4GYGA

Crystal structure of the rio2 kinase from chaetomium thermophilum
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
341
structure length
331
Chain Sequence
b'KLDTRAMRHLTAEDWRVLTAVEMGSKNHEIVPTPLIEKIGVHKSIATLAKAGLIARMKEAKYDGYRLTYGGLDYLALHTHAARKDVYSVGSRIGVGKESDIMIVADEKGKQKVLKIHRLGRISFRTVKRDYLRNRSTGSWMYLSRLAAIKEFAFMKALYEEGFPVPEPIAQSRHTIVMSLVDALPMRQVSSVPDPASLYADLIALILRLAKHGLIHGDFNEFNILIREEKDAEDPSSITLTPIIIDFPQMVSMDHPNAEMYFDRDVQCIKRFFERRFHFVSTTPGPFYKDAKKTVGKDGAKRLDAALEASGFTKKMAKDLEAAIREQQESR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rio2 kinase
publication title ATPase-dependent role of the atypical kinase Rio2 on the evolving pre-40S ribosomal subunit.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transferase
total genus 103
structure length 331
sequence length 341
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gygA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gygA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gygA02
3R7UA 4HYEA 4UMRA 3PY1A 1YWRA 3BRBA 2M30A 4BCMA 3ZEWA 4C4IA 3OY1A 3QC9A 3JS2A 1M17A 2WV0A 5M44A 4DHFA 2PMHA 3LXLA 5FUTA 4G6DA 4O1OA 2PEXA 3PP1A 4EGYA 4CZZA 2FSWA 1PHKA 4L44A 4U79A 4R7HA 3UIBA 4PDKA 3SW4A 5E92A 4MXZA 2CLXA 3CQWA 4K6ZA 2E9VA 4OINF 5EYCA 4LV8A 2UW3A 3FKNA 3QLFA 5HS7A 4G9YA 1QPDA 3R73A 3DLSA 1ATPE 5IQEA 1O9UA 3SG8A 4NZWB 2DQ7X 5L3AA 3RPUA 3VF9A 3BCEA 4RGXA 3DCVA 4EH2A 4G5JA 1MQBA 3DGKA 1TQIA 3OV8A 5HOAA 4HLXA 3IG7A 4FIFA 3AMYA 1W83A 3W8LA 5C27A 4YPSA 4YTFA 5D5WB 3A8WA 2OU2A 1YXTA 4RVMA 3HYHA 3I79A 3IGOA 1E9HA 4DH1A 2M5WA 2BR1A 3TQNA 4UXNA 5EOBA 2QQ9A 3UYSA 4EHVA 4GKIA 5K0KA 1G3WA 2PG4A 3ZO2A 3TO9A 3WZUA 1K78A 3LQ5A 2ZBKA 4HOKA 3F9NA 4C57A 4LI5A 2P7VB 4CFFA 3H3UA 4DH8A 3R02A 4LYNA 4WWCA 5J87A 3LFCA 4EK4A 4Z55A 4KNYA 2X0GA 3K1MA 3V8LA 3I5NA 4PMTA 4IM0A 4M74A 4U0YA 3GOKA 2F5FA 3PZHA 3KC3A 3DEUA 3S95A 3ZZWA 4EWHA 4S04A 2PUPA 4ZZLA 3D5UA 4ZJVA 3KMMA 2BFYA 3N4UA 3E7OA 2AS5F 3NCZA 5TJJA 3W2QA 1IXSB 3QA0A 1H08A 2JPBA 2C5VA 3EQIA 4F1TA 3C1DA 2C0OA 1JVPP 3RGFA 2YIYA 3A4OX 2OLCA 1FNNA 1OIUA 3PTGA 2O03A 3IW5A 1ZGJA 5AP3A 4ZSGA 4DCEA 3F3TA 1OL2A 3D83A 5HLNA 2HQRA 2QM3A 3CGOA 3ETAA 5HICA 4U97A 4K11A 4NEUA 2F4JA 4OMYA 2Y48A 1KQ9A 1Z57A 4MWHA 3AQVA 1U5TC 3R61A 1GZ8A 2XM9A 3IO7A 5J9ZA 2H6DA 4YLKA 4BI0A 2XEZA 4WA9A 2WEIA 4W8DA 4CVAA 1CKIA 2EXEA 5CZIA 1ZMVA 4G31A 4GRBA 4QMTA 3DKOA 3E8EA 3W8QA 4RIXA 4X3FB 4QTAA 2OGVA 2R3GA 2BRGA 5DFPA 3DDPA 2BTRA 2W1DA 4FBXA 5BYLA 4NB5A 1ON2A 2YDIA 4YNEA 2X4FA 2LF7A 3V04A 4ZJIA 3IWZA 5AX3A 4TKSA 3GCQA 5AM7A 2FH9A 3P9KA 4BCGA 5LJJA 3AD6A 1G6NA 3COAC 3TZ7A 5HX8A 1YI4A 4XBRA 1YW8A 3ODZX 1RI7A 6PAXA 2BKKA 3ZRKA 2O5KA 5JT2A 4FODA 4F08A 5A4CA 1UFMA 1QO0D 2QOLA 5AP7A 2IVUA 3JVRA 3E6DA 3JY0A 2YDJA 3P08A 3R6SA 5E9EA 3QTUA 3MWUA 2PQ8A 3VC4A 5I9UA 5CVIA 1E1VA 5LHHA 5FM3A 4CD0A 5BVOA 5CJ9A 4V0GA 3EN5A 3D7TB 5DEQA 4KNBA 1R5GA 3ECOA 3G6HA 4BB4A 3SFZA 3GU5A 3UP2A 3QCQA 4IAKA 2A19B 3I5ZA 2OBJA 4FX4A 3PSDA 3LAPA 5ANKA 2XAGA 5TR6A 1QMZA 4PMMA 4PGGA 4BHCA 2H6CA 2RKHA 4O7ZA 3CSVA 5AIRA 4XOYA 3BJOA 5AR3A 2WEVA 4XP0A 4G8XA 2F57A 2PMOX 3C4FA 2FO0A 3PJ2A 4FIIA 2QBYA 2QNJA 2IP2A 4U88A 3RYPA 2XNMA 5FEQA 4EOOA 4U0VA 4S33A 5CVRA 3RALA 4MQ2A 3IGGA 2H6BA 4QMQA 4NYEA 1FC3A 1FX7A 5DI1A 3AGLA 3ZSHA 1HCLA 4IJAA 5DYMA 4U9AA 1ZZLA 4FSZA 2FVDA 3DLZA 4YLLA 2IA0A 4F7NA 3R2YA 3KEQA 4JR3A 3E6MA 3O96A 2FBHA 2FBKA 3LFBA 3TV6A 2P5VA 3AT3A 4FK3A 4O7TA 3F5PA 3F5XA 3VO3A 4FT7A 4M66A 1RUOA 3LIJA 4XRJA 3AAFA 3GFIA 3CKWA 3CTQA 3ATTA 3QFVA 3E3VA 4DAWA 3U6IA 3ZBFA 4R3CA 3NDMA 2GHGA 3OD6X 4EKLA 4IZYA 2DU9A 2HZ0A 3WILA 1IAWA 2QOHA 3VODA 5FD5A 3PSCA 1RE8A 4W4WA 3PP0A 1M14A 3OZ6A 3BPRA 2ESMA 5AV1A 3RPVA 3WZKA 3RJCA 1M7NA 3IKVA 3VUKA 5KCVA 2CKQA 5E17F 3NGAA 3MB7A 2PZPA 4IHSA 3CLYA 4QTEA 2WELA 2A68F 5AMNA 4QP3A 4D0XA 1UWJA 1FZPB 3G0EA 5E7RA 5IA2A 4TTHB 2GIVA 2OF2A 5CEQA 4FX0A 3KXXA 2STWA 4WG5A 1T38A 2ZCWA 2VV9A 2BYVE 5AR8A 5DDGA 3D94A 3TJCA 5DVRA 4NM7A 5KK1A 4BY9E 4EYMA 2PE2A 1YDTE 3OHTA 4XSXF 2DBBA 4LG4A 4BTMA 2X8DA 3K54A 2J2IB 4W8EA 2X9FA 5KX8A 1ONVA 5FGKA 3LJ1A 3HEGA 2QOQA 5DCFA 4RVTA 2KIFA 5K5QA 2ISYA 2EWAA 4K1BA 3TZ8A 1J2XA 1UV5A 3FXUA 2YHVA 2ZMCA 3QA8A 2Z5UA 3BY6A 2J5EA 3CC6A 2BRBA 5HCZA 4EJWA 5H2UA 4EUTA 2CKOA 2CGWA 5JFSA 3LWFA 4ANBA 5HU9A 5JR3A 1JHFA 4C8BA 5IH5A 1B9MA 3FXRA 1M2QA 2ITNA 3LLAA 4EJTA 1JHHA 3ORXA 1Q8YA 2QR8A 5DR9A 3R7IA 4ASDA 5DPVA 4Z9LA 3F3WA 5CU4A 2CJMA 4FG7A 3I6WA 4M13A 2QLUA 1PXJA 4RJ5A 4L3JA 3NLBA 2XJ0A 4AOJA 5KHXA 3NNWA 4MHAA 3ATSA 4Q47A 5KBRA 3LJ0A 2ETHA 1OKYA 4X2NA 1FGKA 2Y0MA 3TDUC 3TGNA 4KABA 4ZTNA 1PUEE 5JGAA 5HE1A 4QMSA 2P4IA 1M2RA 2ETMA 4G6NA 2J6MA 5IH6A 1ZAOA 4XCUA 4I6FA 1UU9A 4R77A 3ZDIA 4E70A 4IWDA 3D2IA 2WMTA 4DGMA 3OTVA 3DB6A 4AX8A 3KRLA 2VC1A 5DV5A 2YIRA 3JVSA 5C4LA 3KXGA 2B7AA 2W24A 3TNHA 3F72A 5ICPA 3E5XA 3EHAA 1JNKA 4ZTSA 2PE1A 4WNOA 4B99A 3DDQA 1G3TA 1ZLTA 5A4QA 1I27A 2HELA 5E4HA 3UG2A 4IVCA 5FFXA 3C5UA 1YI6A 4Z2YA 5DYJA 3QUPA 5AR2A 2XK3A 3NPCA 3AMBA 4J52A 1R39A 2OZOA 3PXZA 5M55A 3DAEA 3MVJA 3LMGA 3MFTA 5M07A 1J7KA 3RPSA 2CGPA 4ASXA 1J1BA 2WMUA 4FL3A 3UOHA 4GSBA 5EEGA 4ON0A 4CZYB 4G16A 3DBFA 1P4AA 4WF2A 2G7UA 