4GYGA

Crystal structure of the rio2 kinase from chaetomium thermophilum
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
341
structure length
331
Chain Sequence
KLDTRAMRHLTAEDWRVLTAVEMGSKNHEIVPTPLIEKIGVHKSIATLAKAGLIARMKEAKYDGYRLTYGGLDYLALHTHAARKDVYSVGSRIGVGKESDIMIVADEKGKQKVLKIHRLGRISFRTVKRDYLRNRSTGSWMYLSRLAAIKEFAFMKALYEEGFPVPEPIAQSRHTIVMSLVDALPMRQVSSVPDPASLYADLIALILRLAKHGLIHGDFNEFNILIREEKDAEDPSSITLTPIIIDFPQMVSMDHPNAEMYFDRDVQCIKRFFERRFHFVSTTPGPFYKDAKKTVGKDGAKRLDAALEASGFTKKMAKDLEAAIREQQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATPase-dependent role of the atypical kinase Rio2 on the evolving pre-40S ribosomal subunit.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transferase
molecule keywords Rio2 kinase
total genus 103
structure length 331
sequence length 341
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gygA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gygA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gygA02
3NVKI 2JKOA 3O23A 4YFKF 3IW8A 1MJBA 1XBBA 3Q32A 3COIA 5C26A 3E97A 4FKWA 5M06A 5LRRA 4II5A 5LCKA 3AMAA 3U9NA 4HV6A 3UO5A 2Y7JA 4O7NA 4KWPA 4RX8A 5KK1A 3W2RA 5KHXA 3B73A 5T6KA 3VODA 1FMKA 1J0RA 2OQGA 1O3QA 3QQJA 4YJSA 1GZKA 3T3VA 3I53A 2ZM3A 4F9CA 2O64A 3ROYA 1MP8A 4O7TA 3QRUA 4I23A 2HWPA 5AAFA 2QU5A 3TV4A 3NYNA 2GHMA 3KZYA 4QYGA 4PDSA 3RKWA 2CN5A 4FI1A 3G73A 4IWQA 5H6QA 2ITYA 2WIPA 3UOHA 4XH6A 3KRWA 3GC8A 2NS0A 5BYYA 5BVEA 4D1ZA 2OLCA 3CE3A 2O0YA 3LZBA 1QNTA 4CV8A 3MAJA 3C4FA 5AM7A 5L3GA 1QPMA 3NUUA 2OZOA 4G9CA 3VUTA 2OIDA 3OXZA 3DQXA 1YQAA 2XJ1A 4EZ5A 2EU9A 3GBZA 4R7HA 3DXQA 4FL3A 3A7HA 3EOCA 4RRVA 1UNGA 2WQNA 3F23A 2PE1A 3WF9A 4XBFA 5E18F 3OY3A 5L2SA 4Q5SF 5AUTA 2ESHA 1URWA 4PZJA 3R8PA 3Q52A 5JFRA 3K2LA 2A6HF 4BICA 4ZLZA 3HA8A 3OW3A 4FTQA 3V8WA 4G3CA 2A0CX 2R7BA 5KMOA 3IW4A 4EI4A 2D2WA 3AT2A 2KKOA 3EN4A 4XX9A 5EW3A 5AADA 1XH6A 4PL3A 4G5PA 5HG7A 5HS8A 5B2MA 3SKCA 3O2PE 3MFUA 5HCXA 1HQCA 5AEPA 4FNXA 5EDPA 2FB8A 1PXPA 2E1CA 3TUBA 4MD9E 4C35A 2Y4IC 3RBWA 4AGUA 3H3UA 4BQAA 3F8MA 3I6WA 4CFWA 1A48A 2C4GA 3ENMA 1BJAA 2G01A 4E3CA 2M45A 3IC7A 3M8FA 4OIRF 4IQ6A 4AG8A 3DF8A 4FV1A 4O7RA 3ZMTA 3HSEA 4KNBA 2OJJA 4RLKA 4C7TA 2XUUA 5BUJA 2V55A 4YO4A 2B0QA 5DD8A 1G3SA 4TRLA 4KINA 5IA0A 1MRUA 3C1XA 3BX5A 2W4OA 2YABA 1AOYA 2C6OA 4EH3A 4YU2A 4RS8A 4UXQA 4NM0A 3IOKA 2ETKA 3Q5FA 4UXLA 3I59B 4CZTA 4ZSAA 2XMYA 1U5TB 4QYEA 3ZQ7A 5L8LA 4C33A 2ACXA 3THBA 4ANOA 3GC9A 3SZTA 4AT5A 4C36A 1OECA 1KE6A 4PMMA 1CKPA 3KP4A 4RJ5A 2VE9A 4UWYA 1H27A 3SOAA 5F1RA 2HDCA 3IDBA 1XBAA 1K78B 3PVUA 3F3UA 4YNOA 2NNNA 4PX6A 4GG5A 3TNPC 1O7FA 4NZWB 5GZAA 3VB2A 4IFGA 3JXWA 2PLYA 2Q0BA 2WV0A 3QD2B 2WIHA 1U5TA 3UVPA 5CQWA 1PF8A 3EN6A 4R3PA 3OS3A 3KXHA 3HOTA 5L2QA 3WTWC 2A19B 1ZREA 3RTRA 3QUEA 5JZJA 3ZLWA 5K1YA 4EOMA 3EQIA 4M12A 3EN5A 1UVRA 2X7FA 4BI1A 2XIGA 2J4ZA 5D12A 2DYLA 2YIXA 1SZMA 3LCKA 2XAJA 5TKDA 2ITQA 1UU8A 3Q2JA 2J50A 4U9AA 2OAZA 4RX7A 4KRDA 3S00A 2RFDA 4QOXA 5EM8A 3VRYA 2L4AA 4QT1A 4CGAA 4AW1A 4YBKA 4JDJA 1F5QA 3RK9A 4A06A 5AV4A 2YWPA 4F7JA 2KRFA 4OIOF 2KIMA 3ELJA 1BOAA 2QOCA 1D3YA 3WGIA 2GHLA 4JR3A 3FBVA 4U7ZA 3UIMA 2XBAA 3ZFYA 4MNEA 2JAVA 1OL2A 3EQBA 2XAQA 3UOLA 4XV2A 2IW9A 3SX9A 4QMWA 2BTSA 3NIEA 1BL7A 4PGHA 4BCFA 2V5QA 2B7AA 3PUPA 4C4IA 2Y48A 4LLNA 3CD8A 3PJ3A 3PXQA 5ILVA 3UZTA 3V04A 3W2OA 3DNEA 2WMUA 1TW2A 3NNUA 1LP4A 2XF0A 3GEQA 4FICA 2BRGA 3N4UA 5ITAA 1UV5A 2XZSA 4CO8A 3IDCA 2A6EF 4HYUA 4ZJVA 5BMMA 3SHEA 1U5TC 5BMSA 4AW2A 3UZPA 3QQLA 3NUXA 2C5XA 3PVWA 4ZZOA 2YM4A 4QTBA 3LW0A 2IWIA 3NQOA 4P9FA 4U3YA 3TNQB 4F0GA 4MTEA 3PXKA 4B6LA 4BNCA 3VBXA 2XKDA 3DBEA 3KP7A 1Z1DA 5HE1A 1U59A 4FV8A 1TTYA 3CY2A 4LM5A 5EOBA 4EEVA 3IRQA 4J71A 3ZCLA 3UO6A 1V4RA 5IDPA 4QMSA 5ANJA 4IJPA 4USEA 3P79A 2JSCA 4FTKA 2V9VA 1OBDA 4LUDA 1YHVA 4LOPA 1UWJA 4HDUA 4ZS0A 4A9RA 3C0GA 5AJQA 3CQWA 5CF8A 3WF8A 4W8DA 3ZDUA 2MC3A 4XG6A 4PL5A 3VS5A 4YHTA 4EM0B 3DKFA 4I01A 4MBJA 4WSYA 3HAVA 4UV9A 4PDPA 5CAVA 2X4ZA 5A2QK 2STWA 3UP7A 5LARA 2RFSA 4IWPA 5E8VA 5HHWA 3ZO2A 1DI8A 4CZZA 1LB2A 1WMKA 3AGMA 2GHGA 2F7ZE 5EHLA 4IJAA 3C7JA 4YJVA 2XIZA 3E62A 3RCJA 4A0YA 3DT1A 3C5IA 1KU9A 4MQ1A 4FKOA 2REIA 3C4CA 4M66A 2G2IA 5ILSA 2E9UA 3SAYA 3BGZA 3NCGA 2ITNA 2IJMA 3D0SA 5ILUA 3R7OA 2RNJA 4IHPA 4PP9A 5AR5A 5G1XA 4RSSA 3NUNA 4KMFA 3MJ1A 5CSHA 5BX0A 4IWDA 4RA5A 3I60A 4PPBA 3TKHA 1Q1HA 4BHNA 2UWMA 2YACA 4YTCA 4WRSA 5A4CA 1Q61A 4KIOA 5LWNA 4W4YA 2RKUA 3H3ZA 2W0JA 1TQPA 1WQ2A 3H0YA 3ZSHA 4IHTA 4BKJA 3KRXA 4EJOA 3COMA 1PMUA 4IAFA 1Y6AA 5IA1A 4ZIMA 5M51A 3FXQA 3TCPA 2FUMA 3V8TA 2RC4A 3RWQA 3PY0A 1SFXA 1FZPB 4NH1A 3T8OA 2ZXJA 2PTKA 2FMYA 4ENKA 4IANA 3OOPA 4ZTMA 4I22A 3ALOA 5K5XA 3MGYA 2UZBA 5ANIA 4BDFA 4FTIA 3DKGA 4BZOA 1T46A 3HA6A 3R6XA 5C4KA 4ACGA 1XCBA 1H1RA 4FTRA 2C3KA 4BZDA 2VNYA 4EM1A 3E92A 5L8KA 4GFGA 1S7AA 1I44A 3QFVA 1XHAA 4CLJA 3FM3A 1Q4LA 3CPBA 4ACDA 4EC8A 3VJOA 1IAJA 1FINA 5AUWA 2JFMA 3ZDIA 4BDAA 3NEUA 3LQ5A 2XJ2A 1ZGAA 3MS9A 3FYJX 5C4LA 4XG7A 3GNIB 4C4JA 2PE2A 5AR2A 4YZMA 2PZRA 4RWJA 3ZEWA 2IVVA 1HCLA 3DXJF 2YIYA 3QLGA 4HVSA 3TZ8A 2VTNA 5CVGA 4KRCA 3U4UA 3B02A 2B52A 4R3CA 4YJTA 3R7EA 2QO2A 4BXUA 3QA0A 3LXNA 1IN4A 4ZXTA 