4GYOA

Crystal structure of rap protein complexed with competence and sporulation factor
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
366
structure length
357
Chain Sequence
PSEEVAVKLNEWYKLIRAFEADQAEALKQEIEYDLEDMEENQDLLLYFSLMEFRHRIMLDKLMPVKPFSDMLNEIESNLTGLLEYYFYYFRGMYEFKQKNFILAIDHYKHAEEKLEYVEDEIEKAEFLFKVAEVYYHIKQTYFSMNYASQALDIYTKYELYGRRRVQCEFIIAGNLTDVYHHEKALTHLCSALEHARQLEEAYMIAAAYYNVGHCKYSLGDYKEAEGYFKTAAAIFEEHNFQQAVQAVFSLTHIYCKEGKYDKAVEAYDRGIKSAAEWEDDMYLTKFRLIHELYLGSGDLNVLTECFDLLESRQLLADAEDLLHDTAERFNQLEHYESAAFFYRRLMNIKKKLAEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator aspartate phosphatase J
publication title Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 158
structure length 357
sequence length 366
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyoA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyoA02
2KCLA 3AS5A 4B94A 3U3WA 2XGSA 1WAO1 4WNFA 4A1SA 3QDNA 1Y8MA 2UWJG 4Y6CA 3RO3A 1HZ4A 3HYMB 4N3BA 3Q49B 2JLBA 3GYZA 2KCVA 5A7DB 2LNIA 5DBKA 3CVLA 4BT9A 4KYOB 2IFUA 3QWVA 2V5FA 4U0SA 3LPZA 3PDNA 3LKUA 3VTXA 1QZ2A 4APOA 5EKQD 2XCBA 3KS2A 5D0QD 4BTBA 4CGVA 2P58C 1P5QA 2Q7FA 3UPVA 2FI7A 4WNGA 3RO2A 1A17A 1NZNA 4J8FA 4W9RA 3QWWA 3ZPJA 4RG6A 3LY9A 3FFLA 4UI9J 4UQZA 2FO7A 3FWVA 1FCHA 2FEZA 1YA0A 3AS8A 4J0UA 3QKYA 4GYYA 5JJTA 4KXKB 4HOQA 4G23A 4I2ZA 5KJKA 2AVPA 5FJYA 4U07A 3ZGQA 3O48A 4HORA 2FF4A 3MA5A 2VGXB 2PQRA 5M72A 3ZFWA 3Q5MA 4HOTA 1ZBPA 3MEKA 4J8EA 4WNDA 4U0ZA 4BT8A 3JYSA 3ULQA 1QQEA 2R5SA 4LEUA 2KATA 3QWPA 4UQYA 3KD7A 2KC7A 3ASDA 1E96B 4BTAA 3N71A 2IF4A 5LCWJ 5G04C 2ONDA 3S7FA 4AY5A 3OXFA 4GYWA 4N3AA 2UY1B 1IHGA 3PE3A 4G25A 3S7DA 4WNEA 4GYOA 4HOSA 2HR2A 5KJLA 3LYAA 4I1AA 4N2SA 1IYGA 4I9CA 4G1TA 2BUGA 3TG4A 1W3BA 3Q4AB 4J8DA 2VSNA 4U0UA 3ZN3A 4GA1A 3CK8A 4BWRA 1PC2A 2C0LA 5C1DA 2Y4TA 3CK7A 3OXLA 3RIBA 2HYZA 5AYWD 1WM5A 5CCLA 3NF1A 4F3VA 3U4TA 2LSVA 4U04A 4YNDA 5G05C 2PL2A 3GZ1A 4CDRA 4XI9A 3CVPA 3LY8A 3CKBA 5ARGA 3URZA 1ELWA 1OUVA 2FBNA 4AY6A 2C2LA 3SF4A 3PE4A 5KJNA 5G04J 1ZU2A 4N2QA 4ME2A 1HXIA 5KJMA 4GZ5A 4ABNA 3RJVA 4JHRA 1TJCA 3MV3B 2QFCA 4YVQC 5FZRA 2HO1A 2I6HA 3S7JA 3FP3A 5FZQA 5A6CA 2VGXA 4GA2A 4KBQA 4AIFA 5ARFA 2XGMA 4GZ3A 4UI9K 2NC9A 2GW1A 3MKRA 4G2VA 4GCNA 3KAEA 4XI0A 4AM9A 4I2WA 5CHEE 3RU0A 4N5CA 4H7XA 5FTPA 3AS4A 4G24A 1NA3A 5HI7A 1B89A 2UY1A 4CGWA 3K9IA 4UI9C 1XNFA 2MHKA 4GZ6A 2Y4UA 2PZIA 4HOUA 2C0MA 3BEEA 2VSYA 4NRHB 5JJ7A 3EDTB 3QOUA 5CCMA 2KCKA 3VTYA 2XCCA 4Y6WA 4I9EA 2WQHA 3ESKA 4GPKA 4GCOA 2VYIA 1KT0A 4H7YA 4G26A 2J9QA 3S7BA 3E4BA 2VQ2A 2XGOA 4NQ0A 3RKVA 2L6JA 3CEQA 4IN3B 3MV2B 1KLXA 4JA7A 3IEGA 4I17A 3LY7A 5DIZA 3CKCA 2WPVA 3OXGA 3CVNA 2PQNA 5LCWC 2VGYA 5EX0A 3ASHA 2XPIA 5JJ6A 3Q15A 4GA0A 4RG9A 4WUYA 4O6FA 4EQFA 5EX3A 3ASFA 3CK9A 5HQ8A 3GW4A 3CV0A 3TAXA 2LSUA 3GZ2A 3R9AB 4UQXA 4XIFA 2E2EA 5BW8C 4JA9A 5FZSA 5BT1A 1KT1A 3SZ7A 2DBAA 3WXXA 5BNWA 1ELRA 2YHCA 4N39A 3UQ3A 4JL0A 3UUXA 4N3CA 2OOEA 3CVQA 1HH8A 4YVOA 3LCAA 2YQ8A 5D0OD 3TGOA 3ZHEA 5FT9A 5G05J 2XEVA 1NA0A 3TG5A 3ZHEB 3Q47B 3ASGA
chains in the Genus database with same CATH superfamily
4TXPA 5CEAA 3CQGB 5KWDA 4Y6CA 4AOFA 3L82A 2EQXA 1FPPA 1HZ4A 3Q49B 3E32A 2JLBA 3GYZA 4OYSA 3BG1B 2VSXE 1TNBA 5FINA 3QC1A 3V30A 1LTXA 3LPZA 3FU0A 1X5BA 3ONKA 1H19A 3CVWA 4GTRA 3ULYA 4B93B 2WXQA 3KS2A 2J07A 1RZ4A 4CGVA 3PREA 4CDNA 3C98A 4J8SA 3UPVA 3EHRA 2JEKA 3KEAA 3RO2A 2XENA 4F1PA 3CVVA 4NACA 5CMWA 1U3DA 1D8DA 1N9AA 3QWWA 3UM1A 3LY9A 4LUNU 4UWLA 2WQ7A 2I2OA 3ABME 3FFLA 3JCKC 4GTPA 3FH8A 4RLYA 3B7RL 3FHEA 3Q9NC 2P9KG 2EINE 1FCHA 4G8LA 3X2QE 3AS8A 4J0UA 4GYYA 1N0RA 3ONLA 5JJTA 3G2UA 3U66A 4HOQA 4A1GA 2LAIA 4G23A 5CEDB 3DRAA 3NZUA 4FJZA 2AVPA 2WXNA 3FUFA 3AU5A 3FUJA 5KBAA 4HORA 2FF4A 5CRVA 4BEPA 3ASOE 2LUHA 2PQRA 2A5EA 3VLDA 5M72A 2F8XK 1ZBPA 3MEKA 3OTNA 4LEUA 3RAUA 2KC7A 4M7CA 1INZA 3LEWA 3R7QA 1E96B 3Q73A 4HRNA 2IF4A 2ONDA 1H6OA 1U2VG 3ZYQA 2CFZA 4IULA 2VTBA 1H2TC 4F1SA 4UWKA 2XPYA 4AY5A 2EIJE 3DXKG 1YMPA 2WXRA 5H7PA 1OXJA 3S7DA 4WNEA 4GYOA 3UI2A 3UKUG 3FUNA 2DIWA 3SGHA 4L7TA 2BUGA 3B13A 4B8CB 3IBEA 4HB5A 4U0UA 1TR4A 3PUKA 2C0LA 5BXUA 1OCRE 3RIBA 1BU9A 3Q9UC 3U4TA 2MYOA 2CG2A 4I1OB 2P9UG 1E90A 5G05C 4XI9A 4DX1A 3LY8A 4AJWA 4RQIA 4TRQA 3Q7FA 5AARA 1ELWA 2AWIA 4UWHA 5CMYA 4I43A 5KJNA 4CDMA 1ZU2A 4YDOA 4DRXE 4N2QA 4ME2A 5KJMA 1UG3A 2QC9A 3MV3B 3J5QB 4FC8A 3PZ1A 3FP3A 2KZTA 5FWQA 3CSTA 4AV7A 3T8KA 4U63A 4A3VA 2XEHA 3TWWA 4GZ3A 3CGHA 3FTXA 2NC9A 4ACLA 3TWTA 4G2VA 4XX5A 1U3CA 3CVYA 2IU1A 3DEOA 4LERA 3PS6A 3L6AA 3RU0A 4H7XA 2GRLA 1WY6A 3HHMA 4GTTA 4WAFA 2PNNA 4ZHBA 2RG8A 2BKKB 2MHKA 3EJNA 2RFAA 3LXUX 1ELKA 2C0MA 3SY2A 4NRHB 3FU6A 4DI3A 3QOUA 2X6JA 4UWFA 4BESA 3L22A 4GCOA 3WG7E 4B89A 2VYIA 2H6HA 2XS8A 1TN7A 2J9QA 2IOLA 3FUKA 3APFA 4LG6A 2VQ2A 1HG2A 2XGOA 4HRMB 5HS0A 1QBQA 3RKVA 2DZNA 2XZTG 5KNHD 3EHNA 3I3NA 3PVLA 4I6GA 4ACKA 4JA7A 4MRUA 5T3RA 2XRZA 4I17A 3G2WA 2X6HA 5HKPA 2WXKA 1BPOA 3C3OA 2R03A 2QZAA 3IV0A 2VGYA 2WQ6A 3ASHA 3MGBA 2B6CA 4RG9A 2I1JA 1SA5A 5JHAA 1NFIE 2KBXA 2CHZA 3DSSA 5EX3A 3ASFA 4HLLA 3ZYKA 2WXLA 3UT7A 1YCSB 3D9HA 4HS2A 3FUDA 3BUAA 2GRPB 1HE8A 5FQ7A 3CLJA 3FTSA 5BNWA 2YHCA 4ILHB 3UUXA 5HRYA 3SFXA 5AIJA 1DCEA 5FQ4A 3D9NA 1HH8A 5B1BE 4YVOA 3ZNGA 3RK6A 3SQVA 2VGEA 4B0ZA 1E7VA 4PS8A 1JWFA 2XEVA 1NA0A 1IQUA 1EDUA 3ZHEB 4FADA 4F53A 4ATGA 3B95A 4CYMD 3CVUA 3AS5A 4JEUA 3HVEB 4BERA 3U3WA 2WM9A 5E75A 1Y8MA 5CBNA 4GPMA 3RO3A 5FQ8A 4FP7A 3ENEA 3AU4A 2A4ZA 1N11A 4FHJA 