4GYOA

Crystal structure of rap protein complexed with competence and sporulation factor
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
366
structure length
357
Chain Sequence
PSEEVAVKLNEWYKLIRAFEADQAEALKQEIEYDLEDMEENQDLLLYFSLMEFRHRIMLDKLMPVKPFSDMLNEIESNLTGLLEYYFYYFRGMYEFKQKNFILAIDHYKHAEEKLEYVEDEIEKAEFLFKVAEVYYHIKQTYFSMNYASQALDIYTKYELYGRRRVQCEFIIAGNLTDVYHHEKALTHLCSALEHARQLEEAYMIAAAYYNVGHCKYSLGDYKEAEGYFKTAAAIFEEHNFQQAVQAVFSLTHIYCKEGKYDKAVEAYDRGIKSAAEWEDDMYLTKFRLIHELYLGSGDLNVLTECFDLLESRQLLADAEDLLHDTAERFNQLEHYESAAFFYRRLMNIKKKLAEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
molecule keywords Response regulator aspartate phosphatase J
total genus 158
structure length 357
sequence length 366
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyoA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyoA02
4AY6A 4AY5A 4BT8A 4CDRA 2FI7A 5FZQA 3CVQA 3MKRA 2C0LA 3PDNA 3Q49B 5EX3A 4J0UA 4XI0A 5KJKA 4HOTA 3UPVA 3U4TA 3O48A 3N71A 3S7DA 1WAO1 3TG5A 3GYZA 1KLXA 2AVPA 2XPIA 2PQRA 3Q15A 4HOSA 2R5SA 2VGXA 1NA3A 2L6JA 2XCCA 1FCHA 4RG6A 5D0OD 3U3WA 1XNFA 5HQ8A 4JA9A 4G2VA 4GZ3A 5AYWD 3UUXA 3LKUA 3GZ2A 5G05J 5A7DB 4H7YA 5KJNA 2Y4TA 3SZ7A 3QWVA 5CCLA 4WNFA 5D0QD 3RO2A 2Y4UA 5BW8C 4YNDA 2FEZA 4WNEA 2VGYA 5FTPA 3VTXA 3TGOA 4B94A 3GZ1A 3PE3A 5DIZA 2Q7FA 4WNGA 3OXLA 3CV0A 4I17A 5G04J 5HI7A 5C1DA 3RIBA 4G26A 5KJMA 1ZU2A 1P5QA 4KYOB 2NC9A 4UI9J 4G1TA 4AM9A 1TJCA 2XGOA 5KJLA 4GA1A 2DBAA 3ASGA 3LY9A 2YHCA 3Q47B 4U0ZA 4XIFA 5CHEE 5ARGA 1HXIA 5JJTA 4BTAA 4NQ0A 3JYSA 4O6FA 3OXFA 4BT9A 3ESKA 3LPZA 4YVQC 1Y8MA 1ZBPA 4NRHB 3CK8A 4G25A 3QDNA 3RKVA 3S7FA 2LSUA 2PQNA 2IF4A 3MV2B 3UQ3A 5FZRA 2JLBA 3ZN3A 4BTBA 2FO7A 4H7XA 4Y6CA 3AS4A 4IN3B 2KCKA 3WXXA 2VYIA 3SF4A 3CVNA 4U0SA 4CGWA 2C2LA 4J8DA 2E2EA 2P58C 4HOUA 4U0UA 2FF4A 5FT9A 3QWPA 4N2SA 4WUYA 5M72A 5LCWC 1B89A 1HZ4A 1KT0A 2UY1B 2OOEA 2FBNA 4W9RA 3URZA 4UI9K 1QZ2A 2WQHA 2MHKA 3KAEA 5A6CA 4CGVA 2VSYA 3R9AB 3ZHEA 2WPVA 4GA2A 4N5CA 3HYMB 4GYYA 3QKYA 4HOQA 3CKBA 4GA0A 4RG9A 3ZPJA 3AS8A 4JL0A 4KXKB 4HORA 3RO3A 3CVPA 4AIFA 4GPKA 2KATA 4G23A 4J8FA 3CKCA 1E96B 3E4BA 2KC7A 3KS2A 2ONDA 3S7BA 2KCLA 2UY1A 3OXGA 2PZIA 5LCWJ 5FZSA 3MV3B 4ME2A 2J9QA 2LNIA 3RU0A 3FFLA 3CK9A 1ELWA 1WM5A 5CCMA 4GCNA 3MEKA 4JA7A 3IEGA 5JJ6A 4WNDA 3TG4A 5EX0A 4BWRA 3S7JA 3CK7A 3LY7A 3KD7A 4N3AA 2HYZA 1NA0A 3ZHEB 3ULQA 2XEVA 4UQZA 2IFUA 1W3BA 2UWJG 4I9CA 3ZFWA 2V5FA 4I2WA 4GYOA 4I2ZA 4F3VA 3NF1A 3MA5A 4ABNA 2C0MA 3GW4A 2HO1A 2XGMA 5FJYA 2PL2A 2XGSA 3CVLA 3FWVA 3K9IA 2I6HA 4KBQA 1ELRA 3PE4A 2HR2A 4GCOA 4J8EA 5EKQD 3ASDA 2YQ8A 2VGXB 4U04A 5DBKA 3RJVA 2XCBA 4GZ5A 3LCAA 5JJ7A 1HH8A 1QQEA 3Q4AB 3ASHA 1KT1A 3LYAA 2KCVA 4A1SA 1YA0A 2QFCA 4Y6WA 4N39A 4EQFA 3LY8A 1IHGA 4JHRA 4U07A 5BT1A 2VQ2A 3QOUA 1IYGA 1OUVA 4YVOA 4N3CA 1NZNA 2BUGA 4N2QA 3VTYA 3Q5MA 2VSNA 3TAXA 4APOA 4I9EA 4G24A 3FP3A 4UQYA 5BNWA 3EDTB 2LSVA 3ZGQA 4UI9C 5ARFA 2GW1A 3AS5A 4I1AA 4LEUA 3ASFA 1A17A 3BEEA 3CEQA 3QWWA 4N3BA 4UQXA 5G05C 1PC2A 4XI9A 5G04C 4GZ6A 4GYWA
chains in the Genus database with same CATH superfamily
1N94A 2WXKA 4A3TA 4DI4A 5CECB 2WXPA 2PM6A 3S7DA 3JCKC 3AU4A 3Q15A 5EILA 2L6JA 4ZFHA 3GZ2A 3CVVA 4KZCA 1TJFA 5T8IA 3KSQA 1Z3XA 3T5XA 4WWNA 1NP7A 2B6CA 1IKND 4G1TA 4FC8A 4U0ZA 1SA4A 5A23A 4BTAA 3JYSA 4PH4B 5JHBA 3S7FA 4JEHA 5T3RA 3EJNA 3FU6A 4HI8A 4H7XA 4A1GA 2RKKA 3ZVVA 3FU5A 5FT9A 3U9WA 5EIDA 4NIKA 4RLYA 4FULA 2IO3C 1FT2A 4OVVA 3ESLA 1DC2A 3ZEFA 3R7RA 3MV3B 1ELWA 3EIQC 4RVBA 3E30A 4I2ZA 3MA5A 4AEZC 3DRAA 5JJ7A 3Q4AB 1OWLA 3T9KA 1QYMA 2WXFA 3ABKE 5KNHD 4BEPA 3PZ1A 5AENA 1D8DA 3QWWA 3ASFA 4LCTA 3UPVA 3O48A 3TG5A 2XPIA 3DSXA 4F6RD 5HKPA 1FCHA 3TWUA 3MX3A 4GTSA 3RSEG 5AYWD 4FJZA 4TRQA 2IOSA 2XPZA 3VTXA 4B94A 1L5JA 4OAUC 3Q79A 2DZOA 3CHQA 3LY9A 3HVEB 5ENTD 1QNFA 2NXPA 3DEPA 3HXCA 4IULA 1SA5A 3PZ4A 3RKVA 2ETBA 4JD2G 2GRQB 3DSUA 4GTTA 3CLJA 4MBGA 3E37A 5LCWC 3PZDA 3W9FA 1U2VG 2A5UA 3WG7E 1N52A 3FUDA 2WXNA 5C2YA 2J4BA 2X6FA 5FINA 1KPSB 4DX1A 3NB2A 1S63A 2QZAA 1E8ZA 4PUCA 3IEGA 4I6JA 5EX0A 4FA6A 1GW6A 3Q7FA 2L6BA 3SQVA 3D9NA 3Q9UC 3O4ZA 3JUEA 4RSYA 3HHMA 3P1UA 2OVBA 4Y6WA 1IYGA 3G2WA 3ABME 1FPPA 1JWFA 5ARFA 4LUNU 4XI9A 2LXLA 4GB9A 4CDRA 4L2YA 1SW6A 4XX5A 3Q75A 4XI0A 3APFA 3AG2E 3CHOA 3CHPA 1TNOA 5A7DB 4H7YA 3TXNA 4WNFA 4DX6D 2GROB 3IHYA 4XKBA 1BI8B 3OXLA 3AJIA 4AM9A 5J90A 3ASGA 3D9OA 5EIBE 2V4HC 1LF8A 4G25A 4LG6A 2QC9A 3ZN3A 2X6IA 4CCAA 4C9BB 4B89A 1S70B 3PNLB 1BLXB 4BSXA 2VSOE 3HIZA 5M72A 1HZ4A 4TUUA 3SD5A 4RQIA 4GA2A 3QKYA 3C3RA 3CVUA 3PNTB 5CERB 2KATA 3PVLA 1OCRE 3UKRG 3FEXA 1TNZA 2PZIA 3ML8A 3RU0A 4D10C 5JJ6A 3CHMA 3LY7A 1Z6TA 3SBTB 2HYZA 5KWDA 5G55A 4PS8A 1AWCB 1NFIE 2LAHA 3D9IA 4KBQA 4GCOA 2VGXB 2L0IA 4DX7D 4A55A 1HH8A 3HXEA 1KT1A 1IHGA 4ZHBA 3EIJA 1OUVA 3OAWA 2CHZA 4FHJA 4APOA 3MJWA 1EDUA 4O60A 4DX2A 3CVQA 3MKRA 3NOCD 3PDNA 4J0UA 3C3QA 5JMND 4JW1A 5FQ8A 1EPUA 4I1MA 3EHNA 1MZCA 3Q73A 2I1KA 5FTPA 4L2LA 3TWQA 1OXJA 4LRZA 5AJDA 4UI9J 3ZXPA 4AXHA 3V2OA 3UTMA 4HLEA 4O6FA 5LX8A 1ZBPA 2PQNA 5BV0A 4URKA 4U8YD 2P58C 1BU9A 5J08A 3KAEA 5A6CA 4HOQA 5CRVA 3EU9A 4GTPA 3CVPA 2CFZA 3UIPC 1G3NB 4Q69A 1YYHA 2UY1A 2WQ6A 3J5QB 4ME2A 5BUZA 1N95A 1JCRA 3S7JA 3NZUA 2Y69E 3C3OA 5EYLA 2H6IA 4JHKA 3SGHA 2H6HA 3DXKG 5FJYA 4U96D 4L7TA 5B3SE 2B0OE 2OVFA 1QQEA 4EQFA 4U07A 3ULEG 4AP2A 5H7PA 4WWPA 1N54A 5G05C 1A17A 4N3BA 4GYWA 2CHWA 4BT8A 3TXMA 4WAFA 2C0LA 5EX3A 4HRNA 5AQ7A 3BU8A 5HQ8A 3TL5A 4G8KA 3NQPA 2F8YA 1E7VA 