4GYYA

Crystal structure of human o-glcnac transferase with udp-5sglcnac and a peptide substrate
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
715
structure length
693
Chain Sequence
b'PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFHIYDNRIVLNGIDLKAFLDSLPDVKIVNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
molecule tags Transferase/peptide
source organism Homo sapiens
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
total genus 274
structure length 693
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gyyA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gyyA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gyyA03
1LWOA 4RIEA 3NF1A 2PYIA 2O6LA 2PRIA 3NCHA 1FU8A 3CVQA 3Q49B 4HOUA 5JJ6A 3LCAA 2QN1A 3RSCA 1Y6GA 2F3SA 2GJ4A 2WTXA 2XA1A 2WQHA 3CKCA 3HBFA 1LWNA 2IEIA 2QN3A 3HYMB 3OXFA 3G2LA 3NP7A 4EJ2A 2QRMA 1RRVA 4UQZA 3UPVA 2IW1A 4AN4A 2JJMA 4UQYA 4L22A 2Q6VA 3T3IA 3OTHA 5IKPA 4W9RA 1HLFA 2OFFA 3U3WA 2ATIA 4HORA 3D0QA 3GZ1A 4GA2A 3CVNA 1PC2A 1HXIA 2XCCA 4Y6WA 2R5SA 3UQ3A 3FWVA 3TOVA 4X7PA 1WAO1 5JTUA 3MRTA 3ASFA 3S7JA 2BISA 4GZ3A 3R9AB 5BT1A 3BEEA 3PE4A 2HR2A 2OOEA 2UY1B 1P2DA 3RIBA 2VQ2A 2VCHA 3L01A 4HOSA 3AMVA 1L5SA 1H5UA 2X6QA 3DDWA 3FP3A 2JLBA 5GPBA 3VDNB 4N2QA 2VGXA 3OXLA 3LYAA 4YI3A 4JA7A 4N39A 3T3DA 5IKOA 3D0RA 5D01A 1JIVA 1WM5A 4RIFA 4G2VA 2R60A 2VSNA 4FZRA 4WUYA 3RO2A 4KQ1A 4M7PA 4RIHA 3MT8A 2BGTA 4BFCA 4APOA 3UYKA 1IXYA 3ZCPA 3E3OA 1NOKA 5A7DB 2GPAA 3L79A 4J8DA 3QWVA 3H4TA 2C2LA 4O6FA 2IV7A 4AMGA 1GPYA 1NOJA 1Y6FA 3GW4A 4AM9A 2FEZA 1KLXA 3S7BA 4H7XA 2FF5A 2F3QA 2KS6A 1KTIA 5I45A 3PE3A 1NZFA 1P29A 3BCSA 3Q3EA 4F9FA 1ZBPA 4RIIA 4KBQA 1NVKA 3G2IA 3MEKA 1Z6PA 3CUVA 3C4QA 2PRJA 3BDAA 4MICA 2FBNA 4NC9A 3U4TA 4G1TA 2IFUA 3NPAA 2IYFA 2QRQA 3VDMA 3Q4AB 3MKRA 1P4GA 1JIUA 2SKEA 2KCVA 3UUXA 4YUAA 1PSWA 3GZ2A 2PL2A 3CEHA 4MHOA 3L7DA 2KCLA 1A17A 1XL1A 2Y4UA 4I1AA 2C4MA 3Q3IA 3ZGQA 4N3AA 4WNEA 4CTNA 4GYYA 3L7CA 3KAEA 3IA7A 2FO7A 1XL0A 2XGMA 4G2TA 2GEKA 3QWWA 1ELWA 2KCKA 1P4JA 4I9EA 2C9ZA 4GA1A 4KXKB 3QKWA 2QN2A 2R66A 2AZDA 1E96B 1K06A 5G04C 3MSCA 3MV3B 4NQ0A 1QQEA 4X7MA 3DD1A 4GPBA 4GZ5A 4MRAA 3ZCRA 1C8LA 5FT9A 2C0MA 4N2SA 