4GYYA

Crystal structure of human o-glcnac transferase with udp-5sglcnac and a peptide substrate
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
715
structure length
693
Chain Sequence
b'PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFHIYDNRIVLNGIDLKAFLDSLPDVKIVNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 274
structure length 693
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gyyA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gyyA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gyyA03
4HOUA 3S29A 1AHPA 3UYKA 4MI9A 3CV3A 9GPBA 2QRQA 3D1JA 3L7CA 1NZFA 3WC4A 4HORA 2KCLA 2WQHA 3MV2B 5EX0A 4HWGA 2L6JA 4GPKA 3T3HA 1FS4A 2ECPA 1JEJA 5HI7A 3L7AA 3KAEA 3KS2A 1L6IA 1F0KA 1E1YA 2QLNA 3LY7A 5C1DA 3G2HA 4MI6A 2XA9A 1XNFA 1NVKA 5DU2A 3PDNA 4UI9K 4LEUA 1P4GA 1ABBA 2AZDA 4WUYA 4H7XA 4CGVA 3ZCVA 1FU4A 3AS8A 1WAO1 5JJ7A 4GA2A 3UYLA 2IF4A 5FZQA 1UQTA 2QZSA 4JA7A 5JJTA 3OKPA 3KD7A 3QHPA 1GPYA 4Y6WA 4HOSA 3RHZA 4WACA 2BGTA 1L5SA 3CVNA 3CK8A 3TG4A 4BT9A 2G9UA 2ACWA 2GM9A 3CUWA 3WADA 4WHMA 2PQ6A 3ULQA 3NF1A 2R4TA 5TMDA 3Q15A 1GGNA 3JYSA 2XCIA 4CTNA 3AMVA 3MT9A 4WADA 3C4VA 4U0UA 2KS6A 2ZB2A 3CEQA 4HOQA 3G2JA 1FTQA 1NOJA 4AIFA 4A1SA 1AXRA 1RZVA 1NZNA 4AM9A 3G2IA 4NQ0A 4ME2A 1BX3A 2OFFA 2XEVA 3FP3A 3Q49B 3ZCSA 3BEEA 2OOEA 3SYRA 2PYDA 2I6HA 3VTXA 5AYWD 3BDAA 3G2NA 3CEJA 3BD6A 3GUHA 2YJNA 3S28A 2BGUA 3E4BA 4KBQA 4REMA 3IEGA 3C48A 1HLFA 4KQ2A 5BT1A 3NPAA 1C50A 1NZDA 4BQFA 1K08A 4MRAA 2GT1A 2H1HA 4U07A 4BFCA 1HH8A 2XGMA 3CK9A 5JTUA 4MI3A 5BW8C 1Z6PA 1O6CA 4BTAA 4MHSA 4CTOA 2GPBA 2UWJG 5KJKA 3T7DA 3ZCTA 4G2VA 2C9ZA 3OTGA 3UUXA 3MTAA 2JLBA 3FROA 1P5QA 1IXYA 4GA0A 5FJYA 1F6DA 5KJMA 3OXLA 2LSVA 2PRIA 5DBKA 4W9RA 2MHKA 2FBNA 3HBJA 1B4DA 3QWVA 4BQIA 1NLMA 2GPAA 2XGOA 4NESA 1JIVA 2QRHA 4WNEA 1GZ5A 2R4UA 1QKJA 2IEIA 3TSAA 3Q3IA 5EX3A 2E2EA 2QRMA 1UZUA 4IN3B 1Z6QA 3FFLA 2Y4UA 2FEZA 4BT8A 2F3PA 1XOIA 4YNDA 1L7XA 3IAAA 1RRVA 1FA9A 2BISA 2KATA 3RO2A 2FETA 2QFCA 1ELRA 5JJ6A 2XA2A 3Q3EA 2IYAA 5ENZA 3MT8A 4YI3A 1VGVA 3DZCA 4GPBA 4RELA 2P58C 3OXFA 4EJ2A 4KYOB 2PL2A 3MS2A 3SZ7A 4GYOA 4AMGA 3Q5MA 2XPIA 1IIRA 4WNDA 1NOIA 4G26A 3SF4A 4XIFA 2DBAA 3OTHA 2QN2A 2SKDA 3HBNA 3MEKA 5HQ8A 2J9QA 3L7BA 4BWRA 2C0LA 3TOVA 5TMBA 3RT1A 3OKCA 3UPVA 3RO3A 4RIIA 1H5UA 4I1AA 5IKPA 1PC2A 4LEIA 2F9FA 2IEGA 1TJCA 3HBMA 3MTBA 4JHRA 4AY5A 5D01A 4RIGA 3RKVA 3OT5A 3PE3A 4RG9A 1WV0A 4I2WA 1P2BA 1XC7A 5DXFA 1XL0A 3NAZA 2FFRA 1IHGA 2WTXA 2QLMA 3MBOA 2R60A 1UQUA 2QN1A 2AW3A 2AMVA 3MS4A 5TVGA 4GCNA 4GYWA 1LWOA 3ZCQA 3D0QA 2HR2A 5TMEA 4EL5A 2X0EA 3DD1A 4AY6A 2IFUA 2GEJA 2R5SA 4UQXA 3VTYA 2XMPA 3O48A 6GPBA 4F3VA 4X7MA 4GZ3A 4N2SA 3MTDA 2VGXB 3CK7A 4G25A 3MSCA 3LYAA 5ARFA 3VDMA 3Q47B 3MA5A 1KTIA 3HBFA 1NA0A 1QQEA 4H7YA 3TGOA 3G2LA 1QZ2A 2X0DA 4LDPA 5A7DB 5M72A 1QM5A 4GA1A 5LQDA 3AS5A 3HYMB 4G1TA 4O6FA 1GFZA 4Y6CA 3CKCA 4HLNA 2ASVA 4QLBA 5D0OD 1GPBA 3ESKA 1NOKA 1PYGA 4N3AA 2FI7A 2ONDA 3T5TA 2H1FA 1A8IA 2C1XA 4CGWA 2QN9A 5KJLA 4GYYA 1C8LA 1WUTA 4RIEA 3MQFA 3T3DA 2YQ8A 1P29A 4I9CA 1E96B 3QOUA 3S7BA 3LPZA 2GEKA 1WW3A 4N5CA 2XGSA 4J8EA 3RJVA 3N71A 2QLLA 1ELWA 2F3UA 5G04J 2BUGA 2VYIA 2GJ4A 2XCBA 3UQ3A 2VSNA 2VSYA 5FT9A 2VGXA 5ARGA 2R66A 2XA1A 2QN3A 3GYZA 1XKXA 3LY9A 4UI9J 2Y4TA 5CHEE 1EM6A 4FZRA 1ZBPA 1KLXA 1FU7A 4X7RA 1WV1A 1EXVA 4N2QA 4BTBA 3GZ1A 3L01A 3WAGA 2X6RA 4G2TA 4EL0A 1Y8ZA 3ASGA 2R68A 1NA3A 3E3NA 3LKUA 3OY7A 1P4HA 2ACVA 3H4IA 1KT0A 3VUFA 3CEHA 4I2ZA 3MS7A 3EBPA 3RSCA 4JA9A 2JJMA 2KC7A 3R9AB 4W6QA 3IA7A 1FCHA 2FO7A 1GG8A 4MICA 4BQEA 4YI5A 1PNVA 1C3JA 2C2LA 2VQ2A 2QRGA 3T3EA 3QKYA 2FF5A 1P2DA 2QNBA 1JG7A 3H4TA 4YVQC 2HYZA 4Z5XA 2HO1A 4KQ1A 3U4TA 4F9FA 5DIZA 3D0RA 4EKYA 1Z8DA 2C1ZA 3ZN3A 5FZSA 1PN3A 5FZRA 3OTIA 5D00A 4WNGA 3QWWA 4KQMA 3RU0A 2IUYA 3CVLA 2XCUA 1YA0A 5LCWC 3E3LA 3S2UA 3SYMA 1JIXA 2C0MA 3WXXA 3RSZA 3ZCUA 3URZA 2IV3A 3S7FA 3COPA 2NC9A 3BD8A 4UQZA 1FC0A 3ASHA 4GZ6A 5G05C 4J0UA 2VCHA 2PQRA 4J8DA 1Y6GA 3GW4A 4EKEA 4M83A 3GZ2A 1A17A 5FTPA 2SKCA 4U04A 3NP9A 4GZ5A 3BEOA 3BCUA 4I9EA 1WW2A 2PYIA 3NB0A 4J8FA 4AMBA 3BCRA 5LCWJ 4M60A 1Y8MA 1P2GA 2IYFA 4XI9A 1IYGA 5GPBA 4F97A 2Q7FA 1L5RA 3CUVA 5G05J 3CUUA 2PZIA 2JZCA 1P4JA 3ZHEB 2G9QA 4RIFA 3T3GA 2BFWA 3CVQA 2X6QA 1JIUA 3L79A 4JL0A 2YHCA 2PRJA 2O6LA 1E4OA 3C4QA 3EDTB 2ATIA 5IKOA 5I45A 3MRVA 1HXIA 2X0FA 4N3CA 3S0JA 3PE4A 2VCEA 3ZPJA 3CUTA 2G9RA 4MHOA 2IW1A 4X6LA 3OKAA 4NRHB 1KT1A 1K06A 4N3BA 3ZFWA 4F96A 5D0QD 1XL1A 1OUVA 3DDWA 1Y6FA 3Q3HA 5G04C 3S7DA 1WM5A 1M5RA 8GPBA 5JTTA 2KCVA 4U0ZA 2IV7A 3CUYA 1L5VA 3O3CA 4NC9A 2FF4A 2AVPA 2VGYA 4UI9C 4UQYA 4N9WA 2AV6A 1J39A 4I17A 3U3WA 2F3SA 2LNIA 4M7PA 3ZHEA 3MV3B 3CV0A 2QN7A 2QN8A 3ASFA 1YGPA 2XCCA 2GW1A 4L22A 1YA6A 4EQFA 4RIHA 4U0SA 1V4VA 5A6CA 3QKWA 3GPBA 1LWNA 2HY7A 4CTMA 3TG5A 3CX4A 3TAXA 4ABNA 3OXGA 7GPBA 3EBOA 4PQGA 3CEMA 1SXQA 4RBNA 4APOA 3BD7A 3FWVA 5CCLA 2KCKA 5KJNA 3ZCPA 3QWPA 2LSUA 3ZGQA 1JG6A 3NCHA 3MRTA 2UY1B 3LCAA 2VG8A 4FKZA 3VUEA 4YUAA 3S27A 1W3BA 1FU8A 4YVOA 4KXKB 3MRXA 3ZCRA 3ASDA 4G24A 3CKBA 3NC4A 3QDNA 2P6PA 3Q4AB 2G9VA 2V5FA 3MKRA 1XV5A 3G2KA 5DLDA 3AS4A 2F3QA 3DDSA 1L5QA 3CVPA 3S7JA 4B94A 4RG6A 4CDRA 1GPAA 2PQNA 4X7PA 2Q6VA 4GCOA 5EKQD 3BCSA 5HXAA 4G23A 4XI0A 1WUYA 1RZUA 2GPNA 3T3IA 5BNWA 1ZU2A 3K9IA 1L5WA 4N39A 1SXPA 1HZ4A 3NP7A 3L7DA 1C8KA 3LY8A 2C4MA 1PSWA 2SKEA 2QRPA 4NEQA 4AN4A 1FTYA 4RENA 1Z62A 2WPVA 3MT7A 5CCMA 3OY2A 3VDNB 2UY1A 3RIBA 4WNFA 3E3OA 1FTWA 4HOTA 1B89A
