4GY9A

Crystal structure of medicago truncatula nodulin 13 (mtn13) in complex with n6-isopentenyladenine (2ip)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
163
structure length
163
Chain Sequence
IDPFTMGVITSESEYVSSLSAEKLYRGIVEDGNIIYPKALPRFIEKAETLEGDGGPGTIKKLTFVGDFGSTKQHIDMVDRENCAYTYSVYEGIALSDQPLEKIVFEFKLVPTPEEGCIVKSTTKYYTKGDDIELSKDYLEAGIERFEGFTKAVESFLLANPDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MtN13 protein
publication title The landscape of cytokinin binding by a plant nodulin.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Plant protein
total genus 38
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00407 Bet_v_1 Pathogenesis-related protein Bet v I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 4gy9A00
2E3NA 3RD6A 1TXCA 3FO5A 4JDLA 4C94A 4DSBA 5E4BA 3CNWA 5C9YA 5BRLA 2NS9A 2R55A 1XN6A 1T17A 4LGAA 1LN2A 3Q63A 1T27A 2LPXA 3OTLA 5JO2A 2GKDA 3UIDA 2L65A 3KDHA 3KL1A 3JRQB 4N0GC 4C9CA 1BV1A 2VQ5A 4Q0KA 1XDFA 4BTZA 5JNNA 2MOUA 2I9YA 1XUVA 4A84A 4XRTA 4A85A 2L9PA 1X53A 4B9RA 3P9VA 3E85A 3H3SA 3NMHA 1H2OA 2PCSA 4GY9A 3IE5A 1TW0A 4A80A 1Z94A 2EJXA 3K90A 2E3OA 3OH8A 4A8GA 4IGVA 1FM4A 3NR4A 3NEGA 2Z9ZA 3TVRA 1ZXFA 1LN1A 1LN3A 2LGHA 3NMTA 2LIOA 3IJTA 3PU2A 4LG5A 4IGXA 4A8VA 4BKCA 3OJIA 4REIA 4BK6A 3KB0A 3NS2A 4BK7A 3OQUA 1XN5A 4BKDA 3F08A 2RESA 2BK0A 2QPVA 3W9KA 1B6FA 2REZA 2N4AA 2LE1A 2M89A 2Z9YA 4IHRA 4R7KA 4RYVA 1E09A 2L8OA 4A8UA 5I9JA 2M47A 3WG8A 2FLHA 3UJLA 4C9IA 1EM2A 4IGYA 1KCMA 3H3QA 4REHA 3R6PA 3P0LA 2VNEA 3KLXA 4IH2A 4IGWA 4MAPA 2E3QA 3UQHA 5E46A 3NMPA 4JHGA 4REJA 4JHIA 4WVOA 4DSCA 1BTVA 4PSBA 2QIMA 1IFVA 1UW5A 3W9RA 4OICA 2LAKA 5E4DA 3P51A 2E3SA 4DS8A 4IH0A 3NI8A 2KEWA 4MA6A 4A81A 4Y31A 2K5GA 3Q64A 2E3PA 3KAYA 3K3KA 2A1LA 1ICXA 4A87A 2KTEA 3KAZA 4Z3LA 2LF2A 3NJ0A 3TL1A 3NMNA 2LUZA 2E3RA 1QMRA 2KF2A 3GGNA 4M9WA 4A83A 2LDKA 3C0VA 3KB3A 1LLTA 3NJ1A 2KCZA 3QSZA 4MNSA 5JO1A 3KDIA 2NN5A 2N4BA 3NMVA 4JHHA 3TFZA 2PSOA 2FFSA 3RT0C 3PUTA 1VJHA 4FPWA 3RT2A 5I8FA 3NEFA 4A86A 4M9BA 3QN1A 3TVQA 2D4RA 5E4MA 2LCGA 2RERA 4LGBA 2LEQA 5AMWA 2WQLA 4QIPA 3ELIA 1XFSA 4XRWA 4N3EA 3KDJA 2Q3QA 1JSSA 3JRSA 2K7HA 3Q6AA 3H3RA 1FSKA 2E3MA 3H3TA 2IL5A 3NJOA 4JDAA 4LA7A 3ZVUA 4A88A