3MH2A 3FI4A 3CO6C 1Q61A 4HQEA 2UZDA 4RBLA 2W1HA 4BYJA 2VO0A 3UC4A 3ZRMA 3ZM9A 5D5XB 3FZPA 4RWJA 3D5VA 4L68A 2F2CB 2OG8A 4M8TA 2F9GA 4FYNA 3P1AA 1IRFA 1KA8A 2WQEA 1MJAA 2W4KA 4N57A 1D8KA 5LVOA 2ZOQA 4YURA 5K5RA 3LE6A 2I6LA 4OGRA 3SV0A 3S2PA 3R1SA 3O7LD 3LW0A 2VTTA 2IA2A 2M45A 3DNEA 3HLLA 3BDDA 1PMEA 3ZO4A 4LQMA 5CAVA 3LAJA 2QI8A 3ZSIA 2HZTA 5EG3A 3HSEA 2CN8A 4GCVA 3OXIA 3KN5A 4TY1A 2EXMA 1A04A 3NUSA 4MTAA 2COMA 4KKHA 1XCVA 4D1ZA 3KZZA 4J8NA 1SFXA 2YEXA 2VAGA 2P3GX 4DEDA 4D0PA 4JQ7A 3QZFA 2V1DA 1BBYA 2PZ5A 1ZLKA 4YC3A 3EB0A 4ZTHA 4KA4A 2OH0E 2UV2A 4HZRA 3MIAA 1FINA 4D5KA 3GYHX 4M71A 1LB2A 2VO7A 5CLPA 4WUAA 2DI3A 3UPXA 5CEIA 3VQUA 3KXZA 3V51A 3I7BA 5CU2A 1J75A 1HCKA 4JIAA 2PVMA 2F7EE 5HI2A 3LSTA 2FB8A 3U2RA 4M9ZA 3FX3A 4XLVA 5E8YA 2CDZA 4KBAA 1F5QA 3G2FA 5GZ9A 1GIHA 5JFWA 4YNOA 2OQGA 1ZY4A 3P7CA 4EZ5A 4WRGA 5H8BA 3IQ7A 4I02A 4OTIA 4DTAA 4MXXA 4DITA 4JI9A 4O6EA 5KHWA 3DB8A 1XMKA 4ZZDA 2ITOA 2HWVA 3SHEA 2R3PA 4KINA 5EI2A 4P5QA 3ULQB 4G6QA 4NSTA 2DWBA 4EH4A 4IHTA 4FT9A 4UVBA 3PA3A 4LGGA 5HNGA 1XGOA 4WKQA 2C1BA 2ERKA 1PMVA 2BHHA 5M4UA 3P78A 3TOAA 3IW6A 3E97A 5EYKA 5DCMB 3FLWA 4XS2A 2JIUA 2EFOA 4I1ZA 3IRQA 5BVEA 1CKJA 4O0TA 3EQGA 2RG5A 3HV6A 3KP4A 1ZG1A 3V5PA 3CQUA 5CYIA 3FXQA 5CYVA 4MD8E 1LR4A 1UWHA 1H00A 2RKUA 3MFKA 1RJBA 3K3JA 3AC3A 2R7DA 1IUYA 3KP2A 3LFEA 4QNAA 3GFMA 2G15A 4M6YA 4O22A 4E4XA 1XBAA 4MD9E 4QMMA 3GB2A 3KFAA 1YVJA 1STZA 4JXFA 2QKRA 2GTMA 3QZIA 4H3BA 3EQCA 4CKJA 1URCA 4TL0A 3K5VA 5A6NA 4EJVA 4EC9A 2Z3YA 3O2PE 3GUDA 5HVYA 3FKLA 1NVQA 4BI1A 5CT0A 4EQQA 4TWNA 4G9CA 5CVFA 4FKSA 3II5A 1P2FA 4IWOA 2CYYA 3HMNA 1OYIA 2NYXA 2EB3A 3RPYA 3VOEA 1ZOHA 3LXKA 2OO8X 5LGNA 3E5QA 2R0IA 2BMCA 2P8TA 4BHPA 5GJFA 4YHTA 1OIYA 2XS0A 3R22A 4RRVA 2BZHB 4BDFA 3Q9YA 4WG4A 1B4AA 4CYJA 3MZYA 4QMOA 4TWCA 3M8EA 3ORZA 4UHTA 2EV0A 2J0MB 1WFCA 4R6VA 1XJDA 1YQJA 2V1XA 4UXLA 4Z3VA 1REKA 3G90X 1Y6AA 5HD7A 1S3JA 5AUTA 4P5ZA 3MJ1A 3FMDA 5D9HA 4FG8A 4XP2A 4DYMA 1ULYA 5IA3A 1DP7P 4ACMA 1UA2A 3UVRA 2Y4IB 3N51A 4OTGA 4UXQA 4BZNA 3WARA 4ZP5A 2YERA 1YYVA 3COKA 2VWZA 4AWXB 1TNSA 3THBA 4O2PA 5EI6A 3QKLA 3QU0A 4Z16A 2BIKB 3V7SA 3L9MA 3QOPA 2L01A 1YI3A 1Y8YA 5AA8A 2VWYA 5M06A 4CLJA 5F20A 4ZSAA 2W99B 4RVLA 2OAZA 5CSPA 3F21A 3E5AA 2UZKA 4DFBA 4E6AA 1TTYA 3HGKA 2EVAA 2PY3A 4KMUX 3FMLA 3KCFA 5IUHA 1H1PA 4S30A 4O3MA 4E8AA 5G6VA 5JVTA 4O84A 3ZSGA 3DKFA 5LMKC 3QQUA 4KYWA 5K1YA 4ASNA 3VWAA 4EM1A 2DYLA 3F6XA 5HBEA 2ZV7A 3MPAA 1ZOGA 4M69B 2R3OA 2P0CA 5J8FA 4FK6A 4FKWA 4ZAUA 3LFSA 3U9NA 3C9WA 4BGGA 4E4LA 5FBOA 5E8IA 1Q62A 2OD5A 1KOBA 2P7CB 2BHEA 3Q04A 3CO7C 3RKXA 1QL6A 1OKRA 1X8BA 4LL0A 4WRSA 3E7VA 2QONA 2F5CA 2DAOA 3ALNA 5I3OA 3MJ2A 4OTPA 3UBDA 3MZHA 4XV2A 3F5UA 3NYXA 3QRTA 3V8TA 4PDSA 3OOPA 3ABUA 1PY5A 4X2FA 4F6WA 4FNYA 3Q6WA 5IQDA 3HP5A 1LEAA 4NKSA 5BUIA 1FSHA 2QR7A 4DGGA 3S0OA 3H3ZA 1VEBA 3WZDA 2FSLX 4M9XA 2RNJA 2UW8A 1RQQA 5E1XA 4HGTA 3OROA 4HVSA 4AGCA 3UE4A 2Q0OA 5CAPA 4O6LA 3ORMA 1Z9XA 3FMEA 3CJNA 4I01A 5AUVA 2PVRA 3F5GA 4AT4A 5IQFA 4AW2A 1BI2A 2W0JA 4KIGA 4X3FA 2PU8A 3PJCA 3ZTXA 2MD5A 4YJQA 4PTEA 5F6FA 4M6XA 3OS3A 4G3CA 3D5WA 2J0KA 4IW0A 4IXAA 3FQSA 3BHHA 3LMHA 4TNBA 4OUCA 1O6YA 4WX9A 1J7LA 1ON1A 2XYNA 3KN6A 3MESA 4J97A 1R7JA 3Q4ZA 3FKOA 5HLWA 2HY0A 4LMYA 4HCUA 5HIEA 4EOJA 4PDOA 3RYRA 3QALE 3S00A 2PZYA 4TT7A 2GNJA 3GCSA 4S31A 5GHVA 4PDPA 4O86A 3LAUA 3H92A 5LCJA 5TO8A 1WBSA 4PPAA 5ACKA 2XIXA 3HYIA 1KOAA 5I9WA 3OXZA 3VS1A 2PN6A 3A7JA 1CF7A 4ENXA 4HYIA 4QYYA 3GU4A 3D7TA 3VIDA 2CW0F 3LCDA 2NNYA 4WXHA 3C7JA 5D1JA 2O3FA 4PP7A 5HO6A 5AX9A 4GK2A 5F1ZA 4IB1A 2YM8A 4QMUA 3KP5A 4KT5C 2VTHA 3GQIA 1W5SA 1F3MC 1MD0A 1TW3A 1KU9A 1O57A 3ZH8A 2RFNA 1YXVA 3I60A 2ZJ2A 3DOGA 3LM5A 2VONA 2O3PA 4BHBA 3SAYA 1Z6TA 2BALA 3D5XA 2HTSA 2M1BA 5EEHA 2C3KA 4GFOA 2XKFA 1PXPA 4GCJA 4AS0A 3UZRA 4NW5A 3KA0A 4U6RA 2QO9A 1XH4A 1GOLA 2R3SA 4DBXA 4RJ6A 3LQ3A 3TDZC 1TW2A 4MYGA 3RTRA 4O5VA 1ZG5A 3TNWA 5CAUA 4U5JA 3MWMA 2HR3A 3N4MA 3KMUA 4DINA 4I93A 2FF4A 5DMZA 4CG9A 4OTHA 4D1XA 4Q5SF 4PCQA 5FEDA 3PA5A 5CXZA 4MEDA 5EM7A 2IVVA 4IX5A 1ZYLA 5LWMA 4XEYA 4FOBA 3WF8A 5EW3A 5BMSA 1BIBA 4I5PA 3KREA 4LG0B 5CF8A 1Y91A 4XLPF 3LHJA 2HYYA 2A1AB 3DK6A 3QTQA 1I44A 5CAQA 4XOZA 1BL7A 5HD4A 4C38A 3GX4X 4O7RA 4LLGF 5E8GA 3UNZA 4GU9A 2UW9A 4NCTA 4O0UA 3NUXA 4IJPA 3V5JA 4B9DA 2FE3A 1DM2A 4C2VA 4BCIA 4FKJA 2GWRA 3JXWA 3FSFA 3ROYA 4IM3A 3J81K 5K5OA 3C50A 5ANDA 2FBIA 2HZNA 1XGMA 4BIBA 4QRCA 3QZGA 2MLKA 3Q53A 2W85A 2HYGD 5AONA 3CIKA 2LF8A 5AR7A 3TACA 3VS3A 4UMTA 3R2BA 4GH2A 4FL2A 2BIYA 4CFVA 3QLGA 3QGWA 1JSVA 4RPVA 3TDVA 4A9RA 4A9SA 4CHUA 2GZWA 3I59A 3WGIA 3TIZA 4HNIA 3DQXA 5EW8A 4OBQA 1WBNA 5HE2A 4FVRA 3V3VA 1XR1A 3NUYA 3TTJA 4BHNA 5BS6A 1O6LA 1MUOA 5FXQA 2GQRA 3QQKA 3DF8A 3FLYA 4XBUA 4FTKA 2XGXA 5BMMA 2JKOA 2PVYA 4O7YA 2X39A 4UV0A 2G2IA 4UVAA 4BCNA 4AA5A 2W1GA 1H07A 4N0BA 4X6RA 4F99A 3SX9A 5EQYA 3WYXA 4IM2A 3EQDA 3EYHA 3BPXA 4FNWA 3NIEA 4FV0A 1JSTA 1SM2A 3CUQA 3CXWA 3HECA 2CWEA 5TF9A 1HKSA 1UCRA 2MBFA 3SA0A 1GXPA 4Y46A 2R4BA 4NTSA 2W7XA 2UVXA 1TVOA 5K5NA 1LDDA 4IHPA 1XD7A 4WHZA 3VW6A 3O8TA 4L9NA 4QPAA 4GXOA 4YTHA 4QOXA 3HMMA 1W98A 2JD5A 4FSYA 4GFGA 5K0XA 1PXMA 5M4IA 3A7HA 4ORKA 5TRDA 