chains in the Genus database with same CATH superfamily
5K2MA 4LV5B 4ZVMA 4BBZA 1WVIA 4QYXA 2BMVA 5F5LA 4B4DA 2I4IA 2KXPC 3LCUA 4TSFD 4YXFA 4JP5A 3RVDA 5IJZA 4DA8A 2DWCA 1VMKA 4IMIB 4RSHA 4JT4A 4AG3A 1N3BA 2GVZC 2YMLA 5A3VA 3FYSA 3PJRA 2HXYA 2AC2A 1IJKA 3S8EA 3E7PA 3PVLA 4IJ5A 1S63A 4BLWA 2J0VA 2R1VA 5KHLB 1UPAA 4WKNA 3TDNA 3WWZA 3J81k 1I3LA 4PG6A 4MKFA 3FPSA 2RSLA 4UHFA 1EZZA 4NG5A 5T4YA 5KOYA 3NVDA 1HZZA 5CLLA 4NVRA 2R17C 3A1WA 2VA8A 2PX3A 3CLHA 2FRVA 1J8FA 2JJ8A 1ZOLA 2W8BA 4RLHA 5IUKC 1SXGA 3B3AA 3TUZC 4MR7B 1H0SA 1QKJA 4QFBA 4BNIA 3N75A 2LIPA 2Z9BA 3FUKA 4G65A 3PXCX 1C3OA 1BDHA 4J3JA 4DANA 3W2FA 1Z0FA 1DKOA 5BURA 4Q6WA 1QPZA 1RKUA 2D1TA 4QTYA 2A0YA 3OXFA 3MQ2A 3UT6A 3GF4A 4F11A 5AENA 4BNJA 4YJDA 1UXHA 4YQEA 1MA3A 3FNEA 1I1NA 3PJFA 1QIMA 1Q1NA 4R7ZA 4H17A 3IA2A 4C4TA 2J3QA 3HVEA 1NBEA 3Q11A 2QN1A 1NG1A 5ARBA 3CISA 2WU0A 2C98A 2BHSA 1PR9A 2V8BA 3EOZA 2X40A 4CV2A 1Q0ZA 1ANKA 1QVRA 2Q9CA 1QQEA 2AZTA 1DBRA 4H15A 4E6HA 5CJ2A 4FZ3A 1ZN9A 1MAAA 1FVHA 2PQ0A 2QRUA 3I73A 1F3LA 2FQYA 3KSQA 2XGSA 2F3UA 1I2AA 1VFPA 1I14A 1HDRA 2QQEA 1E2HA 4B7UA 1CYDA 1KERA 3NOVA 1V4NA 1IM2A 5DTIA 3CN7A 3PXDA 4Z9FA 5ALJA 1HLPA 2C99A 3FNIA 2NYAA 3KCQA 1EFPB 5DV9A 1DT3A 2EG9A 3PX7A 1PGPA 4N0MA 2Y9MB 5C80A 4QWWA 1GUDA 2W00A 2P9ZA 4D81A 3N7AA 3T6KA 1LK5A 1CQZA 3BL6A 4MGIR 5LU8A 1UIMA 4TTIA 2XVYA 2ZI6A 4ISCA 3NQPA 2EFHB 2WC1A 1QV9A 2XTZA 2PJUA 3E3LA 1UDRA 2D6FA 3BFKA 3CVWA 4WL0A 2Y0BG 2OB1A 4PZDA 1ZBDA 2G5TA 4MWSA 2F3RA 2R87A 2CLEB 3AW9A 2XNKA 3R6GA 1LZLA 2JZCA 1EUDA 3DO8A 3AFGA 1RBYA 4UEWA 5DNCA 1E90A 1QP8A 1N4PA 1XVIA 4R6WA 3ZYZA 2G9RA 3QVMA 5B7NA 2AI2A 1P74A 4E1BA 1TJPB 1NU6A 2NVBA 4IDBA 5NULA 5E76A 2I6UA 4FDLA 4FHJA 1OZHA 1M33A 4WDRA 3A26A 2Y1XA 2R7AA 1OLSB 2XB6A 4AG5A 4K0KB 4UDXX 2L0IA 1N5KA 4NBTA 3D2BA 4V1CB 4BHTA 4GE3A 4MKRA 4Q19A 1ZGHA 2AQHA 4F9TA 2XTAA 4Q48A 4YN3A 4Z53A 5IARA 4BP9A 2COEA 3SZLA 2RDMA 1A1SA 4NZMA 2ZJ1A 1N4AA 2PMKA 3KKLA 3O7MA 4AZ3B 3JQGA 1ZSVA 4O4JF 2BY4A 1YFLA 5AW8A 4L4ZA 2XX3A 5PGMA 1XO1A 1P9OA 4G23A 1SBTA 3K9IA 1MZVA 3IAS1 3ECCA 1C3LA 2PBRA 4BCCA 4D3SA 1EB9A 4D98A 2HHCA 4UXHA 5I5EA 2ATXA 3KWFA 4K6OA 4WERA 3RNLA 4B3CA 3VNUA 3VZBA 2BSAA 3T0GA 1JEJA 2QLNA 4MXDA 3K0CA 2ZJZA 2P27A 2H1CA 2XCLA 1FP4B 3WLQA 2V0GA 3K2BA 5JEDA 1Y42X 5HKPA 1ENPA 2PMBA 1LBEA 2NXEA 5CFOA 3WADA 3DE1X 4IGKA 4HZIA 5J4VA 5KTRA 5GONF 3RRFA 4G01B 1M74A 2CLCX 5AVKA 3RADC 1UT5A 1ZH8A 3QH4A 2IHTA 1V47A 5JSKA 3IPAA 3M0EA 1Q17A 3P20A 5AI8A 3PC4A 4Y1EA 3Q9UA 3H9QA 3OC6A 4B3TB 4BO4A 2O05A 3G2UA 2IX3A 3V7NA 2P68A 4FLFA 2GD2A 3ABIA 2JGLA 2ISSD 2PCLA 5JISA 3PEVB 1DL5A 3B9PA 1VL6A 2XBMA 1L4NA 4EGAA 4P31A 1B0AA 2GEDA 5E8RA 2C9BA 2G4VA 4Z0NA 4DLNA 4CMBA 4YACA 3W5DA 5A5GA 4UYKB 1PEKE 3U3JA 1O89A 3HCEA 4M9XA 1W49A 2ODPA 2D1QA 5E6UA 2EP7A 3P2MA 5FQ7A 2BTEA 4G5QA 4OBXA 1U0OC 4TS9A 3GGOA 3D2LA 3O21A 1AM4D 1WXGA 4WQMA 2I7DA 4ZVRA 2V9CA 3OPYB 2Y0PA 4UUOA 2D2FA 2C88A 3E0XA 4QGBA 3IT0A 3KJIA 4HAVA 1N6PA 5KEIA 2I2FA 1LPAB 1HE2A 2BH9A 1Z6XA 4US0R 3BZBA 5JA4D 3G68A 3T99A 2GEJA 1TL7C 4I1UA 5B3JC 3DKVA 3CMMA 3QHAA 1Z16A 1Q7EA 3THOA 2ZDGA 3CO5A 2BFFA 3F6EX 4CG0A 2A94A 4YRFA 2I1WA 3HYLA 5HF6A 1JDZA 3GR6A 3QXXA 2ZWPA 5CHYA 4C2BA 4FK8A 4Z3DA 1X5BA 3C5VA 4ASUD 2DWUA 1H2TC 1TQHA 3EXHB 1IZ0A 3TINA 2FV8A 3CN9A 3TTVA 1J9GA 3CWCA 3FWYA 4AY3A 4JLDA 3PNQA 2B4YA 3TRKA 2WHRA 1WKBA 4IIJF 2L69A 1GUAA 1QHYA 2C3UA 1VDMA 1XN1A 5ESDA 4XYLA 2HA2A 2D0DA 3NT5A 4AUEA 3IULA 5DTRA 1PDWA 4B9EA 3FSRA 1BW9A 2PH5A 3FGNA 1JNZB 4PVCA 4GKBA 4KZCA 2J3HA 3I23A 4C06A 1TKAA 1BD4A 3CLJA 4YDWA 1RFGE 1EI9A 3WFJA 3WGHA 1FRFS 3PLAE 2PSSA 2WUGA 4JL0A 4LZPA 5CD9A 3IV7A 1GNRA 2D62A 2PGJA 3PC7A 3NCTA 4BMYA 4X63A 1G0NA 1GW6A 4I1MA 3LUFA 4OATA 2F67A 4U0ZA 3M9XA 3STVA 4LZNA 1CUCA 5IVIA 4EG5A 4HVTA 2PO5A 2QN7A 2ZBPA 1RAHA 1J2YA 1TO2E 2DHRA 1O9BA 3UV7A 4ZYUA 2GEUA 4MUEA 3JD4A 3WJ1A 4RAOA 5AM0A 3NCHA 2FUCA 4RCZA 3KQVA 4C7JA 3HUUA 1I3CA 1JB1A 1HO3A 3RIMA 1YHZA 3HJUA 2AS0A 1SKMA 2F3QA 1D4AA 2BHRA 2GD1O 1L2TA 1Z4QA 4KACA 3KB6A 3I9V6 2PZKA 4X54A 2JK0A 3QEAZ 1HOTA 1USVA 3ABKE 4EHAA 4ZVPA 2BKLA 1FF9A 2JGRA 4EPRA 4CFYA 4UHEA 4IL5A 5F9HA 1ZXBA 1PZEA 1N9AA 3WLPA 2OK7A 4ATGA 1US8B 1V11B 3LNCA 3NBQA 3HS3A 3T3HA 2OHVA 5JW6A 2RBGA 5HF9A 5I51A 4EGJA 4MCJA 4C5CA 5LM3A 2FMUA 4WK4B 4IG9A 1W0JD 3IEXA 1UDAA 1VI6A 1FYFA 3HDGA 3F7NA 4TN5A 2BGTA 1L4BA 1TZBA 1TEHA 4R8VA 1XZCA 4F56A 1GGNA 3AEUB 1M2OA 2IY9A 3G9ZA 4O1MA 1HS6A 2GSWA 1U3TA 4EPZA 1DAEA 3G2NA 1E6CA 2AEMA 4GTPA 1E8YA 4G9BA 1KJIA 1PR3A 2NAPA 2RIRA 4RO0A 1CFJA 3DMFA 2ZIRA 4M8NE 2CHVA 3ITKA 4FFPA 1CK4A 3D6NB 2WG0A 1T4CA 4FE3A 2I54A 2HJHA 3T7DA 2EZ4A 1JCSA 3PU6A 2X42A 4D26A 5CFQA 4R1PA 3DL4A 2NTVA 3TPFA 1GVHA 3QWVA 1PIWA 2Q5CA 5FA5A 4RWEA 2FZLA 4I55B 1KJZA 4XWAA 3ESRA 