4GYOA

Crystal structure of rap protein complexed with competence and sporulation factor
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
366
structure length
357
Chain Sequence
b'PSEEVAVKLNEWYKLIRAFEADQAEALKQEIEYDLEDMEENQDLLLYFSLMEFRHRIMLDKLMPVKPFSDMLNEIESNLTGLLEYYFYYFRGMYEFKQKNFILAIDHYKHAEEKLEYVEDEIEKAEFLFKVAEVYYHIKQTYFSMNYASQALDIYTKYELYGRRRVQCEFIIAGNLTDVYHHEKALTHLCSALEHARQLEEAYMIAAAYYNVGHCKYSLGDYKEAEGYFKTAAAIFEEHNFQQAVQAVFSLTHIYCKEGKYDKAVEAYDRGIKSAAEWEDDMYLTKFRLIHELYLGSGDLNVLTECFDLLESRQLLADAEDLLHDTAERFNQLEHYESAAFFYRRLMNIKKKLAEQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator aspartate phosphatase J
publication title Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase
total genus 158
structure length 357
sequence length 366
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyoA01
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyoA02
5CCMA 5G05J 4H7XA 4B94A 3GW4A 5BNWA 1IHGA 3NF1A 2P58C 3MEKA 2E2EA 3JYSA 3QWWA 3FP3A 5EX3A 2XCBA 4I9EA 2OOEA 2KC7A 4JA9A 4YVQC 3LY8A 3RKVA 3RU0A 4BWRA 2UY1B 3AS4A 5BW8C 4WNGA 3S7FA 3QWVA 4BT8A 3O48A 2Y4UA 3ZN3A 1E96B 3CVLA 2PL2A 3MA5A 1IYGA 3E4BA 5DIZA 4RG6A 3Q47B 5FJYA 4N3BA 4AY6A 2AVPA 5KJLA 2YHCA 4ME2A 2LSUA 3CVNA 3RO2A 4HOSA 4JHRA 1TJCA 2KATA 1HH8A 3PDNA 4HOTA 2VGXA 5BT1A 5EKQD 3KS2A 4AY5A 4GYWA 5HQ8A 2XGSA 4GYYA 3LY7A 2VGXB 4G1TA 4XI0A 4WNDA 3KD7A 4IN3B 3Q15A 2WQHA 2YQ8A 3RIBA 5FT9A 4NRHB 4U0ZA 2KCKA 2IFUA 5JJTA 5G05C 1QQEA 4GZ5A 4WNFA 3TG5A 4YNDA 4GCNA 4GYOA 3TAXA 2R5SA 1ZBPA 3TGOA 4N2QA 1W3BA 1WAO1 1ZU2A 4I1AA 1ELRA 5DBKA 4GA1A 5D0OD 3SF4A 1OUVA 2VQ2A 2V5FA 4GCOA 2BUGA 3SZ7A 3N71A 4GZ3A 3LKUA 2KCVA 4I2WA 1NA0A 1YA0A 3LY9A 3Q5MA 4WUYA 2PZIA 2C0LA 4GZ6A 3BEEA 4N3AA 3U3WA 3MKRA 4Y6CA 5FZRA 4AM9A 3ZFWA 5ARGA 3CK8A 1PC2A 1B89A 4CGVA 2UWJG 4Y6WA 4G24A 5HI7A 2LSVA 3UQ3A 4O6FA 5EX0A 4CDRA 4KXKB 3URZA 3R9AB 2VYIA 4HOUA 1HZ4A 4EQFA 4BTAA 3MV3B 2C0MA 5G04C 4UQXA 3QDNA 4KYOB 4YVOA 4GA2A 5JJ6A 4WNEA 5C1DA 3CKCA 4A1SA 1KLXA 2FBNA 5KJKA 4J8FA 4JL0A 3RJVA 4W9RA 4G2VA 2FF4A 3CVQA 3LYAA 4JA7A 2Q7FA 5FZSA 3OXLA 3AS5A 5G04J 3QKYA 3S7JA 3RO3A 3ASFA 4G26A 1KT1A 1P5QA 2L6JA 5KJNA 4UQZA 2IF4A 5CCLA 1FCHA 4G25A 4N5CA 4U04A 2WPVA 3ASGA 3PE3A 4N39A 3CKBA 2XCCA 2NC9A 2VSNA 3Q49B 5AYWD 1HXIA 3CK9A 3ASHA 2XEVA 2PQRA 2MHKA 4U0SA 3CEQA 3FFLA 4I2ZA 5LCWJ 1ELWA 2FI7A 5D0QD 2FEZA 3AS8A 3VTYA 4LEUA 4J8EA 4KBQA 2FO7A 3GZ2A 2HR2A 5KJMA 2ONDA 4GA0A 3OXFA 4UI9K 3OXGA 4N2SA 1XNFA 3HYMB 3UUXA 5CHEE 4BT9A 1WM5A 2XPIA 5FZQA 4UQYA 3ESKA 2HO1A 4ABNA 4UI9J 4U0UA 3EDTB 1NZNA 2UY1A 2I6HA 3VTXA 3TG4A 3ULQA 2JLBA 3QWPA 3ZHEA 4U07A 3ZHEB 4F3VA 3LPZA 4AIFA 2LNIA 4I9CA 5A7DB 1KT0A 2C2LA 3GYZA 4J0UA 3CVPA 1NA3A 4I17A 1QZ2A 3PE4A 2PQNA 5FTPA 5A6CA 4HORA 3CK7A 2XGOA 5JJ7A 3GZ1A 3U4TA 4N3CA 2HYZA 4XI9A 4RG9A 3ZPJA 3KAEA 2VGYA 5LCWC 3S7DA 3Q4AB 2GW1A 1A17A 4APOA 4H7YA 5ARFA 3MV2B 3UPVA 2Y4TA 4G23A 3ZGQA 3QOUA 2J9QA 3S7BA 4J8DA 5M72A 1Y8MA 2QFCA 3CV0A 2VSYA 2XGMA 2KCLA 4NQ0A 4BTBA 3WXXA 4XIFA 4UI9C 3ASDA 2DBAA 3IEGA 4CGWA 3K9IA 3FWVA 3LCAA 4GPKA 4HOQA
chains in the Genus database with same CATH superfamily
2DWZA 3GW4A 4TXRA 5BNWA 3JXIA 3NF1A 2WM9A 5J08A 3DEPA 3MEKA 3QWWA 3DRAA 3W9GA 5EX3A 4ACKA 4TXPA 3DSVA 4JA9A 4YVQC 4BETA 2HE0A 3AG3E 3E34A 3V2OA 2UY1B 4PUCA 3U9WA 4KT6B 5LX8A 3V79K 4UUCA 2OVBA 5CBNA 3CVXA 4AOFA 2PL2A 2IO2C 2V8SE 4XX5A 4FJZA 3MA5A 2JABA 3E4BA 2BTDA 4LERA 5AQAA 3QB2A 5EIDA 3IKOB 1FVFA 3AU5A 3HXDA 2CG2A 4N3BA 4J7WA 1NFIE 4FP7A 1BU9A 3MYVA 4KZ0A 2AVPA 3CVNA 1E8ZA 2EIME 3QC1A 2BF0X 3DXMG 2VGXA 2XS8A 4U63A 5EKQD 3ZKJA 4GYWA 3CVWA 4ANVA 2P9UG 3LY7A 2P9PG 2VGXB 4LRZA 4WNDA 2XEHA 3KD7A 4IN3B 1OWPA 4HXIA 4HLEA 3FUFA 4L23A 4U8VD 2YQ8A 1JWFA 4U0ZA 1QQEA 4GPMA 3HXCA 3L82A 3ZXSA 3TAXA 2M63A 3NZSA 5FINA 1W3BA 2XEEA 4LSZE 2NXPA 4MS6A 2QYUA 3G2VA 4C9BB 1HF8A 1MX2A 3PEVB 2J4DA 4U7EB 1OUVA 1G3NB 2Y1LE 4WWOA 3FUIA 2A4ZA 2P9IG 3SZ7A 3PVLA 4TUMA 1N0QA 2GGFA 1EF1C 2V4HC 1QBQA 3BEEA 3LVRE 4JPSA 4AM9A 5FQ4A 3L08A 2I1KA 1PC2A 3BQOA 1JWGA 4K5CA 3APDA 2LSVA 4YDEA 5EX0A 4B0ZA 4EZKA 3ABLE 1TNZA 2LAIA 4YDYA 3LDZA 3URZA 4DX5D 3R9AB 5AARA 4HOUA 4BTAA 3HHMA 2C0MA 4PS3A 4KYOB 2GRLA 4A3TA 3VLEA 3PNTB 5FIOA 3CKCA 1TNUA 4U8YD 4J8FA 5KNGA 3AJIA 3UM3A 4M7CA 2FF4A 3D9OA 1H0AA 2LXMA 2ZU6B 3BG0B 3SO8A 1K8KG 3AS5A 4HI9A 1U3CA 3QKYA 3RO3A 4F53A 1YMPA 3L9TA 3ASFA 2XENA 1P5QA 3KEZA 2WXLA 2GRRB 1BLXB 3PS6A 1DVPA 3B7TA 2WPVA 4TV3A 3D9NA 3Q49B 3ASNE 5AYWD 4BSZB 1UJKA 3C5RA 5CECB 3SQVA 2L9BA 3CK9A 2XZDG 3UM1A 3IHYA 3CEQA 1EPUA 5JHBA 2KM4A 5ANRA 2MYOA 3AS8A 2XPZA 4LEUA 2FO7A 2HR2A 4GMLA 2AJAA 3D9IA 4GA0A 2Y69E 4GZCA 1JUQA 3OXFA 3DSUA 3PZ3A 5FZQA 3UTMA 3P1UA 4UQYA 1V54E 3SNXA 4ABNA 4UI9J 2P9SG 1PY1A 2DZOA 1RZ4A 2XS1A 4KZCA 2EILE 4JW1A 3E37A 4O1PA 3DPYA 3LPZA 4LNBA 1S0PA 3FTUA 1BI7B 4X8QA 3R7QA 2KBXA 1DNPA 1EDUA 2BKGA 3JCKC 3CSTA 4YDWA 3CVPA 2AW6A 2X6IA 4I17A 1TNOA 3Q79A 1QZ2A 3ZW3A 3ENEA 3FUEA 2H6IA 5CRVA 1TNBA 4I6EA 1TYQG 2PQNA 4GTQA 1EYHA 1N4SA 3RRMB 5A6CA 4HORA 5CMYA 1TN6A 4FULA 5JJ7A 5EN5D 3UINC 5ENQD 1N54A 3FH5A 1YCSB 3NB2A 3KAEA 1JCQA 4GU5A 5LCWC 1Z3XA 4FA6A 3Q75A 3ABME 4H7YA 4FLHA 5ARFA 3KSLA 4L1BA 1OY3D 4G23A 1LF8A 3QOUA 4JHKA 4GMRA 3DBSA 2XGMA 2CFUA 4NQ0A 4EBAA 4ANXA 3PEUB 5ANLA 3AU4A 2ETBA 1E90A 3B7UX 3IEGA 4CGWA 3J5QB 3FWVA 3LCAA 3LEWA 1A5EA 4H7XA 2RFMA 4B94A 5BV1A 4HI8A 3SGHA 3PREA 4UWHA 4F1SA 2OOEA 4C48B 4F7AA 3ONKA 3TWXA 1ZB1A 1L5JA 4GTRA 3EU5A 4BWRA 3SI5A 1IKND 1SVXA 