLA 1TU4A 2V7QD 1A97A 2B8TA 4A0RA 1NNEA 1TVKB 2ZBFA 3KRTA 1PD0A 4GL4A 4PC1A 2RHBA 4L4ZA 3L95X 4OSEA 1LZKA 4Z9XA 4NE9A 2PGIA 1QHGA 3DZBA 4ZVQA 3DT9A 1KJ9A 1AGNA 2JGKA 2PLWA 5LU9A 4HN9A 1WMAA 1QGUA 1P9LA 2AEJA 6Q21A 4L02A 2H1OA 3NWBA 2FEWB 4QPJC 3V2UA 4HWGA 3AK4A 4X91A 4M8KA 2X1LA 3RU3A 2AYAA 1EE2A 5AW9A 4ARZB 4BN0A 4EHHA 3T5TA 2B9EA 4GMDA 2BT4A 3JTEA 4F06A 3LFHA 1DUIA 1NR7A 1U3CA 3NVMB 2IIBA 2QTVB 4FEEA 4IMJB 4U9IS 3ZK8A 2YDYA 4CEHB 2QKYA 2OHOA 4ENTA 4I1PA 3PWSA 1PR5A 5C1DA 2AQIA 4NCHA 4FDAA 3F8TA 4BRSA 5JNVA 5DM0A 5AVJA 5FL7A 3S68A 1C7FA 1T8YA 1WB5A 3C1TA 1DJNA 5BNFA 4WVFA 3R9KA 2J5KA 2PUWA 4B47A 2MR5A 3SNHA 1V6SA 1GZSA 1VKRA 3QUTA 5EWJA 3LXMA 2J46A 2ATXA 1X7YA 1H8HD 2XCOA 2CBXA 1ZH6A 5ARBA 1U80A 4E2ZA 5FXMA 2V1XA 1Q14A 3PQEA 2HWYA 4FGSA 4BVBA 2AOUB 1T3LA 2A0KA 2GFHA 3FJYA 4Q6BA 2BHRA 3NMUF 2APJA 4PICA 5C53B 2PZEA 1C3EA 4UNRA 1QV9A 3Q7EA 2P77A 4NYMQ 3KD2A 1FSZA 3BJZA 1E58A 4D8TA 5B36A 4BN5A 4PLGA 1KO8A 1YZQA 4YP9A 3D3WB 2B5VA 3B6JA 1NI3A 1M6WA 2PANA 3E9ZA 5DTRA 4J0EA 5ESXA 3VU0A 4DSOA 4S0ZA 3VAYA 1BA3A 4LBYA 5FFNA 5JLJA 1NN0A 5JQGA 1UBLS 1L4UA 1LD3A 1C1DB 1IRXA 2PRSA 4JODA 4JXKA 2DMRA 4YDRA 4INPA 1YQQA 5AK4A 5AFSA 2BVNA 1X80A 2ZRIA 3BE8A 3UT5A 1ZMRA 1U11A 1X9GA 4FU0A 2GBIA 4QDJA 5KTKA 4U5YD 1C8LA 2V54A 2PRIA 3LGXA 1QFZA 4IGAA 3K9CA 2Z2XA 3HDQA 4HEA1 3VH4A 3M5CA 1ZK2A 4G97A 3CJRA 5KX5A 3IESA 4IEFB 3NNDA 4CLRA 1T3SA 5BN1A 4KL8S 3V4VB 2XE8A 5TLSA 3TVYA 1UOEA 3U0BA 3VGJA 1YZHA 3ZEIA 2CMHA 2H2GA 121PA 2PL1A 5JVDB 1WY7A 2QLNA 1CYEA 4B3MC 1SVKA 2FWPA 4I6JA 5C5EA 1QPGA 2B2CA 2EJBA 2VP0A 5SYNA 2GF9A 1SC3A 5T6MA 4RKQA 4TV8F 3TM4A 3RUCA 4ZK6A 2CL0X 2X7XA 1K1EA 5JDCC 3V1KA 3IOEA 4NH4A 3L0BA 1H0SA 4MKGA 3IKVA 3MBKA 1ZB9A 3AZQA 3HUDA 5IVDA 3CPSA 1M8KA 4N0QA 4MHSA 5CCBA 1P9RA 1UBFA 1WKVA 2QL7A 1HDOA 4LF8C 4DSUA 2D4AA 1JQEA 2E21A 4MMZB 5LCXA 2VP4A 4AQYB 3BXHA 2HRRA 4JHLA 2B99A 1E7YA 4I4IA 