4GYGA

Crystal structure of the rio2 kinase from chaetomium thermophilum
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
341
structure length
331
Chain Sequence
KLDTRAMRHLTAEDWRVLTAVEMGSKNHEIVPTPLIEKIGVHKSIATLAKAGLIARMKEAKYDGYRLTYGGLDYLALHTHAARKDVYSVGSRIGVGKESDIMIVADEKGKQKVLKIHRLGRISFRTVKRDYLRNRSTGSWMYLSRLAAIKEFAFMKALYEEGFPVPEPIAQSRHTIVMSLVDALPMRQVSSVPDPASLYADLIALILRLAKHGLIHGDFNEFNILIREEKDAEDPSSITLTPIIIDFPQMVSMDHPNAEMYFDRDVQCIKRFFERRFHFVSTTPGPFYKDAKKTVGKDGAKRLDAALEASGFTKKMAKDLEAAIREQQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATPase-dependent role of the atypical kinase Rio2 on the evolving pre-40S ribosomal subunit.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transferase
molecule keywords Rio2 kinase
total genus 103
structure length 331
sequence length 341
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gygA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gygA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gygA02
1YS7A 5DT3A 5AA9A 3PPZA 4FTAA 1M2RA 5M53A 2VTSA 5ILSA 2XGXA 2IZUA 3AT4A 3HDNA 3KLNA 2MLKA 3JSOA 1J7IA 4HW0A 3TDWA 1PYEA 2XNGA 4PL4A 2H6DA 2A6EF 5J6XA 2OO8X 4D9UA 2R9SA 4HF1A 4AZFA 4XG6A 1QBJA 4Y5QA 3U4WA 5ANJA 4OT5A 4MTDA 4IWPA 1J9IA 3ZSIA 3W8LA 5C1QB 2X2MA 3PXRA 4RWLA 1GZKA 4EZ3A 1FGKA 3WU0A 4FTTA 4BDJA 2Q8KA 4KB8A 1OL7A 4DLJA 2HW6A 4E8AA 2VTLA 2XKOA 3MN3A 3EH9A 4WOVA 2UZWE 4PPBA 4TYEA 4CFNA 1Y0UA 3KP4A 3QQLA 1YRPA 4ZSAA 5CU2A 2IPQX 4P90A 5CENA 2FGIA 5EFQA 3DXNA 2B1PA 4ZK5A 2FEZA 2G9XA 5BNJA 4D9TA 1GVJA 2ITZA 3ZLYA 5CY3A 3HA8A 4TWOA 4O7YA 5A3XA 5K5XA 3G3ZA 4F64A 4QMUA 2NRUA 1A06A 4DCEA 2XKPA 4LGDA 4QMTA 5JHUA 2QOBA 1L8TA 3TV4A 4RFMA 2KIMA 2QG7A 2XA4A 5FD2A 4BCJA 3UG1A 2IO6A 2HFHA 2ITVA 2VWWA 4IDVA 1H07A 2WTVA 3DK7A 4BDGA 3R8MA 5CNOA 3S4QA 4FKGA 5F64A 4LG0A 4O0VA 4HVSA 3GU7A 3TIYA 2ZKZA 2PI0A 4IB5A 5E90A 3VUMA 3J80K 1QGPA 3O7LD 4MQ9F 3KP5A 4USFA 4OTGA 3BWGA 3PA3A 3AGLA 3LXLA 2CQKA 5LRSA 4AOIA 3II5A 4A06A 5ICPA 3GW2A 3V6SA 2XJ0A 2RGPA 1ULYA 3RYPA 2VWYA 3QQFA 1VEBA 3F8CA 4ZXTA 1NVQA 2EWNA 1REJA 4MF0A 1XMKA 2XVCA 1UU9A 2VWUA 5DRBA 1Y57A 4GRBA 2FH9A 3EZVA 4PWNA 4EEVA 4L0ZB 1SNUA 5AR2A 3RALA 1IA9A 2GNHA 1Z9CA 3EQLF 1QPMA 1P4WA 4D55A 3SDJA 4BKJA 1U2WA 3FLNC 5DEWA 1RJBA 4I0TA 5FGKA 4BCOA 2EVAA 4JBAA 3RTPA 4I6QA 1Q97A 3Q5ZA 4DH1A 2W06A 1G8SA 4FKQA 2C6LA 4EH4A 4BI0A 2A5YB 4FT7A 2B53A 4ESJA 2XBAA 3G6HA 3OF0A 4B8MA 2VC0A 2OZ6A 4BRXA 2IVTA 4M3QA 4DBNA 2GSFA 4I09A 3PZHA 4EVIA 2IVSA 4G9YA 4FIHA 1GIIA 1V0OA 4AACA 5L6OA 3AD6A 1B6AA 2DAOA 4CMUA 3ZMUA 1KU2A 3MWMA 2IP2A 3BIZA 1F5TA 5AP6A 4C34A 3RK5A 1ZMWA 3ZBXA 4DTAA 3WG9A 2VE9A 4E26A 1Y8YA 1ZLJA 4U88A 3S95A 4I23A 1MDMA 4FUXA 3L00A 3FYJX 5M4CA 4TZRA 1PHKA 4MBLA 4XV2A 3BHTA 3S1HA 1MGTA 2OQRA 3FLZA 1FSEA 5A2QK 4AG8A 1GHCA 3RMFA 3TCPA 5HDGA 2CYYA 1KQ9A 2IA0A 4G16A 3AD4A 3LQRA 4PTEA 2BGCA 4YHFA 4FICA 3L2CA 3KZYA 3MVLA 4HNIA 2F7ZE 2CG4A 4GV1A 3Q9SA 2HZ0A 1H00A 3UIUA 3GFLA 5H8GA 4EQMA 3C4FA 3LW0A 2VWVA 1G5SA 2WAJA 4WD5A 4GK2A 5ANEA 4LMYA 4D5HA 2XK8A 2NP8A 3UC4A 5M08A 4FZ7A 3OP5A 4NJ3A 3HSEA 1BX6A 3QU6A 4NM0A 2BAQA 3BRBA 3DQXA 1O7LA 2ITOA 4CNHA 3KN6A 3O7LB 2QQBA 3VFZA 4ALUA 3RPQA 4UUVA 4PUZA 2ZB1A 3KRWA 3R6SA 4YC6A 3BU5A 4WXCA 5AV2A 5K1YA 3ZPLA 1FMOE 3D7ZA 4FOCA 3QX4A 4BCHA 2FSWA 4WKQA 4CGZA 1XBBA 5J1VA 4X0MA 4JOAA 2FNAA 3WE2A 4ZZDA 4FMQA 5B7VA 2YCRA 4AOTA 4F4PA 2Y8OA 4NKSA 3QP6A 4CHUA 4FZAB 4DCAA 1UV5A 3P7NA 1GZNA 2PVKA 1I6XA 4PPCA 1Q8YA 4W9WA 4I20A 1Z91A 3CBLA 4RGRA 4QP7A 2UZDA 4DBXA 3CTJA 1G8AA 4M15A 3BPXA 3DGKA 2BZJA 4A5NA 4L67A 4XHKB 3UYTA 5FGMA 2UVYA 3I81A 4GT5A 4BDIA 4NFMA 4BB4A 5E92A 1R1TA 2PG4A 3VUHA 2O6GE 2CGXA 5AM7A 5I9XA 3LQ8A 4FTJA 1VJYA 3BE9A 4R7HA 3LXKA 3W6KB 5KMLA 2CLQA 4R6VA 1KE6A 4G31A 5HG8A 4ZTQA 1FSHA 4RWIA 2P55A 4HYSA 5GJDA 2Z7QA 4I0AA 4YG2F 3SOAA 5L3GA 3PJCA 2C1BA 4PDKA 3FL4A 4EH9A 2R3NA 1KQ8A 2QZ8A 2GQGA 2WTKB 2XUBA 3A4OX 4J98A 3QZHA 2WU7A 2E1NA 2CWEA 3IOPA 3R00A 1XD7A 3SQQA 4AZVA 3MZHA 3HKOA 4EK5A 3R1SA 3WILA 5CF4A 4EQCA 3TGNA 4CT2A 2XKEA 3FC2A 5M06A 2BRNA 3JVSA 1STZA 2OXXA 3T9TA 4XSXF 3AGMA 2NS0A 1XKKA 3QYZA 2QOIA 3DF8A 3I79A 4FGBA 4NFNA 3C7JA 1G3YA 5E8UA 4WXHA 4O0SA 5HG7A 1R22A 4FSTA 4YZCA 2ONLC 3CEKA 4MYGA 5DLSA 4PGHA 3V8SA 4IRIA 3NYVA 5EI2A 3MSSA 4YGAA 1Q99A 5LEJA 4XOYA 3JS2A 3S0OA 2ETHA 2OH0E 2M45A 2PZ5A 1ZRCA 3S3IA 5E8VA 5LVNA 4BZDA 4DYMA 3UO4A 4U0WA 5DPVA 2QLUA 3F3TA 3S2PA 4BDEA 1QZYA 4EJWA 4KT5C 2MBFA 3NNWA 5CF5A 1Q24A 2P33A 2C6EA 3RI1A 4KYWA 2XIGA 4RIYB 2EA2A 4M0YA 4RX5A 3QU0A 1ZY5A 2IJLA 1BKXA 4FVRA 2NNWB 5BUIA 1OMWA 2QC6A 4RGJA 1STCE 3IGOA 5C8MA 1LDDA 5CF6A 2Z8CA 2WMQA 2WMAA 4HAMA 1CF7A 2GDOA 1BM9A 4EH2A 4ITJA 2ETKA 1BIBA 4I94A 3QPTA 4A2UA 5A4LA 2ACXA 4BCFA 3FMDA 2PZIA 1ZOHA 2RL5A 3MAJA 3ZZWA 4L7FA 1T39A 3P23A 2V5QA 4DFXE 4ENXA 4LUDA 3KETA 2EFQA 4LRJA 4RGUA 2PVMA 2YJRA 4HX4A 2DTRA 4LFUA 1PY5A 4FSMA 1ZY4A 4O7TA 3MH2A 4GS6A 3PE1A 4RIOA 2B9HA 3JSPA 1U3EM 5KVRA 1RI7A 3ZH8A 4O1PA 1P14A 5ANOA 2CHLA 2O64A 2OZUA 2J4ZA 2R0UA 3OC1A 4APCA 3ODYX 3AC4A 1ZRDA 4AFEA 3FL5A 2FSLX 4FKOA 3FI3A 5ICCA 2GTMA 1ZYRF 2YR2A 3I60A 4MQ2A 4RQKA 4IZ7A 5M07A 2PE1A 4I02A 4QQTA 2VU3A 2JKQA 3UC3A 4I0SA 