4GAAA 3TGOA 2FEZA 2AXVA 3BG0B 4OYSA 1X5BA 1OWMA 3DEOA 5BXUA 1ZU2A 3CQCB 4MS6A 2YHCA 2IU1A 3CK8A 4GZCA 3F6QA 5AQAA 2JLBA 5EN5D 4FLBA 4Y6CA 3ZW3A 2P9UG 2VYIA 1U3CA 4HOUA 4I43A 2FF4A 3QWPA 1OWNA 1OWPA 2MHKA 4BERA 4GYYA 3EHMA 3CGHA 4K5BA 4P29A 4YDOA 2YNQA 2GRNB 2WXHA 2M63A 4C0MA 2J9QA 2R17C 3CVXA 4E85A 4JPSA 5CRUA 5G2NA 3NF1A 5HS0A 3K9IA 4DX5D 4UUCA 3ZKJA 3TWSA 1WDYA 4C48B 5ENRD 2RG8A 4UQXA 1UW4B 1BPOA 3UT8A 3L17A 3DSVA 3N71A 4DJAA 4AV7A 3L6AA 1KLXA 2AVPA 2BKGA 2X6HA 1H6OA 4JB8P 1NA3A 4JA9A 1K1AA 4JXTA 3ZIMA 1S64A 4FADA 3QARA 2J07A 4EZKA 4TXPA 3CIAA 2VGEA 3LEWA 4GA1A 3ULYA 1K1BA 2WXLA 4NQ0A 1JPLA 3PRZA 5B1AE 2IONA 4YVQC 2XENA 3DBSA 5CBNA 1LTXA 5CEDB 5KNGA 1H6KA 2OOEA 1N4PA 3B7TA 4B8CB 2DZNA 1AP7A 4KZ0A 2ETCA 3E34A 4AIFA 2R02A 2BF0X 4OAVB 3MGBA 3D3MA 4Q94A 4EBAG 4HI9A 4E6HA 3CVYA 4HFGA 3L16A 3UM3A 3SNXA 2P9SG 2HO1A 2PL2A 2I6HA 3ASOE 2X38A 4K0RA 1H0AA 4GZ5A 3TWWA 3IKOB 1UJJA 3VLEA 3VLFA 4LNBA 2P9NG 2Y0BG 4N2QA 3Q5MA 2VSNA 2OEWA 3EDTB 4G8LA 5AN8A 4A63B 3U3WA 5ITZF 2YINA 4MKTA 4ACLA 2XS8A 3IBEA 2XRZA 3U4TA 5ANRA 3QNKA 4G11A 4AOFA 4GTMA 3GZSA 1LD7A 3RRNB 3FUEA 4QFVA 4JZYA 2CG2A 3CV0A 3NZSA 3C98A 5ENOD 5ARGA 4U7EB 4DI3A 3ASNE 1JCQA 1V55E 4LSZE 3MV2B 2WVIA 4EECA 3MKQA 4DRXE 4BY6A 1RW2A 4WUYA 2EINE 1KT0A 3EHRA 4I6EA 3APDA 5BV1A 4JEUA 3B95A 3CKBA 4GMRA 2FO1E 4GPKA 2RD0A 4CYMD 3KEAA 5CEAA 3FTVA 5BPPA 4UWLA 4YDEA 2ZISA 4CRWA 1UG3A 2JABA 4L9PA 3FTWA 5AARA 3FUNA 4F3VA 1E90A 4KMOA 4TUMA 3ZXSA 4UWFA 1TR4A 3LYAA 3SO8A 3HG0D 3D9PA 2WB2A 2ZXWE 1MX4A 3CEQA 2HM8A 3TG4A 2LXMA 3HXBA 2IEJA 2PQRA 1MHQA 4DLOA 2VGXA 1MX6A 3RK6A 4DLQA 4CEMA 5KJNA 2Y4TA 5CCLA 3ZYKA 3UX4A 1HS6A 5DIZA 2V4LA 3RIBA 1P5QA 4KYOB 4HB5A 5FIOA 1TN6A 1UOHA 3ESKA 2IY0C 3LPZA 1Y8MA 1WG0A 4MLPA 3FU0A 3AS4A 3FUJA 4IN3B 4WWOA 2C2LA 3APCA 3PH0C 4XKCA 3AG4E 3ONKA 5B1BE 2IJGX 2I2OA 1N4RA 4F1PA 3MZLB 2WQHA 2DCPA 3ZUVB 4NACA 4KXKB 3FULA 3FU3A 4G23A 2X3MA 3CSTA 2IOLA 4IRUA 1RZ4A 1WM5A 5EDSA 4F1SA 4TXRA 3TJPA 3CVLA 3ZYMA 2X6JA 2L0TB 1DCQA 1INZA 1D8EA 2XCBA 4NURA 3FHEA 1YA0A 4ACKA 1SZAA 1MX2A 3ZGQA 2GW1A 4LEUA 3SZ7A 1JWGA 5BW8C 4ANUA 4V3IA 1K3ZD 3JXIA 2E0IA 4GMJA 3Q49B 5CBOA 5LOZA 3RRMB 3GYZA 2QYUA 2EIJE 5E75A 4DUIA 2R5SA 1XNFA 3SBSA 4G2VA 2FULA 4BSZB 3UIOC 2V8SE 2AJAA 2DVWA 3GZ1A 2Q7FA 5KJMA 1DNPA 4FHKA 1H2TC 4GTRA 4HBDA 4MRUA 5HRYA 4FJYA 1N4SA 1A5EA 2FO7A 3OTNA 4U8VD 2RFMA 3R7QA 1SQMA 4GTOA 3CVNA 1BI7B 4XEIG 1JCSA 3UI2A 3URZA 3FY4A 3J5PA 2WXGA 3UT4A 4DPRA 2P9KG 3ZHEA 3DWLG 1O1SA 5AJLA 1MQSA 3JUIA 3HXFA 2NSZA 3FFLA 3B7BA 4JA7A 4LNGA 4WNDA 2IO2C 3ZYLA 2IQCA 3IXEA 1SVXA 4N5QA 4AVXA 1LD8A 2AXZA 1H2VC 3V31A 1S0PA 3PE4A 2DWZA 3UINC 2YQ8A 4B93B 3ISMC 2XZDG 3I3NA 5BT1A 4M7CA 4YVOA 5FWQA 5LFAA 3FP3A 5BNWA 4B8AA 5G04C 4TXQA 4K5AB 2XZTG 2VTBA 2XCCA 3IHVA 2AW6A 2KXPC 1FVFA 1HG5A 3S2AA 4ANWA 3UMVA 1IQUA 2EIME 5G04J 3IV0A 3D9MA 1TJCA 5JA4D 2OV8A 3G2TA 1H2UA 3VLDA 3V30A 1H19A 2KBXA 1UN9A 2WMOA 1NI1A 2KCKA 5D2MC 2GRLA 1OT8A 1TN8A 4U63A 2CFUA 2XEEA 3DSTA 3ABLE 2WMNA 2ZGDA 3V79K 3FUHA 4JC8A 4CDMA 1MJ0A 3FH8A 2F37A 2WXRA 4PS3A 4BWRA 2CHXA 3MKQB 3NAWA 4UQZA 4I9CA 5AQ9A 1TNYA 5JHAA 4ANVA 1ZB1A 1HG2A 4FP7A 2JEKA 4A1SA 2GGFA 3TAXA 4J8SA 3FTUA 3PUJA 5FQ7A 1NL4A 3E32A 1SZ9A 5CMWA 4AY5A 1WY6A 2RFAA 4BFRA 1TNBA 4CDNA 4ATZD 4ILGA 5E76A 2F0YA 3UUXA 3W9GA 3EU5A 2DYSE 2J49A 2VGYA 2J09A 2V5QC 1OCCE 1HO8A 3B7UX 3PS6A 3OXFA 4I6GA 4BT9A 3HDXA 2P9LG 4J6IA 1H6PA 1E8YA 4BTBA 4GU5A 1OY3D 2WXIA 2J4DA 3UM1A 4J7WA 2FBNA 3QC1A 2WXJA 3B13A 1E96B 4U95D 3R9MA 2KC7A 3S7BA 3SFYA 3FTSA 5FQ6A 3CK9A 1YMPA 3B7RL 2GRMA 3CK7A 1D9SA 2OCCE 1HF8A 3ZU7B 1Y6IA 1FT1A 2C0MA 4UWKA 3HRAA 2EIKE 3ASDA 4X8QA 2I1JA 3UM2A 3UM0A 4N39A 3D9JA 2P9PG 2QYJA 1NZNA 3VTYA 4HVBA 4G24A 1EF1C 4I1AA 1HFAA 3E33A 2R59A 3ZFWA 4O1PA 1N4QA 3T5VA 3QJZA 1WAO1 2R05A 3CHRA 3LVQE 2XPYA 4B0ZA 4GZ3A 3LKUA 2MYOA 4BX8A 4YNDA 2WXMA 2WXOA 1KZPA 4CZ2D 3PEVB 2BEDA 3Q47B 5JJTA 3FUKA 3TWTA 5FZRA 5BXOA 4HNAD 3FTYA 3FH7A 4HS2A 4J8DA 3L54A 2GRPB 3LXUX 1N0RA 4KT6B 2A5EA 2H6FA 2KZTA 4CGVA 3LVRE 2WPVA 3LJ3A 3L22A 1IXVA 3UT7A 3G2UA 4GA0A 3AS8A 4JL0A 4HORA 2BKKB 4J8FA 3CKCA 3E4BA 2ONDA 3LJNA 1PY1A 5CCMA 3MEKA 1NA0A 2XEVA 2IFUA 1TN7A 2V5FA 2Y3AA 4R7LA 1V54E 2XGSA 5EKQD 2HR2A 3AAAC 3AG3E 3ASHA 2QFCA 4EZJA 3Q7AA 4I9EA 1TYQG 3SY2A 2NYJA 3SFXA 5ANLA 1E8XA 5ENSD 1JUQA 2VJ8A 3U66A 3PZ2A 2LUHA 3SI5A 4RG6A 3SHFA 2Y4UA 2X6KA 4WNEA 3PE3A 3PUKA 4XE0A 3FUIA 2VSXE 3D9KA 4BETA 2ZGGA 2NC9A 1O1TA 2XHEA 5CHEE 3PREA 3DPYA 2R03A 4AJWA 4M3OA 4ATGA 2LO6A 1OWOA 2L9BA 3FTZA 3QDNA 3TWXA 3V2XA 3D9HA 2HE0A 4KVMA 2J08A 1O5MA 1TNUA 4EBAA 3HVEA 1X81A 1B89A 4EHMA 2UY1B 3ZYQA 5T4YA 4L23A 4IYPA 1OCZE 3RO3A 4YDYA 3DPDA 4PS7A 1QBQA 3KD7A 2ZU6B 4I1OB 3LS8A 4KVOA 3GW4A 3MCXA 3WXXA 2YHEA 3SF4A 1ELRA 1N0QA 3JXJA 4J8YA 3G2VA 3QK0A 2WM9A 4GTVA 3C72A 3CHSA 3DSWA 4CT4A 1PC2A 4NRHB 1U3DA 2FI7A 2ILRA 5FZQA 3X2QE 3CSFA 4PDXA 5D66A 2OEVA 5ENQD 1HX8A 4GZDA 1EYHA 1Z5SC 3C5RA 2P9IG 2AWIA 4WNGA 4G26A 4A3VA 3CQGB 5KJLA 3MYVA 4XZ4A 4XIFA 4UWHA 1HXIA 5KCMA 2LAIA 3D9LA 1TEZA 3I5PA 4U8HA 1BD8A 2E2EA 2WXQA 4O1OA 3P2BA 3PEUB 4UI9K 1QZ2A 2MRIA 4L1BA 2R2LA 2AXUA 3DXMG 4RG9A 2EILE 1HU3A 5AQBA 3KS2A 5AAOA 2KCLA 2ETAA 3OXGA 5LCWJ 1YCSB 3ZHEB 3Q9NC 4N3AA 2MOWA 1XGWA 5LP0A 2PNNA 4I2WA 4Z68A 4GYOA 4APFA 2XGMA 1E8WA 4J8EA 4ILIA 4F7AA 3EUVA 3QB2A 3Q78A 4CT0A 3QOUA 3PZ3A 3NBNB 3UKUG 2VTBB 4GPMA 2XEHA 3L82A 4HLLA 4EZLA 4ANXA 3BEEA 3ENEA 4GZ6A 3TWRA 4HRLA 3DSSA 1N9AA 3KSLA 4HOSA 2P2CP 1N11A 