2KCVA 3PUJA 4KVOA 5BPPA 2LNIA 1S63A 1E8YA 3LJ3A 2WXFA 1IXVA 5DBKA 3ZRHA 5EN5D 2IFUA 3PZ4A 3NOCD 4O1OA 1D9SA 3TWXA 2R02A 1QYMA 3UINC 4L23A 5EKQD 2P58C 1P5QA 1UN8A 2X6KA 3JQ1A 3CHRA 2IJGX 3FUHA 1A17A 4HVBA 3ZVVA 2CHWA 2WB2A 4J8FA 2P9LG 3QJZA 2OV8A 3DSXA 3DWLG 3UTMA 2J4DA 4EPZA 1YA0A 3ML9A 3D3MA 3QKYA 1JCRA 3FU3A 4KXKB 4AP2A 1N4RA 1LD7A 4I6EA 4I2ZA 1FVFA 4RSYA 5JHBA 3MYVA 4A63B 3O48A 4F7AA 5J90A 2XEEA 3RRUA 3QNKA 5B3SE 1TNYA 3FU5A 3KSLA 2GGFA 1NL4A 3ZFWA 4HOTA 4D10C 3T9KA 4G8KA 3HVEA 3Q7AA 3ULQA 4NURA 3EHMA 1OY3D 4PS7A 2R5SA 2F0YA 4C9BB 2KATA 4LRZA 3FY4A 5LOZA 2CFUA 2IO2C 3ASDA 5JMND 5LCWJ 5G04C 4GZDA 2PM6A 2RKKA 4JVSA 2VTBB 4N3AA 3AG4E 4Z68A 2ZIRA 4G25A 4HOSA 3D9OA 5AAOA 5KJLA 3T8MA 3IXEA 2ZGDA 4N2SA 4LNBA 4I9CA 3L54A 4JPSA 1KPSB 3TG4A 4EZLA 1W3BA 1N0QA 4URKA 4J6IA 4TXQA 1D8EA 3FUMA 4O60A 3CK8A 1PC2A 2BTDA 1LD8A 2Y4TA 3OXLA 4XEIG 2HYZA 3FTZA 5AYWD 1JCSA 2J4BA 3ML8A 3NF1A 3MJWA 3DPDA 1SZAA 4BSXA 1BD8A 3GZ1A 1EPUA 3CVPA 4V3IA 3CKBA 5ARGA 4ATZD 3C72A 3F6QA 3SF4A 3AJIA 4TXRA 5FIOA 1YYHA 2DYRE 5BUZA 1IQRA 2V5QC 3SHFA 5G04J 4YDYA 3FEYA 3DSUA 1HXIA 1MX2A 4GZ5A 4JHRA 1TJCA 4YVQC 5FZRA 2EILE 1AP7A 4GZCA 3UXGA 4HI9A 3B7UX 4ANUA 3CHSA 5ENTD 2KZTB 4Q96A 3T5XA 3V2OA 4KBQA 2GRNB 2X6FA 5ARFA 2X6IA 4DPRA 3W9GA 2AXZA 2J49A 3BQOA 2XGMA 4DX6D 2AXVA 4UI9K 2AXUA 3FEXA 4GCNA 1Z3XA 1A5EA 1UJKA 2MRIA 3L13A 1Z5SC 5CHEE 1O1RA 3HXBA 1N4PA 3ULEG 5FTPA 5A23A 1S70B 4KMOA 1FT1A 2E0IA 3L17A 1NA3A 3UX4A 4RVBA 4CGWA 3K9IA 4UI9C 2Y4UA 3APCA 2VSOE 5CERB 3PZ3A 5AQ7A 3LS8A 2LXMA 4ZFHA 4BX9A 3VTYA 1LF8A 4Y6WA 2WQHA 3ZU7B 1N54A 3MKQB 3CHQA 2VJ8A 2BEDA 5IY5E 2QYJA 2L6JA 2WXJA 3E33A 4K0RA 3ZEFA 3BU8A 3MV2B 3EU5A 3AG1E 2ZGGA 2IOSA 3UM2A 3EIJA 3LY7A 5DIZA 2CHXA 1TYQG 2J08A 3RRNB 1UW4B 2WPVA 1UJJA 2V8SE 3JXJA 2L6BA 2AJAA 2X38A 3D9JA 3ZYMA 3FUEA 3L9TA 4U96D 4HBDA 3Q15A 4WUYA 1TJFA 4EQFA 2WXPA 2IY0C 3CK9A 2IEJA 3AG3E 4CEMA 2LO6A 3V79K 4K5AB 2ILRA 5BW8C 5FZSA 1KT1A 3SZ7A 3WXXA 1ELRA 1S64A 4N39A 4JL0A 2YNQA 3IHYA 4N3CA 2OOEA 1SQMA 3Q75A 1DCQA 3PEVB 2LXLA 5AJDA 5ENOD 1MYOA 2YQ8A 1MHQA 1V55E 3ABLE 3JUEA 4DX7D 5G05J 2V4LA 4UUCA 2ETAA 1NI1A 4BY6A 3Q47B 1UOHA 3ASGA 3TXNA 1DNPA 3FH5A 4B94A 1WAO1 4WNFA 3D9PA 1BLXB 5BV1A 3HXEA 4A3TA 4N3BA 3MKQA 3G2TA 1TEZA 3E37A 1TNUA 4APFA 1OWOA 4GTMA 5AQAA 5ENRD 3CVLA 4BT9A 3QWVA 5C2YA 2V5FA 4ANXA 5EILA 1JPLA 3PDNA 5LP0A 1O1SA 4Q94A 4N5QA 1IHBA 4APOA 2I1KA 4OAVB 2OCCE 2R2LA 4BFRA 3I4RB 1IKND 4HLEA 2WXGA 2Q7FA 5ANLA 3TWSA 3PZDA 4XE0A 4C0MA 3CIAA 2Y0BG 3ZKJA 3MCXA 5J08A 3ZPJA 1RW2A 4U8HA 1OCZE 4UQZA 5ENSD 4ILIA 3Q78A 5JA4D 2YHEA 4MBGA 5ENNA 3P2BA 3CHPA 3C3RA 3IKOB 5E76A 3UM3A 1Z3YA 5EIBE 4HQDA 2BKGA 4DX2A 4AVXA 4U07A 3LDZA 3CR3A 5B1AE 3ESLA 1SZ9A 2VGXB 2J09A 3HXDA 2XZDG 4K5BA 5D2MC 1HX8A 3Q5MA 4J8EA 4U0ZA 1HFAA 4ANVA 4BT8A 4E85A 2L0TB 3DPYA 4LSZE 4DK5A 2OEWA 2CG3A 3QWPA 2F8YA 4GB9A 4KZCA 4BTAA 3CHOA 4F6RD 2WMNA 3APDA 5KNGA 3OXFA 4GYWA 3EU9A 1FT2A 2HM8A 1HU3A 4NIKA 3ZUVB 2UY1B 2EIKE 4J7WA 3O4ZA 4DJAA 1O1TA 1UN9A 2IO3C 5AQ9A 4I1AA 3JUIA 1IYGA 3UKRG 2P9IG 3Q4AB 4J8DA 2VSNA 4GA1A 3NAWA 2NSZA 5C1DA 4EBAG 3E30A 3MZLB 3B7BA 1JWGA 2WXIA 2Y69E 4FJYA 5EYLA 1HF8A 4F3VA 5CCLA 3Q79A 2MOWA 3G2VA 4XZ4A 4CDRA 5ENQD 4CCAA 4DLQA 1Z6TA 3URZA 4FA6A 1OUVA 1WG0A 2FBNA 2GRRB 3VLFA 2IQCA 4AY6A 4EECA 4L2LA 4TUMA 3AG2E 4JHJA 4PDXA 3SBTB 4CRWA 4ABNA 1SW6A 2QFCA 2DYSE 2A5UA 2I6HA 2P2CP 3CHMA 3S7JA 3D9MA 5FZQA 2AW6A 2ETBA 5A6CA 1E7UA 4GMRA 2VGXA 1N95A 1TN8A 4GA2A 4AIFA 3QAQA 1XGWA 1K1AA 5ITZF 4DUIA 4GTOA 2KXPC 2DVWA 3KAEA 5AJLA 4XI0A 4I2WA 2NXPA 1K3ZD 4A55A 4N5CA 4G24A 4C48B 5LX8A 5HI7A 4XKCA 2UY1A 2BF0X 3QB2A 3BG0B 5EYPF 1JCQA 2PZIA 4HOUA 2XS1A 2V0PA 3TWVA 4U95D 3BEEA 3RRMB 3JXIA 3VLEA 2VSYA 3CQCB 5JJ7A 2KCKA 4FULA 1AWCB 2KM4A 4LNUD 3ESKA 4GPKA 3TWUA 4H7YA 3U9WA 4G26A 1H2VC 4GTVA 1MJ0A 4ILGA 4C0EA 4EZJA 3AAAC 4L9PA 5CRUA 1OWLA 1L5JA 1GW6A 2QY7A 4NQ0A 2XHEA 3B7SA 3CEQA 4IN3B 5G55A 2YINA 3DSVA 1KLXA 4QFVA 3PRZA 2P9NG 3R9MA 4MS6A 3CKCA 2NYJA 4JXTA 1JUQA 2DWZA 4JZYA 1DVPA 1MX6A 4FLBA 1OWMA 3DXMG 2PQNA 2XPIA 5JJ6A 4GA0A 3PEUB 3CSFA 2RFMA 4FHKA 3HG0D 4J8YA 3GW4A 3ZIMA 4QQIA 1OT8A 3GZ2A 1MZCA 4UQXA 3NBNB 2PM7A 2ETCA 4XIFA 2E2EA 5G2NA 3NOGD 4JA9A 2DZOA 2DBAA 3UQ3A 3QK0A 4R7LA 1KZOA 3HXFA 5T4YA 4K5CA 3LCAA 2ZISA 3RSEG 1OCCE 5D0OD 2FULA 5FT9A 3TJPA 3TG5A 3EIQC 3NQPA 1BI7B 4OAUC 2KCLA 2WXOA 2XGSA 4A1SA 3QDNA 4YDWA 4U8YD 3LVRE 4GMJA 5CBOA 2UWJG 1FVHA 2GRQB 5ANRA 4E6HA 3FDHA 3D9IA 4I1MA 5D66A 1OWPA 3HYMB 4GU5A 1OWNA 4JEHA 3B7TA 4U8VD 2JABA 5A7DB 2OVFA 3UIOC 3HDXA 4KYOB 3HRAA 3JQ0A 4U0SA 3UIPC 4CT0A 1N94A 3LKUA 3VTXA 1KZPA 3DSWA 1QZ2A 1MQSA 4IRUA 2FO1E 4MKTA 2XCBA 4JHKA 2P9PG 5D0QD 4BTBA 3TWRA 2L0IA 4XKBA 4HXIA 1H6PA 2FI7A 3NZSA 4WNGA 3KSQA 1SVXA 1NZNA 3V2XA 4GMLA 4W9RA 4RG6A 2WVIA 4UI9J 5CECB 1MX4A 2H6GA 2FO7A 4IYPA 2L9BA 5KCMA 3UT8A 3L08A 3FWVA 3NB2A 2FEZA 4EHMA 3T5VA 3KEZA 4CZ2D 5LFAA 5KJKA 2GRMA 5ENPD 1NP7A 5FJYA 4TV3A 1N52A 3ZGQA 2WXMA 3SNXA 4BETA 3MA5A 4FLHA 1G3NB 3PZ2A 2XPZA 2Y3AA 3DSTA 1K8KG 4DI4A 4WNDA 2XRYA 3JYSA 2B0OE 1QQEA 4G11A 3DEPA 3R7RA 3IHVA 4HRLA 1K1BA 3D9LA 4UQYA 4PS3A 3KD7A 2H6FA 1EYHA 3FTYA 3N71A 4HNAD 1H0AA 2I9CA 2R17C 3GZSA 4GTQA 3S7FA 3C3QA 5T8IA 1IHGA 3PE3A 2Y1LE 2QYUA 2HR2A 3LYAA 3I5PA 3SO8A 1HS6A 3U64A 2LAHA 4UWGA 4G1TA 4JC8A 1ZB1A 1E8ZA 5AQBA 3ZN3A 1HG5A 4BWRA 3CK7A 3FULA 5FQ6A 3SI5A 3QARA 2X3MA 1WM5A 4KT6B 4DLOA 1TNZA 2LSVA 1H6KA 4M3OA 1N4SA 1TN6A 4U04A 4YNDA 3ABKE 4KZ0A 2PL2A 