3WI6A 3T8TA 5IPJA 3MFUA 4G3FA 3RKBA 3P9CA 4KD1A 3I6UA 4M84A 5IEXA 1ZYDA 2VTJA 3LOKA 2YX7A 5FB2A 1XB4A 3C4WA 1BI7A 4NM5A 1KE9A 3SW7A 3NUNA 3R1QA 2XVCA 3QTRA 2P5LC 3P79A 3PVWA 2RDPA 1XQZA 3BU6A 3FZVA 4I6HA 5TOZA 4FKGA 2X1NA 3IW8A 3BHVA 4LOPA 5JQ8A 3WF9A 2A0CX 4AACA 4L42A 2VTIA 4FOCA 4GUEA 4GUBA 2BAKA 2XNNA 4HYUA 3V5LA 2X6DA 4GVJA 1U54B 5E1WA 4CKRA 4RX5A 3G15A 2YM6A 1P5EA 4D4SA 4TYJA 3HSFA 4R1HA 1DUXC 3EZVA 2VT3A 3SLSA 3HDMA 3P7NA 1BUHA 2OF4A 5E20A 1FPUA 1CTPE 5AR4A 2WXVA 4RIYB 1OUKA 2D45A 4CRSA 3Q4UA 4LUEA 1IN4A 4ZTLA 2W1IA 2W5HA 1WBPA 2R3QA 4D0WA 5KMMA 3PPZA 4FZ7A 4AVPA 2YCSA 4XSZF 2BTSA 3FMMA 2JKMA 3ZHPC 3VQHA 5HG7A 1T0FA 2J0IA 2H8HA 4G9RA 2BPMA 4HCTA 1IN5A 3QRUA 4I2OA 3WYYA 4OOIA 5CU3A 4Y8DA 4FKQA 4CTBA 3HTUA 1AD5A 3MY5A 3IL2A 5J6XA 4MQ1A 1BKXA 4EQUA 2OFVA 2BGCA 4U7BA 3BHUA 1KV2A 5HBHA 2IVSA 2P55A 2CFXA 4HBLA 3QTWA 2PWLA 3V8KA 2VBZA 4ZMFA 3ZMUA 3DTCA 1ND4A 3QBNA 5C8NA 3JAMZ 3E64A 3U9GA 3OW3A 2ZV9A 3DKWA 3R7EA 4XG9A 4L43A 5EOLA 2H34A 4BCPA 3PWYA 1GVJA 1H24A 4YJUA 3SXFA 2V79A 1KV1A 4LOQA 5AUZA 4FTCA 4UWYA 4QPSA 2XIYA 5L3CA 4HX7A 5H8EA 2VGOA 4BN1A 2Z7RA 4IZAA 4D4VA 5CASA 3L8VA 5EK7A 5I9YA 4G3DA 4IANA 3LVPA 5H6QA 3PUPA 3HHGA 3TZ9A 2UZEA 2JT1A 3JAMK 5E8XA 3MA6A 3MSSA 3B2TA 3D4QA 3VNTA 4ZK5A 3BLHA 4AF3A 4KIKB 4X6QC 2JAMA 5D7AA 4C36A 3Q2JA 1RNLA 3R83A 4CFNA 5HBJA 4F64A 3ELJA 5IZFA 4FKTA 3ZMZA 4WBOA 3FPQA 4YJRA 4MGRA 5AUYA 1H1SA 3FE3A 3GI3A 5BX0A 5ANIA 2FRHA 4JQFA 4QP2A 2XBAA 5JGDA 4HVDA 3EOCA 4MNEA 4BGHA 2C5XA 3PY0A 3BU3A 4Y72A 2C0TA 1Y0UA 3L00A 4FTTA 4EH7A 3VW8A 1FQ1B 4V04A 1YW7A 5BVNA 3NNXA 3KP7A 5J9LA 3PJ1A 4JX3A 1I6XA 3WF6A 3OG7A 4MAOA 3W18A 5AR5A 4AIHA 2QKWB 2DTRA 4Y15A 4U0WA 4KWPA 3Q9VA 2XNPA 4TYGA 5HG8A 5HE3A 1JOWB 3HDNA 3LCSA 4GU6A 4DH7A 3IDCA 4FHTA 1IG1A 2J51A 2B0LA 3HL7A 4F9WA 3VUGA 5IA1A 4U3YA 1H0WA 4OR5A 2OIQA 1JBPE 3GBZA 2ZB1A 4JQ8A 2IZSA 2G01A 1BI0A 2VBXA 1U5RA 1IN7A 3GLXA 3CPCA 3H3CA 4JIKA 4L9JA 4FGBA 4KS7A 4QWQA 4M67A 4YGAA 3NX8A 2CGVA 4MQ9F 1Q8UA 1OKZA 5FO5A 4JDIA 5LARA 5CEPA 3ZLYA 2Q2EA 4MBJA 3RDIA 2CCHA 4AGUA 5K4JA 2DFIA 3WIKA 5L2IA 5JH6A 3UDBA 2YWVA 1F5TA 2PE0A 4ZY4A 2TDXA 4CGAA 1IF1A 4IDTA 3HKOA 2OU7A 3NNVA 3ALOA 3IECA 3MV5A 4D4YA 3E87A 4I0BA 2QBYB 2VTQA 3LPBA 3F2RA 2OBPA 4ID7A 1XBCA 2JBOA 5GJGA 5ILVA 5CQWA 3LCKA 4LV5A 4RB0A 1OL5A 5KZIA 3E3BX 4JDJA 4FGRA 3ZDUA 5L3FA 4X3JA 3GFLA 4EOSA 3QPTA 4FSWA 4G3EA 4LL5A 4AW0A 3P0MA 4N9HA 4DEBA 4JBPA 1U2WA 2Q8KA 2E9OA 4RGRA 3QQLA 4CCBA 5L2WA 1SNXA 3ZBXA 4PQNA 4JRNA 2V7AA 3F61A 3ANQA 3RIRA 5DNRA 3LFKA 4KAOA 4RG0A 2FYSA 4IB3A 2B9FA 2G1TA 4F9YA 1FP2A 2WTJA 4YSMA 4PF4A 3HNGA 3LCTA 2XK6A 4F6SA 4IMYA 4Z7HA 5D10A 4DE4A 2HWOA 4JR7A 4ZMEA 5JFXA 5HO7A 3QCYA 1HBXG 1M7QA 3BLQA 4Q48A 2QVSE 2HDCA 3E3PA 5B7VA 3QYZA 2BVAA 1KWPA 3QRIA 2C6MA 4KFCA 2FU4A 3B8QA 5AA9A 5FBNC 1P4FA 3FAAA 2YM4A 4RLKA 3TTIA 4C61A 4MXAA 4FV8A 1PP8F 4YIFA 2RF9A 2ZAZA 2OW3A 4M69A 4RB3C 1B1BA 4BDJA 4PTCA 1Y57A 4K77A 3TZMA 4ZYHA 3KRJA 3QP6A 3Q3BA 3KRXA 4HDUA 5BPDA 5EI8A 4DTBA 1U4DA 1NW1A 4FSQA 2ITPA 4FKPA 2WTKB 5AUWA 1O3QA 4D1SA 3KCKA 1ZY5A 3BOQA 4LOOA 4JG8A 1HSJA 2K86A 2J5PA 3QPHA 3R8LA 4CQEA 1K3AA 3FMNA 3VRZA 4I21A 3MY0A 3T9TA 2YM3A 4YMJA 5BPIA 3QQFA 3HRBA 3B02A 1USTA 5I9XA 4G6LA 3SZTA 1G4DA 3GC9A 3C4EA 3G5DA 3AOXA 3QXPA 4CDGA 4M73A 3BJ6A 3MH0A 1LQ1A 4O7SA 2R7FA 3NSZA 3KP6A 4L8MA 3O71A 1M52A 4UNOA 3ZEPA 2PMIA 1KQ8A 3V5TA 4EK3A 1EH7A 5C1QB 2Y7JA 4LGDA 3GQLA 3LM0A 4O27B 4L5IA 2F7XE 3OY3A 2NAZA 2XZSA 3C3WA 4RWIA 4C4EA 3VS0A 2O0UA 3BI6A 1B59A 5KKRC 4USFA 4EOKA 2RFDA 4NH1A 4JT3A 2O6GE 4JAIA 4HX8A 3E8CA 3CS9A 3VJNA 2QODA 3HX4A 2PVNA 2W57A 2ISZA 3HRTA 2R7BA 2VODA 4FT0A 4E4NA 3AC1A 1UNGA 3K9TA 3OTUA 4N4SA 2HWPA 5FM2A 2NPQA 5E90A 4J1RA 1T45A 3RWPA 3U9CA 2Q83A 1R3CA 2J4ZA 3KK9A 5A46A 1ZYJA 3F2AA 2X7OA 2ZMDA 1S7OA 5IMXA 4ALUA 3MB6A 4FTIA 1H1RA 2OXYA 1X3UA 1KE6A 3AT2A 2B52A 4PNIA 4MVFA 4RX8A 3KK8A 3UO4A 1QPMA 4TYHA 4RGUA 3UGCA 5KMJA 3JSOA 3UMWA 1FYLA 1P4XA 5CVUA 3K1PA 1ZARA 5L3BA 2QURA 5AV3A 3F2NA 1HW5A 4WNPA 3G0FA 2GHLA 3GU8A 4FSMA 2D1HA 3T8OA 5CSWA 4L01A 1XSVA 3EFWA 1JLUE 1JAMA 2XK7A 2WAJA 4LFIA 3ZUTA 1PRYA 1XH9A 4CKIA 2QZ8A 5D12A 3UC3A 4DFZE 1UNHA 2A07F 3PLSA 4U41A 1OYYA 4P5OA 2YAKA 3WGHA 3UTOA 4PY1A 5CF4A 2QQBA 4J7BA 3E93A 4QTCA 5A54A 5FTGA 4BCFA 2DT5A 2LAVA 3QRJA 2WOTA 4FTJA 2WIPA 3ERED 4FEQA 2QVOA 3BKBA 4P4CA 3F88A 3A2CA 5EW9A 5HCYA 3MA3A 3OCBA 1IA8A 2K27A 4ZOGA 2YZAA 4YPDA 3KETA 4BQAA 4L18B 3FMHA 3QTSA 4JLCA 4U80A 4IPAA 2XRNA 5LQFA 4U42A 3KCCA 3W2CA 5F95A 5T6KA 1SD4A 4O1PA 3VN9A 2VTMA 4O0XA 2GNFA 4FX3A 4FIJA 2VE9A 3FHZA 3QWKA 4C3RA 4J53A 4ZTQA 4QYFA 4UB7A 4AZTA 4KRDA 1OR7A 1AOYA 4EGZA 4M0ZA 2WC2A 3O6BB 3SZPA 4HV6A 2AUHA 1YLFA 2YM7A 5D4SA 2RGPA 2KRFA 1L0OC 3VS2A 4I09A 3SHFA 3CEKA 3PRFA 4ZEGA 5AEPA 2I0VA 3MVMA 3L2CA 1YS6A 1FLIA 2XIKA 3GCUA 1O3RA 4IX3A 1SYKA 3F8BA 3HRSA 3BBWA 2XNGA 3QYWA 3RP9A 3SG9A 5CZHA 3P4KA 2WU6A 2UUEA 5K5XA 3R04A 4IFCA 3EH9A 3VB2A 5IQAA 3ERKA 5EYMA 4CZTA 4WIHA 3DZQA 2YWPA 4X0MA 2KTYA 4YZNA 2OZ6A 2YAAA 3EN6A 2HGCA 3VHEA 4C34A 1R0PA 2QOIA 4RGSA 4AW5A 4MTDA 3CJGA 2D2WA 1WBWA 2GQGA 2B53A 2UZBA 3C4XA 4P96A 4EJOA 1FBQA 3Q52A 3EFLA 3QCSA 2K4BA 2NP8A 4TW9A 4GV1A 