2EWNA 1V0OA 1Z91A 1G6NA 3J7AO 4IVAA 4L01A 4YP8A 2RV8A 1LEZA 5A46A 3LMIA 3P78A 1FBSA 1OL1A 1PXOA 1D8KA 2PY3A 3VUMA 4WBBB 3QUPA 2ZV8A 3QUDA 1NA7A 3NPCA 4EGYA 1T39A 4NM5A 1H00A 1XDSA 3I0TA 4FEVA 1D8JA 3PXFA 3C7QA 1URCA 4EKLA 2ZMDA 3R01A 4O81A 3IHUA 4RC2A 2RDPA 3CXWA 1F4KA 3WTYC 4K33A 5CAQA 1ZLKA 1YXTA 3FMSA 1J7IA 2V1XA 3ANQA 4ASDA 4BCKA 4O82A 3U8WA 4IAYA 3A7JA 3PTGA 5HNGA 2GFSA 3TIYA 1YW2A 4EBVA 3LXKA 2ZB1A 1XGMA 3GU6A 5DT0A 5E8IA 2HKOA 3E3VA 5FLFA 5DCMA 3R7YA 4WIHA 1WVWA 1ZYDA 4F7ZA 3MFTA 4IVCA 3K2ZA 4R8HA 3VUDA 2CWEA 2R7IA 4PPCA 3II5A 4X2NA 3FMRA 3O7LD 4O6LA 4ACMA 1ZG1A 5HOOA 2Z7LA 4EJ7A 2KJCA 4BGGA 2BZKB 4YZDA 2X2LA 3AC5A 3OWLA 1PYEA 3Q4ZA 4LGDA 4GU6A 4CFUA 2WB8A 4AFJA 5CNNA 4JRVA 3EYYA 3OOGA 2OF4A 4ZY4A 4QMPA 4MEYF 2X39A 3TTIA 4NUSA 1J3HA 1OL5A 4D2SA 2BMCA 4FNYA 3NNWA 5L6PA 1FX7A 2FU4A 5E9EA 1YW7A 5JR3A 5L6OA 4OTPA 5D5VB 1XH9A 2KTYA 2HXLA 4A5MA 4F4PA 1BI1A 5CI6A 4YGAA 3PQKA 3FLNC 2EXEA 5M55A 5E1SA 2Z7QA 4NJDA 2C6EA 3L09A 2ZB0A 4QP3A 1O6KA 4QPAA 5HESA 3F8NA 4UX9A 2HEOA 3K1MA 4YPDA 3F82A 1D5VA 2L02A 5I5ZA 4Q48A 5HIEA 3EIDA 3U54A 2VN9A 4IM3A 1F9NA 3C5UA 2NAZA 2UZKA 4GG7A 3LQRA 4RJ6A 3BI6A 4EGZA 3LE6A 5FG8A 1K79A 1QBJA 1UNHA 4EBWA 2ERKA 2RGVA 3G51A 1LQ1A 5J5TA 4M0ZA 2QURA 5C01A 4C3PA 3QZIA 3ZLSA 3BWJA 3HRTA 3U6HA 1BI7A 1ZRDA 5L8JA 2QHNA 5T68A 4FT0A 3I5NA 1Q5KA 3W2CA 1R7JA 4JDIA 1CDKA 4WXHA 4LG0A 5CYVA 2DPUA 1FC3A 1ZZLA 4ANBA 4KBAA 4WOVA 2HZ4A 1PW2A 3OFMA 2YDKA 2Y4PA 3GU8A 1JE8A 1GXPA 4GV1A 4DEAA 3OBGA 1KQ0A 2QOQA 4X2KA 5IQCA 5J1VA 3HV6A 4ALWA 4YC8A 3WE8A 4ZTLA 2DBBA 1R58A 4AA0A 4PDKA 4AZVA 3BGQA 3R1SA 5HVYA 1G5SA 4APCA 4WX9A 1XKKA 3RK7A 3HRMA 3Q9ZA 1QQIA 4QTDA 1B4AA 4AIHA 4AOJA 4EJUA 1YKRA 3AC8A 3PLAE 4RX9A 3S2WA 3HTSB 3OD6X 3F7ZA 3TOBA 4YHFA 3OT8A 2Y0MA 2GFCA 3SG8A 2DLLA 3MWUA 1B6AA 3RHXA 4I5PA 3TZ7A 4I6FA 2QLUA 2GWRA 2UZOA 3O17A 3Q2MA 3JSOA 2G9WA 2YZLA 4JIAA 3GU5A 3Q9YA 4IB1A 4L5JA 4D9TA 2IA1A 4LYNA 4I0RA 3DJ5A 2WKMA 1H0MA 1MQBA 1RJBA 3R22A 3KU2A 4KA3A 2VUWA 5A6OA 1KQ8A 4RB3C 4PL4A 4FTUA 4QTCA 4NYEA 1W0XC 1FP2A 4C02A 3DJ6A 5H6RA 4G7OF 3ZSIA 2XVCA 2IG7A 4TYIA 5HO8A 3UPZA 3FHIA 3EQPA 3A8XA 4J98A 2P4WA 2F57A 4J52A 5I3RA 2QKRA 4QP9A 1YXXA 3NRVA 1ZOEA 3BPRA 4CXAA 5I9VA 1QZZA 2VZ6A 2FNPA 4U0YA 5HVKA 5I4NA 1CGPA 4AWIA 5BQTA 2Z2WA 1Q3WA 2YERA 4FKIA 4S04A 4IADA 1F1ZA 5HU3A 2GXGA 4MF0A 3MFRA 1J59A 4D9UA 5AX9A 2JEDA 4BBFA 3CUQA 2IVUA 4WWCA 5AR4A 3Q9XA 3OY1A 3D5VA 2YM3A 4F1MA 3G5DA 2X6EA 1REPC 2JPBA 1IW7F 3BBWA 4E4LA 2UZUE 4F1OA 4GXOA 1ZG5A 5BYLA 3TNWA 4M15A 2GQRA 3EQDA 2P4IA 3P08A 5DLSA 5FXSA 4GJ2A 2DS1A 2NNYA 1H26A 3IKAA 3WTTC 2YWVA 5BVKA 4N0BA 4XLIA 4O7WA 4FV6A 5BS6A 4A0ZA 3MWMA 5DH3A 3H0ZA 4YJOA 3BYOA 4KFCA 3P7AA 2A1AB 3FMMA 4MWHA 4GK2A 1JXSA 5H3QA 1XSDA 1SVHA 4RVMA 4FHTA 2QBYA 2O03A 2L4MA 3QZFA 2HZIA 3UNKA 3EQGA 3RMFA 4D0PA 5LVOA 4RAZA 2QOIA 2F4JA 2IN6A 4DYMA 5CX9A 2C6IA 2JIUA 2XHKA 3ABTA 2OA4A 5KMIA 1RW8A 4BTFA 5IQIA 4S2ZA 2ITZA 3QX2A 3QTUA 4DT8A 3NZ0A 2K86A 3OF0A 3JUHA 4GUEA 1JLUE 4GVJA 4A9YA 4JXFA 1KOBA 4MH7A 2EFOA 4BCPA 3JR1A 2UW4A 1W7PA 3FHRA 4E93A 2V22A 3VN9A 4YTIA 3IGGA 1IZ1A 4OR5A 2C6LA 5HTCA 3S95A 4Y46A 3GOPA 4DGOA 2OGVA 2MLKA 3ULZA 4UWBA 4L43A 5AP0A 5IQHA 1A9UA 4AW0A 3ATTA 4JRNA 4EH4A 1Q8UA 3EQFA 1Z5MA 4K8AA 3DZQA 2Y9QA 5D7VA 4TWPA 2HTSA 1GY3A 1Q62A 4C57A 2WGJA 4QMOA 3UYSA 1GIIA 4RIWB 4E26A 2V1UA 1QMZA 2FA2A 5M4FA 4FX4A 2JDRA 3HX4A 2L01A 3FXUA 3KREA 3KP5A 4RIOA 2G15A 2DQLA 2BR1A 2PHKA 2W1IA 1YXUA 1B59A 3EN9A 3NUYA 5EYMA 2PUPA 3HMNA 3QXPA 4HYEA 3Q60A 4I5CA 2RGPA 4HDVA 5CU2A 1O9UA 2VTMA 4WXDA 4U5JA 3GP0A 1FVRA 3I7BA 3SLSA 4E73A 1YDTE 3O8UA 5C03A 4YZNA 1IN5A 4S32A 4UWCA 2B1PA 4EK8A 1UU7A 2Y0AA 3VS1A 3BHVA 1JQHA 2KIFA 2GS7A 4BDDA 3UQFA 4D1SA 3R9RA 5D4RA 1YDRE 4YLKA 3E6DA 4DFZE 5LHIA 4A7CA 3FE3A 3PA5A 3F69A 1FPQA 3GGFA 3CCNA 3OEZA 1U54A 2PVLA 1ZN2A 4HGLA 4LFIA 1R39A 2J5FA 3WZKA 3MEXA 1OM1A 2YAAA 3A7IA 4FUXA 3BQCA 2DQ7X 3L2CA 3V01A 1P6RA 3IGOA 4FG9A 2J5EA 3TV6A 1KGSA 2ZM4A 4M8TA 3DU8A 2WXVA 3ZSGA 4AWXB 2XKFA 4WO5A 4WNPA 1T0FA 4Y85A 3IQ7A 5HD4A 2ZMEB 4MVFA 3V7RA 5JRSA 4BDHA 4AACA 3QPHA 2XROA 3F7WA 4ZJJA 4QTEA 1H8FA 3PJCA 4NKSA 1ZZ2A 3R7IA 1K78A 3HZTA 3KRLA 3OEFX 1QPCA 2QQBA 3WZJA 3M11A 4IC7A 2PYWA 1JNKA 4FTOA 5K0XA 2BYVE 3GUBA 1I1GA 2HS5A 3PP0A 4E6DA 3ID6C 3QD4A 4A2UA 4BGQA 4NW5A 3A61A 4ANQA 3QRJA 3RI1A 3K0LA 3ZP5A 1OL6A 3SD0A 3C18A 2I0YA 2J90A 4MEDA 1FSHA 2EA4A 2HIWA 5EM5A 4CT2A 3ENHA 2BKZA 3TKIA 1TW3A 4FKLA 5J79A 3SA0A 3U55A 2GPHA 4N4SA 2C0IA 2J9MA 3P7CA 3E3BX 3E64A 3QTSA 4YIFA 4NSTA 2ESNA 1DDNA 3LMHA 2ZV9A 3ZLXA 3KF4A 5TRDA 4HQEA 5HLNA 1KUTA 2F5CA 2K4BA 2O6GE 4YR8A 4Z55A 3FXWA 4C2WA 5FXQA 1WVYA 4XRFA 1MDMA 4J96A 4IAZA 3H30A 5KMMA 4MXXA 3KC3A 3F3WA 4OGRA 2Z5UA 3FXRA 1Y8GA 4K18A 3WGGA 1A04A 5EK7A 4DEDA 3QQFA 1UWHA 2VE8A 3WI6A 3CBLA 3BLQA 4C37A 1GZ8A 3SQQA 2C0TA 4CXFA 5DWRA 3MVMA 4C4HA 2UW9A 2M1BA 2R3KA 2RSVA 1P4AA 4DTAA 3K5VA 2MA3A 5D7AA 1KQ9A 3KE2A 4TW9A 3OV8A 4OMZA 1WBVA 4RG0A 5E8GA 1ZRZA 3NW7A 2PVRA 2G2FA 1J7UA 2HXQA 3ZMDA 3QQKA 5HD7A 5L2IA 1FPUA 2QWWA 4UUVA 3FMDA 2C6DA 5JEBA 1XMAA 5HE0A 4Y5QA 2PG4A 1YI6A 3SXFA 4NHJA 4OINF 4YFNF 3W32A 4U40A 5FWKK 4ALVA 3FLWA 4TT7A 3ZO4A 2BGCA 