3QWVA 4OYSA 2CHZA 4DPRA 1SA5A 2VTBA 1KZPA 5B1AE 1E8WA 1IYGA 4MLPA 2VTBB 2WVIA 3ZUVB 2I1JA 5FJYA 4AY6A 4ME2A 3APFA 5HKPA 5JA4D 4HOSA 4JHRA 1N4RA 3CSFA 5BXUA 3PDNA 1HG5A 2XRZA 4FLBA 4DRXE 5AENA 1Z6TA 2RKKA 4DK5A 2NSZA 2J4BA 1E7UA 3CVUA 2LO6A 1FPPA 3Q15A 5CBOA 4ATZD 2B6CA 3RIBA 5FT9A 2WXFA 4NRHB 2IFUA 5JJTA 2P2CP 2P9NG 5G05C 2XZTG 4FU3A 2F8YA 4GCNA 1TN7A 1UN8A 2R5SA 4FJYA 3E30A 3E32A 1UN9A 3SY2A 2EIKE 2H6HA 1MX6A 5FQ8A 4RVBA 4GTOA 1XGWA 4TXQA 2R17C 3T5VA 5FWQA 3D9PA 4L2YA 5D0OD 4B93B 1OWOA 2VQ2A 2WXJA 4GTSA 4GCOA 4BFRA 1V55E 3N71A 4GZ3A 2XPYA 2KCVA 4HRNA 2PZIA 4ILHB 5IY5E 3MKRA 3CR3A 2KZTA 1TJFA 5FZRA 2WXOA 3RRNB 4XKBA 4DI3A 2KZTB 5ARGA 2Y3AA 1HU3A 2GRPB 1S70B 3CQGB 4K5BA 4G24A 5HI7A 4GTTA 3U64A 4URKA 4CDRA 3DEOA 5FQ7A 2IEJA 4KXKB 1U3DA 3HG0D 5EILA 4BERA 4K5AB 2VYIA 3NOGD 2GRMA 3MV3B 2CHXA 5G04C 4UQXA 3QDNA 2V0PA 3GZSA 4JXTA 4JVSA 5C1DA 2DIWA 3RSEG 4IULA 4A1SA 3SFYA 2FBNA 2WXGA 5KJKA 5AJDA 4JL0A 3RJVA 4CEMA 4A55A 4UWFA 3DSTA 1TNYA 3EHQA 4ILGA 3FH7A 4G2VA 1SQMA 3LYAA 4LNGA 5FZSA 3OXLA 5LP0A 3L54A 3D9HA 3S7JA 5CERB 2AXVA 1KT1A 2X6KA 5KJNA 2QC9A 2L0TB 4UQZA 5CRUA 3UKUG 3SBSA 3ASGA 4N39A 2DZNA 5FQ6A 3JUIA 1HXIA 1H6KA 3T8KA 3ZRHA 5ENOD 4U0SA 5LCWJ 1ELWA 3QARA 3VLFA 2GRNB 2L6BA 4AV7A 3VTYA 4AXHA 3V2XA 3GZ2A 2WXRA 1QYMA 2IQCA 4UI9K 3SBTB 4HVBA 1XNFA 3UUXA 5C2YA 5CHEE 1WM5A 3CIAA 3RAUA 2FULA 2HO1A 4I1MA 3JQ0A 3Q7AA 3TXMA 5AAOA 3VTXA 3JUEA 5ENPD 2WMNA 1X5BA 2PM7A 3CLJA 2R03A 3MJWA 4FHJA 5KBAA 2WXIA 3NQPA 1SZ9A 2LNIA 4I9CA 5A7DB 2C2LA 4HQDA 4Q96A 4DX6D 1JPLA 3V30A 4WAFA 1O1TA 3BG1B 2ZIRA 3UM2A 1NA3A 4ANUA 3ULYA 5J90A 2WQ7A 3UM0A 4ZFHA 5FTPA 1TEZA 3CK7A 1NL4A 3RRUA 3UI2A 4JC8A 1DCEA 4N3CA 2YNQA 2HYZA 4TRQA 1HO8A 4A63B 3EIQC 4RG9A 4XE0A 5KCMA 4GTMA 1UOHA 3ABKE 1DC2A 3FUDA 2GW1A 3Q73A 1A17A 4CZ2D 3MV2B 4HLLA 3D9KA 3Q9UC 3PUKA 5EIBE 3FY4A 3R7RA 5D2MC 4ACLA 2VSOE 1N94A 1IXVA 2J9QA 3S7BA 4HS2A 3PZ1A 4J8DA 3TWVA 5M72A 2QFCA 5HS0A 3CV0A 5D66A 3PH0C 3PZDA 1H2VC 3AG1E 3FEXA 4WWNA 3G2SA 2WQ6A 4F1PA 5E75A 5G05J 3P2BA 4D10C 3ZYQA 2P58C 3I4RB 2E2EA 3JYSA 3TWUA 4KVOA 5B3SE 4LNUD 5AQ9A 4HNAD 1FT1A 4J6IA 3FTSA 3AS4A 2RG8A 3B7BA 3E33A 4WNGA 2WXNA 2Y4UA 2PNNA 1O5MA 1PAQA 3EHMA 5H7PA 5JHAA 2WB2A 4DX7D 4JB8P 2J09A 5DIZA 3D9MA 4RG6A 4AJWA 3Q47B 5JMND 3ESLA 3O4ZA 5AJLA 4QQIA 4QFVA 3NZUA 5KJLA 4FADA 2YHCA 4U8HA 4IRUA 5EDSA 2DYSE 4FHKA 2KATA 2J07A 1INZA 3ZEFA 1H6PA 3ULEG 4HOTA 5BT1A 3KS2A 4AY5A 4HRLA 2XGSA 4R7LA 3RK6A 3SHFA 4G1TA 3UIPC 3F6QA 1K1BA 4XI0A 5AQBA 5G55A 3DXKG 4I6GA 2F37A 3X2QE 2OEWA 4DUIA 4G8KA 4GB9A 2B0OE 1WDYA 4M3OA 2H6FA 1BD8A 2P9KG 4WNFA 4YNDA 1LD7A 4K03A 4A3VA 3ISMC 4IYPA 4N2QA 3C98A 3UT8A 4N5QA 3AG4E 1WAO1 4I1AA 5LFAA 1ELRA 1VDYA 4U95D 3FU5A 3KEAA 2OCCE 3Q7FA 2VSXE 3CQCB 2WXMA 4JD2G 4Q94A 1UW4B 4DLOA 1KZOA 3FTZA 3PNLB 2BUGA 3PUJA 4RSYA 4J8SA 3TWQA 1NA0A 1YA0A 2XRYA 4ATGA 5T8IA 3LY9A 4WUYA 3UX4A 4ANWA 4MRUA 4U96D 4KMOA 4N3AA 4OVUA 1BPOA 3U3WA 2ZISA 2Y0BG 4Y6CA 2BEDA 3FH8A 3L13A 1HX8A 3CVYA 1JCSA 3ZFWA 4KVMA 2ZGGA 1B89A 2X6JA 4CGVA 4J8YA 1ELKA 4Y6WA 4NACA 3CHMA 1E7VA 2XQ0A 1D8DA 1HG2A 3PRZA 4O6FA 3DSXA 3EJNA 1UJJA 4BX8A 4RQIA 1O1SA 3MKQA 4LG6A 2CG3A 4EZLA 3CHQA 3MKQB 1U2VG 4EQFA 4HFGA 1MX4A 3DWLG 3W9FA 1GW6A 1D9SA 4V3IA 4YVOA 1OWNA 2R05A 1E8YA 3ZIMA 1KLXA 1OWMA 2OV8A 3SD5A 3B95A 4HRMB 4W9RA 3ZYMA 2I9CA 2Q7FA 3QJZA 2IONA 2J08A 3LJ3A 2LAHA 3L17A 2YINA 1BI8B 3MZLB 3FUHA 1TR4A 2IF4A 5CCLA 4BESA 2P9LG 1SA4A 1KPSB 1Z5SC 3I5PA 3PZ4A 1NP7A 5HRYA 3PZ2A 1DCQA 4PS8A 2XCCA 3ZYKA 1H2TC 5AQ7A 2V5QC 3ASHA 2XEVA 2PQRA 2MHKA 4AP2A 3D9JA 4XZ4A 5D0QD 3TWRA 3ML9A 5BPPA 2ONDA 1H19A 1FT2A 2V4LA 3HYMB 3IHVA 4F6RD 4BT9A 4CT4A 2OEVA 3CHSA 2X3MA 4U0UA 4HB5A 2AXZA 3EDTB 2EIJE 1NZNA 2UY1A 3OAWA 4B8CB 3TG4A 3UMVA 3ZHEA 3D9LA 1MZCA 4U07A 2X6HA 3ZYLA 1K3ZD 2DCPA 3ZHEB 2NYJA 3MX3A 4F3VA 4TUUA 3TWWA 3FU3A 5A23A 5BUZA 4AIFA 5CEAA 3FTWA 4GTVA 4UWGA 3DSWA 3GYZA 3EUVA 2ETAA 3R9MA 4EPZA 3J5PA 3CVVA 2X6FA 5G2NA 4DX2A 5KNHD 2WXPA 4JHJA 3ONLA 3HXEA 4EECA 4BX9A 5AIJA 1Z3YA 2QY7A 4DJAA 2XGOA 3GZ1A 5T4YA 2A5EA 1D8EA 4Z68A 4ILIA 5ENSD 3FUNA 4OAUC 3FUMA 3TWTA 1MQSA 3UPVA 2LUHA 3CHRA 2WXHA 4CT0A 3ZGQA 1E8XA 4E85A 3TWSA 1Y8MA 3IV0A 3JQ1A 1HFAA 4BTBA 1S63A 3IBEA 2AWIA 3G2UA 4JEUA 4XIFA 3S2AA 3L6AA 2DBAA 3K9IA 4MBGA 3FUKA 4NIKA 4L7TA 4GPKA 5CCMA 2GRQB 4MKTA 4WWPA 1IHGA 4BY6A 4AEZC 1AP7A 3FU6A 5EYLA 3TXNA 3FP3A 2XCBA 4I9EA 3TJPA 2KC7A 4BSXA 3LY8A 1N52A 3RKVA 3RU0A 4AVXA 4PDXA 3JXJA 4EBAG 2R59A 1S64A 3NOCD 3ZU7B 5BW8C 3S7FA 1N4QA 4BT8A 3O48A 3ZN3A 1E96B 1N95A 3CVLA 4L2LA 4GMJA 2EINE 3EHRA 2QZAA 2LSUA 3RO2A 2BKKB 5KWDA 1TJCA 4PS7A 4C0MA 1HH8A 3LVQE 3FTVA 2J8SD 2IU1A 5CMWA 5HQ8A 3T8MA 4GYYA 3T5XA 1WG0A 4XKCA 3LJNA 2J49A 2E0IA 3HIZA 2VJ8A 3SFXA 1OT8A 3C3RA 2WQHA 3NAWA 2WXQA 3IXEA 4CDNA 1IQRA 3C72A 2KCKA 3I4GA 2L0IA 1JCRA 2LXLA 3DPDA 4GZ5A 3FUJA 4UWKA 3TG5A 4GYOA 2CFZA 5ENNA 3Q9NC 3V31A 1ZBPA 3TGOA 4EZJA 3L16A 3CGHA 3VLDA 4G8LA 3ASOE 4APFA 5BXOA 2F8XK 1ZU2A 1Q2ZA 5DBKA 5CEDB 2ZXWE 5BV0A 4GA1A 1N0RA 5AN8A 4I1OB 3G2WA 1HE8A 3SF4A 3LS8A 3C3QA 4CRWA 2V5FA 3CHOA 2DYRE 3U66A 2WMOA 2HM8A 2IOLA 2GROB 3LKUA 4L9PA 4I2WA 1SZAA 1OCRE 4HBDA 2RFAA 3Q5MA 2AXUA 2OVFA 5EYPF 2C0LA 4GZ6A 3FU0A 2VGEA 4LCTA 1WY6A 3B13A 2I2OA 3B7SA 2KXPC 3CK8A 3DSSA 2IJGX 2R02A 3EHNA 2UWJG 1OWLA 3AG2E 1OXJA 3UQ3A 2FO1E 1RW2A 3QK0A 2JEKA 2A5UA 2EQXA 3ZNGA 2MRIA 4BEPA 1QNFA 1HZ4A 1N4PA 4YDOA 3KSQA 3L22A 4ZHBA 3SFZA 1SW6A 3APCA 4DLQA 4GTPA 5T3RA 4GA2A 5JJ6A 2CHWA 