chains in the Genus database with same CATH superfamily
2E3NA 3RD6A 1TXCA 3FO5A 4JDLA 4C94A 4DSBA 5E4BA 4QDCA 3CNWA 5C9YA 5BRLA 2NS9A 2R55A 1XN6A 1T17A 3NQNA 1LN2A 4LGAA 3Q63A 1T27A 3F73A 2LPXA 3OTLA 5JO2A 2GKDA 3UIDA 2L65A 3KDHA 3KL1A 3JRQB 4N0GC 4C9CA 1BV1A 2VQ5A 4Q0KA 1XDFA 4BTZA 4JHYA 2MOUA 5JNNA 2I9YA 1XUVA 4QDFA 4A84A 4XRTA 4A85A 2L9PA 1X53A 4B9RA 3P9VA 3E85A 3H3SA 3NMHA 1H2OA 2PCSA 4GY9A 3IE5A 1TW0A 4A80A 4NCBA 1Z94A 2EJXA 3K90A 2E3OA 4NCAA 3OH8A 4A8GA 4IGVA 3HK2A 1FM4A 3NR4A 3NEGA 2Z9ZA 3TVRA 1ZXFA 1LN1A 1LN3A 2LGHA 3NMTA 2LIOA 3IJTA 3PU2A 4LG5A 4IGXA 4A8VA 4BKCA 3OJIA 4REIA 4BK6A 3KB0A 3NS2A 4BK7A 3OQUA 1XN5A 4BKDA 3F08A 2RESA 2BK0A 2QPVA 3W9KA 1B6FA 3HM9A 2REZA 2N4AA 4E6FA 2LE1A 2YH6A 2M89A 2Z9YA 4IHRA 4R7KA 4RYVA 3DLHA 1E09A 2L8OA 3HO1A 4A8UA 3GTSA 5I9JA 2M47A 3WG8A 4N41A 2FLHA 3UJLA 4C9IA 1EM2A 3GL0A 3GB4A 4IGYA 1KCMA 3H3QA 4REHA 3R6PA 3P0LA 2VNEA 3KLXA 4IH2A 4IGWA 4MAPA 2E3QA 3UQHA 5E46A 3NMPA 4JHGA 4REJA 4JHIA 4WVOA 4DSCA 1BTVA 4PSBA 3TGOC 2QIMA 1IFVA 1UW5A 3W9RA 4OICA 2LAKA 5E4DA 3P51A 2E3SA 4KPYA 4DS8A 4IH0A 3NI8A 2KEWA 4MA6A 4A81A 4Y31A 2K5GA 3Q64A 2E3PA 2ZYLA 3K3KA 2A1LA 3KAYA 1ICXA 3GL2A 4A87A 2KTEA 3KAZA 4QDDA 4Z3LA 2LF2A 3NJ0A 3TL1A 3NMNA 2LUZA 3GTEA 2E3RA 1QMRA 2KF2A 3GGNA 4M9WA 4QCKA 4A83A 2LDKA 3C0VA 3KB3A 3HXMA 4QDFB 1LLTA 3NJ1A 2KCZA 3QSZA 4MNSA 5JO1A 3KDIA 2NN5A 4N76A 2N4BA 3NMVA 3GKEA 4JHHA 3TFZA 3HVRA 2PSOA 2FFSA 3RT0C 3PUTA 1VJHA 2LAFA 4FPWA 3RT2A 5I8FA 3NEFA 4A86A 4M9BA 3QN1A 3TVQA 2D4RA 5E4MA 2LCGA 3DLBA 2RERA 4LGBA 2LEQA 5AMWA 2WQLA 4QIPA 4N47A 3ELIA 1XFSA 4XRWA 3HJFA 4N3EA 5EKQC 3KDJA 2Q3QA 1JSSA 3JRSA 2K7HA 3Q6AA 3H3RA 1FSKA 3GOBA 2E3MA 3H3TA 2IL5A 3NJOA 4JDAA 4LA7A 3ZVUA 4A88A
chains in the Genus database with same CATH topology
2E3NA 3RD6A 1TXCA 3FO5A 4JDLA 4C94A 4DSBA 5E4BA 4QDCA 3CNWA 5C9YA 5BRLA 2NS9A 2R55A 1XN6A 1T17A 3NQNA 1LN2A 4LGAA 3Q63A 1T27A 3F73A 2LPXA 3OTLA 5JO2A 2GKDA 3UIDA 2L65A 3KDHA 3KL1A 3JRQB 4N0GC 4C9CA 1BV1A 2VQ5A 4Q0KA 1XDFA 4BTZA 4JHYA 2MOUA 5JNNA 2I9YA 1XUVA 4QDFA 4A84A 4XRTA 4A85A 2L9PA 1X53A 4B9RA 3P9VA 3E85A 3H3SA 3NMHA 