2GTNA 3D7TB 2OIQA 3FY2A 2WMQA 3MVHA 5DN3A 3SOCA 1XB4A 1W4MA 4J7BA 5AWMA 2BKKA 2FGIA 3PJ1A 2OZ6A 3QCYA 4FL1A 2K02A 5LGTA 1P2AA 3ERED 3W2PA 3EYHA 3F5UA 4FSZA 5DCMB 1IN7A 3FF5A 3M9AA 4S30A 2F5DA 1Q41A 4PNKA 2RG6A 3K69A 5ANGA 2XUBA 2W7XA 4IC8A 2HW6A 3KEQA 3R61A 4ANNA 2COMA 5GZ8A 4BWXA 3BU6A 4O7VA 4Q2AA 3RKYA 5AUYA 5LVLA 3GW2A 4ESBA 5CVRA 2M87A 2EFPA 4FKQA 4U7DA 3MY5A 3Q6UA 4P9UA 5E8XA 5IH6A 1PXIA 2PK9A 1Q8YA 4BCMA 2C0OA 4U6RA 4EOQA 4DEBA 2CW0F 4ANSA 4KBKA 2FBKA 1BC8C 3BEAA 4H1MA 2A68F 5CI7A 2JLDA 4RWKA 2XK9A 4FGRA 4ZTHA 2CGXA 3CTQA 3NW6A 3T3UA 5DNRA 4FKRA 4FX3A 4D28A 4KMUX 3DFGA 4QNAA 5AAGA 4KKGA 3HTUA 1IUYA 3RIRA 4UNOA 5A14A 2R3RA 4ASXA 4QMLA 3HV7A 3ULQB 5JGDA 4RPVA 3SFZA 1FYMA 2P2HA 2X2KA 3GQIA 4FV5A 4FVPA 5DI1A 5HBJA 4FEXA 4NB5A 4QP8A 4AGDA 3AG9A 4MHAA 5M09A 4YBJA 4GT4A 4LV8A 4G6QA 1YS6A 3CLYA 3N97A 2WZJA 4BR3A 5HORA 2BFXA 2C6KA 4ZTNA 3NSZA 5IQGA 4C8BA 1YI4A 5EW8A 1CTPE 4MQ9F 2XS0A 5EKNA 2BDWA 3Q9SA 3ZUVA 2PMOX 4IDTA 1UNLA 4DCAA 3BHUA 1ZY4A 4JG8A 2X0LA 2XA4A 4IAIA 3W8LA 4EOLA 3QZHA 2XGXA 4Q47A 1BX6A 5AUZA 4B09A 1CM8A 5JRQA 3BZ6A 3GXLA 3ROCA 1Q8ZA 1H07A 5FO5A 2WEIA 5IF1A 4PMTA 3ODYX 4DG3E 4E4NA 3QQHA 2JBOA 4FSUA 3AT3A 4BFMA 2CDZA 2ITWA 3C4WA 2CLQA 3CEKA 2BPMA 3KQ7A 4FYNA 4BTMA 3U9CA 2W05A 2WEVA 2G7HA 3P23A 3IKVA 1S8NA 1ZMUA 4TNBA 4RGXA 3ZYAA 4ZH4F 2OJIA 1OPKA 5H2UA 3CJGA 3DXNA 5CANA 4KYWA 1GIHA 1QPDA 3UPXA 4G6LA 2SRCA 1FBNA 4GKIA 4NM3A 3FKNA 3MH2A 3G0EA 4GFMA 3E6CC 4IAAA 3BDDA 4BWPA 1U2WA 3EFJA 3WF5A 4DFNA 2OQRA 4MQVA 3LM0A 5DG5A 3QLFA 2EK5A 3KCKA 3FZOA 1PHKA 2XM8A 3AD6A 5JGBA 4CMUA 4TZRA 5L4QA 4QLCU 2JFLA 5KX8A 2XKPA 4LMYA 2HFHA 3DBFA 5AR8A 3ECHA 1L8TA 3SGCA 2Z99A 1YTYA 3KEXA 2PVYA 4YFXF 4JAJA 3UMWA 4K2EA 4UV0A 1I27A 5CT0A 1VZOA 1WI9A 5ANOA 3PIZA 5HLHA 4B9DA 5GINE 4GRBA 4FODA 4KN7X 3QHWA 2GAUA 3FWQA 2XH5A 2AXLA 3ZXTA 2I0EA 1SNUA 3VUKA 1M2RA 2OXDA 5ERIA 3FC2A 2EJRA 2R3SA 5EDQA 1O57A 1BKXA 4BHBA 5JSMA 4BDKA 2VWWA 1OB3A 4X3FC 3QCXA 1XH5A 4BF2A 3V8SA 4E4MA 4CKRA 5GJFA 4TYEA 4PDYA 3QC9A 2QOKA 3KVWA 5DYMA 1DS5A 4O22A 4RAYA 4J8NA 2I6LA 3RINA 4R8QA 4QMQA 5D4SA 4BRXA 2O8XA 3QF9A 3NIZA 3KLNA 2AC3A 5M56A 3MIYA 1GHCA 4CRSA 1STZA 4CFVA 3OCBA 4RQKA 3GB2A 1Z57A 4W4VA 3GVAA 2C6MA 3KMWA 2R4BA 5M08A 1H08A 1PDNC 4ZP5A 4H39A 1FLIA 4X2FA 3NR9A 2YCRA 4F6SA 3O6BB 5EG3A 1J7LA 2HWVA 1OIUA 2ZVAA 2WOTA 3WTZA 4Q5HA 1JKSA 2Y6MA 4R77A 3MCZA 2YM8A 4APPA 3BROA 4QPSA 1U54B 1KYZA 2A3SA 3FMNA 3V6RA 2CSOA 2OD5A 1ULYA 5CZIA 2D45A 2FSMX 3V5PA 4BDGA 3W8QA 4I0BA 3WBLA 2DQRA 3COAC 1ZAOA 1SD4A 3TZ9A 4G9RA 2VTSA 3GQLA 3QU6A 1H1PA 5ANDA 3Q53A 4AT3A 1K9AA 3GU4A 3OBJA 2VRXA 3GI3A 2XBJA 2ZM1A 1G3NA 1V1KA 2R0UA 1Q97A 5HLPA 3DFAA 4PMSA 4KT5C 3KRRA 2DPDA 1W98A 3LIJA 3WZUA 4LB6B 2X7OA 1O6YA 2VC1A 4DF3A 1OKWA 2RQPA 3WARA 2F7EE 4MXCA 2ETHA 2HKXA 4FV9A 3TI1A 4ZOGA 3WZEA 5C8MA 3MZHA 1E1XA 4G1WA 4ALUA 4IVDA 1P14A 1O3RA 3G0FA 4DINA 4M9XA 5ICCA 3SW4A 1YYVA 4KDPA 3LJ0A 4CNHA 5LGNA 2CJMA 4HZRA 1VYZA 4Y73A 2PBIA 1LDDA 5M07A 5LHHA 3V5QA 2F2EA 3DCVA 4KS7A 4FT8A 5ICPA 1R23A 2VTTA 4MBLA 5LVPA 3R7GA 3IO7A 4D2WA 3QOPA 2DAOA 2CLXA 4IB3A 4I20A 1VEBA 4FC0A 3FL5A 2XM9A 2OXYA 1G3WA 5F9EA 2V0DA 3TXOA 2W85A 3GC0A 4XG3A 3I59A 2QU6A 4EKKA 5HIDA 4ERWA 1P4OA 3LLAA 2W99B 3RDIA 4X0MA 3TNHA 3EKNA 2QOLA 4XJ0A 4K1BA 4TTHB 5ICGA 3W33A 4DH5A 2XCHA 4G6NA 2O3FA 5GIPE 4M72A 1YWVA 2HY0A 2OZUA 2IA2A 2FNAA 5M53A 4C4GA 4XUFA 2D1HA 2QOBA 4IZ5A 1W83A 5ETCA 3QRTA 2WMBA 4S05A 1OKZA 2OO8X 2J0KA 4FT3A 3ZEPA 1WBOA 1S9IA 3LM5A 5A9UA 3TG1A 2XIRA 2PULA 3VFZA 2CFXA 5J1WA 4E7WA 5E8ZA 5CASA 4RFZA 4UVBA 5HS9A 4AUAA 3RTPA 3T1BA 3ATSA 1YW9A 3BJ6A 4O84A 4BKYA 2IPXA 4G3GA 4QO9A 3QKLA 3O3KA 1RIOH 5FM2A 4PTCA 3VUIA 3IL2A 4FTCA 1YDSE 4FGBA 3Q4TA 4U7BA 1IRKA 3Q04A 4YJQA 3EQHA 4CLIA 1JSTA 3OCTA 2E9PA 5ANKA 3NGAA 3ELKA 3HP2A 3CJFA 3GENA 3I71A 5KO1A 3PVGA 2W25A 5HVQC 4FEWA 4F0FA 1R1VA 4DBNA 1SFEA 3NNXA 3D5UA 2GNJA 4GU9A 2X8IA 4M6XA 2OZAB 1KE8A 4S31A 3QAME 4EH6A 1JWHA 3F72A 1BIAA 5J8CA 3R1NA 4QNYA 2O8YA 3F88A 3MJ2A 2XYNA 4MD8E 1LNWA 5DDGA 3OT3A 4QP1A 4FZ7A 3ROUA 2BROA 3FJQE 3TDVA 3LWFA 2Z33A 4C61A 4BIDA 5DYJA 3QGYA 3QQUA 4JLCA 4BYIA 4FL2A 1OUYA 2VTHA 2PMUA 2DW4A 1B6CB 2E9NA 2VTOA 3CUQC 3L9MA 1EV7A 1YRPA 4C2VA 4I5HA 1DM2A 4GKHA 2PVNA 2AUHA 2VBWA 5L3BA 3DKCA 3F3TA 3R2YA 1O3SA 2WMVA 4L8MA 5FP6A 4FUYA 5D8LB 3GFIA 5ANEA 2VC0A 4HCVA 3BU3A 3EYGA 4DTKA 4ORKA 1EH4A 2BILB 4IHSA 5IQFA 5LHGA 3VOEA 3RZFA 1V3FA 4YLLA 2XASA 3V8KA 4H3QA 3HL7A 5FD6A 2GNHA 3HLLA 5H8BA 1PXMA 4DG0E 1RZ4A 5JGAA 2J6MA 5M4UA 1YW8A 4LFUA 2WTWA 2YU3A 2A07F 3QCQA 3SXRA 2YDJA 4O5VA 5EM7A 3F5XA 5CU0A 2FE3A 3FWEA 1HKTA 4EORA 2O65A 4O38A 5GIOE 2R3JA 4DNCA 1Z6RA 3LMGA 3AC1A 2J5OA 3BBTB 4U45A 2DK5A 2EXMA 4OAVB 3CQEA 2B55A 4DEHA 4DAWA 3D5WA 2EFQA 4EL9A 4DA5A 3A7GA 4GO1A 3M1EA 2QCSA 4LG0B 4GJ3A 1M2QA 2C69A 4O1PA 4D0XA 4ZY6A 5EHYA 1ZOGA 2Z8CA 3A99A 1UU3A 1OYWA 3AC3A 4OTQA 1FBQA 5F6FA 3F9NA 4J95A 4RX5A 2PMIA 2LSOA 1JGSA 3QHRA 3ZHPC 3JSPA 4GIIA 3HHGA 1AWCA 4U79A 1R22A 4IRGA 2H94A 5EHOA 4BCIA 3AMBA 2PI0A 3FQEA 5CEOA 3L8VA 5CU3A 3MA6A 3FYKX 3GO5A 4R1HA 4EJTA 4I0SA 4U43A 2EV6A 5CXZA 3GFMA 2NO3A 5FFXA 3TO6A 2NP8A 4FSRA 3LQ3A 4IEBA 4AA4A 3D9VA 4L53A 