3A8XA 3VNTA 4W9XA 5DIAA 4MBJA 3ZFYA 4DINA 5HU3A 1WI9A 4QQ5A 4TYIA 2WMWA 2FB8A 4CZUA 3HP2A 4KRDA 4XLVA 2BDFA 1W7PA 4XG9A 2GHMA 1VR2A 5EQPA 2DLLA 2AUHA 3KZZA 5HLNA 3NW7A 1R00A 2VONA 5AX3A 3ISPA 1BLXA 5FXRA 2ZNYA 1J59A 4M14A 4QMMA 5HTBA 1Q8ZA 3ABUA 4FTOA 3C1XA 4UZDA 3UDBA 2PMLX 2WZJA 3LLTA 1TVOA 3HMNA 5CYIA 4EOSA 2GWRA 4JS8A 3KC3A 4R5SA 2O0YA 3Q04A 3AT2A 2XIXA 3IECA 4F9YA 1GXQA 4R7IA 3DB6A 5FUTA 1FWZA 2R3LA 2QBYB 3GEZA 3NMUF 1HBXG 3FE3A 1IAJA 1RZ4A 5DRDA 5ACBC 3VUDA 4MWIA 5JGDA 4ZSLA 1YHVA 3OBJA 4JLCA 5CS6A 3GOPA 5E8XA 2H96A 2OJ9A 5EDQA 3HV7A 3OCTA 5D8LB 5EHOA 1OVEA 1O6YA 4RIYA 1PXIA 3LIJA 3HUCA 4NEUA 2W1HA 1VTNC 1X3UA 4GSBA 1P4AA 1DAWA 3VRZA 2Z7SA 4S33A 2W0JA 5F94A 2LF7A 1H8FA 3OCSA 3B02A 2DFIA 3UTOA 3GQLA 4YZNA 1S8NA 3K69A 3H9RA 3ERED 1YDTE 2VV9A 4AT3A 2OLCA 1Z6TA 3FLWA 2Q0OA 2FSOX 4DTKA 3F5XA 2BAJA 3ZQ7A 4FL2A 4I6HA 3IHUA 4BIDA 2HYFA 1I09A 3MVMA 3ROYA 2QO9A 4FEQA 2UUEA 4TW9A 2QHMA 2UV2A 5FG8A 1XSXA 3D5WA 3V8TA 1P5EA 3KK9A 3ROUA 4F7LA 2BAKA 2RN7A 3Q4TA 3CR0A 5BMMA 4O7LA 4CXFA 2OWBA 3I4BA 3OWKA 2AYPA 4KMUX 2WB8A 1OKRA 3BU3A 5AR3A 2I0HA 1J7KA 3CPCA 4TL0A 3E6CC 4LLNA 3SXSA 3TDVA 4GU6A 2WTWA 3AG9A 2UXXA 2WC2A 3QX2A 4FEXA 4ZZOA 4EJNA 4QP8A 1JE8A 4OGRA 3W2PA 4NUSA 2BR1A 2E7WA 2C0OA 4FF8A 4PZJA 2I40A 1MP8A 2HW7A 5AONA 4ON0A 3RNYA 2HXLA 4PDSA 2UVZA 2MA3A 2FSMX 3NSZA 1C0WA 3VF8A 4KIQA 3DPTA 5E8WA 2PMUA 4JDKA 2EXMA 3I7BA 4RAYA 4FTLA 2X1NA 2XRNA 4PY1A 1MQ4A 4NB5A 3P5KA 4IC8A 4TNBA 1B6CB 3DXJF 3UG2A 3F2RA 4RIWA 3LM0A 1WVYA 4WNKA 4FIGA 4M74A 1JOWB 2VX0A 2R5TA 4QD6A 2C5NA 1OKVA 1ZAOA 4JG8A 4LB6B 3ZXZA 1NXKA 2X7GA 3LCOA 4Z7GA 1Q3DA 5E1EA 2J5PA 4DF3A 4RIWB 4AIHA 4P5OA 3R6XA 4C35A 5L3BA 3F66A 4HNFA 5JRSA 2HYYA 1TQIA 4LV8A 4M9SA 5AWMA 4FKRA 4BTFA 5M4FA 5AV3A 5A2QZ 4KIPA 3NEWA 2O63A 1YWVA 3SZPA 3HAMA 2V79A 3FPMA 4XBUA 5I9VA 1OYYA 2PUIA 4X3JA 1SFUA 3ENMA 3TNPC 3I64A 3QTWA 4GFOA 4IJAA 5G6VA 2GHGA 1OI9A 5L4QA 4E20A 4ZYDA 3COIA 3AXWA 4BDKA 2ZJWA 1F3MC 2IVUA 2VUWA 3CQEA 2RF9A 3EQBA 2QOFA 4EOJA 1KYZA 2NAZA 1YXUA 1Q3WA 2JAMA 4YPSA 3E6BA 3R7VA 1YXTA 1E17A 2ONLA 1CSNA 3QPHA 3HMIA 3L1SA 4C02A 1OIUA 4FX3A 3BHYA 4FSQA 3TO9A 4RWKA 4Y85A 3BPVA 3JXWA 1PXNA 2UWMA 3BGZA 4M67A 4BI1A 5EOBA 4U5JA 5KK1A 3TWJA 2X39A 3NR9A 2X2KA 5T6KA 3MQ0A 3F7WA 3SA0A 4LI5A 3OTUA 5A9UA 3F2NA 3PG1A 1TNTA 2HGCA 3AAFA 3ALOA 4L7SA 3O3KA 3NX8A 5DMZA 1UKIA 3IKAA 1OECA 3DQWA 1ERKA 5HG9A 1VZOA 1OPCA 2W84A 4L9TA 4YIIA 2Q83A 3R4KA 2HWOA 4AZTA 1JSTA 3FKOA 3GCPA 2DW4A 3IS5A 2CFXA 5L8LA 1J0RA 2PVLA 3L9NA 4XLNF 4I0RA 2CN5A 4AP7A 5E1SA 3TZMA 2ZM1A 1ZYJA 3BROA 3B2TA 1GY3A 2IW9A 3V6RA 3TUDA 3OTVA 5KKRC 4IXAA 1HQCA 2QQAA 3GQIA 1IF1A 3UNKA 2QENA 4ESFA 3RAIA 2HK5A 2I6LA 3DKGA 1BI1A 4ZSGA 2W4JA 3MY1A 3J80Z 3KP7A 4R1HA 2C5VA 4PTGA 3WZEA 4UX9A 4G17A 4L9JA 2HTSA 4FKJA 3TDUC 2CNUA 3UQCA 3VS2A 3UPXA 2W25A 3DEUA 3DKWA 3EFLA 3ZMZA 4IC7A 1W98A 5IQGA 3O51A 1SVEA 2FO0A 5F1ZA 3HA6A 4ZMEA 3DBQA 3ANRA 4LUEA 3ACKA 5KMKA 1XH4A 1AWCA 5LARA 4G1WA 3R04A 3RPVA 5EW3A 5A14A 4FV0A 3KY2A 3VOEA 4RB3C 1Q8WA 3GUDA 4JDHA 3OY3A 5FLXK 3QA0A 5HE3A 3PSBA 4EV0A 2LSOA 2OF4A 1FZPB 2XK3A 5HLIA 3R1YA 2B0LA 4HVIA 1H26A 4A4OA 4F7ZA 4HCTA 1UKHA 4BHPA 3NNVA 4GO1A 5EW9A 3J81K 5J87A 3DTWA 5CAVA 2QOLA 1P2FA 4QP4A 2QO2A 1OL2A 3Q5FA 3VULA 3UIXA 1WBTA 4EHEA 4YJPA 4JG6A 3QGWA 3H9OA 5LLQA 4G34A 2ZJ2A 3MW1A 3FY0A 1K3AA 4FL3A 2K02A 5L2SA 1U59A 4ZYEA 3RK9A 3V5PA 2VC1A 2V62A 4WX9A 2VBXA 1IN7A 3OOPA 2VO7A 3BLRA 2VTPA 1T0FA 4QQJA 4DGOA 1K78A 1KU9A 3QYWA 4TY1A 4E4MA 2C68A 2L4MA 5FM3A 4F6SA 2PZYA 2QU5A 4EBVA 5CT0A 1G4DA 4ID7A 4IFCA 3WZJA 4EK4A 3HMPA 1B9NA 3KVXA 1XQZA 4II5A 2ZO4A 3T1BA 5IQAA 2QOQA 4O96A 3OWLA 4GJ3A 1S3JA 3UO5A 5ILVA 1BI3A 5JQ5A 3W2QA 3CE3A 4B7TA 5IUIA 5IDNA 4DTBA 3WOWA 2XF0A 4LGHA 4ITHA 4QOXA 2W5BA 5KBQA 4I5CA 3TJCA 4YUQA 3JAMZ 3PXYA 5F1RA 3PSDA 5FD5A 3G9LX 3A7JA 1QNTA 3PSCA 5K5RA 5AP3A 3RKYA 2F57A 4ENKA 4AS0A 4GG7A 1SD7A 2EFPA 3QD0A 4V0GB 5JT2A 1XCVA 4LRMA 2OZAA 2VNYA 4DGMA 1S6LA 4F1MA 2DS1A 5DT0A 3H0YA 4UXQA 4RB0A 5JRQA 4RJ3A 4EBWA 3GEQA 3V51A 3QRTA 4D0XA 3FZVA 4AZWA 4JBVA 3GENA 4E6QA 4L18B 3WGHA 2F49A 3R61A 1JBPE 3P86A 5CANA 2IN6A 3K1NA 4FV9A 4R1YA 3OG7A 2FA5A 2L3DA 3C5UA 2VGOA 5HIEA 1D5VA 2RKHA 3OY1A 3BLQA 2OZOA 4FT0A 4QP3A 4OMZA 5I9UA 4ANNA 5CAPA 2HCKA 3FV8A 3BGPA 5LOHA 2QKRA 4PL3A 2EB7A 3QZFA 4PCQA 1BL7A 1W83A 1UHMA 1SM2A 1KV2A 4XRFA 5A4EA 2ZCWA 3BCEA 1ONVA 3UIBA 4U7ZA 2XHKA 5T3QA 2PJPA 1AD5A 4C3FA 2PL0A 3PXZA 1BN5A 3MEXA 4KIKA 3DBEA 3FLSA 5H8BA 4D2RA 4ASDA 3DJ7A 2WWYA 3VB2A 2C6DA 2R64A 2Y7JA 1TQMA 2XNPA 2R7FA 4AT5A 4BDAA 3ZBFA 4ANBA 5KHWA 3LFAA 4CD0A 4CSVA 3ORZA 5LJJA 1WBVA 3RM7A 3MTFA 4L9VA 4NW5A 4YJUA 3QRJA 3UE4A 4TTHB 1DUXC 3GU5A 3ML6A 4RS8A 1YHWA 1UVRA 4QYHA 3ZO2A 2IW8A 4IZAA 4J96A 5IQBA 4UMTA 3R02A 3W2CA 3KB7A 4HQEA 3COHA 4RC3A 2CJMA 4JDJA 1H01A 3OW4A 4DEEA 3DLZA 5LVLA 2HEOA 5EYMA 2YDIA 2H9VA 3U8WA 3T3UA 4L46A 5GNKA 3MH3A 5E17F 3HTUA 3FM3A 4QTCA 3WF8A 3TZ7A 5A4CA 3V7CA 5BS6A 2V9VA 1Y8GA 3SQNA 4YLLA 4FOBA 2B9IA 3QTSA 5B2KA 4ZLYA 2IW5A 4KIKB 2YACA 2OF2A 2XNEA 4UEUA 2FA2A 3GP0A 3FM5A 4I5PA 4KN7X 4FTKA 3HMOA 4XCUA 1RUOA 4L00A 4W4WA 4ZY4A 1FX7A 4LRKA 3PY0A 1J75A 2OI4X 3BJAA 4WSQA 4BICA 