4GYYA

Crystal structure of human o-glcnac transferase with udp-5sglcnac and a peptide substrate
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
715
structure length
693
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFHIYDNRIVLNGIDLKAFLDSLPDVKIVNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 274
structure length 693
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gyyA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gyyA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gyyA03
3IA7A 3VTYA 4Y6WA 1YA6A 4GYYA 1L7XA 2WQHA 4J0UA 2P58C 7GPBA 3GYZA 1C8LA 2F3PA 2X6QA 4F9FA 5TMBA 5HI7A 1HZ4A 1HH8A 3DZCA 3FROA 1GFZA 4F96A 3MTAA 5DLDA 2H1HA 3MTDA 2FFRA 4YI5A 1Y6FA 2XCIA 1Z6PA 3BD6A 4N2QA 5JTTA 3CEMA 5TMEA 4G24A 2ONDA 5JJ7A 3CUVA 3KD7A 4GZ3A 4RENA 4MICA 3RO3A 2AMVA 3IEGA 2AW3A 2AZDA 9GPBA 3MSCA 4YNDA 3WXXA 1WW3A 2C0LA 3CUWA 5G04C 4RIEA 1NVKA 2Q7FA 3CKCA 1JG6A 1A8IA 2WTXA 4WHMA 3RO2A 2R60A 3FWVA 5G05C 1Z62A 3E3OA 1K08A 3CKBA 1L5SA 1P2GA 2F9FA 4KQ2A 3HBNA 5DU2A 2FI7A 2E2EA 3MS4A 2ZB2A 3T5TA 1SXPA 2IFUA 4N3BA 4HOUA 4F3VA 3CUTA 4G2TA 3K9IA 1LWNA 4XIFA 3S27A 3T7DA 5ENZA 4GCNA 3Q4AB 1V4VA 4G25A 3MQFA 2O6LA 1K06A 4RG9A 3NP9A 4I1AA 3QKYA 1FTYA 4M83A 3U3WA 1KLXA 2QLNA 2C1ZA 5LCWC 3ASDA 1FU7A 2QN3A 4BTBA 3MRVA 3HBFA 2XMPA 4GPBA 5FZQA 1EXVA 2HYZA 5GPBA 3NP7A 4J8EA 2VGXA 5FT9A 4H7XA 4HORA 4KYOB 1P5QA 3SYRA 1JIVA 1L6IA 2IW1A 3GPBA 3KS2A 3IAAA 3QDNA 3MRTA 2PZIA 4X7RA 3UYKA 4I2WA 4GA0A 2F3SA 3RSCA 3S7JA 4X7MA 3RHZA 1WW2A 5CHEE 5JJTA 1KT0A 2VYIA 1YA0A 3WADA 3L01A 2KCKA 3ZCQA 3E3LA 1GPBA 2ACVA 3UQ3A 3MT9A 1L5VA 3LY8A 1JIUA 3HBMA 3QHPA 3PE4A 3OXGA 4MHSA 4REMA 2AV6A 3CX4A 2LSVA 2BUGA 2KATA 3CVQA 3L7BA 3SF4A 3S7BA 3CV3A 1ABBA 2BISA 3RIBA 2G9RA 2VSYA 2R4UA 5KJKA 1TJCA 1C8KA 4KQMA 3BEEA 1KTIA 3OY2A 2GEKA 4PQGA 1PN3A 1W3BA 2XPIA 4EL5A 1XKXA 1XOIA 2F3UA 3C48A 4G1TA 5AYWD 3KAEA 3PDNA 5C1DA 3MBOA 2VCHA 4MRAA 2JZCA 1F6DA 3GZ1A 2FO7A 1UQTA 2QRMA 4NC9A 3NAZA 1FS4A 1PNVA 4WNFA 2KCVA 3RSZA 1GZ5A 4RBNA 2R4TA 3AMVA 3TSAA 3O3CA 2HO1A 2JLBA 2QLLA 3Q3EA 1FTWA 4RIFA 4JL0A 5DBKA 4U0SA 3S29A 2PQ6A 5FZRA 2XEVA 5CCMA 1KT1A 4G23A 1H5UA 1NA3A 1Y6GA 2QN1A 3HBJA 2OFFA 3ASFA 3ZCTA 4J8DA 3HYMB 5EKQD 4UI9K 4APOA 3LCAA 4BTAA 2ECPA 4IN3B 3BCSA 4RELA 1ZBPA 5KJMA 4Y6CA 5D0QD 2ACWA 3N71A 4AMBA 2SKEA 4N3CA 3EBOA 3VUFA 4O6FA 2XGMA 3H4TA 3OKPA 4N9WA 3ZCPA 2WPVA 2QN9A 2C9ZA 1B89A 4LEUA 2GM9A 3QKWA 4HLNA 4NESA 4RG6A 3OTHA 4YI3A 1RZVA 2IV7A 5JTUA 1IXYA 2Q6VA 3EBPA 1WV0A 3OKAA 3DD1A 3TG4A 2QRQA 1VGVA 2H1FA 4EL0A 3AS5A 4UQZA 4CGVA 2JJMA 3H4IA 3TG5A 4I2ZA 5JJ6A 1E4OA 2G9UA 3NF1A 3CK9A 4KBQA 3G2HA 1BX3A 3C4VA 3AS8A 1GPYA 2GW1A 3FP3A 1Z6QA 3MA5A 1B4DA 4FKZA 4BT9A 4W6QA 1JIXA 4KQ1A 3L79A 3G2LA 4W9RA 2G9VA 5G04J 3G2KA 2FETA 4WNDA 3COPA 8GPBA 3BD7A 4LDPA 2QRHA 3ZCSA 2IYFA 4M7PA 4RIGA 3WC4A 4EKEA 5BNWA 3GZ2A 2X0FA 4G2VA 5A7DB 3T3GA 5M72A 1RRVA 1PSWA 2PL2A 3ZPJA 1L5WA 4AN4A 4AM9A 1GGNA 3CEJA 1QM5A 3G2IA 3WAGA 3UPVA 3QWVA 4BWRA 1QKJA 2HY7A 2VG8A 3S0JA 4MI9A 4U0ZA 4J8FA 2C2LA 1EM6A 3CK7A 4BQEA 3MS2A 1FTQA 2IYAA 1QZ2A 5BT1A 2BFWA 4BFCA 5TMDA 1C3JA 3D0RA 2FF4A 5A6CA 5HXAA 3SZ7A 1Y8ZA 1WV1A 2X0EA 3FFLA 4GA2A 2GEJA 1O6CA 3OT5A 2XA1A 3DDSA 4NRHB 3T3HA 3OTIA 4AMGA 3CEQA 5IKPA 4GZ6A 3ZCUA 2C0MA 2UY1A 5IKOA 3ZFWA 6GPBA 4B94A 5EX3A 2KS6A 4YUAA 4M60A 3VDMA 1M5RA 2BGUA 1NOKA 3S28A 3OY7A 3CV0A 3GW4A 4HOTA 2LSUA 4JA9A 3ZHEB 3ZN3A 2VCEA 3C4QA 2VGXB 3MRXA 3OTGA 4WNEA 5HQ8A 1P4GA 5DIZA 5CCLA 2GPAA 2QN7A 2FBNA 4L22A 2VSNA 4BQIA 2VQ2A 4UQYA 3TOVA 3Q5MA 1FU8A 3SYMA 4RIHA 2FEZA 3CK8A 2GJ4A 1XC7A 4YVQC 5BW8C 1WUYA 3ZGQA 2Y4UA 2P6PA 2PQRA 1P2BA 1ELWA 4FZRA 3RJVA 4HWGA 5FJYA 1ZU2A 1A17A 3ULQA 5LCWJ 4MI6A 3NC4A 2QFCA 2QZSA 3ZCRA 2UWJG 4EJ2A 1XNFA 3NPAA 2X0DA 4CTMA 3G2JA 4X7PA 3MEKA 1OUVA 4EKYA 3QWPA 4UQXA 3S7DA 1C50A 3Q3HA 3VUEA 3ESKA 3D0QA 3EDTB 4I9EA 3T3IA 1E1YA 1AHPA 1E96B 2QN8A 2MHKA 3UUXA 4I9CA 4GA1A 4H7YA 4EQFA 2GPNA 5G05J 2PRIA 2V5FA 3Q3IA 4UI9J 3ASGA 3LKUA 3ASHA 3Q49B 4CGWA 2C4MA 3T3DA 4N39A 3CEHA 4AIFA 4N5CA 3L7CA 4CDRA 4HOQA 4HOSA 5ARGA 5FZSA 3VTXA 1NZNA 4BQFA 3PE3A 1NZDA 3L7AA 2YJNA 4WACA 3CVPA 3TAXA 5KJLA 4CTNA 3BCRA 2PQNA 2DBAA 2KCLA 2XA9A 1PYGA 5D0OD 2C1XA 2BGTA 1IHGA 1Y8MA 1QQEA 2F3QA 2VGYA 5DXFA 2LNIA 4GYOA 3MT7A 2IV3A 3O48A 1AXRA 2QLMA 2GPBA 1UZUA 5LQDA 3T3EA 4WADA 5D01A 4GZ5A 2QRPA 2IF4A 4GCOA 4I17A 2PYIA 4WUYA 2KC7A 3LY7A 4JHRA 3MT8A 3URZA 2YQ8A 4RIIA 4AY5A 4GYWA 2I6HA 4ABNA 1WM5A 3OXFA 3UYLA 1J39A 3QOUA 3E4BA 3LY9A 2IEGA 5I45A 2UY1B 4GPKA 1UQUA 1JG7A 3GUHA 5EX0A 3OKCA 1P2DA 3ZCVA 2SKCA 3CVLA 2XA2A 3BCUA 3BD8A 2FF5A 1IIRA 5ARFA 2G9QA 2PRJA 5KJNA 2IEIA 1FU4A 3CVNA 3RKVA 1L5QA 3MV3B 1GPAA 1NOJA 4X6LA 3Q15A 3TGOA 1RZUA 4U0UA 1P29A 2ATIA 3MKRA 1NOIA 3L7DA 3LPZA 4WNGA 1P4JA 2XGSA 4N2SA 3Q47B 2XCBA 1WUTA 2QN2A 2YHCA 3U4TA 4MI3A 3MS7A 4NEQA 3NCHA 1WAO1 1GG8A 3MV2B 1F0KA 2HR2A 3CUUA 3G2NA 1NA0A 2XGOA 5D00A 1NLMA 4CTOA 3BEOA 2OOEA 4G26A 2R5SA 1XV5A 2J9QA 3VDNB 1FCHA 1L5RA 3CUYA 3NB0A 3S7FA 2R68A 4YVOA 4BT8A 2L6JA 3OXLA 4ME2A 3JYSA 4KXKB 4XI0A 2XCUA 4N3AA 4U07A 3DDWA 5FTPA 1ELRA 4JA7A 2R66A 3ZHEA 2Y4TA 2PYDA 1NZFA 1YGPA 2QNBA 3RU0A 4NQ0A 1SXQA 3D1JA 4A1SA 2SKDA 2GT1A 3LYAA 4U04A 1P4HA 4XI9A 1XL1A 3E3NA 4LEIA 4F97A 2XCCA 1XL0A 1FC0A 2QRGA 4AY6A 3AS4A 4UI9C 1IYGA 2IUYA 4QLBA 3R9AB 1HLFA 4MHOA 3RT1A 3S2UA 1PC2A 1FA9A 2AVPA 2NC9A 3QWWA 1JEJA 1LWOA 5TVGA 4Z5XA 3MTBA 2ASVA 1Z8DA 2X6RA 1HXIA 3BDAA