4WNEA 3QAQA 3CHPA 1IHBA 4DI4A 4CCAA 2QYJA 3CVQA 3EU9A 1LTXA 4JA7A 3UT4A 5ITZF 5ENRD 5G04J 3BUAA 2XHEA 1AWCB 4G26A 3FDHA 2H6GA 2L6JA 3FULA 3FTXA 1YYHA 1FCHA 4G25A 3NBNB 4N5CA 4U04A 4G11A 3PE3A 3QNKA 1MHQA 3CKBA 3D3MA 2NC9A 2VSNA 3B7RL 1IQUA 3TL5A 3BU8A 4A1GA 2IY0C 3ML8A 4XEIG 3FFLA 4I2ZA 2FI7A 3HXFA 2FEZA 3WG7E 3UIOC 4CYMD 4DX1A 4J8EA 4KBQA 4JEHA 5KJMA 4B8AA 2IO3C 3HXBA 1LD8A 5LOZA 3OXGA 4N2SA 5B1BE 3G2TA 3Q78A 2XPIA 2IOSA 1H2UA 3ESKA 1OCZE 4LUNU 4UWLA 2RD0A 4K0RA 1TN8A 3ULQA 2JLBA 2R2LA 3QWPA 2X38A 4GAAA 1OCCE 1MJ0A 3MGBA 4Q69A 3ZVVA 3FEYA 3UT7A 3LXUX 2PM6A 4P29A 3I3NA 1FVHA 3HVEA 3FHEA 1KT0A 1UG3A 3HVEB 4O1OA 4J0UA 4OVVA 2F0YA 4CDMA 3OTNA 3AAAC 2YHEA 3C3OA 1K1AA 3PE4A 1X81A 4PH4B 1NI1A 2MOWA 2WXKA 4NURA 3HDXA 3U4TA 2ZGDA 4I43A 4XI9A 1MYOA 3ZXPA 4OAVB 3UKRG 4RLYA 4E6HA 3ZPJA 2VGYA 3S7DA 3Q4AB 3FTYA 1O1RA 4GZDA 3HRAA 5ENTD 4APOA 1N11A 3EIJA 2Y4TA 2ILRA 5E76A 3MCXA 1N9AA 4O60A 2VSYA 1OCOE 1Y6IA 4FC8A 2KCLA 4C0EA 4JZYA 3WXXA 4UI9C 4B89A 3ASDA 2DVWA 3UXGA 4I6JA 3T9KA 2ETCA 4EHMA 2I6HA 1H6OA 1HS6A 4HOQA
chains in the Genus database with same CATH topology
5CCMA 4MKTA 4H7XA 4WWPA 5G05J 4B94A 3GW4A 3P2BA 5BNWA 1IHGA 4BY6A 4AEZC 3NF1A 4D10C 5BV1A 3ZYQA 3FU6A 2P58C 2WM9A 3I4RB 5J08A 3MEKA 2E2EA 3JYSA 3SGHA 3QWWA 3PREA 4UWHA 4F1SA 3TXNA 3FP3A 5EX3A 2XCBA 4I9EA 4KVOA 2OOEA 4ACKA 3TJPA 2KC7A 4F7AA 4JA9A 4YVQC 3ONKA 4BSXA 3LY8A 1L5JA 1N52A 3RKVA 3RU0A 4AVXA 4PDXA 4BWRA 4J6IA 2UY1B 3FTSA 3SI5A 4EBAG 2R59A 3AS4A 4PUCA 3U9WA 2RG8A 4KT6B 5LX8A 5BW8C 2OVBA 4WNGA 3S7FA 3QWVA 2WXNA 4OYSA 4BT8A 3O48A 2CHZA 2Y4UA 4DPRA 3ZN3A 1E96B 3CVLA 3CVXA 4L2LA 4AOFA 2PL2A 1PAQA 2V8SE 3EHMA 4GMJA 4XX5A 2VTBA 4FJZA 3MA5A 5JHAA 2WB2A 1E8WA 1IYGA 2J09A 3E4BA 2BTDA 4MLPA 2VTBB 5DIZA 3D9MA 4LERA 4RG6A 2WVIA 4AJWA 3Q47B 3QB2A 2I1JA 3IKOB 1FVFA 3AU5A 5FJYA 2CG2A 4N3BA 3ESLA 4FP7A 3O4ZA 5AJLA 3MYVA 4QFVA 4KZ0A 4AY6A 3NZUA 2AVPA 5KJLA 4FADA 2YHCA 4ME2A 4U8HA 2LSUA 3APFA 4IRUA 3CVNA 1E8ZA 5EDSA 3RO2A 3QC1A 4FHKA 4HOSA 4JHRA 1TJCA 2KATA 2J07A 4PS7A 4C0MA 3CSFA 1INZA 3ZEFA 1HH8A 3PDNA 3LVQE 4HOTA 2BF0X 1HG5A 2XRZA 2VGXA 4FLBA 5BT1A 3FTVA 4U63A 5EKQD 3KS2A 5AENA 1Z6TA 4AY5A 2IU1A 4GYWA 5CMWA 5HQ8A 3CVWA 2XGSA 4R7LA 3T8MA 3RK6A 3LY7A 4GYYA 3SHFA 2VGXB 4G1TA 3T5XA 4ANVA 4LRZA 4XI0A 4DK5A 5G55A 2NSZA 2J4BA 4XKCA 4I6GA 2E0IA 2J49A 4WNDA 1E7UA 3KD7A 2LO6A 2VJ8A 3HIZA 4IN3B 3Q15A 1OWPA 4HXIA 3CVUA 4HLEA 3FUFA 2WQHA 4L23A 2YQ8A 1JWFA 3RIBA 2WXQA 5FT9A 2WXFA 4GB9A 4CDNA 4NRHB 1IQRA 4U0ZA 2KCKA 2IFUA 3I4GA 4M3OA 5JJTA 2L0IA 1QQEA 5G05C 3DPDA 4GZ5A 3FUJA 4FU3A 4WNFA 4UWKA 3TG5A 4YNDA 3ZXSA 4GCNA 4GYOA 4K03A 2CFZA 4A3VA 3TAXA 1UN8A 2M63A 5ENNA 2R5SA 4FJYA 4IYPA 1ZBPA 3TGOA 3NZSA 4EZJA 4N2QA 1W3BA 3L16A 3C98A 3CGHA 1UN9A 3UT8A 3VLDA 4APFA 5FQ8A 1WAO1 2NXPA 4MS6A 1ZU2A 4RVBA 4I1AA 1XGWA 5LFAA 1ELRA 2R17C 5DBKA 1VDYA 3G2VA 3T5VA 3FU5A 4C9BB 5BV0A 5FWQA 3D9PA 4GA1A 1HF8A 3PEVB 4I1OB 2VSXE 3CQCB 4L2YA 3G2WA 2WXMA 5D0OD 4Q94A 1HE8A 1UW4B 4DLOA 3SF4A 1OWOA 2J4DA 3LS8A 1OUVA 3FTZA 2VQ2A 4CRWA 2V5FA 2WXJA 3CHOA 4GCOA 4WWOA 4BFRA 2WMOA 3U66A 2HM8A 2BUGA 2IOLA 2A4ZA 3FUIA 3PNLB 3PUJA 4J8SA 3N71A 4GZ3A 4RSYA 2XPYA 3SZ7A 3LKUA 2KCVA 3PVLA 4I2WA 1SZAA 1NA0A 2GGFA 1YA0A 1EF1C 2XRYA 4ATGA 5T8IA 3LY9A 3Q5MA 2AXUA 4WUYA 3UX4A 4ANWA 4MRUA 2PZIA 2OVFA 4ILHB 4KMOA 2C0LA 4GZ6A 3BEEA 3LVRE 4N3AA 3FU0A 4OVUA 1BPOA 3U3WA 3MKRA 4JPSA 4Y6CA 3CR3A 2KZTA 3FH8A 1TJFA 5FZRA 4AM9A 3L13A 5FQ4A 2WXOA 1HX8A 4LCTA 1WY6A 3B13A 3RRNB 3ZFWA 4XKBA 4DI3A 3CVYA 4KVMA 2I2OA 3L08A 2I1KA 3B7SA 2KZTB 5ARGA 3CK8A 1PC2A 1B89A 2IJGX 2X6JA 1HU3A 2Y3AA 3EHNA 4CGVA 2UWJG 1ELKA 4Y6WA 4NACA 1JWGA 3CHMA 1E7VA 3CQGB 2XQ0A 1OWLA 3APDA 4G24A 5HI7A 3U64A 1HG2A 2LSVA 3PRZA 3UQ3A 4O6FA 5EX0A 4URKA 4B0ZA 4CDRA 5FQ7A 3EJNA 1UJJA 4BX8A 4KXKB 3QK0A 1U3DA 4EZKA 3MKQA 2LAIA 2JEKA 3LDZA 3URZA 2CG3A 2A5UA 3CHQA 4EZLA 2EQXA 3R9AB 3MKQB 2MRIA 2VYIA 1QNFA 2GRMA 4HOUA 1HZ4A 4EQFA 4HFGA 3MV3B 4BTAA 3L22A 3HHMA 2C0MA 2CHXA 3SFZA 5G04C 3APCA 4PS3A 4UQXA 4DLQA 3QDNA 4KYOB 2V0PA 3GZSA 1GW6A 2GRLA 5T3RA 4V3IA 4JXTA 1OWNA 4GA2A 4YVOA 3PNTB 5JJ6A 2CHWA 4WNEA 4JVSA 3VLEA 4A3TA 5C1DA 2DIWA 3CKCA 1E8YA 4IULA 4A1SA 1KLXA 3ZIMA 3QAQA 2FBNA 2WXGA 1OWMA 5AJDA 5KJKA 4J8FA 3CHPA 2OV8A 3SD5A 4JL0A 3RJVA 4CEMA 4A55A 4UWFA 4DI4A 4CCAA 4W9RA 4ILGA 2I9CA 3FH7A 4G2VA 2FF4A 3ZYMA 3CVQA 1SQMA 3D9OA 3LYAA 1H0AA 2ZU6B 3BG0B 4JA7A 2Q7FA 5FZSA 3UT4A 3OXLA 3QJZA 2IONA 2J08A 3AS5A 5LP0A 3L54A 3LJ3A 5G04J 2LAHA 1U3CA 3L17A 3QKYA 3S7JA 3RO3A 4F53A 2XHEA 2YINA 3ASFA 2AXVA 4G26A 1KT1A 3FDHA 1P5QA 3MZLB 3FUHA 2L6JA 2X6KA 3FULA 5KJNA 3FTXA 2L0TB 3KEZA 4UQZA 2WXLA 2IF4A 5CCLA 1FCHA 4G25A 3PS6A 1DVPA 3SBSA 3B7TA 4N5CA 4U04A 2WPVA 3ASGA 4TV3A 4G11A 3D9NA 3I5PA 1NP7A 3PE3A 3QNKA 4N39A 1MHQA 3CKBA 3D3MA 4PS8A 5FQ6A 2XCCA 2NC9A 2VSNA 3B7RL 3JUIA 3Q49B 5AYWD 3ZYKA 1HXIA 1UJKA 1H6KA 1IQUA 4BTBA 3TL5A 1H2TC 2L9BA 3CK9A 3ASHA 4A1GA 3ZRHA 2XEVA 2PQRA 3ML8A 2MHKA 3LEWA 4AP2A 4U0SA 3IHYA 3CEQA 3D9JA 3FFLA 4I2ZA 4XZ4A 1EPUA 1ELWA 5LCWJ 5JHBA 2FI7A 2KM4A 3QARA 3VLFA 5D0QD 5ANRA 2FEZA 4AV7A 3AS8A 3VTYA 2XPZA 3ML9A 4J8EA 4KBQA 4LEUA 4AXHA 2FO7A 3GZ2A 5BPPA 4JEHA 2HR2A 4GMLA 5KJMA 4B8AA 3D9IA 2ONDA 1H19A 4GA0A 2WXRA 4GZCA 2IQCA 1JUQA 3OXFA 4UI9K 3OXGA 5LOZA 2V4LA 3SBTB 4N2SA 4HVBA 1XNFA 3G2TA 3HYMB 3IHVA 5CHEE 5C2YA 3UUXA 4BT9A 1WM5A 2XPIA 3CIAA 5FZQA 4CT4A 3P1UA 2FULA 4UQYA 2IOSA 1H2UA 3CHSA 3SNXA 3ESKA 2HO1A 4I1MA 4ABNA 4UI9J 