1H2OA 2PCSA 4GY9A 3IE5A 1TW0A 4A80A 4NCBA 1Z94A 2EJXA 3K90A 2E3OA 4NCAA 3OH8A 4A8GA 4IGVA 3HK2A 1FM4A 3NR4A 3NEGA 2Z9ZA 3TVRA 1ZXFA 1LN1A 1LN3A 2LGHA 3NMTA 2LIOA 3IJTA 3PU2A 4LG5A 4IGXA 4A8VA 4BKCA 3OJIA 4REIA 4BK6A 3KB0A 3NS2A 4BK7A 3OQUA 1XN5A 4BKDA 3F08A 2RESA 2BK0A 2QPVA 3W9KA 1B6FA 3HM9A 2REZA 2N4AA 4E6FA 2LE1A 2YH6A 2M89A 2Z9YA 4IHRA 4R7KA 4RYVA 3DLHA 1E09A 2L8OA 3HO1A 4A8UA 3GTSA 5I9JA 2M47A 3WG8A 4N41A 2FLHA 3UJLA 4C9IA 1EM2A 3GL0A 3GB4A 4IGYA 1KCMA 3H3QA 4REHA 3R6PA 3P0LA 2VNEA 3KLXA 4IH2A 4IGWA 4MAPA 2E3QA 3UQHA 5E46A 3NMPA 4JHGA 4REJA 4JHIA 4WVOA 4DSCA 1BTVA 4PSBA 3TGOC 2QIMA 1IFVA 1UW5A 3W9RA 4OICA 2LAKA 5E4DA 3P51A 2E3SA 4KPYA 4DS8A 4IH0A 3NI8A 2KEWA 4MA6A 4A81A 4Y31A 2K5GA 3Q64A 2E3PA 2ZYLA 3K3KA 2A1LA 3KAYA 1ICXA 3GL2A 4A87A 2KTEA 3KAZA 4QDDA 4Z3LA 2LF2A 3NJ0A 3TL1A 3NMNA 2LUZA 3GTEA 2E3RA 1QMRA 2KF2A 3GGNA 4M9WA 4QCKA 4A83A 2LDKA 3C0VA 3KB3A 3HXMA 4QDFB 1LLTA 3NJ1A 2KCZA 3QSZA 4MNSA 5JO1A 3KDIA 2NN5A 4N76A 2N4BA 3NMVA 3GKEA 4JHHA 3TFZA 3HVRA 2PSOA 2FFSA 3RT0C 3PUTA 1VJHA 2LAFA 4FPWA 3RT2A 5I8FA 3NEFA 4A86A 4M9BA 3QN1A 3TVQA 2D4RA 5E4MA 2LCGA 3DLBA 2RERA 4LGBA 2LEQA 5AMWA 2WQLA 4QIPA 4N47A 3ELIA 1XFSA 4XRWA 3HJFA 4N3EA 5EKQC 3KDJA 2Q3QA 1JSSA 3JRSA 2K7HA 3Q6AA 3H3RA 1FSKA 3GOBA 2E3MA 3H3TA 2IL5A 3NJOA 4JDAA 4LA7A 3ZVUA 4A88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3N A;  3RD6 A;  1TXC A;  3FO5 A;  4JDL A;  4C94 A;  4DSB A;  5E4B A;  3CNW A;  5C9Y A;  5BRL A;  2NS9 A;  2R55 A;  1XN6 A;  1T17 A;  4LGA A;  1LN2 A;  3Q63 A;  1T27 A;  2LPX A;  3OTL A;  5JO2 A;  2GKD A;  3UID A;  2L65 A;  3KDH A;  3KL1 A;  3JRQ B;  4N0G C;  4C9C A;  1BV1 A;  2VQ5 A;  4Q0K A;  1XDF A;  4BTZ A;  5JNN A;  2MOU A;  2I9Y A;  1XUV A;  4A84 A;  4XRT A;  4A85 A;  2L9P A;  1X53 A;  4B9R A;  3P9V A;  3E85 A;  3H3S A;  3NMH A;  1H2O A;  2PCS A;  4GY9 A;  3IE5 A;  1TW0 A;  4A80 A;  1Z94 A;  2EJX A;  3K90 A;  2E3O A;  3OH8 A;  4A8G A;  4IGV A;  1FM4 A;  3NR4 A;  3NEG A;  2Z9Z A;  3TVR A;  1ZXF A;  1LN1 A;  1LN3 A;  2LGH A;  3NMT A;  2LIO A;  3IJT A;  3PU2 A;  4LG5 A;  4IGX A;  4A8V A;  4BKC A;  3OJI A;  4REI A;  4BK6 A;  3KB0 A;  3NS2 A;  4BK7 