The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
103
|
sequence length |
341
|
structure length |
331
|
Chain Sequence |
KLDTRAMRHLTAEDWRVLTAVEMGSKNHEIVPTPLIEKIGVHKSIATLAKAGLIARMKEAKYDGYRLTYGGLDYLALHTHAARKDVYSVGSRIGVGKESDIMIVADEKGKQKVLKIHRLGRISFRTVKRDYLRNRSTGSWMYLSRLAAIKEFAFMKALYEEGFPVPEPIAQSRHTIVMSLVDALPMRQVSSVPDPASLYADLIALILRLAKHGLIHGDFNEFNILIREEKDAEDPSSITLTPIIIDFPQMVSMDHPNAEMYFDRDVQCIKRFFERRFHFVSTTPGPFYKDAKKTVGKDGAKRLDAALEASGFTKKMAKDLEAAIREQQESR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
ATPase-dependent role of the atypical kinase Rio2 on the evolving pre-40S ribosomal subunit.
pubmed doi rcsb |
molecule tags |
Transferase
|
source organism |
Chaetomium thermophilum
|
molecule keywords |
Rio2 kinase
|
total genus |
103
|
structure length |
331
|
sequence length |
341
|
ec nomenclature | |
pdb deposition date | 2012-09-05 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01163 | RIO1 | RIO1 family |
A | PF09202 | Rio2_N | Rio2, N-terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant, subunit A | Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | ||
Mainly Alpha | Orthogonal Bundle | Transferase(Phosphotransferase); domain 1 | Transferase(Phosphotransferase) domain 1 | ||
Alpha Beta | 2-Layer Sandwich | Phosphorylase Kinase; domain 1 | Phosphorylase Kinase; domain 1 |