1SVOA 2OLKA 3R5KA 2UYCA 1XWFA 1WPGA 5HQ3B 2OL4A 3N74A 1L4KA 3PRYA 4UVHA 1IWOA 1QB7A 4N3GA 2JJ1A 4LA4A 4BFWA 1U7TA 1Z4KA 1UZAA 2O7RA 3IAAA 2WUEA 2YJ5A 2ZYTX 1SU7A 2ZLBA 1CJCA 3G9XA 4Q34A 4TWAA 3RBAA 3EAQA 3A58B 4TXMA 4G4SP 4K86A 2YXNA 2IHYA 2PFKA 1J5EB 1K92A 1ZGGA 5F2KA 3U5TA 1VGRA 1BEZA 1SFRA 2JAWA 4GOOD 5C4GB 4N6OA 3UW3A 3U61B 1FY2A 1O0SA 1W4ZA 3HJBA 4J0DA 4LE0A 3RS2A 1DUVG 3SNKA 3EF3A 3AINA 1PK9A 1M34E 3LL4A 3SYNA 3QPVA 5K0TA 2EP5A 3OA2A 4F97A 4ZV4A 1ZMXA 4QUAA 4AJ4A 3FOFC 4MKIA 1VLHA 5A0VA 1R74A 1MXFA 4EVSA 1WEHA 2V0NA 2FKAA 5B2FA 1O0CA 3LYUA 1YMUA 2GTHA 5KYYB 2NVOA 3CH5A 2Q21A 2VP9A 3VC3A 1MO2A 4DT1A 3KPVA 1U7DA 1FYVA 2D2IA 2YS7A 4K9NA 3WS7A 4FGZA 4BQQA 4FB4A 2EFGA 5ECYA 2W5UA 3ZBTA 4AJHA 1Q12A 1L4LA 1WS6A 5IK2D 1CE8A 2H65A 4KIWA 2WJIA 4B46A 2ZUWA 5JS7A 4QXQA 4B4VA 1E1DA 5GV8A 2AC7A 3NJ8A 3WA7A 1U4SA 3E9DA 1NBWB 4L72A 3RUFA 3VR4D 4GRDA 4MA5A 5ICSA 4C0KA 4HUTA 3WLIA 1NFRA 4L5IA 1E7SA 3K0EA 3NI2A 4JL6A 4MLPA 4XSVA 1NVGA 1I1HA 2OUKA 2ZJ4A 4DCOA 5FBWB 1U5AA 2NSYA 2RBGA 2O5RA 3CRNA 3QWHA 4S1WA 3MUNA 5JT1A 2Y4NA 3WRYA 1NJFA 4L7QA 1GZ6A 1RWXA 2ZJAA 3AXTA 4UU0A 4BCDA 4G5SA 5JO0A 1PJZA 3RDPA 1FQOA 2QTLA 1VMEA 1P77A 1YBAA 3D6NB 4K88A 4UHDA 4D57A 4XPIA 4YUVA 1KMCA 1FW8A 3JALA 2DFKB 4RZQA 3ONDA 1IJBA 3NC0C 1UEJA 4DCSA 1V39A 9GPBA 2QNBA 2EIHA 2OVBA 4WY5A 1V95A 5CLIA 4AF6A 4X62B 5D3ZA 1M2WA 1P0PA 3IBFA 1N77A 1RAIA 3R3HA 5EZYA 3VAAA 5HUJA 4DIFA 2P35A 1CY1A 5D51S 1J8FA 1BDBA 1PNTA 3BH0A 1QIFA 1QG2A 1MEJA 1N9GA 2G9QA 3DNMA 3R5FA 4XVUA 3LC7O 3I83A 2RJNA 3ESZA 4M86A 1G8FA 3ROEA 4KTVA 4EHAA 2HPHA 2Y1GA 1YBMA 2R6ZA 4M9UA 4F4DA 2WY2D 5JC1A 2G4CA 2A1IA 3HJAA 2B69A 2ZVJA 3LY7A 4LF6C 1SVLA 3DE4X 1WTCA 1HMPA 1XRAA 4ZFNA 1ULBA 3OESA 1NUQA 2OXCA 5KNLA 2CJYA 3IA2A 4QOJA 4AS2A 1WMDA 4JYAC 2YN4A 4MQEA 4IBOA 2CUNA 1ENPA 1A3CA 1JPNA 3AG6A 4UUNA 1XTIA 4UEJA 2BONA 1BMDA 2QG6A 3JQEA 1CTQA 5B2EA 1EXDA 