2X3MA 4LUNU 4U0UA 3JQ0A 2AXZA 3EDTB 1NZNA 4UWLA 2RD0A 2UY1A 1PY1A 3OAWA 4K0RA 3TXMA 3VTXA 4B8CB 3TG4A 3ULQA 2JLBA 3QWPA 3UMVA 3ZHEA 2WMNA 2X38A 3D9LA 4KZCA 4U07A 2X6HA 3ZYLA 4GAAA 3MGBA 4Q69A 2DCPA 1X5BA 2PM7A 4JW1A 3ZVVA 3ZHEB 3CLJA 3FEYA 3MX3A 3UT7A 3LXUX 4F3VA 3MJWA 4TUUA 2PM6A 4P29A 4FHJA 3I3NA 2WXIA 1FVHA 3LPZA 3NQPA 3FU3A 5A23A 1S0PA 3FTUA 3HVEA 5BUZA 3FHEA 1SZ9A 4AIFA 2LNIA 4I9CA 5A7DB 1KT0A 2C2LA 3FTWA 1UG3A 3R7QA 3HVEB 4Q96A 4UWGA 1JPLA 3GYZA 1DNPA 1EDUA 3JCKC 3CSTA 4J0UA 4WAFA 4OVVA 4EPZA 3CVPA 3BG1B 4CDMA 2AW6A 3OTNA 4ANXA 1NA3A 2X6IA 3CVVA 2X6FA 5G2NA 4ANUA 4I17A 5J90A 2WQ7A 1QZ2A 2YHEA 3ZW3A 3ENEA 3FUEA 2WXPA 3PE4A 4JHJA 4I6EA 4PH4B 3ONLA 2MOWA 4EECA 4BX9A 5AIJA 2PQNA 2WXKA 5FTPA 1EYHA 4NURA 1TEZA 3RRMB 1Z3YA 2QY7A 5A6CA 4DJAA 3CK7A 5CMYA 3HDXA 3RRUA 4HORA 2XGOA 4FULA 5JJ7A 3GZ1A 5T4YA 3U4TA 1N54A 4JC8A 4I43A 4N3CA 2YNQA 2HYZA 3FH5A 4XI9A 4TRQA 1HO8A 3EIQC 4RG9A 3LCAA 4XE0A 5KCMA 4E6HA 3ZPJA 3KAEA 2VGYA 4GU5A 4ILIA 5LCWC 3S7DA 3Q4AB 3FTYA 1Z3XA 3FUDA 3FUNA 4GZDA 2GW1A 1A17A 4FA6A 4H7YA 3FUMA 4APOA 4FLHA 3MV2B 3EIJA 5ARFA 3D9KA 1MQSA 3UPVA 3CHRA 3PUKA 2Y4TA 3FY4A 4L1BA 3R7RA 4ACLA 2WXHA 4CT0A 4G23A 2ILRA 2VSOE 5E76A 3ZGQA 1LF8A 1E8XA 2J9QA 3QOUA 3MCXA 3S7BA 4E85A 4HS2A 4J8DA 4JHKA 5M72A 1Y8MA 2QFCA 3CV0A 2VSYA 3DBSA 3PH0C 3PZDA 3IV0A 1H2VC 1Y6IA 3FEXA 2XGMA 3JQ1A 4WWNA 1HFAA 2CFUA 4FC8A 2KCLA 4NQ0A 4C0EA 4EBAA 3G2SA 4JZYA 3IBEA 2AWIA 3G2UA 3PEUB 4JEUA 4XIFA 5ANLA 3S2AA 3L6AA 3WXXA 3AU4A 4UI9C 4B89A 3ASDA 2WQ6A 1E90A 2DBAA 3B7UX 3IEGA 4CGWA 4I6JA 3K9IA 3FWVA 3FUKA 5E75A 4L7TA 2I6HA 1HS6A 4GPKA 4HOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCM A;  5G05 J;  4H7X A;  4B94 A;  3GW4 A;  5BNW A;  1IHG A;  3NF1 A;  2P58 C;  3MEK A;  2E2E A;  3JYS A;  3QWW A;  3FP3 A;  5EX3 A;  2XCB A;  4I9E A;  2OOE A;  2KC7 A;  4JA9 A;  4YVQ C;  3LY8 A;  3RKV A;  3RU0 A;  4BWR A;  2UY1 B;  3AS4 A;  5BW8 C;  4WNG A;  3S7F A;  3QWV A;  4BT8 A;  3O48 A;  2Y4U A;  3ZN3 A;  1E96 B;  3CVL A;  2PL2 A;  3MA5 A;  1IYG A;  3E4B A;  5DIZ A;  4RG6 A;  3Q47 B;  5FJY A;  4N3B A;  4AY6 A;  2AVP A;  5KJL A;  2YHC A;  4ME2 A;  2LSU A;  3CVN A;  3RO2 A;  4HOS A;  4JHR A;  1TJC A;  2KAT A;  1HH8 A;  3PDN A;  4HOT A;  2VGX A;  5BT1 A;  5EKQ D;  3KS2 A;  4AY5 A;  4GYW A;  5HQ8 A;  2XGS A;  4GYY A;  3LY7 A;  2VGX B;  4G1T A;  4XI0 A;  4WND A;  3KD7 A;  4IN3 B;  3Q15 A;  2WQH A;  2YQ8 A;  3RIB A;  5FT9 A;  4NRH B;  4U0Z A;  2KCK A;  2IFU A;  5JJT A;  5G05 C;  1QQE A;  4GZ5 A;  4WNF A;  3TG5 A;  4YND A;  4GCN A;  4GYO A;  3TAX A;  2R5S A;  1ZBP A;  3TGO A;  4N2Q A;  1W3B A;  1WAO 1;  1ZU2 A;  4I1A A;  1ELR A;  5DBK A;  4GA1 A;  5D0O D;  3SF4 A;  1OUV A;  2VQ2 A;  2V5F A;  4GCO A;  2BUG A;  3SZ7 A;  3N71 A;  4GZ3 A;  3LKU A;  2KCV A;  4I2W A;  1NA0 A;  1YA0 A;  3LY9 A;  3Q5M A;  4WUY A;  2PZI A;  2C0L A;  4GZ6 A;  3BEE A;  4N3A A;  3U3W A;  3MKR A;  4Y6C A;  5FZR A;  4AM9 A;  3ZFW A;  5ARG A;  3CK8 A;  1PC2 A;  1B89 A;  4CGV A;  2UWJ G;  4Y6W A;  4G24 A;  5HI7 A;  2LSV A;  3UQ3 A;  4O6F A;  5EX0 A;  4CDR A;  4KXK B;  3URZ A;  3R9A B;  2VYI A;  4HOU A;  1HZ4 A;  4EQF A;  4BTA A;  3MV3 B;  2C0M A;  5G04 C;  4UQX A;  3QDN A;  4KYO B;  4YVO A;  4GA2 A;  5JJ6 A;  4WNE A;  5C1D A;  3CKC A;  4A1S A;  1KLX A;  2FBN A;  5KJK A;  4J8F A;  4JL0 A;  3RJV A;  4W9R A;  4G2V A;  2FF4 A;  3CVQ A;  3LYA A;  4JA7 A;  2Q7F A;  5FZS A;  3OXL A;  3AS5 A;  5G04 J;  3QKY A;  3S7J A;  3RO3 A;  3ASF A;  4G26 A;  1KT1 A;  1P5Q A;  2L6J A;  5KJN A;  4UQZ A;  2IF4 A;  5CCL A;  1FCH A;  4G25 A;  4N5C A;  4U04 A;  2WPV A;  3ASG A;  3PE3 A;  4N39 A;  3CKB A;  2XCC A;  2NC9 A;  2VSN A;  3Q49 B;  5AYW D;  1HXI A;  3CK9 A;  3ASH A;  2XEV A;  2PQR A;  2MHK A;  4U0S A;  3CEQ A;  3FFL A;  4I2Z A;  5LCW J;  1ELW A;  2FI7 A;  5D0Q D;  2FEZ A;  3AS8 A;  3VTY A;  4LEU A;  4J8E A;  4KBQ A;  2FO7 A;  3GZ2 A;  2HR2 A;  5KJM A;  2OND A;  4GA0 A;  3OXF A;  4UI9 K;  3OXG A;  4N2S A;  1XNF A;  3HYM B;  3UUX A;  5CHE E;  4BT9 A;  1WM5 A;  2XPI A;  5FZQ A;  4UQY A;  3ESK A;  2HO1 A;  4ABN A;  4UI9 J;  4U0U A;  3EDT B;  1NZN A;  2UY1 A;  2I6H A;  3VTX A;  3TG4 A;  3ULQ A;  2JLB A;  3QWP A;  3ZHE A;  4U07 A;  3ZHE B;  4F3V A;  3LPZ A;  4AIF A;  2LNI A;  4I9C A;  5A7D B;  1KT0 A;  2C2L A;  3GYZ A;  4J0U A;  3CVP A;  1NA3 A;  4I17 A;  1QZ2 A;  3PE4 A;  2PQN A;  5FTP A;  5A6C A;  4HOR A;  3CK7 A;  2XGO A;  5JJ7 A;  3GZ1 A;  3U4T A;  4N3C A;  2HYZ A;  4XI9 A;  4RG9 A;  3ZPJ A;  3KAE A;  2VGY A;  5LCW C;  3S7D A;  3Q4A B;  2GW1 A;  1A17 A;  4APO A;  4H7Y A;  5ARF A;  3MV2 B;  3UPV A;  2Y4T A;  4G23 A;  3ZGQ A;  3QOU A;  2J9Q A;  3S7B A;  4J8D A;  5M72 A;  1Y8M A;  2QFC A;  3CV0 A;  2VSY A;  2XGM A;  2KCL A;  4NQ0 A;  4BTB A;  3WXX A;  4XIF A;  4UI9 C;  3ASD A;  2DBA A;  3IEG A;  4CGW A;  3K9I A;  3FWV A;  3LCA A;  4GPK A;  4HOQ A; 
#chains in the Genus database with same CATH topology