4FU3A 3PNTB 3TL5A 3TXMA 4K03A 4L2YA 4GAAA 5EDSA 4HFGA 2C2LA 3FH7A 3W9FA 3P1UA 3PE4A 3UMVA 3SFZA 1O5MA 3SBSA 2IONA 1V54E 3MX3A 3PH0C 3RJVA 1WDYA 2HO1A 4B8AA 2WMOA 4WWPA 4ANWA 2OVBA 2R59A 3SFYA 3D9KA 1HO8A 2J8SD 5BV0A 3I4GA 2EIME 4I6JA 3FTWA 3EHQA 4Q69A 3LJNA 2OEVA 4LNGA 2GW1A 3MKRA 1SA4A 4BX8A 2XQ0A 4AM9A 3L16A 4CT4A 4YDEA 3AS4A 3E34A 4MLPA 4AEZC 4JD2G 4JB8P 2HE0A 5BXOA 1B89A 2RD0A 2GROB 4WWOA 1XNFA 4GZ6A 2P9SG 3V31A 3FTVA 1E8WA 3EUVA 3EDTB 5CCMA 4PUCA 4KVMA 3OAWA 2XCCA 4I9EA 4TUUA 1X81A 1N4QA 1Q2ZA 1OCOE 4DX5D 1KT0A 2F37A 3S7BA 3E4BA 3ZXPA 3FUIA 2V4HC 2DCPA 3SD5A 4WWNA 5AN8A 4EZKA 3TWQA 4O1PA 3IEGA 5AENA 3ISMC 3HXCA 3UT4A 4AXHA 4GTSA 3FTUA 3G2SA 1TNOA 3OXGA 3C5RA 3CVNA 4PH4B 2H6IA 1S0PA 5LCWC 1DC2A 5EX0A 2R05A 4HI8A 1Y6IA 3PNLB 2ZU6B 4O6FA 1E8XA 3CVXA 3LVQE 3HIZA 2ZXWE 5HQ8A 3ZXSA 3CV0A 3TAXA 2LSUA 3R9AB 4EBAA 4JW1A 1EF1C 4BSZB 5BT1A 4P29A 1VDYA 3ZYLA 3DBSA 3S2AA 3ASNE 3CVQA 3J5PA 5EIDA 3UM0A 1PAQA 2M63A 4OVVA 4OVUA 1QNFA 1BI8B 3TGOA 4X8QA 3ZHEA 4L1BA 2WXHA 3ZW3A 1H2UA 4LCTA 4U7EB 1PY1A
chains in the Genus database with same CATH topology
2KCLA 3CVUA 1DNPA 3AS5A 4JEUA 2WXOA 3HVEB 3FH5A 4B94A 3U3WA 2WM9A 2XGSA 1WAO1 3CQGB 4WNFA 5E75A 3QDNA 4A1SA 3D9PA 3LVRE 4GMJA 1Y8MA 5BV1A 2UWJG 4Y6CA 1FVHA 3RO3A 5FQ8A 4AOFA 2EQXA 5ANRA 4E6HA 4FP7A 3FDHA 4A3TA 3D9IA 1HZ4A 4I1MA 1OWPA 3HYMB 4N3BA 3MKQA 3ENEA 3Q49B 4GU5A 1OWNA 3AU4A 3G2TA 2JLBA 4JEHA 1TEZA 2A4ZA 3B7TA 3GYZA 4FHJA 2KCVA 3PUJA 4OYSA 5A7DB 4KVOA 4APFA 2LNIA 5BPPA 1OWOA 1E8YA 2OVFA 3LJ3A 3BG1B 2WXFA 2VSXE 5DBKA 3ZRHA 3CVLA 4BT9A 3HDXA 4KYOB 2IFUA 3QWVA 3QC1A 5C2YA 2V5FA 3JQ0A 4U0SA 4ANXA 4CT0A 1JPLA 3LPZA 3PDNA 3LKUA 3VTXA 5LP0A 1QZ2A 1MQSA 3FU0A 1X5BA 3ONKA 1H19A 4Q94A 3CVWA 4APOA 2I1KA 4L23A 4IRUA 5EKQD 4MKTA 2WXQA 2XCBA 4JHKA 3KS2A 4BFRA 2J07A 5D0QD 4BTBA 3I4RB 2L0IA 4CGVA 2P58C 1P5QA 4HLEA 3PREA 4CDNA 2WXGA 4XKBA 3C98A 2Q7FA 4J8SA 3UPVA 4HXIA 5ANLA 1UN8A 2FI7A 2X6KA 3NZSA 2JEKA 3JQ1A 3CHRA 4WNGA 3RO2A 2IJGX 3FUHA 1A17A 1NZNA 3PZDA 3CVVA 4GMLA 4XE0A 4C0MA 4NACA 3CIAA 4HVBA 5CMWA 1U3DA 2CHWA 3MCXA 3ZVVA 2WB2A 4J8FA 5J08A 4W9RA 3QWWA 4RG6A 2WVIA 3LY9A 4LUNU 4UWLA 4U8HA 3ZPJA 2WQ7A 2I2OA 3FFLA 4UI9J 3JCKC 4UQZA 3FH8A 4ILIA 2FO7A 3QJZA 3B7RL 4IYPA 2L9BA 3FHEA 5KCMA 3UT8A 2OV8A 3L08A 3FWVA 1FCHA 2YHEA 2J4DA 2FEZA 4EPZA 1YA0A 3AS8A 5ENNA 3P2BA 3ML9A 3CHPA 3D3MA 4J0UA 3QKYA 4GYYA 3ONLA 3T5VA 5JJTA 3G2UA 3FU3A 3IKOB 4HOQA 4KXKB 1Z3YA 2LAIA 3KEZA 5E76A 4A1GA 4AP2A 4G23A 4I6EA 5LFAA 4I2ZA 1FVFA 4RSYA 5JHBA 5KJKA 3NZUA 4FJZA 2AVPA 3MYVA 4AVXA 2WXNA 2GRMA 1NP7A 3FUFA 5FJYA 3AU5A 4TV3A 4U07A 1N52A 3ZGQA 3LDZA 3FUJA 3O48A 4F7AA 5J90A 3CR3A 2WXMA 3RRUA 4HORA 2FF4A 3QNKA 3SNXA 3ESLA 1SZ9A 3MA5A 4FLHA 2VGXB 2J09A 3FU5A 2PQRA 2XPZA 2Y3AA 2GGFA 3VLDA 5M72A 3ZFWA 1HX8A 3Q5MA 4DI4A 4HOTA 1ZBPA 3MEKA 4J8EA 4WNDA 4D10C 4U0ZA 1HFAA 4ANVA 3OTNA 3HVEA 2XRYA 3JYSA 4BT8A 2L0TB 3ULQA 4E85A 1QQEA 4NURA 3EHMA 4PS7A 2R5SA 4G11A 4LEUA 3R7RA 3IHVA 4C9BB 2KATA 3D9LA 4LRZA 2CG3A 4DK5A 3QWPA 3FY4A 4UQYA 4PS3A 3KD7A 2KC7A 2CFUA 4GB9A 1EYHA 5LOZA 4KZCA 3ASDA 3FTYA 1INZA 3LEWA 3R7QA 1E96B 3CHOA 4BTAA 3N71A 2IF4A 2WMNA 5LCWJ 5G04C 2ONDA 3APDA 4GZDA 3ZYQA 2CFZA 2PM6A 4IULA 1H0AA 1H2TC 2I9CA 2R17C 3GZSA 2VTBA 4F1SA 4UWKA 2XPYA 3S7FA 4AY5A 3OXFA 4GYWA 4JVSA 2VTBB 4N3AA 2HM8A 1HU3A 2WXRA 5T8IA 2UY1B 1IHGA 3PE3A 4G25A 3S7DA 4WNEA 4GYOA 4HOSA 3D9OA 4DJAA 3O4ZA 1UN9A 2HR2A 5KJLA 3LYAA 3T8MA 4I1AA 3I5PA 4N2SA 3FUNA 3JUIA 1IYGA 2DIWA 1HS6A 3SGHA 3U64A 2LAHA 4I9CA 4UWGA 3L54A 4L7TA 4JPSA 4G1TA 2BUGA 3B13A 3TG4A 4B8CB 4EZLA 1W3BA 4JC8A 4URKA 3Q4AB 4J6IA 4J8DA 3IBEA 2VSNA 3FUMA 1E8ZA 4U0UA 1HG5A 4GA1A 3CK8A 3ZN3A 1PC2A 2NSZA 2BTDA 3PUKA 4BWRA 2C0LA 5C1DA 2Y4TA 3CK7A 3OXLA 4EBAG 3FULA 3MZLB 5FQ6A 3RIBA 1JWGA 2HYZA 2WXIA 3FTZA 3QARA 3SI5A 2X3MA 2J4BA 1WM5A 3ML8A 4FJYA 1HF8A 3NF1A 5AYWD 4F3VA 4KT6B 3U4TA 5CCLA 2MOWA 4DLOA 3MJWA 2LSVA 3G2VA 1H6KA 4M3OA 2CG2A 4U04A 4I1OB 4YNDA 3DPDA 1E90A 4KZ0A 1SZAA 5G05C 4BSXA 2PL2A 3GZ1A 4FU3A 4XZ4A 4CDRA 4XI9A 1EPUA 3CVPA 3LY8A 3PNTB 4AJWA 4V3IA 3TL5A 3CKBA 3TXMA 4K03A 5ARGA 4L2YA 4GAAA 5EDSA 4TRQA 4CCAA 4DLQA 1Z6TA 3URZA 4HFGA 4FA6A 1ELWA 1OUVA 2FBNA 4AY6A 3VLFA 2IQCA 2C2LA 3FH7A 4EECA 4L2LA 2AWIA 3SF4A 4UWHA 5CMYA 4JHJA 4I43A 5BUZA 1IQRA 3P1UA 3PE4A 3UMVA 4CDMA 5KJNA 4PDXA 3SBTB 3SFZA 3SHFA 3SBSA 5G04J 1ZU2A 2IONA 3FEYA 3MX3A 3PH0C 4CRWA 4N2QA 4ME2A 1HXIA 5KJMA 4GZ5A 4ABNA 1UG3A 3RJVA 4JHRA 1TJCA 3MV3B 2QFCA 4YVQC 5FZRA 2HO1A 4B8AA 2WMOA 2A5UA 2I6HA 3CHMA 4GZCA 4WWPA 2OVBA 3S7JA 4FC8A 3D9MA 4ANWA 3FP3A 2R59A 2AW6A 5FZQA 2KZTA 5A6CA 1E7UA 3B7UX 3D9KA 4ANUA 3CHSA 2VGXA 1HO8A 2KZTB 5FWQA 3CSTA 4Q96A 3T5XA 5BV0A 3I4GA 4AV7A 4GA2A 4KBQA 4I6JA 3FTWA 4AIFA 2X6FA 3QAQA 2X6IA 5ARFA 4DPRA 4Q69A 1XGWA 2AXZA 2J49A 4U63A 4A3VA 2XGMA 4GZ3A 3CGHA 2AXVA 3FTXA 4UI9K 2NC9A 2AXUA 2GW1A 4ACLA 3MKRA 3FEXA 4G2VA 4GCNA 1Z3XA 4XX5A 4BX8A 1UJKA 1U3CA 2MRIA 3KAEA 3L13A 4XI0A 2XQ0A 5AJLA 3CVYA 4AM9A 2IU1A 4I2WA 4LERA 3PS6A 5CHEE 2NXPA 3L6AA 3L16A 4A55A 4CT4A 3RU0A 4N5CA 4H7XA 5FTPA 5A23A 2GRLA 3AS4A 4KMOA 1WY6A 3HHMA 2E0IA 3L17A 4MLPA 4AEZC 4WAFA 4G24A 1NA3A 5LX8A 5HI7A 4XKCA 1B89A 2RD0A 3UX4A 2UY1A 2RG8A 4RVBA 4CGWA 2BF0X 3K9IA 4WWOA 4UI9C 1XNFA 3QB2A 2MHKA 3BG0B 4GZ6A 3EJNA 3LXUX 1ELKA 2Y4UA 2PZIA 3APCA 4HOUA 2VSOE 2C0MA 2V0PA 3FTVA 3BEEA 3RRMB 3LS8A 1E8WA 3VLEA 2VSYA 4NRHB 3FU6A 3CQCB 5JJ7A 3EDTB 4DI3A 3QOUA 4BX9A 5CCMA 2KCKA 4PUCA 3VTYA 