1YFHA 1GXQA 2C30A 2VT2A 2IRFG 4RAZA 4NUSA 4XMOA 5CNOA 3I58A 4B09A 2UW6A 3R4KA 1H1QA 3BROA 4YJPA 4FZFB 4HGLA 3WE8A 4QD6A 1UU8A 1XN7A 2ZVAA 3N4TA 4CG8A 5HHWA 3KU2A 4AZFA 3P9IA 5KMOA 3UNKA 2XCKA 2EA2A 4C62A 2V9VA 4IAFA 5A3XA 4ENMA 5I3RA 4X3FC 3QP5A 1HKTA 4AGWA 4O0SA 1CKPA 3R7OA 5FDXA 3N97A 2C5OA 4ACCA 3WE3A 2QOBA 1U5TA 2VTRA 3BGZA 4NKAA 3QTIA 2VD5A 3M8FA 1TQMA 3MN3A 5F4NA 3UIXA 1USSA 2UZOA 4GYGA 1ZZ2A 3V01A 5DUIA 2W5AA 2VGPA 1CMKE 3VULA 2X4HA 2A27A 2Z02A 4TWPA 2WU7A 5CEMA 1BJAA 3R8PA 4UZDA 2B0QA 5JI6A 3MQ0A 4CYIA 2Z33A 4AN9A 1REPC 4TNDA 3SQQA 1H1WA 3ZM4A 3GENA 4RMZA 3GZ5A 3QWJA 3JTGA 5CEOA 2P6TA 3E63A 4AXAA 2VWIA 3RWQA 2YX4A 5TKDA 2PVFA 3U51A 1JKSA 2XAQA 2JKQA 3T9IA 3E6BA 3ZRLA 1PKDA 3R01A 1K79A 3RJPA 3LFNA 4PDYA 1OKWA 2C47A 1W82A 1XWSA 5LVMA 5I5ZA 2VTNA 1B6CB 4CXFA 4FV2A 1P14A 3MFSA 1GIIA 4H3QA 2RQPA 2ZJWA 2BDJA 2UVYA 1U54A 1B6AA 3GWZA 4EQMA 2OI4X 1JXSA 5AP0A 5J1WA 5E1ZB 5HQ0A 5BVDA 1MRVA 2ITQA 3AG9A 1YWVA 4R3PA 2W1FA 5DR2A 1YRPA 5H20A 2FXAA 4UZHA 4RIYA 5LMAA 3LA2A 2WQNA 1KYZA 2B55A 3W55A 3V7CA 4USEA 2MH9A 3TNIA 5D7VA 3GXOA 5HIBA 4ZXTA 2OZUA 2W06A 2VE8A 4JG7A 3U55A 4MD7E 4EK5A 2HKOA 1PYXA 3FHIA 1R0EA 1CM8A 2FMLA 4IRHA 3KY2A 2W1CA 4C4GA 4D28A 4IVBA 4IIRA 5IT3A 1ZWSA 5CNNA 4RQKA 3D7ZA 5AAFA 2ZXJA 3ZLSA 2F2UA 1F0QA 4K9YA 2W05A 4L5JA 1A06A 3IONA 4X2JA 3MDYA 2R2PA 4QP8A 5CXHA 2IZUA 2HFHA 1Y6BA 5CVHA 4BVUA 4CEGA 2KIMA 3CGFA 4FMQA 3MH3A 3EKKA 4F7SA 4IC7A 3H0ZA 5JK3A 3RK5A 1F9NA 4G94A 1W7PD 4YBKA 1JGSA 4QMPA 3QU3A 5IUGA 5EQPA 3FQHA 2VBWA 4XBFA 5IKWA 4FT8A 2C6YA 3REOA 2C4GA 2I40A 4FKOA 4HQMA 3FI3A 4ERKA 2R9SA 3MPTA 1I09A 2O8XA 3G73A 1OVEA 3L8PA 4IRGA 4A12A 3DFAA 3W2PA 2XKEA 4UMPA 1MDMA 5EHYA 5E8VA 1CSNA 3WOWA 2V55A 4ITJA 4DH3A 5BYYA 4KIKA 1HKQA 4PGHA 4LRJA 2FSMX 4Y17A 4NW6A 2WTIA 2YA9A 3B8RA 3ROCA 4YTIA 5CAOA 4CGZA 4OW8A 1BN5A 4GYIA 4JBAA 1R58A 2B54A 1YO5C 3MFRA 3VUHA 5BMZA 2PULA 3BZ6A 3FPMA 5ANJA 3A7GA 2NRAC 3FM5A 4D2WA 3SVVA 4KBCA 2Q0NA 4R1YA 4IRIA 2PZIA 4KUMA 4BTFA 3U6HA 4LK1F 2ONLA 2CGXA 4YUQA 3R0AA 1XHAA 1J0RA 4X21A 4KN4X 2XNEA 3V6SA 5LHGA 3BLRA 3D15A 3BPVA 2KJBA 1BI1A 4A7CA 2CLQA 3CUQC 3KZYA 3PFIA 2PLYA 2V22A 4FZ6A 4J95A 1MJBA 2K02A 3UIUA 5KBQA 1HW2A 1OI9A 5HESA 4BCHA 4L53A 4R7BA 2JDSA 4OT5A 3V6RA 2OKRA 4FG9A 3PWDA 2DK5A 1P6RA 4K18A 5HORA 5C8KA 4AOTA 3A8XA 3Q32A 4LB5A 2MC3A 3QQJA 2BAJA 5EHLA 1ZMUA 2J90A 1G8AA 1CF7B 3ZPLA 1DS5A 1R78A 5KO1A 2WTDA 3TKUA 4X2GA 4OT6A 1RZ4A 3BYMA 2VN2A 1ZRFA 4U8ZA 4XG7A 3CY2A 4L7FA 4AWIA 1KU2A 4I23A 1BC8C 3A7FA 4R7IA 3KL8A 4U7DA 4F0GA 4FV4A 2VTOA 3K3IA 1NHAA 2QLQA 3ZONA 4EZ3A 4O7NA 2YITA 4JBOA 1H25A 1Q8WA 4ZZMA 3FLZA 1QQIA 1YDSE 5FXSA 3ORLA 2IZTA 1IR3A 4OU0A 2YABA 1Z05A 2F49A 1WVWA 3HUGA 3VBQA 2WTCA 3KQ7A 5H6RA 3FLNC 3BYVA 3RK7A 1JKKA 3MAJA 2BZKB 4G2FA 3NUAA 2WD1A 3GW2A 4BBEA 5ICCA 4C4FA 4KIQA 4QQTA 2EK5A 2WMBA 1DI8A 3JY9A 1TLHB 3IDPA 5LCKA 3L8SA 3WE4A 4C02A 3F8CA 4UWCA 3O23A 5CI7A 3C13A 4AZWA 2CN5A 2PPQA 3OT3A 4O0WA 4IJ9A 4PNKA 1ODDA 3BYSA 5KZ0A 2PHKA 2PSQA 4U3ZA 4NJDA 3HOTA 4FV3A 4ZH4F 5E1EA 2ITVA 4RIWB 5HIDA 5G1XA 1QNTA 3TG1A 5AP5A 1KGSA 5DUKA 2YM5A 4FTLA 2R3HA 4CCUA 4AGDA 4BI2A 2HY81 2JIVA 3HZTA 2OIBA 2XAHA 3R8ZA 3GF2A 4HX4A 3OUNB 2BUJA 5LGUA 4YZBA 4XV9A 4OIRF 4RA4A 3JW4A 1QZZA 5HS8A 3KVWA 2R0UA 2H27A 2W9ZB 2HEOA 3FHRA 4XG3A 3HHHA 2XKDA 5IQBA 1MRYA 3R1YA 5ILUA 5EDPA 2RIOA 3N9XA 3R60A 1NY3A 4LLNA 1JKTA 4QTBA 3E8NA 3FC1X 3O7LB 4M97A 3ZMMA 3ROUA 4YSJA 3ZMSA 4EV0A 4FEWA 2X0LA 4DEEA 2AC3A 2DLLA 5DD4A 1KE5A 3MGYA 4EKKA 5J95A 1R23A 3W10A 3A99A 1S7AA 1H26A 2XV4S 3GZ6A 4MCVA 3TJDA 4D5HA 5D6FA 3PE2A 4TPTA 4A4XA 4BDKA 4NL0A 1XSXA 2G2HA 3Q9XA 4CV9A 4IZ5A 3AC8A 4P90A 3MTFA 2W25A 3OBJA 3ZS5A 3EQFA 3I5UA 3HV3A 2E1NA 3FM3A 3I59B 5AV0A 4DN5A 4M15A 1KE8A 3ECHA 1QPEA 3KP3A 4QQJA 1YWNA 3NRMA 4E6QA 3S1HA 5C01A 4CZUA 4I92A 3I0OA 2XYUA 5ETCA 4DCAA 2XASA 2L4MA 1AQ1A 2ZDUA 1JKLA 4FVPA 1BLXA 1A48A 4K8AA 3TL8A 4LGWA 1K2PA 1V0PA 5M4CA 2JTVA 1TQPA 4MXOA 2QQAA 2WTWA 3R0TA 1HW1A 2VRXA 3JR1A 1G5SA 3MTLA 3QCXA 1WVXA 3C18A 3ENMA 4PMPA 5CSXA 4EYJA 2R3KA 3M1EA 2QU5A 5LVLA 1T46A 3KRRA 4FIEA 1APME 3CUQB 3KEOA 2XH5A 3EWHA 4KSQA 4KB8A 2WMRA 2IO6A 3QAME 2PK9A 3V8WA 3UVQA 4IX6A 2O8YA 2OJIA 2W5BA 4Q5EA 1J9IA 3NMUF 5IUIA 1TKIA 3E5UA 4LJZF 2H09A 5HX6A 5EHOA 1EH6A 4FNXA 4F4PA 2MLGA 4A0XA 2RN7A 3T5XA 2C6IA 1YOLA 1IXCA 3NNUA 4I0AA 3RCDA 3FF5A 4TXCA 5EQEA 1VYZA 3BP8A 1OZ1A 5KNJA 3QQHA 4JBQA 4FZAB 3UQGA 3GFJA 2QG7A 5LRSA 1OBGA 4L67A 4ITHA 4HW7A 1WZYA 4RA5A 3Q5FA 3EYIA 3F3VA 2QCSA 3OWJA 5DOSA 2G9XA 3FQEA 5C9CA 4MKCA 2KKOA 4IWPA 4BIDA 4YU2A 1LDKB 1Q1HA 3QD3A 1XH6A 4FV9A 3WU1B 3W6JB 3O3KA 1Q4LA 1QGPA 2JDRA 2EFQA 4XH6A 1BM9A 2LGCA 5CENA 3U8WA 5IG1A 3ORKA 4NIFA 4D2SA 2Y9QA 3WU0A 3NUPA 5GIOE 1PJKA 3TUCA 3MCZA 2GMXA 2GNIA 1G3YA 3EL8A 2Y4IC 5E8UA 1PYEA 3ZYAA 4RZVA 3R8VA 2DO7A 2BRHA 3WBLA 1Z91A 2Y6MA 3EN9A 1K6OA 3UMXA 3HIFA 5AV4A 2L02A 3QU6A 5EM6A 1XCBA 5ANGA 3RAWA 4I4EA 1H4LA 2OA4A 5K4IA 4NK9A 5BOXA 5HG5A 1TNTA 3M7GA 2VXZA 5CS6A 2NNNA 1SFEA 3T3UA 3QF9A 5IQCA 2PI0A 1ZYSA 3J7AO 2P2IA 3H9OA 1IW7F 5ANOA 1WVYA 3FI8A 3LA3A 4FTNA 1ZN2A 3KXHA 4HDVA 3DBQA 4FT3A 1WBVA 4GJ2A 5A14A 1PW2A 1IA9A 5JFVA 3EN7A 4OTWA 4CQGA 