2QSJA 4EKEA 1GTL1 1ZD5A 3E84A 3P9PA 5H02A 2PRJA 4HDOB 3C97A 5AKZA 4YAFA 4BNJA 1S2DA 2CLMB 5LZ8A 5A06A 4C22A 5ICMA 1N92A 5AVTA 1L7MA 2CW5A 3E5RA 4RL4A 3M81A 4IH1A 4EFNA 2NO6A 1XN1A 1HNNA 1B7GO 2HNAA 4PRYA 1TDJA 5G4KB 3L6UA 4EHKA 1Q7RA 1O95D 4IVNA 3TMYA 3EAGA 3F74A 1XNRC 3K4PA 1BZYA 3PQ6A 4WEQA 3K15A 2V9CA 2R25B 2HQRA 2QD5A 4IIJF 1OXTA 1XS3A 2AN3A 3W8DA 2ONZA 1GU7A 3KEGA 1HTTA 2PROA 3MJFA 3ZHSA 2OGWA 2C92A 3UMGA 1H2WA 1UODA 1N2BA 1W9HA 2PD3A 3GFQA 3D7KA 3IJEB 4L2IA 4ND7A 4ZT2A 3U9TA 3WQHA 4CIYA 5JAZA 4QGBA 5AXBA 4EY6A 4MKFA 1Y3AA 3P9XA 2X2OA 2XVAA 5EINA 5GM1A 4AJIA 1T10A 4ER0A 4XB6B 2MMAB 3UJ9A 4ZAGA 2H2HA 4QUJA 2YMLA 2JI4A 4WXMA 2H16A 3KG2A 3GJ6A 1QP7A 2Q45A 2Q9UA 3MQ2A 4BMNA 4RPGA 1S3GA 3C3BA 1LTQA 1YL6A 2XYGA 4IIHA 2DWQA 3FPAA 4DF3A 2UUAC 5AQ1A 3WP1B 4AYXA 3W5BA 2YINC 2DFTA 4YB8A 1LWNA 4YP5A 5JRZA 2XB8A 1GLNA 1RTKA 2WT8A 3I34X 1W87A 1XU4A 5HRAA 2Q2QA 1HFEL 1W8IA 3QYJA 5AYVA 2CDAA 3GC6A 3ZXXA 3E1KA 1ACMA 3KXDA 4MYSA 4K1LA 4MIEA 3UV6A 2PSEA 6GPBA 2GS9A 2V7WA 1H4QA 2LPMA 4CIWA 5L3SA 1GPLA 1W2WB 2P2YA 4ZJZA 1PT6A 1SZJG 2X2FA 2Y1EA 5JSZA 1OV6A 1I0ZA 4A4DA 1TO1E 1XXHE 2IJGX 1DC6A 1HQCA 2ZPTX 1CUVA 3H9JA 3NATA 1C1HA 1AUPA 3R5HA 4NOMA 4OXQA 2QE7A 4RMJA 4YFYA 3CWZA 5FOSA 5AKYA 2VDWB 3WLTA 4DR1B 1W0JD 4C4AA 1I9GA 2A58A 3L9WA 2FI1A 3D6HA 4AY6A 1N32C 1PFYA 3WRVA 3ZDQA 1SA0A 3AIMA 2NZJA 2ADMA 2PSJA 3WHKA 4D46A 5IWCA 4R5HA 2MINA 3FCYA 5ULLA 1G2OA 3P0RA 4YRDA 5JSFA 4D5EA 2OM6A 3EZGA 2PGJA 1Z0ZA 4AO7A 4C20A 4M0UA 4DEYA 5ALIA 4W5TA 1ESZA 5H59A 3CM0A 4DJTA 4EEXA 3ZBUA 3ZOZA 4DIBA 1G17A 3GFTA 2QJTA 1UOQA 1F4VA 2RK6A 2WIBA 3HCDA 3ZJ5A 2MSEB 4LHXA 1Y4AE 1NMYA 2VYVA 3CN9A 3I2JA 1U1FA 3A1SA 1I4LD 1AUXA 3I64A 2FTKE 3MAAC 3MJRA 2FGKA 2C99A 3ILYA 2GD1O 1VBFA 3LF1A 1FDSA 1P2DA 4ARUA 3M4XA 3BHIA 2QL5A 3F3SA 3WO0A 4GYJA 4JIMA 3W78A 1SXIA 5AM2A 3WIEA 1JQJC 3EFHA 1LPBB 4RE6A 4IG9A 2ZETA 1N2JA 4UBNA 