chains in the Genus database with same CATH superfamily
2CN1A 2DQKA 3O93A 3PG5A 2H7CA 3HXQA 1MNAA 3I32A 4PG5A 2HYDA 1GUAA 3BZBA 3ZHRA 1R5NA 1L5KA 3V4RA 1FW6A 2GGFA 2KBXA 1DRJA 3BB3A 5CEDB 1Z2PX 1XZPA 2E6UX 2KM4A 3GRCA 2WEKA 4MZXA 4HZIA 5F5XA 5JCJA 3W9YA 1I6LA 2ONKA 3G0DA 4DMKA 1CD5A 1LBTA 3DAYA 3FROA 1M10A 2EVWX 3E34A 1GCUA 3LZ6A 4TTQA 1POXA 2GD0A 3FUJA 1NW7A 2CFOA 1GILA 2BFCB 3EUEA 3MTDA 1PR9A 2IZ6A 4FCTA 4IIJF 3L6UA 1N8KA 4TV9A 4N2QA 1UFOA 1JE0A 1X13A 2XTNA 4DBLC 2IDMA 5MHTA 2YVAA 2Q3MA 2B6CA 3KD7A 4TLDA 4CV0A 2WJ4A 4MUJA 2BV3A 1RJFA 3CZ4A 4ZEVA 2B0JA 2O2DA 2HPVA 3QELA 1E5VA 1X74A 2AJLI 5IT4A 1E96A 1HE1C 1LQTA 2RFLA 1M1YB 1V25A 1XJ5A 2Y99A 3DAPA 3NTLA 4FQ8A 3VMMA 1F1BA 2COKA 3RS2A 4B3FX 2YIVX 1E9BA 1DFHA 3K5WA 3KC2A 4XUGB 2V1UA 1WNFA 2CMDA 4M1SA 1Z88A 2ANBA 4FNAA 4UM5A 4KIGA 4CMCA 1QE3A 3FMOB 5J59A 3VYRB 4ETWA 3F6QA 2R8XA 3DOFA 3PGMA 4FGZA 4FM9A 3L05A 4D82A 1ZMXA 4H4CA 1AN9A 4EMSA 1VPEA 4Q96A 4CDMA 2P9EA 4FE3A 3R74A 4ITRC 4OSOA 3VLDA 2Q28A 4DSUA 4GMJA 3ZV4A 2GXSA 1H2FA 1KETA 1NU8A 2CHEA 2FFAA 1GXSA 3E5MA 3ABOB 5HILA 5JZSA 2PKXA 2PGDA 2BMDA 2YVLA 4KJZA 3F3KA 4ZAZA 3WE7A 3DYBA 3IPLA 2I33A 1IPFA 1HEUA 3MYYA 2ZJ1A 3EQZA 2R7NA 4P3OA 1GFIA 3WSWA 1HXHA 2GESA 4U2DA 4KH1A 5I9BA 4X1OA 1E7UA 3M6FA 4BCCA 3K4HA 4RA6B 1EHYA 3BRQA 3FUNA 1HG1A 1R88A 2NAFA 2HBZA 2UZ1B 4P5DA 1KC1A 3IVAA 3VI3B 5EJ5A 2CK3A 1XK7A 3EHRA 3IXQA 3C3PA 3DBOB 2O7RA 2JIZD 1VRVA 3AUFA 5F1YA 2DU8A 2QMZA 4D0LB 3ZZNA 4EHJA 2H2DA 5C18A 4Z9AA 4UDXX 5F2KA 4ENWA 4DR2B 4R0NA 3QLVC 2X5HA 2MDTA 1K1EA 2XAAA 4FD3A 2CY0A 3CHMA 5BVGA 1G38A 5LCWC 1TAGA 1UMCA 3H2IA 1IH8A 4O1HA 1ISJA 3LRPA 2K87A 4CJXA 3AR2A 4JZYA 1MJHA 4ATNA 4GTRA 1II8A 1X86B 4OLJA 4G8LA 4TYWA 5ETJA 1B8OA 4PG8A 1U7WA 1ZHHA 5K6RA 3VZSA 4OQEA 1MFZA 1RW2A 3CSFA 1T5LA 2GDJA 3Q7AA 4HRLA 1NGSA 1VL0A 2H0AA 2YZKA 3WO0A 2QRZA 1UDBA 1X15A 1W2HA 2H5LA 4F53A 2HCFA 2W2LA 2GYYA 4F72A 2GWHA 1JDJA 1E2PA 3DAHA 1PQPA 4UHHA 3ZD6A 5CHEE 2BH9A 3IAFA 3OAAD 2J45A 3WB2A 1WF6A 2XB9A 2ZUVA 3OCUA 3EUVA 1JKFA 3D43A 3EDCA 3NAGA 3NTQA 5KQMA 4D98A 2GCOA 4J7XA 1G4HA 1KEKA 5I4CA 3IC5A 3FUDA 3VTZA 1S3SA 1ND6A 2DAPA 1OXSC 3D4PA 3IP8A 4UHJA 1UZNA 1IFXA 4XRGA 3FPJA 3UO8B 1FYEA 2Q7DA 4YLEA 1QVAA 2J0UA 1W4AA 4FE4A 3AV0B 4GZDA 1YQDA 2I2AA 5DTIA 5AW7A 3I6IA 5SYNA 1LK5A 1TVEA 4KUGA 2F8SA 2WIBA 3RIBA 2H06A 2C2BA 4U0JA 2R4UA 2CVOA 2XE8A 1DIHA 3L1JA 1A9RA 4M9XA 5A4FS 1AKQA 4MEAA 2PUFA 2XMCA 2FQQA 2W00A 2H2FA 1I01A 4N7BA 3LIPA 3KAEA 4GDMA 5C1DA 3DFKA 3MBOA 3BRWA 5EZSA 5KNBD 1A5BB 1JQEA 4UU8A 2Z04A 3GDFA 2PH3A 1HLGA 2DC1A 2JZCA 3RBAA 2HSZA 3TLGA 2FEMA 4FP7A 3TSCA 1P1KA 4R68A 1YE8A 4D0GA 5DZSA 5H4HA 5DK4A 5BR8B 2QRNA 2Z9BA 4FP9A 4KR0A 4IDFA 2WU0A 2N1BA 2VZ0A 4XDZA 2AWNA 3ZY3A 1QVZA 5F77A 1XYYA 4BPRA 5BPFA 3PX2A 4DVGA 1VOTA 2ZREA 3NWBA 4G0WA 3D8UA 5MN6A 3BWVA 3N6RA 4TRMA 3D7LA 5CW2A 3WIBA 5CFZA 2XEVA 3C3QA 1R9NA 1URPA 2OQRA 5LDHA 2LCIA 1XZAA 4FILA 4RE6A 5AVZA 2ODPA 3F47A 4HRYA 3HPRA 4O4LA 3ZCTA 1UPAA 2V8OA 3OE1A 2NUPB 2ZI3A 4E09A 1NHGA 4GYKA 4E4YA 4B74A 2UYHA 2ZB7A 2WKWA 1W35A 4P82A 3VZBA 3DZGA 3J7TA 2Q2WA 3X2FA 1BYUA 3PUJA 3DTNA 3BH7A 2PBRA 4PLFA 2NUBA 4JLKA 3IO3A 5EXXA 3V2XA 5IARA 5ULLA 2EBFX 4RFSA 3ZBUA 4D3DA 4C88A 3GLVA 4EKIA 1G16A 2W5UA 3PDCA 1K6IA 3I28A 4C7JA 1A9XB 1KGDA 2IYXA 3NM4A 4EBAA 2BRUA 4UATA 1SAYA 1II8B 4PRZA 3RG8A 5CEEA 5B1AE 1ARZA 3PNPA 2B92A 3JZIA 1WV0A 2X86A 2BP7B 3H84A 1H6OA 2IYPA 4E94A 1DAEA 4GQBA 1E9VA 1GZSA 4CGVA 3I5MA 1WBDA 3EXIB 3G0CA 4B47A 1E8DA 1CNMA 1H6BA 2D5CA 4GW3A 1VMIA 3L6DA 3AI2A 2BPOA 4GP6A 1VA4A 2NO1A 2JIZA 2OCDA 3P9CA 1Y6JA 2FSGA 3UZUA 4AYTA 3Q6IA 3A0UA 1P9RA 4FS3A 5A7HA 5CM8B 4HEQA 4IHKA 1EUDB 4C4XA 3ME5A 2HB6A 1VSBA 2GNPA 4X6YA 1B4DA 1S3FA 4IJWA 4Y9UA 5BUQA 3DBHB 4DLRA 4BT9A 3USCS 3AY3A 4YJ2F 2QL5A 2YY6A 2Y92A 5IAOA 3RRNA 2NTJA 4OVKA 4U7EB 2J5QA 2HRZA 3RVDA 5HDBB 2DHRA 2YV5A 4MW4A 3QNKA 4HUQB 4F1SA 3JUEA 4ZHQF 1QIKA 4KW7A 5DYTA 1Z8HA 2FETA 5KCZA 3CLKA 1TNZA 3QEOA 4FEEA 4F38A 2R6R1 5EKSA 2L19A 2PUTA 4TSRA 5EINA 3IQDB 2RGGA 1CZRA 1ZD8A 2AJDA 3IMKA 4QX6A 4C43A 2C7QA 4DV1B 2H85A 2ZPTX 4TVOA 4Z9FA 4AN4A 3AXTA 4EGCB 2ISSD 2ONYA 3L9XA 3V4FA 1OAKA 5FTNA 3P9SA 4KO3S 5F7ZA 5EIEA 4MVJH 4QGAA 4PG4A 3K0FA 4ZKEA 3UF0A 4CM9A 3WNCA 1KYYA 4CDGA 3C87A 3C16C 3MOSA 5FBLB 2C2LA 3G2VA 3KWMA 2OV8A 4CBVA 3G82C 4ITVA 1EHIA 2VUTA 3F3YA 1H2WA 3DDOA 1A4RA 3N2GB 2R9VA 1X1AA 4N49A 4NQZA 2OGTA 1EWYA 2IYAA 2FEPA 3WVNA 1KS9A 4ACAA 2ZI5A 4GNKA 3AP2A 3KUXA 3M2TA 3P52A 3DMNA 3BQNB 3FWZA 2I67A 3VO2A 2J4FA 4XIJA 1UFRA 3ZOKA 3DAOA 1KO4A 2KW5A 1B6SA 2ETXA 3Q11A 4UQOA 2Z5FA 3IA2A 5CM9C 5AFSA 1TQ6A 2B36A 3D2BA 3G9ZA 2ZZMA 5F21A 2ZTMA 2C4WA 3VM6A 2RD2A 2HNAA 2PKQO 4MTCA 3TSOA 1F60A 1R5BA 2OHGA 5LXTF 4YRTA 1OA1A 4GKAA 2ZLBA 3TH5A 1Z16A 5K8UA 