4OTFA 4MKCA 4CVAA 3FLQA 2FMLA 4XNEA 3QU0A 2ZJ2A 3GYHX 5CYIA 3DPTA 5JN2A 3FXXA 2WHBA 2H34A 1BBYA 4FG7A 4KKEA 5TT7A 3LFEA 3P9JA 2C1AA 1ERKA 4BH9A 4D4YA 5HDKA 4UB7A 2ONLA 4L0YB 4NKAA 2WD1A 4O0UA 3GVUA 1LUFA 4BI0A 1MUOA 3V4GA 3ORKA 4FG8A 3VS0A 4ZTQA 1LJ9A 1K6OA 1JSUA 4BCGA 4R5YA 4JQEA 2XCKA 5IU2A 5L2TA 4BIEA 1WAKA 4G94A 1GIJA 4G16A 2W57A 4QP4A 3TUDA 5FEDA 3TWJA 5AR7A 1T6SA 4EOJA 3F8CA 4IW0A 4QMVA 5H9BA 3VC4A 4HGEA 2PZ5A 3D15A 3ZRKA 4KD1A 1NVRA 2CMWA 2X8EA 5AV1A 1RUOA 5J8IA 2WTKC 4KABA 5IA3A 2PL0A 5KMLA 4E6CA 4RIXB 4N57A 4DBXA 3OWKA 3UTOA 5E20A 2IZTA 3RCDA 2MLGA 3PG3A 3FI8A 3MFSA 2ELHA 4XRJA 4FK3A 3ZU7A 4N6YA 3FX3A 3RM7A 1OZ1A 1YI3A 2I0HA 2QYOA 3HAMA 2ZNZA 4FKVA 4I21A 3VF8A 1J7KA 1KSWA 3HIFA 4FYOA 4O6EA 5HLGA 3S0OA 4YO6A 3H10A 2BRBA 3O96A 4HCUA 3ANRA 3KCFA 4E20A 5LBQA 4FMQA 3GCPA 5AX3A 2ZFWA 2GNGA 3UP2A 3QWKA 1ZH5A 4A5NA 1PY5A 5IEYA 4CZYB 4B0GA 4KIBA 3PJ8A 3HRSA 4ZSGA 2W1FA 2HTJA 3JY0A 3VNTA 1OVEA 4PV0A 4ENNA 5HIBA 4GVAA 3LCSA 3Q5ZA 2X4HA 2UW5A 4G9YA 1MJAA 3E5AA 4HZSA 3C4XA 2FSWA 3EFWA 4NU1A 3HV5A 4HGSA 4ZYHA 5EI8A 4D55A 4CHUA 5FBOA 2FXAA 4F6WA 2LF7A 4D4RA 4I5MA 3PY3A 4J53A 2YLEA 1SD7A 4DITA 3EQCA 5HEZA 2BRHA 4IWOA 4CEGA 1M17A 2IW5A 3P4KA 1WKMA 3UBDA 5H20A 3N51A 5JK3A 5E8YA 3DLZA 3C13A 5AIKA 5E1XA 5HCYA 2ZAZA 3W10A 4D2RA 3KMUA 4FK6A 4O21A 3VF9A 2NPQA 4ZYDA 3CTJA 4RJ3A 1Z9XA 3UODA 2QQAA 1YXSA 4BCNA 1HCKA 3NDMA 4G31A 4K2RA 1YOMA 1XGNA 3HGKA 4UMPA 1XH7A 2BFYA 1R1UA 3GZ5A 3FL4A 4AN9A 5HU9A 4AZFA 3ALNA 3A2CA 3O7LB 1IA9A 1HSTA 2X7GA 2JAMA 5KMKA 4BY9E 4P96A 5DA3A 3I5ZA 3VO3A 5HNIX 5EKOA 4JBVA 1SD6A 2VGPA 5EI2A 2FH9A 3DK7A 2YJSA 3EFLA 1R5HA 4GCVA 3FY0A 5GJDA 4MNFA 4EOPA 3L7WA 3WF7A 2C3LA 3F61A 2UZNA 1P92A 1JVPP 4WBOA 3DNDA 1ZY5A 2CO5A 1VYWA 4QQJA 4WG4A 4HVGA 2XRNA 4G3DA 3ZRMA 5CNOA 6PAXA 2IT0A 2VOOA 3NUAA 4CICA 2B53A 3O71A 4XBRA 2ISZA 1DI9A 3TT0A 3BHTA 2M8EA 2BUJA 1ZHFA 4P5OA 4FIFA 3ZMZA 4UMRA 3RPOA 4NW6A 2IZSA 4KA4A 5HGIA 3H3CA 1U4DA 3ZPLA 4QMXA 4PUZA 4QD6A 2XK7A 3N4VA 1ZG3A 5F20A 4AN3A 1H0VA 2CCIA 2HR3A 3F6VA 4KIQA 1F5TA 3REPA 3QRFF 2JDSA 5IUGA 3LPBA 2A2AA 4I6BA 4UV8A 3EKKA 3I79A 2VO3A 5J7HA 3MVLA 1V0BA 2YAKA 2QI8A 3R6SA 3K3JA 2C3IB 4FZDB 4HLXA 2FOKA 1GOLA 1ZYLA 2A27A 3R1QA 3ZFXA 1BUHA 2H9VA 3J80Z 3R8LA 3MI9A 1WVXA 2IVTA 4C3FA 5IT3A 4ZSLA 2VTIA 1YWRA 4A6DA 3H9RA 2V6CA 4UVAA 5FXRA 2VBXA 3OG7A 2QKWB 3IKTA 4N9IA 4XCUA 2IO6A 4F63A 1G8SA 1DP7P 2CKEA 1H0WA 3D5LA 3BLHA 3DTWA 4B8MA 4WD5A 5L3FA 1H25A 5TO8A 2G2HA 2B9FA 3BIZA 3FI2A 2RG5A 2J0MB 4IVBA 1R36A 3AC2A 3QRIA 2DU9A 2HW7A 3NVMB 1Q8TA 3K9TA 4LGGA 1YLFA 5HZNA 3LXLA 3F3ZA 2QOOA 1TNSA 1Y91A 2VV9A 4TWNA 1Y57A 4EWQA 4C34A 2QHMA 3VAPA 5LMAA 4CFFA 2L54A 5LQFA 2NNWB 3RJPA 2XK3A 1IRFA 3GF2A 2YJRA 5BVFA 3DPLC 3PP1A 4OOIA 2FEZA 4BDBA 1FWZA 2KJBA 2VD5A 3N4TA 4FTLA 4RC4A 5G6VA 5KMJA 1ZRFA 5FGMA 4FTJA 1KU3A 2XV4S 4EJNA 3RPRA 3DA6A 4FT7A 4WNMA 3ORLA 2HENA 3U51A 2ZDTA 4L52A 4BBMA 2ZJWA 4PCQA 1R0EA 4W4XA 3TIZA 4V0GA 2WQBA 4U41A 1OGUA 4U0WA 4MX9A 3OOMA 3OCGA 3DDPA 3DLSA 2BDJA 4LQMA 2QVOA 1TQIA 3NRMA 2UW8A 1B1BA 5FD5A 2VWVA 2DT5A 4N6ZA 4BI2A 3ZBXA 5JT2A 4EJWA 1ODDA 5M4CA 1XR1A 3FHZA 1PXNA 4YMJA 3CKWA 2JGZA 1Z6TA 3C0HA 4FVRA 3ODZX 3RI4A 4ASNA 4C59A 1AGWA 2UZLA 4U80A 2BZJA 1FP1D 5CSPA 1OYIA 3MIAA 4ITIA 4FSQA 4L9TA 2XKCA 4XLVA 5LVMA 4L9VA 3SHFA 3A4OX 1YFHA 3TKUA 2CGPA 2VODA 2VX3A 4M84A 2JDTA 2C3JA 3ORIA 2BV6A 4E8AA 4K77A 5DEWA 3U4WA 1B9NA 5E1ZB 3MYGA 4BL1A 4TPTA 2J7TA 4R6VA 4YHJA 1ZXEA 1IF1A 3SXSA 4DFLA 3FV8A 3DV3A 4HYSA 4G6OA 3WZDA 4UYAA 3CJNA 5KBRA 1Z7UA 5CAUA 4BHCA 5FD2A 5BQ0A 5EDRA 2R3LA 1S6LA 4NQWA 2CHLA 3QA8A 3EHAA 3JW4A 2QG5A 3V5JA 3CQUA 4DH1A 3FZTA 3HECA 5CVIA 4D2TA 2YM6A 5EEGA 4AE9A 2C5YA 1QPJA 5L6WL 1H1WA 3V5WA 3VQUA 4JBPA 2WNTA 1OKVA 3L00A 2YN8A 4DG2E 4EUUA 1M52A 4TXCA 5A3XA 5HS7A 5IEXA 3DBDA 3BGPA 1OPJA 5HKMA 4JG6A 2QODA 3TDWA 4WRGA 4XV1A 1Y6BA 3V8JA 3ZH8A 3PDTA 1U5RA 5EW9A 2UXNA 1KE5A 2YIQA 2YISA 4ZJIA 1KE7A 3OUKA 2ITOA 3IW5A 5EQPA 2Q8KA 3GX4X 4R78A 4FZFB 4JVGA 1WBSA 3ZO1A 4EK5A 4DGGA 4GS6A 4CGZA 3CKXA 5AP1A 3VUGA 1ZYCA 4XP2A 4KB8A 3VUHA 4GH2A 4KS8A 3SRVB 3I4PA 2PWLA 4P5QA 2ZCWA 2W06A 4Z3VA 3PRIA 2OXXA 4CTBA 4HYIA 4DEIA 4E5WA 4YG2F 1ONVA 3ORMA 1REJA 3WIKA 3TDZC 4C0TA 2CGWA 5BVOA 2XAHA 4HW0A 2WU6A 3C9WA 3VHKA 1JBPE 3DV8A 4AE6A 2JPCA 2RIOA 1G8AA 2A69F 4AP7A 2Z02A 4WHZA 2WOUA 2QENA 2IVMA 4UYNA 4YJNA 2OH4A 4RZVA 3RALA 4RC3A 1SYKA 5E1WA 3PJ2A 3POZA 1KV1A 3F66A 4OBOA 4WA9A 5D5XB 4K6ZA 3E6BA 3ZS5A 4QMNA 1PJKA 2FF4A 2O5KA 4BYYA 3L9PA 3VW8A 2F5FA 4RGJA 5EI6A 2JKQA 2R3MA 4EK6A 4WCGA 1QO0D 4EQQA 4C4FA 5D10A 5HG9A 5EH0A 2QLQA 3I1AA 2PZIA 2EFNA 3R0AA 2B4SB 3I0QA 1QL6A 3SRVA 1K3AA 4O6JA 3T8TA 3WYXA 4U42A 3C4ZA 4MCVA 4IRIA 5JFSA 2GQQA 1UCRA 4H58A 3D83A 3IECA 4FX0A 2GXBA 1OITA 3PRFA 1IRGA 2EXCX 5FLXZ 4KIPA 3NS9A 3WG9A 4UN0C 1UB9A 4QRCA 2XAFA 3KFAA 1WRJA 4I6HA 5CJ9A 3GFEA 3JAMZ 2GNFA 4HLYA 4N9HA 3G3ZA 1LDJA 2IPQX 5CVHA 4A0XA 1KU7A 2GQSA 3QALE 3FLSA 4BBEA 5I3OA 2IA0A 1U46A 5HI2A 5J95A 1UHMA 2FBHA 2YX7A 4JG7A 4CFNA 4KUJA 3RPQA 5D6FA 5F94A 3O0GA 2R3IA 4FEUA 5D8KB 5DR9A 4F7NA 4DCEA 1P4WA 3LHJA 3FDNA 4AF3A 2YX4A 1IXCA 3PG1A 3MB6A 2LGCA 1HW5A 3LFQA 3F5GA 3S2PA 1HSJA 3KK9A 