5FQ4A 1KZOA 3RO2A 2XRYA 4I17A 3BG1B 1Z3YA 4LNUD 2XGOA 2DBAA 4FU3A 4OVUA 3ZNGA 2Y1LE 2DIWA 2LSUA 4C0EA 3L9TA 2GRRB 2DYRE 4FLHA 1UN8A 2XS1A 3FDHA 5CMYA 2PM7A 4W9RA 4Q96A 3B7SA 3ZRHA 3T8KA 1VDYA 2BTDA 2VSYA 3HYMB 3SFZA 3U64A 3FTXA 3JQ1A 4EPZA 5ENNA 2CG3A 5FZSA 2LNIA 3KEZA 2H6GA 2F8XK 4GCNA 3T8MA 3EHQA 3BUAA 3ULQA 1PAQA 4BX9A 3FH5A 1HE8A 1IQRA 3FUMA 3JQ0A 4CGWA 4ILHB 3FWVA 4U04A 5DBKA 2J8SD 2KCVA 3AG1E 3FEYA 3L13A 1UJKA 2WQ7A 1DCEA 2KM4A 4N3CA 2BUGA 4UQYA 1DVPA 4UI9C 3RAUA 4F53A 3BQOA 4AY6A 4K03A 4HOTA 5KJKA 2V0PA 4GMLA 3AU5A 3QAQA 1MYOA 3TWVA 5D0OD 4BESA 1Q2ZA 4JHJA 5G05J 3CR3A 4HRMB 3QWVA 5D0QD 1O1RA 2A4ZA 5HI7A 5C1DA 3RRUA 3HXDA 4QQIA 3G2SA 5AIJA 5EYPF 2EQXA 3CVWA 3FUFA 3UQ3A 2IF4A 3L08A 4U0UA 4N2SA 3I4RB 4GTQA 5ENPD 2ZIRA 3NOGD 2I9CA 1IHBA 2QY7A 3R9AB 4HQDA 4N5CA 3ML9A 5IY5E 3UXGA 3ZPJA 3LDZA 5KBAA 4UWGA 2KZTB 4HXIA 1W3BA 2UWJG 1E7UA 3I4GA 1K8KG 4ABNA 2XQ0A 1FVHA 3RJVA 3LCAA 1OCOE 3ONLA 4JVSA 3LY8A 4JHRA 2VQ2A 1ELKA 4DK5A 2LSVA 4K5CA 4TV3A 3AS5A 4LERA 4U0SA 4YDWA
chains in the Genus database with same CATH topology
4V3IA 2CHWA 4BT8A 2E0IA 2WXKA 3TXMA 4GMJA 4WAFA 2C0LA 3Q49B 5EX3A 5LOZA 4A3TA 4DI4A 3U66A 3RRMB 2WXPA 2PM6A 3S7DA 3JCKC 3GYZA 3AU4A 3Q15A 5E75A 2R5SA 2L6JA 3SI5A 4RG6A 1XNFA 5HQ8A 3SBSA 4G2VA 3TL5A 3NQPA 2FULA 3GZ2A 3SHFA 1E7VA 3CVVA 4KZCA 2Y4UA 2X6KA 4GAAA 2FEZA 4WNEA 2V8SE 2AXVA 1TJFA 5BW8C 5T8IA 1Z3XA 3BG0B 3GZ1A 3PE3A 3PUKA 2Q7FA 4XE0A 5KJMA 3FUIA 4OYSA 1X5BA 2VSXE 3T5XA 1OWMA 4WWNA 3D9KA 1ZU2A 3CVYA 1NP7A 2NC9A 2XHEA 4G1TA 4FC8A 3CQCB 1DNPA 4MS6A 2YHCA 3PREA 4U0ZA 5CHEE 4FHKA 1H2TC 4MRUA 5A23A 4AJWA 4M3OA 4ATGA 4BTAA 2LO6A 3JYSA 4FJYA 1OWOA 2IU1A 4PH4B 2L9BA 3CK8A 3FTZA 3QDNA 4GZCA 3S7FA 5JHBA 4JEHA 5T3RA 2JLBA 3EJNA 3FU6A 2FO7A 4H7XA 4FLBA 4Y6CA 3OTNA 3ZW3A 4KVMA 2VYIA 3R7QA 4A1GA 1SQMA 2J08A 3CVNA 4EBAA 3ZVVA 1U3CA 3FU5A 3HVEA 4HOUA 2FF4A 4I43A 3QWPA 5FT9A 3U9WA 1B89A 1OWNA 2UY1B 3URZA 3ZYQA 3FY4A 2WXGA 4FULA 5T4YA 3UT4A 4L23A 1OWPA 4IYPA 2MHKA 4DPRA 3ZHEA 4GYYA 3EHMA 3CGHA 4OVVA 4P29A 3ESLA 3RO3A 2YNQA 5AJLA 1MQSA 2WXHA 3JUIA 2M63A 3ZEFA 2NSZA 3R7RA 4C0MA 3MV3B 2J9QA 3DPDA 2R17C 3FFLA 4PS7A 3CVXA 1ELWA 3EIQC 4JA7A 4WNDA 4E85A 3KD7A 2ZU6B 4RVBA 4JPSA 3ZYLA 2IQCA 5G2NA 4I1OB 4I2ZA 3LS8A 3NF1A 3MA5A 4KVOA 4AVXA 2AXZA 3GW4A 1H2VC 3MCXA 3K9IA 2YHEA 3SF4A 3WXXA 1S0PA 1ELRA 3PE4A 4AEZC 2YQ8A 5JJ7A 3Q4AB 1OWLA 3G2VA 3I3NA 2WXFA 5BT1A 4YVOA 3QK0A 2WM9A 5AENA 3CHSA 5FWQA 5LFAA 3FP3A 5BNWA 2RG8A 3QWWA 4B8AA 4CT4A 4UQXA 1UW4B 3ASFA 1PC2A 1U3DA 4NRHB 5G04C 1BPOA 2FI7A 3UT8A 2ILRA 5FZQA 3CSFA 3L17A 4PDXA 4LCTA 3UPVA 3O48A 3N71A 4DJAA 4AV7A 3L6AA 1HX8A 4GZDA 3TG5A 1KLXA 2AVPA 2X6HA 2XPIA 3TGOA 1EYHA 2VTBA 1NA3A 2XCCA 1FCHA 3MX3A 3IHVA 4JA9A 2AW6A 5AYWD 4FJZA 4TRQA 4JXTA 3SZ7A 2IOSA 3ZIMA 1FVFA 1HG5A 3S2AA 4FADA 3QARA 2J07A 2XPZA 3VTXA 4B94A 4ANWA 2AWIA 4WNGA 1IQUA 5G04J 3UMVA 4EZKA 4G26A 1L5JA 3CIAA 3IV0A 4A3VA 3CQGB 3D9MA 5KJLA 3MYVA 1TJCA 3LEWA 4XZ4A 4GA1A 3CHQA 3LY9A 4XIFA 2WXLA 3HVEB 4UWHA 2OV8A 1HXIA 1QNFA 4NQ0A 1JPLA 3G2TA 1H2UA 2NXPA 3PRZA 4IULA 3VLDA 2IONA 4YVQC 5KCMA 2LAIA 1H19A 3DBSA 1UN9A 3D9LA 3RKVA 1TEZA 2WMOA 3I5PA 2KCKA 4U8HA 3CLJA 2E2EA 2WXQA 5LCWC 2GRLA 1H6KA 2OOEA 3PZDA 3P2BA 2A5UA 3PEUB 4UI9K 3B7TA 1N52A 1QZ2A 2WXNA 3FUDA 4B8CB 4U63A 2CFUA 2MRIA 4L1BA 2AXUA 5C2YA 2J4BA 2X6FA 4KZ0A 4RG9A 2WMNA 4AIFA 1HU3A 2BF0X 3MGBA 3KS2A 3D3MA 2KCLA 3FUHA 3OXGA 4JC8A 5LCWJ 4Q94A 1E8ZA 4CDMA 4EBAG 3FH8A 4PUCA 3IEGA 4E6HA 2WXRA 4I6JA 4PS3A 4HFGA 1GW6A 2CHXA 3L16A 4N3AA 5EX0A 3ZHEB 3SNXA 4BWRA 4FA6A 2MOWA 3MKQB 1XGWA 4UQZA 4I9CA 5LP0A 3D9NA 4I2WA 3O4ZA 4GYOA 4APFA 2HO1A 2XGMA 2PL2A 1E8WA 4RSYA 2I6HA 3HHMA 2X38A 4K0RA 4J8EA 3P1UA 5JHAA 4ILIA 4F7AA 3QB2A 4ANVA 1H0AA 2OVBA 4GZ5A 3IKOB 1HG2A 4FP7A 2JEKA 1UJJA 3VLEA 3VLFA 4A1SA 4Y6WA 1IYGA 4CT0A 3G2WA 3QOUA 4N2QA 2GGFA 3Q5MA 2VSNA 3TAXA 2VTBB 4J8SA 3FTUA 3EDTB 3PUJA 1JWFA 5FQ7A 4EZLA 5ARFA 3U3WA 4ANXA 3BEEA 4LUNU 2YINA 3ENEA 4XI9A 1SZ9A 4GZ6A 4MKTA 5CMWA 4ACLA 4GB9A 4AY5A 4CDRA 4L2YA 1WY6A 4XX5A 4BFRA 4XI0A 3IBEA 2XRZA 3U4TA 5ANRA 3QNKA 4CDNA 4G11A 3APFA 4AOFA 4HOSA 3CHOA 3GZSA 4ILGA 5E76A 3RRNB 3FUEA 3CHPA 3UUXA 5A7DB 4H7YA 3TXNA 5FQ4A 4QFVA 4WNFA 3RO2A 2XRYA 2J49A 2VGYA 2J09A 4JZYA 2CG2A 3IHYA 4XKBA 3OXLA 3CV0A 4I17A 3NZSA 3BG1B 1Z3YA 3C98A 4AM9A 2XGOA 5J90A 1HO8A 2DBAA 3ASGA 3B7UX 3D9OA 5ARGA 4DI3A 3PS6A 4FU3A 3OXFA 4I6GA 4BT9A 1LF8A 4OVUA 3HDXA 4J6IA 4G25A 2DIWA 1E8YA 2LSUA 3MV2B 4BTBA 3ZN3A 2X6IA 4CCAA 2WVIA 4C9BB 4EECA 4B89A 3PNLB 3MKQA 4GU5A 4C0EA 4FLHA 4BSXA 1UN8A 2WXIA 2J4DA 3FDHA 2VSOE 3HIZA 4BY6A 4WUYA 5CMYA 5M72A 1HZ4A 1KT0A 2PM7A 4I6EA 2FBNA 4W9RA 3APDA 3QC1A 4Q96A 3B7SA 5BV1A 3ZRHA 4TUUA 1VDYA 3SD5A 2BTDA 2WXJA 2VSYA 4JEUA 4GA2A 3HYMB 3QKYA 3SFZA 3B13A 3CKBA 3CVUA 3PNTB 4GPKA 3U64A 3FTXA 2KATA 3JQ1A 4EPZA 3PVLA 1E96B 2RD0A 2KC7A 5ENNA 3FEXA 3S7BA 2CG3A 3FTSA 2PZIA 5FQ6A 5FZSA 3ML8A 2LNIA 3FTVA 3RU0A 5BPPA 3CK9A 4D10C 3KEZA 4UWLA 4GCNA 3T8MA 3B7RL 5JJ6A 4CRWA 3CHMA 2GRMA 3CK7A 3LY7A 1Z6TA 3SBTB 2HYZA 3ULQA 1PAQA 1UG3A 4BX9A 5G55A 3FH5A 4PS8A 1HF8A 3FTWA 1HE8A 3FUNA 1Y6IA 4F3VA 1IQRA 3FUMA 2C0MA 1E90A 2LAHA 3JQ0A 4UWKA 4CGWA 4ILHB 3FWVA 3D9IA 4KMOA 4KBQA 4GCOA 3ASDA 3ZXSA 2VGXB 2I1JA 2L0IA 4U04A 5DBKA 4UWFA 4A55A 1HH8A 3LYAA 1KT1A 2KCVA 3FEYA 3L13A 4N39A 3D9JA 1IHGA 3D9PA 1UJKA 2WQ7A 3EIJA 1OUVA 3OAWA 2KM4A 1NZNA 2BUGA 2CHZA 4N3CA 3VTYA 4HVBA 2WB2A 4FHJA 4G24A 4UQYA 1EF1C 1DVPA 