4N76A 3ZU7B 2PXXA 4ALNA 4HXYA 2EZ9A 4B85A 2CNBA 3HCFA 4CM9A 5CCEA 4D9JA 5LKRA 4NCHA 5K51A 4ARSA 3ZNOA 4NOMA 2RHRA 3SU8A 1NJGA 1UWLA 5P21A 1XZQA 4C4YA 3TXMA 1KK1A 2OSBA 2ESRA 4MIYA 2XMRA 3NTQA 5K09A 1U8ZA 3HPQA 4M99A 1YZKA 2FFHA 2VNKA 2C54A 2CJFA 5EHXA 2ERXA 3PVCA 4JR1A 5CA0F 4QU9A 3OP1A 1H2YA 4XH9B 4QOJA 1RADA 4FWBA 2X6TA 3O0TA 4BNTA 2V9PA 4H7YA 1Y9JA 2P9YA 3IR7A 1VHJA 2ECKA 4CKYA 3ESKA 5CGQB 1PDOA 2ZSEA 4FNMA 3FVVA 3ETDA 2E1RA 3FDXA 1SVSA 3ASOE 1XJQA 1XX6A 2ZU0C 5HCUA 1G5FA 3I8XA 1IBMB 4NU8X 1VECA 3LPZA 4MTCA 1JR3E 4LJ7A 2F55A 3AV3A 3EZ2A 5AUPB 1YBHA 4A4DA 2WWFA 2RHBA 4N2QA 5GM1A 2IVZA 1X2BA 4LNUB 3PR1A 4LCTA 2R6FA 3VR6D 1DKPA 2CVQA 3PENA 1FCHA 1L5GB 4KV9A 4TWJA 3PDIB 4UULA 2O0JA 3TIFA 2H6EA 1M2HA 4RJIA 3AQIA 3PGLA 4KVOA 3IEUA 2HQBA 2I1LA 4LSZA 5E2BA 5DNYB 1JNRB 5TF0A 3UTDA 2QY7A 1I1QB 4LFCB 1RM3A 3A25A 1D2CA 2HCJB 2WA2A 1H9BA 4F21A 1IM8A 2QW8A 3IELA 3DOHA 4G2NA 3QHQA 2OLKA 3K0AA 4GH5A 1T36A 4GLBA 3T8MA 1PHRA 2FQQA 2FGKA 1A8HA 4JC4A 3DBVO 5LA6A 2NOAA 3M6VA 2HLDA 4HNHA 2P4SA 3B5EA 3GUZA 1QANA 2VDJA 1FB5A 3CLUC 5DISB 3ICOA 2XMQA 3KTFA 1JA1A 4GLLA 4MVJP 3UWMA 1L8XA 3IIKA 3ADPA 3AUTA 4CKCA 1IY2A 1KR2A 2Z83A 2LSUA 4IUDS 5GV7A 2GKSA 1RI5A 1CE8B 5G4KB 1U3CA 1W8DA 3G13A 3GJYA 2UDPA 2BGNA 3MIIA 3N3BC 1N8SA 2WOOA 1RKBA 2OKGA 4YONB 3SD7A 4ZC1A 4BU1A 1GARA 3FDFA 1QPBA 4MIKA 2X0RA 8AT1A 5BW5A 2VUUA 2A1TR 4JXKA 1YAJA 4YT4A 1KMHB 2BTDA 9GPBA 4FOLA 3DHYA 1A4XA 2WXHA 3LECA 4YP7A 3C3WA 1HPLA 2XNHA 1IG0A 4A8JA 3F5FA 4G41A 1NVKA 5JSZB 2Q1XA 2H6IA 2CFOA 2H2GA 1XXHE 4E51A 5FBRB 4Y0NA 2XUQA 4BBPA 4JYAB 3KL4A 5L3QA 1H2RS 3N8DA 4Y6GB 4FR0A 1N6OA 2WXNA 1NOJA 2EHJA 3LUPA 2JVJA 2E85A 2I66A 2RH5A 3KQWA 2WV7A 3PNLA 3BWMA 2YWXA 3PUWA 1NAHA 2B83A 4K3UA 3FIUA 4CN9A 2Q46A 1F4VA 2WV9A 4WXYB 2EZTA 3RYFB 2HCFA 1WPXA 4C05A 1P7ZA 2H9IA 3PXUA 2YZ7A 3NYQA 2QNRA 1TM4E 1D6SA 1KI6A 4MLPA 1W0CA 3SSOA 3KLMX 3B60A 1AT1A 3HU2A 2CXRA 4KYVA 4Z6KA 2IO2C 1E1RD 1BHJA 1G5QA 2DUMA 1RCFA 2F3PA 1NMZA 1VBFA 4KSCA 3D02A 1EUYA 3P5BA 5JJ6A 2E7ZA 3P2BA 3KJZA 4I5GA 4ALKA 1IBLB 3MD0A 3CGWA 1Z3YA 1NUTA 4Z0PA 3E58A 1FX1A 1GL9B 2NMVA 1XVVA 4AKEA 5FWDA 1TJNA 3HBMA 4NJMA 4D0RA 3V79K 3E18A 1VGRA 1ZBQA 3FOCA 1N5DA 3ROMA 1NW7A 3JQPA 1MQSA 4RY0A 1SHJA 4O4IA 2GF2A 2QTWB 3IE1A 2HV8A 2CXPA 2O1SA 3FOFC 3NJ4A 2HF2A 3ZD7A 1MGPA 4RSRA 2GH1A 4MMZB 1NXXA 4UQXA 1D2GA 3OEHD 3BSWA 2BF7A 2CHQA 3FYUC 2O57A 1H8HD 1O4WA 3PX2A 1BDBA 4Y6CA 4P83A 4XR9A 1KZ4A 1LDMA 2C7RA 3VR3A 4M7WA 3T7RA 5JXIA 2ONDA 1R4NB 2EJTA 1GYQA 4TTTS 2TMGA 2I1VB 3MMXA 3OVMA 1WX1A 4ENQA 7ADHA 1E1CA 4AZSA 1ZVVA 4MEBA 4JUDX 1EEHA 2HXGA 2Q5JA 1U8TA 2P9EA 3C3AA 3HKDB 3JQFA 2GBIA 4QE3A 3ZXIA 3TQIA 3UNXA 2VEOA 3ORSA 3B85A 4JH0A 4DI3A 2GZHA 5G0SA 2P5YA 2X3MA 1M6YA 3AR8A 3WHKA 1Y9DA 2WMNA 2QRGA 1SKYE 4D9NA 3K94A 2V8SE 1VC2A 2J7PA 2ZK7A 4KQ1A 4LOAA 4LXQA 4LFBB 2FPMA 1KJ8A 1NFIE 3IQWA 3PSHA 3C5WP 2MSKA 1OB5A 2HF8A 5B37A 3OCCA 4XQEA 5L7YA 3OM1A 2DJIA 1WW2A 1L1QA 3LW8A 1KFCB 5A2GA 2IP2A 2WWIA 3ENZA 4RANA 3IT3A 3CHSA 1KEPA 3L4EA 4DVJA 3P9YA 3C5EA 3O4JA 4C5BA 4KVMA 3AHIA 3BFVA 5T4EA 4ND5A 1IPEA 1GLNA 4I5DA 1DQRA 1VQ1A 1MORA 2VJOA 1AUOA 1PFQA 5BR8B 1D9SA 1M5RA 3AUFA 2J0UB 1BQEA 2AF4C 4YRTA 3MYYA 2J87A 4L76A 4QYMA 4M7PA 1J9ZA 3HV0A 2IYQA 5BV2P 1V54E 2XI4A 4LKOA 3DSVA 2Y6UA 3KPYA 3F3MA 5CDFE 3DFKA 5HDBB 3ZR4B 4RQBA 2BZGA 3WLAA 4S24A 4YCLA 3PREA 2EC5A 3HXKA 4QICA 5AVWA 4B4OA 4C9BA 1HO8A 3AFIA 3OCJA 4DYHA 2E37A 1SXPA 2JEKA 3DEZA 4AD8A 2OCAA 1DO0A 1TM7E 4K28A 2VJDA 5ALFA 2IEAA 1F2UB 3A2KA 1X6VA 2WWRA 3CV3A 3D1JA 3H2KA 3M70A 3GX1A 5LLSA 2WZDA 5IK2A 2D5IA 2EIXA 2ONJA 6NULA 5LP6B 3KIPA 1T91A 2CCGA 2CFRA 3W34A 5G2NA 4Q1CA 5GZ3A 2RB4A 4LSMA 2FR0A 1QFMA 2I8AA 2B1IA 1J49A 2JBAA 5DPMA 2G07A 1WW8A 2P3LA 3QWAA 1QZ3A 1QHXA 3QUAA 1TR4A 2A90A 1TN6A 5AYWD 1ZK2A 2C5SA 2GUGA 1PF7E 4W6ZA 3O8NA 2HSWA 4XDYA 5IVKA 1CVLA 3TQCA 2RONA 4E4YA 4ZHBA 1YR3A 4C04A 4DDMA 5U4XA 2JRLA 4J4TA 5AD1A 3PKIA 4OAUC 1J6UA 2JD2A 4J2TA 1P2SA 3A9SA 2C5FA 3LM8A 4TUUA 1SCJA 2FZKA 2QRHA 1GKIA 2AHRA 3IOMA 4UWGA 3THXA 1EUCA 4PTYA 2ZR7A 2UAGA 5JNTA 3BTOA 1EIWA 4PWZA 1QF9A 3GGGA 1JR2A 1T13A 1QZUA 5REQA 1X77A 5JSUA 4G26A 1LJLA 4G0WA 4EJSB 1T4BA 1JSXA 5BOSA 4YLYA 1EF1C 1Q7BA 4UYJB 3OWOA 4C4PA 3QX3A 1IN4A 4D3YA 1V16B 4AJ9A 5K6RA 1LX6A 2VTDA 5CXUA 2R0QC 2PM6A 1K97A 2JL1A 1AMUA 4ZVNA 4MWOA 1E8DA 1AJEA 2VPPA 2FO1E 4ZQFA 2CVFA 5AR1A 1U81A 2GYWA 2WFLB 4M1WA 3T7JA 2ILRA 5L40A 5BSFA 3H13A 5BWLA 4ALMA 1G2QA 1GFWA 1XCJA 4QOEA 2GGSA 2BKVA 4ACAA 5CDHA 3A28A 1VBMA 1GPBA 2ONZA 2HA0A 1VIVA 1T5IA 3LXMA 1H5QA 4QFCA 1Z07A 5CPFA 5KBAA 2W2MA 2DRIA 2DFPA 1G6Q1 2GX6A 3FU5A 4C7VA 1P6XA 4I1YA 1T1EA 2IOHA 3ZBTA 3WYBA 2EKLA 3EHMA 1TOAA 1KH2A 5EMMA 4P34A 2YS7A 3NWJA 1DADA 2QJRA 2GERA 2F1JA 2C5AA 1O6FA 4Z3OA 3P96A 1CZHA 2LZ0A 5FWYA 1I4TD 2KQUA 3IAHA 1V7CA 2WIGA 1PFUA 4NG4A 2CXQA 1PAQA 3KAPA 3Q1LA 2FF7A 1ZVMA 4K88A 1A2QA 4YAEA 3A3KA 1POXA 2CMGA 5F7XA 2IZ7A 5BWCA 2X5TA 3ZCUA 5HQ3B 3ETLA 1AKVA 2X13A 3COPA 1RZRD 3MSXA 2AUMA 4UQZA 1ST2A 1E7QA 4KKXB 5AVVA 3BA1A 4RCYA 3R5KA 1DQZA 2DFKB 2ERYA 4NFYA 1JFVA 4KPUB 1YR2A 4MUMA 3M4ZA 1J8QA 