A;  3OQU A;  1XN5 A;  4BKD A;  3F08 A;  2RES A;  2BK0 A;  2QPV A;  3W9K A;  1B6F A;  2REZ A;  2N4A A;  2LE1 A;  2M89 A;  2Z9Y A;  4IHR A;  4R7K A;  4RYV A;  1E09 A;  2L8O A;  4A8U A;  5I9J A;  2M47 A;  3WG8 A;  2FLH A;  3UJL A;  4C9I A;  1EM2 A;  4IGY A;  1KCM A;  3H3Q A;  4REH A;  3R6P A;  3P0L A;  2VNE A;  3KLX A;  4IH2 A;  4IGW A;  4MAP A;  2E3Q A;  3UQH A;  5E46 A;  3NMP A;  4JHG A;  4REJ A;  4JHI A;  4WVO A;  4DSC A;  1BTV A;  4PSB A;  2QIM A;  1IFV A;  1UW5 A;  3W9R A;  4OIC A;  2LAK A;  5E4D A;  3P51 A;  2E3S A;  4DS8 A;  4IH0 A;  3NI8 A;  2KEW A;  4MA6 A;  4A81 A;  4Y31 A;  2K5G A;  3Q64 A;  2E3P A;  3KAY A;  3K3K A;  2A1L A;  1ICX A;  4A87 A;  2KTE A;  3KAZ A;  4Z3L A;  2LF2 A;  3NJ0 A;  3TL1 A;  3NMN A;  2LUZ A;  2E3R A;  1QMR A;  2KF2 A;  3GGN A;  4M9W A;  4A83 A;  2LDK A;  3C0V A;  3KB3 A;  1LLT A;  3NJ1 A;  2KCZ A;  3QSZ A;  4MNS A;  5JO1 A;  3KDI A;  2NN5 A;  2N4B A;  3NMV A;  4JHH A;  3TFZ A;  2PSO A;  2FFS A;  3RT0 C;  3PUT A;  1VJH A;  4FPW A;  3RT2 A;  5I8F A;  3NEF A;  4A86 A;  4M9B A;  3QN1 A;  3TVQ A;  2D4R A;  5E4M A;  2LCG A;  2RER A;  4LGB A;  2LEQ A;  5AMW A;  2WQL A;  4QIP A;  3ELI A;  1XFS A;  4XRW A;  4N3E A;  3KDJ A;  2Q3Q A;  1JSS A;  3JRS A;  2K7H A;  3Q6A A;  3H3R A;  1FSK A;  2E3M A;  3H3T A;  2IL5 A;  3NJO A;  4JDA A;  4LA7 A;  3ZVU A;  4A88 A; 
#chains in the Genus database with same CATH topology
 2E3N A;  3RD6 A;  1TXC A;  3FO5 A;  4JDL A;  4C94 A;  4DSB A;  5E4B A;  4QDC A;  3CNW A;  5C9Y A;  5BRL A;  2NS9 A;  2R55 A;  1XN6 A;  1T17 A;  3NQN A;  1LN2 A;  4LGA A;  3Q63 A;  1T27 A;  3F73 A;  2LPX A;  3OTL A;  5JO2 A;  2GKD A;  3UID A;  2L65 A;  3KDH A;  3KL1 A;  3JRQ B;  4N0G C;  4C9C A;  1BV1 A;  2VQ5 A;  4Q0K A;  1XDF A;  4BTZ A;  4JHY A;  2MOU A;  5JNN A;  2I9Y A;  1XUV A;  4QDF A;  4A84 A;  4XRT A;  4A85 A;  2L9P A;  1X53 A;  4B9R A;  3P9V A;  3E85 A;  3H3S A;  3NMH A;  1H2O A;  2PCS A;  4GY9 A;  3IE5 A;  1TW0 A;  4A80 A;  4NCB A;  1Z94 A;  2EJX A;  3K90 A;  2E3O A;  4NCA A;  3OH8 A;  4A8G A;  4IGV A;  3HK2 A;  1FM4 A;  3NR4 A;  3NEG A;  2Z9Z A;  3TVR A;  1ZXF A;  1LN1 A;  1LN3 A;  2LGH A;  3NMT