4UI9C 4I1AA 4APOA 1HFAA 2R59A 3CEQA 3MJWA 3ZFWA 2HM8A 4F53A 3TG4A 1EDUA 4AY6A 3T5VA 4K03A 3CVQA 3MKRA 3QJZA 3PDNA 4J0UA 5KJKA 4HOTA 2V0PA 4GMLA 1WAO1 3AU5A 3CHRA 3QAQA 4JW1A 2PQRA 3LVQE 2XPYA 1MHQA 4B0ZA 4DLOA 2VGXA 3RK6A 4DLQA 5D0OD 5FQ8A 4CEMA 1EPUA 4GZ3A 4JHJA 3LKUA 3CR3A 5G05J 4I1MA 3EHNA 5KJNA 4BX8A 2Y4TA 3QWVA 5CCLA 5D0QD 2I1KA 4YNDA 5FTPA 4L2LA 3UX4A 3ZYKA 1HS6A 2A4ZA 4LRZA 5AJDA 5DIZA 2WXMA 5HI7A 2V4LA 2WXOA 3RIBA 3RRUA 5C1DA 1P5QA 4KYOB 3G2SA 4UI9J 3PEVB 3Q47B 4AXHA 5JJTA 5AIJA 4HLEA 2EQXA 3FUKA 3CVWA 4O6FA 3FUFA 3ESKA 3LPZA 5LX8A 1Y8MA 1ZBPA 2PQNA 3UQ3A 2IF4A 4MLPA 5FZRA 5BV0A 3FU0A 3AS4A 3FUJA 3FTYA 4IN3B 4WWOA 3L08A 4URKA 3FH7A 2C2LA 4HS2A 3APCA 2P58C 3L54A 3I4RB 3LXUX 3PH0C 4J8DA 3ONKA 4XKCA 4N2SA 2IJGX 4KT6B 2I2OA 2I9CA 5J08A 3MZLB 2WQHA 2KZTA 3KAEA 2DCPA 4CGVA 3LVRE 2QY7A 4NACA 3R9AB 5A6CA 2WPVA 3LJ3A 4N5CA 3L22A 3ML9A 4HOQA 3UT7A 3G2UA 4GA0A 3ZPJA 3AS8A 4JL0A 4KXKB 4HORA 3CVPA 3FULA 2CFZA 3FU3A 4G23A 3CKCA 2X3MA 4J8FA 3E4BA 4Q69A 3LDZA 2ONDA 2UY1A 2WQ6A 3CSTA 4ME2A 1PY1A 5BUZA 2IOLA 4IRUA 4UWGA 1WM5A 5EDSA 5CCMA 2KZTB 3MEKA 3S7JA 3NZUA 4F1SA 4U0UA 1NA0A 4HXIA 2XEVA 2IFUA 1W3BA 2UWJG 4JHKA 3SGHA 2V5FA 2Y3AA 1E7UA 4R7LA 3I4GA 4ABNA 3TJPA 2XQ0A 5FJYA 3CVLA 2XGSA 3ZYMA 2X6JA 4L7TA 5EKQD 2HR2A 1FVHA 2L0TB 1INZA 3RJVA 2XCBA 4NURA 3LCAA 3FHEA 2OVFA 1QQEA 3ASHA 4EQFA 3ONLA 1YA0A 2QFCA 4JVSA 4ACKA 3LY8A 4JHRA 4U07A 2VQ2A 1SZAA 4AP2A 1ELKA 4EZJA 4I9EA 5ANLA 4WWPA 4DK5A 1E8XA 2LSVA 4TV3A 3ZGQA 2GW1A 3AS5A 4LEUA 1N54A 5G05C 1A17A 1JUQA 4LERA 2VJ8A 4N3BA 1JWGA 4U0SA 4ANUA 4GYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AY6 A;  4AY5 A;  4BT8 A;  4CDR A;  2FI7 A;  5FZQ A;  3CVQ A;  3MKR A;  2C0L A;  3PDN A;  3Q49 B;  5EX3 A;  4J0U A;  4XI0 A;  5KJK A;  4HOT A;  3UPV A;  3U4T A;  3O48 A;  3N71 A;  3S7D A;  1WAO 1;  3TG5 A;  3GYZ A;  1KLX A;  2AVP A;  2XPI A;  2PQR A;  3Q15 A;  4HOS A;  2R5S A;  2VGX A;  1NA3 A;  2L6J A;  2XCC A;  1FCH A;  4RG6 A;  5D0O D;  3U3W A;  1XNF A;  5HQ8 A;  4JA9 A;  4G2V A;  4GZ3 A;  5AYW D;  3UUX A;  3LKU A;  3GZ2 A;  5G05 J;  5A7D B;  4H7Y A;  5KJN A;  2Y4T A;  3SZ7 A;  3QWV A;  5CCL A;  4WNF A;  5D0Q D;  3RO2 A;  2Y4U A;  5BW8 C;  4YND A;  2FEZ A;  4WNE A;  2VGY A;  5FTP A;  3VTX A;  3TGO A;  4B94 A;  3GZ1 A;  3PE3 A;  5DIZ A;  2Q7F A;  4WNG A;  3OXL A;  3CV0 A;  4I17 A;  5G04 J;  5HI7 A;  5C1D A;  3RIB A;  4G26 A;  5KJM A;  1ZU2 A;  1P5Q A;  4KYO B;  2NC9 A;  4UI9 J;  4G1T A;  4AM9 A;  1TJC A;  2XGO A;  5KJL A;  4GA1 A;  2DBA A;  3ASG A;  3LY9 A;  2YHC A;  3Q47 B;  4U0Z A;  4XIF A;  5CHE E;  5ARG A;  1HXI A;  5JJT A;  4BTA A;  4NQ0 A;  3JYS A;  4O6F A;  3OXF A;  4BT9 A;  3ESK A;  3LPZ A;  4YVQ C;  1Y8M A;  1ZBP A;  4NRH B;  3CK8 A;  4G25 A;  3QDN A;  3RKV A;  3S7F A;  2LSU A;  2PQN A;  2IF4 A;  3MV2 B;  3UQ3 A;  5FZR A;  2JLB A;  3ZN3 A;  4BTB A;  2FO7 A;  4H7X A;  4Y6C A;  3AS4 A;  4IN3 B;  2KCK A;  3WXX A;  2VYI A;  3SF4 A;  3CVN A;  4U0S A;  4CGW A;  2C2L A;  4J8D A;  2E2E A;  2P58 C;  4HOU A;  4U0U A;  2FF4 A;  5FT9 A;  3QWP A;  4N2S A;  4WUY A;  5M72 A;  5LCW C;  1B89 A;  1HZ4 A;  1KT0 A;  2UY1 B;  2OOE A;  2FBN A;  4W9R A;  3URZ A;  4UI9 K;  1QZ2 A;  2WQH A;  2MHK A;  3KAE A;  5A6C A;  4CGV A;  2VSY A;  3R9A B;  3ZHE A;  2WPV A;  4GA2 A;  4N5C A;  3HYM B;  4GYY A;  3QKY A;  4HOQ A;  3CKB A;  4GA0 A;  4RG9 A;  3ZPJ A;  3AS8 A;  4JL0 A;  4KXK B;  4HOR A;  3RO3 A;  3CVP A;  4AIF A;  4GPK A;  2KAT A;  4G23 A;  4J8F A;  3CKC A;  1E96 B;  3E4B A;  2KC7 A;  3KS2 A;  2OND A;  3S7B A;  2KCL A;  2UY1 A;  3OXG A;  2PZI A;  5LCW J;  5FZS A;  3MV3 B;  4ME2 A;  2J9Q A;  2LNI A;  3RU0 A;  3FFL A;  3CK9 A;  1ELW A;  1WM5 A;  5CCM A;  4GCN A;  3MEK A;  4JA7 A;  3IEG A;  5JJ6 A;  4WND A;  3TG4 A;  5EX0 A;  4BWR A;  3S7J A;  3CK7 A;  3LY7 A;  3KD7 A;  4N3A A;  2HYZ A;  1NA0 A;  3ZHE B;  3ULQ A;  2XEV A;  4UQZ A;  2IFU A;  1W3B A;  2UWJ G;  4I9C A;  3ZFW A;  2V5F A;  4I2W A;  4GYO A;  4I2Z A;  4F3V A;  3NF1 A;  3MA5 A;  4ABN A;  2C0M A;  3GW4 A;  2HO1 A;  2XGM A;  5FJY A;  2PL2 A;  2XGS A;  3CVL A;  3FWV A;  3K9I A;  2I6H A;  4KBQ A;  1ELR A;  3PE4 A;  2HR2 A;  4GCO A;  4J8E A;  5EKQ D;  3ASD A;  2YQ8 A;  2VGX B;  4U04 A;  5DBK A;  3RJV A;  2XCB A;  4GZ5 A;  3LCA A;  5JJ7 A;  1HH8 A;  1QQE A;  3Q4A B;  3ASH A;  1KT1 A;  3LYA A;  2KCV A;  4A1S A;  1YA0 A;  2QFC A;  4Y6W A;  4N39 A;  4EQF A;  3LY8 A;  1IHG A;  4JHR A;  4U07 A;  5BT1 A;  2VQ2 A;  3QOU A;  1IYG A;  1OUV A;  4YVO A;  4N3C A;  1NZN A;  2BUG A;  4N2Q A;  3VTY A;  3Q5M A;  2VSN A;  3TAX A;  4APO A;  4I9E A;  4G24 A;  3FP3 A;  4UQY A;  5BNW A;  3EDT B;  2LSV A;  3ZGQ A;  4UI9 C;  5ARF A;  2GW1 A;  3AS5 A;  4I1A A;  4LEU A;  3ASF A;  1A17 A;  3BEE A;  3CEQ A;  3QWW A;  4N3B A;  4UQX A;  5G05 C;  1PC2 A;  4XI9 A;  5G04 C;  4GZ6 A;  4GYW A; 
#chains in the Genus database with same CATH topology