4P5QA 3CGFA 3DZQA 1GXPA 1OPLA 4AGCA 4UY9A 3F5UA 5DCMA 3QKMA 4CG9A 4OINF 4RIXB 2GQSA 3BWFA 1OPKA 2EUFB 2EV5A 2XB7A 3AMBA 4DC2A 3TEIA 4KIBA 2OXYA 4DG3E 5HS9A 3J7AO 2BE5F 5DUKA 4U8ZA 3F6OA 4YJRA 4O5VA 4M66A 3MPTA 4U45A 3VQHA 4JR7A 4GVJA 4N9HA 3R9DA 3UBDA 2C4GA 3ZONA 3QHWA 4TYHA 2JIIA 1ODDA 2GIVA 4E5WA 3C13A 5DN3A 4JQ7A 4BY9E 4GIIA 4L01A 3HL7A 3LA3A 1YKRA 5L3FA 5AP5A 4ZEGA 4UZHA 1OB3A 4BDFA 5IZFA 2K4JA 3ZS5A 2X6EA 4HF0A 5A4TA 4XX9A 4OW8A 4RT7A 1WRJA 2ZDTA 2VODA 4S2ZA 1HW2A 3E64A 1JWHA 2XRUA 4ANQA 2RG5A 1U5TB 2C1AA 1TNSA 4U42A 3UQGA 4XG7A 3SGCA 4DA5A 2ITUA 5HLHA 3CC6A 5LMBA 2YCFA 3HZTA 3G0FA 3PXFA 5CEKA 4TRLA 3R71A 5IA5A 1NT2A 1JSUA 4X3FC 4CFXA 3D14A 3VS1A 3KXXA 5FTQA 2BROA 4C2VA 2XV4S 4BN1A 5HO7A 4G3DA 4D1SA 3C7QA 4USDA 4MCVA 4KINA 5HBJA 4KDPA 3LQ3A 2FMYA 4JDIA 2KKOA 2X6DA 1JNKA 4IPAA 2QOHA 1ZGJA 3ROCA 3P9CA 3OV8A 4D0WA 1YDSE 3V8WA 4OBOA 3A7IA 4F9WA 5DR2A 4ZYHA 2VT3A 3GB2A 4DFLA 2UW0A 3R2YA 3ZEPA 2ZNZA 4NHJA 3CO7C 4ERWA 5LMAA 5LGTA 3PG3A 4IIRA 1O3RA 3PY3A 1T6SA 2OZAB 4YJTA 5TRDA 2XASA 4OAVB 3RYRA 3BV3A 3D7TA 3CKXA 1URWA 5C01A 4E6AA 2P4WA 4U0IA 3A8WA 5B0XA 3GU6A 3EKKA 1YXXA 2CO5A 4XS2A 3VS6A 2A69F 5LXMA 3EFJA 1OIQA 5DH3A 3MB7A 1BI2A 3L8VA 5CEMA 2XJ2A 3HV3A 1XCBA 3BY6A 1IW7F 1YWNA 3HV6A 3UOLA 1F5QA 4PMTA 4I21A 2JZYA 5LGUA 3ZDIA 4AAAA 2WMTA 2R7BA 3MPAA 4FX0A 2G2IA 2XROA 5HD4A 3Q52A 3GFEA 4E73A 4BDHA 3SRVB 2F5DA 1R1VA 5IQIA 1OITA 4EM0B 3BOQA 1ZH5A 3RKWA 3ORIA 4B4LA 2MD5A 2VTRA 2YIQA 3QQJA 3DBCA 3PJ3A 3IW6A 5KMNA 3O0GA 1JXSA 4G3EA 3U4UA 3N4UA 4HYEA 4QYGA 4BZNA 1PDNC 4ENNA 4CCBA 1ZG5A 2BRHA 3POZA 5ANIA 1FVRA 4ANLA 3VUTA 1UU8A 5AP0A 4LMUA 4Z3VA 4Z9LA 4IHSA 2GHLA 2RFEA 3DA6A 3FSFA 4U40A 4YLKA 4C4EA 2ZAZA 4MAOA 2JGZA 5CI6A 4BKZA 3L9LA 4C36A 1SD6A 3KXZA 3I6WA 2PE0A 4PDPA 4QLCU 3FWQA 2Z7LA 2X4HA 5FBOA 2FMLA 2D45A 2OIDA 3I7CA 4FTMA 4BHNA 3MFSA 3F3VA 5JFSA 1B39A 4WSYA 4RGSA 3C5IA 1SD5A 1U54A 3TXOA 3E93A 2AXLA 2QONA 3T0YA 5BPIA 4O0RA 1PKGA 3TL8A 5HE2A 1JVPP 4WUAA 1LJ9A 2J5EA 1FLIA 5FP5A 4BCMA 4FYNA 4G6OA 4LQMA 4L8MA 4CT1A 5ERIA 3QAME 4L45A 3OT8A 3R9NA 3FWEA 3E8EA 4LM5A 3ORNA 4ASXA 3F3WA 4XG3A 2YLFA 5FLXZ 3F6XA 5KBRA 4U0VA 4WHZA 3LXPA 1OKZA 2PE2A 3TOAA 2HKOA 2M1BA 4OLIA 1R58A 1UU3A 1UWHA 3KP6A 2J0JA 3TKUA 5CEQA 5JMSA 2RDPA 2OK1A 2W7XA 3KULA 4QNAA 4AQCA 4EMSA 2J0KA 3KXMA 3C4CA 3PPKA 4XJ0A 5EHLA 4FEUA 3FHIA 3CY3A 5EDRA 2P6TA 3PJ1A 4BWPA 2XRWA 3UPZA 4TNDA 4FG7A 2REIA 4E4NA 3PIYA 3IGGA 1O3TA 1QPJA 3LAPA 5HI2A 4NM7A 4RPVA 2BVAA 1DPRA 4L9NA 1T2KA 2B0QA 3SG8A 4EORA 3WU1B 3L09A 5AJQA 1WCCA 3DKOA 2JSCA 2VXZA 3NYXA 2A4LA 3ALNA 5HLPA 4WG4A 3P7BA 4A9UA 4DT9A 2ITWA 4O38A 5L2TA 2V22A 2MLGA 4RIXA 1CGPA 3RHKA 2QNJA 3QUDA 2WTEA 3QALE 1ZHFA 3OVVA 3VIDA 3QFVA 3GI3A 5IH4A 5GJGA 2Y4IC 3WI6A 4F6WA 3U6HA 3QQUA 2QYOA 3VBQA 3JAMK 5G1XA 3EL7A 4F65A 2J0MB 5CI7A 3KP3A 2OJIA 3QQGA 3JY9A 4AUAA 3NW6A 5BUEA 3AC5A 1P6RA 2H8HA 2LAVA 5GIPE 2RV8A 3QXOA 3PDTA 4F09A 5FO5A 4YJNA 4QP6A 4DFZE 3S2WA 3FZTA 5DYJA 4ETSA 2E9NA 3QC4A 5IEVA 2GNFA 2YIYA 4M69A 2JTVA 4DNCA 1WZYA 3RM6A 2WMSA 2YIWA 4H3BA 1I1GA 3EN9A 4AGUA 4D4VA 4FR4A 3IW5A 5E8SA 2PPQA 3C4ZA 1WBPA 2JC6A 2Y0MA 4YMJA 4M8TA 2HS5A 4LB5A 5FEEA 2YM5A 5D6EA 1OIRA 5BQTA 1SFXA 3VJNA 3RZFA 1D3YA 1YS6A 3DKCA 1IN5A 1TW3A 4DH7A 4KUJA 1FQ1B 1U54B 3HRMA 1HXDA 2VOPA 3F9NA 1R5HA 4FKWA 2WQOA 3UVRA 3B8RA 1Y91A 4JR3A 3U6IA 4NL0A 2JLDA 2CKPA 2YEXA 3U1DA 1XBCA 2PZRA 3QQHA 3GYHX 4K8AA 2G7HA 3RZBA 4K18A 2EXCX 1YW8A 1XGNA 2ERZE 5C8NA 4ZSJA 5J8IA 3CUQB 2KJCA 3JYAA 4YTFA 4QYFA 3L7WA 5M57A 5DD8A 4A9RA 1B4AA 4TXCA 5I5ZA 3UMWA 4B9DA 3VUIA 3ZC6A 4J71A 4WG3A 1XN7A 2CKOA 2DU9A 3OXIA 4BQAA 2HZ4A 1IA8A 2ITTA 3P9JA 4QMXA 4F9CA 3HDMA 4BTJA 2YDKA 2ZMEB 4F7SA 2XM9A 2OU7A 3QHRA 2BRGA 4QTBA 1IZ1A 2E9UA 5AP1A 3HSRA 4BCIA 5HNIX 3QU3A 1PKDA 4C4FA 3FBVA 4M0ZA 2J0LA 4L68A 2PMNX 3KCFA 4FTUA 3FZOA 4W4YA 2F5EA 4KWPA 3V4GA 1WSUA 3E7OA 2BKZA 3LAJA 2R3HA 3SRVA 4CZTA 5BYZA 4FBXA 3J81Z 1OUYA 2UW7A 3MTLA 4QP9A 3D4QA 5CU4A 2W1FA 4O2ZA 2Z7RA 3LCKA 4RC2A 4FSNA 2WOUA 4FKPA 2I7QA 2ITYA 4CYJA 3VVHA 1UFMA 4GT3A 2E2BA 3I0OA 4BTMA 4NIFB 4GMYA 4MK0A 5JGAA 3QF9A 2E9VA 4BTKA 2NPQA 5AUUA 4LOQA 3E7VA 2OGVA 1NHAA 2NRYA 4UV8A 5HNBA 4ACMA 4FKSA 4QMSA 2XEYA 2DUVA 4PDOA 4QO9A 3IWFA 4FT5A 5TKDA 4ARKA 3DY7A 4N6YA 2QKWB 3EETA 2PSQA 2VWXA 3WYYA 2HQRA 2J5FA 2VX3A 4PP7A 5BMZA 2PK9A 5D1JA 3LFKA 5FRIA 2VE8A 2YITA 1ZN2A 2QCSA 2O65A 2P2IA 2JEDA 3EQFA 1UB9A 5KKRB 1QL6A 3UVQA 4BBEA 3HAVA 2RVCA 4XH6A 4H1MA 5D9HA 4A4LA 3FXUA 3ERKA 3CJNA 2UZLA 4MEDA 4IJPA 2VT2A 4DQ2A 2Q2EA 1S7AA 5E8TA 2FQ3A 2OJGA 3G2FA 4O7SA 1E1VA 4CV8A 3Q4UA 1L3LA 3HOSA 1MUOA 4QPMA 2BDJA 5KE0A 1KE9A 4D5KA 4TYHB 5J8CA 3U51A 4BYJA 3ZMSA 3AQVA 1DI8A 4GKIA 1Y6BA 3H3ZA 2P5LC 1BMKA 4PRJA 3WIGA 3MS9A 4KNYA 5FTGA 4A5MA 3A60A 3Q9WA 4EYMA 3R8PA 4KMFA 2Y6OA 2VZ6A 2B52A 4L44A 2HDCA 3C4XA 4RSSA 5JN2A 1K7AA 4C4GA 3LXNA 2QODA 3MH0A 1FVTA 3K2ZA 4B6LA 4I6BA 5HCYA 3FZ1A 3QRKA 1FYKA 4A6EA 5LGNA 4D2PA 4IAAA 5EYKA 5IA2A 3TUCA 4ZJVA 2XKCA 3SHEA 2WGJA 3DDQA 1IN4A 3F3XA 3C1DA 5E8GA 5IT3A 2W85A 3VBTA 5DR9A 3COMA 4IAFA 4F7NA 3GBZA 3N4VA 3ZOSA 1UCRA 1FY7A 1EH6A 1YQJA 3Q4CA 3AC1A 4V05A 3B8QA 4LD5A 1K9AA 3GGFA 3UNJA 3LFEA 3RCJA 