3RFFA 4R9NA 2L2QA 3FSGD 5IZCA 4Z4GA 2QRLA 2NM0A 2EIXA 4C7VA 2BGTA 1Q7CA 3KALA 1U3FA 2QAIA 5EEGA 3JYNA 2CFCA 3MG9A 1OXSC 3BQNB 2N46A 1ZP6A 1U7HA 2NWQA 2ZUDA 4KAAA 1SIBE 2HUNA 2R97A 2R86A 1ZD2P 1R5JA 5MN5A 1NHGA 4JBLA 3EASA 3H9EO 4RLFA 4IUYA 2X3UA 3TQOA 3C2QA 4BC1A 2EW8A 3C7CB 5FAKA 1G16A 1GR0A 5EXEA 3MB5A 4X1KA 1QF7A 1P5JA 1WMBA 3DV0A 5IYZB 3ZD8A 2C4TA 4LOJA 4Y1GA 2ZBDA 4CG0A 5IBQA 2QLLA 5ECGC 5FTNA 3T3HA 3NBQA 4FLEA 3NWOA 4MI6A 1IY2A 4HTAA 1A71A 4NEQA 4PXAA 2M1XA 3R76A 2ECPA 3RVLA 1P0QA 1R6AA 1D09A 1MVLA 4CKXA 1SG9A 3T12A 4H6PA 4P58A 4ZO8A 1CUCA 3MT9A 4JGBA 4RGYA 1YQ9A 2EXXA 4C87A 1TZMA 2HT6A 4JLSA 3HZRA 1VECA 1NSYA 1M8GA 3WP0A 1YRHA 3UT0A 1S8OA 3HCOA 2EKZA 1LI5A 4WZAE 3ROFA 1WZNA 3H5NA 3TCXB 3U1TA 3ZK7A 4CMKA 4EPXA 1QYIA 3DT6A 3OZ7A 1E3MA 4LJ7A 3NC4A 1QV7A 4U2GA 3I2KA 2D62A 1CXZA 2WU0A 1QS0B 3HACA 2B36A 3CKKA 3NM6B 2UZIR 3W5CA 2GAOA 3OQ1A 5CX1B 5TMDA 1J0DA 1R0CA 3AW9A 4BYMA 3CEAA 4LXQA 4I50F 1SXJD 1WZEA 1PHPA 2C2GA 3A32A 5B3JA 5D5PA 4WBNF 1KK0A 2ONCA 5H9UA 1DT5A 1TF2A 1X1CA 3KCNA 2EW2A 1ZCFA 1CZKA 5DT9A 1YR9A 1W93A 3VJRA 1BCSA 4XSHA 3E6AA 1FYWA 3MTDA 2IXDA 3LKDA 3NT5A 1RS0A 5EJMA 4PGHA 3OFKA 1RRCA 5IBCA 3F90A 3ZIDA 1KZ1A 4PG8A 1BYUA 3I30X 3O3CA 4UCFA 2XCTB 2XNDA 4U8GA 4X45A 4D45A 5HKAA 3JD2A 4RM3A 4W99A 3HCFA 5G1PA 2BDTA 4UC0A 2NO5A 3R6WA 1UP6A 2J0VA 5LQAA 4MZDA 5G41A 5ENDA 1EK1A 3WISA 1EGHA 5GJVC 3V4RA 2XX3A 3AVOA 1L5GB 4YY3B 4M8IA 4JUFA 4K26A 4P4SA 4OQXA 3JWPA 3X2EA 1P9OA 3HKDA 2EX0A 3QMMA 2AYYA 1XYVA 2X7HA 2BUCA 2EBHX 3BGSA 3DVRX 4F60A 3R7LA 1DFGA 2ZUEA 4PYNA 3SF8B 1WPXA 5JEDA 2C3OA 1P4EC 1SKMA 4BNZA 1VSTA 2XMZA 3G6WA 4K8RB 1MZVA 4BC0A 4F12A 2QXUA 5FPSA 3GB9A 4ZJYA 1MX5A 2GPWA 5K3FA 3G0CA 3KB8A 2W2XA 5I5GA 5H9WA 3B60A 4KMMA 4XWTA 2QVLA 2XUKA 1D2MA 1ZWKA 3WGZA 5LQRA 2J9YB 3BICA 3DA8A 4M7OA 4NBWA 4Y8VA 1Z0SA 4EX6A 4MAAA 2BKUA 4XWYA 2J9GA 1XD9A 5CNMA 2PKQP 5BUSA 5LBTA 