 1N94 A;  2WXK A;  4A3T A;  4DI4 A;  5CEC B;  2WXP A;  2PM6 A;  3S7D A;  3JCK C;  3AU4 A;  3Q15 A;  5EIL A;  2L6J A;  4ZFH A;  3GZ2 A;  3CVV A;  4KZC A;  1TJF A;  5T8I A;  3KSQ A;  1Z3X A;  3T5X A;  4WWN A;  1NP7 A;  2B6C A;  1IKN D;  4G1T A;  4FC8 A;  4U0Z A;  1SA4 A;  5A23 A;  4BTA A;  3JYS A;  4PH4 B;  5JHB A;  3S7F A;  4JEH A;  5T3R A;  3EJN A;  3FU6 A;  4HI8 A;  4H7X A;  4A1G A;  2RKK A;  3ZVV A;  3FU5 A;  5FT9 A;  3U9W A;  5EID A;  4NIK A;  4RLY A;  4FUL A;  2IO3 C;  1FT2 A;  4OVV A;  3ESL A;  1DC2 A;  3ZEF A;  3R7R A;  3MV3 B;  1ELW A;  3EIQ C;  4RVB A;  3E30 A;  4I2Z A;  3MA5 A;  4AEZ C;  3DRA A;  5JJ7 A;  3Q4A B;  1OWL A;  3T9K A;  1QYM A;  2WXF A;  3ABK E;  5KNH D;  4BEP A;  3PZ1 A;  5AEN A;  1D8D A;  3QWW A;  3ASF A;  4LCT A;  3UPV A;  3O48 A;  3TG5 A;  2XPI A;  3DSX A;  4F6R D;  5HKP A;  1FCH A;  3TWU A;  3MX3 A;  4GTS A;  3RSE G;  5AYW D;  4FJZ A;  4TRQ A;  2IOS A;  2XPZ A;  3VTX A;  4B94 A;  1L5J A;  4OAU C;  3Q79 A;  2DZO A;  3CHQ A;  3LY9 A;  3HVE B;  5ENT D;  1QNF A;  2NXP A;  3DEP A;  3HXC A;  4IUL A;  1SA5 A;  3PZ4 A;  3RKV A;  2ETB A;  4JD2 G;  2GRQ B;  3DSU A;  4GTT A;  3CLJ A;  4MBG A;  3E37 A;  5LCW C;  3PZD A;  3W9F A;  1U2V G;  2A5U A;  3WG7 E;  1N52 A;  3FUD A;  2WXN A;  5C2Y A;  2J4B A;  2X6F A;  5FIN A;  1KPS B;  4DX1 A;  3NB2 A;  1S63 A;  2QZA A;  1E8Z A;  4PUC A;  3IEG A;  4I6J A;  5EX0 A;  4FA6 A;  1GW6 A;  3Q7F A;  2L6B A;  3SQV A;  3D9N A;  3Q9U C;  3O4Z A;  3JUE A;  4RSY A;  3HHM A;  3P1U A;  2OVB A;  4Y6W A;  1IYG A;  3G2W A;  3ABM E;  1FPP A;  1JWF A;  5ARF A;  4LUN U;  4XI9 A;  2LXL A;  4GB9 A;  4CDR A;  4L2Y A;  1SW6 A;  4XX5 A;  3Q75 A;  4XI0 A;  3APF A;  3AG2 E;  3CHO A;  3CHP A;  1TNO A;  5A7D B;  4H7Y A;  3TXN A;  4WNF A;  4DX6 D;  2GRO B;  3IHY A;  4XKB A;  1BI8 B;  3OXL A;  3AJI A;  4AM9 A;  5J90 A;  3ASG A;  3D9O A;  5EIB E;  2V4H C;  1LF8 A;  4G25 A;  4LG6 A;  2QC9 A;  3ZN3 A;  2X6I A;  4CCA A;  4C9B B;  4B89 A;  1S70 B;  3PNL B;  1BLX B;  4BSX A;  2VSO E;  3HIZ A;  5M72 A;  1HZ4 A;  4TUU A;  3SD5 A;  4RQI A;  4GA2 A;  3QKY A;  3C3R A;  3CVU A;  3PNT B;  5CER B;  2KAT A;  3PVL A;  1OCR E;  3UKR G;  3FEX A;  1TNZ A;  2PZI A;  3ML8 A;  3RU0 A;  4D10 C;  5JJ6 A;  3CHM A;  3LY7 A;  1Z6T A;  3SBT B;  2HYZ A;  5KWD A;  5G55 A;  4PS8 A;  1AWC B;  1NFI E;  2LAH A;  3D9I A;  4KBQ A;  4GCO A;  2VGX B;  2L0I A;  4DX7 D;  4A55 A;  1HH8 A;  3HXE A;  1KT1 A;  1IHG A;  4ZHB A;  3EIJ A;  1OUV A;  3OAW A;  2CHZ A;  4FHJ A;  4APO A;  3MJW A;  1EDU A;  4O60 A;  4DX2 A;  3CVQ A;  3MKR A;  3NOC D;  3PDN A;  4J0U A;  3C3Q A;  5JMN D;  4JW1 A;  5FQ8 A;  1EPU A;  4I1M A;  3EHN A;  1MZC A;  3Q73 A;  2I1K A;  5FTP A;  4L2L A;  3TWQ A;  1OXJ A;  4LRZ A;  5AJD A;  4UI9 J;  3ZXP A;  4AXH A;  3V2O A;  3UTM A;  4HLE A;  4O6F A;  5LX8 A;  1ZBP A;  2PQN A;  5BV0 A;  4URK A;  4U8Y D;  2P58 C;  1BU9 A;  5J08 A;  3KAE A;  5A6C A;  4HOQ A;  5CRV A;  3EU9 A;  4GTP A;  3CVP A;  2CFZ A;  3UIP C;  1G3N B;  4Q69 A;  1YYH A;  2UY1 A;  2WQ6 A;  3J5Q B;  4ME2 A;  5BUZ A;  1N95 A;  1JCR A;  3S7J A;  3NZU A;  2Y69 E;  3C3O A;  5EYL A;  2H6I A;  4JHK A;  3SGH A;  2H6H A;  3DXK G;  5FJY A;  4U96 D;  4L7T A;  5B3S E;  2B0O E;  2OVF A;  1QQE A;  4EQF A;  4U07 A;  3ULE G;  4AP2 A;  5H7P A;  4WWP A;  1N54 A;  5G05 C;  1A17 A;  4N3B A;  4GYW A;  2CHW A;  4BT8 A;  3TXM A;  4WAF A;  2C0L A;  5EX3 A;  4HRN A;  5AQ7 A;  3BU8 A;  5HQ8 A;  3TL5 A;  4G8K A;  3NQP A;  2F8Y A;  1E7V A;  4GAA A;  3TGO A;  2FEZ A;  2AXV A;  3BG0 B;  4OYS A;  1X5B A;  1OWM A;  3DEO A;  5BXU A;  1ZU2 A;  3CQC B;  4MS6 A;  2YHC A;  2IU1 A;  3CK8 A;  4GZC A;  3F6Q A;  5AQA A;  2JLB A;  5EN5 D;  4FLB A;  4Y6C A;  3ZW3 A;  2P9U G;  2VYI A;  1U3C A;  4HOU A;  4I43 A;  2FF4 A;  3QWP A;  1OWN A;  1OWP A;  2MHK A;  4BER A;  4GYY A;  3EHM A;  3CGH A;  4K5B A;  4P29 A;  4YDO A;  2YNQ A;  2GRN B;  2WXH A;  2M63 A;  4C0M A;  2J9Q A;  2R17 C;  3CVX A;  4E85 A;  4JPS A;  5CRU A;  5G2N A;  3NF1 A;  5HS0 A;  3K9I A;  4DX5 D;  4UUC A;  3ZKJ A;  3TWS A;  1WDY A;  4C48 B;  5ENR D;  2RG8 A;  4UQX A;  1UW4 B;  1BPO A;  3UT8 A;  3L17 A;  3DSV A;  3N71 A;  4DJA A;  4AV7 A;  3L6A A;  1KLX A;  2AVP A;  2BKG A;  2X6H A;  1H6O A;  4JB8 P;  1NA3 A;  4JA9 A;  1K1A A;  4JXT A;  3ZIM A;  1S64 A;  4FAD A;  3QAR A;  2J07 A;  4EZK A;  4TXP A;  3CIA A;  2VGE A;  3LEW A;  4GA1 A;  3ULY A;  1K1B A;  2WXL A;  4NQ0 A;  1JPL A;  3PRZ A;  5B1A E;  2ION A;  4YVQ C;  2XEN A;  3DBS A;  5CBN A;  1LTX A;  5CED B;  5KNG A;  1H6K A;  2OOE A;  1N4P A;  3B7T A;  4B8C B;  2DZN A;  1AP7 A;  4KZ0 A;  2ETC A;  3E34 A;  4AIF A;  2R02 A;  2BF0 X;  4OAV B;  3MGB A;  3D3M A;  4Q94 A;  4EBA G;  4HI9 A;  4E6H A;  3CVY A;  4HFG A;  3L16 A;  3UM3 A;  3SNX A;  2P9S G;  2HO1 A;  2PL2 A;  2I6H A;  3ASO E;  2X38 A;  4K0R A;  1H0A A;  4GZ5 A;  3TWW A;  3IKO B;  1UJJ A;  3VLE A;  3VLF A;  4LNB A;  2P9N G;  2Y0B G;  4N2Q A;  3Q5M A;  2VSN A;  2OEW A;  3EDT B;  4G8L A;  5AN8 A;  4A63 B;  3U3W A;  5ITZ F;  2YIN A;  4MKT A;  4ACL A;  2XS8 A;  3IBE A;  2XRZ A;  3U4T A;  5ANR A;  3QNK A;  4G11 A;  4AOF A;  4GTM A;  3GZS A;  1LD7 A;  3RRN B;  3FUE A;  4QFV A;  4JZY A;  2CG2 A;  3CV0 A;  3NZS A;  3C98 A;  5ENO D;  5ARG A;  4U7E B;  4DI3 A;  3ASN E;  1JCQ A;  1V55 E;  4LSZ E;  3MV2 B;  2WVI A;  4EEC A;  3MKQ A;  4DRX E;  4BY6 A;  1RW2 A;  4WUY A;  2EIN E;  1KT0 A;  3EHR A;  4I6E A;  3APD A;  5BV1 A;  4JEU A;  3B95 A;  3CKB A;  4GMR A;  2FO1 E;  4GPK A;  2RD0 A;  4CYM D;  3KEA A;  5CEA A;  3FTV A;  5BPP A;  4UWL A;  4YDE A;  2ZIS A;  4CRW A;  1UG3 A;  2JAB A;  4L9P A;  3FTW A;  5AAR A;  3FUN A;  4F3V A;  1E90 A;  4KMO A;  4TUM A;  3ZXS A;  4UWF A;  1TR4 A;  3LYA A;  3SO8 A;  3HG0 D;  3D9P A;  2WB2 A;  2ZXW E;  1MX4 A;  3CEQ A;  2HM8 A;  3TG4 A;  2LXM A;  3HXB A;  2IEJ A;  2PQR A;  1MHQ A;  4DLO A;  2VGX A;  1MX6 A;  3RK6 A;  