3QLUC 3UTMA 4UWLA 2Q5FA 1J2RA 1JL3A 3NMUF 1US8B 3ICOA 4FZ5A 4BNDB 1N95A 4AWXA 3C7AA 4LVOA 5H68A 1E79A 1JI3A 3B7SA 2ZSUA 3I9FA 1ADCA 4RH1A 2CE2X 4FTWA 4BNWA 2Q4EA 1Z7EA 4L5AA 4N5LA 1IG0A 1X2EA 3JWEA 1A2OA 4CKEB 4B75A 4ZI2A 4X6XA 2A7XA 3MHTA 4F11A 1LS1A 4D5EA 1C81A 1Q95A 3BTVA 2FSVA 4Q18A 3QWAA 3ETJA 4I9NA 5TGDA 1XWWA 4F5WA 2EATA 1ZIOA 3CNOA 1JV2B 3TR6A 4BY9E 3KQYA 3U3XA 1C29B 3THYB 4QXRA 3SYKA 1C7ZA 4HNSA 5HQ3A 3PR1A 2H11A 1OZGA 4HYYA 4O0LA 3Q5MA 1I0ZA 4EFNA 1OAAA 3GA5A 3DDZX 2OQIA 3GJ4A 4LXXA 2YHAA 4U2BA 2V9CA 1HT2E 2EKQA 1Z18A 3HJUA 1Z6ZA 1UK7A 3PD7A 4K1XA 4QRDA 2J3QA 2C3UA 4ZRNA 2VDNB 1RYYA 1FQJA 1JSCA 4S1OA 5T8KA 2EKPA 1KQ3A 3NHKA 5KVAA 2ZS9A 5A02A 2QTGA 3PHCA 1Q11A 1V26A 3SF8B 5LN1A 4B3SB 4G2NA 4M89A 4NDAA 4KPGA 4PLTA 4BV2A 4RKYA 2VYCA 2VJOA 3AG5A 3ZN2A 1XPUA 3BULA 1UOPA 2DGDA 4N5QA 2ZPUA 3DYVA 4YJGB 4DCSA 2JLWA 3GOHA 3I42A 3PWZA 2GRPB 3EIQC 3QFSA 1CEEA 1OMOA 1SU4A 2R8EA 4QARA 2Q6OA 3MEKA 3NWEA 1P1CA 2IYZA 5L3RA 1WCXA 5ALVA 1OUVA 1EX6A 2C5AA 2ECKA 3NAWA 5D6OA 1VSUA 4UQXA 4RANA 3ZVMA 4BXOA 4EA8A 5TSDA 5JVDF 1PLKA 1FUUA 3JQ1A 3DBIA 3D0QA 4LI3X 1JFLA 4OMDA 2V5UA 3LK7A 4OIFA 1NC3A 1Y6QA 2PR7A 4WOPA 3L1HA 1JLLB 1TLFA 1H2VC 2ILRA 1C4XA 1SCBA 1M8JA 3IUJA 3RYHA 4DX6D 1YZFA 2D1TA 1M6NA 4CI0B 3FHEA 2PDAA 4RZIA 3WK8A 1ACJA 3K5PA 4X8QA 2XCTB 1T9GR 3UMMA 1WPGA 2NPIA 2OB1A 3DC2A 4V03A 4BU0A 3ASGA 3JATA 5CP8A 4ZANA 3CN7A 3PC8C 2Q49A 3TNFA 2Y1DA 3KUCA 4OYRA 2J49A 2A9VA 3A1DA 3ZXYA 1OILA 2F1IA 5KO2A 4YRMA 2FO1E 3JVUA 4PONA 5GONA 1YJ8A 1S8FA 1T25A 2EP7A 4UM7A 2J4CA 3ZEFA 2DFTA 4WACA 3PF8A 3M6WA 3ND6A 1Q0UA 3I62A 2II6A 3LGAA 3BUAA 4QGHA 3AEUA 4FFOA 4TWRA 3JTMA 1L7DA 4QIHA 4DABA 4HLUC 2XCSB 1Q3KA 3ST7A 3P4UA 2M2IA 1T26A 2QLMA 1MX6A 3AP1A 3HZHA 3OLQA 3ZEAA 5LQDA 3T1YB 2HO5A 2JA2A 4JWTA 4NDZA 2QN6A 2HR1A 4BZXA 3FGZA 3MAJA 2EKZA 1AKWA 1N2OA 1FEZA 5AKKA 4AY5A 4YYZA 1U90A 4BEJA 5H8WA 3EX7C 4KHZA 1KPSB 1AG9A 3WWOA 2CMGA 5CU7A 1L1FA 3DGEC 4E33A 4GLOA 4F92B 2P3QA 3GP8A 1JDSA 4IULA 1L3IA 3H1FA 2AFVA 5DWDA 5I45A 1U7OA 2H63A 3IAS6 2PH5A 2F43B 3RJ5A 2X8BA 4KRYA 5JRDS 3IDSA 4A6PA 1GNSA 1TYAE 5JAQA 2GZAA 1VRWA 3KB1A 2HTFA 1OLOA 4UZSA 3HDYA 4C0JA 4NCBA 3HRAA 4IRXA 4HJRA 3PEEA 4URWR 2AXEA 2ZRKA 3DV9A 2J0EA 1WPXA 3TL2A 2J09A 4RD1A 1GV1A 4OK5A 5COAA 2C77A 3FN4A 3K72B 2WR8A 3RKVA 4YWHA 3MV3B 5JY6A 1R0RE 1GPAA 3NFYA 3QKIA 1GAQA 2IX9A 3VFDA 2QVBA 3FYUA 4BNXA 3GLHA 2ATIA 4Y1GA 4BV9A 4PGFA 1H2EA 3MKRA 2NT4A 1UEJA 2NNLD 4L4UA 4XWWA 3QLUA 3IPRA 1DZ3A 2XGSA 4HDMB 2XR1A 3HP7A 4YJFB 3MFYA 2PLNA 4E14A 4N4AA 3ONVA 3HVUA 3PUWA 2GD6A 4G67A 4LYDA 2J6BA 4GOXA 4PAOA 4CMJA 5LL6P 3G0OA 4B33A 5FUQA 2Q0HA 4XPIA 4JC0A 4LJ7A 1I4LD 1QAOA 1F0KA 4J3FA 4CKYA 4KQWA 3E48A 2NTVA 3ZU2A 1T0UA 3PCXA 1DX6A 4BUCA 4WBNA 2P5YA 1DC7A 2W0SA 3I8SA 4M7WA 5FLEX 1PT9A 2FN3A 1BDMA 3NDIA 4G86A 2FSVC 1DPFA 4GI7A 2V55B 4HV4A 3ADDA 1TUEA 2FGJA 3K7EA 1CIJA 4RJLA 2D1RA 3K6SB 4C04A 2M1ZA 2PCLA 2DZOA 5EMNA 1EVYA 1OB5A 1RYBA 4MAMA 4X3CA 1J0DA 1GVHA 1WW8A 3IEPA 2VJBA 3OIFA 1FUYB 4PQEA 4EP1A 3N39C 3OXLA 2BFEA 4F2WA 5FCDA 2XCUA 3UT8A 1E8MA 1E1RD 3FAKA 4FONA 4H6XA 4W99A 3UK0A 4JA7A 1N3YA 4MGKR 4WCFC 1BW9B 3ZDFA 3CLVA 3HXDA 1KDYA 4COKA 4F5ZA 5EIAA 5JS1A 1T5TA 3PA8A 2E0IA 2Q9UA 2QTNA 2WPDA 1ZRNA 4QUIA 5B3LA 1XEWY 4MRNA 4NZNA 4V0ME 3JASB 3U26A 4FOSA 1YB7A 2G1AA 2ZR9A 5T8KC 2B1QA 4WK4B 4F21A 4ZYZA 4MRUA 3HVRA 1X19A 2DT5A 5ADVA 4JLDA 4YRBA 1PVDA 2YWXA 3T5DA 3H3JA 5KVQA 2D3WA 4Q03A 3BSSA 1ZRSA 4YJHB 3T9AA 1ECCA 3W34A 3MTBA 2F2TA 4M98A 1KEZA 2X6RA 4N18A 4QTZA 5EVJA 4BAGA 3UM2A 2FSFA 5C7YA 3H1AA 2C7OA 4EA7A 2GPYA 4NU0A 4GTQA 3SIRA 2D1SA 1H0RA 5LQNA 3A9VA 2VP0A 2WSBA 2BHTA 1FPQA 4MQ5A 3U3ZA 4CMAA 4E30A 1GAEO 2GZSA 2Y4OA 3LJNA 1L7OA 1SOWA 3DP9A 5TMBA 4G8KA 5F9MA 1HH8A 4TV9F 3B9QA 3CINA 4NBLA 1GFZA 4ZT2A 2V6JA 2AN1A 4H3VA 4H7HA 2ZT6A 1N52A 1EJ0A 4YI5A 2QK4A 4ZVKA 3ZDRA 3BD6A 1UM9A 3HK2A 5CXSA 1CC1S 3FG9A 5CVTA 2CFUA 3PPXA 3WXBA 3HXEA 5B1HA 2R7AA 3A6PC 3ZGZA 2FOIA 2DR3A 2AZDA 1JFFA 3GEHA 3GZNB 4M8KA 1ECLA 2XKJE 4NCXA 4RS3A 4Z0TA 2L0TB 3PXUA 3EXG2 2JGKA 3ILSA 1OYWA 1Q3TA 3LUBA 3BKXA 5JNWA 1NY5A 4W8HA 5FPQA 3KAQA 1V55E 2ZWVA 5AI9A 4ECEA 1J42A 2XTZA 1J8FA 3D9IA 1EQ2A 5CEJA 1E90A 1I6KA 2Q5OA 2X9VA 3HUTA 1KGSA 4QLAA 5FKJA 4BEWA 1EDUA 5HA5A 5LOVB 2WAAA 5G0UA 1XTZA 4B48A 5DTQA 1CHDA 1NQOA 1HFWA 1F3LA 5DIFA 1SKYE 4F5YA 1P2GA 1T5BA 4A36A 1W6RA 1WQ1R 4C0BA 4XH9B 2HQOA 3IEXA 3T5XA 3B12A 3P2YA 4UNSA 2DPHA 3D1VA 5CM2Z 4EG7A 1PEAA 1WTCA 4XTRA 2G0TA 5IUJC 4Z4CA 3QYAA 4L5JA 4OTZA 2OXEA 3SO8A 3HKBB 3P94A 4FCCA 3GNQA 5DYNA 5G3ZA 4E2YA 1MCZA 4EG4A 1E2HA 1Z2CA 1E62A 3M33A 4F9GA 2VF8A 3PTLA 1XTUA 2PS1A 4IVNA 2QX7A 3CZ5A 1NAIA 3S2EA 3SDZA 4YMUA 5KKCA 4KWTA 4H35A 1HS6A 4KX5A 3RYFB 2A7QA 5AMXA 2GXAA 1KQGA 1V4VA 3D2AA 1WA5A 3TTWA 2HMYB 1PV1A 4XRRA 5C2JB 3QAQA 5ENTD 5IT5A 3RHFA 4Q4CA 2HU5A 3F74A 4IEFB 1IZYA 1Z5UA 1NC1A 4IBOA 3N59A 3I2IA 4LKOA 4B80A 4BKPA 5LU9A 3WKCA 3VISA 1X7DA 1G0NA 2BMFA 3E32A 2EDCA 5K8CA 1V3VA 2B9VA 4NKRA 3RC1A 3RFUA 4BQQA 1HRDA 1I7SB 2QTVB 2FXVA 3BZUA 3FYSA 3I4LA 3IULA 4S1VA 5TQ2A 3WOVA 4MDYA 5DI9A 1EX1A 2OILA 