 2DWZ A;  3GW4 A;  4TXR A;  5BNW A;  3JXI A;  3NF1 A;  2WM9 A;  5J08 A;  3DEP A;  3MEK A;  3QWW A;  3DRA A;  3W9G A;  5EX3 A;  4ACK A;  4TXP A;  3DSV A;  4JA9 A;  4YVQ C;  4BET A;  2HE0 A;  3AG3 E;  3E34 A;  3V2O A;  2UY1 B;  4PUC A;  3U9W A;  4KT6 B;  5LX8 A;  3V79 K;  4UUC A;  2OVB A;  5CBN A;  3CVX A;  4AOF A;  2PL2 A;  2IO2 C;  2V8S E;  4XX5 A;  4FJZ A;  3MA5 A;  2JAB A;  3E4B A;  2BTD A;  4LER A;  5AQA A;  3QB2 A;  5EID A;  3IKO B;  1FVF A;  3AU5 A;  3HXD A;  2CG2 A;  4N3B A;  4J7W A;  1NFI E;  4FP7 A;  1BU9 A;  3MYV A;  4KZ0 A;  2AVP A;  3CVN A;  1E8Z A;  2EIM E;  3QC1 A;  2BF0 X;  3DXM G;  2VGX A;  2XS8 A;  4U63 A;  5EKQ D;  3ZKJ A;  4GYW A;  3CVW A;  4ANV A;  2P9U G;  3LY7 A;  2P9P G;  2VGX B;  4LRZ A;  4WND A;  2XEH A;  3KD7 A;  4IN3 B;  1OWP A;  4HXI A;  4HLE A;  3FUF A;  4L23 A;  4U8V D;  2YQ8 A;  1JWF A;  4U0Z A;  1QQE A;  4GPM A;  3HXC A;  3L82 A;  3ZXS A;  3TAX A;  2M63 A;  3NZS A;  5FIN A;  1W3B A;  2XEE A;  4LSZ E;  2NXP A;  4MS6 A;  2QYU A;  3G2V A;  4C9B B;  1HF8 A;  1MX2 A;  3PEV B;  2J4D A;  4U7E B;  1OUV A;  1G3N B;  2Y1L E;  4WWO A;  3FUI A;  2A4Z A;  2P9I G;  3SZ7 A;  3PVL A;  4TUM A;  1N0Q A;  2GGF A;  1EF1 C;  2V4H C;  1QBQ A;  3BEE A;  3LVR E;  4JPS A;  4AM9 A;  5FQ4 A;  3L08 A;  2I1K A;  1PC2 A;  3BQO A;  1JWG A;  4K5C A;  3APD A;  2LSV A;  4YDE A;  5EX0 A;  4B0Z A;  4EZK A;  3ABL E;  1TNZ A;  2LAI A;  4YDY A;  3LDZ A;  3URZ A;  4DX5 D;  3R9A B;  5AAR A;  4HOU A;  4BTA A;  3HHM A;  2C0M A;  4PS3 A;  4KYO B;  2GRL A;  4A3T A;  3VLE A;  3PNT B;  5FIO A;  3CKC A;  1TNU A;  4U8Y D;  4J8F A;  5KNG A;  3AJI A;  3UM3 A;  4M7C A;  2FF4 A;  3D9O A;  1H0A A;  2LXM A;  2ZU6 B;  3BG0 B;  3SO8 A;  1K8K G;  3AS5 A;  4HI9 A;  1U3C A;  3QKY A;  3RO3 A;  4F53 A;  1YMP A;  3L9T A;  3ASF A;  2XEN A;  1P5Q A;  3KEZ A;  2WXL A;  2GRR B;  1BLX B;  3PS6 A;  1DVP A;  3B7T A;  2WPV A;  4TV3 A;  3D9N A;  3Q49 B;  3ASN E;  5AYW D;  4BSZ B;  1UJK A;  3C5R A;  5CEC B;  3SQV A;  2L9B A;  3CK9 A;  2XZD G;  3UM1 A;  3IHY A;  3CEQ A;  1EPU A;  5JHB A;  2KM4 A;  5ANR A;  2MYO A;  3AS8 A;  2XPZ A;  4LEU A;  2FO7 A;  2HR2 A;  4GML A;  2AJA A;  3D9I A;  4GA0 A;  2Y69 E;  4GZC A;  1JUQ A;  3OXF A;  3DSU A;  3PZ3 A;  5FZQ A;  3UTM A;  3P1U A;  4UQY A;  1V54 E;  3SNX A;  4ABN A;  4UI9 J;  2P9S G;  1PY1 A;  2DZO A;  1RZ4 A;  2XS1 A;  4KZC A;  2EIL E;  4JW1 A;  3E37 A;  4O1P A;  3DPY A;  3LPZ A;  4LNB A;  1S0P A;  3FTU A;  1BI7 B;  4X8Q A;  3R7Q A;  2KBX A;  1DNP A;  1EDU A;  2BKG A;  3JCK C;  3CST A;  4YDW A;  3CVP A;  2AW6 A;  2X6I A;  4I17 A;  1TNO A;  3Q79 A;  1QZ2 A;  3ZW3 A;  3ENE A;  3FUE A;  2H6I A;  5CRV A;  1TNB A;  4I6E A;  1TYQ G;  2PQN A;  4GTQ A;  1EYH A;  1N4S A;  3RRM B;  5A6C A;  4HOR A;  5CMY A;  1TN6 A;  4FUL A;  5JJ7 A;  5EN5 D;  3UIN C;  5ENQ D;  1N54 A;  3FH5 A;  1YCS B;  3NB2 A;  3KAE A;  1JCQ A;  4GU5 A;  5LCW C;  1Z3X A;  4FA6 A;  3Q75 A;  3ABM E;  4H7Y A;  4FLH A;  5ARF A;  3KSL A;  4L1B A;  1OY3 D;  4G23 A;  1LF8 A;  3QOU A;  4JHK A;  4GMR A;  3DBS A;  2XGM A;  2CFU A;  4NQ0 A;  4EBA A;  4ANX A;  3PEU B;  5ANL A;  3AU4 A;  2ETB A;  1E90 A;  3B7U X;  3IEG A;  4CGW A;  3J5Q B;  3FWV A;  3LCA A;  3LEW A;  1A5E A;  4H7X A;  2RFM A;  4B94 A;  5BV1 A;  4HI8 A;  3SGH A;  3PRE A;  4UWH A;  4F1S A;  2OOE A;  4C48 B;  4F7A A;  3ONK A;  3TWX A;  1ZB1 A;  1L5J A;  4GTR A;  3EU5 A;  4BWR A;  3SI5 A;  1IKN D;  1SVX A;  3QWV A;  4OYS A;  2CHZ A;  4DPR A;  1SA5 A;  2VTB A;  1KZP A;  5B1A E;  1E8W A;  1IYG A;  4MLP A;  2VTB B;  2WVI A;  3ZUV B;  2I1J A;  5FJY A;  4AY6 A;  4ME2 A;  3APF A;  5HKP A;  5JA4 D;  4HOS A;  4JHR A;  1N4R A;  3CSF A;  5BXU A;  3PDN A;  1HG5 A;  2XRZ A;  4FLB A;  4DRX E;  5AEN A;  1Z6T A;  2RKK A;  4DK5 A;  2NSZ A;  2J4B A;  1E7U A;  3CVU A;  2LO6 A;  1FPP A;  3Q15 A;  5CBO A;  4ATZ D;  2B6C A;  3RIB A;  5FT9 A;  2WXF A;  4NRH B;  2IFU A;  5JJT A;  2P2C P;  2P9N G;  5G05 C;  2XZT G;  4FU3 A;  2F8Y A;  4GCN A;  1TN7 A;  1UN8 A;  2R5S A;  4FJY A;  3E30 A;  3E32 A;  1UN9 A;  3SY2 A;  2EIK E;  2H6H A;  1MX6 A;  5FQ8 A;  4RVB A;  4GTO A;  1XGW A;  4TXQ A;  2R17 C;  3T5V A;  5FWQ A;  3D9P A;  4L2Y A;  5D0O D;  4B93 B;  1OWO A;  2VQ2 A;  2WXJ A;  4GTS A;  4GCO A;  4BFR A;  1V55 E;  3N71 A;  4GZ3 A;  2XPY A;  2KCV A;  4HRN A;  2PZI A;  4ILH B;  5IY5 E;  3MKR A;  3CR3 A;  2KZT A;  1TJF A;  5FZR A;  2WXO A;  3RRN B;  4XKB A;  4DI3 A;  2KZT B;  5ARG A;  2Y3A A;  1HU3 A;  2GRP B;  1S70 B;  3CQG B;  4K5B A;  4G24 A;  5HI7 A;  4GTT A;  3U64 A;  4URK A;  4CDR A;  3DEO A;  5FQ7 A;  2IEJ A;  4KXK B;  1U3D A;  3HG0 D;  5EIL A;  4BER A;  4K5A B;  2VYI A;  3NOG D;  2GRM A;  3MV3 B;  2CHX A;  5G04 C;  4UQX A;  3QDN A;  2V0P A;  3GZS A;  4JXT A;  4JVS A;  5C1D A;  2DIW A;  3RSE G;  4IUL A;  4A1S A;  3SFY A;  2FBN A;  2WXG A;  5KJK A;  5AJD A;  4JL0 A;  3RJV A;  4CEM A;  4A55 A;  4UWF A;  3DST A;  1TNY A;  3EHQ A;  4ILG A;  3FH7 A;  4G2V A;  1SQM A;  3LYA A;  4LNG A;  5FZS A;  3OXL A;  5LP0 A;  3L54 A;  3D9H A;  3S7J A;  5CER B;  2AXV A;  1KT1 A;  2X6K A;  5KJN A;  2QC9 A;  2L0T B;  4UQZ A;  5CRU A;  3UKU G;  3SBS A;  3ASG A;  4N39 A;  2DZN A;  5FQ6 A;  3JUI A;  1HXI A;  1H6K A;  3T8K A;  3ZRH A;  5ENO D;  4U0S A;  5LCW J;  1ELW A;  3QAR A;  3VLF A;  2GRN B;  2L6B A;  4AV7 A;  3VTY A;  4AXH A;  3V2X A;  3GZ2 A;  2WXR A;  1QYM A;  2IQC A;  4UI9 K;  3SBT B;  4HVB A;  1XNF A;  3UUX A;  5C2Y A;  5CHE E;  1WM5 A;  3CIA A;  3RAU A;  2FUL A;  2HO1 A;  4I1M A;  3JQ0 A;  3Q7A A;  3TXM A;  5AAO A;  3VTX A;  3JUE A;  5ENP D;  2WMN A;  1X5B A;  2PM7 A;  3CLJ A;  2R03 A;  3MJW A;  4FHJ A;  5KBA A;  2WXI A;  3NQP A;  1SZ9 A;  2LNI A;  4I9C A;  5A7D B;  2C2L A;  4HQD A;  4Q96 A;  4DX6 D;  1JPL A;  3V30 A;  4WAF A;  1O1T A;  3BG1 B;  2ZIR A;  3UM2 A;  1NA3 A;  4ANU A;  3ULY A;  5J90 A;  2WQ7 A;  3UM0 A;  4ZFH A;  