3C7QA 3MPMA 2PFBA 4ZTRA 4BNCA 1OL7A 1SZMA 1MZBA 4YJTA 2LDUA 4FYOA 5JMSA 2CPKE 5M57A 3M11A 4EBWA 1O7FA 2C69A 3ZU7A 4HYSA 4AE6A 5HCXA 4QMYA 3P23A 4C0TA 2GS7A 3BX5A 5M51A 4ETSA 3IOKA 4EVIA 3PXRA 2WWYA 4WNMA 3VAPA 4N9IA 4O81A 1E2XA 3WE2A 3EFJA 4O7WA 1FVRA 4BCKA 4IAAA 1QZYA 4R1VA 1NT2A 4ESFA 3BE9A 3M42A 1GZNA 4HAMA 2R3JA 4F65A 2C5NA 4F1OA 3MS9A 3GXLA 3ML6A 2IT0A 2XRWA 3ZQ7A 4FICA 4B6LA 4EOIA 2P4WA 3R7YA 2GSFA 4BDDA 3C51A 2WTEA 4ERWA 4A5NA 3RPOA 3K5UA 4YP8A 1NVSA 5L4QA 3ZOSA 4A0YA 3ISPA 5H9BA 4KBKA 3IDBA 4A4OA 2H9VA 2PTKA 5HO8A 3TWJA 3DT1A 3O2MA 4RB2C 2VX1A 4O21A 2C0IA 3D2KA 3FMKA 3TXOA 4EH9A 2VUWA 5CSHA 4UMQA 2MA3A 4C3PA 3BEAA 4KRCA 3LFFA 2VBYA 3VBVA 2E7XA 3SC1A 3SKCA 5HLIA 1JE8A 2STTA 4MNEB 5F64A 4DT9A 3O51A 4ITIA 2J0JA 3NWWA 3AD5A 1OECA 3DKCA 2VWBA 2I0EA 4LLLA 2C3JA 3NYNA 2XA4A 4IWQA 4RT7A 5IF1A 4I0RA 3IWFA 4R79A 4I5MA 4M68A 5C4KA 3PFQA 2KIUA 5L6PA 4R3RA 4YZ9A 3F8NA 5JSMA 4DG2E 4IH8A 3NUUA 3UQFA 1K7AA 3R6XA 3LA7A 4M0YA 3GC8A 4JOAA 3RAIA 3EMGA 2YR2A 1ZYCA 5DHJA 3HAMA 1DPRA 3TIYA 4EOMA 2WKMA 2FSTX 4ARKA 2YPRA 5DGZA 1P4OA 2UVZA 1P2AA 2EXCX 4G7OF 3CTAA 4ZSLA 3W16A 4MXCA 4GL9A 4QMLA 5FQDC 4TV7A 2LKPA 4A9UA 1OL6A 1LEWA 5CANA 1ZGAA 4AU8A 1PP7U 3R7VA 5J8CA 2ZMEA 4EONA 2M87A 1BL6A 3OEFX 3ZN0A 2UZTA 3ZLXA 3WZEA 2PVJA 1UHMA 3KRWA 2NRYA 4IF4A 3VRYA 4ESBA 2GXBA 1URWA 5J5SA 2YSRA 2ZM3A 4XV1A 3W2SA 3Q5IA 2J0LA 2XIGA 1YTYA 2QHMA 3HUBA 2ZNZA 2X7FA 4C3FA 5FDPA 4PL3A 5EYDA 4XX9A 2B4SB 1GHCA 3HMOA 3PDTA 3ORPA 1QPCA 1OPJA 1DDNA 4BFMA 4EZ7A 2R3IA 1ZYRF 1GY3A 5GNKA 3C4CA 5HVKA 4PMSA 4HZSA 5IISA 1HXDA 3EKNA 4MX9A 3UJGA 2HENA 1IXRC 4OBOA 3C5IA 3M2WA 4FF8A 1AWCA 2CNUA 3TN8A 4DG0E 1YKRA 4ANLA 3V7RA 4FIHA 4OLIA 4B0GA 3GEZA 3ZUUA 3DPTA 3HV7A 3ORTA 1L3LA 3VHKA 2GQQA 4MBLA 3RCJA 4HNFA 3CE3A 3DTWA 3TI1A 3KF7A 1SMHA 4X7QA 4Q9SA 1U5QA 2G2FA 4J8MA 4LMUA 5CF6A 4WSQA 3NR9A 3NEWA 1O6KA 4JDKA 4M72A 2A3SA 3COMA 4FI1A 4U45A 3R8MA 4IAZA 3U87A 3DKGA 2HS5A 2WMXA 5M4FA 2J50A 4ZTMA 3FZRA 3DS6A 2VX3A 2XM8A 4BBMA 2WMQA 2W84A 2IN6A 4HVIA 5AV2A 2IPXA 4MBIA 1FVTA 3LFAA 2R3RA 2FA5A 1V1KA 1I1GA 2VN9A 1YQAA 2BAQA 2Z8CA 4F7LA 2PVHA 3FJQE 5L3GA 2C1AA 4LM5A 3BHTA 4YG2F 5LEKA 4I98B 4L6QA 5J1VA 1KSWA 2X2LA 1LPUA 5FD6A 3V5QA 4E73A 1W7HA 2VO6A 4BDCA 1FY7A 3CBLA 2ITWA 2YACA 4IQ6A 3WTTC 2UZUE 1T2KA 3O17A 5HS9A 5JKGA 1FGIA 3IOPA 2EFWA 4A5MA 3R7GA 4JG6A 1H0VA 4H1MA 3E62A 3UZPA 4WG3A 2E1CA 5AAEA 2J5FA 2A61A 1BC7C 3QD2B 1SNUA 3N4VA 2CNVA 3IS5A 3Q2MA 4BF2A 1UVRA 4S32A 2AXLA 4DFLA 4UYAA 3ZMVA 2W9FB 4EH6A 4XG2A 2EB7A 4GG7A 4Y5QA 4F9AA 4DFXE 4EK8A 4YFKF 4IFGA 1LUFA 2WZJA 4W4YA 1IN6A 1T39A 2OSCA 3DV8A 3D9VA 1S29A 2VX0A 3ZO3A 5K9IA 3VF8A 1XSDA 3L8XA 3AD4A 4ASZA 5HEZA 3NCGA 3GT8A 4J96A 4KMFA 5EM8A 2FNPA 1IZ1A 3IC7A 1QBJA 5E91A 4BICA 4IZ7A 3CR0A 1XH5A 4QQ5A 4C59A 2JZYA 5I9ZA 2F7ZE 1KE7A 4XLIA 4UEUA 4I41A 2UZWE 4FV7A 3KXMA 1R5HA 4X2KA 3ODYX 3TKHA 5IT9Z 3CP9A 4A07A 4XJ0A 3UIMA 1IRGA 4TYHB 2LNBA 4JL9A 1WAKA 4YLJA 5T68A 4Q4ZF 3FBVA 4C33A 3L9LA 4MF0A 3FWEA 2JLDA 2XP2A 4M14A 5L2QA 4Q9ZA 2QOOA 1P92A 2WB8A 5FXRA 3PIYA 2REIA 3R8UA 3TOBA 1Q3DA 3S3IA 5I9VA 4GK4A 3EQBA 4E5AX 3PE1A 3RKWA 3A61A 1ERKA 5IT9K 3P9JA 3CQEA 2PVKA 2OJ9A 1FVVA 5A4EA 2UW5A 5DT0A 3Q5ZA 2HW6A 4AZVA 4CT2A 3POOA 3PIXA 4L45A 5CALA 3VS7A 4E6CA 4IAIA 5LEJA 5AM6A 2BV6A 3F66A 3F7ZA 3RHXA 3G9LX 5AP1A 5DH3A 3VUDA 4HF0A 4O83A 4C4JA 2ZV2A 2EFNA 3DQVC 5L2SA 3EUHA 3RZBA 5C03A 4FNZA 1V4RA 3ZN1A 2QOKA 3I54A 2X81A 4CT1A 1R1UA 3GCPA 4RIWA 5HG9A 5TT7A 3ULIA 2EV6A 4U40A 3LFQA 3QRFF 4FSTA 4QQCA 4DA5A 4XUFA 4YZCA 2C6KA 4BBFA 3I81A 2XK9A 1Z7UA 4G7ZF 4FZDB 2P5KA 5JGBA 1ZOEA 2D1VA 5D5UB 3RM6A 4DBNA 4A6EA 1A9UA 3PY3A 4B8LA 3RPRA 5DRBA 4CNHA 4F7ZA 4PX6A 1KU3A 2X6EA 4O96A 4GJ3A 4F9CA 2VWXA 3NAXA 3FXZA 1ZG3A 4U81A 5AJQA 2P6SA 3RKYA 5CSVA 2J7TA 2X2KA 2CMWA 4QP6A 1PDNC 4WNKA 5GZ8A 2ZKZA 4G5PA 1GJOA 2PUUA 1OIQA 3JPVA 5AADA 4EH5A 5DRDA 4EBVA 2JIIA 5E8TA 4NU1A 4XRFA 3ZUVA 3IKAA 4CFMA 3MW1A 3UOLA 1U46A 4QTDA 3F23A 4QYGA 5DR6A 4A9TA 3COIA 2JDVA 4FSNA 3BWFA 2FNAA 2M8EA 1G3NA 5T3QA 5L6WL 2XJ1A 2Z99A 4DH5A 4BR3A 3F8MA 3ZFYA 2CGUA 2V5QA 1Q8TA 3MIYA 1QCFA 4P9UA 2WOUA 1YS7A 5CI6A 5C8MA 4AOIA 2WQOA 4GT4A 2QUFA 3IW7A 4E93A 4AAAA 4FV6A 3QZHA 2QLZA 3CTHA 4RZWA 5LXMA 1Z9CA 3RTPA 4KKEA 5FG8A 3NVMB 5BPYA 3TO7A 2DQLA 4U0IA 3LQQA 2WMAA 2ETKA 3BWJA 2GCDA 1JQHA 4HF1A 4YO6A 3PVGA 2YLFA 1SMYF 2ONLC 1GZOA 2C3IB 4Y83A 5EKNA 4D9UA 3SXYA 4ZYGA 4JBVA 5CVGA 1U5TB 4ESJA 1R22A 4EOLA 1RW8A 4L7SA 3A7IA 4ANNA 3FEGA 5L3DA 2I7QA 1WBTA 3UO5A 3QD0A 4EHZA 5JFRA 3BV2A 4AQCA 2A2AA 5D41A 3DAKA 5HLGA 3GOPA 1J1CA 5FP5A 3P7BA 3WTZA 3WF7A 1PXLA 4BWKA 3DBDA 1YOJA 3CDHA 4RX9A 2WO6A 2GAUA 4IC8A 3TV4A 3KULB 4XP3A 2O65A 3TCPA 3IHUA 4AN2A 1DAYA 3CJFA 2ZYBA 3DK3A 1XMAA 3DPKA 4BZDA 3ORIA 1YHSA 3UOJA 2X8IA 4BYIA 4XV3A 5FTOA 4NQWA 3HRMA 1R1TA 4ASEA 4XRLA 4N70A 3NW6A 2FOKA 3DQWA 5A6OA 4UX9A 5A4LA 5AUUA 2C6EA 4ENNA 2XIZA 5F9EA 2IJMA 5B2LA 4M9SA 5DLSA 1J3HA 2G7HA 1IEPA 4NJ3A 3FMRA 4QMXA 2RC4A 4EORA 2Y8OA 1W8CA 4YHFA 3WF5A 4KICA 5AUXA 3SOAA 4RFZA 1SD7A 3LJ2A 3KF4A 4JVGA 3Q4TA 3OMVA 5CVJA 3EQPA 4G1WA 4EHGA 4YC6A 1JWHA 1SVEA 3DK7A 5BUEA 2ADUA 3FXWA 3DV3A 5DBXA 5CQUA 2C6TA 3DFGA 2YLEA 