2Y1KA 3H86A 3QGMA 5CD1A 5TQJA 1IG3A 1BFKA 1N32B 1PJ2A 1IXSB 1DC8A 1KMHB 1TD9A 1A8UA 3LUFA 4X7RA 2IXBA 4L72A 3SX4A 3RRYA 3D7KA 2GNAA 4K9KA 1K6XA 1OXMA 1TM5E 3DXYA 4PSAA 5BYAA 2WZCA 4Z7OB 3U60B 1YA0A 4I9UA 2PT6A 3HWWA 4QELA 3W7BA 3WK5A 3E3LA 1CXZA 3DRAA 1KI8A 3TU3B 3IMGA 4XFKA 5CTAA 5B4TA 3QV1A 3TX6A 4UE3S 1G2OA 1TCUA 1ZBQA 2MSKA 3OXGA 4UEKA 2XNKA 4WXEA 3TNJA 3NTVA 5DGHA 3ENVA 3OE7D 3K6JA 3SS7X 4REQB 3VH4A 4D0SA 1WSBA 3KSRA 2YJ3A 3Q3VA 2QMHA 4LVNA 2HT1A 5IAGA 5DM1A 1AGYA 1QQTA 2WM9B 5DI3A 5HX7A 1KRXA 1JTEA 3UI2A 2H2GA 4MV9A 3BXHA 1E1QD 3B2QA 3OZGA 2EQAA 2G04A 3M3DA 5FORA 1DCKA 5DBIA 4RTMA 1XEXB 5TJHA 1B15A 4DLWA 3U4QA 2KXPC 1E7WA 3UJPA 1C8KA 1BD3A 4C7OB 1RWWA 4NU6A 3PZDA 4JNKA 4HSGA 1IMJA 4WCFA 2FQ1A 3MBIA 4BKMA 4F06A 4JUAA 3GH1A 3G0BA 4LZWA 4FULA 1H65A 4JBWA 4BBJA 3JALA 4LECA 4PSVA 1KOFA 2BFAA 3AM4A 3PR3A 1LJUA 3LXUX 4RJIA 4UBJA 1KERA 2CXUA 3SR4A 4OQLA 2HK8A 1OH7A 1PNVA 4A6XA 4WNFA 4S04A 3JQRA 3OQIA 5U4QA 3T4EA 1MZCA 2WF7A 1N75A 4DCJA 2X23A 3HKCA 3OX1A 4LPKA 5BMOA 1RWQA 4ATZD 1FNBA 3C5RA 1T5OA 1VECA 4FXPA 5IWCA 4YDQA 1P2SA 2F0YA 3RIEA 3L16A 4B6GA 4IIDA 3SK1A 1SHZA 4NAHA 4AZWA 5CCMA 1V96A 1ZGHA 4B93B 1ZVMA 3HEAA 5JCZA 1F06A 3F9IA 1Q6ZA 2GR9A 3V4SA 1KSFX 1WUKS 2UXDB 3H5WA 1I1NA 3HBJA 1BE8A 1XU9A 3ZW3A 4JROA 1NA5A 2Q1YA 3C3KA 5AQAA 2OVFA 1E4VA 1KJWA 1NJGA 4APOA 1E7RA 2IHJA 2ZSDA 4MP8A 3ZHSA 2P6OA 2D2EA 4EYSA 4F45A 5EA2A 4RELA 2B83A 3KQUA 1CQIA 3K8QA 4Y6CA 5FJJA 4B73A 4N3NA 4CXMA 1NSFA 1H8EA 1R27A 3WWZA 1U8TA 3QQPA 4PZAA 4D0NA 3R9WA 4C7VA 1CVRA 3NHZA 1M7HA 1KZ1A 4PW0A 1U9ZA 3Q3CA 4QDOA 1B89A 4GD3Q 4DE5A 1Y3DE 1E8OA 2W2KB 4M76B 1U0NA 1PX2A 2IPNA 2Q29A 3FWYA 3UA3A 4UQLA 5GMOA 3ZE2B 5KSPA 2JFZA 3W6PA 4D46A 5AQ1A 5HUQA 2WHPB 4Y2VA 2X5XA 4EL0A 1F9AA 1ETHA 2DPLA 3UJNA 2Q8PA 2O9JA 3CT6A 4ZVPA 1DCEA 5FBQB 5J2UF 1O8BA 2WM2A 4ENSA 2IEAA 1JEOA 2ZBEA 2HLDD 2V6IA 5BQ3A 1SXJE 1ND5A 2J7KA 3PA6A 3OJWA 4PXSA 3NF1A 1ONNA 3JQ6A 1C7IA 2WIJA 1LSUA 2OD9A 4NJEA 1HFKA 2Y77A 3GFSA 3IHTA 5FYQA 4NNPA 3I2GA 2FOXA 4YMSA 4C07A 1Z6QA 3KQTA 3HXOA 1N2CB 2XXJA 1HDCA 4MWGA 4BWFB 3G2PA 4RPLA 4E7PA 2FW6A 3OSUA 4WZBE 1GQFA 4H7KA 3TD2A 2IDJA 3BL5A 2D5AA 5TT1A 3V2OA 3B1FA 1RE1A 2G9VA 4MVJG 4P38A 4WLUA 4BJ3A 1JMYA 4U39A 3K2QA 3G2KA 4B3HA 4YJ2A 3B13B 3H11B 5C8YF 1E3QA 2XDYA 1EFPB 5BR4A 1T8TA 2WUDA 2WF5A 5CCEA 3ZCSA 3B1YA 1T3SA 4NU8X 2J5RA 3RTCA 4O60A 3FNBA 1IB6A 4XPZA 3JR7A 5JH7A 3MGBA 3ACBA 4WFQA 2YL2A 5EYPA 3O5AA 4AS3A 2UZAA 4DSZA 1PVVA 2WRZA 5DNCA 2QMOA 4F8EA 4HX9A 1KEPA 1KK2A 2P9CA 4S1NA 3CLRC 5EDSA 4J9VA 4U0KA 3B7UX 4GSKA 4TV9B 1DVPA 2VPIA 3KQQA 3Q6NA 5CMYA 4MAFA 4PYLA 2NGRA 3C3XA 3CT4A 2VG8A 1T2DA 3MSXA 4HDKB 4IVQA 2AFIB 4MKXA 3VTKA 1TJNA 5IC5A 2EYQA 1TZCA 1H23A 5GTDA 3FFBA 4EAAA 3APDA 3FFWA 4AZ3A 3DMRA 2ZTLA 4JZKA 1LGYA 4WXHA 1BKSB 5DCWA 3C8DA 1H22A 4MVJA 5JCOC 1TAQA 3QXXA 4ACKA 1U6KA 2P11A 1DHRA 2WYHA 4N0QA 4IVPA 3FVVA 3D7MA 3PGVA 721PA 3G2TA 5EZQA 4LBVA 3ELYA 1W7AA 1O96B 5HKOA 1Z4NA 5E0KB 4QC2A 4XSGA 4G9GA 4CMEA 1QMGA 2GQ0A 1XPRA 4H3KB 1HE8B 5IULC 2CXOA 1FTSA 5K7SA 2Y66A 3KXPA 3RUCA 3VR6H 1XUOA 2XUDA 3IERA 2VXCA 4CM3A 1GOTA 3NNNA 1C2TA 1C3VA 3P2BA 1IY9A 1NR5A 1WMEA 1SZDA 1YR8A 2BVNA 2WMYA 3GGPA 1L7EA 1R4ZA 3S1AA 1QIHA 3H1BA 1QYDA 3HWRA 2O8CB 2YCLA 4Q9NA 1DWPA 4UTZA 3FR7A 3HNRA 3IDAA 4E46A 2NZ8A 2XNSA 3SR3A 3FSJX 2P6UA 1JNZB 2PX0A 3BH0A 5GM1A 4CL8A 3R3VA 1E2JA 3O95A 3BMXA 4RM3A 1N4QA 1AZSC 4BO6A 2QX4A 1JNYA 3VNVA 4GOOD 2QUHA 2Z0MA 1IY0A 2IHBA 4O2AA 4P35A 3PD0A 4I3HA 1UF9A 1J0AA 2ONJA 1P0IA 4D25A 1KZ9A 2G4VA 1IXKA 4AWAA 2FG5A 3ZN3A 1CUFA 3U3JA 1MPTA 3MCUA 2HLNA 2ABWA 1NRIA 4W4TA 2FLWA 5LYYA 1Z4JA 2VRCA 5HF6A 4D3YA 1P4GA 4CPDA 5BNZA 4FC8A 4EITA 2GPAA 4MNTA 2FFHA 4NCAA 1I3LA 1ADYA 1WNTA 4Q21A 1UWKA 3SC3A 1UQRA 4TLAA 5B5SA 3RS8A 1GRVA 1RP1A 4X71A 4QOSA 4BLRA 3I2FA 2DG2A 3T94A 1WTAA 3OU6A 3O31A 5JO9A 5I9NA 1NL4A 1NSTA 1DQNA 2DLNA 5L3VA 1R6AA 2XNJA 4OYYA 1RLIA 4LERA 3HJRA 3IKMB 3O75A 1ZK0A 2HM8A 1FDTA 4GS5A 4IQ8A 3WLSA 5KSOA 3HCNA 4JVNA 4MWEA 5LJIA 2UVPA 5IZCA 4BSXA 4OUDA 5BOSA 5JZOA 4FDUA 4UQPA 2QTAA 4PZEA 4YMVA 2CLMB 5CA0A 1R6VA 3ROFA 5HF5A 3CHOA 4BERA 2P4EA 2QZSA 4HN4B 3CLRD 1E2IA 1VSQA 4Q16A 3PEFA 2YBEA 3WYGA 3V46A 2ZIAA 3G2JA 1QFZA 4KG7A 4MWBA 1WLSA 2OEWA 5DTEA 5HOQA 5LMUB 1YZGA 3V6MA 4CR7A 3QWPA 1IYZA 5ESRA 3FEYA 1PEYA 3P5BA 4R2KA 5H70A 4JEHA 4BVGA 2FSHA 3H1TA 2WU8A 3GLKA 3HN7A 5EZYA 4ZDKA 2JBAA 2ZG6A 1JG2A 5K05A 2AEFA 4UTVA 5KYNA 3ZLJA 5BNFA 3AGPA 2D2FA 3FPGA 4B2LA 4DRZA 1K5PA 1KAEA 1XCLA 2QN8A 1UZLA 2QZPA 1JHQA 4L73A 4QU9A 4FHFA 3WNZA 4B83A 4YMLA 1PK7A 4ZPXA 3RDPA 2DB3A 1RQGA 2NYVA 4P2GA 1WUIS 4LYHA 3IQIX 1HT1E 4E5SA 3UK2A 4Q1BA 1NI5A 2EBUA 2C2GA 2YUIA 3ZY5A 3CW9A 3SSNA 3E7XA 3SHFA 3FTNA 4K9PA 4AEZC 1NVTA 521PA 3X1YA 3RYFA 3RSSA 2AR0A 5C46F 2HHJA 1U1GA 3AEQA 3S2SA 1SCNE 3NIBA 1UDRA 2BGNA 3PE3A 3F90A 2G7ZA 3PQCA 1PZHA 2JAHA 3QKRB 3P0IA 4M99A 1F2DA 4OL0A 1JCQA 4OQZA 4ACBA 1Z0JA 3F4LA 1ZR4A 4C7MA 4HDNA 4MCJA 1CDOA 1MVOA 4PY2A 1TCVA 5IABA 4LUNU 2V7QA 4F1PA 1PFQA 2G09A 2DLDA 4UPEA 5JD4A 3GJRA 3SHVA 3GAFA 1O5TA 1LB1B 1P2TA 3KT3A 3V8RA 1KF0A 1DBWA 3GPCA 