1YWNA 4O7YA 1Y0UA 4RGUA 3GFLA 3NEWA 5KZIA 2HY81 4YUQA 4IE9A 1NXKA 3A62A 5HCZA 4IXAA 3CUOA 4CYJA 4I2OA 5CVVA 2WQEA 2XIYA 2HYYA 4HPUE 1YG2A 3PXZA 5DR6A 3BHHA 3BE9A 4XYFA 4B8XA 5DFPA 4CG9A 4CSVA 4RMZA 2P2IA 3D0EA 5A4EA 4Y72A 4D4VA 3QTIA 5IISA 4EH7A 3TO7A 1DUXC 3BLRA 4YURA 2HZ0A 3E7OA 3E8EA 3LSTA 5L3CA 5E91A 4LLLA 2UW7A 4BCOA 3NAYA 4HF0A 3O50A 1UKHA 3Q4CA 5DE2A 5DT3A 4DN5A 2VTQA 4FF8A 1OI9A 2HAKA 5J87A 2TDXA 5JQ8A 2UVYA 3F8BA 1I5ZA 1XSVA 3GOKA 4FTNA 4HGTA 1B9MA 3BYUA 5L3AA 3NMUF 4M0YA 2EB2A 4OLIA 4ZYGA 2GS6A 1LEWA 3PVBA 5CLPA 5IQDA 3HKOA 1G4DA 3VBQA 4U8ZA 3TO9A 4UXNA 3V7CA 3DGKA 1R3CA 4FTAA 2QQ9A 2W24A 4AVPA 3QYZA 4IACA 2GZWA 3POOA 3CC6A 3LFCA 3QZGA 4C58A 3FZVA 4TNDA 2HOEA 3O2MA 3R60A 4XG4A 1I1SA 2LDUA 2J51A 3MH3A 5LMKA 3IDPA 3ULIA 1APME 3FMEA 4L45A 5TOZA 3RAKA 4HQMA 4J1RA 4FNWA 1XH4A 1REKA 2PVMA 2GMXA 4O0TA 2R3GA 2QR8A 2PPQA 3ACJA 3D4QA 3OHTA 5DRBA 3G9NA 4JNWA 4AFEA 1PMEA 3W1FA 2CKOA 2BIKB 3ZXZA 4NTSA 3HUGA 4IB5A 1YHWA 2M30A 2EB7A 3A4PA 4KUMA 5C1QB 4R79A 4ZSJA 5ACKA 1SMHA 4K9YA 4FV0A 3AOXA 3LFDA 3LOKA 4Y83A 1PMNA 2HCKA 2ITUA 1HKQA 2A4LA 1F0QA 2P0CA 1K7AA 4AT4A 4M3QA 5HG5A 3RPSA 2YCQA 2DO7A 1YHSA 3RPYA 1IEPA 4BCQA 5HLIA 4D2PA 3JS2A 4KKHA 3ERKA 2PFBA 4IBMA 3ZUUA 5EYKA 2XK8A 3L8SA 4CCUA 2PEXA 3IPHA 3PWYA 4KIKA 2GA2A 4PPAA 3FPMA 4NWMA 5IEVA 2YCFA 1E9HA 5DIAA 5I9UA 2YIWA 2W9ZB 3AQVA 2RFEA 3JVSA 3EUHA 3RAIA 1UA2A 3GU7A 5I9ZA 2GDOA 4B7TA 4D2VA 1BI3A 2YEXA 2WELA 2WTEA 2JD5A 3R9DA 3WIGA 5E17F 3DJ7A 4A9SA 2WPAA 4E6QA 4EYJA 1BI8A 3BYSA 1O3TA 2BEOA 3ZN0A 3K54A 3MB7A 4H05A 5D9HA 3I58A 3FQHA 1BLXA 2P5LC 1GVJA 4YJPA 4LL5A 1NY3A 3ZTXA 2PUUA 1ZYJA 2HYFA 4XBUA 4PF4A 4P5ZA 4KICA 4BCJA 2VN2A 1LR4A 1H4LA 4AU8A 4OUCA 4EMSA 4WK8F 4GYIA 3GCUA 2QQ7A 1CSNA 3P5KA 3QC4A 4NT4A 3LJ2A 4F9AA 5HDGA 1SM2A 4XP3A 2PQ8A 3A7FA 4A4OA 1H28A 1XGOA 2OSCA 5K4IA 2X9EA 3EWHA 3OWJA 4D4SA 1IN8A 1R78A 4DLIA 3RP9A 2H6CA 2VWBA 4O2PA 2YR2A 4MNUA 4ZMFA 3EB0A 1EH7A 4C4EA 2VTPA 1TQMA 4Y5HA 4R1VA 3DOGA 5J7BA 5JH6A 5ETFA 3R02A 4O7SA 1KOAA 4HNFA 4I6QA 3TZMA 3R71A 3VBTA 4M67A 3AT4A 2WQOA 1NVQA 3E93A 4YSMA 4W4WA 3W16A 1U8RA 1YOLA 1ON1A 4CYIA 1PUEE 4YTFA 4XG8A 5AAEA 4QTAA 1FOKA 3OUNB 3GCQA 4KSPA 2BAJA 4ZYEA 3Q4UA 1P4FA 2VWXA 3QPTA 3KP6A 3F2AA 4O0SA 3F5PA 1F3MC 2OJ9A 3QRKA 3W6JB 3KRJA 4IX5A 4XP0A 3MTLA 2XNOA 1USTA 4NJ3A 5HBEA 5HO7A 5JQ5A 2JDOA 3R83A 5DCFA 1DAWA 2QNJA 2UZTA 2AYPA 2I1MA 2ITVA 4XOYA 4P7EA 4EK3A 5HNBA 2JZYA 2R64A 5DRDA 3WTXC 4DHFA 3BY6A 3WYYA 5LVNA 1P2FA 5CF5A 3BYVA 1U78A 1STCE 5HVJA 5ETIA 4O7LA 4EONA 2H09A 2UZDA 5AP6A 2CKQA 2JIIA 3BKBA 4JBOA 2VTJA 4BDEA 4HX7A 2BTRA 4ZLYA 5AV2A 3SW7A 4PP7A 2GQGA 5EYDA 2W4KA 5KHWA 3R9NA 4DH3A 4Q9ZA 4YNEA 3G90X 4MF1A 4HYHA 4U0IA 4V01A 3B2WA 3WTSC 2YM7A 4E5AX 3F3VA 5ACBC 4IAKA 3DAJA 5JHUA 3OW4A 4BTKA 4EQMA 3I4BA 2JBPA 3KN6A 1L3RE 4FZ6A 2JTVA 4KAOA 1X8BA 5J9YA 4CCBA 5IA4A 5D5WB 3VS6A 4AOIA 2WTDA 5C9CA 5L2WA 3BELA 2QOFA 3ZBFA 2B9HA 3VW6A 1KWPA 4CFMA 4U0VA 1ZARA 4W9XA 3WE4A 4BYJA 4TWOA 2OK1A 3PPKA 4Q5EA 2B9IA 5BPIA 4EH9A 4M74A 3HUCA 4KBCA 3HSFA 3CO6C 2XK6A 4HF1A 3HSRA 2EWAA 4TYHB 4E4XA 1CF7A 5IQAA 3LFBA 3P9IA 3IG7A 4MXZA 1H24A 3KK8A 4P4CA 2VGOA 3E8NA 1KV2A 4L6QA 1IN6A 2R3NA 4Y8DA 1W7PB 3LAPA 4GFOA 2CPKE 5C8KA 3TNIA 3ECOA 1H1QA 2X0GA 4MXAA 4I7HA 3F21A 4BHZA 3DB6A 4MBIA 3MPMA 4QQCA 5AV3A 3V5LA 3VS4A 3PXYA 3LAJA 2Q0NA 2BALA 4CMTA 4DT9A 2OJGA 2CG4A 2VBYA 4UVCA 3K3IA 2P7CB 3V51A 3OP5A 1WBPA 3P7BA 2Q83A 5B7VA 1HKSA 2RN7A 2OF2A 4ARKA 3MY0A 3S4QA 4LK1F 4R7IA 3VBYA 4BDIA 1JHHA 2EB3A 3HDMA 3R00A 3REOA 5FEEA 1H9GA 4IH8A 1E2XA 5CAOA 4MK0A 4TYGA 3QKKA 1GJOA 2OZAA 4CT1A 3COKA 2X9FA 5EYCA 3UE4A 4GIHA 4LB5A 2PZYA 4EVIA 4FV3A 3VEPA 4IX6A 2XVDA 2F2CB 4I4EA 2L3DA 4FBXA 5C27A 4QMMA 4E5BA 4BN1A 3LLTA 1YOJA 3TKYA 3O8TA 5AV0A 5FLXK 1R0PA 5D11A 4OTIA 2ADUA 4LRKA 5CEIA 2KULA 4AGWA 5L3DA 3BZ3A 2R5TA 1MZBA 4OT6A 4QP2A 3E6MA 2XEYA 3QTZA 4BDJA 1K2PA 4FSYA 2XRUA 2E9VA 3CS9A 5F1ZA 5KZ0A 3HRBA 2XNPA 4JDHA 3ML6A 4O1OA 3W6KB 1HXDA 2KIUA 4ENYA 1AQ1A 2WTVA 2AS5F 4UZHA 2C30A 2ZO4A 4CRLA 1B39A 3KCCA 4WUAA 4DH8A 4GYGA 4R1YA 1QZYA 4RB1A 4HPTE 2BDFA 4HCTA 3ORXA 3N4MA 3DB8A 4IX3A 2I7QA 3TTJA 3DAKA 2XKEA 3MA3A 3L1SA 3GXOA 5DR2A 3DPKA 5AUUA 4E6AA 4C38A 4BIBA 3V8LA 4L67A 4DFUA 3L9NA 2STTA 2YITA 3GC7A 5IMEA 4FNZA 3W2SA 1KYWA 3MN3A 1UHWA 5AUVA 5LOHA 3V6SA 3EQRA 3R1YA 2Y6OA 4O0XA 4UEUA 2ZV2A 2LAVA 4NFMA 3QTQA 5DBXA 4DGNA 1XN7A 4QQ5A 5M57A 1JKKA 3B2TA 3PA3A 5IUIA 4OU0A 3PQJA 3E3PA 4EOOA 2PZPA 2UZWE 2NRYA 4H1JA 3E7VA 2FSLX 4J97A 3T8RA 2LF8A 1FBUA 2XK4A 2CGUA 4XSXF 4GEOA 3LA3A 5DUKA 3ZMSA 4MWIA 4M68A 4F9YA 3KEOA 2OU7A 4D5HA 4ITJA 3S1HA 3PPZA 4OTWA 2OFUA 2YLFA 4LD5A 4TWCA 1EH8A 3FKOA 1OMIA 3J81K 4TKSA 4KN4X 3T9TA 4WNOA 4WF2A 1XO2B 5C8NA 1VR2A 4FIGA 2H27A 3PY1A 4O83A 3HYIA 3CP9A 1SD5A 4I92A 3WU1B 4TYHA 4FKPA 3QCSA 1R1TA 2A5YB 3LCTA 2Y75A 3FMLA 3CD3A 4K0YA 2OFVA 4MQ2A 3TACA 4F09A 4X7QA 4ZK5A 2XNNA 2PMNX 4QP6A 3TN8A 5FRIA 2R0IA 1FNNA 5LEJA 3GFJA 4QQTA 1TNTA 5B2KA 4IZYA 3KETA 3HP5A 3R63A 2GIVA 2K7LA 1IR3A 4LG4A 4BDCA 4UBAA 3MSSA 4FA2A 4CD0A 4RFYA 3ZC6A 3KL8A 4O0YA 5BPYA 4D5KA 4EYMA 5CSWA 3AMYA 2PMLX 3UJGA 2HGCA 4LI5A 2W5HA 2ZYBA 1OKYA 3SQNA 3LA2A 