5ANEA 5L3EA 3BZ3A 3ZO1A 3K0LA 3PA4A 4YZDA 1MGTA 4HLYA 4WD5A 4O6JA 5HVQC 3PPKA 4FTRA 3GVUA 2XKCA 5AP2A 5LVNA 1EV7A 2WMSA 5E8WA 4P55A 3IRRA 4TYIA 4DC2A 4EHEA 3C4ZA 2Y6OA 5JQ5A 2XROA 3FV8A 3UO6A 2PJPA 4AFJA 3R21A 4FL1A 5IA4A 2XEYA 1GZKA 4HF2A 3T0YA 5LRRA 5L6OA 2Y0AA 3L9PA 1XO2B 2DPDA 2EV5A 5BVKA 5J79A 2BKZA 1ZXEA 4HV5A 2RVCA 1FMOE 3HP2A 4G34A 5FGMA 3DA6A 4H58A 3K2LA 2ITUA 2WTKC 5JZJA 1OGUA 4G6OA 5L8KA 3UPZA 2I0YA 3I53A 2PMUA 2UZVA 1T98A 3OWPA 4I94A 3LXNA 5J5TA 2Z7SA 3NW7A 1MDMB 4UUVA 2QYOA 3L09A 3E88A 3F3UA 3F3XA 2JRTA 4ZJJA 1U78A 2BRNA 2WIHA 2WPAA 3I1AA 3SQNA 4E3CA 4FSRA 2B9HA 1FOTA 1OL1A 2XK4A 4JDHA 3V8SA 2UW4A 4AW1A 3L7WA 2YIXA 4CICA 4U7ZA 3RNYA 4EEVA 4B7TA 5A9UA 2Z60A 5D6EA 4AD9A 3KGAA 3KLOA 2GQSA 2VU3A 4P7EA 5KMNA 3OCSA 5F94A 1YHWA 2GFSA 3PXYA 3HOSA 4H1JA 5L8JA 2LSOA 3AXWA 3GEQA 4ZLZA 1UHWA 3TEIA 4AA0A 5GZAA 1W4MA 2YIWA 1ZMWA 3MVHA 1OMIA 1Y8GA 1XKKA 3ENHA 5L2TA 1B38A 3A60A 2XKOA 3E8DA 3EQRA 4ZLYA 1XBBA 2HAKA 2WFYA 1J7UA 5ICGA 4BKZA 3QTXA 3R28A 2ZFWA 2DUVA 3TT0A 5JHUA 2CSNA 5LLQA 4QT1A 4UV8A 4RC4A 4FTOA 3BE2A 3TNPC 1GIJA 4A0ZA 5M09A 3QGYA 4MWIA 4AIKA 1I5ZA 1VJYA 4OTRA 2QD9A 3PQJA 4FTQA 1GAGA 1UKHA 4FA2A 3CPBA 5KVRA 5D11A 5KUPA 4MK0A 4O82A 5IEYA 2JGZA 4FEXA 4YFNF 4EL9A 3BJAA 2JDOA 3DJ6A 2W1ZA 5ETIA 2RGVA 2JSCA 3REPA 4I24A 3RPQA 3FL4A 2Z9OA 3FL5A 4AUAA 1R36A 2NNWB 4D55A 3CCNA 4EWQA 2ZNYA 3SRVA 3PJ3A 3NEUA 3DU8A 2G9WA 2QOCA 3OOMA 4FC0A 2XRUA 2OZAA 1NXKA 3SXRA 3FZTA 4P9FA 2QO2A 5AIKA 5HDGA 4NFNA 3R0JA 4D2RA 4HGEA 4HYHA 1NVRA 4EM2A 3NVKI 5EDQA 4ZS4A 2WQBA 2P2HA 2ITYA 1OPCA 4LGHA 5B2KA 4D2VA 4JK1X 2YCRA 4YR8A 5DA3A 1SFUA 4A9YA 2R3NA 2RL5A 1MKMA 3DFCB 3FZOA 1OIRA 1YIOA 4GGGA 4BKJA 2PYWA 1WWXA 1Z1DA 4W4XA 4WOVA 4LB6B 2HTJA 2K7LA 3KKVA 1IASA 2BZJA 4NM3A 2RFEA 3F6OA 2UW0A 4IVNA 3HVCA 2XUBA 5KE0A 2QC6A 5CVVA 1J7IA 1VTNC 3VUIA 3LZBA 4MF1A 3EQLF 4BZOA 5CF5A 2WGJA 4KKGA 3PPJA 4L0ZB 2HXQA 3G6GA 1OM1A 3EQHA 3JTHA 1F4KA 1SVGA 3FLSA 3PVUA 2OH4A 2A6HF 2E9PA 3P86A 3QX4A 4GG5A 3EETA 1H9TA 5GJDA 2BBYA 2ITZA 1U6GA 3QUEA 4BWXA 4QP4A 4EOQA 4NFMA 4CV8A 5EM5A 4DF3A 4FKVA 3PZEA 1S9IA 4I20A 2KULA 3K1NA 4F0IA 1O7LA 3NZ0A 5JN2A 2FSOX 2OICA 2YIQA 4WCGA 3CD8A 3KB7A 3PLAE 5IEVA 4F7JA 3SGCA 5AWMA 4UALA 2XIRA 5LGTA 2B9JA 4AZSA 4I0SA 5CTPA 4DEAA 5HDNA 3KFWX 1AGWA 4AA4A 1WSUA 1LJ9A 2IPQX 4TN6A 1YXSA 3S2WA 2OFUA 2YU3A 2MH2A 2ZM4A 1BOAA 3UNJA 1L3RE 3FZ1A 1ZHFA 3L9NA 4AT3A 3BGQA 2YISA 4ZYDA 3EN4A 3QHRA 5HDKA 4BDGA 3VS5A 3LQ8A 3RK9A 1V0OA 4BWPA 4G17A 4AZEA 3I4PA 2C3LA 3RNIA 4W4VA 4FT5A 1BI8A 2YN8A 4HVHA 2H96A 5IDNA 4JNWA 1E17A 5EKOA 2F5EA 1MRUA 1HSTA 4FEUA 5E8ZA 4BDHA 4H39A 4I5HA 2PMLX 4B8MA 2IZRA 4DNCA 4O38A 4QMNA 2BE5F 3WTUC 3VUTA 3DBCA 4BYYA 2GNHA 3PSBA 3RI1A 3VBYA 5GINE 4E7WA 4AG8A 4IVAA 3PG3A 4FKIA 3F82A 2C6LA 2K4JA 3TM0A 1BI3A 1IAJA 3T1BA 3FUPA 3HTSB 2HIWA 4YC8A 2JITA 3F8FA 3HMPA 3B73A 2L3DA 4R5YA 3ACKA 1YOMA 2ZB0A 5H3QA 2HYFA 4BRXA 1UU7A 1W5TA 5EFQA 3L1SA 4Y73A 3WODF 4QYEA 2GTNA 3WTWC 1UU3A 2WMWA 4A06A 3ELKA 2PL0A 5ED4A 4WXDA 4K33A 3MVLA 3HMIA 3ZP5A 3NYOA 4BTJA 4IVDA 3OXTA 5BVWA 3W6KB 4CFWA 3AC4A 4UN0C 1VR2A 4RJ7A 2IG7A 3R9OA 5DG5A 4L9IA 3E92A 5ACBC 1HQCA 4JQEA 5K3YA 2GNGA 5CY3A 3HV4A 3OUKA 3VBWA 3RHKA 4QLCU 1Z5MA 3IW4A 4Q2AA 1OKVA 2X4ZA 2CSOA 3U4WA 3RVGA 2Y75A 2XNOA 4NIFB 1FMKA 5DEYA 4HZFA 3TUDA 2JDTA 4OIOF 2OWBA 4F0FA 1Q8ZA 3U54A 4RJ3A 4K2RA 1YG2A 4IE9A 2C68A 5HOOA 3OEZA 4R5SA 5B0XA 2GDOA 3SDJA 4BIEA 3RI4A 4BL1A 2QHNA 5ETFA 3FDNA 1SAXA 4N0SA 4RAYA 4L3PA 4V01A 4I6QA 4YJSA 1LP4A 1XGNA 4LRMA 5E18F 1FPQA 5M53A 1EH8A 3VBTA 4ALWA 3D0EA 3FI2A 4ANOA 5BQ0A 3EDPA 3PYYA 2VO3A 2PUNA 2JKKA 4D2PA 3AC5A 1BIAA 4RLLA 2EWNA 5FRIA 5D5VB 4M7IA 3WG9A 4GIIA 4DEIA 2GNLA 2NO3A 5HU3A 4DFNA 5JRQA 1LDJA 2OXDA 4O0RA 3G51A 3K2ZA 1W0XC 3KEXA 3FMSA 2QENA 3F6VA 5D4RA 3QRKA 4YJOA 2Z7LA 3CTJA 1JSUA 4DEHA 3EL7A 2GU8A 3J81Z 5FWKK 2BDFA 3KMWA 4HGSA 2WQMA 2GXGA 4HOBA 2ESNA 4KN7X 3UOKA 4H36A 5CX9A 2KJCA 4ZYEA 4HPUE 3GVAA 4PV0A 1SD6A 5AIQA 2OIDA 2R3LA 4C58A 4BAYA 1UNLA 2QU6A 1P4WA 2HKXA 1OITA 4XHKB 4GK3A 4OAVB 4RJ4A 5EDRA 3ZMDA 4E1ZA 1J91A 4RWKA 1PXOA 4CMUA 2C6DA 2XBJA 2IWIA 4DG3E 4WO5A 1FYMA 4FKRA 4IBMA 3R1NA 4OTDA 4D58A 5AP6A 3W2RA 3MY1A 4RIOA 4GMYA 5IA5A 1W7PB 1MP8A 3DNDA 4EJ7A 4E5WA 5DT3A 3R30A 2YCQA 2DK8A 3EFKA 4F9BA 3ET7A 3H9RA 3HRFA 5HLHA 3VVHA 3DJ7A 2I1MA 3SD0A 4FKUA 5A4TA 1RUNA 4CRLA 3U1DA 3DBEA 3IKTA 4LUDA 3BQCA 2JFLA 2VOPA 2V0DA 1ZRCA 3QTZA 1WRJA 5DE2A 3PRIA 4CSVA 5D8KB 3DJ5A 5JEBA 4NT4A 3F69A 2XJ2A 2ZM1A 4BHZA 2AC5A 3C0HA 5FTQA 4KIPA 2XAJA 2XAFA 3DAJA 2ZV8A 2FQ3A 4DTKA 1RDQE 3H10A 5LBQA 1D3YA 2Q0BA 4HPTE 3HUCA 4PUZA 1EH4A 5DD8A 1R1VA 3FLQA 1R1WA 2A4LA 3ZC5A 3UZTA 3SXSA 2JAVA 4C35A 4DLJA 2XK8A 3Q96A 1FBUA 3FZSA 4ANMA 1STCE 3MEXA 3Q9ZA 4USDA 4DFUA 3OVVA 3R63A 1GNGA 4QMVA 3OWLA 2ERZE 4BC6A 3BYOA 2V7OA 2XCHA 4EUUA 4PP9A 2IVMA 4WT6A 2EUFB 3WIGA 4GS6A 1C0WA 1CGPA 2Z7QA 4OBPA 4PPBA 4ZY6A 3PXKA 3PJ8A 4CO8A 3W2OA 2VWUA 3ID6C 4LFUA 3FY2A 3KULA 5CWZA 2BEOA 3FC2A 3ULZA 4YJVA 4RS8A 3LFDA 3ZXTA 3GNIB 2ZMEB 2ACJA 1Q24A 4S34A 1O3TA 4NHJA 2H94A 2HOGA 5F1RA 4AFEA 4XG8A 1SD5A 4BCJA 3AT4A 3LKMA 4FIGA 3F7WA 4ENKA 4OTFA 2VTAA 2VTSA 3QQGA 1G3SA 4JJRA 5LHIA 