2VBGA 4OJKA 4G63A 2R7AA 1VEHA 3N76A 2Y1LA 4I7EA 2VZ0A 1RBQA 2C57A 2I67A 4C21A 5LN1A 2WYVA 1ABEA 4MRMB 1DTEA 2BH2A 3MWDA 2W6NA 3IP8A 4E7OA 5C4IA 3GLIE 5C18A 4R2KA 2LIPA 4OA8A 5EYPA 3LUDA 4GBJA 3BEDA 4UARA 3PI6A 3BA1A 4HH1A 4IX1A 1C0KA 3CLVA 3MFYA 4NXNC 2YJ3A 1N0WA 3AEUA 3A6LA 4PY2A 1OFHA 3H7IA 5FPKA 4NBLA 1CRQA 4LOHA 4EHIA 2EGGA 4YCMA 2FX3A 4A36A 1NLYA 4TTTS 3HU3A 4KPGA 1PJBA 1SBNE 3GLQA 5FI5A 1TFUA 4H6VA 3RQSA 1Y4ZA 1ZA2A 2AG5A 3OO0A 1ESNA 4F4CA 3K9FC 4IKOA 1JEJA 4LFAC 1E8MA 1A88A 3L92A 1VHJA 2VDRB 4ZDJA 3TRIA 5F9MA 3S55A 4CMIB 5L3QB 4LFBB 2XCLA 1KJZA 5AVQA 2IUSA 3EXFA 1JAXA 1QGED 3KAKA 1DIRA 3NO4A 4UW9A 2PZAA 5EKDA 4XTCS 4R2JA 1EMDA 2FWMX 5T8KA 2NU8A 3U4CA 1JZTA 3CZ9A 2V6FA 4TZKA 5KJ6A 4UFNA 5HKKA 1PNOA 1Y37A 4S1VA 3MTGA 5HE9A 3ROTA 5FLXA 4G8CA 3RCBA 3L2OB 3EC1A 4ITUA 3GLHB 4K6GA 4BASA 1YQUA 4MW9A 1K5HA 3D8HA 4POOA 1L7QA 3VR4H 1XTVA 5CT4A 5JAUA 1HH2P 1RHQA 1CUZA 1KMHA 3G13A 4U7PB 3KD3A 4L3VA 2VT6A 5DMXA 2O8FA 2H00A 1Z0AA 3BCHA 3OY2A 4LJKA 1FU4A 4UTXA 1ECPA 2BE7A 1U9IA 5EIEA 1RLOA 2OB2A 4C7BA 4QG3A 1YHNA 2GZ3A 4PV7A 4DLLA 2X5KO 1ZEMA 4OP3A 1DJOA 2R6CA 3L1UA 4IY1A 4IF6A 4L28A 4NV3A 4RETA 3EWSA 1T29A 4A0SA 4B5LA 4B40A 5KTRA 2QRVB 4X9XA 3UGJA 3JY6A 4EARA 4OF4A 3THSA 2JGJA 2P8SA 3H2HA 2NTNA 2WV7A 2DFNA 4JELA 1D07A 4YGXB 3MJHA 4FFBB 4EG5A 1XZHA 1QHNA 1ZMOA 2I3BA 3EG9A 1QH9A 2DHEA 4B09A 2V4MA 3PGMA 5K6TA 1ISJA 1G5QA 3ACCA 4UDOA 3CNOA 3D0OA 5HCUA 4AF8A 2XW6A 3A4TA 3CB4A 5SZJA 3AQIA 4MR7A 5HE8A 4Z2AA 4INOA 1Y6FA 1P80A 3GKUA 1M6XC 1T1GA 1CVIA 1SIWA 2AL7A 1ISPA 2A33A 2Q3BA 3OBBA 3OZXA 3QLJA 2AMYA 2B21A 3HJRA 5CCXA 3NQ41 4XYGA 4FJ2A 3KLPX 1KI8A 1KR5A 1PHRA 5KAPA 1NYRA 2CE2X 5EIAA 4LZZA 1FQWA 3DOIA 4PGFA 4NPHA 1OAOA 3BWBA 4YIHA 5IBRA 4W6ZA 5FNVA 1BGXT 2OG1A 1N2CE 1XV5A 4UDNA 4HQNA 5FAXA 3CVXA 1QSGA 1U7PA 1U0LA 1ZJ5A 2VATA 4N3AA 1XZ8A 1F8XA 3UH0A 4XIIA 3N6RA 3OKCA 4ETMA 1ZM3A 3LAWA 