3M6VA 2NTNA 5K8TA 4V24A 4NHEA 4X84A 1TF2A 2PYIA 2NPOA 2JG3A 2BL4A 1K8ZB 3UJ3X 2BCEA 4GYWA 5I8ZA 2E82A 5BOVA 1IY1A 5KNGA 3A25A 4WSOA 5DWVA 1Q3HA 5CMLA 5C2YA 5M3BA 2L42A 1B74A 2OBBA 4KGXA 5AN8A 5ILOA 4YR9A 1XEXA 3HE3A 2OK7A 4LOAA 2B1GA 1YRBA 4ASUA 1LQ2A 3EN0A 2H7XA 2AMJA 3GH3A 2QZ4A 3IE1A 1RJDA 1V5GA 4KGZA 4QGFA 3P0FA 4R9SA 1MO5A 2LGJA 5IKXA 4Q3LA 4DLYA 3SBEA 3BUSA 2P9IG 4RF4A 1H4QA 5DK6A 4R69A 2GAOA 3PSHA 1UXOA 1ELKA 4FDVA 4BFXA 4AMZA 3ELUA 2I2DA 1UPCA 3BL8A 3M70A 1RKQA 4AUEA 3TDNA 3D3QA 1R6TA 1ECPA 3V3LA 4P53A 2ZE8A 3OAAA 2GASA 4BYGA 3B1ZA 1HL7A 3AU4A 2C92A 3ABME 2BW0A 1EUCA 3R6DA 4FMDB 3HFGA 3I64A 4TWBA 3T5VA 4ZKDA 3N8DA 4Q02A 2YHCA 3GGJA 4HGNA 2O0JA 4YRPA 3SNHA 4BBZA 1FXWF 2H3HA 2OCCE 4D6XA 1OAOC 4JWKA 3CUUA 2FX2A 3UCFA 3VDQA 3LNCA 1HDGO 5KOHA 4MYCA 4KRXA 3TJPA 2YMLA 3ZYCA 2B30A 3X1DA 4ZI3A 4GTOA 3OUUA 1VDMA 3A9UA 3WMGA 2AN9A 3KB2A 1CUDA 3TRHA 3PNSA 4D9NA 2N9UA 1IZ8A 1FCHA 1Q84A 3ZDEA 2E37A 1JQJC 2ES4A 1LU9A 4B9AA 4O2LA 2RIRA 2VOJA 1ZN9A 3K3PA 4BX2A 3OE7A 3PQ7A 4IUCS 4KQKA 5A9TA 1NBME 3KKPA 4QHSA 3WFJA 3RKSA 3RROA 3AR9A 1SWWA 2JJQA 3AVQA 2Z6AA 2I80A 5EGSA 2V0NA 4HVAA 5DHFA 3QKRA 3GVHA 1WHSB 3K0BA 4GOJA 4MQ6A 1SKAA 4Q37A 4RV9A 2R751 3D2LA 3P4YA 4M8LA 2EGHA 1NXWA 3G8AA 1CW2B 4ZCMA 3D6MA 5G55A 1AB5A 4LF4B 2SKDA 5KYYB 1RHJA 2JW5A 3PHGA 1C1XB 3LZDA 4OLFA 1SHUX 1XU7A 2QG4A 3LGXA 3ORRA 4Q1EA 4LEIA 1P5HA 4HGPA 4O1MA 4CNBA 1J09A 4U95D 1JIJA 1M8PA 1ZH6A 4LBYA 5LZ4A 4GKJB 3BXXA 3HO1A 4JFRA 2PGNA 3KR0A 3MOIA 3F46A 2J3JA 4J76A 2CFZA 2NC9A 1PRYA 3B48A 3SBXA 1K7EB 1W2WB 2ALJA 4UTXA 5SYAA 1UKYA 3IXEA 1SBHA 2GXUA 3MUFA 4DX1A 3EUAA 3KKZA 2F7SA 4L78A 2WW8A 2QY7A 4Y6WA 1O5IA 1S96A 2ODEA 4Q94A 1HYGA 1L7XA 3EXHB 3KPWA 3PSAA 2F9LA 4KFCA 4D9CA 3CHYA 3GI1A 2F3PA 5TGZA 1DRWA 2C3PA 3M0EA 3THWB 5HI7A 1TK2A 2XQ0A 4QFCA 3H0CA 4QYMA 4RVGA 4OOEA 4BNNA 2VBCA 3M3PA 1O1YA 4R1MA 4F96A 1X39A 2C7BA 2H1HA 3RS4A 5HFNA 2VF2A 3UKJA 3IOBA 1VSVA 1YSCA 3CEMA 4HEHA 4YDSA 4DNFA 4DZZA 4BFZA 5B64A 5EP3A 1E2BA 3ACDA 3A14A 3N2EA 3A36A 4TLEA 4IIBA 3B13A 1E89A 3UC9A 4Q9HA 1F14A 2AW3A 1XYGA 2EDAA 1PGPA 1H6DA 3NB2A 1DCTA 1UWCA 1P61B 3MSCA 4OHMA 3FUIA 1WXQA 1IMOA 1OLUB 3HGTA 4N8SA 3UWPA 5DB4A 2JFGA 4AURA 5C31A 3K2BA 5EYPB 2LWIA 3ET5A 5A4MS 4UVHA 5F3DA 3JRWA 2RGRA 5YASA 4PFQA 4G81A 1I7PA 3N2KA 3PFFA 4KI0A 1JIQA 2WKRA 4NH0A 1YJCA 4MDHA 1T4CA 3FYHA 1ZNWA 3CHPA 4RD3A 3RO2A 5DBEX 3TBFA 2R60A 2J3KA 1GGHA 2JNWA 4GOKA 5G05C 2J6HA 4IMRA 3ID6C 3CKBA 2F9FA 3S1AB 2ZEJA 5C52B 2YNMD 1EDZA 3OLVA 2QSJA 2J87A 2RG7A 1U94A 3BGVA 1LZKA 3ENQA 3H7AA 4LSZA 3M9WA 2NNWB 4P93A 2J3IA 1Z37A 1DTEA 1ACLA 2JFQA 4TXHA 3JARB 4N3BA 3TW4A 4XKCA 5J23A 3IODA 3S8EA 2A78A 2DECA 5KAPA 3HABA 3CNNA 2GCGA 1WIWA 4HQRA 5G4KA 6REQB 4JKOA 4YTEA 2BH2A 2VSFA 1ILWA 3MBKA 3OJOA 1KMMA 2BKLA 3ONDA 4U2FA 3RPEA 5F3WB 4WIAA 3GW8A 1X7XA 5ALOA 1WHSA 3PJEA 3FPKA 1VG8A 1H9AA 5JMND 2JFFA 4KBYA 4XE5A 1YVUA 3MWDA 2HF8A 1Y1KE 1XVIA 4DTIA 1FTYA 2ZT5A 4KLNA 4XWGA 2JLVA 1TZJA 3FF4A 5E6UB 3ASDA 5LXTA 4TZTA 3I9MA 2B94A 1VHLA 2L0IA 5EXTA 4FQ7A 4J2HA 5FZQA 3A05A 5ES4B 3AVTA 2LZ0A 4A6DA 1OSNA 1YHZA 3O4GA 1RXSA 3TZEA 3H2KA 3WRYC 1WMFA 3UW3A 3VNRA 4H4EA 3TKLA 2YX1A 3RU9A 2ZJ7A 2PK3A 3IAAA 2WG1A 3B1WA 1IHPA 3OQ1A 3FTXA 3QX8A 4NBNA 5DH9A 4KEAA 3IAEA 4RJKA 1EKXA 1JGTA 1KT0A 1UIRA 3C8MA 3NPMA 3E7FA 5BSWA 4F04A 2HSDA 1UXGA 2XQVA 1Z3YA 3QHPA 1SN7A 4K87A 3VXKA 4C21A 4Q1DA 2AV6A 1TYBE 4DYHA 1WL8A 5I9LA 3DM9B 3KAKA 4QM6A 3U56A 1M67A 3WG7E 3IBSA 1E3IA 3RVPA 4AJ9A 4PQFA 3UK7A 4R8RA 2UU9B 2GRQB 1VCOA 4OAPA 4RSRA 5DGCA 5DCYA 4C0KA 4JHLA 5AVXA 1EIWA 4M9SA 4MB2A 4R2JA 3VYUB 4B8CB 2JVJA 1H2TC 1ABBA 1GTVA 1MB2A 1RHRA 4B4DA 2AFHB 5KJKA 3PHIA 1IDN1 4G07A 1E6KA 1M1YA 3TB4A 3KK0A 3EOZA 4TN1A 3UGTA 5B7QA 1RRCA 1W3BA 3BT3A 4YY3B 2RKKA 3DZHA 1XOIA 1J2TA 4B0ZA 1MXFA 3GGDA 5EL0A 4MIKA 1BS1A 5ICMA 4CLRB 4IRUB 5DGDA 1SMKA 4CCWA 4Q7QA 2QI9C 5ALHA 1Q0RA 2A0YA 1OYOA 4R7GA 3VTFA 1Y4SA 2IXFA 3C6ZA 2VK1A 4LRQA 3OP1A 1F0PA 3NAZA 4HB0A 3SAJA 5K0ZA 3Q0IA 1RI3A 2O0LA 3PPWA 5AP9A 4TKZA 3RU2A 4CEJA 1KEEA 3ZYLA 1UUFA 1AKTA 5CLFA 2JHFA 3ZU4A 2NUTA 5I9IA 4RIFA 4RZ2A 1EAMA 4KVOA 4HL6A 4GLFA 1CV2A 1JQKA 3Q8XB 2BJWA 3WLMA 2RD0A 3GLTA 3Q7IA 4MULA 2PHZA 1XQYA 1FXUA 4KITB 3C7TA 3U39A 1OROA 1Z39A 2ZQYA 4KPUB 1I32A 3FAZA 4S0XA 4DQDA 2REQA 3QFTA 1XLTC 2OFFA 2Z1NA 3MW8A 5ICFA 3V7UA 5EKQD 3AJEA 2OFOA 1EDDA 1IK6A 1G2QA 1USWA 3EZ9A 3AYXB 2VYFA 3MGKA 2Z58A 3IB6A 5E7JA 4BL5A 1E5LA 2MINA 1F3OA 4LDRA 4C6TA 4G8DA 1JW9B 4C5AA 1L7PA 4D92A 3AFMA 4J03A 5LBIA 5HR5A 4GZLA 2P5SA 4ZYTA 3ABRB 1G17A 4I14A 2IFTA 5A0TA 1Q15A 3PKZA 5I7HA 1CRQA 1W48A 4BZZA 3N3BC 4YAJA 4V1CA 3WICA 2WXJA 3O6VA 1QRUA 1ZN8A 3QKWA 2JI7A 3LV8A 1H0AA 3ICPA 4ZOAA 5C9ZA 1KDTA 4I2VA 4CU2A 4R9UC 4M49A 4DAEA 5ITWA 1NUTA 3EVGA 1OXKB 4P08A 4DLXA 5JTUA 1PR5A 1O95C 1M6YA 2FWPA 1Y98A 2V03A 3EBPA 5G41A 4DG8A 1X9HA 2XUFA 3B7WA 3O7WA 1XNHA 1ZPDA 4QTUB 3VH3A 3TJMA 1O0BA 1QX4A 1TTPB 2PAAA 2QAGB 1JCRA 4RV4A 1KU6A 1V6SA 1B43A 1K3TA 3IE2A 1U0BB 2QYSA 1JN0A 3CWZA 1UG3A 1RZRD 4DDUA 3ZE6A 1ORIA 1GPYA 2GW1A 4PHCA 3MTJA 1N1DA 1X1QA 4NOMA 4P81A 2IS1A 2CHFA 