1FP7A 2OT3B 3WNVA 2Z30A 1ZD1A 4W1RA 3C3QA 4BMCA 3WKDA 4TLBA 4MK4A 4B6EA 1T2EA 4JW1A 3QLVA 5B1SA 4KL8S 1C0IA 2C5HA 8GPBA 4MQ5A 4OB7A 2HWKA 4B44A 3KQHA 3TYXA 2QYHA 3I4CA 3T1HB 1QB8A 1SUIA 4QGAA 1A82A 3ZHEA 5DHAA 5JBNA 2WR8A 4Q1EA 2PM8A 1CXZA 2ZUFA 2GW1A 1Z2CA 1QFJA 2JGNA 5CIWA 3BHIA 2AT1A 1MW9X 5ULLA 4RS3A 4FFVA 4DKJA 3ISVA 1WNFA 2R02A 4PXAA 1Y3IA 2XY4A 1AS0A 1S3GA 2PPVA 5DLDA 3I9V1 2HE0A 2QTNA 4OHWA 4H7PA 4DJAA 1EGVB 2LAIA 3HXBA 5JH7F 4NBKA 3A1UA 2Z98A 3TWOA 4KIJA 1RHKA 1RHRA 1J21A 1H4VB 2R7LA 4CNBA 2WD7A 4HLUA 721PA 1M10A 3CCFA 2O4CA 1SCNE 2LBPA 2R1VB 3OOWA 4EI8A 2XEEA 3RW9A 4G81A 2QL7A 3SM9A 2Q3EA 5E0KB 3O4HA 4N0PA 3AAAC 4P3XA 1Z8NA 4X1YA 3O4IA 2UZ3A 3AFMA 1WCXA 1HLDA 3W5BA 1W76A 5DCWA 1Y9ZA 2ZXWE 4Z54A 5IAKA 2EX1A 2R1ZA 3B7WA 2AXNA 3U09A 3MT9A 2OCGA 2C59A 1YQWA 1ESEA 2VBCA 4YUZA 5AQ7A 1PQPA 3QBDA 1E2NA 3A6FA 4CR6A 3O03A 2C2KA 1Y5IA 2W8BB 1KDYA 4LXGA 1JXOA 4BMOB 1XA4A 1U1DA 5IAAA 1C3OB 2FN4A 3EDQA 2ZRCA 3CK9A 1O0SA 2YZMA 1U2RA 2VSOE 4GX2A 3TCNA 2BMJA 4XQ0A 3ENQA 3CT4A 3DLIA 4LYJA 3ZE0B 1RZ3A 4YS6A 4MW6A 3ONLA 4FYJA 2XXAA 1ML4A 2VJLA 4MLDA 3QF4A 1FYDA 4BT8A 1NW6A 5EP3A 3ZGLA 1JNYA 1SOAA 3DDNA 1V5WA 2Q6KA 4R9RA 1KNQA 1R4ZA 3IHYA 4X64B 2E87A 3HVEB 3RUDA 4YV2A 4CQJA 1XZIA 4G5OA 4Q96A 1WBDA 5BPFA 3PZDA 2NU9A 1VXRA 5K6AC 3RVMA 1IE3A 4RMNA 2XYGA 1UEIA 3FZQA 3JQEA 2ONYA 1FUUA 2XRMA 2FG6C 3F6PA 1YOVB 3BJIC 2QRZA 1NI5A 2B0JA 3JZDA 2BEDA 1LJ8A 3ZNPA 3K8QA 4CETA 2P62A 1I3KA 3IX7A 3MTDA 4G25A 4MINA 3JY6A 4Y8VA 4GGPA 2O3JA 4MS1A 1ZIYA 4BKQA 2X5GA 4Q3EA 2P9NG 4WDQA 1J2RA 3B7UX 2B21A 4M9SA 1II0A 2D13A 4BZWA 1X74A 1KEEB 1TGYA 4DHEA 1R6XA 2GFHA 4CYMD 2HF7A 2IHKA 5KYWB 2NXWA 3INYA 1WHSA 2P7IA 1A1VA 5TPZD 3HC7A 1U9IA 4IXDA 3O0DA 4AX4A 2GESA 4WBNF 3AF5A 3G8DA 4XGRA 3NASA 4HDCA 3A8TA 3LRPA 3U17A 4EY3A 3ZZ0A 1NNEA 2ZB3A 2YCBA 1ECBA 1RHMA 3SEZA 4GPAA 2FO7A 2ODQA 3HDVA 3T95A 3SZUA 1OCZE 3NYRA 3OQPA 4B5LA 3HWWA 3IMEA 4LS3A 2QD5A 5LDHA 1QBGA 2FR8A 4PINA 3D1LA 1EUDB 2ZJ4A 3J7TA 5CEJA 3IB6A 2VK1A 2IHJA 3Q9SA 1YA0A 2DYRE 4C21A 4ZDKA 5FFNA 3H05A 1YS4A 4YJ2A 2E4AA 1QU2A 1IY0A 5BWMA 4ZP1A 2OP1A 4EX6A 4MYCA 4FILA 4A1GA 1JZSA 4QUKA 4PIVA 3KFVA 3TB4A 4YJKA 3CJRA 3OUZA 5E1BA 3AF6A 5JMND 4LC9A 2YHCA 2X5KO 3QVXA 3UAXA 1Z4OA 2IU6A 3M5WA 3ZZ1A 2ZJ0A 2PRZA 3ZTWA 2PX8A 2H85A 1CRQA 2OG2A 2A92A 4YYEA 5AQAA 2ENUA 3OQOA 4PQYA 1H0AA 4RJ2A 3JQGB 1XZPA 3UJ9A 4U95D 3APCA 1DWPA 1DMSA 2X22A 4UXIA 3JRXA 3K92A 3IVCA 1QYCA 3UXMA 4MVJG 1Z33A 2PFSA 4KX5A 1LPMA 1N0QA 4OREX 2YZNA 4CEIA 1ZGBA 3GJZA 3A2NA 3A6KA 5JXWA 4QQRA 2DPGA 1DWOA 3S81A 2HQSA 2W71A 1JG6A 2PKQO 4HCJA 3ZK9A 4JMPA 3FUFA 3LCAA 2WUEA 3GLIA 4EEZA 3S7TA 1W85A 1AZWA 2GBCA 4GFDA 4DLZA 1T9KA 1G64A 2LD4A 1I7LA 4V2IA 4HLCA 2PUCA 5C1IA 3ADCA 4WOBA 4GMXA 1S9DA 2GPNA 1EDBA 1MB2A 1S3IA 4ILEA 3R24A 1U7HA 4X1OA 5JPCA 1FL9A 1Q0HA 2CCKA 1P61B 2WPDA 3O31A 1RYEA 1HDOA 3MV2B 2ZVJA 1EGMB 5EE9A 2YYSA 1UK6A 3HWRA 2X6KA 1ACJA 2BBWA 3ZS8A 4LX0A 4D82A 5AI9A 4TM7A 1FJGB 3EVDA 1BDIA 1UBOS 1HYQA 2JBHA 1P8AA 2AR0A 3I92A 2VSXE 3O94A 5BSVA 1U7WA 3K9WA 3I8SA 1MQAA 4LIPD 2CL0X 3FOEC 4QELA 3L43A 2A88A 2HJSA 3S28A 3UB4A 4QJ4A 2JH3A 1KOJA 1OAAA 4UNSA 2FFAA 3OX2A 2P6OA 2LKCA 1S2DA 3R9XA 4OL9A 2XCOA 5CCDA 2LDXA 5E6UB 4DOMA 3EOAI 4EY7A 2RAVA 2ZYGA 1VBNA 3Q41A 3FUVA 1NSFA 3TW8A 3H83A 3FFLA 2Q4RA 4PE5B 1RRKA 1IHPA 2PANA 4C6TA 4S1VA 4F6LA 4E2YA 1LTHR 4JBNA 1PJBA 4HKTA 1DTWB 1V6SA 1DEAA 3MJTA 3ONKA 1WY7A 2CV2A 2PL3A 4XQGA 4YXWA 3T0IA 3G7UA 4IOKA 2LAHA 1IOVA 1MBZA 2WSSD 4F4UA 3MBOA 3QAQA 4V0RA 2QYJA 4AL4A 5KJ6A 3LSTA 1K2VN 3DVRX 1PTJA 2IOLA 4L8VA 1E2IA 1JWAB 1WR8A 4MX8A 3S2EA 1T9HA 5LQDA 1BMDA 3O38A 2ZSHA 2A5DA 2XCRB 1BPOA 1C4KA 3SC2A 1A9PA 2Q27A 4RABA 2WTMA 5JAMA 5ELXA 5HW0A 1WW3A 2JGDA 3T4EA 1MNAA 5A05A 4LG1A 3PJEA 2BEUA 3UKJA 4BU0A 3CYFA 3DWLG 3VMFA 4M1MA 1PR6A 3BB3A 4MR8A 1P0QA 3ZLBA 1UMKA 4P3NA 4C3OB 4B71A 2PKYX 3GNSA 5KSPA 4UW9A 2AZMA 1WXQA 3R9MA 1BW9B 2HDWA 3TQSA 3BWVA 4QRDA 4A2CA 2BBSA 4IQ8A 4ACBA 1K66A 4A3SA 1XU7A 1PX2A 2C20A 2AQIA 3LNTA 1EU1A 4Z0HO 2RJNA 1AKYA 4L0DA 5B3SE 1THTA 3CRW1 1Y3BE 5D00A 1V35A 3ND7A 4RMGA 3MAGA 2IY8A 1R0WA 1EA7A 3MMZA 4L02A 1SG0A 4J1QA 5CB4F 2IUSA 1DCFA 4KI0A 1U3DA 1CQJB 5FO1A 3C3BA 1C9NA 2HIMA 3BEOA 2CLOB 4LJ5A 2JH9A 1O6BA 1C2YA 2I1KA 5B2ZA 2WJVA 3AO0B 4GZDA 4JYCA 1ZNWA 3EA0A 1U2ZA 4ZI7F 5BQXA 1QONA 3FA2A 2O19A 4CDNA 3W4JA 3ZD6A 3PWKA 1KT1A 3LLUA 3VNQA 4TZKA 1JQBA 3KM0A 3CS3A 3ADKA 4LJ6A 4KREA 5FUQA 3RREA 3B3JA 3D81A 4P08A 4AUMA 4K7JA 5C0OE 1UPTA 4KVAA 1U4NA 3L18A 1PSZA 3ENEA 3HNPA 5G0VA 1DKRA 2FQWA 3ZVVA 4MW2A 1K9VF 1ZJZA 3PKZA 3LQ1A 4PF1A 3OXGA 3FPAA 1O94C 1QG4A 1E3JA 2W9JA 2OORC 4XYMA 3OJCA 1U1GA 1BWRA 1HTTA 1MB3A 1WMBA 1ZJYA 1NE2A 4N49A 1VOTA 3NHYA 4ZYXA 2Y1LE 2Q0HA 1PR1A 3RKSA 1YJXA 2ZRQA 4I1PA 2WYIA 4FLHA 2Q07A 4AW9A 5K2OA 3BBPA 1TKRA 3ED5A 3FPLA 1UMDA 2HH9A 4KGDA 2OYRA 2VYVA 4QODA 2I91A 1V25A 3L9TA 2BM8A 4WXHA 3UX4A 1M2OB 1GQRA 1O54A 2NU7A 2P9JA 4RHYA 3D3MA 3VC2A 4DHWA 3O26A 1JPLA 3L7NA 1BOFA 4UZFA 3WIBA 4EYQA 4N0EA 3UM1A 4N8EA 2HREA 4YRLA 4M0EA 4GA2A 1U0EA 4X6UA 2WIKA 3ANNA 5ALUA 3V7WA 1NXOA 1X8XA 4KSBA 