5FTP A;  1TEZ A;  3CK7 A;  1NL4 A;  3RRU A;  3UI2 A;  4JC8 A;  1DCE A;  4N3C A;  2YNQ A;  2HYZ A;  4TRQ A;  1HO8 A;  4A63 B;  3EIQ C;  4RG9 A;  4XE0 A;  5KCM A;  4GTM A;  1UOH A;  3ABK E;  1DC2 A;  3FUD A;  2GW1 A;  3Q73 A;  1A17 A;  4CZ2 D;  3MV2 B;  4HLL A;  3D9K A;  3Q9U C;  3PUK A;  5EIB E;  3FY4 A;  3R7R A;  5D2M C;  4ACL A;  2VSO E;  1N94 A;  1IXV A;  2J9Q A;  3S7B A;  4HS2 A;  3PZ1 A;  4J8D A;  3TWV A;  5M72 A;  2QFC A;  5HS0 A;  3CV0 A;  5D66 A;  3PH0 C;  3PZD A;  1H2V C;  3AG1 E;  3FEX A;  4WWN A;  3G2S A;  2WQ6 A;  4F1P A;  5E75 A;  5G05 J;  3P2B A;  4D10 C;  3ZYQ A;  2P58 C;  3I4R B;  2E2E A;  3JYS A;  3TWU A;  4KVO A;  5B3S E;  4LNU D;  5AQ9 A;  4HNA D;  1FT1 A;  4J6I A;  3FTS A;  3AS4 A;  2RG8 A;  3B7B A;  3E33 A;  4WNG A;  2WXN A;  2Y4U A;  2PNN A;  1O5M A;  1PAQ A;  3EHM A;  5H7P A;  5JHA A;  2WB2 A;  4DX7 D;  4JB8 P;  2J09 A;  5DIZ A;  3D9M A;  4RG6 A;  4AJW A;  3Q47 B;  5JMN D;  3ESL A;  3O4Z A;  5AJL A;  4QQI A;  4QFV A;  3NZU A;  5KJL A;  4FAD A;  2YHC A;  4U8H A;  4IRU A;  5EDS A;  2DYS E;  4FHK A;  2KAT A;  2J07 A;  1INZ A;  3ZEF A;  1H6P A;  3ULE G;  4HOT A;  5BT1 A;  3KS2 A;  4AY5 A;  4HRL A;  2XGS A;  4R7L A;  3RK6 A;  3SHF A;  4G1T A;  3UIP C;  3F6Q A;  1K1B A;  4XI0 A;  5AQB A;  5G55 A;  3DXK G;  4I6G A;  2F37 A;  3X2Q E;  2OEW A;  4DUI A;  4G8K A;  4GB9 A;  2B0O E;  1WDY A;  4M3O A;  2H6F A;  1BD8 A;  2P9K G;  4WNF A;  4YND A;  1LD7 A;  4K03 A;  4A3V A;  3ISM C;  4IYP A;  4N2Q A;  3C98 A;  3UT8 A;  4N5Q A;  3AG4 E;  1WAO 1;  4I1A A;  5LFA A;  1ELR A;  1VDY A;  4U95 D;  3FU5 A;  3KEA A;  2OCC E;  3Q7F A;  2VSX E;  3CQC B;  2WXM A;  4JD2 G;  4Q94 A;  1UW4 B;  4DLO A;  1KZO A;  3FTZ A;  3PNL B;  2BUG A;  3PUJ A;  4RSY A;  4J8S A;  3TWQ A;  1NA0 A;  1YA0 A;  2XRY A;  4ATG A;  5T8I A;  3LY9 A;  4WUY A;  3UX4 A;  4ANW A;  4MRU A;  4U96 D;  4KMO A;  4N3A A;  4OVU A;  1BPO A;  3U3W A;  2ZIS A;  2Y0B G;  4Y6C A;  2BED A;  3FH8 A;  3L13 A;  1HX8 A;  3CVY A;  1JCS A;  3ZFW A;  4KVM A;  2ZGG A;  1B89 A;  2X6J A;  4CGV A;  4J8Y A;  1ELK A;  4Y6W A;  4NAC A;  3CHM A;  1E7V A;  2XQ0 A;  1D8D A;  1HG2 A;  3PRZ A;  4O6F A;  3DSX A;  3EJN A;  1UJJ A;  4BX8 A;  4RQI A;  1O1S A;  3MKQ A;  4LG6 A;  2CG3 A;  4EZL A;  3CHQ A;  3MKQ B;  1U2V G;  4EQF A;  4HFG A;  1MX4 A;  3DWL G;  3W9F A;  1GW6 A;  1D9S A;  4V3I A;  4YVO A;  1OWN A;  2R05 A;  1E8Y A;  3ZIM A;  1KLX A;  1OWM A;  2OV8 A;  3SD5 A;  3B95 A;  4HRM B;  4W9R A;  3ZYM A;  2I9C A;  2Q7F A;  3QJZ A;  2ION A;  2J08 A;  3LJ3 A;  2LAH A;  3L17 A;  2YIN A;  1BI8 B;  3MZL B;  3FUH A;  1TR4 A;  2IF4 A;  5CCL A;  4BES A;  2P9L G;  1SA4 A;  1KPS B;  1Z5S C;  3I5P A;  3PZ4 A;  1NP7 A;  5HRY A;  3PZ2 A;  1DCQ A;  4PS8 A;  2XCC A;  3ZYK A;  1H2T C;  5AQ7 A;  2V5Q C;  3ASH A;  2XEV A;  2PQR A;  2MHK A;  4AP2 A;  3D9J A;  4XZ4 A;  5D0Q D;  3TWR A;  3ML9 A;  5BPP A;  2OND A;  1H19 A;  1FT2 A;  2V4L A;  3HYM B;  3IHV A;  4F6R D;  4BT9 A;  4CT4 A;  2OEV A;  3CHS A;  2X3M A;  4U0U A;  4HB5 A;  2AXZ A;  3EDT B;  2EIJ E;  1NZN A;  2UY1 A;  3OAW A;  4B8C B;  3TG4 A;  3UMV A;  3ZHE A;  3D9L A;  1MZC A;  4U07 A;  2X6H A;  3ZYL A;  1K3Z D;  2DCP A;  3ZHE B;  2NYJ A;  3MX3 A;  4F3V A;  4TUU A;  3TWW A;  3FU3 A;  5A23 A;  5BUZ A;  4AIF A;  5CEA A;  3FTW A;  4GTV A;  4UWG A;  3DSW A;  3GYZ A;  3EUV A;  2ETA A;  3R9M A;  4EPZ A;  3J5P A;  3CVV A;  2X6F A;  5G2N A;  4DX2 A;  5KNH D;  2WXP A;  4JHJ A;  3ONL A;  3HXE A;  4EEC A;  4BX9 A;  5AIJ A;  1Z3Y A;  2QY7 A;  4DJA A;  2XGO A;  3GZ1 A;  5T4Y A;  2A5E A;  1D8E A;  4Z68 A;  4ILI A;  5ENS D;  3FUN A;  4OAU C;  3FUM A;  3TWT A;  1MQS A;  3UPV A;  2LUH A;  3CHR A;  2WXH A;  4CT0 A;  3ZGQ A;  1E8X A;  4E85 A;  3TWS A;  1Y8M A;  3IV0 A;  3JQ1 A;  1HFA A;  4BTB A;  1S63 A;  3IBE A;  2AWI A;  3G2U A;  4JEU A;  4XIF A;  3S2A A;  3L6A A;  2DBA A;  3K9I A;  4MBG A;  3FUK A;  4NIK A;  4L7T A;  4GPK A;  5CCM A;  2GRQ B;  4MKT A;  4WWP A;  1IHG A;  4BY6 A;  4AEZ C;  1AP7 A;  3FU6 A;  5EYL A;  3TXN A;  3FP3 A;  2XCB A;  4I9E A;  3TJP A;  2KC7 A;  4BSX A;  3LY8 A;  1N52 A;  3RKV A;  3RU0 A;  4AVX A;  4PDX A;  3JXJ A;  4EBA G;  2R59 A;  1S64 A;  3NOC D;  3ZU7 B;  5BW8 C;  3S7F A;  1N4Q A;  4BT8 A;  3O48 A;  3ZN3 A;  1E96 B;  1N95 A;  3CVL A;  4L2L A;  4GMJ A;  2EIN E;  3EHR A;  2QZA A;  2LSU A;  3RO2 A;  2BKK B;  5KWD A;  1TJC A;  4PS7 A;  4C0M A;  1HH8 A;  3LVQ E;  3FTV A;  2J8S D;  2IU1 A;  5CMW A;  5HQ8 A;  3T8M A;  4GYY A;  3T5X A;  1WG0 A;  4XKC A;  3LJN A;  2J49 A;  2E0I A;  3HIZ A;  2VJ8 A;  3SFX A;  1OT8 A;  3C3R A;  2WQH A;  3NAW A;  2WXQ A;  3IXE A;  4CDN A;  1IQR A;  3C72 A;  2KCK A;  3I4G A;  2L0I A;  1JCR A;  2LXL A;  3DPD A;  4GZ5 A;  3FUJ A;  4UWK A;  3TG5 A;  4GYO A;  2CFZ A;  5ENN A;  3Q9N C;  3V31 A;  1ZBP A;  3TGO A;  4EZJ A;  3L16 A;  3CGH A;  3VLD A;  4G8L A;  3ASO E;  4APF A;  5BXO A;  2F8X K;  1ZU2 A;  1Q2Z A;  5DBK A;  5CED B;  2ZXW E;  5BV0 A;  4GA1 A;  1N0R A;  5AN8 A;  4I1O B;  3G2W A;  1HE8 A;  3SF4 A;  3LS8 A;  3C3Q A;  4CRW A;  2V5F A;  3CHO A;  2DYR E;  3U66 A;  2WMO A;  2HM8 A;  2IOL A;  2GRO B;  3LKU A;  4L9P A;  4I2W A;  1SZA A;  1OCR E;  4HBD A;  2RFA A;  3Q5M A;  2AXU A;  2OVF A;  5EYP F;  2C0L A;  4GZ6 A;  3FU0 A;  2VGE A;  4LCT A;  1WY6 A;  3B13 A;  2I2O A;  3B7S A;  2KXP C;  3CK8 A;  3DSS A;  2IJG X;  2R02 A;  3EHN A;  2UWJ G;  1OWL A;  3AG2 