4GYGA

Crystal structure of the rio2 kinase from chaetomium thermophilum
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
341
structure length
331
Chain Sequence
KLDTRAMRHLTAEDWRVLTAVEMGSKNHEIVPTPLIEKIGVHKSIATLAKAGLIARMKEAKYDGYRLTYGGLDYLALHTHAARKDVYSVGSRIGVGKESDIMIVADEKGKQKVLKIHRLGRISFRTVKRDYLRNRSTGSWMYLSRLAAIKEFAFMKALYEEGFPVPEPIAQSRHTIVMSLVDALPMRQVSSVPDPASLYADLIALILRLAKHGLIHGDFNEFNILIREEKDAEDPSSITLTPIIIDFPQMVSMDHPNAEMYFDRDVQCIKRFFERRFHFVSTTPGPFYKDAKKTVGKDGAKRLDAALEASGFTKKMAKDLEAAIREQQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rio2 kinase
publication title ATPase-dependent role of the atypical kinase Rio2 on the evolving pre-40S ribosomal subunit.
pubmed doi rcsb
source organism Chaetomium thermophilum
molecule tags Transferase
total genus 103
structure length 331
sequence length 341
ec nomenclature
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4gygA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gygA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gygA02
4F99A 2VONA 1ZYCA 3IQ7A 3LA3A 5I9UA 2XNEA 3Q9VA 4FIFA 4JG8A 4FZFB 5ICPA 3QAME 2B54A 3NYXA 3VS4A 4LI5A 3KRRA 3HX4A 3BWGA 4C35A 5EQEA 3FI4A 2IW6A 4NYEA 1YQAA 3VS7A 2XNPA 4YJVA 3NUAA 4EKKA 2Z7LA 4OTIA 2K86A 3FLWA 4L7SA 5HG8A 2UW4A 1ZLTA 4BFMA 5J87A 5L3FA 3I4BA 1K79A 4KSPA 5EI8A 1SZMA 2HYFA 5DYJA 1CKIA 4G34A 5CF5A 1NA7A 3E5AA 3JS2A 4X6QC 5IT3A 3UGCA 3VHEA 3CUQB 4TYGA 3HP2A 4EH8A 4M71A 2NRUA 2R5TA 1CKJA 4AAAA 2F2CB 4O6LA 5KNJA 2WV0A 4FV8A 4NT4A 3M8FA 2EUFB 1IN7A 4MGRA 4FKLA 4YC3A 2A3SA 3UNKA 1U3EM 4BKZA 3TV7A 5AV4A 3DZQA 1U5TC 5CAPA 2HYYA 4IBMA 3R7EA 3DF8A 2OIQA 2MC3A 4P9UA 4EC9A 4N0SA 5AV2A 3H0YA 1LNWA 4PTEA 3RWPA 3OWKA 2XHKA 5HIEA 5CEOA 3DA6A 2ESNA 3R8VA 2GWRA 4OTHA 3IDCA 4DCEA 3QRTA 5IUIA 1P4WA 2E1CA 3DKCA 5M53A 4RGRA 5EW3A 4C4JA 1MZBA 3VBXA 5CWZA 4DG2E 5AX9A 1IXRC 1HSJA 4ZTQA 4C33A 4ACCA 2EFPA 4I20A 2BHEA 4D0WA 3S00A 3RPQA 5F4NA 2OK1A 3F23A 1CSNA 3I79A 1NW1A 1FYMA 3TXOA 4BCKA 1MD0A 5TOZA 3WE4A 5FEDA 3FJQE 4IACA 5AP6A 3PA4A 5AAEA 1WVWA 2I0YA 2FA2A 3IKVA 3R7IA 1VZOA 1M2QA 2JEDA 1M2PA 5IG1A 4CYIA 2ITPA 3SGCA 1P4OA 1IAWA 2BV6A 3R1NA 1LB2A 4AW2A 3NW5A 5EDPA 3D14A 3FZRA 5DCMA 3E8EA 3CIKA 3C4ZA 3L9LA 3PJ8A 3V8KA 4C37A 4GFOA 3QTWA 4U81A 1XBAA 3AT3A 4RG0A 4IANA 4PDSA 4RX7A 4BRXA 1REPC 3NIEA 5M08A 4Q47A 4QP6A 5LJJA 5J6XA 3ODZX 4AX8A 3ERED 4O7LA 2XBAA 4DITA 5C8MA 5LCJA 4XG9A 3HP5A 2X7FA 3SOCA 4BTJA 2VTAA 5T3QA 3BOQA 3RAIA 3U8WA 4MEXF 5IH6A 3QRIA 1H25A 4CVAA 4J71A 4FIIA 3UPXA 2XKFA 4U5JA 4XP0A 5ICGA 3SXSA 4TXCA 2O63A 1BN5A 2PZIA 4CMUA 4CFNA 4KBKA 4A06A 3LAJA 2R3HA 3PZHA 5IDNA 4I0SA 1XKKA 2EXEA 1FWZA 3UE4A 4IVDA 4C38A 4QP7A 3M7GA 4EI4A 5BQ0A 2WMXA 4EOJA 1WBOA 2OWBA 4PCQA 2BAKA 3SRVB 2YM6A 4M7IA 3VIDA 4AS0A 2W1EA 2ERZE 3LJ0A 4XLVA 1YO5C 1SFUA 4U7BA 4XG3A 2PVLA 1B9MA 5EK7A 4EOLA 4JQ7A 1FBUA 2F2UA 3MJ1A 3WF9A 5DEYA 4DFZE 4AW5A 4RVTA 2SRCA 4LOQA 2O8XA 1IW7F 1KU9A 3WGGA 4BN1A 3G2FA 5CEQA 3BJOA 5LVOA 3U2RA 2JZYA 3HV6A 3KFAA 1SD6A 4XV3A 3BELA 2ITVA 3BZ6A 3NNUA 2FF4A 3G9LX 3P4KA 1B59A 3QCSA 4PL5A 3E8CA 2XBJA 3WE8A 1ZYRF 4BCMA 4CKJA 4BKYA 4E5AX 4D9TA 3SHEA 4IZYA 4FODA 4K8AA 5L6WL 4CSVA 5ETIA 3DTCA 1Z9XA 4IPAA 4G3GA 4GRBA 2JLDA 3EN9A 3M2WA 3ZLWA 4FKIA 4JIAA 4G5PA 1AD5A 2G2IA 2OU7A 2JGZA 2C5OA 2UW6A 4F6WA 3COHA 4GKIA 4BZDA 4AE9A 2OI4X 3L8XA 3LQRA 4RJ5A 3EQPA 2VTOA 4MTDA 2C6EA 1OZ1A 2RSVA 2JKOA 2PYWA 2Y8OA 2Z7RA 5KO1A 3Q96A 1IF1A 4I6FA 2OBJA 4LG0B 1O7LA 3FBVA 5AIPA 4U79A 1FYKA 1BYGA 4CRLA 2W25A 3HOSA 2DO7A 2VO0A 1P4AA 4JBAA 3W55A 3GCPA 3RI1A 5FLXZ 3KFWX 5HICA 5KKRB 4AWIA 5I4NA 2VX0A 4JK1X 1XH7A 4ZJVA 4RWIA 5E90A 1F3MC 4R5SA 1RZ4A 4ASDA 1YHSA 2GMXA 4CMOA 3KEXA 2EWNA 3W6JB 2V6CA 3V6SA 2DW4A 3OP5A 3BIZA 3NCGA 3MAJA 1OL2A 5FEQA 3DBQA 4O5VA 2PY3A 3PA3A 1GOLA 3GO5A 4LGDA 4GK3A 1U59A 2WTJA 4GK2A 4QMSA 3QU6A 5L2QA 4DFNA 2ELHA 4CZTA 5J9YA 3PY0A 5FQDC 2ITYA 2W1FA 4QYGA 5M55A 4D0XA 3REPA 3NAYA 2BRNA 1HBXG 3MVJA 1IR3A 2HS5A 4QTDA 2MLGA 3PP0A 2IRFG 4WNKA 3I1AA 1F9NA 5I9WA 2EFWA 2JBPA 3SD0A 5E8IA 4HW0A 3ABTA 3LE6A 2J6MA 3SQQA 2OZAB 4FV0A 5LBQA 4DH8A 1XR1A 4NM3A 2VU3A 2RNJA 4X6RA 5IEXA 5IT9K 1VEBA 4C0TA 1VR2A 4FL2A 2DWBA 4U97A 3BBWA 2IW8A 1UU3A 4JNWA 2XJ0A 4YZBA 4F9AA 4B7TA 3NAXA 2EA4A 4TYHA 2CMWA 2QU5A 4ZJIA 1XMKA 1J7KA 4O6EA 1IUYA 2GTMA 4NM5A 3E64A 1ZMUA 3R7GA 2C6KA 1QNTA 4PPBA 1RI7A 3FL5A 2J5EA 3UP2A 4QMTA 4RIWB 3L00A 3LFKA 1ZG1A 1OVEA 5CF4A 1Y6BA 3W8LA 2PZYA 3VUKA 3D94A 3ML6A 4MXAA 4EJWA 3C1XA 5E7RA 3CD8A 2R0UA 2C3IB 3RALA 4EK4A 1Q5KA 2YM7A 4JBPA 3WZUA 4BQAA 4P5OA 5F20A 3MZYA 3AMYA 4UV9A 4Q5EA 2C6IA 1SD7A 3GZ5A 3UIMA 2JKMA 3DP7A 2HZNA 2J51A 3AMBA 5GINE 2ZJ2A 3BZ3A 4FTUA 4LV5A 3T0YA 3NRMA 3RK5A 3HMOA 3ORIA 4FSZA 3HHGA 3Q2MA 2RG6A 3RZFA 5AX3A 5HU9A 3L9MA 5AUYA 2IVVA 4HNIA 4NM0A 5G6VA 5BVFA 4ZOGA 3A62A 2PU8A 3VHKA 5HLIA 1G3NA 4HX4A 1UFMA 2YHVA 4IB0A 3MFKA 5HEZA 2QR8A 3MTLA 2QG7A 4FTRA 3KRWA 3ULIA 3H92A 4M0ZA 2K02A 5H8EA 3FC1X 3VBWA 4OTQA 3F2RA 4EJOA 2A2AA 3F66A 2X1NA 3OFMA 1T38A 3W2QA 4QQJA 5LHGA 4TT7A 5JKGA 4AA5A 4ANLA 3NDMA 4ZLYA 1LEZA 3KETA 3T9IA 3FMEA 5HD4A 4PDKA 5GZ8A 4KNYA 4IJ9A 5E8WA 4KD1A 3VJOA 5CJ9A 3AT2A 4USDA 5AADA 4C7TA 2YCRA 