2C5NA 5BVWA 1DPRA 3MY1A 4RIYA 4UHTA 4FV7A 1WSUA 4RT7A 3ZRLA 4FR4A 3WTUC 3KULA 5HX6A 5AA9A 3RYPA 5DD4A 4NIFB 3CTHA 3KVXA 3ZC5A 4KSQA 4BAYA 5CU6A 4IPAA 1HBXG 2G7UA 5BUIA 1TBXA 2I40A 1UFMA 4LMUA 4F1TA 4ZZDA 3UOJA 1BYGA 3ZUTA 3W18A 3ABUA 4L7FA 1V0PA 3TM0A 4GMYA 2V7AA 3LXPA 4L00A 4BC6A 4NCTC 3DZOA 2WMRA 2VX1A 3DTCA 1OPCA 5IUHA 3MESA 2P5VA 4CKIA 2WTJA 2WC2A 1X3UA 3KXZA 3F2RA 4XG9A 3K1PA 3MBLA 3RWPA 3LAUA 3ET7A 2QO9A 1JHFA 3PFIA 3RJCA 2BBYA 5TJJA 4LJZF 4G2FA 3EQLF 5ED4A 2PSQA 4IZAA 4O27B 1LVAA 3EMGA 3L8PA 4HOKA 2BHEA 1JSVA 3H9OA 3UYTA 4FKSA 4OW8A 1GZNA 3RAWA 3WF6A 1NVSA 2Z60A 3UOKA 3HV3A 2IZUA 4MNEB 3NCZA 2VWUA 4W9WA 5J5SA 4DFBA 4RZWA 3KZZA 2I0VA 4P90A 5CVUA 5DV5A 4QMYA 3KXXA 3OC1A 3QP5A 1CKJA 5KUPA 3UGCA 5CEMA 3WE2A 3BPXA 4GT3A 2F9GA 5F95A 2C6YA 5J9ZA 4O86A 1QPEA 1SMYF 1FGKA 2WO6A 3I81A 5F4NA 5H8GA 2PVJA 1W5SA 4HJOA 3F6OA 4GW8A 4Y13A 3AC4A 4RWLA 1XGSA 3HEGA 4XEYA 4G6DA 3EH9A 4TN6A 3HHHA 3NYXA 4R7BA 2XIXA 5FGKA 3IONA 1JOWB 4I0TA 4Y95A 1H01A 5CZHA 3BV2A 4JX3A 3JTGA 1ZYRF 1J91A 1R1WA 2WTCA 3HRFA 3EYIA 1S7OA 1XBCA 3Q6WA 4X2JA 4M13A 4ZY5A 5CEQA 4LL0A 1DAYA 1Q8WA 4IIRA 2MH2A 2PVKA 4QWQA 3D2KA 1G3TA 4G34A 1XDUA 4PQNA 4NEUA 3T5XA 3R28A 4YZ9A 2AC5A 3R8ZA 3UNZA 2VWIA 3J80K 1LDKB 3DFCB 2C5VA 1ZMVA 4FIHA 4KIFA 3LFAA 3LFNA 3FSFA 3NUPA 3NUSA 1W84A 4H3BA 5GZ9A 3QTXA 2W1DA 1S3JA 2WMXA 4U81A 4BGHA 4KIKB 1R5GA 1FOTA 5HG8A 4ASEA 5LJJA 3CGFA 4LGWA 5GNKA 3JTHA 3FXZA 3BCEA 5KVRA 4GK4A 5AA8A 3CR0A 4LV5A 5CTPA 3CLOA 2YPRA 2HZNA 3E63A 4WUNA 1AD5A 1FMOE 3EZVA 1PYXA 4J99A 2PMHA 2PVHA 4DQ2A 3QU3A 4ZEGA 2P3GX 2ITXA 1PP8F 1IXRC 3QYWA 4RLLA 2XYUA 5T3QA 2LKPA 2R3QA 4FKJA 4LOQA 3OTUA 4M6YA 2PN6A 4XLNF 4FSMA 2EVAA 3COHA 1W82A 4CKJA 5TE0A 3R0TA 1J5YA 5LWMA 3FSKA 3FI3A 3RZBA 2QLZA 1NT2A 2GS2A 2P5KA 2W96B 2P8TA 2V62A 3VRZA 3M42A 3RKBA 2E2BA 4L46A 1XD7A 3DS6A 1MD0A 3FMHA 2J0IA 4LGHA 2HOGA 3VBWA 1MRYA 3LQQA 3NW5A 4IM0A 2MH9A 3EZRA 3O51A 5A2QZ 3D5XA 4RIYB 4LUEA 5I9XA 2RVCA 3JPVA 3QQGA 4D1XA 1BL6A 3QTRA 4BWKA 4DE4A 5BVDA 4AGCA 3I0OA 3R2BA 4XHKB 2B9JA 3W55A 2ZOQA 4Y15A 2FVDA 3E87A 3R7UA 4MEXF 3FZSA 4AIKA 1S9JA 2GU8A 2WMTA 4ZTSA 4I93A 3VS7A 4YZCA 2RKHA 2F5EA 3CTAA 4F64A 4ETSA 4LOOA 5FM3A 3VVHA 5CSXA 3ZMUA 4D0WA 2QR7A 2DTRA 2Z3YA 1FYKA 2EUFB 3NNVA 1M2PA 4XV3A 4HW7A 3LFFA 1CF7B 2W1ZA 3RVGA 2DK8A 3R7VA 3CO7C 3BOQA 1MDMB 2HWOA 2V7OA 4IXPA 3FPQA 3DQVC 3HV4A 3QBNA 3KP2A 2CNUA 4EQCA 4MXOA 3ZLYA 1OIRA 4PDOA 2RF9A 2OIBA 2Q2EA 4TY1A 4V0GB 2HK5A 3IWFA 4I09A 5M44A 2JKKA 5DEQA 4GSBA 4JDKA 5CQUA 5AP2A 2DWBA 1YVJA 3ZM9A 4NL0A 3HNGA 1WBNA 4F7LA 4WKQA 4ENJA 2DUVA 3FM5A 4MTAA 4ONAA 3G6GA 3ORTA 5FTQA 3TJDA 1W7HA 3QGWA 3PSBA 4L9JA 3H9FA 2F49A 3PXRA 5IH5A 5ICEA 4X21A 3SVVA 4EH5A 3OZ6A 5ETAA 3SZPA 3FAAA 2NRAC 4YC6A 3PSCA 4W8EA 2ESMA 4ZZNA 4PGGA 4RWIA 4IMYA 3M8EA 3C51A 2QM3A 5J6XA 4L18B 1FVVA 3KP3A 5AIQA 3ZMMA 2XNMA 5B0XA 5CF6A 1S29A 3MDYA 4IZ7A 1HOWA 5KKRB 4LRMA 4FSNA 1KU2A 3R8MA 1BMKA 3NYVA 2PVFA 3VIDA 4A6EA 3DKWA 5JZNA 3MFKA 2J0JA 4FTMA 1FVTA 4XV9A 2GNLA 2V79A 2X81A 5D1JA 4L68A 3L8XA 5CWZA 3BYMA 2R7FA 4M14A 3K1NA 2UW6A 3BEGA 5D5UB 2WQMA 1SMTA 4CQGA 1SVEA 3PYYA 3OWPA 4FVQA 1LEBA 5HO6A 5AUXA 4X3JA 3GUDA 2FBIA 3G33A 4AZWA 2M5WA 4OMYA 3O8PA 2HELA 5K3YA 3HMPA 3D7ZA 4HVIA 3H92A 3VQHA 4EZ3A 3FC1X 5CS6A 4O0RA 5EQEA 4GT5A 4QPMA 4Z7HA 3N9XA 2F2UA 2ACJA 3HRCA 4U97A 2UW0A 1PP7U 3DBCA 5CXHA 2H8HA 3HMOA 4E1ZA 1IASA 3UQCA 5IPJA 3SV0A 4M7IA 3T9IA 4AAAA 4K11A 1ZRCA 5IG1A 5CY3A 4TV7A 4ON0A 3TOAA 5BYZA 3U87A 4GUBA 3Q96A 3FZRA 4L3PA 4A4XA 2P6TA 4HNIA 3HDNA 5DMZA 3CSVA 3S3IA 4CZUA 3HMIA 5E90A 3P9CA 4F65A 4F0IA 3IWZA 4M69B 1FSEA 4G5JA 4O96A 4GK3A 1H9TA 5A4LA 4IFCA 4UMUA 3LKMA 3UMXA 5IT9K 4Q4ZF 3VS2A 2EA2A 2CSNA 2X6DA 4HVDA 4I98B 4JX7A 2HQRA 1L0OC 3LFSA 3GZ6A 1ZOHA 4RB2C 3MH1A 3I7CA 5HTIA 4B4LA 2XB7A 1XQZA 4I1ZA 2H6DA 2DFIA 2BHHA 4HBLA 4CFXA 4XOZA 4F6UA 4XSZF 2CYYA 4RA4A 4FZAB 3ZOSA 4ITHA 3C50A 4U44A 5EQYA 2IZRA 5D6EA 4LLGF 3KY2A 4JS8A 1ZLJA 5IKWA 1RQQA 3DKOA 2CNQA 5EFQA 3P86A 3IRRA 4FTTA 4ERKA 3PPJA 2UUEA 3FUPA 5A4QA 3RHKA 5KBQA 3VULA 2E9OA 3UC3A 4FSTA 5JVTA 4RBLA 1MRVA 4DLJA 2D1VA 3LVPA 5F64A 4ANMA 3UNJA 2ETMA 4BTJA 1GAGA 1RE8A 2O3PA 2GSFA 3RNIA 3FZPA 2QOHA 3WTVC 1ZGJA 5CEKA 1LPUA 4I3ZA 3G15A 4KIGA 4RGSA 2YHVA 1WFCA 1M7NA 4QP7A 3G9LX 5EM6A 3D2IA 2JIVA 5BUEA 2VO0A 3PA4A 5A54A 5DUIA 2JITA 4ZAUA 4PRJA 4PNIA 4XS2A 3OCSA 3IOPA 4AA5A 5FTOA 1L3LA 1YQJA 3ACKA 3AAFA 1BC7C 2O2UA 3OXIA 4PTEA 1Q24A 2YDIA 3RGFA 5E1EA 4FSWA 2VWYA 2XEZA 3G2FA 5HBHA 4EH8A 2VTAA 4JIKA 3UG2A 2VAGA 4C3RA 2VWZA 3TEIA 5E7RA 4AW5A 2R3OA 2CKPA 1FGIA 4XMOA 2W5BA 5DOSA 4AD9A 3GFWA 3WILA 5CT7A 4CDGA 4JL9A 4HA8A 2NRUA 3LQ8A 3FLZA 4G8XA 2O61A 4EC9A 4HX8A 4OIPF 3FZ1A 2W4JA 1B38A 1SNXA 2ITTA 4CTCA 2RL5A 4G17A 3Q5IA 4B99A 3NWWA 3ZZWA 2OG8A 2XKOA 3QL8A 4IF4A 5JFVA 4JQFA 3Q3BA 4V05A 2Z7SA 3EDPA 3KMMA 4EHZA 5BNJA 1ON2A 3PZEA 2WFYA 3PSDA 4ZTRA 5CVJA 1OIYA 4IRHA 4UZDA 4Z7GA 2OBPA 4FV4A 1OMWA 1BI0A 1CMKE 2CGVA 4MXYA 4ASZA 4IX4A 5EEHA 2Q0OA 4NM7A 2P7VB 4EH2A 2HQNA 4QMTA 1J1BA 2UXXA 1J1CA 1BI2A 4O2ZA 2UW3A 5ICFA 4L9IA 3BWFA 3SDJA 2DI3A 4WT6A 3V5TA 3KN5A 1IAHA 4RJ7A 4A4LA 1FT9A 3CPCA 3A60A 1YO5C 4WSQA 3ORZA 3G6HA 2W84A 