A;  2LIO A;  3IJT A;  3PU2 A;  4LG5 A;  4IGX A;  4A8V A;  4BKC A;  3OJI A;  4REI A;  4BK6 A;  3KB0 A;  3NS2 A;  4BK7 A;  3OQU A;  1XN5 A;  4BKD A;  3F08 A;  2RES A;  2BK0 A;  2QPV A;  3W9K A;  1B6F A;  3HM9 A;  2REZ A;  2N4A A;  4E6F A;  2LE1 A;  2YH6 A;  2M89 A;  2Z9Y A;  4IHR A;  4R7K A;  4RYV A;  3DLH A;  1E09 A;  2L8O A;  3HO1 A;  4A8U A;  3GTS A;  5I9J A;  2M47 A;  3WG8 A;  4N41 A;  2FLH A;  3UJL A;  4C9I A;  1EM2 A;  3GL0 A;  3GB4 A;  4IGY A;  1KCM A;  3H3Q A;  4REH A;  3R6P A;  3P0L A;  2VNE A;  3KLX A;  4IH2 A;  4IGW A;  4MAP A;  2E3Q A;  3UQH A;  5E46 A;  3NMP A;  4JHG A;  4REJ A;  4JHI A;  4WVO A;  4DSC A;  1BTV A;  4PSB A;  3TGO C;  2QIM A;  1IFV A;  1UW5 A;  3W9R A;  4OIC A;  2LAK A;  5E4D A;  3P51 A;  2E3S A;  4KPY A;  4DS8 A;  4IH0 A;  3NI8 A;  2KEW A;  4MA6 A;  4A81 A;  4Y31 A;  2K5G A;  3Q64 A;  2E3P A;  2ZYL A;  3K3K A;  2A1L A;  3KAY A;  1ICX A;  3GL2 A;  4A87 A;  2KTE A;  3KAZ A;  4QDD A;  4Z3L A;  2LF2 A;  3NJ0 A;  3TL1 A;  3NMN A;  2LUZ A;  3GTE A;  2E3R A;  1QMR A;  2KF2 A;  3GGN A;  4M9W A;  4QCK A;  4A83 A;  2LDK A;  3C0V A;  3KB3 A;  3HXM A;  4QDF B;  1LLT A;  3NJ1 A;  2KCZ A;  3QSZ A;  4MNS A;  5JO1 A;  3KDI A;  2NN5 A;  4N76 A;  2N4B A;  3NMV A;  3GKE A;  4JHH A;  3TFZ A;  3HVR A;  2PSO A;  2FFS A;  3RT0 C;  3PUT A;  1VJH A;  2LAF A;  4FPW A;  3RT2 A;  5I8F A;  3NEF A;  4A86 A;  4M9B A;  3QN1 A;  3TVQ A;  2D4R A;  5E4M A;  2LCG A;  3DLB A;  2RER A;  4LGB A;  2LEQ A;  5AMW A;  2WQL A;  4QIP A;  4N47 A;  3ELI A;  1XFS A;  4XRW A;  3HJF A;  4N3E A;  5EKQ C;  3KDJ A;  2Q3Q A;  1JSS A;  3JRS A;  2K7H A;  3Q6A A;  3H3R A;  1FSK A;  3GOB A;  2E3M A;  3H3T A;  2IL5 A;  3NJO A;  4JDA A;  4LA7 A;  3ZVU A;  4A88 A; 
#chains in the Genus database with same CATH homology
 2E3N A;  3RD6 A;  1TXC A;  3FO5 A;  4JDL A;  4C94 A;  4DSB A;  5E4B A;  4QDC A;  3CNW A;  5C9Y A;  5BRL A;  2NS9 A;  2R55 A;  1XN6 A;  1T17 A;  3NQN A;  1LN2 A;  4LGA A;  3Q63 A;  1T27 A;  3F73 A;  2LPX A;  3OTL A;  5JO2 A;  2GKD A;  3UID A;  2L65 A;  3KDH A;  3KL1 A;  3JRQ B;  4N0G C;  4C9C A;  1BV1 A;  2VQ5 A;  4Q0K A;  1XDF A;  4BTZ A;  4JHY A;  2MOU