5HLNA 3OWPA 1XH5A 4ZTLA 2Z7QA 2J0JA 3R8MA 3G6GA 2EV0A 1KQ9A 3I0OA 4HBLA 1S7OA 4K18A 4USFA 2P5LC 4YO4A 2ZV7A 2ETKA 4ZZOA 4PGGA 1Z9CA 5KZIA 3ZP5A 3L1SA 1XGNA 4YIFA 2ITNA 3GXLA 1P14A 5C4KA 3MEXA 2EXMA 3FXWA 3D5UA 3LQ8A 4KA3A 2NO3A 4FIEA 2UW3A 5L8LA 4ENJA 3HV3A 2PVFA 2R3OA 3KF4A 4XYFA 2GQGA 3WIGA 4P7EA 5A2QZ 3R0TA 5LHIA 4ZZDA 4JR7A 1Y8YA 2EK5A 2XS0A 4NHJA 4U41A 2WIHA 2WU7A 5F6FA 4M9ZA 3QTUA 4XRLA 4KBCA 5CX9A 3SG9A 3FXQA 5LVNA 3GZ6A 4UXLA 5EFQA 2UZKA 3N51A 4U6RA 4A4LA 3NQOA 5D4RA 3QD3A 1ON1A 1L0OC 4ETSA 4QYYA 3JTGA 3U6HA 3IKAA 4M6XA 3IPHA 4G3FA 4YFKF 2PSQA 3EIDA 2CHLA 5ANOA 4BCNA 1GVJA 4GJ2A 2Y7JA 4ZH4F 4M97A 5CVFA 4EWQA 3FZSA 5CVVA 5EM7A 3GFLA 4IZ7A 2YIWA 4KIGA 2DYLA 4GKHA 5DDGA 3KN6A 4X21A 3REOA 5D4SA 4UWCA 3TOAA 4C59A 4GL9A 5HIDA 3SW4A 5DLSA 4L9JA 3HVCA 3DLSA 3LXNA 4KB8A 1YKRA 1FVTA 4D2TA 2DFIA 5KMLA 1ZYSA 3ZLXA 4MF0A 4EQUA 2ZO4A 4R3PA 3ZFMA 1M2RA 4ITIA 4E4NA 5IQEA 5FXQA 2B0QA 4AW0A 3KK8A 5M4IA 5J8CA 4ZS0A 4PDPA 4KIFA 5HS7A 2UZDA 3BE9A 2Y4IB 2VN2A 4L3LA 4WXCA 5C8NA 1QGPA 5TT7A 2HKXA 3DKGA 4HNFA 3TKUA 2YZAA 1S3JA 3BLQA 4Y5QA 2IPQX 3G3ZA 4KS8A 4RT7A 2A6EF 2A0CX 3DEUA 4DEAA 2BRBA 3E93A 4NUSA 2QLZA 2XK7A 3HHHA 5HOOA 3OG7A 3PVGA 4RJ7A 4AE6A 4AZWA 2HYGD 4AIHA 4QMOA 3IC7A 3ZMMA 2W1CA 3EB0A 4O6JA 3OROA 4TYIA 1BLXA 2FMYA 3WYYA 2VGPA 5D12A 4EK6A 2OICA 3QP6A 5HHWA 2F9GA 5A3XA 4FYOA 3HEGA 1P2AA 4DFXE 2IA1A 1IEPA 3Q4CA 3U51A 2KIFA 4H3BA 3H10A 4JDJA 4XUFA 3KF7A 3QA0A 4R8QA 1IA9A 2XZSA 2ZMEA 5JI6A 3FSFA 1JSVA 3GCVA 4HCVA 4Q48A 1OI9A 2YCQA 4CMTA 2QO7A 3HZTA 2HZ0A 4FNXA 5KBRA 5D7AA 3OXTA 1GNGA 5AP2A 1HW1A 2A5YB 3KMUA 4FG8A 4ENXA 4CXAA 3HNGA 3D5VA 3OHTA 5JRQA 4EJNA 4RWLA 4R7BA 4TWOA 3BE2A 3RHKA 1JWHA 3K3IA 1GXQA 3S2WA 5BPDA 1JE8A 4I23A 1HSTA 4MEDA 3F3TA 2FU4A 4FTQA 4LLLA 4UYNA 3NYNA 2YDJA 3L9FA 3THBA 4U0IA 4ESBA 4M13A 3TNIA 2NAZA 5LLQA 3IW7A 3FLNC 4TKSA 5L3BA 3NNXA 4L3JA 3TJCA 2QOLA 4RGXA 3DBFA 1EH4A 3ATTA 5CANA 2L3DA 1GIIA 3OXIA 2PMOX 3FHRA 1WBVA 2Q0OA 4IFGA 3TKHA 4ANMA 4WIHA 1EH6A 1ZMVA 2GHGA 2H6BA 4FF8A 4HF0A 2C68A 3TEIA 2G7UA 3LHJA 3BGPA 2ZV8A 4BDAA 3QPHA 3MW1A 3MVHA 3EZVA 5J1WA 4ZMFA 3LPBA 2XK4A 2X4HA 1MJAA 5LXMA 5E8ZA 4F9BA 3ZO2A 3CGFA 2STWA 4IADA 4FG7A 4O7TA 3ZLSA 2PMNX 4BL1A 5FXRA 3PA5A 4M15A 3F8NA 4I0AA 4QMZA 3PIZA 4B4LA 3EQGA 3NR9A 5HZNA 4WX9A 5AP1A 1P5EA 3GEZA 5FFXA 2E9NA 5EM5A 4NCTA 1H0MA 2CN8A 3UG2A 3JTHA 2XK6A 4C4IA 3RPUA 2UZTA 1KV2A 4M0YA 3M11A 4IWDA 3PXRA 3ZDIA 3ZOSA 3ECOA 4BDGA 4MWHA 5J9ZA 1TNSA 4CT1A 1QPJA 3CUQA 3FUPA 3ZO4A 1W4MA 3W2SA 3F8MA 5EG3A 5C03A 1H1SA 1O7FA 3U9CA 3HMNA 1BC8C 4OW8A 4Z7GA 2R9SA 2ITOA 3CQWA 4LQMA 3PXFA 3FQEA 5AP4A 2QKWB 2BTRA 4QYHA 1Q61A 4LGGA 3J80Z 1MRYA 2PHKA 1WVYA 4ANSA 4H0EA 3SAYA 4M6YA 1UHMA 4U45A 4PF4A 1FPQA 2MD5A 2P4IA 3CR0A 3V7CA 4YJTA 4UMQA 2ZDTA 5ACKA 3TCPA 3V3VA 4DFBA 1JGSA 4CGZA 3A2CA 5CS6A 1W0XC 2GHMA 4IXPA 3RTRA 4BTFA 1CF7A 1ZRDA 2CNVA 1ZOHA 5A14A 4L9TA 1HXDA 2WMAA 3UO4A 1YVJA 3KKVA 3POOA 4I0BA 3TO9A 3F5UA 4FSNA 4BCQA 2FQ3A 1RW8A 4DFUA 4EM1A 1PRYA 4CDGA 4HYIA 4CTCA 4LFIA 4ANQA 3BWFA 3AC1A 4XG7A 3E97A 2WKMA 5HTBA 2IVTA 2XJ2A 2RIOA 5GIOE 3RDIA 3G90X 4L7FA 4YJUA 4Y17A 4K33A 2HXLA 4NJ3A 5CALA 4N9IA 1H08A 1H26A 2C5YA 1OL6A 4U3YA 1WZYA 2VRXA 2XA4A 3FWQA 3HTUA 3WTZA 4LK1F 3ZS5A 2VWUA 1PMNA 2LF7A 2FE3A 1SM2A 3F6VA 4IX3A 3E63A 3GGFA 1URCA 4JR3A 4S2ZA 2I7QA 5EKNA 2YDIA 3TN8A 4L18B 4NCTC 2VWYA 4RGJA 2C6MA 3U9GA 2BAQA 4MD7E 3O7LD 3EFJA 3DBEA 4YJSA 1AGWA 3O8TA 3ZU7A 3C3WA 1I1SA 2BVAA 5HE0A 3DQWA 5DI1A 4A0ZA 2Z3YA 1S29A 3O0GA 3FZPA 3C7JA 3IW5A 1BL7A 3QQFA 5JFRA 2VTJA 3QXOA 2JITA 3R9HA 4JX7A 4BCHA 3ZH8A 4KN7X 3GNIB 3I54A 3R61A 3K69A 3MWMA 2DK5A 1ZMWA 5B2MA 5LGTA 3JAMZ 3R7VA 3ZMSA 3PFIA 5I9ZA 1UNGA 4D2WA 4EUUA 2QOBA 5B2KA 4TWNA 5CVIA 2PLYA 2XIYA 3KULB 2ZNYA 2VGOA 2BE5F 2OXXA 1W98A 4BGGA 5AP3A 4HGTA 3QL8A 2J0KA 3GFEA 1OIRA 3QQUA 2ETHA 2P3GX 1H1WA 3GCUA 3CC6A 3VS1A 2YITA 4J7BA 1K6OA 2FSTX 4FSMA 2YIYA 1XH4A 1ZARA 4FV9A 1X8BA 2X81A 5F9EA 4AZSA 4A5NA 3CJNA 5KVRA 3R7UA 3NEUA 5BMMA 4IF4A 2L4MA 4FMQA 5D5UB 3MZHA 1Y6AA 2ZB0A 4DTBA 3I64A 2GNIA 3UOKA 4BTKA 5J79A 2PULA 4XV2A 2PG4A 4JXFA 2ZFWA 5HQ0A 2AXLA 2R3FA 5T6KA 3VUGA 3U55A 3EETA 2WC2A 4J96A 2XYNA 2GNGA 4R8HA 1DAYA 4B99A 2QCSA 3WGHA 2QHMA 2C1AA 4APCA 4K1BA 3MH0A 3UQCA 4MHGA 2JC6A 3FAAA 4FGRA 4MCVA 4PNIA 4U3ZA 4EHZA 3PSBA 3A99A 1BBYA 3F5GA 4JDHA 5K4IA 4GG5A 4AZVA 5CASA 4F09A 5CSWA 2Z99A 2WMBA 3I53A 2UW5A 5B0XA 2LKPA 3BKBA 5GIPE 3PWYA 1YI3A 2XJ1A 3F82A 4LLGF 1V0BA 2WD1A 3EQDA 2PQ8A 1KSWA 5DWRA 2XNNA 4HX8A 4Y85A 2YU3A 1RNLA 5CVJA 3CPBA 1ZHFA 3OOPA 4RB0A 2CO5A 4JL9A 3L2CA 2P8TA 4OTDA 2FBIA 2RKHA 4QQCA 4JBQA 1KU3A 3PG1A 3LSTA 1KE6A 3UOLA 1PKDA 4O1PA 5I3OA 3FY0A 4QNYA 3FXUA 4CZYB 1UA2A 4PZJA 3SZTA 3C7QA 2HCKA 4NH1A 4NSTA 3BHYA 4CFFA 1H9GA 3KLNA 3G73A 4XJ0A 4XV1A 3S1HA 1U54A 1KV1A 4Z7HA 1O3RA 2QO2A 3OT3A 2R3GA 4IFCA 2KIMA 3NEWA 3QD0A 2ZMCA 3I5UA 3BEAA 5ANEA 3R22A 4HCUA 2WAJA 3DQXA 3Q4UA 4AN3A 2NRYA 3FPMA 1M17A 1XSXA 5C26A 3Q5IA 2EV5A 4RIYA 3E87A 5TR6A 4O7RA 5E92A 3QZGA 2FSWA 4OTWA 4CQEA 3VS2A 1MDMB 4BDKA 5CYIA 2PZPA 4KRDA 3CD3A 2JFLA 4XP2A 3SV0A 4YBJA 4DBNA 3F9NA 5BUIA 4U0YA 5C8KA 2PMUA 2XV4S 1DUXC 4EUTA 4KDPA 5D7VA 4GYIA 