3NYOA 3KULB 5AP3A 2JRTA 5HOAA 1G3YA 3U2RA 1HW1A 3KF7A 1TKIA 3D7TA 1WBWA 5AIPA 2C47A 1T38A 4FKGA 5GJGA 5E8UA 4AN2A 5AP5A 3DBQA 2UV2A 2YFXA 4RFMA 5FFZA 4M9ZA 5FDPA 4R5SA 3PZHA 3UZRA 3E8DA 3ZZEA 5TF9A 4BZNA 4L5IA 4ENMA 4FIIA 4A9TA 3J81Z 4OAUC 2VNWA 2QO7A 3HRUA 1ZWSA 1GZOA 4X3FB 1PXJA 3VJNA 5HQ0A 4DEEA 3DXPA 5JFWA 5AMNA 4XLPF 5LMBA 4CG8A 4H0EA 4H3PA 3ZMVA 2WMSA 1RUNA 4ZLOA 3D14A 5I9YA 3OMVA 3CUQB 3LCOA 5E92A 4EOKA 4RIXA 2QVSE 3KXMA 2VONA 3U6JA 2F7XE 2VU3A 3E5QA 4EM2A 5JI6A 4MD7E 5JKGA 3GEZA 2FRHA 4GCJA 1PRYA 4EV0A 4CV9A 4O7ZA 5CU4A 2H6BA 4O0VA 2OW3A 4I41A 1IXSB 3FQSA 2ONLC 3TQNA 4PTGA 4IB0A 4G3FA 2EV0A 2EFWA 5IA2A 3D94A 1FYLA 3ZFMA 2VT2A 4ZS4A 2ZV7A 2YCSA 3MW1A 4EOSA 1OYYA 3BWGA 4I94A 4EQUA 5GHVA 4A12A 2PU8A 4UY9A 4YJUA 1W8CA 3BU5A 4JT3A 4YTHA 1P4XA 3R21A 5BPDA 5K5NA 2R7DA 5KCVA 3R30A 2IW8A 2QZ8A 4D58A 1IG1A 1GNGA 4TL0A 3EFKA 4I24A 4MHGA 3WOWA 3VHEA 3WU0A 3LJ1A 3M1SA 2OH0E 3E88A 3RM6A 3BE2A 5KE0A 2OWBA 1JKLA 3LFKA 1Z05A 2BIYA 4BHPA 4M9SA 3RAHA 2QC6A 4I4FA 5AIRA 3FEGA 3GCVA 4TYJA 4EHEA 2XAGA 3RPVA 4JK1X 4O3MA 3V3VA 3ZN1A 4EHGA 4AZSA 3CGOA 3R8VA 3BHYA 1MQ4A 2C6TA 3MPTA 4L42A 3PIYA 4DTBA 1YIOA 4P55A 4WXCA 1OUKA 1GXQA 1OIQA 4RVTA 4QMZA 4ENXA 1LEAA 3OROA 3T0YA 4RJ8A 4BB4A 4Y17A 2CQKA 5DEYA 2IJLA 4HOBA 5LRSA 5LLQA 3EL8A 2WTIA 3U6IA 2C5OA 3CY3A 5BOXA 4F9WA 4FKUA 3M7GA 2WWYA 2XIKA 4DGLC 1VTNC 3R8UA 1USSA 5K5QA 5AONA 4FE2A 5IMXA 3OXTA 3B8RA 3PE1A 5TR6A 3QTWA 4M69A 3F8FA 5CF4A 3NX8A 4FOBA 3R73A 4HAMA 1VJYA 5E8TA 2FQ3A 5AFVA 5HLWA 2R3HA 2R3FA 2PUIA 3GLXA 2QD9A 2YZAA 3QX4A 3R9HA 4L7SA 3GT8A 3TGNA 4I02A 1NHAA 1MJ9A 2PUNA 4L3JA 4EOIA 2OU2A 1Q3DA 1PXKA 5IA5A 2G1TA 5DGZA 5CVFA 4EZ7A 2VO6A 3E5UA 2YA9A 4F70A 2XRWA 4AOTA 3LCDA 4YIIA 2WTKB 3UDBA 3FMKA 5KMNA 2VTLA 3KKVA 5AP4A 1ZMWA 1H1SA 3K5UA 2BVAA 4LMNA 1W7PD 5FUTA 2GA1A 1J2XA 2K4JA 4Z2YA 3NLBA 1T45A 5IZFA 4MTDA 3KXGA 3DP7A 2MBFA 1SVGA 3DQWA 4QYYA 5DHJA 3QP6A 1XCVA 3L9FA 2UVZA 3P1AA 1PMVA 4ZMEA 3HMMA 4UMQA 4OTRA 2IP2A 4L0ZB 4DGMA 4AZEA 3U1DA 3F22A 1FQ1B 4AIJA 3ZM4A 2UVXA 3RKXA 5J9LA 4LK0F 3JAMK 2IRFG 5LEKA 4M73A 4JQ7A 1ZYSA 2IVSA 3HYHA 5A4TA 3TV7A 1FY7A 5DT4A 3OVVA 4J8MA 1Q99A 5A6NA 4FKTA 3MQ0A 3DK3A 5FEQA 1SAXA 5FB2A 2X2MA 2WAJA 2WU7A 4EK4A 3RK5A 5J8FA 5H8EA 2HYGD 3PLSA 3BJOA 4X2GA 4BVUA 4DFYA 2BCJA 3TUCA 1SFUA 4ESJA 4GGGA 5FTGA 4S33A 4OTGA 2QG7A 5CLSA 2OBJA 1NW1A 4OT5A 3JVRA 3MTFA 1I6XA 3RNYA 4JAIA 3FMQA 2XNEA 4PWNA 2ETRA 3R0JA 4CQEA 4RGRA 1A06A 5CAPA 2IW6A 2BAKA 2BRNA 5I9WA 4EJVA 4JJRA 2RFNA 4E70A 4UALA 4ZZLA 1KE9A 4FIEA 4DEGA 3W2QA 4BKZA 3Q9WA 4PY1A 3SXYA 2W5AA 2CCHA 4PMPA 5HE2A 3WODF 4M97A 5CEPA 5K0KA 5IQBA 3Q9VA 3RYRA 1WCCA 2OKRA 4F7SA 3ORPA 3MPAA 3EJ1A 1PKDA 2NYXA 3ZONA 4YZBA 1RNLA 4G7ZF 4WG5A 3C0IA 1BM9A 2P55A 2ZBKA 1RDQE 2Z9OA 2C68A 4X3FA 4ANLA 3UC4A 4HZFA 2FA5A 1PKGA 2JT1A 3DAEA 4JBQA 4OTHA 2BE5F 3VS3A 5JFXA 2E7XA 3VBVA 5M4IA 2XNBA 3GCSA 1ZLTA 4USDA 3UVQA 4ACCA 3CIKA 2OJFE 4NCTA 5K5RA 2VO7A 2W9FB 4OBQA 3UQGA 4YC3A 1BIBA 4AXAA 4OBPA 4O91A 4L9NA 1KA8A 3IS5A 1OL7A 2ZNYA 4MGRA 4I0AA 4IM2A 4CMOA 2YSRA 3P0MA 4WNKA 2MD5A 2FO0A 2ERZE 4UMTA 3TJCA 1QCFA 5AR3A 1P5EA 4P2KA 3PFQA 1OPLA 1MGTA 2O63A 3UG1A 4MAOA 3QKMA 4NK9A 4A07A 1OBGA 1HW2A 3NAXA 3RPUA 1EH6A 4DH7A 1QGPA 1WWXA 2QBYB 2W17A 4AQCA 2PE0A 3DDQA 3QAHA 3F3XA 2JDVA 2FSTX 3I54A 3L9LA 4N0SA 3ORNA 3JY9A 3F2NA 1E17A 4LRJA 4X6RA 1U5QA 1MKMA 4JR7A 3V7SA 3AXWA 2YIRA 3H4JA 4NIFA 4DC2A 4OTDA 2K27A 2A61A 1J75A 1IA8A 4YLJA 4Q9SA 4N70A 2ITPA 5FP5A 2QONA 3KB7A 2CN8A 4HV5A 3ITZA 4MYGA 4YPSA 2W1CA 4OIQF 4AX8A 2P6SA 3UVRA 5CALA 3SC1A 2BAQA 2VOPA 1C0WA 2O0UA 1OKRA 4ESFA 1E1VA 2X1NA 5E4HA 1UKIA 2J0LA 5I0BA 2QUFA 2GTMA 5LXMA 4YJRA 1M7QA 2BRMA 4V04A 5CSVA 5AP7A 1YXVA 3SG9A 5AM6A 4AZTA 3MVJA 4F99A 3LA7A 5JMSA 3DEUA 4Z9LA 4DFXE 2LNBA 3PE2A 4IVNA 2ZDUA 1TVOA 1T98A 1ND4A 2Y8OA 4H36A 2CNVA 2EV5A 4ID7A 3GWZA 5K4JA 5HDNA 3P9KA 4GL9A 1WBTA 5DVRA 5LCJA 4RVKA 3KLOA 1U3EM 2ISYA 4EUTA 4JI9A 4CYDA 3ISPA 4G3EA 3FKLA 3MH0A 2H96A 4A9UA 4U3ZA 5LGUA 3KFWX 1T2KA 4RIWA 3QD3A 1U6GA 4O0WA 3BP8A 4BCHA 2HZTA 4HVHA 2OICA 1I09A 3C4EA 3EL7A 1W5TA 4C62A 2VTRA 4JBAA 5K5OA 3BQRA 3C3WA 5E8SA 3ETAA 2WMAA 2UZVA 3AD4A 4JOAA 2G9XA 3FI4A 5HTBA 2C1BA 4EWHA 1JKTA 3ZO3A 4WG3A 4X6QC 1XSXA 3TDUC 4HX4A 2J2IB 1YS7A 3BPVA 5LMKC 4FT9A 3JYAA 1O7LA 2R3PA 4M71A 1JPAA 3FMJA 4IDVA 2VT3A 4IJ9A 5K9IA 5KNJA 3I6UA 3AD5A 2B0LA 3R4KA 4QYFA 1ATPE 5L3EA 3IW6A 3E5XA 2WMWA 3B8QA 3HOSA 1UU9A 4QYHA 4S34A 3MZYA 4F08A 3EN7A 2J5PA 1TLHB 5KKRC 5D41A 2X8DA 4FT5A 3QXOA 2BZIB 3UIUA 5FQDC 2E1NA 5HE3A 3WE3A 4KNYA 3E8CA 1CKIA 1BN5A 1OR7A 5E8WA 4XRLA 1IAWA 5FBNC 1XJDA 4EHVA 3DY7A 3CDHA 2ZMCA 2W1GA 4RJ4A 1Y8YA 4ZSEA 3BJAA 2X4FA 2VBZA 2GNIA 4YSJA 3I64A 3KA0A 5IT9Z 3C1DA 5IDNA 4FIJA 4L44A 3BRBA 3P7NA 2FYSA 4L3LA 3IK3A 4RB0A 4ZZMA 2BZHB 3WGHA 1O6LA 2GCDA 3BV3A 1PXLA 2B54A 5IH4A 5DPVA 4QMUA 3KGAA 4XG2A 4ACHA 3HVCA 1WZYA 1DPUA 1R00A 5HICA 2P33A 4USFA 5IQEA 3M2WA 1M14A 2E7WA 5BVNA 3R04A 2VXZA 4RVLA 2ZMEA 4Z16A 4NFNA 4U88A 4G7HF 1XH8A 4JQ8A 1Z9CA 3IW7A 5FDXA 2W1EA 3MV5A 4RQVA 5CENA 2R2PA 3FLYA 3UIXA 2W1HA 4FV2A 2PJPA 2Z7RA 3VWAA 2XNGA 2JC6A 3EETA 4AS0A 4F9BA 2YM5A 3AGLA 3UO4A 3R9OA 4B8LA 1XMKA 2ZKZA 2OI4X 4R3RA 1JAMA 3F6XA 4HF2A 1RI7A 3DK6A 3QWJA 4FOCA 5EOLA 3QD0A 2VX0A 3A8WA 1XWSA 2JKMA 3OTVA 3UIBA 4NTTA 5BMZA 4FEQA 2XJ0A 5B2LA 3U9GA 1J9IA 5HX8A 2V1DA 2FSOX 3PIXA 2UZEA 3I5UA 3KXNA 2R9SA 3TL8A 2XP2A 2Y4IB 3HUBA 3PWDA