4DLQ A;  4CEM A;  5KJN A;  2Y4T A;  5CCL A;  3ZYK A;  3UX4 A;  1HS6 A;  5DIZ A;  2V4L A;  3RIB A;  1P5Q A;  4KYO B;  4HB5 A;  5FIO A;  1TN6 A;  1UOH A;  3ESK A;  2IY0 C;  3LPZ A;  1Y8M A;  1WG0 A;  4MLP A;  3FU0 A;  3AS4 A;  3FUJ A;  4IN3 B;  4WWO A;  2C2L A;  3APC A;  3PH0 C;  4XKC A;  3AG4 E;  3ONK A;  5B1B E;  2IJG X;  2I2O A;  1N4R A;  4F1P A;  3MZL B;  2WQH A;  2DCP A;  3ZUV B;  4NAC A;  4KXK B;  3FUL A;  3FU3 A;  4G23 A;  2X3M A;  3CST A;  2IOL A;  4IRU A;  1RZ4 A;  1WM5 A;  5EDS A;  4F1S A;  4TXR A;  3TJP A;  3CVL A;  3ZYM A;  2X6J A;  2L0T B;  1DCQ A;  1INZ A;  1D8E A;  2XCB A;  4NUR A;  3FHE A;  1YA0 A;  4ACK A;  1SZA A;  1MX2 A;  3ZGQ A;  2GW1 A;  4LEU A;  3SZ7 A;  1JWG A;  5BW8 C;  4ANU A;  4V3I A;  1K3Z D;  3JXI A;  2E0I A;  4GMJ A;  3Q49 B;  5CBO A;  5LOZ A;  3RRM B;  3GYZ A;  2QYU A;  2EIJ E;  5E75 A;  4DUI A;  2R5S A;  1XNF A;  3SBS A;  4G2V A;  2FUL A;  4BSZ B;  3UIO C;  2V8S E;  2AJA A;  2DVW A;  3GZ1 A;  2Q7F A;  5KJM A;  1DNP A;  4FHK A;  1H2T C;  4GTR A;  4HBD A;  4MRU A;  5HRY A;  4FJY A;  1N4S A;  1A5E A;  2FO7 A;  3OTN A;  4U8V D;  2RFM A;  3R7Q A;  1SQM A;  4GTO A;  3CVN A;  1BI7 B;  4XEI G;  1JCS A;  3UI2 A;  3URZ A;  3FY4 A;  3J5P A;  2WXG A;  3UT4 A;  4DPR A;  2P9K G;  3ZHE A;  3DWL G;  1O1S A;  5AJL A;  1MQS A;  3JUI A;  3HXF A;  2NSZ A;  3FFL A;  3B7B A;  4JA7 A;  4LNG A;  4WND A;  2IO2 C;  3ZYL A;  2IQC A;  3IXE A;  1SVX A;  4N5Q A;  4AVX A;  1LD8 A;  2AXZ A;  1H2V C;  3V31 A;  1S0P A;  3PE4 A;  2DWZ A;  3UIN C;  2YQ8 A;  4B93 B;  3ISM C;  2XZD G;  3I3N A;  5BT1 A;  4M7C A;  4YVO A;  5FWQ A;  5LFA A;  3FP3 A;  5BNW A;  4B8A A;  5G04 C;  4TXQ A;  4K5A B;  2XZT G;  2VTB A;  2XCC A;  3IHV A;  2AW6 A;  2KXP C;  1FVF A;  1HG5 A;  3S2A A;  4ANW A;  3UMV A;  1IQU A;  2EIM E;  5G04 J;  3IV0 A;  3D9M A;  1TJC A;  5JA4 D;  2OV8 A;  3G2T A;  1H2U A;  3VLD A;  3V30 A;  1H19 A;  2KBX A;  1UN9 A;  2WMO A;  1NI1 A;  2KCK A;  5D2M C;  2GRL A;  1OT8 A;  1TN8 A;  4U63 A;  2CFU A;  2XEE A;  3DST A;  3ABL E;  2WMN A;  2ZGD A;  3V79 K;  3FUH A;  4JC8 A;  4CDM A;  1MJ0 A;  3FH8 A;  2F37 A;  2WXR A;  4PS3 A;  4BWR A;  2CHX A;  3MKQ B;  3NAW A;  4UQZ A;  4I9C A;  5AQ9 A;  1TNY A;  5JHA A;  4ANV A;  1ZB1 A;  1HG2 A;  4FP7 A;  2JEK A;  4A1S A;  2GGF A;  3TAX A;  4J8S A;  3FTU A;  3PUJ A;  5FQ7 A;  1NL4 A;  3E32 A;  1SZ9 A;  5CMW A;  4AY5 A;  1WY6 A;  2RFA A;  4BFR A;  1TNB A;  4CDN A;  4ATZ D;  4ILG A;  5E76 A;  2F0Y A;  3UUX A;  3W9G A;  3EU5 A;  2DYS E;  2J49 A;  2VGY A;  2J09 A;  2V5Q C;  1OCC E;  1HO8 A;  3B7U X;  3PS6 A;  3OXF A;  4I6G A;  4BT9 A;  3HDX A;  2P9L G;  4J6I A;  1H6P A;  1E8Y A;  4BTB A;  4GU5 A;  1OY3 D;  2WXI A;  2J4D A;  3UM1 A;  4J7W A;  2FBN A;  3QC1 A;  2WXJ A;  3B13 A;  1E96 B;  4U95 D;  3R9M A;  2KC7 A;  3S7B A;  3SFY A;  3FTS A;  5FQ6 A;  3CK9 A;  1YMP A;  3B7R L;  2GRM A;  3CK7 A;  1D9S A;  2OCC E;  1HF8 A;  3ZU7 B;  1Y6I A;  1FT1 A;  2C0M A;  4UWK A;  3HRA A;  2EIK E;  3ASD A;  4X8Q A;  2I1J A;  3UM2 A;  3UM0 A;  4N39 A;  3D9J A;  2P9P G;  2QYJ A;  1NZN A;  3VTY A;  4HVB A;  4G24 A;  1EF1 C;  4I1A A;  1HFA A;  3E33 A;  2R59 A;  3ZFW A;  4O1P A;  1N4Q A;  3T5V A;  3QJZ A;  1WAO 1;  2R05 A;  3CHR A;  3LVQ E;  2XPY A;  4B0Z A;  4GZ3 A;  3LKU A;  2MYO A;  4BX8 A;  4YND A;  2WXM A;  2WXO A;  1KZP A;  4CZ2 D;  3PEV B;  2BED A;  3Q47 B;  5JJT A;  3FUK A;  3TWT A;  5FZR A;  5BXO A;  4HNA D;  3FTY A;  3FH7 A;  4HS2 A;  4J8D A;  3L54 A;  2GRP B;  3LXU X;  1N0R A;  4KT6 B;  2A5E A;  2H6F A;  2KZT A;  4CGV A;  3LVR E;  2WPV A;  3LJ3 A;  3L22 A;  1IXV A;  3UT7 A;  3G2U A;  4GA0 A;  3AS8 A;  4JL0 A;  4HOR A;  2BKK B;  4J8F A;  3CKC A;  3E4B A;  2OND A;  3LJN A;  1PY1 A;  5CCM A;  3MEK A;  1NA0 A;  2XEV A;  2IFU A;  1TN7 A;  2V5F A;  2Y3A A;  4R7L A;  1V54 E;  2XGS A;  5EKQ D;  2HR2 A;  3AAA C;  3AG3 E;  3ASH A;  2QFC A;  4EZJ A;  3Q7A A;  4I9E A;  1TYQ G;  3SY2 A;  2NYJ A;  3SFX A;  5ANL A;  1E8X A;  5ENS D;  1JUQ A;  2VJ8 A;  3U66 A;  3PZ2 A;  2LUH A;  3SI5 A;  4RG6 A;  3SHF A;  2Y4U A;  2X6K A;  4WNE A;  3PE3 A;  3PUK A;  4XE0 A;  3FUI A;  2VSX E;  3D9K A;  4BET A;  2ZGG A;  2NC9 A;  1O1T A;  2XHE A;  5CHE E;  3PRE A;  3DPY A;  2R03 A;  4AJW A;  4M3O A;  4ATG A;  2LO6 A;  1OWO A;  2L9B A;  3FTZ A;  3QDN A;  3TWX A;  3V2X A;  3D9H A;  2HE0 A;  4KVM A;  2J08 A;  1O5M A;  1TNU A;  4EBA A;  3HVE A;  1X81 A;  1B89 A;  4EHM A;  2UY1 B;  3ZYQ A;  5T4Y A;  4L23 A;  4IYP A;  1OCZ E;  3RO3 A;  4YDY A;  3DPD A;  4PS7 A;  1QBQ A;  3KD7 A;  2ZU6 B;  4I1O B;  3LS8 A;  4KVO A;  3GW4 A;  3MCX A;  3WXX A;  2YHE A;  3SF4 A;  1ELR A;  1N0Q A;  3JXJ A;  4J8Y A;  3G2V A;  3QK0 A;  2WM9 A;  4GTV A;  3C72 A;  3CHS A;  3DSW A;  4CT4 A;  1PC2 A;  4NRH B;  1U3D A;  2FI7 A;  2ILR A;  5FZQ A;  3X2Q E;  3CSF A;  4PDX A;  5D66 A;  2OEV A;  5ENQ D;  1HX8 A;  4GZD A;  1EYH A;  1Z5S C;  3C5R A;  2P9I G;  2AWI A;  4WNG A;  4G26 A;  4A3V A;  3CQG B;  5KJL A;  3MYV A;  4XZ4 A;  4XIF A;  4UWH A;  1HXI A;  5KCM A;  2LAI A;  3D9L A;  1TEZ A;  3I5P A;  4U8H A;  1BD8 A;  2E2E A;  2WXQ A;  4O1O A;  3P2B A;  3PEU B;  4UI9 K;  1QZ2 A;  2MRI A;  4L1B A;  2R2L A;  2AXU A;  3DXM G;  4RG9 A;  2EIL E;  1HU3 A;  5AQB A;  3KS2 A;  5AAO A;  2KCL A;  2ETA A;  3OXG A;  5LCW J;  1YCS B;  3ZHE B;  3Q9N C;  4N3A A;  2MOW A;  1XGW A;  5LP0 A;  2PNN A;  4I2W A;  4Z68 A;  4GYO A;  