E;  1OXJ A;  3UQ3 A;  2FO1 E;  1RW2 A;  3QK0 A;  2JEK A;  2A5U A;  2EQX A;  3ZNG A;  2MRI A;  4BEP A;  1QNF A;  1HZ4 A;  1N4P A;  4YDO A;  3KSQ A;  3L22 A;  4ZHB A;  3SFZ A;  1SW6 A;  3APC A;  4DLQ A;  4GTP A;  5T3R A;  4GA2 A;  5JJ6 A;  2CHW A;  4WNE A;  3QAQ A;  3CHP A;  1IHB A;  4DI4 A;  4CCA A;  2QYJ A;  3CVQ A;  3EU9 A;  1LTX A;  4JA7 A;  3UT4 A;  5ITZ F;  5ENR D;  5G04 J;  3BUA A;  2XHE A;  1AWC B;  4G26 A;  3FDH A;  2H6G A;  2L6J A;  3FUL A;  3FTX A;  1YYH A;  1FCH A;  4G25 A;  3NBN B;  4N5C A;  4U04 A;  4G11 A;  3PE3 A;  3QNK A;  1MHQ A;  3CKB A;  3D3M A;  2NC9 A;  2VSN A;  3B7R L;  1IQU A;  3TL5 A;  3BU8 A;  4A1G A;  2IY0 C;  3ML8 A;  4XEI G;  3FFL A;  4I2Z A;  2FI7 A;  3HXF A;  2FEZ A;  3WG7 E;  3UIO C;  4CYM D;  4DX1 A;  4J8E A;  4KBQ A;  4JEH A;  5KJM A;  4B8A A;  2IO3 C;  3HXB A;  1LD8 A;  5LOZ A;  3OXG A;  4N2S A;  5B1B E;  3G2T A;  3Q78 A;  2XPI A;  2IOS A;  1H2U A;  3ESK A;  1OCZ E;  4LUN U;  4UWL A;  2RD0 A;  4K0R A;  1TN8 A;  3ULQ A;  2JLB A;  2R2L A;  3QWP A;  2X38 A;  4GAA A;  1OCC E;  1MJ0 A;  3MGB A;  4Q69 A;  3ZVV A;  3FEY A;  3UT7 A;  3LXU X;  2PM6 A;  4P29 A;  3I3N A;  1FVH A;  3HVE A;  3FHE A;  1KT0 A;  1UG3 A;  3HVE B;  4O1O A;  4J0U A;  4OVV A;  2F0Y A;  4CDM A;  3OTN A;  3AAA C;  2YHE A;  3C3O A;  1K1A A;  3PE4 A;  1X81 A;  4PH4 B;  1NI1 A;  2MOW A;  2WXK A;  4NUR A;  3HDX A;  3U4T A;  2ZGD A;  4I43 A;  4XI9 A;  1MYO A;  3ZXP A;  4OAV B;  3UKR G;  4RLY A;  4E6H A;  3ZPJ A;  2VGY A;  3S7D A;  3Q4A B;  3FTY A;  1O1R A;  4GZD A;  3HRA A;  5ENT D;  4APO A;  1N11 A;  3EIJ A;  2Y4T A;  2ILR A;  5E76 A;  3MCX A;  1N9A A;  4O60 A;  2VSY A;  1OCO E;  1Y6I A;  4FC8 A;  2KCL A;  4C0E A;  4JZY A;  3WXX A;  4UI9 C;  4B89 A;  3ASD A;  2DVW A;  3UXG A;  4I6J A;  3T9K A;  2ETC A;  4EHM A;  2I6H A;  1H6O A;  1HS6 A;  4HOQ A; 
#chains in the Genus database with same CATH homology
 5CCM A;  4MKT A;  4H7X A;  4WWP A;  5G05 J;  4B94 A;  3GW4 A;  3P2B A;  5BNW A;  1IHG A;  4BY6 A;  4AEZ C;  3NF1 A;  4D10 C;  5BV1 A;  3ZYQ A;  3FU6 A;  2P58 C;  2WM9 A;  3I4R B;  5J08 A;  3MEK A;  2E2E A;  3JYS A;  3SGH A;  3QWW A;  3PRE A;  4UWH A;  4F1S A;  3TXN A;  3FP3 A;  5EX3 A;  2XCB A;  4I9E A;  4KVO A;  2OOE A;  4ACK A;  3TJP A;  2KC7 A;  4F7A A;  4JA9 A;  4YVQ C;  3ONK A;  4BSX A;  3LY8 A;  1L5J A;  1N52 A;  3RKV A;  3RU0 A;  4AVX A;  4PDX A;  4BWR A;  4J6I A;  2UY1 B;  3FTS A;  3SI5 A;  4EBA G;  2R59 A;  3AS4 A;  4PUC A;  3U9W A;  2RG8 A;  4KT6 B;  5LX8 A;  5BW8 C;  2OVB A;  4WNG A;  3S7F A;  3QWV A;  2WXN A;  4OYS A;  4BT8 A;  3O48 A;  2CHZ A;  2Y4U A;  4DPR A;  3ZN3 A;  1E96 B;  3CVL A;  3CVX A;  4L2L A;  4AOF A;  2PL2 A;  1PAQ A;  2V8S E;  3EHM A;  4GMJ A;  4XX5 A;  2VTB A;  4FJZ A;  3MA5 A;  5JHA A;  2WB2 A;  1E8W A;  1IYG A;  2J09 A;  3E4B A;  2BTD A;  4MLP A;  2VTB B;  5DIZ A;  3D9M A;  4LER A;  4RG6 A;  2WVI A;  4AJW A;  3Q47 B;  3QB2 A;  2I1J A;  3IKO B;  1FVF A;  3AU5 A;  5FJY A;  2CG2 A;  4N3B A;  3ESL A;  4FP7 A;  3O4Z A;  5AJL A;  3MYV A;  4QFV A;  4KZ0 A;  4AY6 A;  3NZU A;  2AVP A;  5KJL A;  4FAD A;  2YHC A;  4ME2 A;  4U8H A;  2LSU A;  3APF A;  4IRU A;  3CVN A;  1E8Z A;  5EDS A;  3RO2 A;  3QC1 A;  4FHK A;  4HOS A;  4JHR A;  1TJC A;  2KAT A;  2J07 A;  4PS7 A;  4C0M A;  3CSF A;  1INZ A;  3ZEF A;  1HH8 A;  3PDN A;  3LVQ E;  4HOT A;  2BF0 X;  1HG5 A;  2XRZ A;  2VGX A;  4FLB A;  5BT1 A;  3FTV A;  4U63 A;  5EKQ D;  3KS2 A;  5AEN A;  1Z6T A;  4AY5 A;  2IU1 A;  4GYW A;  5CMW A;  5HQ8 A;  3CVW A;  2XGS A;  4R7L A;  3T8M A;  3RK6 A;  3LY7 A;  4GYY A;  3SHF A;  2VGX B;  4G1T A;  3T5X A;  4ANV A;  4LRZ A;  4XI0 A;  4DK5 A;  5G55 A;  2NSZ A;  2J4B A;  4XKC A;  4I6G A;  2E0I A;  2J49 A;  4WND A;  1E7U A;  3KD7 A;  2LO6 A;  2VJ8 A;  3HIZ A;  4IN3 B;  3Q15 A;  1OWP A;  4HXI A;  3CVU A;  4HLE A;  3FUF A;  2WQH A;  4L23 A;  2YQ8 A;  1JWF A;  3RIB A;  2WXQ A;  5FT9 A;  2WXF A;  4GB9 A;  4CDN A;  4NRH B;  1IQR A;  4U0Z A;  2KCK A;  2IFU A;  3I4G A;  4M3O A;  5JJT A;  2L0I A;  1QQE A;  5G05 C;  3DPD A;  4GZ5 A;  3FUJ A;  4FU3 A;  4WNF A;  4UWK A;  3TG5 A;  4YND A;  3ZXS A;  4GCN A;  4GYO A;  4K03 A;  2CFZ A;  4A3V A;  3TAX A;  1UN8 A;  2M63 A;  5ENN A;  2R5S A;  4FJY A;  4IYP A;  1ZBP A;  3TGO A;  3NZS A;  4EZJ A;  4N2Q A;  1W3B A;  3L16 A;  3C98 A;  3CGH A;  1UN9 A;  3UT8 A;  3VLD A;  4APF A;  5FQ8 A;  1WAO 1;  2NXP A;  4MS6 A;  1ZU2 A;  4RVB A;  4I1A A;  1XGW A;  5LFA A;  1ELR A;  2R17 C;  5DBK A;  1VDY A;  3G2V A;  3T5V A;  3FU5 A;  4C9B B;  5BV0 A;  5FWQ A;  3D9P A;  4GA1 A;  1HF8 A;  3PEV B;  4I1O B;  2VSX E;  3CQC B;  4L2Y A;  3G2W A;  2WXM A;  5D0O D;  4Q94 A;  1HE8 A;  1UW4 B;  4DLO A;  3SF4 A;  1OWO A;  2J4D A;  3LS8 A;  1OUV A;  3FTZ A;  2VQ2 A;  4CRW A;  2V5F A;  2WXJ A;  3CHO A;  4GCO A;  4WWO A;  4BFR A;  2WMO A;  3U66 A;  2HM8 A;  2BUG A;  2IOL A;  2A4Z A;  3FUI A;  3PNL B;  3PUJ A;  4J8S A;  3N71 A;  4GZ3 A;  4RSY A;  2XPY A;  3SZ7 A;  3LKU A;  2KCV A;  3PVL A;  4I2W A;  1SZA A;  1NA0 A;  2GGF A;  1YA0 A;  1EF1 C;  2XRY A;  4ATG A;  5T8I A;  3LY9 A;  3Q5M A;  2AXU A;  4WUY A;  3UX4 A;  4ANW A;  4MRU A;  2PZI A;  2OVF A;  4ILH B;  4KMO A;  2C0L A;  4GZ6 A;  3BEE A;  3LVR E;  4N3A A;  3FU0 A;  4OVU A;  1BPO A;  3U3W A;  3MKR A;  4JPS A;  4Y6C A;  3CR3 A;  2KZT A;  3FH8 A;  1TJF A;  5FZR A;  4AM9 A;  3L13 A;  5FQ4 A;  2WXO A;  1HX8 A;  4LCT A;  