chains in the Genus database with same CATH superfamily
3NVKI 2JKOA 3O23A 4YFKF 3IW8A 1MJBA 1XBBA 4LV7A 3Q32A 3COIA 5C26A 3E97A 4FKWA 1W5CC 5M06A 5LRRA 4II5A 5LCKA 3AMAA 3U9NA 4HV6A 3UO5A 2Y7JA 3QPLA 4O7NA 4KWPA 4RX8A 1MBFA 5KK1A 3W2RA 5KHXA 3B73A 5T6KA 3VODA 4C2TA 1FMKA 1J0RA 1LE8B 2OQGA 1O3QA 3QQJA 4YJSA 1GZKA 3T3VA 5GAEJ 3I53A 2ZM3A 4F9CA 3DCFA 2O64A 3ROYA 1MP8A 4O7TA 3QRUA 4I23A 3LOCA 2HWPA 2XB5A 5AAFA 2QU5A 3TV4A 2NOJB 3NYNA 2GHMA 3KZYA 4QYGA 1FOWA 4PDSA 2OTJI 1MBGA 3D5SC 3RKWA 2CN5A 4FI1A 5C3EJ 3G73A 4IWQA 2YS9A 5H6QA 5KAFC 2ITYA 2WIPA 4CSWA 3UOHA 4XH6A 3KRWA 3GC8A 2NS0A 1JTXA 1GLNA 5M5XJ 5BYYA 5BVEA 4D1ZA 2OLCA 3CE3A 2NVYJ 2O0YA 3LZBA 1QNTA 4CV8A 3MAJA 3C4FA 5AM7A 5L3GA 1MNEA 1QPMA 3NUUA 2OZOA 4G9CA 3VUTA 2OIDA 3OXZA 3DQXA 1YQAA 2XJ1A 5M5YJ 4EZ5A 3W0RA 2EU9A 3GBZA 2LMDA 4R7HA 3DXQA 4FL3A 3A7HA 3EOCA 4F52A 4RRVA 1UNGA 2WQNA 3F23A 4E7LA 2PE1A 3E1SA 4II2A 1ZTRA 4PJ0C 2E34A 3WF9A 4XBFA 5E18F 3OY3A 5HODA 3GTJJ 3HZJA 5L2SA 4Q5SF 5AUTA 2ESHA 1URWA 4PZJA 3R8PA 3FHNA 4AXDA 3Q52A 5JFRA 3K2LA 2A6HF 4BICA 4ZLZA 3HA8A 3OW3A 3OYBA 4FTQA 3V8WA 3W0NA 4G3CA 2A0CX 2R7BA 5KMOA 3IW4A 4EI4A 2D2WA 3AT2A 2KKOA 3EN4A 4XX9A 5EW3A 5AADA 1XH6A 4PL3A 3PNTA 4G5PA 2XPVA 5HG7A 5HS8A 5B2MA 3SKCA 3O2PE 3MFUA 5FKMA 5EGOB 2ME0A 5HCXA 1HQCA 5AEPA 4FNXA 5EDPA 2FB8A 1PXPA 2E1CA 3TUBA 4MD9E 4C35A 2Y4IC 3RBWA 4AGUA 2KFDA 3H3UA 4BQAA 3F8MA 4DGWB 3I6WA 1UG0A 3DWLE 2KL4A 4CFWA 1A48A 1W0UA 2C4GA 3ENMA 1BJAA 2G01A 3DPUA 4E3CA 2M45A 3IC7A 3M8FA 4OIRF 4IQ6A 4AG8A 2KZVA 3DF8A 4FV1A 4O7RA 3ZMTA 3HSEA 4KNBA 1VQPI 2OJJA 4RLKA 4C7TA 2XUUA 5BUJA 2V55A 2FOWA 4YO4A 2B0QA 5DD8A 1G3SA 4TRLA 4KINA 5IA0A 1MRUA 3C1XA 2X6YA 1LPQA 3BX5A 2W4OA 1N77A 2YABA 1AOYA 2C6OA 4EH3A 4YU2A 4RS8A 4UXQA 4NM0A 3IOKA 2GLOA 3Q5FA 2ETKA 5EG0A 4UXLA 3I59B 4CZTA 4ZSAA 2XMYA 3NAUA 1U5TB 3CJTB 4QYEA 2X6XA 3ZQ7A 5L8LA 1NK3P 2W00A 4C33A 2ACXA 3THBA 4ANOA 3GC9A 3SZTA 4AT5A 4C36A 1OECA 1KE6A 2IS4A 4PMMA 1CKPA 3KP4A 4RJ5A 2VE9A 2WB1N 4UWYA 1H27A 1VQ4I 3SOAA 5F1RA 2HDCA 2DN0A 3IDBA 4IL6C 1XBAA 1K78B 3PVUA 3F3UA 4YNOA 2NNNA 1VQ9I 3QODA 4PX6A 4GG5A 3TNPC 3H5AA 4IOCF 1O7FA 4NZWB 5GZAA 3VSKA 3VB2A 4IFGA 3JXWA 1MNMC 2PLYA 2Q0BA 2WV0A 3QD2B 3H0DA 2WIHA 1U5TA 3UVPA 5CQWA 4HSTA 1PF8A 3EN6A 4R3PA 3OS3A 3KXHA 4QPQA 3HOTA 5L2QA 3WTWC 2A19B 1ZREA 3RTRA 4NUBA 1VQ5I 3QUEA 5JZJA 2VIXA 3K70D 3ZLWA 5K1YA 4EOMA 3PUBA 5GTHC 3EQIA 4M12A 3EN5A 1UVRA 3AG4H 2X7FA 4BI1A 2XIGA 2J4ZA 5D12A 2DYLA 2E5NA 2YIXA 1SZMA 3LCKA 2XAJA 5TKDA 2ITQA 1UU8A 3Q2JA 2J50A 3LFUA 4U9AA 2OAZA 4RX7A 4KRDA 3S00A 2RFDA 4QOXA 4QIWN 5EM8A 3VRYA 2L4AA 1T95A 1XMXA 4QT1A 4CGAA 3Q3SA 2PMZN 4AW1A 4M3FA 4YBKA 4JDJA 1F5QA 3RK9A 4A06A 1W2FA 5AV4A 4CYCB 2YWPA 4F7JA 2KRFA 4OIOF 1W2CA 4CCKA 3G71I 2KIMA 4D7NA 3ELJA 1BOAA 3A01B 2QOCA 1V55H 1D3YA 3WGIA 3CC7I 3D5RC 5FKOA 2GHLA 4JR3A 3FBVA 2HZDA 4U7ZA 3UIMA 2XBAA 3ZFYA 4MNEA 2JAVA 1OL2A 4PSXA 3EQBA 2XAQA 3GTKJ 3UOLA 4XV2A 2IW9A 3SX9A 4QMWA 2BTSA 3NIEA 5EZGA 1UHSA 2ECCA 1BL7A 4PGHA 4BCFA 4BU2A 2V5QA 3TL4X 2B7AA 5F0CA 3PUPA 4C4IA 2Y48A 4LLNA 3CD8A 3PJ3A 3PXQA 1YRNA 5ILVA 3UZTA 3V04A 3W2OA 2HYJA 3DNEA 2WMUA 1TW2A 3NNUA 1LP4A 2XF0A 3GEQA 4FICA 3G1LA 2BRGA 3N4UA 5ITAA 1UV5A 1MSEC 5IYDJ 2XZSA 4CO8A 3IDCA 2A6EF 4HYUA 4ZJVA 3OIOA 5BMMA 3SHEA 1U5TC 5BMSA 4AW2A 3UZPA 3G2BA 3QQLA 3NUXA 4BUPA 2C5XA 3PVWA 4ZZOA 2YM4A 4QTBA 3LW0A 2IWIA 1NG7A 3NQOA 4P9FA 4U3YA 3TNQB 2DMTA 4F0GA 4MTEA 3PXKA 4B6LA 4BNCA 3VBXA 2XKDA 3DBEA 3KP7A 3M07A 2ZXIA 1Z1DA 5HE1A 3BG7A 1U59A 4FV8A 1TTYA 3CY2A 4LM5A 5EOBA 4EEVA 3BTCA 3IRQA 4J71A 3ZCLA 3UO6A 1YX5A 1V4RA 5IDPA 4QMSA 5ANJA 4IJPA 4USEA 3P79A 2JSCA 4FTKA 2V9VA 1OBDA 4A3DJ 4LUDA 1YHVA 4LOPA 1F43A 3AL0B 1UWJA 4HDUA 4ZS0A 4A9RA 3C0GA 5AJQA 3CQWA 5CF8A 3VPRA 5FRMA 3WF8A 4W8DA 4MIMA 3DEEA 3ZDUA 2MC3A 3S1RJ 4XG6A 4AC0A 4PL5A 3VS5A 4YHTA 4EM0B 5TGTA 3DKFA 4I01A 4MBJA 5CQGA 4WSYA 3HAVA 3A0HC 4UV9A 4PDPA 1P9QC 5CAVA 2X4ZA 5A2QK 2STWA 3UP7A 5LARA 2RFSA 4IWPA 5E8VA 5HHWA 3ZO2A 1DI8A 3PSIA 3CP2A 4CZZA 1LB2A 1WMKA 3AGMA 2GHGA 2K9QA 2F7ZE 5EHLA 4IJAA 3C7JA 4YJVA 2XIZA 3E62A 3RCJA 1V5FA 4A0YA 3DT1A 2JA2A 3I56I 1OFCX 2K9SA 3C5IA 1KU9A 4MQ1A 4FKOA 2DMQA 2REIA 3C4CA 4M66A 3FKJA 4BS9A 2G2IA 2K9LA 5ILSA 3ZQFA 2E9UA 3SAYA 5M3FJ 3BGZA 3NCGA 2ITNA 2IJMA 3D0SA 5ILUA 1TL8A 3R7OA 2RNJA 4A3EJ 5BV3A 1BL0A 4IHPA 4PP9A 5AR5A 5G1XA 4RSSA 3NUNA 4KMFA 3MJ1A 5CSHA 3VDXA 5BX0A 4IWDA 4RA5A 3I60A 1BOBA 4PPBA 3TKHA 1Q1HA 4BHNA 2UWMA 2YACA 4YTCA 4H4KC 4WRSA 5A4CA 1Q61A 4KIOA 5LWNA 4W4YA 1X3WB 2RKUA 3H3ZA 2W0JA 1TQPA 1WQ2A 3H0YA 3ZSHA 4IHTA 4BKJA 3KRXA 4EJOA 3COMA 1PMUA 3K7AJ 4IAFA 1Y6AA 5IA1A 4ZIMA 5M51A 3FXQA 2CUZA 3TCPA 2FUMA 3V8TA 2RC4A 3RWQA 2R92J 3PY0A 1SFXA 1FZPB 4NH1A 3T8OA 2ZXJA 2PTKA 2BOLA 2FMYA 4ENKA 4IANA 3OOPA 4ZTMA 2F4OB 4I22A 1I39A 4OWRB 3ALOA 5K5XA 3MGYA 2UZBA 5ANIA 4BDFA 4FTIA 3DKGA 4BZOA 1T46A 3HA6A 3R6XA 2UUZA 5C4KA 4ACGA 1JKOC 1XCBA 3HL2A 1H1RA 4FTRA 2C3KA