1UQUA 1VL2A 3S1AB 3WZLA 1ZGCA 2DUJA 2GBLA 3FVWA 5COAA 4AIIA 4RLHA 4TTIA 5JS2A 2J6IA 1GCUA 2PD4A 3W9YA 1GEGA 2W6IA 3W2TA 1RWMA 4J3NA 4C14A 1JW9B 2W2LA 2WTMA 2R85A 3HB0A 2YN0A 4TGLA 1GTZA 1FP7A 1K3UB 3SR4A 2QD4A 3EN0A 4YECA 3W5UA 3Q12A 3WMGA 1I36A 3WB2A 5EE1A 2Y9PB 3DZFA 1QYVA 5ADVA 2VTEA 4URYR 1RXIA 1NWCA 1N5IA 2W6MA 3SOPA 3AI7A 2VBFA 3NBXX 3V00A 4FXPA 3RHZA 4RFSA 3G17A 1K4KA 4IDGA 2QMZA 2AIRA 4DNPA 5ALUA 2PBRA 3BE4A 3BA6A 5F2EA 2I2DA 1JEYA 2PPLA 4ND1A 1R0SA 1B15A 1MNAA 4MO2A 2QMQA 3ABIA 3I09A 3M1AA 4JI2B 3NHKA 2CL5A 4FMCF 2H51A 2N0SA 4GVPA 4JASB 4G0YA 4NU8X 4KMOA 2C94A 3NJ4A 3U3RA 3WE7A 4AP5A 1DOAA 1EUYA 1V8DA 1Y7PA 2ID7A 4NS1A 5IVIA 1VIYA 4EUEA 4EYSA 4D42A 3P19A 5CDUA 2QROA 1RLUA 2TSYB 3OE1A 4KHZA 1BN6A 2COEA 3V5NA 1H8EA 1VJ5A 3DYBA 1W4CA 3F73A 2FXIA 2H57A 4LN1A 3QVGA 2QRQA 3FPHA 3D3KA 4DC0A 2NTJA 3ROXA 2QRZA 1V11A 3QBTA 2H1RA 3KB1A 3CKMA 3PVCA 4JBWA 4M9XA 4LYAA 5EIFA 3VZQA 3WWOA 1P29A 3L8MA 2ENWA 4YUXA 1FFSA 4UHFA 1KNQA 1B8UA 4N3BA 3ZV3A 4PGGA 2IPLA 4BO4A 4CYMA 1WXIA 3PZRA 4BSZA 1HT3A 1TM7E 4L8YA 4DM4A 4ZN6A 4ZHSA 5JMOA 1P3DA 2BRUC 3DTVA 1WPRA 3G2KA 1CJKC 1YVEI 3PU6A 4ECEA 5KX5F 4TMVA 2H8KA 2XT9A 1J0AA 2ERYA 1OBHA 2I80A 3QPDA 3FXAA 4QUKA 4DLRA 3FVQA 1DBQA 2VDVE 2IDZA 2VDLB 4RKRA 4JLUA 1QIKA 4R8LA 5DEIA 1W36D 1ZL0A 4BFVA 5TGZA 1V5EA 3HBLA 3M33A 3ZTTA 4ES6A 1XK7A 5ILGA 2QLFA 3JYHA 4PAQA 4XLZA 3MT7A 2HU2A 1IOVA 2E6UX 2E4VA 3GT0A 1UCFA 1UM9A 5EY5B 3RU2A 1OAAA 3ZQ6A 4MRRA 3TGWA 5BRAA 1TQ4A 4AS3A 1OYWA 3EW9A 1JOSA 1W44A 4H15A 5DGDA 2PT7G 4V1CA 4TT8A 2ZIZA 4BVLA 1VA4A 4D9BA 1GRNA 3U6BA 1SZDA 1W5EA 1U2QA 1VTKA 2Z5GA 1P7YA 1X86B 3DVAB 1Q7GA 1JSRA 3MT8A 3OCXA 4OL0A 5IJAA 4HXYA 1I9CA 1MEEA 4ZRMA 4D2IA 3LCMA 3B1FA 4MW2A 1LK7A 3D5EA 2UZAA 3PI7A 2ADOA 3BMCB 1SUWA 1OYVA 2WSYB 2P3LA 2W90A 3NANA 3VJKA 2CLIB 1G63A 3AL3A 4YJ3A 4KTTE 5JWHA 2ZUFA 4ZICA 3WGLA 2XOEA 1XHFA 4KPFC 1RLTA 1T9GS 