4L43A 1V0PA 1IRGA 2UXNA 3MFKA 3I53A 3PZEA 3VS3A 4E3CA 3UOJA 4I98B 4BYYA 2UZKA 5IG1A 4JJRA 4H05A 1U4DA 1WMKA 1OL5A 4FVPA 3DV3A 2PZPA 1G3WA 4AW2A 3ZRLA 4R77A 4FKVA 4I01A 2DYLA 4FKLA 3ECOA 3UOHA 4ANOA 3P08A 4IRGA 2JITA 2RFSA 2LF8A 3OEFX 1YFHA 1ZREA 3TM0A 3I59B 4JAJA 4DT8A 3LQ5A 1XGSA 1UNGA 2PU8A 5HG5A 3DK3A 4FNYA 5C03A 1Q8TA 4V01A 4OR5A 3FQSA 3GFIA 3RPOA 2PQ8A 3IW8A 4BF2A 4AA5A 2J5OA 3GF2A 2YJSA 1XH7A 3BWJA 3FSKA 3KXHA 4P55A 4G94A 5BVFA 4AA0A 4U6RA 5HCXA 5HD7A 4I1ZA 4ONAA 4RQVA 4EK8A 3A99A 2NNNA 5EEGA 2W1GA 4UYAA 3ZMTA 4O0XA 2CSOA 3TNWA 4DH5A 2BCJA 4UVAA 4OAUC 3W2OA 3CY2A 4F9AA 1JKSA 3F8NA 3AT3A 2AC3A 5ETFA 4YTCA 3BELA 3A2CA 1FBSA 3VUGA 3QC9A 3LJ1A 2QI8A 4IB1A 2QVSE 1W7PB 4QTAA 3BEAA 5KCVA 3RAHA 4DGLC 4IZYA 3ZSHA 3MZYA 3G5DA 5LMKA 3ULQB 2CCIA 4M97A 4CEGA 1FINA 3NZ0A 3PQKA 3RWQA 5AR4A 3QUEA 4GGGA 2GFCA 4DHFA 2W4KA 3QXPA 1YI6A 2C30A 3NS9A 4WA9A 2XK7A 5CEOA 2P2HA 3HGKA 4FTNA 3ZFXA 2CN8A 2XJ1A 1DM2A 4D1ZA 5AUZA 4Z2YA 3OUKA 4HQMA 4DLIA 2J6MA 1KGSA 5HOOA 3VBWA 3IG7A 5E91A 3L8SA 2W1CA 4AE9A 2YERA 2WTCA 5LVMA 4EM2A 1AOYA 2J51A 3BQRA 2MC3A 2CGPA 3F6VA 4J8MA 3CGOA 1J7LA 1PXMA 3HUBA 2R2PA 3LA7A 4EHZA 2WTJA 1WVXA 3VN9A 1ZG1A 3QRFF 4FIJA 3DAJA 2YISA 3OZ6A 3KF7A 4ZSEA 1SFEA 2VD5A 5IUGA 4IVDA 5M51A 2K4BA 2PWLA 1L0OC 4MHGA 2XAHA 3KFWX 4BXUA 4OUCA 4DEBA 2BYVE 4IRHA 4D4YA 2OICA 4DAWA 2HY0A 2R3GA 3O17A 2O61A 3THBA 4WXDA 3RWPA 3O2PE 5AEPA 3TDZC 1HSJA 5D41A 4IB3A 4EOOA 2EA4A 2IJMA 1PXLA 4BCPA 4IFGA 4C37A 2I1MA 3MPMA 3KK8A 5JGBA 4M9XA 2OBPA 3FZSA 1X8BA 1R5GA 3U9NA 4BVUA 1Z57A 2J90A 4Q5SF 4Q9SA 2YM7A 4HX8A 2Y6MA 4JAIA 4EJOA 3ELKA 2CNQA 3MFRA 3PVBA 3W33A 3MY0A 1CMKE 3E6DA 3MI9A 4ZTLA 5TE0A 3R01A 2EWAA 2F4JA 2O3PA 3TKIA 2ZB0A 3BYMA 5FD6A 3BBWA 4AW0A 3JR1A 3IONA 2PYWA 2WO6A 3OS3A 1RQQA 2A6HF 5FTOA 3EYYA 4AW1A 4GT4A 2HZIA 3VW6A 3KFAA 3PA4A 4ZZMA 3E6MA 3FZPA 4AIKA 4UMQA 5C4LA 3IK3A 2G15A 3H10A 2R3JA 3O2MA 3WTUC 5CQWA 3QAHA 4FKUA 3LKMA 4ZP5A 3FX3A 3ZDUA 1V1KA 3A7FA 2W9FB 2O5KA 3MJ1A 1FYLA 4I93A 4O7NA 4I5HA 1SD4A 1GIJA 4EWQA 2BIKB 3ULZA 1WBWA 3BLHA 5IA1A 1JPAA 3HNGA 3PVWA 4S04A 4BBMA 4G9RA 2DO7A 3MJ2A 2VTAA 1FPUA 4RVLA 1B38A 4BHBA 2EK5A 4UXLA 2HENA 3MA6A 1O3QA 3FPQA 3EDPA 2B55A 2P3GX 3QLFA 2ZMEA 4G2FA 5M4IA 1R78A 5CU0A 1U8RA 1AGWA 4M72A 4NW6A 3LWFA 4UB7A 4BHZA 4MKCA 1CKJA 5AR7A 4XG4A 4FGRA 3FXQA 4AT4A 3VRYA 1MKMA 4ZH4F 4IM0A 2RGVA 4MD9E 5CF8A 5EM8A 2GAUA 5LBQA 5IQCA 1WBNA 2ACJA 3QTUA 2JDSA 1H27A 1ATPE 3RPSA 3TIZA 4BYIA 2G1TA 4E4XA 2A0CX 5DWRA 3FMRA 4R3RA 1P4FA 2GXGA 1OIYA 2JBPA 3QRUA 2CCHA 4BDDA 3Q6UA 3A7GA 5CAUA 3QL8A 5J9LA 3QLGA 3IKVA 4GW8A 2WEIA 3PPJA 5CVVA 2J50A 4UNOA 2GS6A 4CDGA 1HKTA 3VW8A 3RI4A 4FI1A 2Q0NA 2WQBA 4OIOF 2ZV8A 1O57A 3FLYA 2VWIA 4B09A 3WGGA 4CYDA 3QUPA 3NEUA 2BILB 4KBKA 3R9OA 2VTQA 4NCTA 3WZKA 2C6OA 2BBYA 3BX5A 2GFSA 4TT7A 4NWMA 4L0YB 2ZYBA 2QO7A 3EQHA 2O8XA 1J7UA 4CZZA 3MVHA 3ANQA 3OXTA 3LHJA 5HVJA 1YIOA 2J7TA 4Y83A 1PXKA 3ZUTA 2PUUA 3DOGA 3D83A 4UWYA 4XV1A 1M17A 2UVXA 4XV3A 4S32A 1U6GA 4XP0A 4RX8A 5EKNA 4PMSA 2RFDA 3TTIA 5BUJA 2W57A 4KICA 4ZJIA 1ZRZA 3NIZA 4IVBA 4H3PA 1H08A 1W5SA 3UJGA 3IRQA 3CD8A 4A9TA 4BCNA 3KU2A 1T38A 4H3QA 4YJQA 3LFNA 3R8ZA 3R30A 3KREA 4CKRA 4O82A 5DCMB 2CKQA 3F5PA 2FUMA 3M2WA 5AUWA 3OFMA 4H36A 3OROA 4YP8A 4M6YA 3RBWA 5JZJA 2VN9A 2OFVA 2OKRA 2GQRA 4EJVA 4CTBA 5LHHA 1YWRA 1F4KA 3FF5A 5AR5A 5HIDA 4AOJA 5GHVA 1S7OA 3P79A 2M5WA 3ZRMA 3KP2A 5M55A 2W24A 5AUYA 4S05A 3KEXA 5ANKA 3KULB 3QCSA 4K0YA 4X2FA 2PUNA 4RJ5A 3KMWA 4NTSA 2D1VA 3P0MA 3IDCA 2C6KA 5F9EA 4CFWA 4NYEA 4MEYF 1I44A 4OTDA 2DPDA 5K3YA 4EC9A 3OHTA 2YFXA 4WBBB 1IR3A 4QQCA 5LEKA 3NUXA 5D5VB 1R3CA 2IT0A 3OT3A 2PVHA 1J5YA 4DGNA 3LFQA 1G3TA 4R5YA 4IEBA 2JKMA 3MFUA 5M09A 2GNJA 4RVTA 3O6BB 2YDJA 5IMXA 3TACA 4F63A 3QCYA 4OBPA 3ECHA 3UP7A 2ZFWA 4N57A 4Y95A 4C58A 2CGUA 2HTJA 1PXPA 5AIPA 2ZV9A 2Y75A 3FZRA 2WMXA 3EL8A 5CZIA 2C5OA 3FMJA 3ZMVA 5BVEA 3I1AA 3R9HA 1YVJA 4AVPA 2WIHA 5HDNA 5K5OA 4EH6A 1PMVA 3OW3A 2CKEA 3CKWA 1KQ0A 3EN4A 5CVJA 4AU8A 1YOMA 4X21A 2W17A 1H9GA 3QZGA 4IX3A 3VC4A 1O7FA 3BHHA 1ZYLA 4G6LA 1IRKA 5AX9A 3TUBA 3WF7A 2PUPA 3ZO1A 2OH4A 4DEIA 3SHFA 2Z9OA 4UWBA 4ENJA 4UWCA 4IVAA 3F8FA 2BZKB 2KULA 4CV9A 5CJ9A 4HF2A 5BYYA 2QQ9A 2QM3A 3HHHA 3RIRA 4GYIA 3PYYA 3QOPA 2R3FA 5HU9A 5EDPA 2DWBA 2EFOA 3FMHA 3P7CA 3MY5A 4BCGA 2Q0BA 4N4SA 1OGUA 2IZTA 1O9UA 1KE5A 4BBFA 1F1ZA 4C33A 2C3JA 3GFMA 1P4OA 4MNEA 2BFYA 3C3WA 4K6ZA 3F82A 4I5MA 4E4LA 4MEXF 4XG2A 1W7HA 3SC1A 2XVDA 2R3QA 5EKOA 3LAUA 1LR4A 4R3CA 4DG2E 1UWJA 4UXNA 4MXYA 5DD4A 3HTSB 4E5AX 5A6OA 4CMTA 3QWKA 3GCUA 2UW6A 2YX4A 3BYOA 3EYHA 5E1WA 1IASA 4JVGA 2K7LA 4G9CA 3FKNA 5J79A 4NJDA 4W8DA 1D8KA 4RBLA 3JPVA 1KU7A 5EI8A 4CYIA 5LCKA 2XAFA 1YHSA 4ANSA 4EK3A 3JTGA 5LQFA 2XKFA 4BAYA 3HHGA 3BKBA 3GLXA 5D6FA 4EH5A 3OOGA 4XNEA 2YWVA 4HZRA 2JFLA 3GZ6A 4OT6A 4B8LA 3I58A 3UZRA 4YTHA 3UP2A 2X2LA 1RW8A 2W1ZA 5J9YA 3KMUA 2FXAA 5CVUA 3LFBA 4G5PA 4DN5A 2ITQA 2ZOQA 1YXSA 5KNJA 4QMWA 1QZZA 4RJ7A 4EOIA 5JI6A 3AMAA 4RZWA 2VTNA 4YSMA 1FGIA 4Y72A 4I6FA 3HEGA 3U6JA 3KKVA 1XGOA 3FI2A 3C9WA 3I5UA 4JBOA 4X2KA 4YZDA 2HOEA 5CSWA 1V3FA 5A46A 5C4KA 3PLSA 3RTRA 2YX7A 1K79A 4K33A 1H0WA 3OMVA 2GNLA 5CSVA 4IBMA 