4FULA 4KVMA 2X6JA 1LF8A 3OAWA 4UWFA 2XCCA 2KM4A 4Y6WA 3L22A 2WQHA 4I9EA 4TUUA 3ESKA 4GPKA 4GCOA 4B89A 2VYIA 1N54A 3MKQB 3CHQA 1KT0A 4H7YA 3U9WA 4G26A 1H2VC 4ILGA 4C0EA 4EZJA 2J9QA 2IOLA 3FUKA 3S7BA 3E4BA 3APFA 2VQ2A 1HG2A 2VJ8A 2XGOA 3FUIA 1OWLA 2DCPA 1L5JA 3SD5A 1GW6A 2QY7A 4NQ0A 2XHEA 4WWNA 3RKVA 3B7SA 2L6JA 3CEQA 4IN3B 2WXJA 4EZKA 4K0RA 3EHNA 3I3NA 3ZEFA 3PVLA 4I6GA 5G55A 3MV2B 2YINA 1KLXA 4ACKA 4QFVA 4JA7A 3PRZA 3IEGA 2IOSA 4MRUA 5T3RA 5AENA 4I17A 2XRZA 3EIJA 3LY7A 3G2WA 5DIZA 4MS6A 3UT4A 4AXHA 2CHXA 3CKCA 3FTUA 3G2SA 2J08A 2X6HA 3RRNB 2WXKA 1UW4B 1BPOA 1JUQA 4JXTA 2WPVA 1UJJA 4JZYA 1DVPA 3OXGA 2V8SE 4FLBA 1OWMA 3CVNA 2PQNA 2X38A 4PH4B 3IV0A 1S0PA 5LCWC 2VGYA 5EX0A 3D9JA 3ZYMA 2WQ6A 3ASHA 3FUEA 1Y6IA 2XPIA 3MGBA 3Q15A 5JJ6A 4GA0A 3PNLB 4RG9A 2I1JA 4WUYA 1TJFA 2ZU6B 4O6FA 1E8XA 5JHAA 3CVXA 4EQFA 3LVQE 2CHZA 2WXPA 5EX3A 3PEUB 3CSFA 4FHKA 3ASFA 3HIZA 3CK9A 3ZYKA 5HQ8A 3ZIMA 3GW4A 3ZXSA 2WXLA 3CV0A 3TAXA 2LSUA 3GZ2A 3UT7A 2LO6A 3R9AB 4UQXA 4CEMA 2ILRA 2PM7A 4EBAA 4XIFA 4JW1A 4HS2A 3U66A 1EF1C 2E2EA 5G2NA 3FUDA 5BW8C 4JA9A 5FZSA 5BT1A 1KT1A 4P29A 1VDYA 1HE8A 5FQ7A 3CLJA 3FTSA 3SZ7A 2DBAA 3ZYLA 3WXXA 5BNWA 1ELRA 2YHCA 3DBSA 4N39A 3UQ3A 4ILHB 3QK0A 4JL0A 2YNQA 3S2AA 3UUXA 3IHYA 4N3CA 4R7LA 5AIJA 2OOEA 1SQMA 3CVQA 3D9NA 5FQ4A 1HH8A 4YVOA 5T4YA 1PAQA 3PEVB 2M63A 3LCAA 5AJDA 3RK6A 4OVVA 4B0ZA 4OVUA 1QNFA 2YQ8A 1MHQA 5D0OD 3TGOA 2FULA 3ZHEA 5FT9A 4L1BA 1E7VA 5G05J 4PS8A 2WXHA 2V4LA 1JWFA 2XEVA 1NA0A 1IQUA 1H2UA 3TG5A 3TJPA 3ZW3A 1EDUA 4LCTA 3ZHEB 4BY6A 3Q47B 4FADA 4F53A 3ASGA 3EIQC 3NQPA 4ATGA 3TXNA 1PY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCL A;  3AS5 A;  4B94 A;  3U3W A;  2XGS A;  1WAO 1;  4WNF A;  4A1S A;  3QDN A;  1Y8M A;  2UWJ G;  4Y6C A;  3RO3 A;  1HZ4 A;  3HYM B;  4N3B A;  3Q49 B;  2JLB A;  3GYZ A;  2KCV A;  5A7D B;  2LNI A;  5DBK A;  3CVL A;  4BT9 A;  4KYO B;  2IFU A;  3QWV A;  2V5F A;  4U0S A;  3LPZ A;  3PDN A;  3LKU A;  3VTX A;  1QZ2 A;  4APO A;  5EKQ D;  2XCB A;  3KS2 A;  5D0Q D;  4BTB A;  4CGV A;  2P58 C;  1P5Q A;  2Q7F A;  3UPV A;  2FI7 A;  4WNG A;  3RO2 A;  1A17 A;  1NZN A;  4J8F A;  4W9R A;  3QWW A;  3ZPJ A;  4RG6 A;  3LY9 A;  3FFL A;  4UI9 J;  4UQZ A;  2FO7 A;  3FWV A;  1FCH A;  2FEZ A;  1YA0 A;  3AS8 A;  4J0U A;  3QKY A;  4GYY A;  5JJT A;  4KXK B;  4HOQ A;  4G23 A;  4I2Z A;  5KJK A;  2AVP A;  5FJY A;  4U07 A;  3ZGQ A;  3O48 A;  4HOR A;  2FF4 A;  3MA5 A;  2VGX B;  2PQR A;  5M72 A;  3ZFW A;  3Q5M A;  4HOT A;  1ZBP A;  3MEK A;  4J8E A;  4WND A;  4U0Z A;  4BT8 A;  3JYS A;  3ULQ A;  1QQE A;  2R5S A;  4LEU A;  2KAT A;  3QWP A;  4UQY A;  3KD7 A;  2KC7 A;  3ASD A;  1E96 B;  4BTA A;  3N71 A;  2IF4 A;  5LCW J;  5G04 C;  2OND A;  3S7F A;  4AY5 A;  3OXF A;  4GYW A;  4N3A A;  2UY1 B;  1IHG A;  3PE3 A;  4G25 A;  3S7D A;  4WNE A;  4GYO A;  4HOS A;  2HR2 A;  5KJL A;  3LYA A;  4I1A A;  4N2S A;  1IYG A;  4I9C A;  4G1T A;  2BUG A;  3TG4 A;  1W3B A;  3Q4A B;  4J8D A;  2VSN A;  4U0U A;  3ZN3 A;  4GA1 A;  3CK8 A;  4BWR A;  1PC2 A;  2C0L A;  5C1D A;  2Y4T A;  3CK7 A;  3OXL A;  3RIB A;  2HYZ A;  5AYW D;  1WM5 A;  5CCL A;  3NF1 A;  4F3V A;  3U4T A;  2LSV A;  4U04 A;  4YND A;  5G05 C;  2PL2 A;  3GZ1 A;  4CDR A;  4XI9 A;  3CVP A;  3LY8 A;  3CKB A;  5ARG A;  3URZ A;  1ELW A;  1OUV A;  2FBN A;  4AY6 A;  2C2L A;  3SF4 A;  3PE4 A;  5KJN A;  5G04 J;  1ZU2 A;  4N2Q A;  4ME2 A;  1HXI A;  5KJM A;  4GZ5 A;  4ABN A;  3RJV A;  4JHR A;  1TJC A;  3MV3 B;  2QFC A;  4YVQ C;  5FZR A;  2HO1 A;  2I6H A;  3S7J A;  3FP3 A;  5FZQ A;  5A6C A;  2VGX A;  4GA2 A;  4KBQ A;  4AIF A;  5ARF A;  2XGM A;  4GZ3 A;  4UI9 K;  2NC9 A;  2GW1 A;  3MKR A;  4G2V A;  4GCN A;  3KAE A;  4XI0 A;  4AM9 A;  4I2W A;  5CHE E;  3RU0 A;  4N5C A;  4H7X A;  5FTP A;  3AS4 A;  4G24 A;  1NA3 A;  5HI7 A;  1B89 A;  2UY1 A;  4CGW A;  3K9I A;  4UI9 C;  1XNF A;  2MHK A;  4GZ6 A;  2Y4U A;  2PZI A;  4HOU A;  2C0M A;  3BEE A;  2VSY A;  4NRH B;  5JJ7 A;  3EDT B;  3QOU A;  5CCM A;  2KCK A;  3VTY A;  2XCC A;  4Y6W A;  4I9E A;  2WQH A;  3ESK A;  4GPK A;  4GCO A;  2VYI A;  1KT0 A;  4H7Y A;  4G26 A;  2J9Q A;  3S7B A;  3E4B A;  2VQ2 A;  2XGO A;  4NQ0 A;  3RKV A;  2L6J A;  3CEQ A;  4IN3 B;  3MV2 B;  1KLX A;  4JA7 A;  3IEG A;  4I17 A;  3LY7 A;  5DIZ A;  3CKC A;  2WPV A;  3OXG A;  3CVN A;  2PQN A;  5LCW C;  2VGY A;  5EX0 A;  3ASH A;  2XPI A;  5JJ6 A;  3Q15 A;  4GA0 A;  4RG9 A;  4WUY A;  4O6F A;  4EQF A;  5EX3 A;  3ASF A;  3CK9 A;  5HQ8 A;  3GW4 A;  3CV0 A;  3TAX A;  2LSU A;  3GZ2 A;  3R9A B;  4UQX A;  4XIF A;  2E2E A;  5BW8 C;  4JA9 A;  5FZS A;  5BT1 A;  1KT1 A;  3SZ7 A;  2DBA A;  3WXX A;  5BNW A;  1ELR A;  2YHC A;  4N39 A;  3UQ3 A;  4JL0 A;  3UUX A;  4N3C A;  2OOE A;  3CVQ A;  1HH8 A;  4YVO A;  3LCA A;  2YQ8 A;  5D0O D;  3TGO A;  3ZHE A;  5FT9 A;  5G05 J;  2XEV A;  1NA0 A;  3TG5 A;  3ZHE B;  3Q47 B;  3ASG A; 
#chains in the Genus database with same CATH topology