4CG1A 4QATA 1T4CB 5MN5A 3ICPA 4JJ4A 2GDZA 5LYJF 1ZVJA 1SCDA 3BMCA 3IV0A 4QHSA 3WA6A 4D8UA 4RE5A 2FWRA 2RGBA 3H2SA 3A7EA 4FT2A 3CRVA 1DJOA 3QQ5A 4V24A 2NUAA 4F5YA 5DNUA 4D43A 4OP2A 3QW2A 5C4MA 5E7JA 3F73A 3TRDA 1VKJA 4IGIA 2GZ2A 4UZEA 3C8DA 3NOXA 1BNCA 3CKYA 3W5SA 2V7WA 1V6AA 3APFA 2DSNA 2XCTB 4GGMX 1LNZA 1YC5A 1Z6QA 3LKBA 1AA9A 2GAJA 3LT0A 1LBHA 1T4MA 1ESMA 4LXIA 4CE6A 4K9NA 5JNSA 5SYNA 1CYEA 3NHRA 3LYUA 2XEDA 1H6OA 1KZ1A 3WQSB 3B2QA 5BR1A 1IRXA 3EUEA 5E7IA 2PRKA 2P2NA 1SOMA 1OBCA 2DECA 1Q7GA 3I45A 5IBQA 4KE7A 4TV3A 1UBFA 4KTVE 3H9GA 3K9NA 3C43A 3TEFA 2Y76A 5EYPA 1HUQA 5F3DA 2PT9A 3EGIA 3FTQA 3DTNA 1TCUA 4RPGA 2V74B 2YKGA 3E9EA 2PS0A 2IKQA 5KC9A 4YDSA 3R1IA 1R64A 2W2KA 1WTCA 3HDYA 5C8ZA 5TC4A 5FRDA 4IM7A 3UA4A 3A7DA 1FFCA 1SUWA 3THRA 1ELWA 5A4KA 4DLRA 4KHPB 2YINC 3QLUA 1L4FA 3TNDA 4Y6QA 1J33A 5JXHA 4DF3A 3E2PA 3INNA 3N2LA 3ORRA 3QEBZ 3H86A 3ZE6A 4KQCA 5EZ5A 2GNAA 3DXMG 3G2QA 2AZ4A 1U0SY 4C20A 1T0UA 2KC7A 5DRYA 1PLKA 4XM0A 4FLMA 1WBBA 1YMPA 5CVEA 3U0VA 2OO5A 3V46A 5CNJA 1T36B 2FF5A 2QNBA 1R7RA 3RYHA 4OLJA 3HLYA 4PFQA 5LLDA 3ZGOA 3C3RA 5KPDA 3QFHA 4XWOA 1IRIA 5LA6B 4DDHA 4IJVA 3Q7QA 2O5VA 3DMHA 4MIEA 3GWGA 1BRTA 3FH5A 2P41A 3NOQA 4G84A 1R0YA 4YV1A 3OIFA 3K1AA 1YQEA 5FBZA 4BMSA 5BW6B 2J09A 3C1AA 4C0WA 2MR5A 3HBAA 2X6IA 2XZTG 1GQ2A 4AKXB 3W3AH 3HCRA 5C5DA 2CVPA 3GLTA 1U99A 3LHIA 1NQTA 4CKCB 1JA9A 1QO0A 4H6PA 1N1GA 2VDWA 4I1OA 3T3MB 4MH0R 1Z15A 3JQAA 1SVLA 3K72B 2QDKA 1NIJA 1GGMA 4FFWA 5ED4A 3GVCA 5T57A 4ZZ3A 4U8YD 3DW3X 4DW8A 3OBBA 5ALZA 3S5UA 4K0RA 1U2GC 2VYNA 1F51E 1LWNA 4Q0MA 4CIVA 3TAXA 1MABA 2XOXA 3TJMA 3FLBA 3HY6A 3A6DA 1GDHA 3BIFA 4AF8A 1WCYA 1FT2A 2UUOA 3FWPA 2NO9A 3TEMA 1VLJA 3MKRA 2ENWA 4C6SA 5B7QA 1Z29A 3EY9A 1F8FA 3NHWA 4A8JB 4MB0A 3SM3A 3W3ZB 1N0IA 3K71B 4MJXA 5CVCA 4F4CA 1FZTA 5LQAA 3CLUD 1R0ZA 2NPFA 4YEDA 4ZQBA 3T5CA 3PEEA 2WD8A 2GZMA 4EIWA 4H2DA 4UTOA 3DSRA 1UKEA 3T3OA 5EPEA 5CBPA 5L3QB 2ZS9A 1TJ3A 2FFQA 1M3SA 4HWGA 5ILQA 3CQGB 3A06A 2O52A 4G67A 1S2MA 3QKIA 5IC4A 4CGVA 3PNLB 4GOXA 5FBWB 3FOWA 3F5MA 2UYQA 3AP1A 4BXOA 2OGWA 4RA9A 3I6YA 2F00A 1NC1A 5JV5A 3G2IA 1B8OA 4L75A 5E6SB 1SZCA 5M3BA 2GOYA 4ANXA 3A9WA 5H3LA 5C5IA 1KI6B 1E59A 2QAGA 1PZGA 2ONCA 4RXUA 1WULS 1M0EA 1XELA 1VPVA 2PAAA 1E6UA 3F4LA 5T3YA 4FMDF 1PDVA 5AI6A 4LZLA 1T1IA 2WIAA 4BTAA 4F91B 4G4GA 1GL3A 4O1PA 3ICVA 2Z4SA 5JLJA 2VS1A 2DWZA 3RYCA 1OFHA 2GBFA 3FB4A 1S8NA 3ML9A 4B6RA 2PA0A 3UMRA 4UASA 4HX9A 4JLMA 1ZM4A 4UUCA 5BOVA 1DQPA 1UZUA 4FDUA 1Z36A 2Y4UA 3DSSA 4NJMB 1T0PA 2GPSA 2FUNB 3T9BA 2AXEA 2LR0A 5LDGA 2IYAA 4O4IB 2J5BA 2VHWA 1NF8A 4UREA 1P75A 1TMYA 2XPCA 4W7SA 5IHXA 5IDWA 3HN7A 1DBIA 1SD1A 1V26A 4X8OA 1FQJA 3TMYA 4C2UA 2P9BA 4C88A 2IYSA 2G71A 5CUQA 2JJYA 3KRTA 2HIAA 1KQ3A 1IHGA 1ZHFA 3LPMA 4OXYA 4C43A 1WDMA 4ZI5A 1U8FO 1DQNA 3P0FA 2A9RA 3OLWA 3FHTA 4ZTZB 4D0LB 1NJ5A 2GEFA 5DDIP 1E1CB 1O5OA 5IYZA 2WJYA 2JARA 4NE9A 2A5UA 5AVYA 3AB3A 3OEWA 2ECFA 2QSUA 5FCDA 4G5GA 4V39A 4AVYA 4QRHA 2WMNB 4REOA 5KQMA 3EXG2 4ILGA 3K70C 1YIDA 2RAPA 3FF4A 2BZ0A 3OLQA 3FMGA 1MOPA 4CL3A 4MVXA 3CR7A 2H4XA 4RM2A 4WFIA 5JFGA 1TUBA 3M8KA 3QFFA 3BICA 1Q0TA 1A2KC 4PO9A 3W6PA 5B3KA 3OE7D 2BMAA 4Q01A 3UT7A 1DXOA 2PVPA 3B53X 1MB9A 1SQ5A 2EFEB 5TJ9A 3J80A 1K6JA 1N0UA 3A58B 1N2XA 4N01A 1A5BB 1BLXB 1KKUA 5LJLA 2R79A 4ESOA 5D5PA 1OREA 2OQVA 4IX9A 3IEVA 5EERA 2VGEA 1D8EA 3X44A 1UJ6A 1F17A 5ICFA 3A9CA 1GRNA 2FULA 5HQTA 4PDXA 3ZFWA 4KI7A 3U3XA 4IFIA 5SY4A 3ZDQA 2FF4A 3PHJA 3R7AA 1LD7A 2VQFB 4GAEA 4C9BB 5IFKA 2W6JA 3WGKA 2PAFA 4D99A 4QQNA 1E3IA 3AL2A 1BJTA 3L4SO 4HFNA 3TR5A 2YVLA 3ER8A 1XQXA 1JTEA 4B76A 2BGKA 4AJHA 3OMSA 5DP2A 1AX9A 3AONB 3QGMA 1SBZA 1IUKA 3WLLA 5BPHA 4TZ0A 4UNRA 4FD3A 4KAFA 1OGYA 5NLLA 3NUZA 1GP2A 5GIPE 3EZYA 1E61A 4ZU6X 3AGPA 4URFA 1CC1S 2DMRA 3WIUA 3OIUA 4LYFA 5FUVA 2P11A 2AEEA 2HUPA 5JCOC 4J76A 4OHFA 3K4PA 2HM7A 1ZP6A 4E0BA 2JBAB 3IAM6 3E9CA 2OSVA 3D3KA 3R5JA 2C3OA 4DV4B 1HC7A 2P9KG 2JC3A 4J6FA 1JKXA 1BN7A 3ZE9A 3ZV6A 3QHPA 4JN6B 4CQMD 1H1TA 2KI5A 3KFLA 2XB2A 2GM9A 3ZE7A 2ZYTX 2B1QA 3HJFA 3D5TA 1NQXA 3D59A 4EHFA 1P31A 3D8RA 4NMXB 3RTCA 2PRYA 4IH9A 4CL8A 4BAZA 2YJ3A 3THXB 2WU3A 1EUCB 5B1EA 1DX9A 3Q4GA 4EQ6B 1YU6A 2I2XB 2XYRA 2HKIA 2XMGA 1P5QA 4G8KA 4ZAGA 5REQB 2YOGA 4CMIB 2F2TA 4X85A 3GPCA 1YR9A 2EFGA 4EW2A 4K9KA 1Z4MA 1ODSA 2GBGA 621PA 4EO4A 3UXYA 3F3SA 2WTAA 1JYSA 5F3WB 1SBIA 3G5UA 2NYRA 5D3ZA 3GZTB 4DN6A 2QJTA 2Y69E 4J0DA 2YVKA 2IOYA 8ATCA 5J9FA 3QX8A 4K9RA 4BWRA 1XK7A 2NZWA 3LS8A 4GOMD 3MHPA 3DLHA 4G1FA 1EHYA 4YJ3A 1T8PA 1CY0A 4BGVA 3TAHA 3HJTA 4JYMA 3S1SA 4EFDA 2GCOA 2H7YA 5AN8A 3HN6A 1OXJA 1AHHA 2UYHA 1Y6ZA 1KYXA 4XZ4A 4QPPA 2CNOA 5B58C 1URPA 4EL5A 5I7VA 4WE3A 1HNNA 4RETA 1P1IA 2VHEA 2FDRA 5L45A 4KVGA 3ZY3A 3QC1A 1QM5A 3K09C 5I01A 4DSTA 4HLQB 5A1JA 3GLVA 2VQ3A 4RD2A 1RZ4A 2JLSA 1CF9A 2IA5A 2VDVE 5CYGA 5HBRA 3MNFA 1AQ6A 2P2LA 4KXNA 2ORED 3UJ8A 5JAZA 4HFJA 1U2SA 4O29A 4RXTA 2VRNA 3TD2A 3WB1A 2V54A 4P0QB 2J9GA 4PAMA 1VG9B 3L0PA 1T15A 4MDYA 3QPAA 1T5DX 4U2FA 1RPTA 2C0QA 3E53A 4LRQA 4BQOA 1X38A 1R6DA 2O59A 1GWNA 2QRKA 3S2UA 1W35A 4RVOA 4YBRA 3KT3A 1W94A 3TBFA 