4WSYA 4GFMA 2OZAA 3V5WA 4G2FA 4X3FA 5EH0A 1MUOA 3AC5A 2C5XA 2JIUA 4L0YB 4UX9A 4PWNA 3PLSA 4EQQA 5ITAA 1W5SA 2UZOA 2R3IA 3QTSA 1GXPA 5JR3A 3CY2A 4M9XA 5DUIA 1X3UA 2XIGA 3COMA 4DN5A 2H96A 3QZFA 2B55A 5LARA 4IAYA 3LCKA 2BFXA 3UO5A 2XRWA 1RIOH 1JLUE 4ID7A 2VXZA 3BYMA 3G33A 2W7XA 4EZ3A 1D8KA 2UUEA 4YTIA 2OJIA 4QYEA 4PMTA 4R7IA 2H8HA 4OIQF 5BUJA 4K6ZA 2AYPA 5FM3A 4RGUA 3EKNA 4ANOA 5L3AA 4LLNA 2QO9A 4D4SA 4DA5A 3OCSA 4ENYA 5FD5A 3DXNA 1WBPA 2PVRA 2XK8A 4YLJA 1IZ1A 3RIRA 5ILVA 2BAJA 4DTKA 5ANIA 5K9IA 1H27A 3QUDA 3QBNA 2RC4A 2KIUA 2BKZA 1NXKA 2WTIA 4IWPA 2GTNA 2R3QA 3UYSA 4FHTA 4H3PA 4X2KA 2UZWE 3Q32A 3RPVA 1QBJA 3EHAA 3W2PA 3CXWA 4RA5A 5HS9A 3D4QA 5JGDA 1ZRCA 2OZOA 1QO0D 4IJAA 4UXQA 5CT7A 3PXKA 4FVQA 3AGLA 3D2KA 3HDNA 5AIQA 2WIPA 4HJOA 4BCOA 1BI8A 4RWJA 1FNNA 4PV0A 4BGQA 3TL8A 3GU4A 2DQ7X 2QQ9A 5GHVA 4I5PA 3ITZA 3JYAA 2BEOA 3TOBA 2QLQA 2F5FA 2XKDA 3VF9A 5EOLA 2UW7A 1LDKB 3LFCA 2OXYA 3VBTA 4MH7A 4IIRA 5TJJA 5E8SA 2VX3A 3MESA 2WQMA 1WAKA 1HCLA 4KIBA 4DCAA 2JSCA 3U6IA 2GXBA 3SVVA 2UW9A 2XAFA 2GNLA 3PDTA 5M06A 3CO7C 4OIOF 4JRVA 4UV8A 1UU8A 2WXVA 4AN2A 3CTQA 3ROUA 4X3FC 1EH8A 4YZ9A 2P7CB 5TF9A 4UMTA 5EI6A 3CP9A 3SDJA 5DOSA 2QG5A 2HK5A 3RAHA 5CAVA 5BQTA 4KYWA 4XRFA 1RDQE 2PK9A 3HMIA 5EI2A 4AP7A 4HLXA 5JVTA 4KSQA 2RL5A 2G7HA 2J0MB 4HPTE 5HVYA 4YNEA 4EH4A 3GQLA 2XVDA 2FYSA 5CENA 1ULYA 3T3UA 4YBKA 4GU6A 4X0MA 3ZSHA 4KMUX 3TM0A 4WG4A 4O27B 5AR5A 4GS6A 4FL1A 2OGVA 4D1SA 4AGCA 1KE7A 1BIBA 4ACMA 5E8TA 5E1ZB 4YPDA 1UU7A 4BF2A 2R3MA 1OIUA 4YC8A 3P1AA 3HGKA 2RGPA 2HDCA 4O7VA 4NK9A 2J0LA 3RPRA 3ENHA 3P9JA 5CVRA 2WMTA 3RHXA 4A2UA 1T6SA 4YC6A 3R9OA 2WB8A 4A9YA 4D2PA 3RJCA 4ALWA 4MHAA 5HE1A 1ZYDA 3GC0A 3QC4A 4ITJA 3OW4A 3J81K 5JMSA 3BRBA 2OAZA 4PMMA 2C5NA 3N4UA 2P6TA 3DS6A 3VVHA 3M9AA 5E1EA 2A68F 1S6LA 2WNTA 2Y6MA 1OPLA 3OOGA 4RB1A 3QQLA 5EW9A 2O5KA 2WTKC 5FBNC 4TYJA 2CDZA 2O64A 4U40A 4GK4A 1U5QA 4BHCA 2ZJWA 5G1XA 3FF5A 1EV7A 5KBQA 1YXSA 4L46A 3CBLA 2O3FA 3UTOA 4HA8A 1B39A 4P9FA 3CKWA 4GYGA 5HO8A 1ZGAA 3O51A 3HRTA 2CG4A 2XROA 1OB3A 4O86A 5IT9Z 2YSRA 3Q04A 2OH4A 1VYWA 1OUKA 1TW2A 4W4YA 2E9OA 3T8TA 2B4SB 4WD5A 5E1WA 3UQFA 4IAZA 5J5SA 4C34A 2PFBA 4ZMEA 4L01A 3QYWA 3SOAA 3R0AA 5E8UA 2PVNA 1FC3A 2QR7A 4HZRA 4ERKA 4Z9LA 1XH8A 1FOKA 2HZ4A 1U2WA 3VAPA 4KABA 2W5BA 2F57A 5HKMA 4JG7A 2IVMA 3EUHA 2GU8A 3DXQA 3O71A 4GMYA 4MYGA 4AXAA 4B9DA 2DLLA 3UZPA 3ZMDA 4MBJA 5DA3A 4CFXA 2ZNZA 2VO6A 2NP8A 3R60A 4LUEA 2JBOA 4QTAA 4KBAA 4APPA 4RZVA 2CW0F 3VUIA 3CCNA 3QA8A 1YW2A 1IG1A 1NY3A 3CPCA 5AR4A 4BR3A 4C02A 4HYEA 3MH2A 3BYVA 4TV7A 4Y95A 1WWXA 1REJA 2X2KA 3QD4A 4WRSA 3R9RA 2LAVA 3BHVA 4FZDB 4IQ6A 2X4ZA 4HVGA 3QKMA 2F5CA 1HCKA 3VS3A 1K78B 3KRXA 1PXMA 4I98B 2YIRA 4E93A 2W9FB 4FEQA 2BRGA 2D2WA 3NCZA 3UIXA 3KP7A 4FV7A 3LXKA 3D5XA 4BKJA 3K0LA 3LM5A 3UC3A 3V01A 4IM3A 4FEWA 1EH7A 2W1HA 4L6QA 3HECA 2V1XA 1KA8A 1W7PB 3OCGA 1KOBA 2WQEA 3BYSA 3ZZWA 2YWVA 5LEKA 5DD4A 2CKEA 3GI3A 2CKQA 4O7ZA 3P79A 4UZDA 1PXJA 3PIXA 2VOOA 3VC4A 5L8JA 2XNOA 1R36A 4GT3A 4EKLA 1SFXA 4L53A 5HE3A 3DPLC 2CYYA 3ZSIA 3FXRA 4ZS4A 2UZUE 2X7GA 5A54A 1LEWA 3SXYA 2I0VA 3FKLA 2YWPA 3KXHA 2O65A 4CYJA 3EJ1A 4QMWA 3LFBA 3R7OA 4BIBA 4ZTHA 5AUWA 4OBOA 5A6NA 2HFHA 1HW5A 4HYSA 1UU9A 5FGKA 5H20A 4IDVA 4NIFB 4CCBA 4M69B 4NTSA 1J9IA 5CVUA 4YLKA 2DU9A 1FP2A 4J8MA 4YHJA 1TKIA 1ZH5A 4LD5A 3ZFYA 3CLOA 2PUPA 1LP4A 3P86A 4WA9A 2FGIA 3DDQA 4ACGA 3KE2A 4I94A 5GJFA 3CS9A 2E9PA 3FHIA 3TDVA 3EDPA 3WZKA 2YIXA 3NYOA 1FZPB 4LL0A 3HRMA 4O22A 1PXNA 3HUCA 3E6DA 1YDTE 4KIQA 4F9WA 3D9VA 2VTPA 3SX9A 5HTCA 3C0IA 3PE1A 1E17A 3L8PA 4RWKA 4M3QA 4F1OA 4OR5A 5E8YA 4I0RA 4O0YA 4LMYA 1KUTA 5FDXA 2YM4A 2MH9A 5IEYA 4FSQA 4EOSA 3HSFA 4Z55A 3FV8A 1KU2A 1TQPA 5HO7A 4CG8A 2BHHA 4HX7A 3GVUA 4EEVA 2Q0NA 1FQ1B 2XK3A 4F7JA 2W85A 3TI1A 2GS7A 4C4EA 3M1SA 3MGYA 2K27A 1PJKA 4Z3VA 4OTRA 5M4FA 4X2GA 1UVRA 2J7TA 3BP8A 5M09A 1REKA 3V7SA 2JTVA 4XOZA 4DFYA 3KQ7A 4QMPA 4O0UA 4RAYA 3K5UA 4C2VA 4GT5A 3Q9ZA 3QTXA 2RV8A 4MNEA 4DLJA 4BH9A 2CWEA 2PMLX 2YIQA 3ZUTA 3NLBA 4A07A 4FSUA 4GEOA 4RBLA 3FE3A 4ZLZA 1T0FA 3CSVA 2M45A 3ZMVA 3ULQB 5J8FA 1ODDA 4O38A 2P2IA 4IVBA 3I7BA 4MQ1A 4YTCA 2D1VA 4C4HA 2JRTA 4NEUA 1BMKA 2UVXA 5AR2A 2ZV9A 4RA4A 3RKYA 5TRDA 4FTIA 4KIOA 4C3RA 3L9PA 4Q2AA 3WTUC 3K1PA 1P6RA 4ENMA 4S05A 3RPOA 4AZFA 5BVNA 3HRCA 4S31A 4BCGA 4BHPA 6PAXA 1BI7A 4V05A 1QPEA 3GOPA 4IAAA 2XIXA 4RFYA 4AZEA 1R5GA 1UWHA 5EW8A 2PMHA 5AR3A 1OPJA 3MY0A 5DFPA 5CT0A 1ZY5A 3QQJA 2ZV2A 1I44A 3K9TA 4FKWA 4JAIA 4I02A 5D11A 2RFDA 5ETCA 4GG7A 3MI9A 1PXLA 4MNFA 4WXDA 3RKWA 5T68A 5FTGA 5HG7A 3QTRA 5KUPA 3MB7A 5CAQA 1FBQA 4Y5HA 4FNWA 3M42A 1U5TB 5LEJA 3QLGA 1LJ9A 1M7QA 3WTVC 2W5HA 2OG8A 4UV0A 5KK1A 4FV3A 1OMWA 4YLLA 4O7WA 4Q5SF 2H6CA 3UOJA 3B8QA 2W4JA 4FKVA 2M87A 4IW0A 3F8CA 3WF7A 5D9HA 1H00A 2EB3A 3MH1A 5HNIX 4J98A 3EMGA 1R1UA 4FOBA 5JN2A 1J7IA 5IZFA 3FLSA 2XIRA 3R21A 5L2TA 3RTPA 2XKCA 3LLTA 4EGYA 3TZMA 4CG9A 4NZWB 3OY1A 2YR2A 5E8XA 2BCJA 2PE0A 4QMYA 3AOXA 3QRFF 2ITWA 4FC0A 2IN6A 2VWZA 2XB7A 2REIA 3ATSA 3RP9A 5AV1A 5AUXA 4F6SA 3HYIA 4ZY6A 4I6BA 5BPIA 4RX8A 4YGAA 2ZM4A 4D2VA 3WE3A 4F7ZA 1UB9A 1E9HA 3RPYA 3OMVA 3PJ2A 2Z60A 4MAOA 1F5QA 3LFEA 3SHFA 2ZXJA 3DNDA 3RAKA 