5E7RA 3F61A 5D7AA 2QBYA 1J1CA 3OBGA 4GCJA 5CLPA 4XOZA 2G9WA 4C2WA 3RAKA 5DCFA 4AGWA 3P9IA 3K2LA 3VWAA 1Q4LA 2UZVA 4B99A 4LGWA 3IW7A 1ZG3A 2ESNA 2V6CA 2C47A 5AADA 3UNZA 4X2JA 2RNJA 2R3OA 4FODA 1Z1DA 4FUYA 2P7CB 3NVKI 4FNXA 3VUKA 2XBJA 4YJOA 4W4VA 5J8FA 3HV5A 2WIPA 5FQDC 1R7JA 4IW0A 3H92A 2E9OA 1YOJA 3NUSA 3KLOA 4E93A 3NWWA 5IISA 2ZMCA 3CLOA 3D5XA 3HX4A 1IAHA 1QPDA 2D1HA 3GNIB 2A68F 3VO3A 1SMYF 1J3HA 1HKQA 5FFXA 2OJFE 2VWBA 3Q4ZA 4YZMA 5IQHA 4F99A 5LHIA 4LV5A 4YBKA 4FT8A 3QD3A 4JG7A 4NH1A 3F3UA 4G3GA 4U44A 1OPJA 3GU8A 4M6XA 4A0YA 2COMA 1H0VA 4Y73A 1LEAA 1W84A 1ZYSA 3PFIA 3CS9A 3TV7A 4JT3A 3K3IA 2XK4A 4QMQA 4EK6A 4RJ8A 3S00A 2A61A 4YNEA 2QOCA 4MXAA 2C6MA 2PFBA 4BNCA 3DK6A 4WUNA 3A7HA 4KS7A 1GZOA 2R4BA 3I54A 4BHCA 4CMOA 4FC0A 3NUUA 2X0GA 2FNPA 3TZ9A 3SAYA 5BVDA 3ZEWA 5DNRA 1YQAA 5H9BA 2DI3A 4TYJA 3ZN0A 4PPAA 3R0AA 4FV8A 2C0TA 4AF3A 3NPCA 3DCVA 2E9PA 4YR8A 3CCNA 2QG5A 4B8XA 2QOKA 4FIEA 3WF6A 1L3RE 3M8FA 3V7RA 4ZTHA 5GINE 2X8EA 2M8EA 4J52A 2VN2A 2EB2A 2F5CA 4I4EA 3ZLWA 3E5QA 2VNWA 1ZWSA 3G33A 1KOBA 5K0KA 3SXFA 5HE1A 3ZUUA 4AW5A 3QZIA 3CUQC 5IDPA 3V7SA 1S9IA 4CFUA 4APPA 2IZSA 4FSYA 4YZ9A 2GCDA 4IM3A 4ZMFA 4TV7A 5FDXA 3N9XA 3SZTA 4OIRF 2ZBKA 4EH3A 4EHGA 3H30A 4JX7A 4KKGA 4P96A 4AN3A 4JQFA 4BZOA 4E6CA 5D5XB 4O21A 3KRRA 1ON2A 3FI8A 1LB2A 3W10A 1WKMA 3EWHA 3ETAA 5I0BA 3WYXA 2ETRA 4YFNF 2JRTA 1ZMUA 4JX3A 4C0TA 4UVCA 3EN7A 3WF5A 3DP7A 3WODF 1B59A 1RNLA 4X2NA 4JQ8A 4XBRA 3TKHA 4FT9A 3ZP5A 2WMRA 2CLXA 2QQ7A 4PDYA 2ZM3A 1CM8A 4D4SA 1LDKB 2TDXA 3K5VA 4C61A 2W96B 5IF1A 3RDIA 5AM6A 3QP5A 4NSTA 3ZN1A 1R23A 1FC3A 4O6LA 3MDYA 2BMCA 2Y4PA 3F8MA 3O8PA 3E3BX 4O6EA 5HVKA 3D2KA 3KQ7A 3HRFA 3HRUA 3CDHA 3WTXC 3EYIA 4ZAUA 4H1JA 2HIWA 1W4MA 4QYEA 1ZLTA 5CZHA 2V0DA 5CXHA 2XAQA 4U41A 2R0IA 4RZVA 5EM6A 2XH5A 3ABTA 1SZMA 5LWMA 2IG7A 4IWDA 1M2PA 1UNHA 2XIKA 2P6SA 2HKXA 5TO8A 3F88A 4IAKA 4X3FB 2F7XE 5AMNA 3UVPA 2UZTA 5DFPA 4X3FA 4CKJA 2QURA 2O2UA 5CAQA 2XZSA 4PQNA 4CZYB 3FAAA 4NIFA 3EOCA 4I0BA 1ZLKA 4MGRA 1XSDA 5DDGA 1SMHA 5DOSA 3I5ZA 1LQ1A 3AMYA 3ZMDA 2RFNA 3FMMA 4QTEA 4TN6A 4QNYA 2BZIB 5AIRA 1JSVA 2WHBA 5IQFA 4M12A 3FMLA 2G2HA 4PX6A 1J91A 2XK9A 1DI9A 4GXOA 2RKUA 3D0EA 3L9FA 5K4IA 4ZTSA 5GZ9A 3HVCA 3FEGA 2Z2WA 2PVJA 4HVHA 3LCSA 3UODA 1SVGA 4CQGA 3O96A 2WELA 2GZWA 4YTIA 1REPC 4ALVA 4ZLZA 2YZAA 1LVAA 2IVVA 3NNXA 4O22A 4LL0A 5L8JA 3H9FA 1VYWA 4FX4A 4YJVA 2P5VA 4EQQA 4IAZA 1Q1HA 1F0QA 1PF8A 3FXZA 5CSPA 3ZM4A 4Z55A 4EYJA 5B2LA 2JFMA 4AA4A 4Q48A 2F2EA 1S29A 4L3LA 5I3RA 4HA8A 3Q60A 2YM3A 4NU1A 3BHVA 4ZTMA 2GPHA 2C5YA 4HVGA 1R1UA 3NRMA 5BVKA 1SNXA 3R7GA 3RKXA 1G6NA 3VBYA 3DJ6A 3WF9A 3ZCLA 1Z9XA 2H27A 2BKKA 2JDOA 3FY2A 1KYWA 5GZAA 3FQEA 4OIPF 4AN2A 4J7BA 5E1ZB 4WBOA 4MF1A 4A7CA 1NA7A 2BHHA 5J5SA 2LDUA 5BVOA 4O86A 3U9GA 2OIQA 4I92A 3LZBA 2WQEA 5AV1A 5H6RA 4Y17A 3SX9A 3HECA 3EHAA 5K5QA 5EQYA 3I5NA 4M71A 3H4JA 3O71A 4RX7A 2OG8A 3P9KA 3CP9A 1H1QA 1O3SA 4FK6A 5I9YA 4HCVA 2C0IA 1JKTA 1XH5A 3KE2A 4ANMA 2Z5UA 4L53A 3LE6A 4YBJA 4M69B 4RJ6A 4IF4A 3RVGA 5CTPA 5HTIA 1IG1A 3W6JB 5ACKA 2FRHA 4ZS4A 4DFUA 3ZXTA 4ZTNA 2E7XA 4JXFA 2ISYA 4HGTA 3M7GA 1K6OA 2UW9A 3VEPA 1XDSA 2ZV2A 5AUVA 1JGSA 2W05A 3R8UA 5D11A 2YN8A 4E6DA 4ZY6A 5L2IA 3VODA 3E62A 3QD2B 2CDZA 4D2TA 3BYUA 4RRVA 2XIZA 4GFMA 1ZARA 1P2AA 2OW3A 1PMEA 5I9ZA 3SW7A 3N4MA 2VGPA 4JBQA 4FA2A 4KNBA 3ORTA 3WE8A 3QTQA 5DGZA 2BTRA 6PAXA 5DEQA 4IACA 2JT1A 1WFCA 5A4QA 2ZVAA 4C4HA 5I4NA 1CDKA 4RVMA 2P0CA 3TJDA 5HICA 4HVDA 4L52A 3I0QA 3E3PA 2XNBA 4DEGA 4GG5A 4FVQA 3NDMA 4U43A 2X7OA 4GEOA 2G01A 3BI6A 3F69A 2YIXA 2SRCA 4KABA 4DFYA 3ZO4A 4IVNA 3T8RA 3VHEA 3C0GA 4J53A 2STWA 3QKLA 2GMXA 4MQ1A 2OA4A 1KOAA 5CX9A 1B9MA 3GC9A 3DAKA 4C38A 4BR3A 3KMMA 3Q3BA 3PVGA 1APME 4TPTA 3M8EA 4YO4A 1HCKA 3F22A 3K0LA 1WBOA 4FK3A 2ITNA 5K0XA 3GZ5A 3R0JA 1YW7A 4CVAA 3M42A 1S9JA 2UW3A 3IPHA 4FIFA 4IMYA 1OZ1A 2VTOA 3UQFA 1J1BA 2VTMA 3VF9A 5AP4A 1MDMB 3TG1A 3HUGA 4GYGA 2J0IA 3G90X 3NUPA 2FYSA 4HDVA 3EQIA 4G6DA 3P4KA 4ZYGA 1ZYDA 2BTSA 2QLQA 2YM6A 4XBFA 1WVWA 1XGMA 3W2RA 3CTAA 4MH7A 3V8LA 4ZZNA 4CICA 3V5LA 3GVAA 2WXVA 3R21A 5DHJA 2DQRA 4M73A 4CRLA 1BI7A 4Q4ZF 3Q9YA 2WU6A 2JDVA 3Q96A 3UGCA 5HO6A 3WTSC 2CGVA 3D7TB 3F7ZA 1OL6A 3IOKA 3LMIA 3CJGA 5I3OA 5M56A 3F21A 4MBIA 3GXOA 3EJ1A 4QP1A 4PGGA 5HQ0A 5GZ8A 2HY81 4BIEA 4EZ5A 1FP2A 3DS6A 1V0BA 4UBAA 5HX8A 4A0ZA 1OBDA 4OTHA 1MJ9A 2EU9A 4PF4A 4RGXA 2QOOA 4DG0E 1NY3A 2A19B 4G6QA 4FV3A 4F08A 5D8KB 1GAGA 4UVBA 4IADA 3RJPA 4ENMA 1W0XC 5IEYA 5AAFA 4IWQA 5EM5A 4HCUA 5BOXA 2C6TA 1H1WA 3SV0A 2E1CA 2YLEA 4EOLA 1G3SA 4QMLA 2BUJA 3MIYA 2FBIA 2PHKA 2W4OA 5D5WB 4FV7A 1H24A 3I6UA 4HX7A 4YC8A 3UIMA 4BCKA 3SXYA 3QQKA 3CTQA 4RVKA 2FE3A 3ZRKA 4ERKA 3NYNA 4QPSA 2Y0AA 4HLYA 2BFXA 1XHAA 1SAXA 4YLJA 3D9VA 3OUNB 2P4IA 5TOZA 4FTCA 3SOCA 2H6CA 3BDDA 2PBIA 4Q5HA 4YU2A 3SKCA 1U5QA 5A54A 4J99A 3C18A 3HV4A 3WARA 4V04A 3F8BA 5H2UA 5L2WA 5AA8A 4CTCA 2Y9QA 1USSA 3W8QA 4KS8A 2YIRA 1Q61A 4A9SA 1A48A 4P9FA 4D2WA 4X7QA 3MV5A 4ZLOA 3Q32A 2YABA 4G5JA 2XYUA 4QWQA 2ESMA 3LMHA 3ODZX 1R1WA 1XO2B 2L4AA 5FXQA 1TW2A 3T8TA 3BGQA 2DPUA 4FV6A 5F20A 2PVNA 4XP2A 1A04A 4I22A 4BGGA 4JRVA 4FKTA 3NYOA 3I0TA 2OSCA 5AAGA 1DP7P 1FBUA 