A;  5JNN A;  2I9Y A;  1XUV A;  4QDF A;  4A84 A;  4XRT A;  4A85 A;  2L9P A;  1X53 A;  4B9R A;  3P9V A;  3E85 A;  3H3S A;  3NMH A;  1H2O A;  2PCS A;  4GY9 A;  3IE5 A;  1TW0 A;  4A80 A;  4NCB A;  1Z94 A;  2EJX A;  3K90 A;  2E3O A;  4NCA A;  3OH8 A;  4A8G A;  4IGV A;  3HK2 A;  1FM4 A;  3NR4 A;  3NEG A;  2Z9Z A;  3TVR A;  1ZXF A;  1LN1 A;  1LN3 A;  2LGH A;  3NMT A;  2LIO A;  3IJT A;  3PU2 A;  4LG5 A;  4IGX A;  4A8V A;  4BKC A;  3OJI A;  4REI A;  4BK6 A;  3KB0 A;  3NS2 A;  4BK7 A;  3OQU A;  1XN5 A;  4BKD A;  3F08 A;  2RES A;  2BK0 A;  2QPV A;  3W9K A;  1B6F A;  3HM9 A;  2REZ A;  2N4A A;  4E6F A;  2LE1 A;  2YH6 A;  2M89 A;  2Z9Y A;  4IHR A;  4R7K A;  4RYV A;  3DLH A;  1E09 A;  2L8O A;  3HO1 A;  4A8U A;  3GTS A;  5I9J A;  2M47 A;  3WG8 A;  4N41 A;  2FLH A;  3UJL A;  4C9I A;  1EM2 A;  3GL0 A;  3GB4 A;  4IGY A;  1KCM A;  3H3Q A;  4REH A;  3R6P A;  3P0L A;  2VNE A;  3KLX A;  4IH2 A;  4IGW A;  4MAP A;  2E3Q A;  3UQH A;  5E46 A;  3NMP A;  4JHG A;  4REJ A;  4JHI A;  4WVO A;  4DSC A;  1BTV A;  4PSB A;  3TGO C;  2QIM A;  1IFV A;  1UW5 A;  3W9R A;  4OIC A;  2LAK A;  5E4D A;  3P51 A;  2E3S A;  4KPY A;  4DS8 A;  4IH0 A;  3NI8 A;  2KEW A;  4MA6 A;  4A81 A;  4Y31 A;  2K5G A;  3Q64 A;  2E3P A;  2ZYL A;  3K3K A;  2A1L A;  3KAY A;  1ICX A;  3GL2 A;  4A87 A;  2KTE A;  3KAZ A;  4QDD A;  4Z3L A;  2LF2 A;  3NJ0 A;  3TL1 A;  3NMN A;  2LUZ A;  3GTE A;  2E3R A;  1QMR A;  2KF2 A;  3GGN A;  4M9W A;  4QCK A;  4A83 A;  2LDK A;  3C0V A;  3KB3 A;  3HXM A;  4QDF B;  1LLT A;  3NJ1 A;  2KCZ A;  3QSZ A;  4MNS A;  5JO1 A;  3KDI A;  2NN5 A;  4N76 A;  2N4B A;  3NMV A;  3GKE A;  4JHH A;  3TFZ A;  3HVR A;  2PSO A;  2FFS A;  3RT0 C;  3PUT A;  1VJH A;  2LAF A;  4FPW A;  3RT2 A;  5I8F A;  3NEF A;  4A86 A;  4M9B A;  3QN1 A;  3TVQ A;  2D4R A;  5E4M A;  2LCG A;  3DLB A;  2RER A;  4LGB A;  2LEQ A;  5AMW A;  2WQL A;  4QIP A;  4N47 A;  3ELI A;  1XFS A;  4XRW A;  3HJF A;  4N3E A;  5EKQ C;  3KDJ A;  2Q3Q A;  1JSS A;  3JRS A;  2K7H A;  3Q6A A;  3H3R A;  1FSK A;  3GOB A;  2E3M A;  3H3T A;  2IL5 A;  3NJO A;  4JDA A;  4LA7 A;  3ZVU A;  4A88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...