2QOHA 4CZUA 2RFEA 1PXPA 2R3RA 2EB7A 4NW6A 3F88A 3SG8A 3I59A 3FWEA 5HU3A 4YJPA 3ID6C 3E5QA 3P9KA 1GZNA 1IA8A 5J8IA 2FNPA 1UKIA 2JKKA 4G9RA 2YAAA 3LMGA 3QQHA 5A4CA 3ZN1A 2V0DA 2JIVA 3HKOA 3W18A 1M14A 4W4XA 2Z5UA 4OMYA 1SVHA 3DPKA 3SC1A 2VNWA 1HW2A 1M7NA 2HENA 1I6XA 3HTSB 3BROA 2ITQA 3LAPA 1YWRA 4P2KA 4E26A 5ETAA 3Q9YA 1TVOA 3H3UA 4PPCA 2H9VA 4LYNA 3PY3A 1J91A 4AT4A 1HKQA 5JQ5A 4R78A 4KAOA 1R23A 3RKXA 4H39A 4NL0A 5CAOA 3V6RA 2OA4A 4N6YA 4CV8A 4F7NA 3Q53A 4FICA 4LJZF 2R7DA 3ANRA 1W7HA 4F0GA 3IDBA 4A5MA 5EEHA 2AS5F 1Y8GA 3NW7A 3RKBA 3KZZA 1FYLA 4IAKA 4HVSA 3GU8A 4W4VA 4DFLA 1Z91A 1WI9A 3IONA 2BRMA 1OKRA 1RQQA 3DLZA 4FX3A 4BY9E 5L3CA 4N9HA 3BPRA 4XBRA 3HUBA 4D0PA 3EH9A 5HTIA 4WO5A 1ZRFA 5AP0A 5IDPA 4UN0C 2ZM3A 3NYVA 4CHUA 3WIKA 3ZFXA 3DT1A 4RJ8A 3FLYA 1U46A 3WTWC 3MTFA 3QLFA 3UBDA 2UV2A 3BGQA 3PZEA 1H28A 4Y13A 4QO9A 3OZ6A 3HA8A 4IC7A 1Z05A 5IA0A 1MQBA 5IA3A 3R02A 3CTAA 2XEYA 5DCMB 1MGTA 2R64A 1R39A 5L3DA 5LMBA 4A6EA 3IDPA 5JFVA 1YS6A 2QVOA 3KXMA 1G3SA 1Q8TA 5LVLA 2X9EA 4ZSEA 2HR3A 3R9NA 3NVKI 1OYWA 4FTOA 3SXRA 2F7XE 3W2RA 1YDSE 3QKLA 2JT1A 3B2WA 2R4BA 4G7HF 2R3NA 5IMEA 4ZTRA 2ETMA 4BGHA 4BYJA 4ACHA 4RQVA 5AEPA 4RJ6A 3SZPA 2M30A 4WT6A 3ZM9A 1SVGA 3WGIA 1B9NA 2X2LA 2C6DA 4IZAA 1GY3A 1DI9A 4K2EA 4EH6A 2V5QA 5AV3A 2YX7A 3L7WA 3ZMTA 3LAUA 3BHUA 3UMXA 5KMNA 3LCSA 3T8RA 2YCSA 5FWKK 3AD5A 4O1OA 2C3KA 4MXXA 1P4FA 2YDKA 3I5ZA 5AIKA 1JSUA 2O2UA 2K7LA 3I81A 2D1HA 2ITTA 3QPTA 4M72A 2IW9A 2XASA 5CQWA 3JSPA 5BX0A 2FNAA 3ECHA 2BYVE 4RIXB 4RJ3A 3EN4A 2YERA 1TLHB 3DJ7A 5IUGA 3EZRA 4EJUA 2JAVA 3ELJA 4MD9E 3D15A 4NM7A 5BMZA 3DV8A 4NFNA 4ITHA 3TTIA 4EOIA 1KU7A 3A61A 3W16A 1G6NA 2M8EA 2Z9OA 2C4GA 2PVYA 2VBXA 3K1NA 4YJRA 3ZC6A 5ANJA 2W9ZB 4K0YA 2G9WA 2VO7A 5J95A 1D5VA 1OBDA 2LGCA 4ZSGA 2KKOA 3QD2B 3IW4A 3N9XA 4C57A 1Z5MA 1PXOA 2CPKE 2XK9A 2O6GE 2PI0A 4Y72A 5J7HA 4OIRF 5E9EA 4MBLA 2UZVA 4JRNA 4WUAA 5CU2A 4NWMA 2PN6A 2FVDA 2STTA 2XKOA 4S30A 2EWAA 3TACA 3WF5A 1PMVA 2AUHA 3QFVA 4L8MA 2B52A 3EFLA 4E6CA 1ZAOA 5L2WA 2O8YA 2IVSA 3ROYA 5HCZA 4BTMA 2H34A 4FK6A 1JHHA 5BOXA 2XAHA 2B1PA 3ERKA 2ZB1A 4PUZA 4I22A 1AWCA 4WXHA 3EKKA 3KC3A 3DJ6A 4PP7A 4FZ6A 3QKKA 3WBLA 4I5HA 3C51A 2CGXA 4PMPA 2OSCA 4FBXA 4L5JA 5BNJA 2FEZA 4I92A 5HLWA 2LDUA 4P96A 5E4HA 5F64A 4C2WA 2PVMA 3MBLA 3O3KA 3FXXA 2F4JA 2L54A 2WHBA 3KCCA 4XSXF 2YAKA 3NUXA 3FMHA 2J2IB 4K2RA 4U44A 2EA2A 1J75A 3R04A 2VTNA 4I09A 2CCIA 3HIFA 3EFKA 1PW2A 3VS0A 3O96A 4YHFA 2C3LA 3R1YA 4D4RA 3OTVA 2L01A 1JKTA 4ANNA 5HESA 4BB4A 1O3SA 1AOYA 3E5XA 2X6DA 4XV9A 3O23A 3E5UA 4A7CA 3V5PA 1ZG3A 4Q9ZA 2WFYA 3PY1A 1QPDA 3GC9A 4FE2A 2D45A 1Z6TA 1SVEA 4DGGA 1XBCA 4QTBA 1YHVA 2VTTA 4MXZA 2UZLA 4C62A 4AVPA 3IS5A 4ONAA 3OEZA 1ZZ2A 3TJDA 1Y91A 3EQLF 4BI0A 2X4FA 4PY1A 4S33A 3D83A 5DGZA 5LGUA 3PSCA 5CSXA 2ESHA 2BILB 2A19B 2G9XA 3ORZA 3VW6A 4L00A 1PYEA 4F08A 5CI7A 4ALVA 3OWJA 3TZ8A 5D5WB 3HUGA 3KEQA 2J5PA 3WZJA 4LGWA 5AUZA 1R78A 4IB3A 3TKYA 2ESMA 3P9IA 2A27A 2W99B 4FTNA 4I1ZA 4TYHB 2WPAA 1L3LA 3II5A 5DNRA 3G0FA 4DEEA 1YOMA 3NW6A 1JBPE 4P55A 3FYJX 2B9FA 3BCEA 1DP7P 2FBKA 1XQZA 2FSLX 5J1VA 4NTTA 3NRVA 3PJCA 4XEYA 4WNPA 1BIAA 4LV8A 4U88A 3QALE 5JZJA 2VAGA 2R2PA 3UC4A 2H6DA 4YZNA 4YR8A 3BJAA 4IX5A 2W0JA 5CSPA 3KXNA 3MVLA 5J9LA 5FTQA 3ZLYA 5HOAA 4D1XA 3BJ6A 3Q9SA 5A4EA 1SNUA 2B7AA 3HA6A 4GH2A 1WVXA 2V79A 2QQBA 3UG1A 3KZYA 4HDUA 3LQQA 2VUWA 5HX8A 3I71A 4K77A 3KMMA 2QI8A 1QQIA 3OOMA 2HQNA 2H09A 2GCDA 4EYJA 4L44A 3VEPA 2R3KA 2X2MA 1R1WA 2W1ZA 2XH5A 3OBGA 1O3QA 3RGFA 1H24A 4DGMA 3PVUA 4U9AA 2PVHA 3W32A 2HZTA 1YXXA 5KMMA 3R2YA 2F7ZE 5CEPA 1DS5A 1QCFA 4R79A 4DG3E 2VE9A 4E4MA 2FXAA 3W6KB 4NW5A 2P5KA 2CFXA 1OKVA 3ZTXA 4AZTA 4XG6A 5HVKA 2VWVA 2ERKA 2OKRA 5C1QB 4BBFA 4ZTNA 3MH3A 4QP3A 1PHKA 1R22A 2HGCA 3A8WA 4UMPA 3F3UA 5BMSA 2IJMA 3TT0A 3RNYA 2C69A 3TUDA 2YACA 3ZM4A 3CDHA 5AWMA 2VC0A 1Q4LA 4FYNA 4FSTA 4HW7A 4Y15A 1Q97A 1W7PA 3CEKA 1E1XA 2QC6A 4I24A 3LJ1A 3M1EA 3PTGA 5ETFA 3GBZA 2KRFA 3UO6A 2VTRA 3R00A 1IN8A 3QTZA 1W7PD 4QYFA 4UY9A 4QMVA 2ISYA 4G94A 1FGKA 2ZBKA 4FA2A 2XUUA 3F8FA 1G3YA 3PRIA 4U7ZA 3UQGA 3V5QA 2Z02A 5JSMA 2WQNA 3R6SA 4E4LA 4UWYA 1IRFA 2RQPA 3H9OA 5HORA 5L2IA 1W82A 3S4QA 4EM2A 4LB6B 3QRUA 2FRHA 2XAJA 4HGEA 4KT5C 4E5WA 3EFWA 3P7NA 4MTEA 4P4CA 3SLSA 4AUAA 5KE0A 2QYOA 3UNJA 4B0GA 4O2PA 1TQMA 2XUBA 3GP0A 4IHPA 4D58A 1JSTA 3QYZA 3ORMA 4F4PA 3R2BA 4ZTMA 3JVRA 3RYRA 2BZJA 4BCIA 4AGWA 4RC4A 2RFSA 1SFEA 3ETAA 3RYPA 2V22A 1A04A 4TW9A 3ODYX 5EYCA 1SNXA 2PWLA 3RMFA 3E3PA 3FMDA 1WRJA 3MPMA 3FZVA 3C50A 1F5TA 3MDYA 4MXYA 3P23A 2DT5A 3MPTA 4G9CA 3C5IA 1H9TA 3DJ5A 4U0WA 1YQJA 3AXWA 5DV5A 3ANQA 3DXPA 1B4AA 4X2NA 2W05A 4ZYHA 5AMNA 3J81Z 4AFEA 3KL8A 5JQ8A 5K1YA 2XM8A 4AIJA 4QMQA 4HDVA 3QQKA 2HELA 2RVCA 4XCUA 4V0GB 3VOEA 4KKHA 4HYUA 4ERWA 2QBYB 4I5MA 3C5UA 2CCHA 2ZAZA 4IM0A 2QOKA 3KCKA 4EBVA 4BC6A 1ERKA 3TUBA 4CNHA 3QOPA 5AP5A 2IVUA 1LDJA 1JPAA 2GFCA 4MTAA 2M1BA 1Q99A 4DYMA 3E7OA 5D6EA 4EJVA 2FOKA 3PQKA 2O0UA 4GJ3A 4ZZNA 4W9WA 1K7AA 4QMNA 3F6OA 5DYMA 4AOJA 2WTDA 4EONA 4BDEA 2EU9A 5ILSA 1Z7UA 1UWJA 5F95A 3IL2A 2PVJA 2XP2A 4KN4X 2PEXA 3V8TA 3PQJA 3NZ0A 3FPQA 1Q8WA 4G6DA 3CY3A 5IQAA 3R63A 3CGOA 2A07F 3Q60A 5AAFA 3BU5A 3ORXA 