1L7XA 2IUYA 2X0EA 8GPBA 3FFLA 2G9QA 3MTBA 3O3CA 5D0QD 3CK9A 4ME2A 2YHCA 3MBOA 2XCUA 3K9IA 2HY7A 1GPAA 2J9QA 2SKCA 5TMDA 4U07A 2ONDA 1YA6A 2GEJA 5EX3A 3Q47B 4LEIA 2IF4A 5TMEA 5KJNA 3SZ7A 2Q7FA 1F6DA 2QRPA 3VTXA 3T3GA 1QM5A 3CEJA 1JG7A 3CUTA 4U0ZA 1ELRA 3RO3A 2IV3A 4N3BA 2QLLA 2QFCA 4MHSA 3SF4A 4NESA 4X7RA 2C0LA 3ZCSA 1FCHA 4NRHB 1TJCA 2HO1A 4WNDA 4CDRA 3S27A 1RZVA 2XCBA 3OKCA 2HYZA 3BD6A 5JTTA 1B89A 3CVLA 1FA9A 1HH8A 2KATA 3ZCQA 4JA9A 2QRGA 3BD7A 2DBAA 3S7DA 3VUFA 2PQNA 5TVGA 3CUUA 3RJVA 4HOQA 3C4VA 3ZFWA 4GZ6A 1J39A 2XPIA 5EX0A 2GPNA 4EQFA 3CEQA 3GYZA 3E3NA 3EBOA 2VCEA 3SYMA 1NZNA 2I6HA 3ZHEB 2IEGA 2VYIA 5HI7A 1IYGA 1YA0A 3AS8A 4QLBA 5TMBA 2QN7A 4WNGA 2H1FA 1KT1A 2GW1A 4I9CA 1OUVA 1XNFA 5G05C 2BFWA 5HXAA 1NOIA 3FROA 3TAXA 4JL0A 3EBPA 1QKJA 5LCWC 1PN3A 2XMPA 3TGOA 3G2KA 2GT1A 3Q3HA 1Z6QA 2PQRA 5KJKA 4KQMA 3WAGA 5EKQD 1Y8MA 3ULQA 3IEGA 3QDNA 1L5WA 4WADA 4BTAA 5DBKA 3CKBA 5DIZA 4ABNA 5KJMA 4XI9A 3L7BA 3SYRA 3O48A 2X6RA 4BQFA 1WW2A 1WV1A 4EKYA 2PZIA 1XC7A 1W3BA 5CCMA 1YGPA 2XGOA 2XCIA 2YQ8A 1NZDA 1EM6A 4GCNA 4HOTA 3OY7A 7GPBA 2ACVA 5FZRA 4BT9A 3MS7A 3OT5A 2X0DA 3ZN3A 4RG9A 4EL5A 4AY5A 2PQ6A 5ENZA 3VTYA 1O6CA 1FTYA 1RZUA 2ACWA 3OKPA 2NC9A 4RELA 1M5RA 2ASVA 1C8KA 5CCLA 3T3HA 1V4VA 3ASDA 2ZB2A 1E1YA 5FJYA 2ECPA 2LSUA 5FZQA 4G25A 2MHKA 3LY8A 3OKAA 5JJTA 2GPBA 3HBMA 3T5TA 4RIGA 4HWGA 3Q15A 1L5VA 4UI9J 5JJ7A 4I2ZA 1GG8A 4PQGA 1P2GA 1L6IA 3MRXA 3NB0A 3WXXA 3MT7A 3RHZA 5LCWJ 2KC7A 5C1DA 4M60A 3N71A 3ZHEA 3AS4A 2LSVA 3URZA 2G9VA 3LY9A 5ARGA 3D1JA 1C3JA 4W6QA 1GZ5A 3VUEA 2F3UA 2VSYA 4GPKA 2UWJG 4HLNA 3GUHA 1EXVA 5HQ8A 2XA2A 3G2JA 2C1XA 4GYOA 1L5RA 1VGVA 2AVPA 3NP9A 3OY2A 3MS2A 4RENA 3ASHA 2F9FA 4LDPA 3QHPA 3ESKA 4EKEA 5G04J 4J0UA 2FF4A 4KQ2A 3GPBA 4EL0A 4N3CA 1B4DA 1PNVA 2AMVA 5D00A 1IIRA 1E4OA 4YNDA 3RKVA 3T3EA 5CHEE 3BCRA 1JIXA 1Z62A 4U0UA 2QN8A 3OTGA 4FKZA 2G9RA 4G24A 4F96A 3QWPA 3MT9A 1KT0A 2P6PA 3G2HA 1BX3A 3AS5A 4UI9C 3MV2B 4F97A 3CX4A 3RU0A 2VGYA 1WW3A 1HZ4A 2QNBA 1UQTA 5BNWA 4MI9A 2SKDA 3UYLA 2AV6A 3CUWA 6GPBA 1SXPA 4RG6A 4RBNA 3QKYA 4GCOA 4KYOB 4Y6CA 1AXRA 2PYDA 4YVQC 3WC4A 2IYAA 3G2NA 1P5QA 4A1SA 3QOUA 4NEQA 1NA0A 4J8FA 4N9WA 2VG8A 4AMBA 5M72A 5FZSA 3MTDA 