3EXFA 3WLEA 1BS9A 2BHSA 4TL8A 1SOUA 2ZFUA 2QRUA 5JDCA 3PVSA 1XDGA 1I9GA 4UJ5A 1UC5B 5EY5B 2JD2A 3PFCA 2V7VA 1NT2A 1RWBA 2H08A 3BGDA 3KEGA 3NKVA 3GNSA 2IOLA 2I6UA 3FCSB 4L8FA 2AOXA 4KMOA 1VMDA 4RORA 3VHQA 1UZAA 4YDRA 3WC4A 4NG5A 3JVEA 2Q5LA 1XP5A 2HA7A 3KD2A 3LVRE 4NARA 2OXIA 1SHLA 3HGQA 2C7RA 1HKUA 1A9SA 4ABYA 4BLPA 4OEHA 4N54A 1NPDA 3ORSA 3UUFA 1FTNA 2AG6A 4DLOA 4K5AB 2X0IA 3EMKA 5FPYA 4K9RA 4OKIA 4RC9A 4MJLA 5D7BA 2V5QC 1TT7A 2Q2NA 2VPZA 5EXPA 2E1PA 2NVUB 1JZSA 3ZDQA 5I7FA 3U9WA 2BUAA 5A1JA 2WJGA 4YQEA 5B57C 4AUKA 4Q5IA 4E1AA 1RXVA 5K1ZA 1IJKA 4IYJA 1JQAA 2GDZA 3AINA 1Q91A 5FPKA 2BFWA 1P31A 2OA0A 3RS7A 5CCXA 2WWXA 2DBZA 3FSRA 1R66A 2FF4A 1UL1X 2CUKA 2JIBA 1E3SA 1ML4A 2NV6A 2OMEA 4OHUA 5EKXA 3TPZA 4YX9A 1VGQA 3KYIB 1Q0TA 4LSZE 1VP3A 3WR5A 4GA2A 3JWHA 4OYHA 2OCAA 2H9IA 3EPHA 3PPIA 3EZ6A 2FJPA 1PNRA 3HHPA 1ZU5A 2NO7A 5HM6A 1J9EA 2X40A 1LK7A 1NVVR 1CFJA 2M6SA 2P2GA 3CEQA 4GZ6A 5BWOA 4M0FA 1YNSA 4HGOA 2UZ1A 2Q9AA 1PUJA 4WA8A 3IMFA 3TDMA 2IYTA 2CT8A 1Z15A 3M4ZA 1P1BA 3QUTA 3HKCB 4BMDA 1V48A 4DNPA 1P17A 3B1JA 3AERA 5IY5E 3HCFA 4EEKA 3AFHA 3AG4E 3EC2A 5BVGB 3NQ41 2IH2A 4DR6B 3V4VB 3L17A 2PL5A 2CNDA 2Q6TA 2ZK7A 3RSFA 3U3OA 2YNQA 5T4BA 2GPJA 4BEVA 2GCNA 3OU2A 2IOFK 3P1UA 3QWHA 1QU2A 2OWDA 3OZ7A 2GETA 2PGJA 4C0XA 4C2BA 2JLYA 2BIFA 5EUBA 1FP6A 1K88A 3GEEA 1CUVA 1SC4A 3E22A 3FU0A 2R47A 1SK9A 1ECFA 4ARVA 4IDOA 3ZLUA 1V11A 1G60A 3V4LA 4YRNA 2HRRA 3HQ4O 4PUCA 2G7MC 2DFNA 4KO2S 2G71A 1EINA 1Z25A 4OKNA 2C59A 5LDGA 3VU0A 2VSNA 3TIVA 1XD2B 1WKVA 3LPDA 2O8FA 2ZRLA 4FYVA 4IDEA 1NBOA 2C04A 4JLAA 4XVQA 5K45A 1GZVA 3B7PA 2V4HC 2O3RA 4AKSA 4XOUA 2O4UX 2AG8A 4DX7D 5FTJA 5K0CA 4ZVNA 1KIAA 2DQSA 3T7CA 3UXGA 4UFNA 3FSEA 3GGOA 3QA9A 1XGWA 1ZUIA 1U8ZA 3NJ8A 4EHLA 1EFVB 1A17A 1OCEA 1TYZA 3FF1A 5LCWJ 1IRXA 1VIAA 4MI6A 3NC4A 3ADCA 1U7ZA 4PN3A 2XHEA 3C7KA 2JGNA 3CLTD 3IUNA 3Q87B 4G65A 2AIRA 5AJVB 1T1RA 3W04A 1E2GA 3I1FA 1M1UA 1QKKA 1QIJA 1R18A 1I3NA 3KYDA 3EYAA 1YE3A 4N7JA 4DV5B 5ED0A 1X77A 2WZBA 2EKDA 4WY8A 2IYUA 4FBGA 4H77A 2A3NA 3BIOA 3BJZA 4R2WA 1QCCA 1JXOA 1C7QA 2ZJOA 2I71A 4FMPA 2NO4A 2AQIA 3F8WA 2MHKA 1FFEA 2P3OA 4WN9B 5B37A 5HKKA 4UNRA 5LKRA 1EZZA 3PCRB 1V6CA 4UDOA 5JH7F 4AK9A 2WYWA 2Y67A 1K6EA 3A37A 1WP4A 2C4VA 2WYUA 3O4ZA 1YBAA 3I45A 3OEHA 4MGIR 4CGWA 3ASHA 2RGYA 4XB1A 3O3OB 1W4LA 4QYTA 2PX8A 4WY5A 3SD5A 3C1OA 4J8YA 4JJZA 3TD9A 3ROGA 4NS4A 4RD4A 5HVNA 1N3LA 3OIGA 3PXCX 4ND3A 4X65B 3M4YA 3L7AA 2XT9A 1ZR2A 3N7TA 3PRKE 4KK3A 3A1UA 4KK4A 5KVVA 1NW6A 3Q1LA 3GXBA 4ARBA 5KJLA 1U9IC 3CIAA 1YMUA 4MLPA 1XTQA 3BPSA 5JDCC 4YPOA 1B8NA 2FPRA 1OKKD 4WT7A 4EG6A 4Q9AA 1T3GA 4YRJA 1W5EA 3E9EA 5IYZF 4FIZA 4IH9A 2HBYA 3UIEA 1DKQA 3G23A 4RHEA 2ZYIA 1OCOE 3D5TA 4OATA 4WK0B 3U7HB 2ZSIA 1TO2E 1SOVA 2J3EA 2QZJA 3OZIA 4TT3A 3HCOA 1ZK2A 5CVVA 2IL1A 3GA7A 4YAKA 1GWNA 4CIXA 5AQ7A 3PQ6A 1IVSA 2VLBA 3HVEB 3OZFA 1LBQA 1QYWA 4GE0A 4AY3A 1Q7BA 2RIPA 2ZSHA 2PFSA 5ALLA 3TW8A 2XCRB 4HX2A 3IAS1 4DA4A 3KZOA 4LRUA 2XXAA 4YGXB 1DG3A 1FP7A 2W6CX 3PPVA 1VYUA 2VGEA 2HQRA 2W6JA 1NI1A 3CRW1 5FAXA 4B3TB 1RQRA 2IEGA 4TV3A 2ETAA 2GAIA 1GHTA 1A9QA 5FQ6A 3GLQA 3ICWA 2GZ1A 4MJXA 4X85A 5E6RB 3W77A 4C20A 1KPGA 3DMFA 4QLOA 4TSFD 4ZA2A 4FKMA 2VWQA 1TA0A 1MO6A 3MA0A 1GLNA 4TMFA 2C2XA 2XVXA 1SUIA 2YN4A 4Q9DA 4NXMB 4UE2A 4YEDA 1E0AA 2WFLB 3G7UA 5KYVA 3CEAA 5ARFA 4CETA 1R8JA 3QU5A 3HJAA 3I6MA 6LDHA 2ATXA 2IEIA 3BWCA 3GJ3A 2QTHA 1FU4A 3GU3A 4LYFA 4DVJA 3MK31 2V3WA 2RHGB 1NOJA 2VZ8A 3TWXA 4GBMA 3ONEA 1W2GA 4GMHA 4LJ8A 5J2TA 1ZEMA 1VCMA 2GEDA 2WD9A 4IHAA 2XMGA 4YV2A 4BMSA 4L8GA 2ZIVB 5B1BE 2NYUA 4EW2A 1P5JA 4AKEA 1QCDA 3VLEA 2VT6A 1K6MA 3JZDA 3RM3A 2OOKA 5KSZA 1I2BA 3CONA 5EZ5A 4CODB 5IKMA 4RE5A 6ABPA 3A9SA 3F7MA 4M2LA 3THXA 4NJMA 3LO5A 1INLA 4EARA 4HDAA 2MR6A 4R40A 1E3DA 4FVTA 5EPUA 2YQ5A 2ZXUA 3UMSA 4IQFA 4KXFB 1NN3A 5JR3A 1GNRA 2NU7A 1BOFA 1P7CA 3DE3X 3ZJVA 4YUZA 4A9AA 1E0DA 2HU8A 4D97A 4ZEMA 1EUYA 4QXAA 2X2OA 2XNCA 2G1UA 2J08A 4ZCRA 2QVGA 3TE7A 4IKOA 5FBVB 1V54E 3NB0A 4PAGA 1KYXA 2IZ1A 5FF9A 1OU0A 1OXXK 2BFDA 3E70C 2O19A 4J0CA 4ME2A 2HJSA 2H0RA 5L8VA 1MDFA 4NL4H 4WECA 3TFWA 1IJFA 1DQSA 2R66A 1V43A 3SFVA 2Y4TA 1YCGA 2VJMB 1PJ3A 5HM8A 1M33A 2NYJA 2IHYA 4FFNA 5GZ3A 5K09A 5IYZA 4QJBA 4HNAD 1I3CA 4NQ0A 1L8XA 1U8AA 3FDJA 5CH3A 4D0RA 2GT1A 3REGA 1SUCA 2QTMA 4KQ6A 1FB5A 4CGYA 1L4YA 1RI4A 3VHXB 4UOQA 3COZA 4BMPB 2FPWA 4HVCA 1DP4A 5FINA 4Y6SA 2V5AA 5C8DA 3KJXA 1BE0A 2WWIA 3AS4A 3TFQA 2VKQA 4OXQA 3IT2A 5KOJA 1VPLA 3TOXA 1BCSA 2JH9A 1PC2A 4X54A 1C7JA 2I2FA 3D6HA 4NAUA 5EN4A 2YDXA 3EZNA 5EP1A 2P1RA 3O8DA 4HP8A 3GDWA 4D79A 2AX4A 1GA1A 4N0EA 1N34B 2DJ5A 3BB1A 1XPJA 3D3EA 1U3VA 2FEWB 2I3GA 5AENA 1XHLA 2QQ0A 3C6YA 1QHHA 2O2IA 1QPGA 3SJ7A 3TQCA 3X43A 4BQSA 4KQ9A 2W2TA 4EW3A 7GPBA 1FFAA 2FQYA 3T3PB 2VH5R 4AB1A 4D3SA 4MI1A 5F23A 3KUKA 3PGXA 1HZ4A 1MG0A 1PQ4A 2PX5A 5AVOA 5GVRA 2NP6A 1EFCA 5CCDA 4UVEA 2ZI4A 4X94A 2CHGA 5TB5A 2QZZA 1QBKC 1X5BA 4N6NA 1VLVA 4ZODA 4YUWA 1Y6FA 2OCGA 2XCIA 2NVUA 3EA0A 3OD1A 2FXIA 1FQKA 2EZUA 3MEQA 3TUIC 2X4IA 4X6UA 4NCHA 3JQAD 5JV5A 3O1HB 2VJAA 5FOVA 2FJUA 2ZYGA 1XNGA 1OVMA 4PFSA 