 4TXP A;  5CEA A;  3CQG B;  5KWD A;  4Y6C A;  4AOF A;  3L82 A;  2EQX A;  1FPP A;  1HZ4 A;  3Q49 B;  3E32 A;  2JLB A;  3GYZ A;  4OYS A;  3BG1 B;  2VSX E;  1TNB A;  5FIN A;  3QC1 A;  3V30 A;  1LTX A;  3LPZ A;  3FU0 A;  1X5B A;  3ONK A;  1H19 A;  3CVW A;  4GTR A;  3ULY A;  4B93 B;  2WXQ A;  3KS2 A;  2J07 A;  1RZ4 A;  4CGV A;  3PRE A;  4CDN A;  3C98 A;  4J8S A;  3UPV A;  3EHR A;  2JEK A;  3KEA A;  3RO2 A;  2XEN A;  4F1P A;  3CVV A;  4NAC A;  5CMW A;  1U3D A;  1D8D A;  1N9A A;  3QWW A;  3UM1 A;  3LY9 A;  4LUN U;  4UWL A;  2WQ7 A;  2I2O A;  3ABM E;  3FFL A;  3JCK C;  4GTP A;  3FH8 A;  4RLY A;  3B7R L;  3FHE A;  3Q9N C;  2P9K G;  2EIN E;  1FCH A;  4G8L A;  3X2Q E;  3AS8 A;  4J0U A;  4GYY A;  1N0R A;  3ONL A;  5JJT A;  3G2U A;  3U66 A;  4HOQ A;  4A1G A;  2LAI A;  4G23 A;  5CED B;  3DRA A;  3NZU A;  4FJZ A;  2AVP A;  2WXN A;  3FUF A;  3AU5 A;  3FUJ A;  5KBA A;  4HOR A;  2FF4 A;  5CRV A;  4BEP A;  3ASO E;  2LUH A;  2PQR A;  2A5E A;  3VLD A;  5M72 A;  2F8X K;  1ZBP A;  3MEK A;  3OTN A;  4LEU A;  3RAU A;  2KC7 A;  4M7C A;  1INZ A;  3LEW A;  3R7Q A;  1E96 B;  3Q73 A;  4HRN A;  2IF4 A;  2OND A;  1H6O A;  1U2V G;  3ZYQ A;  2CFZ A;  4IUL A;  2VTB A;  1H2T C;  4F1S A;  4UWK A;  2XPY A;  4AY5 A;  2EIJ E;  3DXK G;  1YMP A;  2WXR A;  5H7P A;  1OXJ A;  3S7D A;  4WNE A;  4GYO A;  3UI2 A;  3UKU G;  3FUN A;  2DIW A;  3SGH A;  4L7T A;  2BUG A;  3B13 A;  4B8C B;  3IBE A;  4HB5 A;  4U0U A;  1TR4 A;  3PUK A;  2C0L A;  5BXU A;  1OCR E;  3RIB A;  1BU9 A;  3Q9U C;  3U4T A;  2MYO A;  2CG2 A;  4I1O B;  2P9U G;  1E90 A;  5G05 C;  4XI9 A;  4DX1 A;  3LY8 A;  4AJW A;  4RQI A;  4TRQ A;  3Q7F A;  5AAR A;  1ELW A;  2AWI A;  4UWH A;  5CMY A;  4I43 A;  5KJN A;  4CDM A;  1ZU2 A;  4YDO A;  4DRX E;  4N2Q A;  4ME2 A;  5KJM A;  1UG3 A;  2QC9 A;  3MV3 B;  3J5Q B;  4FC8 A;  3PZ1 A;  3FP3 A;  2KZT A;  5FWQ A;  3CST A;  4AV7 A;  3T8K A;  4U63 A;  4A3V A;  2XEH A;  3TWW A;  4GZ3 A;  3CGH A;  3FTX A;  2NC9 A;  4ACL A;  3TWT A;  4G2V A;  4XX5 A;  1U3C A;  3CVY A;  2IU1 A;  3DEO A;  4LER A;  3PS6 A;  3L6A A;  3RU0 A;  4H7X A;  2GRL A;  1WY6 A;  3HHM A;  4GTT A;  4WAF A;  2PNN A;  4ZHB A;  2RG8 A;  2BKK B;  2MHK A;  3EJN A;  2RFA A;  3LXU X;  1ELK A;  2C0M A;  3SY2 A;  4NRH B;  3FU6 A;  4DI3 A;  3QOU A;  2X6J A;  4UWF A;  4BES A;  3L22 A;  4GCO A;  3WG7 E;  4B89 A;  2VYI A;  2H6H A;  2XS8 A;  1TN7 A;  2J9Q A;  2IOL A;  3FUK A;  3APF A;  4LG6 A;  2VQ2 A;  1HG2 A;  2XGO A;  4HRM B;  5HS0 A;  1QBQ A;  3RKV A;  2DZN A;  2XZT G;  5KNH D;  3EHN A;  3I3N A;  3PVL A;  4I6G A;  4ACK A;  4JA7 A;  4MRU A;  5T3R A;  2XRZ A;  4I17 A;  3G2W A;  2X6H A;  5HKP A;  2WXK A;  1BPO A;  3C3O A;  2R03 A;  2QZA A;  3IV0 A;  2VGY A;  2WQ6 A;  3ASH A;  3MGB A;  2B6C A;  4RG9 A;  2I1J A;  1SA5 A;  5JHA A;  1NFI E;  2KBX A;  2CHZ A;  3DSS A;  5EX3 A;  3ASF A;  4HLL A;  3ZYK A;  2WXL A;  3UT7 A;  1YCS B;  3D9H A;  4HS2 A;  3FUD A;  3BUA A;  2GRP B;  1HE8 A;  5FQ7 A;  3CLJ A;  3FTS A;  5BNW A;  2YHC A;  4ILH B;  3UUX A;  5HRY A;  3SFX A;  5AIJ A;  1DCE A;  5FQ4 A;  3D9N A;  1HH8 A;  5B1B E;  4YVO A;  3ZNG A;  3RK6 A;  3SQV A;  2VGE A;  4B0Z A;  1E7V A;  4PS8 A;  1JWF A;  2XEV A;  1NA0 A;  1IQU A;  1EDU A;  3ZHE B;  4FAD A;  4F53 A;  4ATG A;  3B95 A;  4CYM D;  3CVU A;  3AS5 A;  4JEU A;  3HVE B;  4BER A;  3U3W A;  2WM9 A;  5E75 A;  1Y8M A;  5CBN A;  4GPM A;  3RO3 A;  5FQ8 A;  4FP7 A;  3ENE A;  3AU4 A;  2A4Z A;  1N11 A;  4FHJ A;  2KCV A;  3PUJ A;  4KVO A;  5BPP A;  2LNI A;  1S63 A;  1E8Y A;  3LJ3 A;  2WXF A;  1IXV A;  5DBK A;  3ZRH A;  5EN5 D;  2IFU A;  3PZ4 A;  3NOC D;  4O1O A;  1D9S A;  3TWX A;  2R02 A;  1QYM A;  3UIN C;  4L23 A;  5EKQ D;  2P58 C;  1P5Q A;  1UN8 A;  2X6K A;  3JQ1 A;  3CHR A;  2IJG X;  3FUH A;  1A17 A;  4HVB A;  3ZVV A;  2CHW A;  2WB2 A;  4J8F A;  2P9L G;  3QJZ A;  2OV8 A;  3DSX A;  3DWL G;  3UTM A;  2J4D A;  4EPZ A;  1YA0 A;  3ML9 A;  3D3M A;  3QKY A;  1JCR A;  3FU3 A;  4KXK B;  4AP2 A;  1N4R A;  1LD7 A;  4I6E A;  4I2Z A;  1FVF A;  4RSY A;  5JHB A;  3MYV A;  4A63 B;  3O48 A;  4F7A A;  5J90 A;  2XEE A;  3RRU A;  3QNK A;  5B3S E;  1TNY A;  3FU5 A;  3KSL A;  2GGF A;  1NL4 A;  3ZFW A;  4HOT A;  4D10 C;  3T9K A;  4G8K A;  3HVE A;  3Q7A A;  3ULQ A;  4NUR A;  3EHM A;  1OY3 D;  4PS7 A;  2R5S A;  2F0Y A;  4C9B B;  2KAT A;  4LRZ A;  3FY4 A;  5LOZ A;  2CFU A;  2IO2 C;  3ASD A;  5JMN D;  5LCW J;  5G04 C;  4GZD A;  2PM6 A;  2RKK A;  4JVS A;  2VTB B;  4N3A A;  3AG4 E;  4Z68 A;  2ZIR A;  4G25 A;  4HOS A;  3D9O A;  5AAO A;  5KJL A;  3T8M A;  3IXE A;  2ZGD A;  4N2S A;  4LNB A;  4I9C A;  3L54 A;  4JPS A;  1KPS B;  3TG4 A;  4EZL A;  1W3B A;  1N0Q A;  4URK A;  4J6I A;  4TXQ A;  1D8E A;  3FUM A;  4O60 A;  3CK8 A;  1PC2 A;  2BTD A;  1LD8 A;  2Y4T A;  3OXL A;  4XEI G;  2HYZ A;  3FTZ A;  5AYW D;  1JCS A;  2J4B A;  3ML8 A;  3NF1 A;  3MJW A;  3DPD A;  1SZA A;  4BSX A;  1BD8 A;  3GZ1 A;  1EPU A;  3CVP A;  4V3I A;  3CKB A;  5ARG A;  4ATZ D;  3C72 A;  3F6Q A;  3SF4 A;  3AJI A;  4TXR A;  5FIO A;  1YYH A;  2DYR E;  5BUZ A;  1IQR A;  2V5Q C;  3SHF A;  5G04 J;  4YDY A;  3FEY A;  3DSU A;  1HXI A;  1MX2 A;  4GZ5 A;  4JHR A;  1TJC A;  4YVQ C;  5FZR A;  2EIL E;  1AP7 A;  4GZC A;  3UXG A;  4HI9 A;  3B7U X;  4ANU A;  3CHS A;  5ENT D;  2KZT B;  4Q96 A;  3T5X A;  3V2O A;  4KBQ A;  2GRN B;  2X6F A;  5ARF A;  2X6I A;  4DPR A;  3W9G A;  2AXZ A;  2J49 A;  3BQO A;  2XGM A;  4DX6 D;  2AXV A;  4UI9 K;  2AXU A;  3FEX A;  4GCN A;  1Z3X A;  1A5E A;  1UJK A;  2MRI A;  3L13 A;  1Z5S C;  5CHE E;  1O1R A;  3HXB A;  1N4P A;  3ULE G;  5FTP A;  5A23 A;  1S70 B;  4KMO A;  1FT1 A;  2E0I A;  3L17 A;  1NA3 A;  3UX4 A;  4RVB A;  4CGW A;  3K9I A;  4UI9 C;  2Y4U A;  3APC A;  2VSO E;  5CER B;  3PZ3 A;  5AQ7 A;  3LS8 A;  2LXM A;  4ZFH A;  4BX9 A;  3VTY A;  1LF8 A;  4Y6W A;  2WQH A;  3ZU7 B;  1N54 A;  3MKQ B;  3CHQ A;  2VJ8 A;  2BED A;  