2LNIA 2GM9A 5DLDA 4WNFA 4CGWA 4AY6A 3CK8A 1FC0A 3MTAA 3OXGA 3CVPA 3Q5MA 4GA0A 1FTWA 3LY7A 3CUYA 1NLMA 5G05J 2H1HA 1P2BA 4U04A 3RT1A 4YVOA 2V5FA 4MI3A 4Z5XA 2FFRA 3S2UA 4CTMA 1Y8ZA 4U0SA 3LKUA 4M83A 3E3LA 5ARFA 3KD7A 4BQEA 4XIFA 3ZCVA 5LQDA 2QN9A 4N5CA 2R68A 1JG6A 1Z8DA 3MA5A 4I17A 4BQIA 2X0FA 2R4TA 1WUTA 5BW8C 3LPZA 3BCUA 3ASGA 4B94A 3CV0A 3EDTB 4H7YA 5D0OD 1PYGA 1XKXA 3IAAA 1L5QA 2Y4TA 3ZCUA 5FTPA 3S7FA 2QLMA 1FS4A 2QRHA 1WV0A 3S28A 4BT8A 3JYSA 3TG4A 1XV5A 4G23A 4XI0A 3WADA 4MI6A 2FETA 3ZCTA 1GPBA 4WHMA 3C48A 3BD8A 3E4BA 2P58C 3BEOA 4F3VA 1XOIA 1GFZA 4G26A 3CEMA 1UQUA 4YI5A 1JEJA 4REMA 3DZCA 3NC4A 1IHGA 4LEUA 3MRVA 2FI7A 1FU4A 2F3PA 2R4UA 3HBNA 4GYWA 2XA9A 1UZUA 2QZSA 9GPBA 3RSZA 2VGXB 2QLNA 3TG5A 3T7DA 4J8EA 5AYWD 1P4HA 1WUYA 4IN3B 3MQFA 2AW3A 3HBJA 3MS4A 4WACA 2YJNA 3S0JA 3ZPJA 3PDNA 4CGVA 3COPA 5DU2A 3S29A 5KJLA 2L6JA 3KS2A 2XEVA 5DXFA 4CTOA 1ZU2A 2E2EA 1FTQA 1AHPA 1SXQA 2XGSA 4UI9K 2C1ZA 3H4IA 2G9UA 1QZ2A 4JHRA 4BWRA 3L7AA 3CK7A 1FU7A 3TSAA 1ABBA 1A8IA 2BUGA 4AIFA 2JZCA 4I2WA 4BTBA 2WPVA 1K08A 3NAZA 3CV3A 3OTIA 4X6LA 1F0KA 2BGUA 1GGNA 3DDSA 4UQXA 2UY1A 5A6CA 1C50A 1NA3A
chains in the Genus database with same CATH superfamily
1T2CA 3JRNA 3KV1A 2JLAA 3HKEA 3NF1A 1EBBA 3R44A 4HATA 4M76B 4R05A 5AJZA 1P7VA 3UA4A 1XMIA 2YCBA 5FYDA 4BVKA 1R88A 5J47A 4MDYA 1VE1A 4PZLA 4WFQA 3UAYA 2Y92A 3WFJA 4P0PB 1SUWA 2EDCA 3BD9A 3FA2A 5JJ6A 1WL8A 1GOTA 1R6DA 3CBQA 3B1FA 5EE5B 3GEDA 5BSGA 1OA1A 2XUIA 2I1LA 3IJRA 3RRZA 3UFXA 1LW6E 4CMIA 3OLVA 4JLOA 2L69A 2R8BA 3OECA 2AUMA 4ZN6A 3QGMA 2ARKA 3TFWA 1GGJA 3PWKA 4DR7B 1W9HA 1VXRA 2DFVA 3RUPA 2VPIA 4H6WA 1U0SY 5SYMA 2ZBFA 1MW8X 4RM2A 1B76A 2QNRA 4KMRA 1E0SA 3MXTA 4AZTA 2GBPA 2PWBA 1CS0B 1SVIA 3QKSA 4EI7A 1JEAA 2W2NA 4DV6B 4UBJA 1U28C 4GA2A 3CVNA 2WM8A 2QV7A 4YCDA 1YE5A 1ONSA 1Q1QA 4N5HX 4C6SA 5CAEA 4LNBA 1UWLA 3PC2A 2IYYA 1WJGA 1EP9A 1TNUA 2I7VA 3NQPA 3HDXA 4LXHA 3ZNGA 5BOSA 1ZC4A 2ZISA 3VSAA 2WU4A 1BX1A 4GZ3A 3DOIA 1BWRA 4HYTA 4OQFA 4QFCA 2HR2A 2K2QB 3EXG2 2OV1A 2X8LA 2WSMA 4FEGA 5CGZA 4HDMA 1TX4B 5IUKC 3RC7A 5AW3A 1A7KA 3P9KA 5HIJA 4LXGA 3DDWA 4OQMA 4ZICA 3DMYA 5AESA 2QY7A 1E60A 2W6ZA 1UEJA 4JWTA 4DLUA 5GVSA 3RARA 4FHJA 