3RVMA 5L6LB 4DAOA 3HRIA 3L77A 5J4LA 1QVVA 3QP9A 4IOKA 4KZKA 2ZZMA 1G41A 4Z9AA 1K0RA 1G3RA 3OZTA 4MNTA 1RKUA 2A1TR 4CL0A 1H2EA 3K8YA 2YWXA 2Z43A 1NJ5A 3PHJA 1QDUA 1M5RA 2PT5A 1F2UB 1H1TA 2L17A 1Y8QB 2RBKA 2CHQA 4B4DA 1P7ZA 4DQKA 4JA0A 1UPAA 4MXDA 1XAHA 2WNHA 2N42A 2P8JA 4CU2A 1V16A 5TB5A 2YQ4A 3AF4A 1JLKA 2OM2A 4C4XA 3ZCQA 4HZUB 3I9V1 2YJNA 4JI4C 4BJ5A 1AKUA 4RPHA 5ALQA 2ZWMA 2O19A 1D1QA 2O0LA 4BFYA 5E6RA 4UTOA 4K03A 5TQVA 1PZNA 1X1QA 1RRPA 2HKIA 5BV2P 1Q0TA 5BMOA 5AW1A 1Y34E 2I2BA 4A2WA 2C2ZA 3JXEA 4NSNA 4YDQA 3A6FA 3HCRA 1SEPA 5FEMA 4BECA 1YZFA 5JDCA 3AVTA 4TWZA 4EI7A 3IB6A 2V6MA 3UMYA 3ETOA 3H16A 3WKDA 1VJDA 3CHYA 4LYHA 3ITDA 1KMIY 1N4DA 2AOXA 2JHGA 4R8MA 3VDXA 4BJHB 4BGDA 2Q0QA 3Q6IA 1TUBA 3KVRA 3LJKA 5AHWA 4ERNA 5HKOA 4IO1A 3LLCA 4OKSA 3AY6A 3W9SA 3Q40A 3IRUA 4BP3A 3X1YA 7GPBA 1FXWF 2QTMA 2JIQA 3PC4A 4LMAA 1Z4LA 2B0CA 3ITEA 4RDCA 5K0FA 2F9LA 3OJLA 2P20A 1KSFX 1C0LA 4X8MA 1U0HC 2V45A 3WK8A 4ARIA 3GMDA 1ZK0A 4J03A 2YRXA 2D0IA 4EYOA 4YJKA 4DBZA 3ZC3A 3HKEB 4Q3CA 3M89A 3VI3B 4DIMA 4X54A 3BH6A 3LNVA 3PUWA 4MV7A 3I1YA 2CT8A 1G5PA 4XD7D 1JIJA 2P2NA 2BGJA 4NBVA 3RVNA 4JVSB 4JLBA 521PA 2CNNA 5LP6B 3TG8A 3ICVA 4QA9A 4U5XA 5H80A 2O2CA 3TNYA 2WK1A 3RTGA 1LJ8A 1RWNA 2AK3A 3TEFA 4A0FA 4ER7A 4MUYA 3AJAA 3BFPA 1O97D 2ERCA 3IS3A 3HG7A 3GJYA 4FFRA 2VSOA 1JWAB 2RCNA 2VJDA 5J5AA 2FN7A 3F96A 3W6OA 1N2SA 2C5EA 2NSDA 5D01A 3DPSA 3ZNOA 1Z9BA 1KJNA 3HU2A 4RA6B 2EKPA 1E1MA 3RRYA 3U5ZB 2IW1A 4U6SA 2G1AA 3PL1A 2OHJA 1FUGA 2HL6A 3L8YA 4TTRA 4B2IA 3GFBA 4GQIA 2PUCA 2MCQA 2NO9A 1XE3A 4CKBB 2OWDA 4Z0NA 3E70C 4IIDA 3KQQA 4C2BA 1PLKA 3NVDA 2QS9A 3UX2A 3DAPA 1N6OA 5K1ZA 3AR6A 4RMHA 1EVYA 4BLUA 1JHPA 4CKYA 3M7IA 3VM6A 1M7BA 3A3YA 3NAGA 1ODLA 4GKVA 2WZCA 3K9LA 4ON9A 3I6ZA 5B1DA 1BCRA 3PC7A 3OT5A 1XCOA 2BUBA 1D4OA 4JYPA 3O4HA 3UOGA 4NRDA 4E32A 3HXOA 4KI7A 3UBTA 3KYDA 1KI6B 2NTVA 2B8NA 2XE7A 3I6MA 2JZOA 2D2FA 