5IY5 E;  2QYJ A;  2L6J A;  2WXJ A;  3E33 A;  4K0R A;  3ZEF A;  3BU8 A;  3MV2 B;  3EU5 A;  3AG1 E;  2ZGG A;  2IOS A;  3UM2 A;  3EIJ A;  3LY7 A;  5DIZ A;  2CHX A;  1TYQ G;  2J08 A;  3RRN B;  1UW4 B;  2WPV A;  1UJJ A;  2V8S E;  3JXJ A;  2L6B A;  2AJA A;  2X38 A;  3D9J A;  3ZYM A;  3FUE A;  3L9T A;  4U96 D;  4HBD A;  3Q15 A;  4WUY A;  1TJF A;  4EQF A;  2WXP A;  2IY0 C;  3CK9 A;  2IEJ A;  3AG3 E;  4CEM A;  2LO6 A;  3V79 K;  4K5A B;  2ILR A;  5BW8 C;  5FZS A;  1KT1 A;  3SZ7 A;  3WXX A;  1ELR A;  1S64 A;  4N39 A;  4JL0 A;  2YNQ A;  3IHY A;  4N3C A;  2OOE A;  1SQM A;  3Q75 A;  1DCQ A;  3PEV B;  2LXL A;  5AJD A;  5ENO D;  1MYO A;  2YQ8 A;  1MHQ A;  1V55 E;  3ABL E;  3JUE A;  4DX7 D;  5G05 J;  2V4L A;  4UUC A;  2ETA A;  1NI1 A;  4BY6 A;  3Q47 B;  1UOH A;  3ASG A;  3TXN A;  1DNP A;  3FH5 A;  4B94 A;  1WAO 1;  4WNF A;  3D9P A;  1BLX B;  5BV1 A;  3HXE A;  4A3T A;  4N3B A;  3MKQ A;  3G2T A;  1TEZ A;  3E37 A;  1TNU A;  4APF A;  1OWO A;  4GTM A;  5AQA A;  5ENR D;  3CVL A;  4BT9 A;  3QWV A;  5C2Y A;  2V5F A;  4ANX A;  5EIL A;  1JPL A;  3PDN A;  5LP0 A;  1O1S A;  4Q94 A;  4N5Q A;  1IHB A;  4APO A;  2I1K A;  4OAV B;  2OCC E;  2R2L A;  4BFR A;  3I4R B;  1IKN D;  4HLE A;  2WXG A;  2Q7F A;  5ANL A;  3TWS A;  3PZD A;  4XE0 A;  4C0M A;  3CIA A;  2Y0B G;  3ZKJ A;  3MCX A;  5J08 A;  3ZPJ A;  1RW2 A;  4U8H A;  1OCZ E;  4UQZ A;  5ENS D;  4ILI A;  3Q78 A;  5JA4 D;  2YHE A;  4MBG A;  5ENN A;  3P2B A;  3CHP A;  3C3R A;  3IKO B;  5E76 A;  3UM3 A;  1Z3Y A;  5EIB E;  4HQD A;  2BKG A;  4DX2 A;  4AVX A;  4U07 A;  3LDZ A;  3CR3 A;  5B1A E;  3ESL A;  1SZ9 A;  2VGX B;  2J09 A;  3HXD A;  2XZD G;  4K5B A;  5D2M C;  1HX8 A;  3Q5M A;  4J8E A;  4U0Z A;  1HFA A;  4ANV A;  4BT8 A;  4E85 A;  2L0T B;  3DPY A;  4LSZ E;  4DK5 A;  2OEW A;  2CG3 A;  3QWP A;  2F8Y A;  4GB9 A;  4KZC A;  4BTA A;  3CHO A;  4F6R D;  2WMN A;  3APD A;  5KNG A;  3OXF A;  4GYW A;  3EU9 A;  1FT2 A;  2HM8 A;  1HU3 A;  4NIK A;  3ZUV B;  2UY1 B;  2EIK E;  4J7W A;  3O4Z A;  4DJA A;  1O1T A;  1UN9 A;  2IO3 C;  5AQ9 A;  4I1A A;  3JUI A;  1IYG A;  3UKR G;  2P9I G;  3Q4A B;  4J8D A;  2VSN A;  4GA1 A;  3NAW A;  2NSZ A;  5C1D A;  4EBA G;  3E30 A;  3MZL B;  3B7B A;  1JWG A;  2WXI A;  2Y69 E;  4FJY A;  5EYL A;  1HF8 A;  4F3V A;  5CCL A;  3Q79 A;  2MOW A;  3G2V A;  4XZ4 A;  4CDR A;  5ENQ D;  4CCA A;  4DLQ A;  1Z6T A;  3URZ A;  4FA6 A;  1OUV A;  1WG0 A;  2FBN A;  2GRR B;  3VLF A;  2IQC A;  4AY6 A;  4EEC A;  4L2L A;  4TUM A;  3AG2 E;  4JHJ A;  4PDX A;  3SBT B;  4CRW A;  4ABN A;  1SW6 A;  2QFC A;  2DYS E;  2A5U A;  2I6H A;  2P2C P;  3CHM A;  3S7J A;  3D9M A;  5FZQ A;  2AW6 A;  2ETB A;  5A6C A;  1E7U A;  4GMR A;  2VGX A;  1N95 A;  1TN8 A;  4GA2 A;  4AIF A;  3QAQ A;  1XGW A;  1K1A A;  5ITZ F;  4DUI A;  4GTO A;  2KXP C;  2DVW A;  3KAE A;  5AJL A;  4XI0 A;  4I2W A;  2NXP A;  1K3Z D;  4A55 A;  4N5C A;  4G24 A;  4C48 B;  5LX8 A;  5HI7 A;  4XKC A;  2UY1 A;  2BF0 X;  3QB2 A;  3BG0 B;  5EYP F;  1JCQ A;  2PZI A;  4HOU A;  2XS1 A;  2V0P A;  3TWV A;  4U95 D;  3BEE A;  3RRM B;  3JXI A;  3VLE A;  2VSY A;  3CQC B;  5JJ7 A;  2KCK A;  4FUL A;  1AWC B;  2KM4 A;  4LNU D;  3ESK A;  4GPK A;  3TWU A;  4H7Y A;  3U9W A;  4G26 A;  1H2V C;  4GTV A;  1MJ0 A;  4ILG A;  4C0E A;  4EZJ A;  3AAA C;  4L9P A;  5CRU A;  1OWL A;  1L5J A;  1GW6 A;  2QY7 A;  4NQ0 A;  2XHE A;  3B7S A;  3CEQ A;  4IN3 B;  5G55 A;  2YIN A;  3DSV A;  1KLX A;  4QFV A;  3PRZ A;  2P9N G;  3R9M A;  4MS6 A;  3CKC A;  2NYJ A;  4JXT A;  1JUQ A;  2DWZ A;  4JZY A;  1DVP A;  1MX6 A;  4FLB A;  1OWM A;  3DXM G;  2PQN A;  2XPI A;  5JJ6 A;  4GA0 A;  3PEU B;  3CSF A;  2RFM A;  4FHK A;  3HG0 D;  4J8Y A;  3GW4 A;  3ZIM A;  4QQI A;  1OT8 A;  3GZ2 A;  1MZC A;  4UQX A;  3NBN B;  2PM7 A;  2ETC A;  4XIF A;  2E2E A;  5G2N A;  3NOG D;  4JA9 A;  2DZO A;  2DBA A;  3UQ3 A;  3QK0 A;  4R7L A;  1KZO A;  3HXF A;  5T4Y A;  4K5C A;  3LCA A;  2ZIS A;  3RSE G;  1OCC E;  5D0O D;  2FUL A;  5FT9 A;  3TJP A;  3TG5 A;  3EIQ C;  3NQP A;  1BI7 B;  4OAU C;  2KCL A;  2WXO A;  2XGS A;  4A1S A;  3QDN A;  4YDW A;  4U8Y D;  3LVR E;  4GMJ A;  5CBO A;  2UWJ G;  1FVH A;  2GRQ B;  5ANR A;  4E6H A;  3FDH A;  3D9I A;  4I1M A;  5D66 A;  1OWP A;  3HYM B;  4GU5 A;  1OWN A;  4JEH A;  3B7T A;  4U8V D;  2JAB A;  5A7D B;  2OVF A;  3UIO C;  3HDX A;  4KYO B;  3HRA A;  3JQ0 A;  4U0S A;  3UIP C;  4CT0 A;  1N94 A;  3LKU A;  3VTX A;  1KZP A;  3DSW A;  1QZ2 A;  1MQS A;  4IRU A;  2FO1 E;  4MKT A;  2XCB A;  4JHK A;  2P9P G;  5D0Q D;  4BTB A;  3TWR A;  2L0I A;  4XKB A;  4HXI A;  1H6P A;  2FI7 A;  3NZS A;  4WNG A;  3KSQ A;  1SVX A;  1NZN A;  3V2X A;  4GML A;  4W9R A;  4RG6 A;  2WVI A;  4UI9 J;  5CEC B;  1MX4 A;  2H6G A;  2FO7 A;  4IYP A;  2L9B A;  5KCM A;  3UT8 A;  3L08 A;  3FWV A;  3NB2 A;  2FEZ A;  4EHM A;  3T5V A;  3KEZ A;  4CZ2 D;  5LFA A;  5KJK A;  2GRM A;  5ENP D;  1NP7 A;  5FJY A;  4TV3 A;  1N52 A;  3ZGQ A;  2WXM A;  3SNX A;  4BET A;  3MA5 A;  4FLH A;  1G3N B;  3PZ2 A;  2XPZ A;  2Y3A A;  3DST A;  1K8K G;  4DI4 A;  4WND A;  2XRY A;  3JYS A;  2B0O E;  1QQE A;  4G11 A;  3DEP A;  3R7R A;  3IHV A;  4HRL A;  1K1B A;  3D9L A;  4UQY A;  4PS3 A;  3KD7 A;  2H6F A;  1EYH A;  3FTY A;  3N71 A;  4HNA D;  1H0A A;  2I9C A;  2R17 C;  3GZS A;  4GTQ A;  3S7F A;  3C3Q A;  5T8I A;  1IHG A;  3PE3 A;  2Y1L E;  2QYU A;  2HR2 A;  3LYA A;  3I5P A;  3SO8 A;  1HS6 A;  3U64 A;  2LAH A;  