4U79A 2Z60A 2O3FA 1R0EA 4BDCA 3IKTA 5E18F 2VWZA 3Q2JA 5AIQA 4IJ9A 4FTQA 4D28A 4QT1A 5DI1A 3ATSA 5CEIA 4WRSA 3V01A 2W1DA 3HOTA 5AFVA 2ITXA 4NTTA 4JIAA 4LLLA 3O8UA 2VAGA 1YOLA 1ZYCA 2GTNA 4M68A 4RA4A 4F7JA 3IDBA 1R39A 3DJ5A 1P4XA 2PMHA 3KVWA 3R7OA 2JDRA 3RJCA 4ALWA 4DH8A 3RNIA 5C27A 1KE8A 4EWHA 2UZOA 3E5XA 1QMZA 3DLSA 2VTJA 4CLJA 4EJUA 1WQ2A 3W18A 5ITAA 5IA4A 5BX0A 2QR7A 4HBLA 4EM1A 2C69A 4AZEA 4EHVA 5J1WA 4N0SA 4V0GA 3P78A 4GFGA 1DPUA 2PULA 4A0XA 4R1VA 3GC8A 5HVYA 4OTFA 4HPTE 1RIOH 4FZFB 4LOOA 5KX8A 1XMAA 3DFAA 3GC0A 3MVJA 3PE2A 4C3PA 3M1SA 4CQEA 2JDTA 4LFIA 4Y13A 5LHGA 5KMJA 3D5LA 1PMUA 2HQNA 2W1EA 5CSHA 3LFFA 1KUTA 3BP8A 2YSRA 2Z99A 5IA3A 3R1QA 2GNIA 1QQIA 3ZUVA 3E8DA 5M44A 2YCSA 3HRTA 2X8DA 4I41A 4O27B 4ZY5A 5JFVA 2C5XA 2PVYA 2WPAA 3Q2MA 4KKHA 3PJ8A 2DK8A 1FPQA 3RPRA 4MTEA 2C3IB 4TWCA 3JUHA 2AC5A 2WOTA 3DAEA 1TKIA 4QMYA 4ZJJA 4FHTA 4GIHA 5ILUA 4FL1A 4FSZA 3DZOA 2DT5A 3H0ZA 2LNBA 2WTDA 3D15A 3FMNA 1SVHA 2W5AA 4DITA 2GA1A 2F2UA 2V1XA 5JFRA 2VTIA 1BL6A 1CKPA 1Z7UA 4A4XA 3I4PA 4ITIA 4XMOA 3EQDA 5EQEA 3RGFA 4OBQA 1OKYA 4XLIA 5TF9A 4P4CA 5CXZA 3FJQE 3DKFA 3QBNA 1LNWA 5IUHA 3PY1A 3ZHPC 2ZDUA 4TKSA 4FYOA 4A07A 1TTYA 2WNTA 4M84A 3M11A 2BHEA 3ZFMA 2C6YA 3LPBA 3D0SA 1VYZA 5TJJA 3REOA 4ACHA 4N6ZA 3DNEA 3WTTC 5L6WL 2Y48A 1GJOA 4I7HA 2ERKA 2EFWA 5JR3A 4ZZLA 3UMXA 4BDBA 5H6QA 5E8YA 2CMWA 4TWPA 2V55A 2HZNA 5EM7A 5HORA 3NAXA 4KBCA 3DDPA 1MJBA 1UNLA 5HKMA 2Z02A 1BC7C 1ND4A 3LSTA 4KBAA 3ATTA 5FEDA 4RJ4A 4KFCA 5ETIA 3KRJA 4HLXA 2YWPA 3OXZA 5HOAA 4QMNA 4QMZA 1JQHA 4IX6A 3EN6A 2JD5A 2R3KA 1CKIA 5CU6A 1Q8UA 3B73A 1F9NA 4Q5EA 2YU3A 3F5GA 1IN6A 2RC4A 4WNMA 2I0VA 4FSUA 3CUOA 5HS8A 3Q9ZA 4HGSA 3PWDA 1XH6A 4DGGA 1OUKA 3C50A 3ZLXA 4FEWA 4O7RA 4BCQA 4R7BA 4NKAA 3E5UA 4XV9A 3FLQA 4IANA 3MH1A 2C6IA 1XJDA 1T46A 2XCHA 4FG9A 3PUPA 1WAKA 4JI9A 4MXZA 2R3RA 4MX9A 4AFJA 3CTHA 3PIZA 4BWXA 2V7OA 1XR1A 4FTIA 4U97A 3EQGA 3DXQA 3AD5A 2GS2A 1Z5MA 3QTIA 4MTAA 3T9IA 5B2MA 3EMGA 5D10A 2PVRA 3ZM9A 2VBZA 4L3JA 4HDUA 1HOWA 2DQ7X 3GFJA 3LCDA 4YURA 1IN8A 1V4RA 1MRUA 2ITPA 4CFMA 4UMPA 1BI0A 4QMOA 3PXQA 2VO6A 4IAIA 4LGGA 2OU2A 4ESBA 3LFCA 4WCGA 4G3CA 4XP3A 1M7NA 4U3YA 3F2AA 3TNQB 5H20A 2C3LA 4YNOA 3C4EA 5BVWA 1RE8A 2J2IB 2WD1A 3BV2A 3UOKA 5FP6A 1IAWA 1KSWA 3SG9A 3NUNA 3MYGA 3O23A 2IA1A 4OTWA 4AWIA 4K11A 3G73A 4H39A 4EC8A 4P2KA 2JIUA 3KL8A 1BBYA 5CVHA 4QRCA 3DBDA 1REKA 3EQPA 3IL2A 4IE9A 1YDRE 2RG6A 1MRYA 4EJTA 3ORPA 2RIOA 4YPDA 4EH7A 4FV2A 4LG4A 5HO8A 3BQCA 4DFNA 2P5KA 3PXKA 2EXEA 3G51A 2BZHB 3PQJA 3E63A 4K77A 4Y5HA 4F0GA 4W8EA 4Q47A 3QRIA 1TQPA 1XH8A 3DXPA 4ASZA 4C57A 5FDPA 1O6KA 2PN6A 3FI4A 3R0TA 4WT6A 2STTA 1YW2A 4OTQA 5FXSA 3B2WA 4NM3A 3TO6A 3D94A 3C4WA 2VTTA 1H1SA 4H0EA 3QCQA 5H3QA 4WK8F 2JPBA 2EV6A 1FT9A 2B7AA 4RAZA 4JBPA 3R8VA 2R7DA 2X0LA 1KA8A 1FBQA 2XNMA 4N9IA 3HRBA 2XM8A 3K1PA 1HCLA 1M52A 4QP2A 5CT7A 3Q5IA 3GCSA 3TN8A 2LGCA 4RLKA 4IX5A 4HGEA 3M9AA 3U2RA 3EFWA 2H6BA 3TI1A 1I27A 2EFNA 1P92A 4I3ZA 1KV1A 4JQEA 4I24A 3W1FA 1YW9A 3E92A 2CGWA 1PRYA 4KD1A 1PXJA 3CUQA 3QCXA 3NCZA 5J95A 4O6JA 4G3FA 4A6DA 4GK3A 1R0PA 3WTVC 1H25A 1NVRA 4I4FA 4O0YA 1RUNA 1MQBA 5CVGA 3LFDA 3WBLA 4ZIMA 2YPRA 3EUHA 3CO6C 2XCKA 5GIOE 3VBVA 3W2SA 3MCZA 4ACDA 3CSVA 4U3ZA 3G6GA 4EGZA 3GVUA 1ZGAA 1OM1A 5LRRA 5FFZA 3KXGA 4K2RA 1GIHA 4P7EA 1YI4A 5HESA 2XK6A 5EK7A 3E5AA 1JKKA 3AOXA 3VS0A 5DE2A 4Q9ZA 4LLGF 3ZTXA 3F23A 5IQEA 3WTYC 3K54A 3LQQA 5D7VA 4PV0A 2ISZA 5E9EA 5KZIA 2BV6A 4DE4A 4CXAA 4Z7HA 2OIBA 4ZTRA 3V5JA 4AIJA 3QGYA 1U78A 4F0IA 2F5FA 3R1NA 4ACGA 2Z33A 4NZWB 5CNNA 1SMTA 4AX8A 2ELHA 4MQVA 1PP8F 5L3CA 4MVFA 5EW8A 2CPKE 1FOKA 1MZBA 5DVRA 2VBWA 4HOBA 5KHXA 3AC8A 2QUFA 1XB4A 1UHWA 3TT0A 3VAPA 3P1AA 1KE7A 3NUAA 3R7IA 3FYKX 4S31A 2XS0A 5D12A 1IEPA 3BBTB 3KRXA 2IWIA 4C4JA 3N4TA 5JVTA 4XLPF 3WIKA 3NUYA 4EI4A 4O83A 4E7WA 4RWJA 4FV1A 4R8QA 5IU2A 2F7EE 4J95A 4PNKA 4EOKA 2UZEA 4FIIA 4OTRA 2IA2A 2XMYA 1OBGA 5FWKK 1KU3A 2H34A 5D4SA 2PMOX 3EQCA 4NM5A 3ZO3A 4CFVA 3WE3A 2X4ZA 3DBFA 4O1OA 3GFWA 3SW4A 4KAOA 3DB8A 2BRBA 3A61A 5L3DA 3BEGA 2FVDA 5E20A 4UV9A 5BPYA 4GL9A 1PYXA 2YCQA 3VQUA 4UV0A 3DFGA 4OTIA 3TNHA 3PRIA 2R3MA 4NCTC 3WZDA 1T45A 3E88A 3TO7A 2PMIA 4G6NA 4PL5A 3O8TA 2L01A 5KMMA 4LK0F 3E3VA 3WZUA 2FSTX 5JEBA 2OQGA 1J2XA 4XRLA 3REPA 4HYHA 1I1SA 2ZXJA 1LDJA 2IRFG 3H3UA 5DV5A 5F4NA 1EV7A 4RLLA 3ET7A 4IZ5A 5AP2A 5CYVA 1W82A 4O91A 5CALA 3MB6A 3W16A 4F9BA 3R22A 3DQVC 2JKKA 4JK1X 3RPUA 4WNOA 4YO6A 2UZNA 4E5BA 3VS4A 4YC3A 1PMNA 3R9RA 5IA0A 4YIFA 2JPCA 4EGYA 1PW2A 2R3IA 4KUMA 3LM5A 5CLSA 4M9ZA 4O7VA 5D4RA 2V1UA 4GKHA 2ESHA 1XBAA 3FMEA 3I71A 2DBBA 1YXVA 2XAJA 1IXRC 2R7IA 4CRSA 4L6QA 1LEWA 4CG8A 3FHZA 2KJBA 5C9CA 5JFWA 4AE6A 5HLGA 4KIFA 5FM2A 3H3CA 3P7AA 4D1XA 3IW4A 4D58A 2OBJA 3GU4A 4L3PA 1K2PA 4OOIA 1G3NA 3ZMMA 1HSTA 3BZ3A 5EEHA 1W7PD 2W1IA 3NQOA 2H09A 5JQ8A 4F70A 2X8IA 4C7TA 3WTWC 1AQ1A 4XSZF 1HKSA 4KIGA 3L9PA 4OIQF 2KTYA 2R3SA 3TNIA 3CLYA 3ORKA 5AUXA 4U7BA 2X9EA 3WTZA 4TWNA 1HW5A 3ORMA 4MNEB 3VBXA 1PXOA 2VRXA 4D0PA 3DTCA 3FMSA 1IRFA 3IRRA 4MXOA 4GK4A 3PA5A 1LEBA 4IH8A 2X7FA 2K86A 4XG8A 3M1EA 2W5HA 4A12A 3NVMB 2WMBA 3LOKA 5AP7A 2IZRA 4HV6A 1OR7A 3ENHA 3OWJA 4GU9A 4AGDA 4O0WA 