4APF A;  2XGM A;  1E8W A;  4J8E A;  4ILI A;  4F7A A;  3EUV A;  3QB2 A;  3Q78 A;  4CT0 A;  3QOU A;  3PZ3 A;  3NBN B;  3UKU G;  2VTB B;  4GPM A;  2XEH A;  3L82 A;  4HLL A;  4EZL A;  4ANX A;  3BEE A;  3ENE A;  4GZ6 A;  3TWR A;  4HRL A;  3DSS A;  1N9A A;  3KSL A;  4HOS A;  2P2C P;  1N11 A;  5FQ4 A;  1KZO A;  3RO2 A;  2XRY A;  4I17 A;  3BG1 B;  1Z3Y A;  4LNU D;  2XGO A;  2DBA A;  4FU3 A;  4OVU A;  3ZNG A;  2Y1L E;  2DIW A;  2LSU A;  4C0E A;  3L9T A;  2GRR B;  2DYR E;  4FLH A;  1UN8 A;  2XS1 A;  3FDH A;  5CMY A;  2PM7 A;  4W9R A;  4Q96 A;  3B7S A;  3ZRH A;  3T8K A;  1VDY A;  2BTD A;  2VSY A;  3HYM B;  3SFZ A;  3U64 A;  3FTX A;  3JQ1 A;  4EPZ A;  5ENN A;  2CG3 A;  5FZS A;  2LNI A;  3KEZ A;  2H6G A;  2F8X K;  4GCN A;  3T8M A;  3EHQ A;  3BUA A;  3ULQ A;  1PAQ A;  4BX9 A;  3FH5 A;  1HE8 A;  1IQR A;  3FUM A;  3JQ0 A;  4CGW A;  4ILH B;  3FWV A;  4U04 A;  5DBK A;  2J8S D;  2KCV A;  3AG1 E;  3FEY A;  3L13 A;  1UJK A;  2WQ7 A;  1DCE A;  2KM4 A;  4N3C A;  2BUG A;  4UQY A;  1DVP A;  4UI9 C;  3RAU A;  4F53 A;  3BQO A;  4AY6 A;  4K03 A;  4HOT A;  5KJK A;  2V0P A;  4GML A;  3AU5 A;  3QAQ A;  1MYO A;  3TWV A;  5D0O D;  4BES A;  1Q2Z A;  4JHJ A;  5G05 J;  3CR3 A;  4HRM B;  3QWV A;  5D0Q D;  1O1R A;  2A4Z A;  5HI7 A;  5C1D A;  3RRU A;  3HXD A;  4QQI A;  3G2S A;  5AIJ A;  5EYP F;  2EQX A;  3CVW A;  3FUF A;  3UQ3 A;  2IF4 A;  3L08 A;  4U0U A;  4N2S A;  3I4R B;  4GTQ A;  5ENP D;  2ZIR A;  3NOG D;  2I9C A;  1IHB A;  2QY7 A;  3R9A B;  4HQD A;  4N5C A;  3ML9 A;  5IY5 E;  3UXG A;  3ZPJ A;  3LDZ A;  5KBA A;  4UWG A;  2KZT B;  4HXI A;  1W3B A;  2UWJ G;  1E7U A;  3I4G A;  1K8K G;  4ABN A;  2XQ0 A;  1FVH A;  3RJV A;  3LCA A;  1OCO E;  3ONL A;  4JVS A;  3LY8 A;  4JHR A;  2VQ2 A;  1ELK A;  4DK5 A;  2LSV A;  4K5C A;  4TV3 A;  3AS5 A;  4LER A;  4U0S A;  4YDW A; 
#chains in the Genus database with same CATH homology
 4V3I A;  2CHW A;  4BT8 A;  2E0I A;  2WXK A;  3TXM A;  4GMJ A;  4WAF A;  2C0L A;  3Q49 B;  5EX3 A;  5LOZ A;  4A3T A;  4DI4 A;  3U66 A;  3RRM B;  2WXP A;  2PM6 A;  3S7D A;  3JCK C;  3GYZ A;  3AU4 A;  3Q15 A;  5E75 A;  2R5S A;  2L6J A;  3SI5 A;  4RG6 A;  1XNF A;  5HQ8 A;  3SBS A;  4G2V A;  3TL5 A;  3NQP A;  2FUL A;  3GZ2 A;  3SHF A;  1E7V A;  3CVV A;  4KZC A;  2Y4U A;  2X6K A;  4GAA A;  2FEZ A;  4WNE A;  2V8S E;  2AXV A;  1TJF A;  5BW8 C;  5T8I A;  1Z3X A;  3BG0 B;  3GZ1 A;  3PE3 A;  3PUK A;  2Q7F A;  4XE0 A;  5KJM A;  3FUI A;  4OYS A;  1X5B A;  2VSX E;  3T5X A;  1OWM A;  4WWN A;  3D9K A;  1ZU2 A;  3CVY A;  1NP7 A;  2NC9 A;  2XHE A;  4G1T A;  4FC8 A;  3CQC B;  1DNP A;  4MS6 A;  2YHC A;  3PRE A;  4U0Z A;  5CHE E;  4FHK A;  1H2T C;  4MRU A;  5A23 A;  4AJW A;  4M3O A;  4ATG A;  4BTA A;  2LO6 A;  3JYS A;  4FJY A;  1OWO A;  2IU1 A;  4PH4 B;  2L9B A;  3CK8 A;  3FTZ A;  3QDN A;  4GZC A;  3S7F A;  5JHB A;  4JEH A;  5T3R A;  2JLB A;  3EJN A;  3FU6 A;  2FO7 A;  4H7X A;  4FLB A;  4Y6C A;  3OTN A;  3ZW3 A;  4KVM A;  2VYI A;  3R7Q A;  4A1G A;  1SQM A;  2J08 A;  3CVN A;  4EBA A;  3ZVV A;  1U3C A;  3FU5 A;  3HVE A;  4HOU A;  2FF4 A;  4I43 A;  3QWP A;  5FT9 A;  3U9W A;  1B89 A;  1OWN A;  2UY1 B;  3URZ A;  3ZYQ A;  3FY4 A;  2WXG A;  4FUL A;  5T4Y A;  3UT4 A;  4L23 A;  1OWP A;  4IYP A;  2MHK A;  4DPR A;  3ZHE A;  4GYY A;  3EHM A;  3CGH A;  4OVV A;  4P29 A;  3ESL A;  3RO3 A;  2YNQ A;  5AJL A;  1MQS A;  2WXH A;  3JUI A;  2M63 A;  3ZEF A;  2NSZ A;  3R7R A;  4C0M A;  3MV3 B;  2J9Q A;  3DPD A;  2R17 C;  3FFL A;  4PS7 A;  3CVX A;  1ELW A;  3EIQ C;  4JA7 A;  4WND A;  4E85 A;  3KD7 A;  2ZU6 B;  4RVB A;  4JPS A;  3ZYL A;  2IQC A;  5G2N A;  4I1O B;  4I2Z A;  3LS8 A;  3NF1 A;  3MA5 A;  4KVO A;  4AVX A;  2AXZ A;  3GW4 A;  1H2V C;  3MCX A;  3K9I A;  2YHE A;  3SF4 A;  3WXX A;  1S0P A;  1ELR A;  3PE4 A;  4AEZ C;  2YQ8 A;  5JJ7 A;  3Q4A B;  1OWL A;  3G2V A;  3I3N A;  2WXF A;  5BT1 A;  4YVO A;  3QK0 A;  2WM9 A;  5AEN A;  3CHS A;  5FWQ A;  5LFA A;  3FP3 A;  5BNW A;  2RG8 A;  3QWW A;  4B8A A;  4CT4 A;  4UQX A;  1UW4 B;  3ASF A;  1PC2 A;  1U3D A;  4NRH B;  5G04 C;  1BPO A;  2FI7 A;  3UT8 A;  2ILR A;  5FZQ A;  3CSF A;  3L17 A;  4PDX A;  4LCT A;  3UPV A;  3O48 A;  3N71 A;  4DJA A;  4AV7 A;  3L6A A;  1HX8 A;  4GZD A;  3TG5 A;  1KLX A;  2AVP A;  2X6H A;  2XPI A;  3TGO A;  1EYH A;  2VTB A;  1NA3 A;  2XCC A;  1FCH A;  3MX3 A;  3IHV A;  4JA9 A;  2AW6 A;  5AYW D;  4FJZ A;  4TRQ A;  4JXT A;  3SZ7 A;  2IOS A;  3ZIM A;  1FVF A;  1HG5 A;  3S2A A;  4FAD A;  3QAR A;  2J07 A;  2XPZ A;  3VTX A;  4B94 A;  4ANW A;  2AWI A;  4WNG A;  1IQU A;  5G04 J;  3UMV A;  4EZK A;  4G26 A;  1L5J A;  3CIA A;  3IV0 A;  4A3V A;  3CQG B;  3D9M A;  5KJL A;  3MYV A;  1TJC A;  3LEW A;  4XZ4 A;  4GA1 A;  3CHQ A;  3LY9 A;  4XIF A;  2WXL A;  3HVE B;  4UWH A;  2OV8 A;  1HXI A;  1QNF A;  4NQ0 A;  1JPL A;  3G2T A;  1H2U A;  2NXP A;  3PRZ A;  4IUL A;  3VLD A;  2ION A;  4YVQ C;  5KCM A;  2LAI A;  1H19 A;  3DBS A;  1UN9 A;  3D9L A;  3RKV A;  1TEZ A;  2WMO A;  3I5P A;  2KCK A;  4U8H A;  3CLJ A;  2E2E A;  2WXQ A;  5LCW C;  2GRL A;  1H6K A;  2OOE A;  3PZD A;  3P2B A;  2A5U A;  3PEU B;  4UI9 K;  3B7T A;  1N52 A;  1QZ2 A;  2WXN A;  3FUD A;  4B8C B;  4U63 A;  2CFU A;  2MRI A;  4L1B A;  2AXU A;  5C2Y A;  2J4B A;  2X6F A;  4KZ0 A;  4RG9 A;  2WMN A;  4AIF A;  1HU3 A;  2BF0 X;  3MGB A;  3KS2 A;  3D3M A;  2KCL A;  3FUH A;  3OXG A;  4JC8 A;  5LCW J;  4Q94 A;  1E8Z