2M6SA 3HU1A 3T5XA 5JQWA 1DTEA 2IEZA 5K8IA 4Z4CA 4Q4LA 3NB0A 3UCXA 4E5MA 4UD6A 3W04A 1E9DA 4BO3A 4CLEA 2DUWA 1OCEA 3ZHEB 4FBLA 3L79A 3JPWA 1ND6A 4XUDA 5JQGB 2IH2A 5BN3A 3WOVA 5JD6A 4J6EA 2CXTA 4TMYA 1RWMA 2P9TA 3K05A 4DUPA 3AG4E 4YR7A 1N3LA 1SZJG 4X41A 4RVNA 3PQ3A 1TPYA 4A55A 4EJ6A 1B8UA 3DEFA 2B99A 4YA6A 2FZGA 1I3NA 3G7NA 3ABQB 4HLDA 2OE2A 3UCFA 2KCKA 5K6TA 3L7MA 1SKAA 1PGNA 1FK8A 3M1AA 3G5LA 4P4TA 1EFKA 2WD7B 2NT3A 5A03A 4YHHB 1I13A 3L1HA 1GU1A 1WUYA 3ROZA 1EBUA 4R1OA 3CLRC 5AKYA 3NATA 4X1YB 1KJ9A 2HMTA 1AKQA 1Q15A 1XNGA 1Y6JA 4CM4A 4DM4A 4P7GA 4OAOA 3AXSA 4I4TA 2E6KA 3O8QA 2VJPA 5ADWA 1G3NB 3HH8A 5HOEA 3TEJA 1UG3A 5LZ7A 3SQNA 3AH8A 3DZIA 4GM1A 3OKPA 4YO8A 4F2WA 3AF2A 4FZ5A 2LWIA 3EEIA 3LCCA 3R6TA 4Y2SA 1GOTA 3D6TB 5TMDA 5CB0A 2BCEA 3DMPA 3T94A 5FJIA 3OICA 2A2ZA 2OCBA 1HURA 2KZTA 2XNSA 4PSDA 4G0QA 1ISIA 4ML3A 4FHZA 5IJWA 1DO8A 4REMA 3B7TA 1OKKD 1XMQB 2H7XA 2XDWA 4B8YA 2XXAB 3EVBA 4J0JA 4N6NA 3QF4B 3PUYA 3L05A 1RTKA 1FPMA 1XFAA 1QGDA 2GA9A 5AW0A 4M9CA 3IPXA 1BX1A 3U31A 2DFDA 3AHJA 2Y92A 3F46A 1FDVA 2ID8A 3UMGA 2AWNA 2X23A 1WCWA 4K5CA 3PFFA 4J7WA 2RHTA 5A0FA 4PIPA 3I0NA 1CZUA 1U1EA 4ZEMA 4LF9B 4PRLA 1N94A 1SAYA 3WRXA 4ZEOA 2G25A 2JIRA 2VP0A 3INRA 3GDFA 4P3PA 3F4BA 3BE4A 1T25A 4EHKA 1Z88A 1QK4A 3SZ7A 2HMAA 3OF5A 1KRWA 3Q2IA 4WWHA 3RR2A 3FBWA 4LW8A 2IS1A 4JEIA 1JXMA 4HBGA 1KWGA 4MS1B 1BG6A 3I5AA 1E7YA 4JFRA 3D6FA 3KEQA 3CZPA 2CF6A 4U5XA 3RC7A 4AO6A 2F8YA 2DBYA 1BWPA 4BEJA 4M9ZA 1OROA 1AQYA 1GPKA 2HBQA 3AGQA 3NJ8A 2QJWA 4OYRA 2G0TA 3HWX1 2OEPA 3VTAA 1O6GA 1WHSB 1IUOA 3LPDA 2DETA 2BM0A 1GFZA 5JYBA 4L51A 4EABA 4UAVA 2GARA 4NPCA 4QWMA 1NBME 4IQFA 5CRUA 2E6UX 4LFAB 3TVDA 5EIDA 3D7NA 1EHIA 1G8HA 2IEDA 1YDGA 4US2R 3WYGA 2QL9A 3RASA 3RVRA 3GJRA 3RHTA 2FMIA 1WUHS 4CQLA 4BATA 3UHAA 2VHZA 1KKMA 1R0XA 3R23A 2CHWA 3G2SA 1WUIS 1A77A 2COUA 3QPWA 3ZEIA 4IZHA 4YJ2B 3R9WA 1EG2A 4FYMA 2OXIA 2CB0A 3JR3A 3EQ2A 1VJ5A 1E7RA 5I7SA 4DK5A 1XTPA 3FE2A 4H7EA 1NPDA 3ZN3A 3B7BA 4HGRA 3P9ZA 1VMIA 2WINI 4FGLA 5CA1A 3QU5A 4ZANA 5K45A 2CVOA 1KQFA 1JJFA 5FIOA 3USZA 2PQRA 4S04A 1UAAA 1XZHA 3H9UA 4JQOA 4HGOA 2Q9UA 2PT7A 4KN9S 2GN4A 1FTNA 2VTBB 3OEEA 4HP8A 2SECE 4MVJE 2J0SA 4UTXA 4MYTA 5BNIA 5TQJA 1FMTA 2NUTA 1SM4A 2FAXA 2VYQA 5T67A 3GLIB 2ZAIA 1W85B 4U6SA 1K1EA 3E22A 3O3CA 2PQMA 2VGYA 4HQFA 4A8HA 4FW9A 2J3JA 4P29A 1G2IA 4BZZA 2BE9A 2E3JA 4IFBA 4MZXA 4RBNA 1GGJA 3E84A 1DCTA 3N2KA 3OZBA 3V3LA 1FRVA 1UKVY 3MRXA 3CPSA 1ICIA 4NCXA 3DMGA 4INOA 4MV3A 2CL5A 2C9CA 3S1AA 1ZSYA 1FQKA 2PEYA 1YXMA 1KYWA 1YU9A 5E8JA 3DSXA 3PYMA 3CKKA 4LXHA 1CR4A 3BZWA 4UAGA 4YRQA 3HGQA 5J2TF 1SPXA 1AN0A 1V1RA 3CB2A 4U2GA 4FB5A 2WMOA 1GU0A 4HRAA 1NZFA 1W4LA 3VAAA 4GPKA 1RCTE 4U8VD 3NBFA 2A8YA 3B2EA 3KQQA 1RQNA 3W8FA 1G8GA 1N77A 1ELKA 2LDBA 4PLPA 2VPWA 3AIKA 3AC0A 3WL7A 5CMWA 2POCA 3EPJA 2BI4A 2ZKLA 1WY5A 4HADA 4GYKA 3WYFA 3I2GA 2C7QA 3OF3A 2GLXA 1F7VA 1DDGA 2FSVC 1NYLA 1KTVA 2XCIA 3I5UA 3L6CA 3R9XB 3COSA 4GR5A 2G04A 2B82A 3B38A 1YBAA 4LZAA 2AN9A 3SZRA 1A71A 2X5NA 1TEZA 4NICA 3G3EA 3NTUA 1Q95A 4OGLA 5KWEA 2R5FA 4X3PA 1NY6A 3LKDA 2WVAA 4PW0A 2OCXA 5CM2Z 1YQTA 4BQFA 3DVAA 2ZE6A 2FQ1A 5D1NA 4FDMA 3HA3A 4C6TB 1FVOA 3GLKA 4XIYA 3JZIA 1O77A 1UKCA 3IBEA 2LE0A 4BFLA 1YSCA 2OV3A 3WGNA 1CWUA 4OVUA 1BU5A 4RDCA 2XZOA 3B9QA 2ZI4A 3C1UA 5CDFA 3DVQX 3OP4A 1CQXA 3HXCA 2XA2A 4OPMA 1KJYA 4PFSA 2QXTA 1KVQA 2HGZA 3V1NA 2VOEA 1YQ9A 2PL2A 1EWRA 2JFGA 1X1BA 5EEGA 3HNOA 5JATA 1Z7EA 4NCIA 5A71A 1UF9A 3DEPA 1VPLA 3O9ZA 4YWHA 4ILKA 5DCLA 5B6PA 1A98A 2J3EA 4PX3A 4MS4A 3ZHXA 2W6NA 1C0PA 4AQYB 3RTEA 3WNBA 3UM0A 1XC7A 3CGGA 4N7JA 4IRUA 3SC2B 3GLSA 3UXGA 4A82A 1E9BA 2DBQA 2JGDB 2HI0A 4QUHA 1KSGA 1EK2A 3E2MA 1BMTA 3PHBE 2BEUB 4UJ5A 1QK3A 4LCEA 4G1TA 3TSZA 4UWHA 4IEFB 1RWNA 1M5TA 1SQ0A 4MR8B 3JQ0A 1PYGA 3ZWOA 4FR2A 4DRXE 1G42A 2B34A 1OV4A 4G97A 1LI7A 1QDLB 3I3OA 1AKWA 2WPNA 4TMWA 4WZAE 2DBZA 5FQ8A 1PL7A 1THZA 1YA4A 5DHPA 3ZWVA 4PSAA 2PDAA 3GEIA 2MYPA 4GPIB 3CHPA 1O58A 5A7GA 1VL8A 1HEUA 4DQDA 5KB3A 3OFNA 1LRLA 1L4EA 4DMGA 1LPNA 2FSHA 1UBEA 4PRYA 3ORHA 4DMCA 5JD4A 4YRJA 3CZCA 3V4OA 1Z0KA 2EFYA 5T6MA 4BYMA 3GJQA 2W90A 1PQWA 4RESA 2EW1A 3E5HA 3LMKA 4Z4EA 1YB4A 4C01A 3NIBA 2N42A 2QTAA 5H3HA 3ZDZB 4L9PA 4U8HA 4D3XA 2OO7A 4BMZA 4JROA 2SKCA 1JE1A 1E9EA 2X9GA 4WCVA 1PS9A 4DLLA 2GXUA 4YP1A 1G98A 1SVNA 1ULUA 4TL7A 1ES9A 3K4QA 2NPOA 4G0MA 1IMJA 2ZEJA 4JI4B 3D6HA 5G1NA 5F64A 5TQ2A 3L1JA 1AGXA 4OHCA 1PCXA 1KGDA 1Y6FA 4AP9A 5E2AA 2B1GA 3KOXA 1OYWA 4BKMA 5EXXA 4GEKA 3CUYA 4O3FA 1MPTA 1TYAE 3LC1O 2OZKA 2X1MA 1ZZEA 3RABA 3GCDA 5FBLB 2YNQA 1YGPA 4O0MA 4H1WA 4C3UA 2VP2A 4Q7KA 1YL6A 4BP1A 2PZAA 3DULA 1CVRA 4ABNA 4A92A 5JAUA 1UMDB 3DEHA 3SNHA 3II6X 4HRLA 4DMLA 3LC7O 4D4MA 4V03A 4M87A 5KKCA 1G7SA 4O08A 3JVIA 5AIBA 1I6WA 2Q1UA 2NU7B 4ZAZA 1GZ7A 3R7WA 2ZT8A 4BKRA 4DLXA 1U31A 3FTCA 1RZUA 4LF5B 1X42A 1IATA 2SKEA 3AIIA 4PC1A 5F9MA 4BS9A 4W1PA 2ZBGA 4XKBA 4HGNA 3QRWA 1OFTA 3IAM1 3DEKA 4E85A 4C07A 2F1OA 1RPJA 1FS4A 1YRBA 3EMVA 3BMCB 5C1DA 1O94D 2XNDA 5F2OA 1GUZA 3T4UA 2CLFB 1XA3A 3AS8A 2IPLA 1PNQA 3OQNA 4DIEA 3QIAA 4EYSA 4JR2A 3EZ7A 2XUIA 2D5BA 