4HCVA 4KIFA 4RFYA 2E2BA 3ANRA 3TNQB 2EFPA 2VWWA 3D14A 2XMYA 5IQIA 1OPKA 2OK1A 5J9YA 2XNBA 1LVAA 4NTTA 3D0SA 3QUDA 3VJOA 4RX7A 4A2UA 4L0YB 3P5KA 4FE2A 4BCQA 4Y13A 4Z7GA 2HZIA 1JPAA 2I0HA 2VNWA 1YXXA 2UZNA 2UZLA 2F5DA 3OCGA 3OP5A 2JEDA 5IQHA 3DP7A 4DQ2A 2R3FA 3UP7A 4ZLOA 2HZ4A 2E7WA 4FUXA 5HNIX 1BYGA 4L00A 2ZDTA 3CLOA 4BTKA 3UQCA 3O8PA 3TUBA 3DY7A 1IN8A 3UODA 5HE0A 4WUNA 2V1UA 4GIHA 4QP7A 5IMEA 3ZMTA 5A2QZ 3H0YA 1E1XA 4GFMA 5HZNA 4TZRA 4RWLA 3VS4A 2XKPA 2RFSA 1FWZA 2V6CA 4CYDA 4NCTC 5ICEA 3W32A 3A4PA 4XYFA 3OBGA 2WHBA 1G8SA 5D8LB 3POZA 5ILSA 1K78B 1UKIA 3JUHA 4F70A 2YZLA 1NA7A 2O63A 3VEPA 2VC0A 3BYUA 4W9XA 3I7CA 3WGGA 5EH0A 1D5VA 4P2KA 1WQ2A 2Z2WA 3CD3A 4RJ8A 3VFZA 5A2QK 4RVKA 4BXUA 4KUJA 3DXNA 3LMIA 1WKMA 3C0GA 4O91A 1SMTA 4FTUA 4ZSEA 4K2EA 2JC6A 4TWOA 4D2TA 3BIZA 1FOKA 3OFMA 2RV8A 5LOHA 2B1PA 2PVLA 1XDSA 2R3MA 4KSPA 3FMQA 3QHWA 2VZ6A 3GO5A 4BKYA 1SVHA 1IRKA 3WZJA 3SOCA 3PQKA 1I1SA 4OTQA 4CLIA 3QKKA 2CCIA 2RSVA 5C26A 2YJRA 1H01A 5FEEA 3ZLWA 3BU5A 3E6CC 3BEGA 4IDVA 4IXPA 2IW5A 2OJGA 3FY0A 4EJNA 4KS8A 3EZRA 4CXAA 1CDKA 1FYKA 2NRUA 3R9NA 4YHJA 3H30A 3V8JA 4RIXB 2QO7A 1ZRZA 4FV5A 3UG1A 1LNWA 1BMKA 2P33A 4UMUA 4YZMA 3HA6A 4ZY5A 4KA3A 2O64A 5DCMA 4GW8A 1W84A 4G3GA 3KVXA 4FR4A 2HXLA 2CKEA 2XVDA 4J98A 5DN3A 4B4LA 3CY3A 3H4JA 1B39A 3DXJF 1QPJA 3V4GA 4ONAA 2WNTA 4WK8F 4AN3A 3NIZA 3J80Z 4XG4A 2OQRA 4YTCA 3VS6A 4R8QA 4FKLA 4PRJA 3JYAA 4EH3A 1S6LA 1WI9A 2PZRA 4H0EA 3QD4A 3ZFMA 3BHYA 4XG6A 1VYWA 2GA1A 3LCOA 5HGIA 4G7HF 1LEZA 2A6EF 3BQRA 2IW6A 3O0GA 5AIPA 4A4LA 1ZH5A 1WCCA 4MEXF 2ETRA 4V0GB 3KE2A 4NWMA 4ANQA 5BVFA 4R8HA 4JX7A 3MH1A 2GHMA 2NS0A 4RC2A 4LRKA 1O3SA 4ACDA 2VTPA 3MBLA 4IX4A 4ACHA 3F3ZA 2DS1A 2VNYA 2EU9A 3J80K 1J5YA 3CKXA 2RG6A 4ENYA 4PL4A 2ESHA 4APCA 5IDPA 5ERIA 1WMKA 3S4QA 3KLNA 2W1EA 4HW0A 4S2ZA 2PBIA 4O7LA 4O0VA 2YDKA 2R5TA 2FMYA 4O7VA 3TKIA 3NRVA 3CUOA 3FMJA 3C0IA 3OWKA 4MNUA 3UYTA 2BCJA 5CU0A 2ELHA 4WBBB 3HAVA 2L54A 3R9DA 4CMTA 3KXNA 3GP0A 5AAGA 5LWNA 2IA1A 1DI9A 5HNBA 4U44A 4QMWA 1B9NA 3FYKX 4HA8A 1YDRE 5L8LA 4LD5A 2PUIA 4I4FA 4MXYA 5AP4A 4RFMA 4NM0A 4Q5HA 5ITAA 3A62A 4UV9A 3GU7A 2GPHA 3TO6A 4E20A 2L4AA 3WTSC 1XH8A 3GU6A 1H27A 3M9AA 3GFEA 4ZIMA 3V5WA 4C4HA 4QNYA 4ENJA 2XHKA 4UY9A 3BV3A 4FUYA 4Y85A 5J7HA 2QWWA 4CMOA 4ZZNA 1PXKA 2EA4A 2JFMA 4N6ZA 1H8FA 4RSSA 1VZOA 1XH7A 2VTLA 3BBTB 4XNEA 4DGNA 4Y5HA 2AYPA 1Q3WA 3QC4A 3PXQA 2EJRA 2FA2A 2J9MA 4BDBA 4JAJA 3Q60A 1REJA 4PZJA 4MH7A 4OIPF 4YJNA 4IADA 2IW9A 3BELA 3O8UA 4N6YA 4BGQA 3GGFA 1KYWA 4FTAA 4YO4A 4APPA 4CFXA 4MTEA 2YJSA 2YCFA 1PMNA 4J71A 4OMZA 2IJLA 3QX2A 4EMSA 1U8RA 4AE9A 2W4OA 5BYZA 3DXQA 1ZREA 4GEOA 4QPMA 4L52A 2W4JA 2JBPA 4HVGA 4IEBA 2GA2A 3EIDA 3K69A 1D8JA 4LMNA 4D9TA 2FEZA 4JS8A 3HSRA 4GVAA 4O0YA 3WTXC 2E9NA 3OF0A 1PXIA 3DZOA 2HOEA 2CO5A 4OIQF 5CT7A 1FP1D 2ITXA 3RAKA 2QG5A 3AGMA 3GCVA 2GS6A 1OUYA 2OJFE 1PMUA 3O50A 1DPUA 2QOFA 3PG1A 3LLTA 2BFXA 4E26A 1OYWA 4QP9A 1S8NA 1F1ZA 4L9TA 3T8RA 2CNQA 3RINA 4H3PA 2ACXA 4HJOA 2O61A 4E4MA 4QP1A 5E1SA 4F6UA 1M2PA 3FSKA 4ZS0A 4F09A 1U3EM 3RAHA 5HKMA 4BDAA 5H8GA 4M3QA 4L46A 3RZFA 2F2EA 3R00A 5LVPA 5HVJA 4EOPA 3NYVA 3Q9WA 4DT8A 4CTCA 3QAHA 4UVCA 5HTIA 3OC1A 5HTCA 3NAYA 3ACJA 1J59A 5HTBA 3TDWA 1T6SA 1KU7A 3LQRA 2C6OA 5BQTA 3EJ1A 3DPLC 2IW8A 4TRLA 3BWGA 4L3LA 4EJUA 1TBXA 1HOWA 2GFCA 4IB0A 3HRUA 5AFVA 4PTGA 1Q41A 4ALVA 4DGLC 2HQNA 4MNFA 3U6JA 5FFZA 1H0MA 2R64A 3I0QA 1ZRDA 4DEGA 2WMVA 3FXXA 3R9RA 4I0TA 4XLNF 3B2WA 3G3ZA 4FSUA 3I64A 4B8XA 3ABTA 4UYNA 2DQRA 3UVPA 2HW7A 1YXUA 3GC7A 1V0BA 2C5YA 5GIPE 5CEKA 4ACGA 3OCTA 4EK6A 3PIZA 3ZZEA 3OOGA 4FVQA 4YBJA 2HCKA 4I6BA 4FTMA 4Y95A 3LXPA 4PL5A 3GFWA 3IK3A 4UBAA 5IQGA 2J5OA 3GC0A 2QQ7A 2CKPA 1WBOA 4D4RA 4MHGA 4JRVA 4KIBA 1H9GA 2EB2A 2BDWA 4DGOA 5E8SA 3H9FA 5B2MA 4J99A 2CQKA 4F63A 3W1FA 1MQ4A 2BRMA 5DEWA 2XF0A 4I5CA 3RBWA 2O2UA 4PPCA 1LEBA 1Q99A 4RB1A 4MQVA 2A69F 2W96B 4YIIA 5TE0A 3P7AA 2FGIA 2IVTA 4EC8A 5KMKA 4R78A 3GUBA 4LK0F 1OMWA 3RM7A 3I4BA 1H28A 5I0BA 3PXFA 4QMZA 3T3VA 3ZXZA 2WTVA 4C7TA 1OBDA 1R00A 5M56A 4UWBA 4I7HA 3PVBA 3M1SA 2B9IA 1KUTA 5J7BA 2UWMA 2HK5A 2XB7A 2X2MA 3ORNA 4MEYF 2X9EA 1K9AA 4KDPA 3I71A 4RQVA 2YFXA 4LG0A 2SRCA 2DPUA 2A5YB 2X8EA 4H05A 5IH4A 4QO9A 4C37A 5LMKA 4EH8A 4II5A 5FD2A 1FSEA 3JSPA 2UXXA 3TV7A 4OAUC 2ZO4A 4WSYA 2V62A 5J8IA 3HV5A 4GO1A 3ZFXA 4AT5A 2BZIB 3AMAA 4A6DA 1V3FA 1Z6RA 5FLFA 4RGJA 5BUJA 4U43A 2CHLA 2CG4A 1PXNA 2PMNX 5FP6A 4ZZOA 1YHVA 5CLSA 4GKHA 1PKGA 3R9HA 1IAHA 1YW9A 5FLXZ 5KMLA 4FV1A 5I4NA 4BDIA 1XDUA 2O0YA 1W7PA 2UXNA 3QL8A 4IACA 4ZSJA 5DIAA 1BX6A 1ZLJA 4E5BA 3FYJX 3Q9SA 3Q4CA 4QYHA 3ZCLA 3VBXA 3MYGA 2DW4A 1PF8A 3EYYA 4K0YA 5ICFA 3QKMA 1KQ0A 4W9WA 3FWQA 1YW2A 4DFYA 3OW4A 4RC3A 1MJ9A 4AP7A 3WTYC 3HA8A 4O2ZA 3IPHA 2GS2A 4TYEA 1Q5KA 4IB5A 5DWRA 2XUUA 3R71A 4V05A 3QXOA 3TKYA 1U59A 1S9JA 3OT8A 3VUMA 1OB3A 4EQCA 5DT4A 2OJJA 4EI4A 1XGSA 4BDEA 5FLXK 4WXCA 2UW7A 3NQOA 4YFXF 3COHA 4KIOA 3RMFA 3ITZA 3G9NA 5HLPA 1DAWA 5M08A 1Q97A 3MI9A 3U4UA 4PWNA 2OXXA 4S05A 4GT5A 3WTVC 4ANSA 4IAYA 5JZNA 4DLIA 2FUMA 3Q6UA 2ITTA 5IU2A 5KKRB 4I3ZA 5JRSA 3W33A 2W17A 1FT9A 3DXPA 1FBNA 3EYGA 5CU6A 4F1MA 2Y4PA 4BCOA 2VWVA 3HRCA 3L9FA 4BH9A 2R7IA 2BILB 4E6DA 4C2WA 5BNJA 3ZC6A 4I22A 3D5LA 4EM0B 4FEVA 3NS9A 4GT3A 4L9VA 4AIJA 3G33A 5LMBA 1UB9A 3SRVB 5IA0A 3AC2A 3I0TA 2E9UA 3NW5A 1OPLA 1L8TA 1RIOH 3F22A 2OZAB 4M12A 5KMIA 2JPCA 4CFUA 2VOOA 2X7GA 2BROA 1FBSA 5ETAA 3BGPA 3C1XA