A;  4CDM A;  4EBA G;  3FH8 A;  4PUC A;  3IEG A;  4E6H A;  2WXR A;  4I6J A;  4PS3 A;  4HFG A;  1GW6 A;  2CHX A;  3L16 A;  4N3A A;  5EX0 A;  3ZHE B;  3SNX A;  4BWR A;  4FA6 A;  2MOW A;  3MKQ B;  1XGW A;  4UQZ A;  4I9C A;  5LP0 A;  3D9N A;  4I2W A;  3O4Z A;  4GYO A;  4APF A;  2HO1 A;  2XGM A;  2PL2 A;  1E8W A;  4RSY A;  2I6H A;  3HHM A;  2X38 A;  4K0R A;  4J8E A;  3P1U A;  5JHA A;  4ILI A;  4F7A A;  3QB2 A;  4ANV A;  1H0A A;  2OVB A;  4GZ5 A;  3IKO B;  1HG2 A;  4FP7 A;  2JEK A;  1UJJ A;  3VLE A;  3VLF A;  4A1S A;  4Y6W A;  1IYG A;  4CT0 A;  3G2W A;  3QOU A;  4N2Q A;  2GGF A;  3Q5M A;  2VSN A;  3TAX A;  2VTB B;  4J8S A;  3FTU A;  3EDT B;  3PUJ A;  1JWF A;  5FQ7 A;  4EZL A;  5ARF A;  3U3W A;  4ANX A;  3BEE A;  4LUN U;  2YIN A;  3ENE A;  4XI9 A;  1SZ9 A;  4GZ6 A;  4MKT A;  5CMW A;  4ACL A;  4GB9 A;  4AY5 A;  4CDR A;  4L2Y A;  1WY6 A;  4XX5 A;  4BFR A;  4XI0 A;  3IBE A;  2XRZ A;  3U4T A;  5ANR A;  3QNK A;  4CDN A;  4G11 A;  3APF A;  4AOF A;  4HOS A;  3CHO A;  3GZS A;  4ILG A;  5E76 A;  3RRN B;  3FUE A;  3CHP A;  3UUX A;  5A7D B;  4H7Y A;  3TXN A;  5FQ4 A;  4QFV A;  4WNF A;  3RO2 A;  2XRY A;  2J49 A;  2VGY A;  2J09 A;  4JZY A;  2CG2 A;  3IHY A;  4XKB A;  3OXL A;  3CV0 A;  4I17 A;  3NZS A;  3BG1 B;  1Z3Y A;  3C98 A;  4AM9 A;  2XGO A;  5J90 A;  1HO8 A;  2DBA A;  3ASG A;  3B7U X;  3D9O A;  5ARG A;  4DI3 A;  3PS6 A;  4FU3 A;  3OXF A;  4I6G A;  4BT9 A;  1LF8 A;  4OVU A;  3HDX A;  4J6I A;  4G25 A;  2DIW A;  1E8Y A;  2LSU A;  3MV2 B;  4BTB A;  3ZN3 A;  2X6I A;  4CCA A;  2WVI A;  4C9B B;  4EEC A;  4B89 A;  3PNL B;  3MKQ A;  4GU5 A;  4C0E A;  4FLH A;  4BSX A;  1UN8 A;  2WXI A;  2J4D A;  3FDH A;  2VSO E;  3HIZ A;  4BY6 A;  4WUY A;  5CMY A;  5M72 A;  1HZ4 A;  1KT0 A;  2PM7 A;  4I6E A;  2FBN A;  4W9R A;  3APD A;  3QC1 A;  4Q96 A;  3B7S A;  5BV1 A;  3ZRH A;  4TUU A;  1VDY A;  3SD5 A;  2BTD A;  2WXJ A;  2VSY A;  4JEU A;  4GA2 A;  3HYM B;  3QKY A;  3SFZ A;  3B13 A;  3CKB A;  3CVU A;  3PNT B;  4GPK A;  3U64 A;  3FTX A;  2KAT A;  3JQ1 A;  4EPZ A;  3PVL A;  1E96 B;  2RD0 A;  2KC7 A;  5ENN A;  3FEX A;  3S7B A;  2CG3 A;  3FTS A;  2PZI A;  5FQ6 A;  5FZS A;  3ML8 A;  2LNI A;  3FTV A;  3RU0 A;  5BPP A;  3CK9 A;  4D10 C;  3KEZ A;  4UWL A;  4GCN A;  3T8M A;  3B7R L;  5JJ6 A;  4CRW A;  3CHM A;  2GRM A;  3CK7 A;  3LY7 A;  1Z6T A;  3SBT B;  2HYZ A;  3ULQ A;  1PAQ A;  1UG3 A;  4BX9 A;  5G55 A;  3FH5 A;  4PS8 A;  1HF8 A;  3FTW A;  1HE8 A;  3FUN A;  1Y6I A;  4F3V A;  1IQR A;  3FUM A;  2C0M A;  1E90 A;  2LAH A;  3JQ0 A;  4UWK A;  4CGW A;  4ILH B;  3FWV A;  3D9I A;  4KMO A;  4KBQ A;  4GCO A;  3ASD A;  3ZXS A;  2VGX B;  2I1J A;  2L0I A;  4U04 A;  5DBK A;  4UWF A;  4A55 A;  1HH8 A;  3LYA A;  1KT1 A;  2KCV A;  3FEY A;  3L13 A;  4N39 A;  3D9J A;  1IHG A;  3D9P A;  1UJK A;  2WQ7 A;  3EIJ A;  1OUV A;  3OAW A;  2KM4 A;  1NZN A;  2BUG A;  2CHZ A;  4N3C A;  3VTY A;  4HVB A;  2WB2 A;  4FHJ A;  4G24 A;  4UQY A;  1EF1 C;  1DVP A;  4UI9 C;  4I1A A;  4APO A;  1HFA A;  2R59 A;  3CEQ A;  3MJW A;  3ZFW A;  2HM8 A;  4F53 A;  3TG4 A;  1EDU A;  4AY6 A;  3T5V A;  4K03 A;  3CVQ A;  3MKR A;  3QJZ A;  3PDN A;  4J0U A;  5KJK A;  4HOT A;  2V0P A;  4GML A;  1WAO 1;  3AU5 A;  3CHR A;  3QAQ A;  4JW1 A;  2PQR A;  3LVQ E;  2XPY A;  1MHQ A;  4B0Z A;  4DLO A;  2VGX A;  3RK6 A;  4DLQ A;  5D0O D;  5FQ8 A;  4CEM A;  1EPU A;  4GZ3 A;  4JHJ A;  3LKU A;  3CR3 A;  5G05 J;  4I1M A;  3EHN A;  5KJN A;  4BX8 A;  2Y4T A;  3QWV A;  5CCL A;  5D0Q D;  2I1K A;  4YND A;  5FTP A;  4L2L A;  3UX4 A;  3ZYK A;  1HS6 A;  2A4Z A;  4LRZ A;  5AJD A;  5DIZ A;  2WXM A;  5HI7 A;  2V4L A;  2WXO A;  3RIB A;  3RRU A;  5C1D A;  1P5Q A;  4KYO B;  3G2S A;  4UI9 J;  3PEV B;  3Q47 B;  4AXH A;  5JJT A;  5AIJ A;  4HLE A;  2EQX A;  3FUK A;  3CVW A;  4O6F A;  3FUF A;  3ESK A;  3LPZ A;  5LX8 A;  1Y8M A;  1ZBP A;  2PQN A;  3UQ3 A;  2IF4 A;  4MLP A;  5FZR A;  5BV0 A;  3FU0 A;  3AS4 A;  3FUJ A;  3FTY A;  4IN3 B;  4WWO A;  3L08 A;  4URK A;  3FH7 A;  2C2L A;  4HS2 A;  3APC A;  2P58 C;  3L54 A;  3I4R B;  3LXU X;  3PH0 C;  4J8D A;  3ONK A;  4XKC A;  4N2S A;  2IJG X;  4KT6 B;  2I2O A;  2I9C A;  5J08 A;  3MZL B;  2WQH A;  2KZT A;  3KAE A;  2DCP A;  4CGV A;  3LVR E;  2QY7 A;  4NAC A;  3R9A B;  5A6C A;  2WPV A;  3LJ3 A;  4N5C A;  3L22 A;  3ML9 A;  4HOQ A;  3UT7 A;  3G2U A;  4GA0 A;  3ZPJ A;  3AS8 A;  4JL0 A;  4KXK B;  4HOR A;  3CVP A;  3FUL A;  2CFZ A;  3FU3 A;  4G23 A;  3CKC A;  2X3M A;  4J8F A;  3E4B A;  4Q69 A;  3LDZ A;  2OND A;  2UY1 A;  2WQ6 A;  3CST A;  4ME2 A;  1PY1 A;  5BUZ A;  2IOL A;  4IRU A;  4UWG A;  1WM5 A;  5EDS A;  5CCM A;  2KZT B;  3MEK A;  3S7J A;  3NZU A;  4F1S A;  4U0U A;  1NA0 A;  4HXI A;  2XEV A;  2IFU A;  1W3B A;  2UWJ G;  4JHK A;  3SGH A;  2V5F A;  2Y3A A;  1E7U A;  4R7L A;  3I4G A;  4ABN A;  3TJP A;  2XQ0 A;  5FJY A;  3CVL A;  2XGS A;  3ZYM A;  2X6J A;  4L7T A;  5EKQ D;  2HR2 A;  1FVH A;  2L0T B;  1INZ A;  3RJV A;  2XCB A;  4NUR A;  3LCA A;  3FHE A;  2OVF A;  1QQE A;  3ASH A;  4EQF A;  3ONL A;  1YA0 A;  2QFC A;  4JVS A;  4ACK A;  3LY8 A;  4JHR A;  4U07 A;  2VQ2 A;  1SZA A;  4AP2 A;  1ELK A;  4EZJ A;  4I9E A;  5ANL A;  4WWP A;  4DK5 A;  1E8X A;  2LSV A;  4TV3 A;  3ZGQ A;  2GW1 A;  3AS5 A;  4LEU A;  1N54 A;  5G05 C;  1A17 A;  1JUQ A;  4LER A;  2VJ8 A;  4N3B A;  1JWG A;  4U0S A;  4ANU A;  4GYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...