4L4RA 1EGVB 4TWJA 4A0RA 3VAZA 1E1QA 5AHOA 5K6TA 2IEJA 4UVEA 2JD1A 2XW6A 3L93A 1DMRA 1K3TA 4LY6A 2DQYA 4ZCIA 5CA1B 3OQMA 3CNHA 3D6VA 1FFHA 2BGTA 4LRZA 1YC2A 4W9NC 3BWEA 5BNTA 4LXTA 1Z82A 4N5IX 2BMJA 2JH9A 2Y1GA 3DE5X 3N70A 3ZXUB 2J6CA 2RHHA 1II8B 3QWVA 2C2LA 1DCFA 1LRLA 3ANNA 2FW6A 1P1RA 3FJ1A 3PHLA 3VPGA 5B6JA 4DV5B 1BDHA 1RM4A 5H7XA 3EH2A 1MEOA 2QI9C 5CUQA 1HDEA 2Q5LA 4RF4A 1POXA 3PE3A 2ZDGA 4NBLA 1MO2A 1Q2UA 3C5RA 1BWPA 4GOMD 3G6KA 3HUFA 3KLNA 2V8SE 3DWLG 1ZJWA 1Y89A 1DJQA 5EJAA 3NONA 1JU9A 3PD0A 3R7WB 1HMYA 3K4PA 3O1JC 2AGVA 1NYLA 5IDYA 3ZWBA 5HK9A 5IJ0A 2M98A 4ND2A 4PSCA 3HEBA 3C1UA 1LCIA 4TS3A 5H7PA 1A04A 4HRMB 1J2TA 2ZUSA 3M5PA 1GHTA 3MOIA 4PFKA 4QC2A 1Y37A 2JCGA 4DLVA 1H0AA 3H11A 3I2JA 3KXDA 1G7RA 1SVNA 1B93A 4M89A 4ND8A 2O59A 3OTWA 1ZNWA 1MPXA 3PDIA 1WQ4A 4HDNB 4C0AC 3V3LA 1Q1EA 2XV1A 3V4PB 2ZE6A 1KP2A 1QP8A 1PGQA 1XF1A 2HZ7A 2IKSA 3FCXA 3IKJA 2ENWA 2ZI9A 2B0OE 3UANA 4B3JA 2XBMA 3WLSA 3PFBA 1CF9A 2OXEA 3EQZA 3RVDA 2F4VB 4C0XA 3EIQA 4DNPA 1EP1B 1H2RS 2X41A 4LFCB 1CHNA 1GQRA 2MCFA 3A31A 3KHTA 4D99A 2P9FA 2I7CA 3F2VA 2CNNA 1LX7A 3IHYA 3NJ4A 2NN3C 2Q0QA 3LF2A 2O1EA 4TV8A 4Z0NA 2H1LA 4EX6A 5CDHA 1FMFA 2GA8A 3A1NA 1UP6A 3K0BA 1OWNA 1ONOA 3QVLA 3JQQA 3T5BA 3HWSA 4IX9A 4Z7QB 5JXHA 1ZMBA 2GLUA 4UASA 1VG0B 1GT6A 2JI6A 3DSTA 4B5KA 3I9V1 1L7XA 5NLLA 8GPBA 5ICGA 1Z56C 2O8DA 2WJHA 5IM5A 1ELKA 2CJXA 2OHGA 4TVSA 3Q2KA 2E7ZA 4HVTA 3GRZA 1PRYA 4KN6A 4JVLA 4AQDA 3OEEA 3USES 2XWQA 3TBKA 2EAUA 1KI6A 4IYRA 4R2WA 3ETLA 1ZIPA 3D9KA 1LQUA 3T3GA 1KYYA 3SBSA 4IULA 3FPFA 3TLZA 1E9SA 8ATCA 4DAOA 4LJ6A 4LVCA 4C6TB 4D92A 3C3RA 2EFGA 4FFMA 2BT4A 3LBIA 1IQRA 1ELRA 3SY2A 2R7KA 1EYZA 3UHPA 3NHYA 3QYAA 5EL0A 3A58B 5LYJF 2ATVA 2QFCA 4OFWA 3L0SA 2Z58A 3TWRA 1PK8A 4URVR 2IK8A 5A02A 1ZOSA 2IZ0A 2JK1A 4AZWA 4BMOB 1JGTA 1Y4DE 2WIBA 5I48A 2KBEA 4GX5A 4YX9A 2OAEA 4X90A 4WLNA 4MW1A 5HQJA 2P6OA 2VP0A 1LLFA 4OB7A 4UTPA 1HM5A 1V9CA 3SS7X 1W5AA 4X62B 4ZC8A 3EVFA 2XCQA 3L8DA 4H9GA 4K1LA 3OFJA 2H8GA 3GUUA 1H4QA 1FNDA 4PH4B 1TCVA 3IOEA 2O06A 3B6KA 4GQIA 1T24A 3I58A 3R0QA 4II3A 5BQFA 1ZUWA 2JFHA 3BSYA 3HUUA 4IMRA 2BSXA 4A5SA 3B7RL 1KMCA 1NN0A 2EIXA 4UUPA 2ZVJA 2QM8A 3CUUA 5LPNA 2CXRA 5IY5E 