3OIFA 4Q1DA 4C89A 5CIYA 2RE8A 4M22A 5B2ZA 3RJ5A 4DMCA 1HOXA 4YR9A 3H1AA 4MWGA 4PZDA 1XPJA 5SZHB 2GVZC 4JYZA 1UINA 1A77A 1WNTA 3A2LA 4UM9B 3KQLA 3F47A 4MARA 1VA5A 2UDPA 1F51E 4Y0VA 5AP9A 5EP4A 1B6SA 2FPPB 4I2VA 1JDBB 4MRAA 1RYNA 1XVIA 1Z5UA 3DCYA 4B3XA 3LLUA 2I1WA 3Q3HA 3HI6A 2E49A 1G1MA 3A2NA 1OWLA 2XVZA 1FDIA 2F3TA 4LKRA 3H1GA 1YI8A 2W0MA 2YWCA 3AJEA 1OZAA 1A9YA 2CU6A 2R8RA 4OHUA 2DERA 1IBSA 1ZY2A 4K6CA 1GPNA 1OUMA 5J23A 1LK0A 2X76A 1JECA 3AVPA 3C0KA 1Z3CA 4QICA 4R2WA 4MPTA 2NUAB 4E5DA 5BNIA 1UWLA 2MDTA 1R0ZA 5JBIA 5L7TA 2GZ1A 4GLBA 1BMQA 1C3XA 1P44A 2ZVDA 1C3OB 3U3DA 3ZW9A 3RV2A 2Y9MB 4D8UA 2XTNA 1FFAA 5E1BA 2OGUA 3IB3A 3NDRA 2TYSB 2IP1A 4URXR 3KR1A 3AF6A 2JBHA 4DZRA 1YBFA 4CT0A 3JR7A 3N7AA 1AQIA 3JPYA 2FMTA 3TW6A 1RRMA 1KJIA 3GJSA 3GMSA 3K5IA 5GOZA 1GT6A 2ANBA 4LTDA 2E5LC 2EEPA 4AM8A 4EHBA 1M2HA 2XA9A 1MBZA 2FPSA 3F4BA 3VH1A 4JKOA 4QZVA 1FLOA 2ZZNA 2AG8A 2ZRHA 3HMQA 3TNDA 1D03A 3WWEA 5FJJA 4M1EA 1T8TA 1Z45A 4PGAA 1YS6A 2O2HA 4OXYA 3KJGA 2HK9A 1LWOA 1HQDA 4G0WA 4WUTA 4JN6B 1XZFA 2XSZA 1T2FA 2GEKA 3M6VA 1ZIOA 3F3YA 1NI4B 4JROA 1FVFA 2ZIXB 3WJ1A 1O03A 3AXSA 1Y48E 2A6PA 3HDHA 1DZIA 1Q74A 3TTYA 3TW8B 1EWVA 3QXJA 2HF8A 1T9GR 4Y98A 3HJHA 3IP5A 2JJ2A 1SHTX 1ZB8A 4BLWA 1P0FA 3VR5D 3CO0S 3H2IA 2AHRA 1K08A 4B71A 1A7KA 2BZ0A 2J7PD 1KKGA 3DB2A 3UAVA 4EW2A 3BD7A 5HM8A 3EPJA 1WB9A 1EPUA 1XWIA 2ZTLA 1EJ0A 1ZINA 2I62A 3MTIA 3NBYC 4R8RA 1K5GA 4YAOA 1E92A 4NESA 4HLNA 3L0SA 3DEHA 2PV7A 3HBJA 1O9GA 1XTKA 2HI0A 2LCFA 3OVMA 4RJKA 4WADA 4YRGA 2Z51A 3EYAA 1V6CA 1VL1A 2W4MA 5L8VA 1XCBA 1YB1A 1R50A 2HJ9A 1GGVA 1JU9A 3ADOA 3GIDA 3H8VA 3L0YA 4CIBA 3P26A 3T3GA 4XLTA 4KPEC 1JQ3A 2Q1SA 3KE8A 3MOSA 1G291 5L9AA 2Z83A 2JAUA 1X8XA 3PT5A 5L4SA 3N2IA 4L4SA 4WKPA 4H1WA 1W85B 4ZHQB 1QVRA 3JWEA 4Y6OA 2F9MA 4P7KA 2ODPA 3L40A 3H0EA 3TQRA 3TTXA 5BXQC 4B3SB 1X19A 1YIOA 3B1WA 3QLVC 3LRXA 4BWVA 1Q7TA 4ZVRA 1R4ZA