3AD6A 1ONVA 5BYZA 3QZHA 5F1RA 2Z33A 3Q3BA 3GYHX 2ZMEB 4D9UA 2DI3A 4I21A 3PPZA 1B6CB 2ZDUA 4L3PA 3LCTA 1BC7C 3D0SA 3QWKA 3U1DA 2PBIA 4R1YA 4EJTA 4C3PA 5CTPA 3CUOA 3POZA 3ZRMA 3Q5FA 1DDNA 1K9AA 3JXWA 3NS9A 2W1IA 4KRCA 3ROCA 4EH5A 3H3CA 4XLNF 4W8EA 1YI6A 4EK5A 4XSZF 2QZ8A 2W1DA 1U5TA 1BKXA 2PE1A 4YTFA 5FTOA 2Z2WA 1UV5A 3R8PA 2A69F 3I6WA 3UNZA 1OL7A 4IM2A 4XX9A 3TGNA 3V8SA 2EFOA 5CU0A 4GCVA 2IW5A 4UUVA 4J95A 3TUCA 5ICFA 1FOTA 5FRIA 4CXFA 5A4LA 4XLPF 2CGPA 1UNLA 1A06A 5LWNA 4RJ4A 4EL9A 4ZLOA 3V5JA 2O61A 2IT0A 5GNKA 3P7BA 5LQFA 4HVIA 1SMHA 3BY6A 5EQPA 3EQBA 2WMQA 4G9YA 2X8DA 4XLIA 4I93A 5HBEA 4ZSAA 2QOQA 4J8NA 3PVWA 3V51A 1H07A 1V4RA 1U78A 1JKSA 5E18F 2QOCA 5HE2A 2J50A 4PP9A 1OBGA 2FMLA 1CGPA 3H9FA 4AOTA 4YZDA 2QONA 4RPVA 3WU1B 4DC2A 3MQ0A 3DDPA 1GIHA 2V62A 4I4FA 1J0RA 2GNHA 3W1FA 4GT4A 3QUEA 4HOBA 4OINF 4LMNA 1PUEE 1MRVA 3KP6A 4ZY5A 1Y0UA 2NNYA 2Y48A 1G4DA 3CJFA 1RUNA 2WZJA 2DQRA 3NUUA 3QP5A 4G8XA 4NJDA 5CVHA 3VUDA 1RJBA 3W33A 4HQEA 3OD6X 3A60A 3NMUF 5LMAA 3ZEWA 3B2TA 4H58A 3FMQA 4KIKB 5DEWA 1O57A 5IQHA 5L8KA 3K1MA 3FEGA 3NVMB 4ZJJA 3G5DA 2X39A 2JDTA 4H3QA 3GFIA 4EHGA 4FZ7A 1J59A 1FMOE 1ZG5A 4IJPA 2CKPA 4CGAA 1ZRZA 3A8XA 3S2PA 2KJBA 4AA0A 4YUQA 3PIYA 5I3RA 2R7FA 3VFZA 3F3ZA 1G3WA 3LFNA 1R5HA 3TNWA 2VODA 3F2AA 3MV5A 2EFQA 2OFVA 3DK6A 2KTYA 3LCDA 1IN5A 3LIJA 1VTNC 3MPAA 3RCDA 3CQUA 5K5NA 4JQ8A 2NNNA 1XD7A 5LRRA 3TNQB 4XBUA 2PUNA 4I6QA 1PP7U 5HDKA 1LEBA 4G3DA 2OQGA 5JH6A 4E3CA 4C3FA 4FKRA 3OF0A 4MQ9F 3FDNA 1S9JA 4YZCA 3DKWA 4WKQA 2K4JA 3T8OA 3BYOA 5IA4A 1T2KA 3QGYA 2YPRA 2A6HF 3E3VA 3O2MA 2BZKB 3GCSA 3OS3A 3ACKA 4JQFA 1YWNA 3E3BX 1CF7B 2HZIA 4E8AA 5GJDA 3LFQA 5JFXA 2VE8A 3BBTB 4EH7A 1CM8A 3COIA 3DCVA 3AMAA 3GX4X 3NIZA 4UB7A 3LMIA 3WILA 1KYWA 2YN8A 4QOXA 3ZUVA 3PSDA 3L8VA 3IWFA 1SD5A 2QUFA 2QU6A 3EYGA 5BS6A 5JK3A 4KNBA 3MIAA 4DLIA 4GUBA 3A4PA 2W17A 4E4XA 5K5OA 4RIOA 2JD5A 3BWJA 2W1GA 3IOPA 3EL7A 3ORNA 1XDSA 4MWIA 3AG9A 4IC8A 1XH6A 5CXZA 4YSJA 2HW6A 1IN6A 1UHWA 4C4FA 2GS2A 3T3VA 4LGHA 1Q62A 5BVOA 3PJ3A 3FC2A 2OH0E 2WMVA 1HOWA 3R0JA 3QC9A 3FY2A 2VTMA 4KKGA 1USTA 1G8AA 1YHWA 3AAFA 4L52A 4D5KA 4E5BA 2WU6A 5HGIA 5FD2A 4IVAA 4BI1A 3O7LB 4FVPA 3WARA 5IPJA 3RAWA 4WOVA 1FINA 1JKKA 2VWXA 4A4OA 4R6VA 1ZLKA 4IDTA 5AAGA 3ZHPC 1QL6A 2KULA 4G7ZF 3V7RA 1XSDA 5LCKA 5C9CA 4PGHA 1KQ8A 3NPCA 1Q3DA 4F65A 4G17A 3IRRA 2YX4A 3OT8A 4EOMA 2VT3A 3FMNA 4UYAA 5BVKA 5A4QA 3I58A 3HAVA 3FMMA 2W4OA 3PWDA 2F2EA 2RFNA 1YG2A 2IP2A 2GQRA 2R3JA 3VB2A 5CF6A 3VULA 4CCUA 2ZYBA 4YFNF 4V01A 1OPCA 3KP5A 4ZIMA 4BZOA 5E1SA 4U42A 4XHKB 3TDUC 1PP8F 3WTTC 1A48A 4DEGA 3VQUA 3Q4TA 3QZIA 4BBEA 2VNYA 4ENKA 5M57A 4M74A 3BDDA 5FDPA 2RN7A 3FZOA 3VODA 1WSUA 5HVQC 5KX8A 1XGMA 1BI1A 5IF1A 2J4ZA 3OCBA 2QOIA 3BU3A 4BDBA 4RIXA 5K5XA 2HTSA 1O6LA 4M14A 5EYKA 1MQ4A 3CUQC 1ZOGA 5HCYA 4AW1A 5J7BA 4HGLA 1OR7A 4I7HA 2W84A 1T39A 2OD5A 1FLIA 4F0FA 2ETRA 3I7CA 4R1HA 3EQIA 3ZRLA 4AOIA 3FZ1A 4ACDA 4Y83A 3QCQA 4QPSA 1OGUA 3WZDA 3ALNA 2OJJA 4FV6A 5EHYA 3LOKA 4CFMA 3MY5A 1R00A 5HO6A 4R77A 5BVWA 5A6OA 2ITUA 4EHVA 3FYKX 1XO2B 5HG5A 3SRVA 1OL5A 2J5OA 3VUTA 2P0CA 4CICA 1O6KA 4F64A 3F61A 3ZPLA 4ANBA 3C4EA 4HV6A 4IZ5A 3R01A 4OLIA 2OQRA 2I0EA 5HCXA 2E1NA 3TIYA 4LRKA 3TIZA 2EB2A 4MK0A 4F6UA 3QRKA 4E7WA 4JBOA 4O0TA 3GU7A 5ED4A 5I9VA 1YDRE 2GQQA 1XN7A 2HXQA 3ACJA 4WUNA 2ISZA 4HZSA 2MLKA 3ENMA 3DBDA 1BI0A 4R3RA 4FV2A 2C6TA 4YJQA 4RS8A 3P0MA 3TG1A 5IUHA 3NSZA 4KKEA 4J97A 2R0IA 3DOGA 1UCRA 5CXHA 1F1ZA 4CLIA 4ZSLA 3FX3A 3R8LA 1OIQA 4Q4ZF 1P4XA 3SQNA 3HV7A 3UVPA 2HIWA 3MA6A 2HY0A 1ON2A 1JVPP 3NX8A 4LUDA 4QMLA 4XG4A 3LLAA 1XCBA 2F7EE 2FSOX 4O0RA 5L4QA 4DH5A 1GZOA 3ZCLA 1U54B 2P33A 3AC8A 3WF8A 3DAKA 2C47A 5EYDA 4GFGA 5IQCA 1KQ0A 4R3CA 5K5RA 4GUEA 1O9UA 3LCOA 4WG5A 4Y73A 5TO8A 3PYYA 3E6MA 5I9YA 4HPUE 4ZYEA 3LA2A 4O7NA 4RIYB 1ZOEA 4LG0A 4PNKA 4HAMA 1SAXA 4O0VA 5JZNA 4PPAA 2X0GA 5KMJA 3R8UA 2HOGA 3KP4A 1MKMA 4JJRA 1ZN2A 4U0VA 4PRJA 4FEUA 1BX6A 2XAGA 4GCJA 3MYGA 1TTYA 3Q9WA 3D5LA 2DPUA 1Z57A 3DKFA 5DT3A 2DQLA 4TY1A 1IAHA 1IN4A 4QNAA 4YTHA 3BI6A 5AM6A 3V5LA 1TNTA 3Q52A 4FT3A 4B8MA 3K54A 5A9UA 5ANDA 2CGVA 2QLUA 4LM5A 4X3FB 3DXJF 2YLEA 3N97A 1DPUA 3UPZA 5JGBA 4QWQA 2R3LA 3OBJA 3H3ZA 4RX9A 2C1BA 1FPUA 5IEVA 2WMSA 5DIAA 4LOOA 4CKIA 1FSEA 4XS2A 4CYDA 1IRKA 1W8CA 3RPSA 3Q6UA 4I0TA 1ZXEA 2IA2A 4AT5A 4BBMA 3NUSA 3G9NA 2CJMA 5LHHA 1OYYA 3CQEA 3MFRA 4OTGA 3FMLA 5AA9A 5IA5A 2ZMDA 2XYUA 2O3PA 3ZONA 2XF0A 3ZQ7A 1S9IA 2WELA 3MWUA 2VOPA 4MD8E 2FO0A 5GZ9A 3WODF 2V1DA 3GWZA 3G0EA 4BHZA 1H8FA 2OO8X 1LVAA 3P78A 2UXNA 1YWVA 3G15A 1J7UA 1BOAA 2XCKA 1NVQA 3DFGA 4A0YA 4MF1A 4GO1A 4F9CA 4EQCA 3BPXA 4KUMA 4DBXA 2WTCA 2I40A 2JDSA 4QP8A 4AG8A 5FD6A 4UVAA 3DNEA 4M68A 4YJNA 1V0OA 3VN9A 4IHTA 2OZ6A 1NHAA 4HCTA 2E7XA 2H94A 2A1AB 5BYLA 2FA5A 3V04A 3O50A 3WE2A 5FB2A 3R71A 4N0BA 4RIWA 4RFMA 1J1CA 4BAYA 5AP7A 5HLGA 1YFHA 3RM7A 3KLOA 3GXOA 5AV0A 4YP8A 2WO6A 3IGOA 4U80A 1JOWB 4FUYA 3QHRA 4QMMA 3ORLA 4XNEA 1YS7A 3NNVA 4O82A 1T98A 2WTKB 4HGSA 3UDBA 4EH2A 2E9VA 3MFUA 2PVKA 3QCXA 3EYIA 3DAJA 4WRGA 4YMJA 5FGMA 4DEBA 1QZYA 5KKRC 4TNDA 4FUXA 5TKDA 3HRFA 5E8VA 3IK3A 2YEXA 4E6QA 5D6FA 2BTSA 5M4CA 3V4GA 2UVZA 4IWQA 5AIRA 3IG7A 