3R2BA 4X2GA 3V5TA 4EL9A 1GZ8A 4K9YA 3EQRA 4JIKA 5BQ0A 4IHPA 5HIBA 5JKGA 5L2QA 1U5RA 5HZNA 4HYUA 5ICGA 5HHWA 2H94A 4GJ2A 4O84A 2PVFA 5CQUA 1U5TA 4PP9A 2A1AB 3KCKA 2J9MA 3ORLA 3R83A 3FC1X 4LK1F 1WBSA 5HTCA 3KA0A 2VTHA 5IMEA 4BH9A 3CJFA 2XUUA 3FMQA 3LMGA 4KKEA 4D4RA 5LWNA 1QPCA 3UZTA 5J7BA 1ZXEA 4U9AA 3QD4A 4NT4A 4XYFA 3Q6WA 3E97A 4W4XA 2A27A 4O0UA 3Q9VA 2WTKC 1K78B 3DFCB 3V3VA 4WNPA 2YM8A 4GVAA 4J97A 5ICEA 3QTRA 2M30A 4JL9A 1FNNA 5HEZA 4CGAA 1ZRFA 1M2QA 1W5TA 3GT8A 1FP1D 3ZYAA 3K3JA 1BIAA 3ID6C 4G7OF 1E2XA 3SXRA 4EUUA 2WKMA 1OYWA 4ORKA 3ACJA 3CD3A 4KA3A 5HCZA 5AAEA 1Q5KA 3IC7A 4O0TA 4UALA 4FNZA 2XIRA 3D2IA 5EHYA 2RQPA 1BYGA 4EKKA 4RX9A 3Q9XA 2VBYA 3SVVA 4U80A 1XWSA 4PTCA 5LVPA 4UHTA 4WF2A 4R8HA 3HP5A 5I9WA 3NIEA 1FBNA 4AZSA 3GC7A 5TR6A 3NW5A 3BU6A 4WWCA 3ZC5A 2ZV7A 2FBKA 3MBLA 3KCCA 1DDNA 4H58A 4AWXB 2PLYA 4EOMA 4OMYA 3QTZA 2V1DA 3SFZA 1E1XA 5HX6A 3LJ0A 4IB0A 2VOOA 2JIVA 4RB1A 2OJJA 2QWWA 3FDNA 3L8XA 3MA3A 2PEXA 4LOPA 3MWUA 4FTRA 4WG5A 1EH7A 4USEA 5CASA 4U81A 4BGQA 4MNFA 4ZOGA 4UN0C 4RFZA 4X6QC 3KEQA 5HNGA 4N0BA 1PUEE 4DEAA 3CQUA 4BKYA 4R78A 5HDKA 2B4SB 1Q62A 3VHKA 4IX4A 3RINA 1DS5A 2YZLA 2OXDA 3GXLA 4FT3A 2M87A 3ELJA 3OCBA 1XSVA 3MIAA 2G2FA 5EI6A 1FOTA 5J5TA 5FBNC 3PP0A 2ZMDA 3IO7A 1TLHB 4J1RA 5AR8A 3TZ8A 2NNYA 5AIKA 2WFYA 1YG2A 4BI2A 1YTYA 3DV8A 3BYVA 3HRCA 1OMIA 1LP4A 2YM4A 1ZOGA 4FZ6A 4U0YA 5JSMA 5AV4A 2KIFA 3BJ6A 4KSPA 5F6FA 5JH6A 3BYSA 3TV6A 1KWPA 1UA2A 4C4IA 3O50A 3FXRA 4O81A 2WQMA 2BDWA 5EOLA 4FV5A 1QPEA 3PWYA 5KO1A 4EUTA 4YFKF 3RHXA 3UO6A 1W8CA 2B9JA 4IAYA 4FG8A 5H8EA 2BPMA 3A4PA 4BWKA 3C0HA 4IM2A 4MXCA 3U9CA 2L02A 3BPRA 3TTJA 3UYSA 4FEVA 4CO8A 1GOLA 4D2VA 1QO0D 4BFMA 5T68A 5IT9Z 5BYLA 2A2AA 4LL5A 3MFTA 2UZBA 1I5ZA 3EB0A 5HE0A 2PTKA 4Y15A 3FKLA 5KMIA 2UZUE 2RSVA 4FV4A 3EFKA 4E70A 5JFXA 3R28A 5L3AA 4EOQA 2YAAA 1FYMA 3ZZEA 4QMPA 2DQLA 3U87A 2WMVA 4L5IA 2O0UA 5E4HA 3BE2A 2GS7A 5DT4A 2KIUA 3OWPA 5DG5A 2IPXA 3NLBA 3COKA 3DU8A 1NW1A 3HLLA 5E8IA 3WE4A 2VX1A 3R7UA 1U5TC 4L9IA 1JHHA 2HYGD 4KA4A 3PRFA 4P9UA 3PIXA 2QR8A 2O8YA 4G7ZF 4RG0A 3ZU7A 5C26A 1PP7U 2QVOA 4HZSA 5CEPA 2UW5A 3N51A 3PLAE 1U46A 4F6UA 2NO3A 5KZ0A 1HW1A 1OYIA 3SD0A 4O7WA 4RMZA 3GWZA 3OEZA 3V04A 3POOA 4NQWA 5M4UA 4NK9A 3IWZA 3CXWA 2FOKA 2W99B 4CCUA 2X9FA 3T3VA 5ANDA 2HWPA 4HGLA 3ZSGA 1RDQE 1EH4A 5CWZA 4HYIA 5L3EA 3ITZA 3JVRA 5IEXA 3BJOA 5K4JA 3HSFA 3FQHA 3T8OA 4FNWA 4FSWA 4BC6A 4IDTA 4IWOA 4Y8DA 5ETCA 4WIHA 5HGIA 1ZOEA 3K5UA 1OKWA 4Y46A 5CU3A 2VO3A 4YHTA 3R7YA 1LUFA 2G7UA 3GCQA 2HAKA 4WRGA 4KN4X 2A3SA 2P7VB 4C3RA 5ANGA 4EONA 1H1PA 3LLAA 2ZM4A 2V7AA 1ZZ2A 4LYNA 2X4FA 3JY0A 1M7QA 1IXCA 3WGIA 4XRJA 4BGHA 5IT9K 3F72A 2IVMA 4IHTA 2XKDA 5FEQA 2WV0A 1JLUE 1XH9A 3LVPA 1TBXA 1LEZA 2BRMA 5C8KA 5HLWA 1YI3A 3G0EA 5L8KA 2BEOA 2NYXA 5J9ZA 2BIYA 4C8BA 4L5JA 2CNVA 3K1MA 4XUFA 4QTDA 4OTPA 4RFYA 4C62A 2MH2A 3EZRA 4K1BA 5FB2A 4KSQA 4DEHA 3FXXA 3TKYA 4EZ7A 3FUPA 3AC2A 4UMUA 5BPDA 4MWHA 3G9NA 1UU7A 4DFBA 4GH2A 3GO5A 3KEOA 3E8NA 5EYCA 2CW0F 3QKKA 2WQNA 4HOKA 4F0FA 4M7IA 3ZLSA 3EYGA 5TT7A 5HBEA 2HOGA 4MD7E 5GJFA 3E87A 3NCGA 4CLIA 3I59A 5EH0A 4CFFA 2NRAC 2W9ZB 3KF4A 3FHRA 4RB2C 1BOAA 3HMMA 3AC3A 1JHFA 2Y4IB 3BZ6A 1JAMA 2R3PA 3FXWA 1CTPE 1BC8C 1H0MA 3CQWA 4HZFA 5CVRA 2ETMA 4EH8A 4HW7A 4GUEA 4U7DA 3BHUA 5HBHA 2GA2A 1SYKA 1T98A 3CIKA 5CVFA 3T5XA 4GUBA 3DPLC 3NAYA 2LKPA 2B9FA 2OAZA 3C0IA 3IDPA 5FLFA 5IH5A 2IW6A 4CKIA 3QTXA 5CAOA 3GOKA 3L9MA 1H9TA 3G15A 4TYGA 3V8KA 2ADUA 1Z6RA 3U55A 4C59A 4E1ZA 3HRSA 3VS5A 3PVUA 5AV0A 1NVSA 4ACCA 5ICFA 1D8JA 1BI8A 3EN5A 1IXSB 3FMKA 2I0EA 4FKIA 2GQQA 4KRCA 4MHAA 1ZMVA 1CF7B 2HZTA 4EOPA 4KIOA 3OOMA 4YSJA 3NRVA 4Q2AA 2XP2A 4L42A 3CPBA 5DUIA 2YAKA 3RAWA 2QU6A 3F3ZA 2GNGA 4B0GA 4AN9A 1DAYA 3V8JA 4JRNA 3K9TA 1MJAA 2JKOA 1EH8A 2QLZA 3VJOA 3UZPA 1GNGA 4IXPA 4OU0A 5ETAA 4D2SA 1FVVA 4K2EA 1ON1A 3LA2A 4UYNA 4MD8E 2XAGA 4ENYA 3HYIA 3PFQA 2PY3A 2OD5A 3HYHA 4ASNA 4Z16A 3GCVA 2AS5F 4O3MA 5IH6A 1YYVA 3PTGA 5BVNA 3COAC 2MH9A 4YJSA 4IQ6A 3R7EA 2XIYA 5DA3A 4DH3A 1H4LA 2QD9A 4BIBA 3NNUA 2X81A 5DEYA 2JAVA 5CVIA 4YZBA 3ULIA 5BMSA 4S30A 5JK3A 3C51A 5JZNA 3LCTA 5E1XA 4G8XA 2P8TA 4XEYA 1ZZLA 3OD6X 4ZS0A 1R36A 3DT1A 3W32A 4MXXA 1Y6AA 2WTIA 5LMKC 2YA9A 4LG0B 4PMPA 4AD9A 2D2WA 1H28A 1FMKA 2O03A 4F1TA 4EJ7A 3E8CA 4R79A 2L54A 5CSXA 3EKNA 2EV0A 2F2CB 3QWJA 4EQUA 4QPAA 3R73A 4UMRA 3Q53A 1B1BA 2HELA 2FF4A 4GCVA 3LJ2A 2FBHA 3R8LA 3IQ7A 3EIDA 3RK7A 1H1RA 1E9HA 5A6NA 4ASEA 2GXBA 3W55A 5E8ZA 3GUBA 4AXAA 5KMOA 4QYYA 2I0YA 1LPUA 1BUHA 2XEZA 3PP1A 2EJRA 4WO5A 5LVOA 4LJZF 2EB3A 1BJAA 4O2PA 3PJ2A 4QMVA 3D5VA 5AUTA 4O7ZA 2A07F 4X6RA 1Z05A 4HV5A 2XYNA 4R3PA 3RCDA 3TOBA 5KUPA 5K9IA 5J7HA 2KRFA 3V5WA 2VO0A 3OCGA 3L8PA 3SLSA 2F9GA 3RPYA 1PJKA 2K27A 1JKLA 5LCJA 1A9UA 4EKLA 5IKWA 3VS7A 4HPUE 2YHVA 1YO5C 1O6LA 3NGAA 3R63A 4RC4A 1Q41A 3ORXA 1MRVA 2BALA 2HXQA 3RP9A 3R60A 2JBOA 2FU4A 2UW4A 2QHNA 5L6PA 4P5ZA 2B54A 3RKBA 1QCFA 3DNDA 4FZDB 3D5UA 2GU8A 4I2OA 4A9YA 3A62A 4RA5A 1XDUA 3GX4X 4YHJA 4FSRA 1MD0A 3KN5A 5DR6A 4MNUA 4DEDA 4S34A 5DBXA 5K5NA 3JTHA 3MGYA 2UW8A 3LFSA 2Z3YA 2XNOA 4YFXF 5DYMA 2OFUA 4F1OA 3KGAA 1USTA 3TQNA 3DPKA 1OL1A 3QA8A 5EG3A 4JNWA 2C3KA 5IPJA 1M14A 5ED4A 4FE2A 3N97A 3MESA 3HIFA 4G7HF 2WMUA 4M13A 4PMMA 3KXNA 5HVQC 2HWVA 2XNNA 5D5UB 4LMNA 3V5QA 5EYDA 2CSNA 4J8NA 2DK5A 3KRLA 4BL1A 5HS7A 1IUYA 4N70A 1YLFA 3JW4A 3U54A 5IQDA 1WWXA 2HR3A 4IVCA 2WEVA 5F95A 4HJOA 1URCA 4PNIA