1HLDA 2PPVA 2W2KB 4FUQA 1XK6A 5KZMB 5LUAA 1K2WA 1GG2A 2ZRKA 3P4YA 3ZFWA 2I78A 4E30A 1TMOA 3NDBB 3KR0A 5C2JB 1U5CA 3RAGA 2FNAA 4B6EA 1HYEA 1EFUA 3TZKA 1JX6A 1R0CA 4RVUA 1XZEA 5KC8A 5AVVA 1RCFA 3GEMA 4BWVA 3H4MA 1CY8A 4CIVA 3IDOA 2P2GA 1MOPA 2QJWA 3KSBC 4QM7A 4WNCA 2IUSA 1OIWA 2XCOA 4YUVA 3LLCA 1ODKA 3B7UX 1DAFA 2QVBA 4COKA 1LD3A 4EW2A 5IEJA 1S8NA 1YI8A 2WSSD 2C31A 2HGSA 1PGNA 1RJGA 4XGQA 3QF4B 1W6RA 1NSYA 2FDRA 2PKXA 3CURA 2FUG1 3EQ7A 1XVVA 3TGOA 5CW1A 2D0OB 1NDQA 1WXQA 2V03A 4EMBA 5HS4A 1F1JA 2QPTA 5CEEA 4D10C 4L1KA 1I3KA 1EI9A 2EZ9A 1LW7A 1R0BA 2AZMA 6NULA 2HU5A 4FYKA 1QG0A 1GUAA 2P9SG 3JTEA 4NNOA 3S6JA 5D1NA 3OZEA 1WVGA 4P82A 3U3KA 1XTVA 3HKBA 2QZAA 4BIIA 4X8LA 4ZCRA 2CMHA 1CQZA 4BJ3A 4F9EA 3FWPA 3DEHA 1QQ5A 4ZZ3A 1XZMA 2RG1A 3M6VA 4HWSA 4OQ4A 2A57A 3RFFA 5KNDH 4MGYR 3THYB 4G01B 4XGKA 3DR3A 3I64A 5DTJA 4N3GA 2JJYA 5K05A 2P3SA 3GZJA 4K2AA 1RKVA 4NU5A 4PRZA 2RGYA 4OHKA 1KS9A 4MINA 1YE8A 2DIWA 1D4AA 2G4CA 2GTPA 4V39A 2CG2A 3U44A 2O19A 3FTVA 1SXJB 2UZ1B 5LZ4A 1VE3A 1VHJA 5AQEA 2EP7A 1XLUA 7YASA 4KDFA 3IEPA 3ASDA 3G79A 4FKMA 4OPMA 2BSQA 5B1AE 3GFGA 1L4GA 5H59A 4I7EA 1KERA 2A5DA 2WM2A 2ZAIA 3DP9A 3E9MA 3NT2A 4ZEMA 1HT3A 2IP1A 3D4PA 2XMSA 2P5UA 3GT0A 3MTIA 2GTIA 2CBXA 4IIXA 4WINA 4RS3A 2ZWPA 3E5RA 2NSLA 4ZV4A 2V8BA 3CUEF 4WZZA 2GILA 1ZSNA 1NIPA 2IOQA 2VDPB 4QT0A 3TQOA 3WJAA 4POAA 1RZ4A 4FGLA 4RVOA 1BG6A 4EFNA 1FFYA 1BJTA 3MWKA 5AVRA 1Q7GA 3VZCA 5K0TA 1T4BA 3L1UA 1A50B 3AF2A 4K9OA 1J06A 3R9XA 4RQBA 2E6KA 1UEIA 2P3QA 2Y8EA 2LAHA 4Q3DA 2CHXA 1F2VA 3OZIA 3IIMA 4FJ1A 5ARGA 3D1JA 3DQPA 4ZI7A 1ZR4A 2PD6A 1WBJB 4CQMB 5JMTA 4UCXA 3DEYX 4WCFA 4K81B 1XTPA 3VHXA 4AUKA 1CF4A 5FULA 1K97A 5TJ9A 4CLHA 1YB7A 2VZLA 5CFRA 2MU1A 4NK4A 4HS2A 2AMYA 4PO3X 5IVIA 1YU6A 1SCKA 3CKMA 3A9CA 5F1YA 1AKMA 1Z18A 4PICA 1V7CA 3RASA 4UFPA 3OF5A 3AHEA 1P7ZA 4BNWA 4DMKA 2Q2QA 3UAVA 4OHOA 4RY2A 4AV7A 2F9MA 3OT1B 1VMAA 4DB2A 2VQ6A 3HCFA 3O31A 3DL0A 4CL2A 1H4TA 1IPHA 4MCIA 5JWHA 3SC2A 5KSWB 4N7JA 3U16A 4Z4EA 3PFIA 3BRWA 3GPBA 1E8OB 2QD5A 1N6NA 2WPNA 1JXAA 4BE9A 2XSZA 4QREA 5ALKA 4BWFB 5KOYA 1E94E 4EIWA 3GOQA 2YMMA 5GQSA 3R6GA 5IJZA 4NDAA 1LBTA 2HTEA 2I4IA 3JX9A 4OA8A 2I22A 5LR6A 2FPGA 2B7LA 3PFKA 