2XNGA 5AUUA 1XJDA 4OAVB 3DV3A 1DPRA 3KRJA 4L43A 2GDOA 5EM8A 1OITA 4E70A 2HWOA 4L9IA 1P92A 3GFJA 3IW6A 4LK0F 4HV5A 2PL0A 1JAMA 4RSSA 4N70A 5CU4A 2ITZA 1U5RA 4BHNA 4OGRA 2OU2A 4YSMA 1WBWA 2L4AA 5FEEA 5FM2A 4BWKA 2IZRA 4QTCA 4D4YA 4DEHA 4UHTA 3UP7A 2P4WA 2VC1A 4UALA 1GAGA 3A7IA 4RMZA 4D28A 3L8SA 3QTIA 1PYXA 1CKPA 2ADUA 5ERIA 2YJRA 3PPKA 3A7FA 3FI8A 3MY1A 3JY9A 2BBYA 5AUVA 2YA9A 5JGAA 3HDMA 4QPAA 3O8UA 3P5KA 2QHNA 5L2SA 4CFWA 5HI2A 3I60A 4YNOA 4EOPA 3RZBA 2YLFA 4B09A 3MCZA 4ZK5A 2IZSA 4RX5A 4ESFA 4U7DA 5FFZA 4ENNA 2EVAA 4HF1A 5DRBA 4F9YA 5HBHA 3BGZA 4BCPA 1XGOA 3DB8A 2GIVA 3HMMA 4BDFA 2G15A 2WTWA 2XM9A 3BQRA 3D7ZA 5HLHA 5DE2A 4DE4A 1PDNC 4QQ5A 1NT2A 3ELKA 3E92A 2LSOA 3I6UA 4JAJA 3Q6WA 1K3AA 4IMYA 1GJOA 1BI3A 4EGZA 1JHFA 4O0XA 4TL0A 2CSNA 4FIGA 5AJQA 4QQTA 2XMYA 4BCFA 5DPVA 4QLCU 4OMZA 4WWCA 4ZY4A 3BV2A 1OMIA 2GNFA 4FR4A 4LOPA 4BHBA 2QM3A 3ZYAA 1CDKA 3EQFA 4BCJA 1FBNA 2HWPA 2WMRA 3KCFA 4A9RA 4DHFA 1F0QA 4O2ZA 4CO8A 4V0GA 4CD0A 3UMWA 2VT2A 2BZIB 4O83A 3LFSA 2QBYA 3C0GA 2XIZA 5BVDA 2IZUA 4HYHA 1U6GA 3OTUA 3KP3A 2E2BA 5D8KB 2ITXA 2F5DA 1OYIA 5FO5A 4HZFA 3D7TB 4BWPA 4WF2A 5E1XA 4BDIA 4O0WA 1R1VA 4AQCA 3SKCA 4LG4A 3N4MA 3Q4ZA 3V8WA 4M9SA 5DHJA 5FG8A 4I4EA 3I5NA 3K2LA 4HVDA 4R5YA 3P08A 4Z2YA 2B9HA 3ZBFA 4C8BA 3ZDUA 3KU2A 4FI1A 3C4XA 3FI2A 4EJ7A 1LUFA 4J52A 2X8IA 2NRAC 3VQHA 2R3SA 2XRNA 3UVQA 2BIKB 4Q5HA 3KXXA 5HLPA 3HSEA 5JT2A 4ZAUA 2WTEA 1PF8A 4JS8A 2C0OA 3IECA 4EOQA 2W5AA 3OVVA 4FT8A 4WCGA 4QMXA 4G1WA 2JIIA 3RK7A 4MBIA 4FKQA 5ANKA 5K5QA 1O6YA 2LF8A 3PFQA 4IE9A 2A61A 1WBNA 4HQMA 3EL8A 1T46A 2P55A 5L3GA 5JRSA 2GS6A 2FH9A 1NVRA 3HAMA 5EM6A 3RM6A 5LVPA 1B6AA 4AFJA 1STZA 4NB5A 3N4TA 5DRDA 2HKOA 2R3PA 2H27A 3P9CA 3QU0A 3CTHA 3H4JA 5M44A 1E2XA 3HRSA 4MVFA 5ICEA 4G6LA 4FEXA 1HKTA 2FB8A 1MRUA 4JG6A 4LFUA 2RF9A 5CI6A 4EK8A 2PMIA 2QODA 3MN3A 4WBOA 4L42A 3OXZA 1I27A 5E91A 3CTJA 3C0HA 2FUMA 1XCVA 4FOCA 3AC3A 4X3JA 1V0PA 4S04A 4IB1A 3UJGA 4EMSA 3E8DA 3P7CA 5I9XA 4Y8DA 3WU0A 4M12A 4IRIA 4PL4A 2W24A 1KE5A 3KY2A 3GCQA 2QOOA 4CRSA 3ORKA 4YJOA 4IXAA 4EHEA 1KWPA 2YISA 2P5VA 1PMEA 1H1QA 4FT9A 4EYMA 3TTJA 3HSRA 5H6RA 3VRYA 5DEQA 4RC2A 4DH1A 3KXGA 4DGNA 5E8GA 5HD7A 1APME 3FM5A 3SFZA 3GUBA 3UZRA 4J1RA 4TTHB 4UEUA 1XWSA 4IRHA 4DTAA 3FQHA 4CFVA 2CLXA 3HL7A 3R28A 3TV6A 2HAKA 5D8LB 4FTAA 2B9JA 3VUMA 2GQSA 3DZOA 4FKTA 5E17F 2JDOA 4RVMA 1LEAA 1L8TA 2OLCA 4IX4A 5GZAA 3AD4A 5K4JA 2XGXA 4PTCA 1OKWA 4E1ZA 2UWMA 1SMYF 1S7AA 5HNGA 2CNUA 4HLYA 2UZEA 3GC7A 4F0IA 3VRZA 2VBWA 3A4OX 3I0TA 3EWHA 4KICA 4KIKA 2V55A 4H1JA 4TWCA 3GOKA 2W4KA 1I09A 1XHAA 3O2PE 5AUTA 4ZYDA 1QPMA 3VUHA 2GA2A 2UVYA 5EOBA 1FT9A 2Y9QA 4GSBA 3C4FA 4QD6A 4PDYA 2WWYA 3QRJA 4ZTSA 3COAC 1ZREA 4P5QA 5D1JA 2Y4IC 3KREA 1TQIA 3JPVA 4A9TA 2A4LA 4F1MA 3RK9A 4BIDA 1JNKA 2EFNA 3GENA 4FV1A 4L67A 3OEFX 4EZ7A 2QWWA 2ACXA 3R6XA 3LJ2A 1ATPE 2AC3A 4RVKA 4O21A 4AIKA 4L9NA 1HQCA 1FVRA 1OM1A 1R3CA 1BM9A 4JT3A 2GPHA 5DMZA 4MNUA 5DT4A 2QURA 4EOKA 2X7OA 3C4CA 4EZ5A 2LNBA 4DINA 4OOIA 2P6SA 1OUYA 5I5ZA 1M52A 2ACJA 1YW8A 5LGNA 3QTQA 2F49A 2VWBA 4MNEB 2C3JA 4FT7A 4KWPA 5BUEA 3GB2A 3GW2A 1TW3A 3WTXC 1Q24A 3AQVA 3WG9A 3E8NA 3H30A 4AGDA 3QU3A 3I4PA 5A46A 4FSRA 4JIKA 1RUOA 2NPQA 3JUHA 2DBBA 3NUYA 5IH4A 4W8DA 3KVWA 4ZZMA 2Q8KA 3FXZA 2BR1A 5JEBA 3C18A 2BRHA 3OUNB 1YOJA 3FSKA 2X0LA 4FKUA 4LMUA 5ICCA 3T5XA 4FV4A 2OXDA 1DAWA 3B8RA 5E20A 3AGMA 3NUPA 4USEA 4O0SA 3UODA 5DVRA 1OKYA 2CGUA 5AFVA 3KA0A 1Q3WA 1CMKE 4FKGA 4IH8A 1YW7A 4CZZA 3HV4A 3BQCA 4FTCA 3F3VA 5IKWA 3RCJA 3TNHA 3MSSA 3MB6A 3WZEA 2QQAA 2DUVA 3W2CA 3MJ2A 4EQMA 4IX6A 3W2OA 2MA3A 4F7LA 1O3TA 3E88A 2WOTA 5C01A 4QT1A 3WF6A 1F4KA 4M73A 5GJGA 3UIUA 3ZN0A 1G8SA 1SD4A 3DTWA 3DFAA 2CKOA 1XBBA 3DGKA 4YU2A 4O7SA 5IISA 5FXSA 4OBQA 2EXCX 2VD5A 4JOAA 2BKKA 3F3XA 1BUHA 5EHLA 4OT5A 4IWOA 4CV9A 4ZYGA 3F69A 3S3IA 2G2FA 1DM2A 3PP1A 3LMHA 4EV0A 4BDCA 3LZBA 1S8NA 4XMOA 4W9XA 4F1TA 5IQIA 3KMWA 3DKOA 4G6QA 4BNCA 1SMTA 4BWXA 5KMOA 1B1BA 1XB4A 4FTJA 3PVBA 4GVAA 4OTPA 5IQBA 3A7HA 4KA4A 2QENA 5BVEA 5KHWA 3Q9XA 3AC2A 1XMAA 1YXVA 2JDRA 3PLAE 3QGWA 5AONA 4I3ZA 1FY7A 3F72A 2PPQA 4DH7A 4DF3A 4AF3A 3RJPA 1Q41A 5H6QA 2Z7SA 3BEGA 4RFZA 5CEMA 3A7GA 1I1GA 3T9TA 1YXUA 3FI3A 5LRSA 5IU2A 2EJRA 3V8LA 4DQ2A 3LKMA 3GLXA 4JX3A 3UYTA 1TBXA 5IA1A 5CLPA 4ZSJA 5KZ0A 4L9VA 2NS0A 4YPSA 5EDQA 2C30A 4FEVA 5H8GA 1E1VA 3IGGA 4A9SA 1Q8YA 5FP5A 3SW7A 4P90A 3LQ5A 3MFTA 1ZLJA 3OW3A 2OJFE 2XKPA 1GZ8A 4BDDA 3ZO3A 2KJCA 3I59B 4ZEGA 2BDWA 1VJYA 2C5VA 1R0EA 3KULA 4KFCA 4ARKA 4Y46A 4H36A 1IASA 4FG9A 4OT6A 4CLJA 4I6HA 4UNOA 3NUNA 1ZWSA 3G51A 1U4DA 5H8BA 5CLSA 3ET7A 1Q8ZA 2CN5A 1D3YA 1KOAA 2QOFA 3LWFA 3EN5A 4I41A 3GEQA 3B02A 5J5TA 3EYHA 5K0KA 5CVGA 3RNIA 3EYYA 1BL6A 2Y6OA 3U4UA 2XAQA 4AACA 3LM0A 2C0TA 3MIYA 2HOEA 4ON0A 2C6LA 3ZEPA 1NVSA 4FTTA 5M07A 5LVMA 2BDJA 5CYVA 4EVIA 2UZNA 5M4UA 2V1UA 4MQ2A 3ZSGA 5C4LA 4JDKA 2Y0AA 4TWPA 4RB3C 3QXPA 4BIEA 4YIIA 2ZM1A 3VBYA 4FKOA 2VWIA 3ZBXA 2GXGA 4E6DA 4AWXB 3TNPC 3DAEA 3FKNA 4H1MA 1YI4A 5H9BA 4NFMA 2FBHA 2DTRA 1Z1DA 3IOKA 4DG0E 2BIYA 2HTJA 5FLXK 4TN6A 4KMFA 4WNMA 3F5PA 1T45A 3QWJA 2XRUA 5HNBA 4ORKA 4FTMA 4CTBA 4RRVA 2B53A 2OF2A 4G7OF 3FQSA 2X9FA 4RAZA 3S0OA 3P7AA 