2NUAB 2RFAA 4BNGA 2C4WA 1OFIA 3IVXA 2Q6LA 5A5EA 2IE0A 3VVMA 2PZBA 4JSYA 2XEHA 2QLJA 4ME2A 5A3SA 3MCVA 2ZTVA 1CUSA 3EPRA 3LXUX 1EUQA 2QPLA 2VPTA 4HAZA 3WLEA 2NSDA 3FUEA 5IM4F 5FKJA 2D5LA 3DZGA 3LFTA 4QDZA 3DCNA 2HSDA 4YPFA 5LUAA 3EUWA 1QG2A 4FC6A 3K1ZA 2IYEA 4ZEXA 2XUJA 1SIBE 4Y2RA 3AU4A 2QIPA 5K0BA 1UWVA 4TXMA 1THGA 1H0KA 3R7LA 2ETVA 4KFTA 2HJGA 2PFGA 4ZVTA 1UINA 3KZ1E 3H04A 1YQDA 5AKGA 2CDRA 1NQUA 4AECA 3SJ7A 2OFPA 1LDBA 2H51A 5KKAA 4ARCA 1X1AA 4Q15A 2ZRKA 2ORVA 2E9SA 4G0VA 3CUKA 5KQRA 2JCVA 3RKUA 3WYAA 4TTJA 3S55A 3NTVA 4D79A 1XMJA 1DKUA 3LE8A 4DLKA 5CT6A 2QT0A 2ZROA 4IDHA 2W2KB 2H5LA 2XPZA 4MUJA 1QJCA 1JJVA 4B46A 5DCYA 1YI8A 1HFAA 1BSVA 4QXRA 4S1OA 1PV4A 4XTCS 3X0DA 1Q2ZA 1Z0SA 1IHYA 2W22A 3L8DA 1V8BA 4LDPA 1OH8A 1IJFA 3TZLA 5DHFA 2NTEA 3E23A 1F12A 5ALVA 3GYXB 1SK9A 2FI7A 2WYUA 1SIWA 3HEBA 4F3CA 4IMPA 4JI1B 1P29A 3RRXA 3AJ8A 4L8WB 4NBUA 4N54A 1FNBA 3RYHB 3L04A 1FRQA 3DPUA 2QG4A 3L6RA 1QZZA 4AJKA 1ZBPA 2X4DA 4W8OA 2JAOA 4OJKA 1RPZA 3TWQA 2GCIA 4PS0A 4RD6A 1DEXA 1CJSA 1NY5A 5DKFA 2VRCA 4HGQA 4XPIA 1D0VA 3K1AB 4YMLA 2I6FA 1ZG3A 3HACA 2A4ZA 1Y5LA 3R3ZA 4E46A 1ZRMA 3Q8MA 4AYTA 4HD8A 3PIRA 2R11A 3OCZA 5FTNA 2QPOA 1SKBA 3CU5A 3JWEA 3W3AA 3U4IA 3EEBA 2VDWB 4RF2A 3W05A 4F2PA 1TZKA 3B6JA 3TUIC 3JQAB 3HCWA 4J8FA 1Z5UA 5CRIA 3IQFA 2EIME 4D7AA 4IZIA 1QLJA 4KR3A 1SIUA 2ATIA 4L5IA 4JNKA 3FB1A 4F3NA 4JELA 5JHAA 3F71A 1NM5A 1MABB 3GIDA 4ZVLA 4COOA 3DV9A 1RJGA 1MENA 3AUYA 4Q66C 3PF9A 3O8BA 3G49A 1G8FA 1GKKA 2GHTA 2GK3A 1CR0A 4K1LA 1QIGA 1N1DA 1YJBA 4RM3A 1RQGA 1IZ8A 1U2QA 1Y3AA 5C4GB 1KO4A 3EVEA 4GS5A 1DWQA 1JHMA 1SFRA 2XKBA 1S3FA 5C1OA 5CBPB 1L7MA 4IYJA 3NDBB 3QW4B 2A58A 1E64A 2IXBA 1A9SA 2G28A 4KPYA 5KREA 3I4GA 3A4TA 3I72A 2J4DA 4UU1A 2Y0BA 5IMSA 2CT8A 1Z5ZA 1B26A 3L0YA 3F5SA 4Y2UA 1XP8A 2EYQA 4BXOB 1CUVA 2A9OA 3KJXA 5FX2A 3QQPA 3HYSA 3A9RA 2YIJA 1N8KA 2GEBA 2AZDA 2QAGB 3PUKA 3UYLA 1P0IA 2QZSA 4DB2A 5COAA 5BSTA 4Z7JA 2QM0A 3SHQA 2BFFB 3OX3A 4X5OA 5AO9A 5U1PA 3CKMA 1X7ZA 1E69A 1T5HX 1GGFA 4J16A 2R59A 2ZT5A 4ZCIA 2G1AA 1RAAA 2XEVA 3PLRA 4OFXA 3JQCA 3RYCB 4OLAA 2AGVA 4BPBA 3OTWA 5CTAA 4ERXA 5IT5A 4Z51A 5I4CA 1JYFA 3A11A 3G89A 3CXRA 3SYNA 5A1TA 5DSZA 4IIDA 4S2UA 1E79D 2O0MA 4WKGA 2TMYA 1P5JA 2QENA 1D7AA 5KVVA 3PTAA 1NQ5A 5A7FA 1UDWA 3W8EA 2Z56A 1OLOA 4RV4A 3PJDA 3TB6A 3BILA 1WB6A 3QFTA 2PA3A 3OZFA 2V03A 1E7SA 4L72A 2ZYVX 3HJNA 3UBTA 1XTIA 2RKOA 5IY5E 4C2TA 1RRVA 2H48A 1EFVA 2IELA 2BISA 3S8MA 1GZSA 4JMLA 2IUUA 3L06A 4G1EB 2KLBA 4CHTA 4BZXA 3ZW8A 1UC4B 1NA5A 4H7KA 3W6UA 2CK3D 3IPCA 3QK7A 5MDHA 4RVCA 1KC3A 3AJIA 1V37A 1DBSA 1Z2PX 1PTKA 5IYZB 1VIAA 3QU2A 2Q5QA 2AD5A 2C92A 2JFBA 4Q16A 1XI2A 1JF8A 2ZSBA 2I2BA 2ZYIA 5AUQA 4DZTA 2Q2NA 3B1JA 1HM5A 3WGLA 1W9MA 4E5UA 2YY7A 3CW8X 2DEUA 4Q7MB 1QR2A 2OILA 3IJPA 1J8YF 3I1JA 3IP5A 3AP3A 1QTNA 1NP7A 2I71A 4HK4A 3V9PA 4ZV4A 1ZN2A 3TMAA 3KV3O 3FTVA 3V6LA 4HRXA 4UM5A 3G9UA 1COWA 1N8NA 4GRAA 4HMQA 3QG1A 2DE0X 1E6LA 4UCQA 1J70A 3ON5A 2B8WA 3AF4A 2VT3A 1W7AA 4U2EA 3MQFA 4B3XA 5FB3A 1VPDA 2WFMA 1DV2A 1DXQA 4XWTA 3WG9A 4KRXA 2BBTA 1TUBB 1WU8A 3E9MA 1A88A 1P62B 1OXBB 1R6AA 2HA4A 1LSSA 4E5SA 3H11A 1P4HA 2JJ1A 2BKUA 4CL0A 5CDSA 2VPXA 1Y4DE 4EEKA 2OMEA 2PGAA 3L84A 4DEXA 3FPJA 2EDAA 5HZKA 1JR4A 3BFXA 3M6MD 5KTOA 4BV9A 2DBVO 3T35A 2P8SA 3EARA 2G4CA 5KHAA 3DLPX 3ROEA 3QU4A 4B8ZA 1IC6A 2Y93A 2PU7A 4OJTA 4OU5A 2IV3A 2N0SA 4ARUA 4BVHA 1E2BA 3EODA 3L49A 4OH1A 4JCOA 1SQFA 3D4LA 3ZH2A 3TAUA 3K70D 2FPRA 1UXJA 5D87A 4FT4A 4Q3KA 4MUAA 4C76A 4JU9A 1LLCA 3QMVA 4A0HA 4DNOA 2Q3LA 1Z2NX 4HN2A 4GTVA 2Q3JA 2UXBB 4R2JA 5D3KA 2VPZA 2SHKA 3VVLA 4UUBA 3U5TA 5F5XA 4R9VA 3O4VA 1R4AA 2V3VA 3B7PA 5AHKA 3V8MA 4TPKA 3ZNQA 1X13A 4K1XA 1Z34A 3KB1A 3F6RA 1QJ4A 2IYNA 2C0CA 5ECDA 2KHZA 2X3UA 3H1AA 5HM6A 4WJKB 1PEDA 5H82A 2F1HA 4NU6A 4XX5A 1FU8A 5T3UA 4B4KA 5HWSA 2EQBA 3IQDB 3K1TA 3O4FA 1RYNA 1EIZA 3RYIA 3VBEA 5KUTA 2ZXEA 3O8DA 1BEEA 3FCEA 3FGPA 4J49A 1H1DA 4BO9A 1OYYA 4LRXA 1N54A 4KXWA 1IZYA 2YICA 1QVZA 1XRMA 4DT1A 4DCMA 1EWQA 2C29D 1UT8A 2GO7A 1XTZA 1NJ1A 4M21A 1TKBA 1DU4A 2QRQA 3AOEC 5FPPA 1PJZA 3KYIB 1OCOE 1E0DA 1QKIA 2RSFA 1GLGA 1JDVA 4TVOA 2DWPA 3QE3A 3GFOA 3VAZA 4MYHA 2YBDA 4YPVA 3B2NA 2ZKIA 3HB7A 4B2LA 4GPTA 2ODNA 1P44A 3LW7A 4EW6A 1JAHA 1POWA 2OVFA 3NDJA 1JE0A 2DSTA 5EKSA 1H9CA 4IQ0A 4EZBA 4K9PA 3BYZA 4B2IA 2BEJA 1Z08A 5FTJA 2WDPA 1TT7A 5GTDA 2R85A 5T5QA 2FN7A 2Z8YM 5KNCD 5JASA 3JASA 1N7IA 2GSDA 3BOSA 5E6RA 2RGNA 4YYZA 1PR4A 1XGWA 3HI4A 2ATVA 3SXJA 4U9UA 1XLVA 2B5OA 1K98A 3NVAA 4S1PA 1OWPA 4NNOA 3MJFA 4YJ3B 1WWKA 3WBJA 3T41A 4TWIA 2Z3ZA 4HH1A 3RG2A 3K0AB 2G67A 3ZXUB 3O82A 4QBIA 3Q3VA 2QX6A 4X95A 2Y1LA 3LX4A 2PBZA 3N7UA 1PFVA 3DONA 2YDXA 1MG5A 1NJ6A 1TMGE 5FUBA 4OI4A 2KJZA 2KBEA 1NNLA 1UBSB 1TIBA 4BWGA 3ZYMA 4FE7A 4KOEC 1Z5PA 2HRZA 2GROB 2JVIA 3LUAA 4JLPA 3AF3A 5I7HA 1XCPA 4JI7B 4MV8A 1JS1X 2HRRA 1K6MA 3REFA 3KD3A 4BSZB 4QPNA 1G20E 3RGGA 1PZMA 3TLZA 3Q8WA 3EK2A 2FWAA 3NWPA 3DZKA 4O4LA 3VXKA 5D84A 1HL7A 1KARA 2V3WA 1JHDA 2D7CA 4GWLA 4BRWA 2Y1KA 3ELYA 4DMKA 3VJKA 2F43A 2GKGA 2ZAMA 4R0VA 4FU0A 2B69A 4F2DA 2BRUA 3COJA 4V2UA 1HE5A 1SJ9A 