1KR2A 2OFOA 2CYBA 4A0HA 1GRRA 2Q6KA 2RI1A 4IFEA 4KW7A 2C77A 3LBAA 5E2AA 2A5UA 1TNDA 4E22A 1WY6A 2CNWD 2ZSFA 1KI6B 1F9AA 2H54A 3JQAD 4FFWA 1MGOA 4UI9C 1XCJA 2R59A 1FSSA 4EZKA 1C81A 1MQSA 1UBJS 3HCEA 3ZQ6A 1I2ZA 1F7VA 4BXOA 1HRKA 2QNBA 3LA8A 5KSYA 1O94A 1OWLA 4JQYA 4MRMA 3NBMA 3AUAA 4IICA 1A3CA 1CNEA 2XQFA 3PGMA 4FM9A 5AENA 2Q8PA 1N1DA 3QELB 3ZWKA 5CT6A 1JEOA 4MW2A 2IGBA 3AFNA 3K0CC 3S40A 2QU8A 3EPKA 4IMJB 3V2IA 3BXHA 4M86A 4K5BA 5J08A 1TGVA 3DMDA 3LHFA 3COZA 3TUJC 2WWVD 3SFXA 3F4KA 4YJGB 1UZAA 3EHRA 1WB9A 2IXAA 2HF2A 1KY2A 3AR3A 5FA5A 3G5AA 4TTQA 3GELA 4XQCA 3Q5MA 3P9NA 1W9MA 4WK0B 3PQ8A 4WBSA 4YTEA 1XXHB 2W6OA 3ETDA 3SSOA 3BXGA 4FDMA 2IPLA 2DB3A 2WXJA 3G17A 2MYNA 3ZDYB 3QF7A 1K98A 5AICA 4MI3A 4XVQA 2GUGA 4L16A 2WM9A 2C4VA 3DLCA 4ISBA 4RCVA 2ETXA 5JBNA 1M8JA 4BUCA 3N3BC 3DWIA 4ZYXA 4BJHB 3SJUA 3ANXA 4KWEA 2VT2A 2PSFA 4GGMX 4U2GA 3KQLA 4S2UA 2QL9A 5EFOA 3T3OA 1RD4A 4UAGA 1S8OA 1OXVA 3EDTB 1KYTA 3GCGA 3HXTA 3IAAA 3LT2A 4PX5A 2XMRA 2QGZA 4L4UA 4DC1A 2AXUA 3GZ4A 3AAAC 2PHZA 3NOVA 4EMTA 1FS4A 2A5LA 1Q7CA 2PEYA 2UYGA 5CJPA 1L5GB 3TMYA 3VQTA 2EKDA 1J5XA 3GRUA 4MI6A 2G0TA 2H0AA 3BRSA 3OZUA 3QJYA 1NLZA 2W4MA 3BD8A 2XE7A 2GJKA 2C78A 3O92A 4WCDA 1E32A 4LZLA 3SHQA 5HRCA 1G4UR 1ZUD1 5TQ2B 2V65A 4TX1A 4KE8A 3UM1A 3PFHA 2DKOA 4RDCA 1KQGA 1F3OA 1PQYA 1LJLA 4MRVA 2RH8A 4MR9B 1BLXB 2ZS8A 1Q22A 3E0QA 3RU2A 2BFFA 3EZ2A 3LDFA 5FAXA 5KWEA 2GN2A 3UCXA 4XJVA 3RKSA 1GTMA 5DI3B 1V55E 2VTBA 1EE1A 3MLAA 4HH1A 3P0HA 4I50B 1DKPA 1P7YA 5DU2A 3COPA 4E08A 5B58T 1UAAA 2V7GA 4QBIA 1G5RA 1W48A 3U49A 1UBRS 3OPYB 4BB0A 3FYHA 4KX5A 5DM2A 1ZN2A 4MH0R 1XDBA 3H4IA 1M6VA 3JUIA 1T26A 1QIGA 2N46A 2G76A 3BX1A 2D54A 4AN1A 5FUMA 1WMDA 1X1SA 4KXNA 5EEHA 5HCIA 4DDVA 5AVYA 1FDUA 3HLTA 3L8HA 2ETCA 5KINB 2PXAA 3LIPA 3HXLA 2VDLB 3KEZA 5IAGA 3RTGA 2YMPA 3H9BA 2UUCB 3OWHA 2HA4A 3IKTA 3GDWA 1BZYA 4KTVE 5G0WA 1OWPA 3BG5A 4ARZB 1OV6A 1QMOE 1E90A 4X6LA 2DH6A 3U3XA 3V8NA 1C1DA 2WWGA 1KQNA 4WK2B 2DFLA 1EVKA 1YMUA 2BKGA 1H4VB 1AM4D 1YZUA 1K1AA 4B89A 2ZR0A 1CULC 3HFSA 3Q72A 2H51A 3ZDQA 1BA3A 4DUGA 5CVUA 4JC0A 1Z5WA 3NRBA 1OJLA 4JP5A 5DHPA 1YS2X 1BIFA 2PRZA 3GDHA 5TSDA 3N2KB 3NEAA 3F7TA 4OBBA 3G2MA 4GBMA 4MUYA 4FUTA 