4UWG A;  4G1T A;  4JC8 A;  1ZB1 A;  1E8Z A;  5AQB A;  3ZN3 A;  1HG5 A;  4BWR A;  3CK7 A;  3FUL A;  5FQ6 A;  3SI5 A;  3QAR A;  2X3M A;  1WM5 A;  4KT6 B;  4DLO A;  1TNZ A;  2LSV A;  1H6K A;  4M3O A;  1N4S A;  1TN6 A;  4U04 A;  4YND A;  3ABK E;  4KZ0 A;  2PL2 A;  4FU3 A;  3PNT B;  3TL5 A;  3TXM A;  4K03 A;  4L2Y A;  4GAA A;  5EDS A;  4HFG A;  2C2L A;  3FH7 A;  3W9F A;  3P1U A;  3PE4 A;  3UMV A;  3SFZ A;  1O5M A;  3SBS A;  2ION A;  1V54 E;  3MX3 A;  3PH0 C;  3RJV A;  1WDY A;  2HO1 A;  4B8A A;  2WMO A;  4WWP A;  4ANW A;  2OVB A;  2R59 A;  3SFY A;  3D9K A;  1HO8 A;  2J8S D;  5BV0 A;  3I4G A;  2EIM E;  4I6J A;  3FTW A;  3EHQ A;  4Q69 A;  3LJN A;  2OEV A;  4LNG A;  2GW1 A;  3MKR A;  1SA4 A;  4BX8 A;  2XQ0 A;  4AM9 A;  3L16 A;  4CT4 A;  4YDE A;  3AS4 A;  3E34 A;  4MLP A;  4AEZ C;  4JD2 G;  4JB8 P;  2HE0 A;  5BXO A;  1B89 A;  2RD0 A;  2GRO B;  4WWO A;  1XNF A;  4GZ6 A;  2P9S G;  3V31 A;  3FTV A;  1E8W A;  3EUV A;  3EDT B;  5CCM A;  4PUC A;  4KVM A;  3OAW A;  2XCC A;  4I9E A;  4TUU A;  1X81 A;  1N4Q A;  1Q2Z A;  1OCO E;  4DX5 D;  1KT0 A;  2F37 A;  3S7B A;  3E4B A;  3ZXP A;  3FUI A;  2V4H C;  2DCP A;  3SD5 A;  4WWN A;  5AN8 A;  4EZK A;  3TWQ A;  4O1P A;  3IEG A;  5AEN A;  3ISM C;  3HXC A;  3UT4 A;  4AXH A;  4GTS A;  3FTU A;  3G2S A;  1TNO A;  3OXG A;  3C5R A;  3CVN A;  4PH4 B;  2H6I A;  1S0P A;  5LCW C;  1DC2 A;  5EX0 A;  2R05 A;  4HI8 A;  1Y6I A;  3PNL B;  2ZU6 B;  4O6F A;  1E8X A;  3CVX A;  3LVQ E;  3HIZ A;  2ZXW E;  5HQ8 A;  3ZXS A;  3CV0 A;  3TAX A;  2LSU A;  3R9A B;  4EBA A;  4JW1 A;  1EF1 C;  4BSZ B;  5BT1 A;  4P29 A;  1VDY A;  3ZYL A;  3DBS A;  3S2A A;  3ASN E;  3CVQ A;  3J5P A;  5EID A;  3UM0 A;  1PAQ A;  2M63 A;  4OVV A;  4OVU A;  1QNF A;  1BI8 B;  3TGO A;  4X8Q A;  3ZHE A;  4L1B A;  2WXH A;  3ZW3 A;  1H2U A;  4LCT A;  4U7E B;  1PY1 A; 
#chains in the Genus database with same CATH homology
 2KCL A;  3CVU A;  1DNP A;  3AS5 A;  4JEU A;  2WXO A;  3HVE B;  3FH5 A;  4B94 A;  3U3W A;  2WM9 A;  2XGS A;  1WAO 1;  3CQG B;  4WNF A;  5E75 A;  3QDN A;  4A1S A;  3D9P A;  3LVR E;  4GMJ A;  1Y8M A;  5BV1 A;  2UWJ G;  4Y6C A;  1FVH A;  3RO3 A;  5FQ8 A;  4AOF A;  2EQX A;  5ANR A;  4E6H A;  4FP7 A;  3FDH A;  4A3T A;  3D9I A;  1HZ4 A;  4I1M A;  1OWP A;  3HYM B;  4N3B A;  3MKQ A;  3ENE A;  3Q49 B;  4GU5 A;  1OWN A;  3AU4 A;  3G2T A;  2JLB A;  4JEH A;  1TEZ A;  2A4Z A;  3B7T A;  3GYZ A;  4FHJ A;  2KCV A;  3PUJ A;  4OYS A;  5A7D B;  4KVO A;  4APF A;  2LNI A;  5BPP A;  1OWO A;  1E8Y A;  2OVF A;  3LJ3 A;  3BG1 B;  2WXF A;  2VSX E;  5DBK A;  3ZRH A;  3CVL A;  4BT9 A;  3HDX A;  4KYO B;  2IFU A;  3QWV A;  3QC1 A;  5C2Y A;  2V5F A;  3JQ0 A;  4U0S A;  4ANX A;  4CT0 A;  1JPL A;  3LPZ A;  3PDN A;  3LKU A;  3VTX A;  5LP0 A;  1QZ2 A;  1MQS A;  3FU0 A;  1X5B A;  3ONK A;  1H19 A;  4Q94 A;  3CVW A;  4APO A;  2I1K A;  4L23 A;  4IRU A;  5EKQ D;  4MKT A;  2WXQ A;  2XCB A;  4JHK A;  3KS2 A;  4BFR A;  2J07 A;  5D0Q D;  4BTB A;  3I4R B;  2L0I A;  4CGV A;  2P58 C;  1P5Q A;  4HLE A;  3PRE A;  4CDN A;  2WXG A;  4XKB A;  3C98 A;  2Q7F A;  4J8S A;  3UPV A;  4HXI A;  5ANL A;  1UN8 A;  2FI7 A;  2X6K A;  3NZS A;  2JEK A;  3JQ1 A;  3CHR A;  4WNG A;  3RO2 A;  2IJG X;  3FUH A;  1A17 A;  1NZN A;  3PZD A;  3CVV A;  4GML A;  4XE0 A;  4C0M A;  4NAC A;  3CIA A;  4HVB A;  5CMW A;  1U3D A;  2CHW A;  3MCX A;  3ZVV A;  2WB2 A;  4J8F A;  5J08 A;  4W9R A;  3QWW A;  4RG6 A;  2WVI A;  3LY9 A;  4LUN U;  4UWL A;  4U8H A;  3ZPJ A;  2WQ7 A;  2I2O A;  3FFL A;  4UI9 J;  3JCK C;  4UQZ A;  3FH8 A;  4ILI A;  2FO7 A;  3QJZ A;  3B7R L;  4IYP A;  2L9B A;  3FHE A;  5KCM A;  3UT8 A;  2OV8 A;  3L08 A;  3FWV A;  1FCH A;  2YHE A;  2J4D A;  2FEZ A;  4EPZ A;  1YA0 A;  3AS8 A;  5ENN A;  3P2B A;  3ML9 A;  3CHP A;  3D3M A;  4J0U A;  3QKY A;  4GYY A;  3ONL A;  3T5V A;  5JJT A;  3G2U A;  3FU3 A;  3IKO B;  4HOQ A;  4KXK B;  1Z3Y A;  2LAI A;  3KEZ A;  5E76 A;  4A1G A;  4AP2 A;  4G23 A;  4I6E A;  5LFA A;  4I2Z A;  1FVF A;  4RSY A;  5JHB A;  5KJK A;  3NZU A;  4FJZ A;  2AVP A;  3MYV A;  4AVX A;  2WXN A;  2GRM A;  1NP7 A;  3FUF A;  5FJY A;  3AU5 A;  4TV3 A;  4U07 A;  1N52 A;  3ZGQ A;  3LDZ A;  3FUJ A;  3O48 A;  4F7A A;  5J90 A;  3CR3 A;  2WXM A;  3RRU A;  4HOR A;  2FF4 A;  3QNK A;  3SNX A;  3ESL A;  1SZ9 A;  3MA5 A;  4FLH A;  2VGX B;  2J09 A;  3FU5 A;  2PQR A;  2XPZ A;  2Y3A A;  2GGF A;  3VLD A;  5M72 A;  3ZFW A;  1HX8 A;  3Q5M A;  4DI4 A;  4HOT A;  1ZBP A;  3MEK A;  4J8E A;  4WND A;  4D10 C;  4U0Z A;  1HFA A;  4ANV A;  3OTN A;  3HVE A;  2XRY A;  3JYS A;  4BT8 A;  2L0T B;  3ULQ A;  4E85 A;  1QQE A;  4NUR A;  3EHM A;  4PS7 A;  2R5S A;  4G11 A;  4LEU A;  3R7R A;  3IHV A;  4C9B B;  2KAT A;  3D9L A;  4LRZ A;  2CG3 A;  4DK5 A;  3QWP A;  3FY4 A;  4UQY A;  4PS3 A;  3KD7 A;  2KC7 A;  2CFU A;  4GB9 A;  1EYH A;  5LOZ A;  4KZC A;  3ASD A;  3FTY A;  1INZ A;  3LEW A;  3R7Q A;  1E96 B;  3CHO A;  4BTA A;  3N71 A;  2IF4 A;  2WMN A;  5LCW J;  5G04 C;  2OND A;  3APD A;  4GZD A;  3ZYQ A;  2CFZ A;  2PM6 A;  4IUL A;  1H0A A;  1H2T C;  2I9C A;  2R17 C;  3GZS A;  2VTB A;  4F1S A;  4UWK A;  2XPY A;  3S7F A;  4AY5 A;  3OXF A;  4GYW A;  4JVS A;  2VTB B;  4N3A A;  2HM8 A;  1HU3 A;  2WXR A;  5T8I A;  2UY1 B;  1IHG A;  3PE3 A;  4G25 A;  3S7D A;  4WNE A;  4GYO A;  4HOS A;  3D9O A;  4DJA A;  3O4Z A;  1UN9 A;  2HR2 A;  5KJL A;  3LYA A;  3T8M A;  4I1A A;  3I5P A;  4N2S A;  3FUN