2C6YA 4G31A 4G6NA 2XIKA 3LFFA 2RG5A 4C36A 1W84A 4EORA 1USSA 4CKRA 4D2RA 4LB5A 2HQRA 4ASEA 2XEZA 5D10A 2G2HA 5CZHA 4QP4A 2HY81 3F7WA 2OF4A 4RLKA 4BICA 2O0YA 3RBWA 4A9UA 4G3CA 4EK3A 5EDRA 2VTLA 4RQKA 4PX6A 3KK9A 1DI8A 2NNWB 3ZUUA 4UXNA 2GA1A 5HIBA 1OECA 4JLCA 1FP1D 2ONLA 5EKOA 4DNCA 2MH2A 2O03A 4AGUA 1WBSA 4BYYA 4RZWA 4FX4A 1I5ZA 5EYMA 4TYEA 3DK3A 2V7AA 5DR6A 4DGLC 2HEOA 3ZXTA 3L09A 4OTFA 2K4BA 3EOCA 1FVVA 3F7ZA 2QKRA 4DEIA 1LQ1A 4D4VA 2BDFA 3R8ZA 5FP6A 1OKZA 4B8LA 3E6CC 4DT8A 1QPCA 1MDMA 2DAOA 4WG3A 3K2ZA 4EOOA 2PTKA 2F5EA 2HWVA 3AT4A 3H0ZA 4N4SA 1KYZA 3WYXA 5CU3A 5DUKA 5L6OA 1KE8A 3COKA 4IEBA 4MX9A 4JVGA 4EC8A 2X8EA 1OPKA 2DS1A 1QZZA 5CSHA 2XCHA 1XGSA 1KE9A 3MS9A 1VYZA 3FM3A 4M67A 1XSVA 4QMUA 3DFCB 3IO7A 3VS5A 3VF8A 2Y75A 3C9WA 4M66A 4UWBA 3V5TA 5IQDA 2ZOQA 2MBFA 1B38A 4RLLA 3A7JA 4QP2A 1UNHA 4N6ZA 1ZY4A 4BI2A 3O17A 3F2NA 4YG2F 2VTHA 3HYHA 3EQCA 3WOWA 3OC1A 4F70A 2IO6A 5BPYA 5CSVA 3BPVA 4DGOA 4D55A 4HVHA 5DCFA 3GVAA 4AD9A 4NKSA 2M5WA 3RI4A 4BDHA 3L9NA 3KVXA 3BYUA 4BZNA 4UZHA 2ZVAA 4O91A 4TNBA 3WTSC 4A12A 4UBAA 3TZ9A 3QHWA 4IVCA 2YM5A 2PJPA 3WTYC 2YZLA 2VTQA 5F94A 3S95A 2CNQA 4FVRA 2VV9A 5H3QA 4XOYA 3JSOA 4DH3A 3CE3A 3U4WA 2I6LA 3DQVC 2COMA 2WMUA 2YM8A 2WQOA 4RVLA 3F6XA 3BV3A 2J0IA 3HRBA 2B0LA 2UXXA 3VO3A 2EV6A 3ORTA 1R1TA 3ORPA 1J3HA 3R83A 5HVJA 4IVNA 3EQHA 2TDXA 4CT2A 2J5FA 3TO7A 2ONLC 4JBVA 4GXOA 2XNMA 4QTEA 4J53A 2X6EA 3TQNA 2Q83A 2IJLA 2V7OA 3D5WA 4HOKA 3FMKA 2ZCWA 4C4GA 1GIJA 3ZC5A 4XG8A 3VS6A 2QVSE 5HDGA 3UOHA 4II5A 3ULZA 3C1DA 2C6OA 2IPXA 5DR2A 1W83A 4R7HA 5LOHA 4FSYA 2RGVA 5JHUA 4E20A 4QRCA 1YOLA 3FMSA 4JDIA 4YFXF 2WEIA 2BUJA 4KINA 4GGGA 3IHUA 3VJNA 5C27A 5A2QK 3QUPA 3IKTA 4FIHA 2RDPA 3U9NA 3BHTA 2YM3A 1STCE 1PXKA 4A4XA 2CQKA 2VTSA 1Q1HA 2AC5A 5DBXA 2VX1A 3LFDA 3I0QA 1R0PA 4LRMA 3CLYA 4B8XA 3GF2A 4DT9A 3EN6A 4IB5A 2OZUA 2CGWA 4OBPA 3BU6A 4RC3A 5A4TA 4D2SA 3FMJA 5ACBC 4FZAB 4IAIA 2E7WA 3VBVA 1Y57A 3E7VA 1LPUA 1PMUA 3KN5A 3CO6C 4R1VA 5B7VA 2UW0A 2JDVA 3SA0A 1FX7A 2PZRA 2B9IA 3TDWA 2E9UA 3GU5A 3F8BA 4J99A 4KUJA 1H4LA 1FGIA 2XNBA 3ZMZA 4FKSA 4G5JA 2WOUA 3VWAA 4GIIA 3HMPA 4PTGA 5ILUA 3R1QA 4UVBA 4C61A 5CY3A 3GQIA 4OIPF 3VBQA 1IAJA 5HDNA 3F21A 2WQBA 3M8EA 2OW3A 3D7TA 4TRLA 3KP2A 4C58A 5IQGA 3G6HA 4B6LA 1YYVA 3MVMA 4Q9SA 3FHZA 2VZ6A 1G3TA 3PUPA 3LQ3A 3FLQA 1YW9A 4FNZA 5M56A 4MQVA 4MXCA 3TZ7A 4U8ZA 2OJGA 2VWWA 3U54A 1JKLA 5CF8A 4D1ZA 4CQGA 3EN7A 3IW8A 3KB7A 1YTYA 2R7IA 4FTKA 1D8JA 3PXZA 2W06A 4U43A 5CU6A 3KEOA 4X7QA 2Q0BA 2BFYA 5JFWA 3LVPA 3RVGA 4S34A 3QF9A 2NYXA 1H0VA 4K11A 4GW8A 3BLRA 3ZRKA 4RB2C 3F5XA 3E6BA 4FV5A 4DAWA 1J7LA 3BX5A 3TDZC 5LMKA 5AM7A 4FK3A 4XP3A 4OUCA 2P2HA 1H1PA 3DU8A 2OJ9A 2WGJA 3AC4A 5KMKA 4ESJA 4E73A 4ZP5A 1ZGJA 3UZTA 1BJAA 2ZKZA 2GFSA 5TE0A 1JXSA 3OUKA 4WK8F 3PG3A 5L6PA 3OV8A 3TV4A 2GZWA 4YO6A 3VW8A 3OCTA 2IG7A 3JVSA 3GFMA 4XRJA 1A9UA 2JPCA 1ND4A 3DB6A 1FBSA 2JPBA 3W10A 3DPTA 5HBJA 5H2UA 3ZO1A 4KS7A 4FNYA 1URWA 3MA3A 2XKEA 4FL3A 4UMRA 3PXQA 4X2FA 4BDJA 1R7JA 4MXOA 4FGBA 5AR7A 3GT8A 3UVRA 2BMCA 2PUUA 4E6AA 5IA2A 2V9VA 2OBPA 2G01A 3C4WA 3RWQA 5EQYA 5KHXA 3W8QA 3HRUA 1V1KA 1K78A 4M84A 2PUIA 4M8TA 3BLHA 1U8RA 5LWMA 4FKPA 5CNOA 4FIJA 2BALA 5CEKA 4A6DA 1G5SA 4GU9A 5CAUA 5CZIA 4FTLA 1YRPA 3RINA 2UW8A 3FMRA 4BVUA 2XVCA 5I0BA 3ZMUA 4TZRA 1Q8UA 5KMIA 2Z8CA 4I2OA 2CSOA 1ZYLA 4EM0B 4PDOA 1Z6RA 2YFXA 3PE2A 4PQNA 4G6OA 2G1TA 5HX6A 5F1ZA 3R4KA 1GZKA 3OY3A 4FSWA 2IA0A 4LRJA 2YJSA 1MJBA 4WBBB 1YIOA 4YURA 2RKUA 2P7VB 3QX2A 4DEDA 1H0WA 5B2LA 3PXYA 3ABUA 2W96B 3DBCA 2VBYA 2YABA 3ALOA 4L0ZB 2FSMX 4I01A 1IXCA 4L68A 4P5ZA 3EQRA 2VN9A 4F63A 5JFSA 1MP8A 3KXZA 3PPJA 5DR9A 4FT0A 5EHOA 1WCCA 1YLFA 1C0WA 4XG2A 1J2XA 5FBOA 3ISPA 5LMKC 1SYKA 1YXTA 4OAUC 4NIFA 4L45A 4M69A 5K3YA 2BPMA 2VO3A 5IQFA 2C0IA 1WMKA 2JFMA 4O84A 3GFWA 4V04A 4IHSA 4K9YA 2I0HA 2UZBA 2GSFA 3WI6A 2DPDA 1XH9A 3U6JA 4O81A 2OIDA 2IWIA 4HF2A 4GIHA 4F7SA 1WQ2A 2VTIA 3OWLA 3KGAA 3IRQA 4LL5A 4PL3A 1UKHA 1KGSA 3F22A 3J80K 4OU0A 1FMKA 3DY7A 2OIBA 4Z16A 3GC8A 3GU6A 3O6BB 3O8PA 1W5TA 4MEYF 3DK7A 1FSHA 1ZYJA 5D5VB 2OFUA 3T1BA 1JQHA 3HV5A 5D5XB 2BZHB 2VBZA 2DK8A 3QCYA 1RE8A 5AA8A 3QAHA 4FT5A 3F3WA 3CJGA 2Y0MA 4UMUA 4IAFA 4AU8A 1K2PA 3LFAA 3D2IA 3TWJA 5M51A 4L5IA 4BXUA 4EBWA 4WNOA 2HW7A 3NNWA 3N4VA 4FKJA 4EWHA 4AA4A 3FZTA 4ASZA 5L3EA 3QQGA 2JKQA 3ZZEA 3ZXZA 4AN9A 1V3FA 3MFSA 4O96A 3Q2JA 3NGAA 5D41A 2GAUA 1IXSB 5K0XA 4A0XA 3R9DA 3TO6A 4IRGA 1AQ1A 1BI2A 1WBTA 4MKCA 2R7BA 4O7YA 1QMZA 3FKOA 3V8JA 3Q5ZA 1LR4A 4WHZA 3R7YA 3B73A 4ASNA 1CTPE 1L3RE 1IRGA 5CEIA 3H9RA 4QP9A 5EEGA 1R58A 3SXFA 5HG9A 1J1BA 4PMSA 4D5HA 4N57A 1PXIA 5KCVA 3BHHA 3R30A 4XH6A 3PJ1A 4BYIA 4WSQA 4QP1A 1P2FA 3R73A 4FX0A 2I1MA 1J5YA 2IZTA 3LA7A 1XDUA 2PZ5A 4ZXTA 4EH3A 4KIPA 5HS8A 1ZZLA 3C13A 1WFCA 4NQWA 2WMWA 4CFUA 3UIBA 1H01A 1LDDA 3GUDA 5DD8A 5DG5A 5FLFA 2PE2A 4ASXA 3JR1A 4QPMA 5DH3A 5AR8A 3HLLA 5ANGA 3FLZA 1OL1A 1OIYA 4UVCA 3IWZA 2J90A 4ALUA 4CEGA 5DT0A 3NWWA 4X2JA 3JAMK 2QQ7A 3QX4A 1H1RA 3KRLA 3J7AO 5FUTA 3K3JA 3LW0A 4EH9A 3HOTA 1WKMA 4YZMA 4GVJA 5IMXA 2BGCA 3LXPA 4O3MA 2J9MA 2WTVA 2Y4PA 4RGSA 3LXLA 4ZZLA 4NKAA 2Q2EA 5DN3A 2GHLA 2WEVA 4G3EA 5BYYA 4NU1A 4W4WA 3U87A 3CKXA 2W57A 3FL4A 4JI9A 1MJ9A 4TPTA 1HKSA 2CLQA 2GNJA 3PRFA 4JQEA 1PKGA 3TKIA 3K5VA 2QNJA 2BROA 3VNTA 3R1SA 4I5CA 1GHCA 2JAMA 4G16A 4S32A 4AT3A 4XBFA 4YHTA 1PY5A 3E62A 5IH5A 4H05A 2YCFA 3JY0A 5CNNA 5CQUA 4GV1A 2QD9A 2L02A 3D0EA 3JW4A