1WY6 A;  3B13 A;  3RRN B;  3ZFW A;  4XKB A;  4DI3 A;  3CVY A;  4KVM A;  2I2O A;  3L08 A;  2I1K A;  3B7S A;  2KZT B;  5ARG A;  3CK8 A;  1PC2 A;  1B89 A;  2IJG X;  2X6J A;  1HU3 A;  2Y3A A;  3EHN A;  4CGV A;  2UWJ G;  1ELK A;  4Y6W A;  4NAC A;  1JWG A;  3CHM A;  1E7V A;  3CQG B;  2XQ0 A;  1OWL A;  3APD A;  4G24 A;  5HI7 A;  3U64 A;  1HG2 A;  2LSV A;  3PRZ A;  3UQ3 A;  4O6F A;  5EX0 A;  4URK A;  4B0Z A;  4CDR A;  5FQ7 A;  3EJN A;  1UJJ A;  4BX8 A;  4KXK B;  3QK0 A;  1U3D A;  4EZK A;  3MKQ A;  2LAI A;  2JEK A;  3LDZ A;  3URZ A;  2CG3 A;  2A5U A;  3CHQ A;  4EZL A;  2EQX A;  3R9A B;  3MKQ B;  2MRI A;  2VYI A;  1QNF A;  2GRM A;  4HOU A;  1HZ4 A;  4EQF A;  4HFG A;  3MV3 B;  4BTA A;  3L22 A;  3HHM A;  2C0M A;  2CHX A;  3SFZ A;  5G04 C;  3APC A;  4PS3 A;  4UQX A;  4DLQ A;  3QDN A;  4KYO B;  2V0P A;  3GZS A;  1GW6 A;  2GRL A;  5T3R A;  4V3I A;  4JXT A;  1OWN A;  4GA2 A;  4YVO A;  3PNT B;  5JJ6 A;  2CHW A;  4WNE A;  4JVS A;  3VLE A;  4A3T A;  5C1D A;  2DIW A;  3CKC A;  1E8Y A;  4IUL A;  4A1S A;  1KLX A;  3ZIM A;  3QAQ A;  2FBN A;  2WXG A;  1OWM A;  5AJD A;  5KJK A;  4J8F A;  3CHP A;  2OV8 A;  3SD5 A;  4JL0 A;  3RJV A;  4CEM A;  4A55 A;  4UWF A;  4DI4 A;  4CCA A;  4W9R A;  4ILG A;  2I9C A;  3FH7 A;  4G2V A;  2FF4 A;  3ZYM A;  3CVQ A;  1SQM A;  3D9O A;  3LYA A;  1H0A A;  2ZU6 B;  3BG0 B;  4JA7 A;  2Q7F A;  5FZS A;  3UT4 A;  3OXL A;  3QJZ A;  2ION A;  2J08 A;  3AS5 A;  5LP0 A;  3L54 A;  3LJ3 A;  5G04 J;  2LAH A;  1U3C A;  3L17 A;  3QKY A;  3S7J A;  3RO3 A;  4F53 A;  2XHE A;  2YIN A;  3ASF A;  2AXV A;  4G26 A;  1KT1 A;  3FDH A;  1P5Q A;  3MZL B;  3FUH A;  2L6J A;  2X6K A;  3FUL A;  5KJN A;  3FTX A;  2L0T B;  3KEZ A;  4UQZ A;  2WXL A;  2IF4 A;  5CCL A;  1FCH A;  4G25 A;  3PS6 A;  1DVP A;  3SBS A;  3B7T A;  4N5C A;  4U04 A;  2WPV A;  3ASG A;  4TV3 A;  4G11 A;  3D9N A;  3I5P A;  1NP7 A;  3PE3 A;  3QNK A;  4N39 A;  1MHQ A;  3CKB A;  3D3M A;  4PS8 A;  5FQ6 A;  2XCC A;  2NC9 A;  2VSN A;  3B7R L;  3JUI A;  3Q49 B;  5AYW D;  3ZYK A;  1HXI A;  1UJK A;  1H6K A;  1IQU A;  4BTB A;  3TL5 A;  1H2T C;  2L9B A;  3CK9 A;  3ASH A;  4A1G A;  3ZRH A;  2XEV A;  2PQR A;  3ML8 A;  2MHK A;  3LEW A;  4AP2 A;  4U0S A;  3IHY A;  3CEQ A;  3D9J A;  3FFL A;  4I2Z A;  4XZ4 A;  1EPU A;  1ELW A;  5LCW J;  5JHB A;  2FI7 A;  2KM4 A;  3QAR A;  3VLF A;  5D0Q D;  5ANR A;  2FEZ A;  4AV7 A;  3AS8 A;  3VTY A;  2XPZ A;  3ML9 A;  4J8E A;  4KBQ A;  4LEU A;  4AXH A;  2FO7 A;  3GZ2 A;  5BPP A;  4JEH A;  2HR2 A;  4GML A;  5KJM A;  4B8A A;  3D9I A;  2OND A;  1H19 A;  4GA0 A;  2WXR A;  4GZC A;  2IQC A;  1JUQ A;  3OXF A;  4UI9 K;  3OXG A;  5LOZ A;  2V4L A;  3SBT B;  4N2S A;  4HVB A;  1XNF A;  3G2T A;  3HYM B;  3IHV A;  5CHE E;  5C2Y A;  3UUX A;  4BT9 A;  1WM5 A;  2XPI A;  3CIA A;  5FZQ A;  4CT4 A;  3P1U A;  2FUL A;  4UQY A;  2IOS A;  1H2U A;  3CHS A;  3SNX A;  3ESK A;  2HO1 A;  4I1M A;  4ABN A;  4UI9 J;  2X3M A;  4LUN U;  4U0U A;  3JQ0 A;  2AXZ A;  3EDT B;  1NZN A;  4UWL A;  2RD0 A;  2UY1 A;  1PY1 A;  3OAW A;  4K0R A;  3TXM A;  3VTX A;  4B8C B;  3TG4 A;  3ULQ A;  2JLB A;  3QWP A;  3UMV A;  3ZHE A;  2WMN A;  2X38 A;  3D9L A;  4KZC A;  4U07 A;  2X6H A;  3ZYL A;  4GAA A;  3MGB A;  4Q69 A;  2DCP A;  1X5B A;  2PM7 A;  4JW1 A;  3ZVV A;  3ZHE B;  3CLJ A;  3FEY A;  3MX3 A;  3UT7 A;  3LXU X;  4F3V A;  3MJW A;  4TUU A;  2PM6 A;  4P29 A;  4FHJ A;  3I3N A;  2WXI A;  1FVH A;  3LPZ A;  3NQP A;  3FU3 A;  5A23 A;  1S0P A;  3FTU A;  3HVE A;  5BUZ A;  3FHE A;  1SZ9 A;  4AIF A;  2LNI A;  4I9C A;  5A7D B;  1KT0 A;  2C2L A;  3FTW A;  1UG3 A;  3R7Q A;  3HVE B;  4Q96 A;  4UWG A;  1JPL A;  3GYZ A;  1DNP A;  1EDU A;  3JCK C;  3CST A;  4J0U A;  4WAF A;  4OVV A;  4EPZ A;  3CVP A;  3BG1 B;  4CDM A;  2AW6 A;  3OTN A;  4ANX A;  1NA3 A;  2X6I A;  3CVV A;  2X6F A;  5G2N A;  4ANU A;  4I17 A;  5J90 A;  2WQ7 A;  1QZ2 A;  2YHE A;  3ZW3 A;  3ENE A;  3FUE A;  2WXP A;  3PE4 A;  4JHJ A;  4I6E A;  4PH4 B;  3ONL A;  2MOW A;  4EEC A;  4BX9 A;  5AIJ A;  2PQN A;  2WXK A;  5FTP A;  1EYH A;  4NUR A;  1TEZ A;  3RRM B;  1Z3Y A;  2QY7 A;  5A6C A;  4DJA A;  3CK7 A;  5CMY A;  3HDX A;  3RRU A;  4HOR A;  2XGO A;  4FUL A;  5JJ7 A;  3GZ1 A;  5T4Y A;  3U4T A;  1N54 A;  4JC8 A;  4I43 A;  4N3C A;  2YNQ A;  2HYZ A;  3FH5 A;  4XI9 A;  4TRQ A;  1HO8 A;  3EIQ C;  4RG9 A;  3LCA A;  4XE0 A;  5KCM A;  4E6H A;  3ZPJ A;  3KAE A;  2VGY A;  4GU5 A;  4ILI A;  5LCW C;  3S7D A;  3Q4A B;  3FTY A;  1Z3X A;  3FUD A;  3FUN A;  4GZD A;  2GW1 A;  1A17 A;  4FA6 A;  4H7Y A;  3FUM A;  4APO A;  4FLH A;  3MV2 B;  3EIJ A;  5ARF A;  3D9K A;  1MQS A;  3UPV A;  3CHR A;  3PUK A;  2Y4T A;  3FY4 A;  4L1B A;  3R7R A;  4ACL A;  2WXH A;  4CT0 A;  4G23 A;  2ILR A;  2VSO E;  5E76 A;  3ZGQ A;  1LF8 A;  1E8X A;  2J9Q A;  3QOU A;  3MCX A;  3S7B A;  4E85 A;  4HS2 A;  4J8D A;  4JHK A;  5M72 A;  1Y8M A;  2QFC A;  3CV0 A;  2VSY A;  3DBS A;  3PH0 C;  3PZD A;  3IV0 A;  1H2V C;  1Y6I A;  3FEX A;  2XGM A;  3JQ1 A;  4WWN A;  1HFA A;  2CFU A;  4FC8 A;  2KCL A;  4NQ0 A;  4C0E A;  4EBA A;  3G2S A;  4JZY A;  3IBE A;  2AWI A;  3G2U A;  3PEU B;  4JEU A;  4XIF A;  5ANL A;  3S2A A;  3L6A A;  3WXX A;  3AU4 A;  4UI9 C;  4B89 A;  3ASD A;  2WQ6 A;  1E90 A;  2DBA A;  3B7U X;  3IEG A;  4CGW A;  4I6J A;  3K9I A;  3FWV A;  3FUK A;  5E75 A;  4L7T A;  2I6H A;  1HS6 A;  4GPK A;  4HOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...