A;  3JUI A;  1IYG A;  2DIW A;  1HS6 A;  3SGH A;  3U64 A;  2LAH A;  4I9C A;  4UWG A;  3L54 A;  4L7T A;  4JPS A;  4G1T A;  2BUG A;  3B13 A;  3TG4 A;  4B8C B;  4EZL A;  1W3B A;  4JC8 A;  4URK A;  3Q4A B;  4J6I A;  4J8D A;  3IBE A;  2VSN A;  3FUM A;  1E8Z A;  4U0U A;  1HG5 A;  4GA1 A;  3CK8 A;  3ZN3 A;  1PC2 A;  2NSZ A;  2BTD A;  3PUK A;  4BWR A;  2C0L A;  5C1D A;  2Y4T A;  3CK7 A;  3OXL A;  4EBA G;  3FUL A;  3MZL B;  5FQ6 A;  3RIB A;  1JWG A;  2HYZ A;  2WXI A;  3FTZ A;  3QAR A;  3SI5 A;  2X3M A;  2J4B A;  1WM5 A;  3ML8 A;  4FJY A;  1HF8 A;  3NF1 A;  5AYW D;  4F3V A;  4KT6 B;  3U4T A;  5CCL A;  2MOW A;  4DLO A;  3MJW A;  2LSV A;  3G2V A;  1H6K A;  4M3O A;  2CG2 A;  4U04 A;  4I1O B;  4YND A;  3DPD A;  1E90 A;  4KZ0 A;  1SZA A;  5G05 C;  4BSX A;  2PL2 A;  3GZ1 A;  4FU3 A;  4XZ4 A;  4CDR A;  4XI9 A;  1EPU A;  3CVP A;  3LY8 A;  3PNT B;  4AJW A;  4V3I A;  3TL5 A;  3CKB A;  3TXM A;  4K03 A;  5ARG A;  4L2Y A;  4GAA A;  5EDS A;  4TRQ A;  4CCA A;  4DLQ A;  1Z6T A;  3URZ A;  4HFG A;  4FA6 A;  1ELW A;  1OUV A;  2FBN A;  4AY6 A;  3VLF A;  2IQC A;  2C2L A;  3FH7 A;  4EEC A;  4L2L A;  2AWI A;  3SF4 A;  4UWH A;  5CMY A;  4JHJ A;  4I43 A;  5BUZ A;  1IQR A;  3P1U A;  3PE4 A;  3UMV A;  4CDM A;  5KJN A;  4PDX A;  3SBT B;  3SFZ A;  3SHF A;  3SBS A;  5G04 J;  1ZU2 A;  2ION A;  3FEY A;  3MX3 A;  3PH0 C;  4CRW A;  4N2Q A;  4ME2 A;  1HXI A;  5KJM A;  4GZ5 A;  4ABN A;  1UG3 A;  3RJV A;  4JHR A;  1TJC A;  3MV3 B;  2QFC A;  4YVQ C;  5FZR A;  2HO1 A;  4B8A A;  2WMO A;  2A5U A;  2I6H A;  3CHM A;  4GZC A;  4WWP A;  2OVB A;  3S7J A;  4FC8 A;  3D9M A;  4ANW A;  3FP3 A;  2R59 A;  2AW6 A;  5FZQ A;  2KZT A;  5A6C A;  1E7U A;  3B7U X;  3D9K A;  4ANU A;  3CHS A;  2VGX A;  1HO8 A;  2KZT B;  5FWQ A;  3CST A;  4Q96 A;  3T5X A;  5BV0 A;  3I4G A;  4AV7 A;  4GA2 A;  4KBQ A;  4I6J A;  3FTW A;  4AIF A;  2X6F A;  3QAQ A;  2X6I A;  5ARF A;  4DPR A;  4Q69 A;  1XGW A;  2AXZ A;  2J49 A;  4U63 A;  4A3V A;  2XGM A;  4GZ3 A;  3CGH A;  2AXV A;  3FTX A;  4UI9 K;  2NC9 A;  2AXU A;  2GW1 A;  4ACL A;  3MKR A;  3FEX A;  4G2V A;  4GCN A;  1Z3X A;  4XX5 A;  4BX8 A;  1UJK A;  1U3C A;  2MRI A;  3KAE A;  3L13 A;  4XI0 A;  2XQ0 A;  5AJL A;  3CVY A;  4AM9 A;  2IU1 A;  4I2W A;  4LER A;  3PS6 A;  5CHE E;  2NXP A;  3L6A A;  3L16 A;  4A55 A;  4CT4 A;  3RU0 A;  4N5C A;  4H7X A;  5FTP A;  5A23 A;  2GRL A;  3AS4 A;  4KMO A;  1WY6 A;  3HHM A;  2E0I A;  3L17 A;  4MLP A;  4AEZ C;  4WAF A;  4G24 A;  1NA3 A;  5LX8 A;  5HI7 A;  4XKC A;  1B89 A;  2RD0 A;  3UX4 A;  2UY1 A;  2RG8 A;  4RVB A;  4CGW A;  2BF0 X;  3K9I A;  4WWO A;  4UI9 C;  1XNF A;  3QB2 A;  2MHK A;  3BG0 B;  4GZ6 A;  3EJN A;  3LXU X;  1ELK A;  2Y4U A;  2PZI A;  3APC A;  4HOU A;  2VSO E;  2C0M A;  2V0P A;  3FTV A;  3BEE A;  3RRM B;  3LS8 A;  1E8W A;  3VLE A;  2VSY A;  4NRH B;  3FU6 A;  3CQC B;  5JJ7 A;  3EDT B;  4DI3 A;  3QOU A;  4BX9 A;  5CCM A;  2KCK A;  4PUC A;  3VTY A;  4FUL A;  4KVM A;  2X6J A;  1LF8 A;  3OAW A;  4UWF A;  2XCC A;  2KM4 A;  4Y6W A;  3L22 A;  2WQH A;  4I9E A;  4TUU A;  3ESK A;  4GPK A;  4GCO A;  4B89 A;  2VYI A;  1N54 A;  3MKQ B;  3CHQ A;  1KT0 A;  4H7Y A;  3U9W A;  4G26 A;  1H2V C;  4ILG A;  4C0E A;  4EZJ A;  2J9Q A;  2IOL A;  3FUK A;  3S7B A;  3E4B A;  3APF A;  2VQ2 A;  1HG2 A;  2VJ8 A;  2XGO A;  3FUI A;  1OWL A;  2DCP A;  1L5J A;  3SD5 A;  1GW6 A;  2QY7 A;  4NQ0 A;  2XHE A;  4WWN A;  3RKV A;  3B7S A;  2L6J A;  3CEQ A;  4IN3 B;  2WXJ A;  4EZK A;  4K0R A;  3EHN A;  3I3N A;  3ZEF A;  3PVL A;  4I6G A;  5G55 A;  3MV2 B;  2YIN A;  1KLX A;  4ACK A;  4QFV A;  4JA7 A;  3PRZ A;  3IEG A;  2IOS A;  4MRU A;  5T3R A;  5AEN A;  4I17 A;  2XRZ A;  3EIJ A;  3LY7 A;  3G2W A;  5DIZ A;  4MS6 A;  3UT4 A;  4AXH A;  2CHX A;  3CKC A;  3FTU A;  3G2S A;  2J08 A;  2X6H A;  3RRN B;  2WXK A;  1UW4 B;  1BPO A;  1JUQ A;  4JXT A;  2WPV A;  1UJJ A;  4JZY A;  1DVP A;  3OXG A;  2V8S E;  4FLB A;  1OWM A;  3CVN A;  2PQN A;  2X38 A;  4PH4 B;  3IV0 A;  1S0P A;  5LCW C;  2VGY A;  5EX0 A;  3D9J A;  3ZYM A;  2WQ6 A;  3ASH A;  3FUE A;  1Y6I A;  2XPI A;  3MGB A;  3Q15 A;  5JJ6 A;  4GA0 A;  3PNL B;  4RG9 A;  2I1J A;  4WUY A;  1TJF A;  2ZU6 B;  4O6F A;  1E8X A;  5JHA A;  3CVX A;  4EQF A;  3LVQ E;  2CHZ A;  2WXP A;  5EX3 A;  3PEU B;  3CSF A;  4FHK A;  3ASF A;  3HIZ A;  3CK9 A;  3ZYK A;  5HQ8 A;  3ZIM A;  3GW4 A;  3ZXS A;  2WXL A;  3CV0 A;  3TAX A;  2LSU A;  3GZ2 A;  3UT7 A;  2LO6 A;  3R9A B;  4UQX A;  4CEM A;  2ILR A;  2PM7 A;  4EBA A;  4XIF A;  4JW1 A;  4HS2 A;  3U66 A;  1EF1 C;  2E2E A;  5G2N A;  3FUD A;  5BW8 C;  4JA9 A;  5FZS A;  5BT1 A;  1KT1 A;  4P29 A;  1VDY A;  1HE8 A;  5FQ7 A;  3CLJ A;  3FTS A;  3SZ7 A;  2DBA A;  3ZYL A;  3WXX A;  5BNW A;  1ELR A;  2YHC A;  3DBS A;  4N39 A;  3UQ3 A;  4ILH B;  3QK0 A;  4JL0 A;  2YNQ A;  3S2A A;  3UUX A;  3IHY A;  4N3C A;  4R7L A;  5AIJ A;  2OOE A;  1SQM A;  3CVQ A;  3D9N A;  5FQ4 A;  1HH8 A;  4YVO A;  5T4Y A;  1PAQ A;  3PEV B;  2M63 A;  3LCA A;  5AJD A;  3RK6 A;  4OVV A;  4B0Z A;  4OVU A;  1QNF A;  2YQ8 A;  1MHQ A;  5D0O D;  3TGO A;  2FUL A;  3ZHE A;  5FT9 A;  4L1B A;  1E7V A;  5G05 J;  4PS8 A;  2WXH A;  2V4L A;  1JWF A;  2XEV A;  1NA0 A;  1IQU A;  1H2U A;  3TG5 A;  3TJP A;  3ZW3 A;  1EDU A;  4LCT A;  3ZHE B;  4BY6 A;  3Q47 B;  4FAD A;  4F53 A;  3ASG A;  3EIQ C;  3NQP A;  4ATG A;  3TXN A;  1PY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...