chains in the Genus database with same CATH superfamily
1ZTRA 5J4VA 2ZC2A 1YS7A 5DT3A 5AA9A 3PPZA 4FTAA 1M2RA 5M53A 2VTSA 5ILSA 2XGXA 2IZUA 3AT4A 3HDNA 2TCTA 3M3YJ 2DA4A 3KLNA 2MLKA 3JSOA 1J7IA 4HW0A 3TDWA 1PYEA 2XNGA 4PL4A 2H6DA 2A6EF 5J6XA 3CJTB 2OO8X 4D9UA 4C2UA 4DW6A 4Y4RA 2R9SA 4HF1A 4AZFA 4O4CA 4XG6A 3RZDJ 1X3WB 1QBJA 4Y5QA 3U4WA 5ANJA 4OT5A 4MTDA 2HOTA 4IWPA 4BEHA 3BLAA 2MSYA 2HPMA 1J9IA 3ZSIA 3W8LA 5C1QB 2X2MA 3PXRA 3HZJA 1GZKA 4RWLA 4EZ3A 1FGKA 3WU0A 4FTTA 4BDJA 2Q8KA 2KLOA 4KB8A 1OL7A 3M07A 5EZHA 4DLJA 2HW6A 4E8AA 3AL0B 2VTLA 3IUOA 2XKOA 3MN3A 1NK2P 3EH9A 4WOVA 2UZWE 4PPBA 4TYEA 4CFNA 1Y0UA 3KP4A 3QQLA 1YRPA 4ZSAA 5CU2A 2IPQX 4P90A 5CENA 2FGIA 5EFQA 3AKKA 3S14J 3CESA 3DXNA 2B1PA 2FJ1A 4ZK5A 3FXJA 2FEZA 2G9XA 3I4NJ 5BNJA 4D9TA 4PJNA 1GVJA 2ITZA 3ZLYA 3DPUA 5CY3A 4G6TB 3HA8A 4TWOA 2LY1A 4O7YA 1G59A 2RNGA 5A3XA 1VQ6I 2LC2A 5K5XA 3G3ZA 4F64A 4QMUA 2NRUA 2ECCA 3K4CA 2MFZA 1Z7LA 1A06A 4DCEA 2XKPA 4LGDA 4QMTA 5JHUA 2QOBA 5GAEJ 4BU2A 1L8TA 2E5NA 3TV4A 4RFMA 2KIMA 2QG7A 2XA4A 5FD2A 4BCJA 2EH3A 3K7AJ 3UG1A 2IO6A 2HFHA 2ID6A 3UKGA 2ITVA 2VWWA 4IDVA 1H07A 2WTVA 3DK7A 4BDGA 3R8MA 5CNOA 3S4QA 4FKGA 5F64A 1UELB 4LG0A 4O0VA 4HVSA 3GU7A 3TIYA 4A3KJ 2ZKZA 2PI0A 4IB5A 5E90A 3VUMA 3J80K 1QGPA 4CCKA 3O7LD 4MQ9F 4IL6C 5FKKA 3KP5A 4USFA 4OTGA 3BWGA 2KFDA 3H36A 3PA3A 2CW8A 3AGLA 3LXLA 2CQKA 5LRSA 3II5A 4AOIA 4A06A 5ICPA 3GW2A 3V6SA 2XJ0A 2RGPA 1ULYA 3RYPA 3CQZJ 2VWYA 3QQFA 1VEBA 3F8CA 3LOCA 4ZXTA 1NVQA 2EWNA 1REJA 4MF0A 1XMKA 2KIQA 1WJCA 2XVCA 1UU9A 2VWUA 5DRBA 1Y57A 4GRBA 1TWFJ 1K6YA 2FH9A 3EZVA 1V54H 4PWNA 4EEVA 4L0ZB 1SNUA 5AR2A 3RALA 4HEA2 1IA9A 4UUTA 2GNHA 1Z9CA 3EQLF 1QPMA 4RAFA 2WADA 1P4WA 4D55A 3SDJA 4BKJA 1U2WA 3FLNC 3CCRI 5DEWA 1RJBA 1ORKA 4I0TA 5FGKA 4BCOA 2EVAA 4JBAA 3RTPA 4I6QA 4XRSG 1Q97A 3Q5ZA 4DH1A 2W06A 3CDIA 1G8SA 4FKQA 2C6LA 4EH4A 4BI0A 2A5YB 4FT7A 2B53A 4ESJA 2XF5A 4II3A 2XBAA 3G6HA 3OF0A 4B8MA 2VC0A 2OZ6A 4BRXA 2IVTA 4M3QA 4DBNA 2GSFA 4I09A 3PZHA 1X1PA 2EIJH 4EVIA 2IVSA 4G9YA 4FIHA 1GIIA 1V0OA 4AACA 5L6OA 3AD6A 1B6AA 2DAOA 4CMUA 4E7LA 3ZMUA 1HOMA 2DA6A 4A3MJ 1KU2A 3MWMA 2IP2A 3BIZA 4Z6YA 1F5TA 5AP6A 4C34A 3RK5A 1ZMWA 3ZBXA 4DTAA 3WG9A 2VE9A 4E26A 4II2A 1Y8YA 1ZLJA 4U88A 3S95A 4I23A 2XC7A 1VI0A 1MDMA 2B63J 4FUXA 3Q0UA 3L00A 3FYJX 5M4CA 2DFHA 3CC4I 4TZRA 1PHKA 3RSNA 4MBLA 4H4KC 4XV2A 3BHTA 4O4BB 4C2TA 3S1HA 1MGTA 2OQRA 2CJJA 2LBFB 3FLZA 1FSEA 5A2QK 4AG8A 1QZEA 1GHCA 3RMFA 3TCPA 5HDGA 2CYYA 1KQ9A 2L9RA 2IA0A 4G16A 1IJWC 3AD4A 3LQRA 4PTEA 2BGCA 4YHFA 4FICA 1MBJA 3KZYA 3L2CA 1R9TJ 2F7ZE 3MVLA 2CG4A 4HNIA 4GV1A 3Q9SA 2HZ0A 1H00A 3OL4A 3UIUA 3GFLA 3CC7I 5H8GA 4EQMA 3C4FA 3LW0A 2VWVA 1G5SA 2WAJA 4WD5A 2O8KA 4GK2A 4C30A 5ANEA 4LMYA 4D5HA 2XK8A 2NP8A 3UC4A 5M08A 4FZ7A 1T0FC 3OP5A 4NJ3A 2DCEA 3HSEA 1BX6A 2ICWG 1K61A 3QU6A 4NM0A 2BAQA 2R0QC 3BRBA 3DQXA 1O7LA 2ITOA 4CNHA 4PJJA 3KN6A 1Z21A 3O7LB 2QQBA 3VFZA 1VQ9I 2ELKA 4ALUA 3RPQA 4UUVA 4PUZA 2ZB1A 3VYSB 3KRWA 3R6SA 4Y52J 4YC6A 3BU5A 4WXCA 5AV2A 5K1YA 3ZPLA 1FMOE 3D7ZA 2NS7A 4FOCA 3QX4A 5F27A 4BCHA 2FSWA 4WKQA 4CGZA 1XBBA 2X6XA 5J1VA 3F9KA 4BACA 4X0MA 4JOAA 2FNAA 3WE2A 4ZZDA 4FMQA 5B7VA 4BEHB 2YCRA 4AOTA 4F4PA 2Y8OA 3Q3SA 3WHCA 4NKSA 3QP6A 4CHUA 4FZAB 4DCAA 1UV5A 4A3FJ 3P7NA 1GZNA 2PVKA 1I6XA 4PPCA 1Q8YA 3L2RA 4W9WA 4I20A 1Z91A 2BVMA 3CBLA 4RGRA 4QP7A 2UZDA 2IS4A 2R4GA 4DBXA 3CTJA 3HPHA 1G8AA 4M15A 3AKZA 3BPXA 3DGKA 2BZJA 4A5NA 4L67A 4XHKB 3UYTA 5FGMA 2UVYA 3I81A 4GT5A 4BDIA 4NFMA 4BB4A 5E92A 1R1TA 2PG4A 3VUHA 3QPLA 2O6GE 2CGXA 5AM7A 3JR9A 5I9XA 3LQ8A 4AYBA 1W2CA 4FTJA 1YRNA 1VJYA 3BE9A 4R7HA 3LXKA 3W6KB 5KMLA 2CLQA 4R6VA 1KE6A 4G31A 5HG8A 4ZTQA 4QEBA 1FSHA 4RWIA 2P55A 4HYSA 5GJDA 2Z7QA 4I0AA 4YG2F 3SOAA 5L3GA 3PJCA 2C1BA 4PDKA 3FL4A 3W0NA 4EH9A 2R3NA 1KQ8A 2QZ8A 2GQGA 2WTKB 2A5WA 2XUBA 3A4OX 4J98A 3QZHA 2WU7A 2E1NA 3K4NA 2CWEA 3IOPA 3R00A 1XD7A 2JUGA 3W0OA 2VXDA 4E7IA 3SQQA 4AZVA 3MZHA 1WCMJ 3BR0A 1W0UA 3HKOA 4A3IJ 1WFXA 3GMEA 4EK5A 1MIJA 3R1SA 3WILA 4XL9A 5CF4A 4EQCA 3TGNA 4CT2A 2XKEA 3FC2A 5M06A 2BRNA 3JVSA 1STZA 2R7TA 5J40A 5F0CA 4BJJB 2OXXA 3T9TA 4XSXF 3AGMA 2NS0A 1XKKA 1VFCA 3QYZA 2CQXA 2EZKA 1DGRM 2QOIA 1LUJB 3DF8A 3I79A 4FGBA 4NFNA 3C7JA 1G3YA 5E8UA 2CH0A 4WXHA 4O0SA 2F48A 4BQQA 5HG7A 5J1YA 1P7JA 1R22A 3W2AA 4FSTA 4YZCA 2ONLC 3CEKA 4MYGA 5DLSA 4PGHA 3V8SA 2COBA 4IRIA 2AQXA 3MSSA 3NYVA 1Q99A 5LEJA 4YGAA 5EI2A 4XOYA 3JS2A 3S0OA 2ETHA 2OH0E 1OCCH 2M45A 2PZ5A 3HBLA 1ZRCA 3W0SA 3S3IA 1R71A 5E8VA 5LVNA 4BZDA 4DYMA 3UO4A 1JJ6C 4U0WA 5DPVA 2QLUA 3FISA 2CUJA 3F3TA 3S2PA 5E3NA 3QOEA 4BDEA 1QZYA 1PJRA 4RLQA 4EJWA 4KT5C 2MBFA 3NNWA 4EEFG 2X51A 5CF5A 1Q24A 2P33A 2C6EA 3RI1A 4KYWA 2XIGA 4RIYB 2EA2A 4M0YA 4RX5A 3QU0A 1ZY5A 2IJLA 1BKXA 4FVRA 2NNWB 3ABLH 2PJRA 5BUIA 1OMWA 2QC6A 4RGJA 1BOBA 3IH4A 1STCE 3IGOA 2DYRH 1T56A 5C8MA 1LDDA 5CF6A 1JKPC 2Z8CA 1D1AA 3HUGB 2WMQA 2WMAA 1IDYA 4HAMA 1CF7A 2GDOA 1BM9A 4EH2A 4ITJA 4QTRA