chains in the Genus database with same CATH superfamily
3CMEI 3R7UA 4HYEA 4UMRA 3PY1A 1YWRA 3BRBA 2M30A 3ZEWA 4BCMA 4C4IA 4JX4A 3OY1A 3QC9A 3JS2A 4XLAA 1M17A 2WV0A 5M44A 4DHFA 2CFOA 2PMHA 3LXLA 5FUTA 4G6DA 4O1OA 5FKNA 2PEXA 3PP1A 4EGYA 4CZZA 4ITVA 2FSWA 1YITI 1PHKA 4BJ5C 4U87A 4L44A 2VQCA 3BG5A 4D1QA 4U79A 4R7HA 3UIBA 4PDKA 3SW4A 5E92A 2W82A 4MXZA 2CLXA 3CQWA 4F92B 4K6ZA 2E9VA 4OINF 2AEGA 5EYCA 4LV8A 2UW3A 3FKNA 3QLFA 5HS7A 4G9YA 4C3IJ 1QPDA 3R73A 3DLSA 1T56A 1ATPE 5IQEA 1O9UA 3SG8A 4NZWB 2DQ7X 5L3AA 3RPUA 3VF9A 3BCEA 4RGXA 3DCVA 4EH2A 4G5JA 1MQBA 3DGKA 1TQIA 3OV8A 5HOAA 4HLXA 3IG7A 4FIFA 3AMYA 1W83A 3W8LA 5C27A 4YPSA 4YTFA 5D5WB 3A8WA 2OU2A 4ZDLA 1YXTA 4RVMA 3HYHA 3I79A 3IGOA 1LFPA 4DYQA 1E9HA 2YS9A 4DH1A 2M5WA 2BR1A 3TQNA 4UXNA 1WPKA 5EOBA 2QQ9A 3UYSA 4EHVA 2CS3A 4GKIA 2ZSIB 2NOGA 5K0KA 1G3WA 2PG4A 3ZO2A 3A4CA 3TO9A 1GLNA 3WZUA 3EPZA 1K78A 2IGOA 4DHJA 3LQ5A 2ZBKA 4HOKA 3F9NA 4C57A 4LI5A 2P7VB 2XGDA 4CFFA 4DYRA 2ZJRF 3H3UA 4DH8A 1R4NB 4AIDA 3R02A 2KMUA 4LYNA 4WWCA 5J87A 3LFCA 4EK4A 4Z55A 4KNYA 2X0GA 3ZRGA 3K1MA 4XRMA 3V8LA 3I5NA 4PMTA 4IM0A 4M74A 4U0YA 3GOKA 2F5FA 3PZHA 3LNQA 3KC3A 3DEUA 3S95A 3ZZWA 4EWHA 4S04A 2PUPA 2W7NA 4ZZLA 3D5UA 4ZJVA 3L2RA 4PJJA 3KMMA 2BFYA 1JUPA 3N4UA 4C2MJ 3E7OA 1HLVA 2AS5F 3NCZA 5TJJA 3W2QA 1IXSB 3QA0A 1H08A 2JPBA 2C5VA 3EQIA 2K9LA 4F1TA 3C1DA 2C0OA 1JVPP 2EZIA 3RGFA 2YIYA 3A4OX 2OLCA 1FNNA 1OIUA 3PTGA 2O03A 2OCEA 3IW5A 2XGCA 3ABKH 1QHHD 1ZGJA 5AP3A 4ZSGA 4DCEA 3F3TA 1OL2A 3D83A 5HLNA 2XB0X 2HQRA 4MFEA 2QM3A 3BZKA 4LITA 3CGOA 3ETAA 1YOVB 5HICA 4U97A 4I6LA 3BG9A 3VYSB 4K11A 4NEUA 2F4JA 4OMYA 2Y48A 3K7AJ 1KQ9A 1Z57A 4MWHA 4YIRX 3AQVA 1U5TC 3R61A 1GZ8A 2XM9A 2R93J 3IO7A 5J9ZA 2H6DA 2ELKA 2NYAA 4YLKA 1XMXA 4BUPA 4BI0A 2XEZA 4WA9A 2WEIA 4W8DA 4CVAA 1CKIA 2EXEA 5CZIA 1ZMVA 4G31A 3HOUJ 4GRBA 4QMTA 3DKOA 3E8EA 3W8QA 1ETKA 4RIXA 2Y9ZA 4X3FB 3WU2C 1SVLA 4QTAA 2OGVA 2R3GA 1QHGA 2BRGA 5DFPA 3DDPA 2BTRA 4LIUA 2W48A 2W1DA 4FBXA 5BYLA 4NB5A 4RM3A 1ON2A 2YDIA 4YNEA 2X4FA 2LF7A 3V04A 4ZJIA 3JRGA 3IWZA 3ZQLA 5AX3A 4TKSA 3GCQA 5AM7A 1LUJB 2FH9A 3P9KA 4BCGA 5LJJA 4AVZA 3AD6A 1G6NA 3COAC 1UAAA 3TZ7A 5HX8A 1YI4A 4XBRA 1YW8A 3ODZX 1RI7A 1VI0A 6PAXA 2BKKA 3ZRKA 2O5KA 1OGYA 5JT2A 4FODA 4F08A 5A4CA 1UFMA 3LSIA 1QO0D 4A3BJ 2QOLA 5AP7A 2IVUA 3JVRA 3E6DA 3JY0A 2YDJA 3P08A 3R6SA 5E9EA 3QTUA 3MWUA 2PQ8A 3VC4A 5I9UA 2JVGA 5CVIA 1E1VA 5LHHA 5FM3A 4CD0A 5BVOA 5CJ9A 4V0GA 3EN5A 3D7TB 5DEQA 4KNBA 1R5GA 3ECOA 3G6HA 1AKHA 4BB4A 3SFZA 3GU5A 3UP2A 3ONQA 3QCQA 4IAKA 5CKTA 1I39A 2R5ZA 2A19B 3I5ZA 2OBJA 4FX4A 3PSDA 3LAPA 5ANKA 4CYCA 1TZDA 2XAGA 2M7BA 5TR6A 2CRGA 1QMZA 4PMMA 4QDEA 4PGGA 4BHCA 4CCNA 2H6CA 2RKHA 4O7ZA 3CSVA 5AIRA 4XOYA 3BJOA 5AR3A 2WEVA 4XP0A 4G8XA 2F57A 2PMOX 3C4FA 2FO0A 3PJ2A 4FIIA 2QBYA 2QNJA 2IP2A 2M4KA 4U88A 3RYPA 2XNMA 5FEQA 4EOOA 4U0VA 4S33A 5CVRA 1W36C 3RALA 4MQ2A 3IGGA 2H6BA 4QMQA 4NYEA 1FC3A 1FX7A 5DI1A 1IC8A 3AGLA 2E2JJ 3ZSHA 1HCLA 4IJAA 5DYMA 4U9AA 1ZZLA 4FSZA 2FVDA 3DLZA 4YLLA 2IA0A 4F7NA 3R2YA 3KEQA 4JR3A 3E6MA 3O96A 2FBHA 2FBKA 3LFBA 3TV6A 2P5VA 3AT3A 4FK3A 4ZYAA 2OUMA 2ZXWH 2BXYA 1UJ8A 2R7UA 4O7TA 2WB1A 1IDYA 3F5PA 3QOEA 3F5XA 3VO3A 4MIMA 3S8PA 1S72I 4FT7A 1RUOA 4M66A 3LIJA 4XRJA 3AAFA 3HPGA 3GFIA 3CKWA 2HXIA 3CTQA 3ATTA 3QFVA 3LSHA 3E3VA 4DAWA 2DTZA 3U6IA 3ZBFA 3W0PA 4R3CA 3NDMA 2GHGA 3OD6X 4EKLA 4IZYA 2DU9A 2HZ0A 3WILA 1IAWA 2QOHA 1A6IA 3VODA 5FD5A 4XN0A 3A2KA 3PSCA 1RE8A 3D1NI 4W4WA 3PP0A 1M14A 3OZ6A 2E71A 3BPRA 2ESMA 5AV1A 3RPVA 3WZKA 3RJCA 2NS7A 1M7NA 3IKVA 1BJZA 3VUKA 1GV2A 5KCVA 2CKQA 5E17F 3NGAA 2ZB9A 5E3LA 3MB7A 2PZPA 2X6OA 4IHSA 3CLYA 4QTEA 2WELA 2A68F 5AMNA 4QP3A 4D0XA 1UWJA 1FZPB 3G0EA 5E7RA 5IA2A 5KAFC 4TTHB 2GIVA 2OF2A 5CEQA 4FX0A 3ZQIA 3C2HA 3KXXA 2STWA 2XF7A 4WG5A 1T38A 2ZCWA 2VV9A 2BYVE 5AR8A 5DDGA 3D94A 3TJCA 5DVRA 4NM7A 5KK1A 4BY9E 4EYMA 2PE2A 3UDSA 2Z16A 1YDTE 3OHTA 4XSXF 2DBBA 2JN6A 4LG4A 4BTMA 2X8DA 3K54A 2J2IB 4W8EA 3CJQB 2X9FA 5KX8A 1ONVA 5FGKA 2QCOA 3LJ1A 3HEGA 2QOQA 5DCFA 4RVTA 2KIFA 5K5QA 2ISYA 5F04A 2EWAA 4K1BA 3TZ8A 1J2XA 1UV5A 3FXUA 2YHVA 2ZMCA 3QA8A 2Z5UA 3BY6A 2J5EA 3CC6A 2BRBA 5HCZA 4EJWA 5H2UA 4EUTA 2CKOA 2CGWA 5JFSA 5J3LA 3LWFA 4ANBA 1DU6A 4ZC3A 5HU9A 5JR3A 1VLRA 1JHFA 4AM3A 4C8BA 5IH5A 1D1AA 1B9MA 3CCVI 3FXRA 1M2QA 2ITNA 3LLAA 4EJTA 4BE0A 1JHHA 3ORXA 1Q8YA 2QR8A 5DR9A 3R7IA 4ASDA 5DPVA 3HDDA 4Z9LA 2OC6A 3F3WA 5CU4A 2CJMA 4FG7A 3I6WA 4M13A 3OYEA 2QLUA 1PXJA 3LL7A 4RJ5A 4L3JA 3NLBA 2XJ0A 4AOJA 5KHXA 3BLYA 3NNWA 4MHAA 3ATSA 4Q47A 5KBRA 3BR2A 3LJ0A 2ETHA 1OKYA 4X2NA 1FGKA 2Y0MA 5J40A 3TDUC 3TGNA 4KABA 5F08A 4BQNA 1NG6A 4ZTNA 1PUEE 3F9KA 5JGAA 2H8WA 5HE1A 1PYVA 4QMSA 4UUSA 2P4IA 1M2RA 2ETMA 3G2BA 4G6NA 4JX6A 2J6MA 5DTDA 5IH6A 1ZAOA 2GM4A 4FE7A 4XCUA 4I6FA 1UU9A 4R77A 3ZDIA 1YX5A 3WG7H 4E70A 4IWDA 3D2IA 2WMTA 4DGMA 3OTVA 3DB6A 4AX8A 3KRLA 2VC1A 5DV5A 2ID3A 2YIRA 3JVSA 5C4LA 3KXGA 2DYSH 2B7AA 2W24A 3TNHA 3F72A