4MICA 3HU2A 4H0FA 5C8ZA 1QDEA 1M2VB 3GFQA 3EPKA 4JP1A 1RBZA 5E8JA 5E2BA 2JLXA 2W43A 4Q9LA 5WRFA 4GTTA 1RW4A 4A4DA 5CIYA 3WXXA 1JLMA 4ALJA 2J5XA 4NZPA 3T5GA 1Z17A 2VI5A 2WKSA 3V00A 4CL2A 2X0KA 1UKEA 4MV8A 3OZUA 1EH5A 2KE5A 5LLSA 4AS2A 2O8BA 1OZFA 1L5GB 3RUPA 4UXJA 3TDKA 1KZOA 3V4PB 4DZRA 3PDHA 1K08A 1MX1A 1H8HA 4N8EA 2YYYA 5FI3A 1DARA 3BL6A 1U6IA 1M7GA 4YUVA 1XZBA 2E2EA 1M34A 1ZWKA 1CS0A 4EJMA 3CVUA 1RLUA 3CKLA 4C0QC 1IUPA 1PQUA 2QQGA 2QW1A 1GKYA 2F1HA 3KE9A 4GTMA 3MT0A 4POAA 4QGGA 4WOKA 2Y0EA 3FMIA 5BWBA 3TWQA 2MYUA 5KTTA 2LE0A 1JLLA 3Q7QA 4TUYB 2NMVA 1KDRA 3FGNA 5A1TA 3HKBA 2V7XA 1FYWA 2PKEA 4HJXA 4LY3A 4EF5A 2X2PA 1VPDA 3I76A 3Q7TA 1CRZA 3DEAA 3IVXA 5K3SA 4RTOA 3JPYA 1UP4A 3JATB 3LCCA 3KXLA 1JSRA 2QYOA 3CS3A 1H4SA 4ZAXA 3DPDA 3L8CA 4YONB 2LKDA 1T8WA 3U6BA 3NTXA 4LXUA 4YHBA 2VYVA 3TGLA 2AUTA 1Z45A 1ZZGA 3DE6X 3B1KA 1A1VA 1SOAA 3O2JA 4G6ZA 2QPAA 3AEKA 1MVLA 3BKWA 2QRLA 4BNDA 2QN3A 2WT8A 3KB8A 4BTBA 2Q0QA 1RABA 3QVOA 4TV8B 3DBSA 2B4RO 2C5BA 4RLSA 5LB2A 3WL7A 1YRAA 3K2IA 4U2EA 3N9IA 3GPDG 1VXOA 4IM7A 2VXYA 5I7WA 4KMRA 1GEGA 4P7FA 3C3DA 4KREA 1P80A 1SD1A 1Q16A 3GPBA 3QJGA 4M0CA 2DCMA 2HMSA 5L3SA 1QQ5A 3Q8MA 4IIJB 1C7EA 2QTCA 4HF7A 2NZUG 2YY5A 4X7MA 3AVYA 3K30A 2OXFA 3HU3A 4WGGA 3GEMA 3IB3A 4TRNA 3VKUA 3ZJ5A 7ADHA 4A0GA 3C3MA 1KDVA 2I1JA 5BV7A 3BA1A 1FQOA 1VIMA 3EPJA 1XMPA 5JOQA 2X13A 3C39A 4JP2A 1COWA 2D2XA 1YVDA 2PX2A 2XLBA 3PUYA 3K70C 1AV7A 2PSEA 4WCVA 4REMA 1NXQA 1MIOA 1E5DA 1N2XA 5TPZD 5T4EA 1SBIA 3ILYA 1RCFA 2QZ9A 3WGIA 3W8RA 1MT3A 1PR6A 3EVTA 1SH7A 2WJVA 3EXIA 1RCUA 2CHVA 1XTRA 2W4MA 4PYMA 5H82A 1KTVA 1XZLA 4HVTA 1QB7A 3SF4A 1GEEA 2ACKA 1QCYA 4NACA 1CDEA 3LD9A 4ALLA 1V8DA 5IDQA 3ZWWA 4R71A 3UKRG 2VSYA 2FEOA 4CQMA 5AM0A 1E2EA 4TMXA 1OWLA 4LGVA 3NYRA 3RV3A 3L7KA 1LDNA 4MVJD 2FPMA 1UN8A 4PQGA 3WLNA 2JEZA 1WR8A 4DQVA 5AW0A 2E21A 4YT8A 2GKOA 2F3UA 4MUYA 2I4NA 2JRCA 3GWZA 4EHBA 1VLQA 5JNTA 2I9PA 4HUQA 1N2JA 3S81A 1PFGA 3CKMA 3FJOA 4PX5A 5CB4B 5JY1A 3VV3A 4QTXA 2ZU6A 1SKBA 3CKYA 4MKGA 2O7VA 1KDPA 1P1IA 1P7YA 2FNAA 2FZEA 2IIPA 4K40A 1LPMA 4X8HA 1ULHA 3E7PA 3PNOA 3ZGOA 3R5JA 4QDKA 1GZ5A 3WBBA 1VE3A 2ZVPX 4JUCA 5KNBH 2ERXA 3D3WB 3ZPXA 3BBPA 3WISA 4GXNA 2C83A 2QP4A 5AOBA 4TX1A 2EKLA 3CLUC 1YBHA 3STYA 1TQ4A 3SZGA 2RGAA 2WTAA 3F6BX 4Q6BA 3DDNA 2W71A 1UMCB 1VE6A 2WXLA 3EUFA 5IEBA 1P72A 2AMLA 3AV3A 4GI3A 4C3ZA 5BV8A 3KLMX 2CXRA 5KTMA 1OX4A 4G56A 4ILEA 1ZI6A 5GONB 2OCBA 2PH1A 2OVBA 1M8KA 2C61A 2BEWB 3O82A 1ZBPA 2XEEA 3ZH2A 1YACA 1TJ4A 2D5LA 5E9QA 1U04A 3G2SA 4LCTA 4FHKA 1YJBA 4UM8B 1V3TA 4BMNA 3KSMA 3N2IA 5DP2A 2CSUA 2WTBA 4BLVA 3F9CA 3OKPA 3EIFA 3ECAA 1H66A 3AU8A 1MDBA 5D8DA 2DWPA 2C9ZA 2EG5A 3HB0A 2GLUA 3SIXA 1C3XA 1J25A 1Q12A 4EYQA 1QTIA 1K2VN 1NM5A 2P1ZA 1UKAA 3CB2A 3L02A 4GPMA 1BDJA 1G8YA 3A3YA 1X7WB 1B2LA 4FGUA 1LDMA 3BS4A 3QSYA 3S4YA 2XF8A 3PT5A 5K3CA 4G5XA 4OM7A 3Q0EA 2EC5A 4DIKA 2Q2QA 1CZHA 3BTOA 1MJFA 2DERA 3UAZA 2P2YA 1XLTA 1YULA 3MMSA 4WKCA 1ZKDA 5KYYA 2ENWA 1TVMA 5E1DA 3B7TA 5TEWA 2HO4A 3ESYA 4JQYA 4ARUA 2WXPA 3G1WA 2AHOA 3FP3A 3EWAA 4P0PB 3QX3A 1IEVA 4B79A 2B35A 3MJDA 3VSCA 3H42B 4XYBA 4B5LA 4W6QA 1OLXA 3F8TA 1J9GA 4ZEWA 1U98A 1GM5A 1SM4A 4WESA 5A0FA 1KS2A 2DZDA 1MOPA 3HV0A 4FFLA 5CG1A 1RRFA 2SCUB 5AJDA 1R4AA 2VSOE 1YA4A 2NSDA 4JB8A 1Q44A 3DEIA 4J6EA 5I7VA 4R2HA 1T36B 2GO7A 1SXGA 1E1CA 2GZDA 4FFMA 4NZZA 1WABA 3RVRA 4BS9A 5B7GA 3HRHA 5HFAA 3VOBA 5MF6A 3R76A 4RA9A 1E2MA 1LTXA 1KSHA 1PSWA 2JA1A 3HUEA 3WG9A 4BFTA 1J97A 1NUQA 1PYDA 2CNWD 4Y98A 3SEAA 1V8FA 5EJGA 1P0PA 1ZQ9A 5HWSA 2BEUB 2QM8A 4MVYA 2MSDB 3T7EA 1PJQA 3WX0A 3QWVA 4Y67A 1IN5A 3L04A 1E2DA 2GNOA 5FBHA 4EX6A 3L54A 2VAPA 2B5OA 2I8LA 3L6CA 3PIIA 1G8FA 1GR1A 1CZLA 2GILA 1ZMOA 5JG7A 3U4AA 1WS6A 1THTA 2COEA 1WAMA 2CUTA 3E9RA 1ZMTA 3HUFA 3NOVA 4BJ6A 4EYGA 2Q8NA 1LTKA 2ZAIA 4OO3A 2Y3AA 4FMDF 4UW9A 1KKMA 4YMHA 5EHZA 1BVHA 5AVYA 3AL0C 2X15A 2VAMA 4L28A 3CF0A 1X7YA 1D1TA 4ND7A 1X1DA 1U81A 1TYQG 4JI3B 1D4ZA 3ZJYA 5GJVC 4O4LF 1QQAA 3R8XA 1I33A 4NRHB 1FJ2A 2HHLA 1E7VA 3U81A 1G5RA 4MV1A 3UC5A 3VR3D 5H7PA 5IKPA 4YO8A 3V8QA 2WT9A 5KS2A 2EQ5A 1F8XA 1HQKA 3KM0A 1QS0B 2E4WA 4NCJA 5DNDA 3Q10A 1LC0A 1L4HA 1FS5A 3B3JA 2PT5A 4RF5A 5IHPA 1ZJ6A 2B5VA 5GADl 2Q9CA 2M1XA 1HSOA 2GAFA 4V0KA 2XWJI 3QBEA 4YDOA 4Y2XA 3VDMA 3V1UA 3R3SA 4NYJQ 3EOBI 4BQRA 3KZKA 3KETA 1PL6A 1JNRB 2CNOA 3Q98A 3VRHA 4PO9A 1V9SA 1AURA 4MQ4A 4U1RA 4LWOA 2YIMA 3ZHEB 1CYDA 3ITWA 2VEOA 4KDFA 5DHQA 3VU3A 4ZV4A 1G20A 4MWOA 3ZLTA 2MMCA 1I6WA 1Y81A 1T8YA 1XO1A 3AB3A 3ESLA 2QSZA 2CXXA 4Q3CA 5EXSA 1DV1A 1SO8A 3JYPA 5J47A 2Q62A 5J1SB 1P75A 2AK2A 3TLJA 4W5RA 5TC4A 1NVXQ 5B1DA 2WKPA 1GA6A 3U4CA 3CHQA 2CDNA 2Q3LA 3QV2A 2H7YA 3UMRA 3ZGVA 4KIWA 1PL0A 1H85A 1S0UA 3H9CA 3PZ2A 1W0JD 1M5UA 4HXEB 1YO6A 2PNNA 2D0IA 4FCVA 5C1IA 3NONA 4JX8A 4REQA 5AHOA 2NT3A 5C5CA 1K3UB 2A0UA 1S6YA 1E5QA 4IMIB 1C5KA 4ZALA 3LHKA 1H9CA 1L4MA 3QW2A 4M6WB 4PNZA 4YMTA 3DXKG 4J1TC 4M8SA 3QVLA 1II9A 3WLOA 4EJ2A 3UT0A 4DCOA 2A0WA 1MKYA 1QIIA 4EQZA 4C76A 5CUQA 4WZAE 1A5TA 1F2TB 3P4XA 1E6WA 1WG0A 1E7MA 3D9JA 2VJLA 4X7PA 2XUHA 3L22A 2E4ZA 1BCRA 1TMGE 5KNDA 2CFTA 