4XVUA 4K81B 4DGSA 5JRDS 5LD2C 4XVCA 1S6YA 1XRJA 5K8CA 5CW1A 2ZIGA 3TL6A 5K99A 3VNAA 3NONA 4Z5XA 1HETA 4OXQA 3CIFA 1D5CA 1KFBB 3QSGA 2ZS8A 1P3JA 1QHSA 1RD4A 1EBBA 1OZFA 4BDTA 5BN3B 5L4SA 3HQ4O 1PZXA 1ZNYA 3REGA 2JBWA 2P9GA 3HCNA 3CW9A 1XEXA 4HAOA 1NXVA 3VSEA 1I6MA 4I5FA 3LBIA 1NGSA 2D59A 4N5MA 2WIBA 3FR7A 4C22A 1N6KA 5BRNA 1NJSA 4ID9A 3JTMA 2WK1A 3FDHA 4NBLA 1Y1PA 4H0CA 1AK2A 5I9SA 2OOSA 4MJ3A 4LTMA 4GM4A 4C87A 4R2WA 1JHYA 3SIWA 4TX1A 3MUEA 1FXUA 1FFHA 2VI5A 4IBOA 1YULA 3UMMA 1XAGA 3WGTA 3PQDA 1ICEA 2PSHA 4AXHA 2OGSA 9LDBA 2FRDC 3BQNB 5L6MB 5CW2A 5JZ9A 4C7OA 4APOA 1SVWA 2ZIEA 1EP9A 4IZOA 2RMKA 2R8PA 4D6YA 1OIWA 1I0IA 1CF4A 1KOLA 1M76A 2WAMA 4HEJA 4NV0A 3DDZX 4CM4B 3UGKA 2C9OA 2VUTA 5B1AE 5FWXA 3Q0EA 1GM5A 4WLOA 3P9PA 3ITEA 3KR1A 2C4TA 3O8QB 3IKVA 4DMFA 1UK9A 3ANMA 1Z4LA 2GFQA 3HZOA 3AVWA 4OM7A 4HNGA 3MQ4A 4O4HA 3FRJA 5I7EA 4IP0A 1K4MA 4D92A 3SOZA 821PA 2CGEA 2CXOA 1HK7A 2WQ6A 5JFTA 1MHQA 2KZTB 2B1JA 4FC7A 5A04A 2BTOA 4PAOA 4M98A 1VLLA 2CVHA 4DV1B 1EFTA 2H2IA 1IEXA 3I9NA 1U0JA 3LP5A 3VR5D 1CRPA 4S05A 3JZFA 2G9UA 3Q79A 2WTUA 4BEVA 1UEXC 5DYYA 4L9SA 2A5LA 3VSBA 1UBHS 5CLQA 4FEYA 4GZCA 2KB0A 3F8SA 1MOSA 3CLRD 4DQKA 1P5RA 1PW7A 5TEWA 1XU9A 1HBJA 3OOSA 2UKDA 3S7ZA 4N40A 2H1HA 5F23A 4F93B 1RLUA 1EK1A 1DO2A 1VSUA 1E8OA 4MW4A 5F7JA 1C7FA 3X1JA 4R2HA 3RSGA 4WKBA 1JEOA 1E9RA 5LBTA 1MHPA 2NTJA 3HKBA 3T5VA 4EGFA 3PC6A 1EAYA 1ZNQO 4LRYA 3NX4A 4GU5A 1E7VA 4IV8A 1X3LA 1NW9B 1FP2A 1LXCA 4LQLA 3ZWAA 5JCZA 3E3AA 4KIGA 2Q3BA 3RAJA 2Q5OA 4WZ6A 1OJLA 3PUVA 1U3WA 1ZL2A 3RT1A 4AXXA 4EOGA 1JTFA 4N8DA 3H87A 5E38A 2P91A 2P3QA 4KQEA 4KMOA 4C0BA 3PXXA 2HHHB 3OSZA 2ROQA 1AGPA 2ALJA 3N9IA 2YC4C 1K1AA 1UQUA 5B4VA 1VJDA 2D5AA 3K8OE 5BXQC 3UQZA 3GRKA 3KZKA 3R5FA 4TWZA 3FPKA 4XDGA 4C0QC 8LDHA 2AXVA 1CV2A 3FCYA 1NVXQ 4FCTA 1G59A 2O7RA 2NX2A 4HL6A 1KTIA 2NWQA 5FV4A 1HU3A 2DR2A 1NXWA 3JQ9A 4MV6A 1KAOA 3WWEA 4ZHQF 4IIEA 3QEMA 4W5QA 3SBXA 1G38A 4P4SA 2EVWX 4Y6RA 4ZTBA 5K8VA 1ULAA 4BNDA 3I37X 4ZPXA 4PPFA 1FNNA 4ZDJA 5FT9A 2LTAA 4ACLA 4OA5A 4RZHA 1VJCA 3AEXA 2J49A 1EXVA 1RHQA 3CNQS 2J32A 3EGWA 4M88A 1NV8A 3D31A 3H8JA 2R68A 1WG8A 2I7TA 1NNSA 3NDRA 5BWBA 2AE2A 4CGZA 5CA1B 2DVMA 3DPSA 2FQXA 5BV7A 2PUHA 1S0PA 1GSIA 3H1PA 3R0VA 5C8YF 4Y6SA 1BE8A 4P93A 1OX6A 3QKYA 1AQIA 2WIJA 4B4UA 4HSEA 2FLKA 3UH0A 1A7UA 2TSYB 1EX6A 4D41A 2R05A 4D44A 4O8CA 1S0UA 1UOPA 4DI4A 3TRHA 2C7VA 3V1YA 4Z1MD 3SHWA 3KVVA 4TQGA 3BX1A 4ZT7A 2OGUA 2EX0A 2ZUEA 3BVPA 2C77A 3JD3A 1IOZA 5KOHA 2BMDA 4RHXA 4WNAA 1T3LA 4KXXA 4PO8A 4OKSA 3JVEA 5B5SA 5ALWA 2A3NA 3G9QA 2IW1A 3BXPA 4L3WA 4DX2A 4TTPA 3WLJA 2X5XA 3N2KB 3QOFA 3D3QA 2WM3A 3QTLA 1WU7A 4LYHA 2QJOA 1CEEA 1WKVA 5D6NA 2BCJQ 3P4UA 3S1AB 3IGFA 4RZQA 4BCDA 3N6RA 4BV8A 2OAP1 1L9XA 4UM9D 1YCSB 4Q6BA 2ZIWB 4OU4A 1ZK0A 1AK1A 2GCGA 1V1RB 2OHFA 2IP4A 1QCDA 4NZ9A 3AG1E 1ZLXA 2CFCA 2WMOB 1K7SN 2WDZA 1OAOA 5KSOA 5I3ZA 4CDRA 5BOSB 2H16A 2ZWOA 3FFTA 3K9CA 1RFLA 1E4VA 3NTLA 1N9ZA 2F8SA 3CW2A 3VDNB 1XEWY 3A9UA 4JWKA 1DHRA 2R8XA 2JJ2A 3OM8A 5FP0A 3UVEA 3WGYA 3WQQA 1KVTA 5J4KA 4L27A 4M86A 4FOPA 4JWTA 3W4IA 4WLFA 5INTA 4W82A 4F45A 3EG5A 4MKTA 3DAYA 3HKCA 5KWVA 2QE7D 3OPVA 5I9IA 4HOSA 1KQGA 1Y8QA 3UPUA 4DADA 3DVAB 2GI4A 1KORA 4IS3A 3FUTA 3LK7A 3QSYA 1U2TA 2R2GA 5COQA 2OBYA 4YFYA 1BE1A 2A0FA 3MCAA 2PKXA 3QVUA 2ZWIA 4B7AA 5FOTA 4L50A 2VNHA 1GNTA 2W4QA 3WLTA 1TYEB 4YUVA 2HPHA 4KQ2A 3U7IA 1C9YA 4I9UA 3RC2A 3CFYA 4WI1A 2UUAB 2OHHA 4QO7A 3KQLA 4IR7A 4P7JA 2D4AA 5FWYB 4AFNA 1DEOA 3SC4A 4FQ7A 3R8FA 1QHIA 5KJMA 3EZNA 2SICE 3HRKA 4G8DA 4NNJA 1Q1QA 4DGQA 2Y66A 3PCXA 3UHPA 1SK8A 3QNKA 3KSDO 1XZBA 2D1RA 2B4TO 3W5HA 5A02A 2E2EA 1SHTX 1HTWA 1ETUA 3O74A 4MS4B 2UZ4A 1N4DA 3OLVA 5ENZA 4IRUB 5SYMA 1D2NA 4WFKA 1RRMA 2XNCA 1ZJJA 1JILA 3DWIA 4XIFA 2ZRPA 4K2HA 5F7ZA 2FEKA 3AINA 4I36A 2X1LA 3CZRA 2AMFA 2YN0A 4ZAYA 2G9NA 2HZBA 4QC2A 4N82A 1WDWB 4OVKA 3C3OA 1JDBB 4BMNA 1KAQA 1T9GS 1IYZA 4UVDA 4FYHA 5CVDA 3PNPA 2BGLA 3MWEA 3COYA 1AV6A 3JATA 2H2FA 4WN3A 4BGDA 1M34E 2I1QA 1O9HA 1SBNE 2A5JA 4CIYA 1ULSA 1Y8RA 3OJFA 2VNSA 5JCPA 1WSBA 3THWA 4LDZA 3D8BA 5DTMA 3BE6A 4DBVO 4QYIA 3PFWO 4IJKA 4QNMA 2D06A 4DX6D 1ORDA 2FGJA 3MCUA 1DLIA 1W93A 4N0DA 1ZZGA 2MYUA 2OXCA 1QVAA 4KXLA 3BXGA 3T7SA 2MJLA 2DFVA 1ID1A 1JR3A 3MGKA 4JGBA 2UVQA 2YFYA 5A4DA 4MGKR 5ES3A 2II6A 3I42A 4RS4A 2QP3A 3OTIA 4Q4JA 4MMXB 3B13A 4IIGA 2H3HA 4I50F 3BH7A 1WLYA 4KGXA 4OMDA 3K0BA 3NYWA 4H6XA 2X19A 1DKMA 3ISTA 4FPXA 3ZXXA 4HB2A 1TC1A 4U7DA 5GPBA 3ZHQA 3D3JA 2J3LA 1MC8A 2HK6A 4OQYA 2G9QA 4QLAA 5EJFA 1R12A 4ITUA 5KCZA 4UTRA 4P80A 3FUHA 4HDNA 2WIFA 4DTCA 4ZYLA 2Z8ZA 3MPOA 1SBHA 4F96A 3UV6A 4IWXA 2P2GA 1O1SA 4C0KA 2EOAA 2QB5A 1J39A 4L7VA 3LUGA 3QLEA 1GAEO 1LLDA 3RS2A 4ABTA 4RHEA 5H4HA 1B00A 1N5MA 3R7WB 4ZAFA 1PEAA 4PS7A 1EE1A 1JHRA 3GN2A 4C0MA 2EX4A 3DDHA 1OHHA 4P92A 1ZI8A 4M1ZA 5L7WA 3SLKA 3AFHA 3RSQA 1LV8A 4QHTA 4FVTA 2A0XA 1XV5A 1VKOA 3NGXA 4BAGA 1SC1A 2NU9B 1NRXA 3T3IA 4A0SA 2WSLA 4E70A 2PCJA 4HH4A 1B0UA 3RROA 3GAAA 3STYA 1B89A 1Y82A 3L1IA 1NR7A 2Y1CA 3KEGA 4RTQA 1G8SA 1WE2A 1MX4A 1N9GA 1UFVA 2FEAA 3P94A 1AQLA 2ZSAA 3CBQA 2DHQA 2IYTA