5ARDA 4J3FA 3RRMB 5AUNB 4IGAA 4GNKA 5G2OA 4DV3B 2IT1A 2XODA 4DMMA 1RBQA 1I3LA 3ICPA 3FJYA 2GEVA 5AJHA 1L4LA 2VP3A 4H3KB 4X0EA 3RYCB 4KMOA 2BEVB 4QYMA 3FFWA 3PQ5A 3KZOA 1NHGA 3LPDA 2V7QA 4YREA 2DTDA 3B2NA 3HSKA 2DERA 2W83A 2NQTA 1E62A 3DMTC 5MGNA 4XYMA 1RC8A 3RS5A 3LVRE 3B52X 3C6YA 4ZFNA 3GQVA 1MT0A 1VKRA 1J0DA 4J4BA 5EHZA 1N2EA 3G7UA 4ISCA 3B82A 3K70D 3FMOB 2DBRA 1RYNA 1IMOA 3F6EX 2R9VA 3H5TA 5CLIA 2G80A 4DVJA 5EPEA 2H0RA 4PLYA 5B37A 1V25A 2GM5A 1ST2A 2WHPA 4LNUB 2C9MA 1PV2A 3E9NA 1RP7A 2E37A 4ZPJA 5ANRA 2L17A 4D9HA 3EX7C 5BQ5A 4YIHA 2VJLA 4RZHA 5G1PA 4ZK6A 3PICA 1M7BA 2G28A 3PWSA 5G0UA 4GX0A 3M83A 1L7AA 3DDCA 5EIBE 4EARA 1K27A 3N2KA 3WL3A 3TAUA 4N1AA 3RGWS 1VJ1A 2FTKE 3IJEB 5MN6A 5IVKA 3GA0A 3T3DA 4BYGA 3TW0A 1GNRA 4M1KA 1CSEE 4U1RA 1SHZA 3E9QA 3QW2A 1WD5A 1G55A 2JIRA 4KB5A 4RWZA 4XEUA 5KNHD 4KXYA 4RIHA 4YRCA 5LLTA 3EUAA 2XT6A 1YZVA 3B6IA 4ICIA 2IYWA 3DE4X 4ZVUA 1XXLA 1C7FA 5E6SB 3P9SA 4YRZA 2J5XA 1MJNA 3FH8A 4M46A 1XWFA 5F73A 2V4ZA 3KQKA 2F55A 1U0JA 2GEFA 1AURA 3EG9A 2VYCA 4NIMA 4W99A 1C1HA 5G4KA 4DXAA 4D8YA 2MMGA 2WM3A 1E3WB 3KAJA 4YAEA 1WW8A 4U2BA 5DB4A 3S8YA 5K0FA 4V0QA 2OCLA 1DKRA 1UXOA 4YUWA 1EMDA 1RMYA 3AEYA 3U7QA 4RFSA 1CBUA 2BGIA 5SV2A 1U8TA 2NPOA 5LN1A 1JCQA 4K5CA 2GETA 4JYCA 1SVMA 1Y6ZA 4D9CA 3HM9A 1DJOA 4J6EA 4FE3A 1E66A 1JT9A 4KQKA 3UCFA 1PZNA 3NBZC 1QVAA 1M2WA 3LIIA 3BUAA 1P18A 1Z35A 4P83A 3A6ZA 5JCOA 2G5CA 2G83A 4M0EA 4F5DA 1BCSB 1KZOA 5F3RA 3R74A 3UUXA 1QOPB 1U65A 2GRAA 2QZZA 2WF9A 4YMHA 4GO1A 4NL4H 5CVEA 4ARUA 3CEHA 1P7PA 3PX3A 2KCLA 1VJGA 3T7IA 3Q12A 3X43A 1T0HB 4DJTA 2JI4A 3FSRA 1KA9H 4ZZ0A 1R4AA 4GUDA 3ZKWA 2CG3A 1I80A 1E8MA 1TEVA 3QUBA 5H82A 5A9TA 3WIVA 2ODNA 3EGVA 4DMFA 3N2LA 4JLBA 4TLBA 4CNQA 2NV0A 3KT8A 5ALGA 4RVBA 2HUNA 5I9LA 2YUTA 1PVOA 1J2UA 1T8RA 2DHDA 3EG9B 3PI7A 1BMFA 2J45A 4G67A 3V4FA 1AA9A 4GTPA 1G3RA 3BH7A 1P0CA 4RZIA 3T7RA 1ZVVA 2WFZA 3N2YA 1T8SA 2LTAA 4IF4A 1IM5A 1E96B 1OCRE 2LIVA 4DPMA 4PWZA 2CFUA 2QUAA 2X5JO 4O4IA 3FTYA 4DCMA 4LYHA 4KK3A 4LZPA 3Q73A 4B47A 4GZ5A 5DN9A 3FTZA 1KVSA 5FT9A 2AXEA 4XWYA 5KAPA 4F56A 1SKUA 2ZKIA 3ZI4A 1C8BA 1C4OA 4TKVA 4COOA 1QH0A 3IAM6 2NT4A 5DBEX 4J76A 4ZZIA 1YJBA 1BKSB 3WA7A 2ZTVA 