3UB3A 2FMKA 5KWDA 3INTA 3EIWA 4R2XA 1N94A 1LPOA 1Y4AE 5ICGA 1YAJA 1CE8A 1N0HA 1TZ2A 4JA2A 4MK4A 2ZXFA 2J7PD 2HDNB 3E4DA 4NFHA 3V1KA 4DV7B 4KZKA 3I1JA 4QKQA 3WLLA 1NFQA 1K5DA 4YRAA 1D2GA 1K68A 1DJLA 5K3OA 3HH8A 1D7AA 2YWRA 2JKVA 1WXFA 2OHXA 2ZWPA 4EQFA 3ONFA 4JFAA 3VTAA 4NFLA 3RYCB 3QVKA 5CNMA 2PRIA 2HCJB 3H8SA 1AUPA 3Q3IA 3W05A 4Z7QB 1UJCA 1IM8A 3LKUA 1E1LA 2E49A 1E8YA 2FPGB 4O29A 2G1JA 2L2QA 5K2OA 2DWOA 3PE6A 2O57A 2GA9A 2HH9A 3LKBA 5BUCA 1QHEA 1PVOA 1ZESA 1XRPA 2C03A 3TQRA 4OLHA 3EZYA 3WYNA 4MRMB 1B8PA 3FPBA 5AVUA 3NVMB 1UH5A 3WLPA 4DCVA 1OX6A 1XBTA 2BI4A 3ASUA 5IF9A 4KE7A 2CW5A 2LDXA 1RJEA 4GAEA 4HPXB 3ZQUA 1LSOA 3EXEB 1BHSA 5F2EA 1MRSA 2YC2C 3FCCA 3UV3A 4GYOA 2NZYA 3DFMA 1KHTA 3GMDA 1ZD9A 2ADOA 3ESQA 3C6XA 4DI4A 3QF7A 1CR4A 2B1IA 4GZ5A 1P7VA 2WTNA 3GRRA 1WB9A 1VI6A 3KYBA 5EQTA 5FWDA 3PUIA 3H9EO 4ZZ3A 4R2LA 1KOGA 8MHTA 4A5OA 3LY7A 1WCWA 3DVRX 3N7AA 2EZTA 3O8NA 5G1NA 2JIDA 3GP3A 1FFXA 4MSUA 4GLBA 4TQGA 3UAYA 2AZXA 1CR2A 2G6TA 2Z2YA 2GXQA 3U1BA 2AJCA 1GSIA 4MW0A 1T9KA 3IHLA 4IZHA 2YTZA 4TXQA 2EZ9A 3F6RA 1GYQA 1QRAA 2EL7A 5E9WA 1U9IA 4R7ZA 1JG7A 3OF3A 3IAM1 4TM8A 3R77A 4YCJA 3LPCA 1DEAA 2V0PA 4CM7A 1WDMA 1FFSA 2X5KO 2G9NA 4J3JA 5ED4A 1NKVA 3LHIA 4LRZA 1C0KA 2X42A 3FUCA 3ZZMA 5C53B 3PU6A 3DZDA 2BGGA 3CW2A 4CUJA 1CUZA 5E9JA 3TEFA 2D5BA 2V6FA 2VHVA 3ORFA 3C3OA 2EF1A 1TU0A 4K9DA 5FPTA 2X0JA 3T1QA 4DPRA 4XLLA 3SC4A 3CLHA 1D0VA 3UXYA 4CT5A 5KYWA 3DVLA 4ZICA 1JU3A 5CGZA 4PPNA 4ZXFA 2CDRA 2CNNA 2MSCB 1RWPA 1N9GB 2JABA 4Q00A 3C8HA 2QUAA 2AR9A 4ND2A 3CZAA 4CV1A 3QVVA 1S2NA 2QN2A 4LSMA 1XCBA 1XMSA 3SVLA 4Y2PA 3DMPA 1M83A 2WA2A 1WAO1 3LLCA 3O91A 3RIGA 1G9XA 1QHNA 4BNKA 1Z33A 1CE8B 4MVJP 1N3IA 1P0FA 2VBIA 4UYKB 2ILVA 4QQ8A 4GX0A 4UEJA 5CX1B 3RE1A 3WSTA 2C2ZA 3L9WA 1ATZA 2J3HA 1ZUD1 3BEOA 4Q48A 3SD7A 3UT6A 3WGJA 2VTEA 4EW6A 2ET6A 5CYFA 2R5SA 2A4MA 5BSTA 2EG9A 2YYZA 5D3KA 2CFCA 4LHZA 5AUNB 4JITA 3RYCA 1ABFA 1Z9BA 4J8SA 1E4EB 1G21B 2QXTA 3HB4X 2KWIA 4Q7LA 1MO4A 1D0IA 4HSEA 2LAHA 1XDDA 1KYTA 5EWJB 2R1TB 3I05A 1ONPA 2D8MA 3AJAA 3G9QA 2D0PB 2NX2A 4IJUA 4N5NA 3W1VA 2R8PA 3R0XA 3ROKA 1QIDA 2EFGA 3I0NA 3RK1A 2N1MA 4IP0A 4XQ9A 5LFAA 1DC4A 4KOEC 1AP7A 4US2R 1A9XA 2IS6A 4Z4GA 4NATA 1VYHA 3B85A 5FFNA 3EFOB 3N76A 1QYIA 5C1OA 1ZA2A 3FHLA 1H19A 4KPYA 3TI7A 4CDNA 3LUJA 4ZT5A 3VNBA 4O3MA 1L1RA 5ELLA 3SZMA 1E8OB 1LCIA 1EWKA 1Z6TA 2J8SD 5SICE 3Q7PA 3E9MA 4W6ZA 2ASVA 2JJYA 1Z8DA 2DQYA 5BV1A 3F4BA 3U3DA 4DC1A 3LX8A 5HE9A 3FLMA 1W25A 4X24A 1H3NA 2GKGA 2QY9A 1HDEA 1O77A 3PV0A 4EHIA 1L7RA 3V31A 3AIMA 1U1IA 4Q7EA 4I5IA 4OXKA 1FZTA 3I5XA 4DJFC 4G1CA 3ESDA 3UAGA 3NBAA 5DHTA 3UFXB 5LZ9A 4JT2A 1H2AS 1RAHA 4PIMA 2WE8A 1Q0PA 1T6BY 3AONB 3GLHB 4F7DA 3LFUA 4ZN6A 1GQQA 5CCBA 1DTSA 3GGGA 3QEJA 3G5MA 3GRZA 2C97A 1QMOE 4MYHA 1NP6A 4IIVA 1I24A 4EAQA 5JC8A 4BNHA 2L18A 2CXPA 5CLIA 1BGVA 4B3IA 4FGKA 3MWKA 5L7WA 1GRRA 3U7EB 1DJMA 5FXMA 1DX9A 1U0TA 3UM0A 2EQBA 2RGDA 1P8AA 4MUHA 3HU1A 1WM1A 5TV2A 1KK1A 3FDHA 2QGZA 3ZHTA 2EGUA 1KI2A 3GARA 3QW4B 4OM8A 4QXOA 3RLFA 1TKCA 4RIEA 5AXAA 4EUEA 3T9BA 4EUSA 4RWZA 3IP6A 5CA0B 4EUKA 1WQ3A 1JAIA 4C7KA 1SKMA 2ZR7A 3ZI4A 5ER9A 5MFPA 5BQFA 1O0SA 1FX1A 3BGWA 4D96A 3VZCA 5DHSA 1E64A 2DBYA 2EJCA 3SP1A 3JUIA 4HEA6 1TO1E 5EXDA 3WV5A 5TJ9A 4WLVA 4W9NC 1AHNA 4QRHA 1BMTA 5H81A 5AUOB 4MKTA 1HYEA 1JH8A 1JKJB 4A63B 3DHWC 5LYJA 4ZYLA 5JU6A 4AKXB 2WB4A 1ZISA 1F12A 3I52A 3N87A 3OX2A 2QYTA 3PJFA 4F3VA 1U7PA 1LLUA 2E4YA 1KMCA 4EUFA 4CR6A 4QGBA 5A9RA 1JDUA 1WZCA 3IV0A 2OKGA 4C3UA 1SUWA 1XZIA 4BGUA 3U5TA 1GR0A 1N2HA 1L4NA 1P7PA 2AR7A 2JCBA 2Y2UA 4TKUB 1M2KA 3I23A 4NSNA 3PT9A 4MQEA 3TBKA 1DADA 4LHWA 4UULA 2WAYA 4FYJA 1YJQA 1PJ4A 2D0OB 4FLMA 4H16A 5SY4A 5JHBA 2X5OA 2XKBA 5JRJA 2PT7A 4K6FA 1FVFA 1E7SA 2N46A 4M83A 1MRNA 4WXPA 3ZHBA 1JP7A 3LUAA 5DO9A 2QBYA 4IH1A 4D9BA 1T43A 3CMCO 2WUFA 4EHAA 2JFWA 4RADA 3AR3A 2V6BA 4ROSA 1G1MA 4EFMA 4G1FA 4I4IA 1JJFA 1NP7A 2X38A 1IWPB 3D9MA 1SVXA 2VGXA 3LQKA 4IH4A 4BVEA 1T4BA 2JLUA 5DM60 2IY8A 1Z0KA 1OFHA 2P4HX 2QGFA 4I1YA 2DE0X 4Q3DA 5HBGA 3U1VA 2GHIA 3L6OO 2XITA 1QHGA 3AF3A 4AKTA 4EGFA 3IGFA 4N1AA 4YYEA 4X66B 1FJXA 1VLJA 1U8XX 5E7MA 4MR8A 1LPBB 5I8WA 3ZD8A 4FYKA 2MTBA 4C4OA 4OP1A 2ACVA 3Q73A 5AK5A 4DWVA 1IM2A 1TDJA 4R1PA 4TRJA 1XZEA 4JP5A 3TR0A 3ZQKA 5IDWA 2BEVB 1VL6A 3ESCA 4J16A 5L7TA 3PFNA 2CYBA 4ANWA 5AI8A 3LW7A 5E0OA 3GLUA 4A8PA 4ZTZB 3DKRA 1KH2A 5KYXA 3IQHX 4MYDA 2XOKA 2H5EA 8ATCA 2AN4A 2YINC 1KNXA 1EA5A 3IPCA 2XE6A 3RTGA 5D2MC 1T2EA 1ZS9A 3H19A 4A8JA 3TECE 3ADBA 3NHBA 5COQA 2BGKA 1S2GA 5CIWA 1AQIA 1EFDN 1KR5A 3SQOA 2PY6A 1KY5A 1N2CA 2OP0A 2WSYB 2WU1A 3PHLA 3Q9UA 4FXOA 4Q4AA 3WB0A 3DZFA 10MHA 4PWZA 3WKBA 1V7PC 3K6SA 3O21A 1BIFA 2WDPA 1MVNA 5AYWD 1YQWA 2Z2ZA 1CETA 1ZSVA 3FMVA 3K05A 1IQPA 3NDRA 4FPXA 2FPGA 5KAMA 3WJ1A 3RVOA 1OT3A 3A26A 2F8XK 1EFPA 3HJCA 4IKEA 4NE9A 2W98A 3GLFB 3IEIA 3HEMA 3C6BA 5KWIA 2XLCA 4Q4LA 3CQCB 5EZYB 5FPPA 3VC7A 3F3SA 3FUUA 3ZE7A 5J2TB 3KQPA 1DC5A 2C95A 4JEUA 4P4GA 4QOEA 4RPJA 4CM5A 4C0WA 3K0SA 2XWPA 3K09C 2A8YA 5FEMA 2D4HA 3VKVA 5CITA 2QB5A 5DBKA 4U0SA 5HIMA 2VHWA 3O73A 5CEAA 4LJAA 3R7AA 3REQB