chains in the Genus database with same CATH superfamily
4F99A 2VONA 1ZYCA 3IQ7A 3LA3A 2R0QC 5I9UA 2XNEA 3BG9A 3Q9VA 4FIFA 2VQHA 3C2HA 4JG8A 4FZFB 5ICPA 3QAME 2XF7A 2B54A 3NYXA 3VS4A 2DODA 4LI5A 3KRRA 5EG0B 2JA5J 3HX4A 3BWGA 4C35A 5EQEA 3FI4A 4NDLA 2IW6A 2DJIA 4NYEA 1YQAA 3BTIA 3VS7A 2XNPA 4YJVA 3NUAA 4EKKA 2Z7LA 4OTIA 2K86A 3FLWA 4L7SA 5HG8A 2UW4A 1ZLTA 4BFMA 5J87A 5L3FA 3I4BA 2JUGA 1K79A 4KSPA 5EI8A 1SZMA 2HYFA 2Y2ZA 5DYJA 4LV7A 2CW8A 1CKIA 4G34A 5CF5A 1NK2P 1NA7A 3E5AA 4OAZA 3JS2A 4X6QC 5IT3A 3UGCA 3VHEA 1X1DA 3CUQB 4FQGA 4TYGA 3HP2A 4EH8A 4M71A 2KISA 2NRUA 2R5TA 1CKJA 2WB1N 4AAAA 2F2CB 4II3A 5J4YA 4O6LA 5KNJA 2WV0A 4FV8A 4NT4A 3M8FA 2EUFB 2CUZA 1IN7A 4MGRA 4FKLA 4YC3A 2A3SA 3UNKA 1U3EM 4BKZA 3TV7A 1D1BA 5AV4A 3DZQA 1U5TC 3OL4A 5CAPA 2WY8Q 2HYYA 3DU5A 2GBYA 3DTEA 4IBMA 3R7EA 4BEHA 3DF8A 1W5CC 2OIQA 2MC3A 4P9UA 4EC9A 2DMQA 4N0SA 5AV2A 3H0YA 2DOAA 1H8AC 2QKMB 1LNWA 4PTEA 1UELB 3RWPA 3OWKA 1ST4A 2XHKA 5HIEA 5CEOA 3DA6A 2ESNA 1MBJA 4DBQA 3R8VA 2GWRA 4OTHA 3IDCA 4DCEA 3QRTA 5IUIA 1P4WA 2EZKA 2E1CA 4DHZA 2I10A 3DKCA 5M53A 4RGRA 3ZGKA 5EW3A 2NVXJ 3PUBA 4BKXA 4C4JA 1MH4A 1MZBA 3VBXA 1W36C 4M3EA 3IP4B 5CWZA 4DG2E 5AX9A 1IXRC 1HSJA 4ZTQA 2YU9J 4C33A 4ACCA 2LTPA 2EFPA 4I20A 2BHEA 4D0WA 1B8IB 3S00A 3RPQA 5F4NA 2OK1A 3F23A 1CSNA 2Y0SA 3I79A 1NW1A 1FYMA 1FIPA 3ABKH 3TXOA 5F0CA 4BCKA 1B72B 4CSWA 1MD0A 5TOZA 3WE4A 5FEDA 3FJQE 4IACA 5AP6A 4HRIA 3PA4A 5AAEA 1WVWA 2I0YA 3OWTA 3IKVA 2FA2A 1VZOA 3R7IA 1M2QA 2JEDA 2LP0A 1M2PA 1TWFJ 2X6XA 1EA3A 5IG1A 2W1OA 4MIMA 4BS9A 4CYIA 2ITPA 3SGCA 1P4OA 1IAWA 2BV6A 3DBRB 3R1NA 1LB2A 4AW2A 4QEBA 3NW5A 5EDPA 3D14A 3FZRA 2EZIA 5DCMA 2D5VA 3BG3A 1M1EB 3E8EA 3CIKA 3C4ZA 3L9LA 3PJ8A 3V8KA 4C37A 4GFOA 3QTWA 4U81A 1XBAA 3AT3A 4RG0A 4IANA 4PDSA 4RX7A 4BRXA 1REPC 3NIEA 5M08A 4Q47A 3AL0C 4QP6A 5LJJA 3DTIA 5J6XA 3ODZX 4AX8A 3ERED 4O7LA 2XBAA 4DITA 2IBDA 5C8MA 5LCJA 3HDDA 3CMEI 4XG9A 3HP5A 2X7FA 3SOCA 4BTJA 2VTAA 5T3QA 3BOQA 3RAIA 3U8WA 4XKCA 4MEXF 5IH6A 1WJEA 3QRIA 2OCEA 1H25A 4CVAA 4J71A 4FIIA 3UPXA 2XKFA 4U5JA 4XP0A 5ICGA 3SXSA 4TXCA 2X6OA 2O63A 1KZHA 1CQTA 1BN5A 2PZIA 4CMUA 4CFNA 4KBKA 4A06A 3LAJA 2R3HA 3PZHA 5IDNA 4I0SA 1XKKA 3J7ZI 1FWZA 2EXEA 3UE4A 2V4JC 1WH7A 3OOUA 2R7WA 4IVDA 2FX0A 4C38A 4QP7A 3M7GA 4EI4A 5BQ0A 2WMXA 4EOJA 4XRSA 1WBOA 1PJRA 2OWBA 4PCQA 2BAKA 3SRVB 2YM6A 2F48A 2BZTA 2BW3B 4M7IA 3VIDA 4AS0A 4QDEA 2K85A 2W1EA 1YX5A 2ERZE 1MBFA 3LJ0A 5EZGA 4XLVA 1YO5C 1SFUA 4U7BA 4XG3A 3H3VK 5IOZA 2PVLA 1B9MA 5EK7A 4EOLA 4JQ7A 1FBUA 5E3LA 2F2UA 3MJ1A 3WF9A 5DEYA 4DFZE 4AW5A 4RVTA 5DTDA 2SRCA 4LOQA 4AM3A 2O8XA 1F43A 1IW7F 1KU9A 3WGGA 4BN1A 3G2FA 5CEQA 3BJOA 1Y39A 5LVOA 3U2RA 2JZYA 3HV6A 3KFAA 1SD6A 4XV3A 5CPRB 3BELA 2ITVA 1G8JA 3BZ6A 3NNUA 2K9MA 2FF4A 3ERMA 3G9LX 3P4KA 1B59A 3QCSA 4PL5A 3E8CA 2XBJA 3S3MA 3WE8A 1ZYRF 4BCMA 4CKJA 4BKYA 4E5AX 4D9TA 3SHEA 4IZYA 4FODA 4K8AA 3EPZA 5L6WL 3VSKA 4CSVA 5ETIA 3DTCA 1Z9XA 4IPAA 4G3GA 3OIOA 4GRBA 2JLDA 4CCOA 1LFBA 5EJCA 3EN9A 3M2WA 3ZLWA 3HGGA 4FKIA 3KPHA 4JIAA 2E36A 4G5PA 1AD5A 2G2IA 2OU7A 2JGZA 2C5OA 2UW6A 2L7MP 4F6WA 1JKPC 3COHA 4GKIA 4BZDA 1HDPA 4AE9A 3BR2A 2OI4X 3ABLH 3L8XA 3PIPF 3LQRA 2MW8A 4RJ5A 3EQPA 2VTOA 4B3AA 4MTDA 2C6EA 4BY1J 1OZ1A 2RSVA 2JKOA 1X2NA 3JREA 3HOXJ 2Y8OA 2PYWA 2Z7RA 5KO1A 3Q96A 1IF1A 4I6FA 2OBJA 4LG0B 1O7LA 3FBVA 5AIPA 4U79A 1FYKA 1BYGA 1T33A 4CRLA 2W25A 3HOSA 2DO7A 2VO0A 1P4AA 4JBAA 3W55A 3GCPA 3RI1A 5FLXZ 3KFWX 5HICA 5KKRB 5J3LA 4AWIA 5I4NA 2VX0A 3BG5A 4JK1X 1XH7A 4MFDA 4ZJVA 4RWIA 2F5VA 5E90A 1F3MC 4R5SA 1RZ4A 2VASA 3TW7A 4ASDA 1YHSA 2GMXA 4CMOA 3KEXA 2EWNA 3W6JB 3S17J 2V6CA 5IY5H 3V6SA 3J7AY 2DW4A 3OP5A 3M4OJ 3BIZA 3NCGA 3RCOA 3MAJA 1OL2A 5FEQA 3DBQA 4O5VA 2PY3A 3PA3A 1VLRA 3MKWB 1GOLA 3CCJI 3GO5A 4LGDA 4GK3A 1U59A 2WTJA 4M3BA 4GK2A 4QMSA 3QU6A 4IHXA 5L2QA 4DFNA 2ELHA 4CZTA 5J9YA 3PY0A 5FQDC 2ITYA 4DYCA 3UDSA 4LOCA 2W1FA 4QYGA 4ZDPA 5M55A 5FKLA 4D0XA 3REPA 3NAYA 2BRNA 1HBXG 3MVJA 1IR3A 2HS5A 4QTDA 2MLGA 3PP0A 2IRFG 4WNKA 3I1AA 1F9NA 2IEWA 5I9WA 2EFWA 2JBPA 3SD0A 4BE0A 4PJJA 2HQ5A 5E8IA 4HW0A 3ABTA 3LE6A 2J6MA 4P1WA 2W82A 2OZAB 3SQQA 4FV0A 5LBQA 1JTYA 4DH8A 1XR1A 4NM3A 2XC7A 2VU3A 2RNJA 4X6RA 4N4OB 2AQFA 5IEXA 3W3CA 5IT9K 4B43A 1VEBA 4C0TA 1VR2A 4FL2A 2DWBA 4U97A 4DZJA 4XRMA 3BBWA 2IW8A 1UU3A 4JNWA 3OYMA 2XJ0A 4YZBA 4F9AA 4B7TA 3NAXA 2EA4A 4TYHA 2CMWA 2QU5A 4ZJIA 4EEFG 1XMKA 1J7KA 3PM1A 3B6AA 4O6EA 2FUG2 1IUYA 2GTMA 3VONA 4NM5A 3E64A 1ZMUA 3R7GA 2C6KA 1QNTA 4PPBA 1RI7A 3FL5A 4RMNA 2J5EA 3UP2A 4QMTA 4RIWB 4IZZA 3L00A 3LFKA 3LMMA 1ZG1A 4X1EA 1OVEA 5CF4A 1Y6BA 3W8LA 2PZYA 1K83J 3VUKA 3D94A 1U9NA 3ML6A 4MXAA 4EJWA 2YS9A 3C1XA 5E7RA 3CD8A 2K3FA 2R0UA 2R7XA 2C3IB 3RALA 4EK4A 1Q5KA 2YM7A 4JBPA 3WZUA 1G8XA 3SEQA 4BQAA 4P5OA 5F20A 3MZYA 3AMYA 4UV9A 4Q5EA 2C6IA 1SD7A 4ZYAA 3GZ5A 3UIMA 2JKMA 3DP7A 2HZNA 2J51A 3AMBA 4O4BB 5GINE 2ZJ2A 3ZQLA 3BZ3A 4FTUA 4LV5A 3QOEA 3T0YA 3NRMA 3H9JA 3HMOA 2L7ZA