3LFTA 5JJLA 2GEJA 4D0GA 3KYCB 2C9YA 1SZDA 4EX7A 1U3TA 4NNJA 5SY9A 1EA5A 4AP5A 2OAGA 4EABA 3VTXA 1PDVA 3VHQA 2RGAA 2PNNA 3KJHA 3OPXA 4OF4A 4B3FX 3D9LA 3FHCB 4NBKA 1MA3A 2V96A 1Y8AA 3W7BA 2GN6A 1QMPA 4FBMA 4LV8B 2KE5A 3SQOA 4QO8A 3JWPA 3ZHOA 1WXHA 3RYFB 1WDYA 3L4BA 3INRA 4C14A 1X4RA 2VF7A 3SF4A 5CBKA 4X7RA 2I8AA 3UKDA 1N2BA 3ZCSA 3HXKA 3IP5A 4BNTA 4IJUA 1HT0A 4F1SA 2C98A 1QR6A 3T4EA 5DBGA 3L92A 5A7HA 1V11B 3A36A 3HHEA 3R7WA 4HWPA 2ILRA 4KZPA 4CN8A 5KS2A 4YDRA 2GZMA 4GL4A 4ZYZA 3DXKG 4LBWA 1N9KA 2NUBA 4PYNA 1JBEA 3CLVA 1NNLA 4U00A 4AW9A 4EOGA 4M1QA 1VI5A 4HQRA 1UT6A 2RJOA 4FADA 3ZUGA 2RH9B 1G63A 2R97A 2PZGA 3K0AA 1OFUA 3UKJA 1B16A 3CNEA 3HGMA 1OCCE 3MHPA 1CRLA 2XBUA 3HHPA 4HXYA 1TAQA 4Y2PA 4ZARA 2KB0A 5JBIA 1J42A 5AW9A 2OK7A 4NCJA 3BZBA 5JR3A 2OG2A 2ODAA 2R11A 1T8YA 3KR9A 3SQLA 4M9QA 1UOEA 5T41A 4YWJA 1EGHA 3CHRA 2QXYA 2P5TB 2ZJ6A 2UV8A 2EG5A 3QITA 4PSDA 3SDSA 3TIGA 5FFMA 2P68A 5AKZA 3KX2A 3TZLA 3CTPA 3TR0A 1MHQA 3WXBA 4DRYA 2BCGY 1T3SA 3GLHA 1IYGA 4P58A 1WPXA 4JBNA 5JSYA 2IBSA 1ZD9A 4BRSA 4RMIA 3P0RA 1AQJA 3FF4A 2X7XA 5BSKA 5KTNA 2I2OA 2C5EA 2M1ZA 4QJIA 4YJHB 5HXAA 2BPOA 4C43A 4DQXA 5CFNA 4MUJA 3AGQA 3T5XA 2B83A 3BGWA 3DCJA 4BO1A 8ADHA 1U2GC 3UB2A 5F7OA 5AM4A 2KSQA 3K0HA 4LJRA 1T36B 1EX7A 6CHYA 3NG1A 3AVYA 4YRKA 2PSSA 1FRZA 3MCXA 4RH0A 2ZJAA 2NPFA 3VPHA 2GCPA 3ZWYA 4DA8A 4YT8A 1Z6XA 3QU9A 4C9BA 4I4TA 3R76A 2AOUB 3L0DA 4X54A 3I6QA 4EHFA 2IEYA 3TFOA 2BMFA 1DOAA 4QPZA 2JD0A 1VZ3A 2QYJA 3ICWA 3PQCA 4EG4A 4CXMA 2DFKB 4HB4A 1A97A 2MOKA 2ES4A 3VNRA 1NL3A 3UATA 3P97A 3RFTA 4YMGA 2R8OA 1YCFA 2A0KA 1KFEB 1CRQA 4NKRA 1GA6A 1SVKA 1V1RB 3PWTA 1U2DA 5AYVA 3L41A 4TRRA 2XUOA 4OI1A 1XAGA 1XJ0A 4F2WA 2PFSA 2A9OA 3C7CB 4HFGA 1R12A 3WRWA 4N9QA 1KWKA 7GPBA 3W9GA 3P2YA 3ICEA 1P91A 4D25A 3I5AA 1NVGA 1ODLA 3MS7A 3SYKA 2BY4A 2FEXA 2RH4A 3OC0A 3I6MA 2QG4A 4LWZA 4U7DA 1VLHA 3C7TA 2FDXA 3N3AC 4FR5A 4IIGA 1OXTA 3OJOA 1X94A 1QE3A 2ABWA 3WNDA 4NCAA 1WM1A 1SXJE 3URKA 1E6UA 1ZI8A 4QPDA 1EVEA 4Z0TA 1WCIA 1M5RA 1JFFA 3H1EA 1UXIA 4QYTA 3SHWA 2A9RA 4MVJD 3ZXSA 3QARA 1P62B 2LSUA 5JHHB 4WBNA 4TKUB 4UEWA 2XPZA 2Z95A 4MDEA 1UK6A 2MYUA 4JROA 4OO3A 5IABA 4MQMA 4GR5A 2K2WA 4R98A 4GOKA 1YHNA 2FX5A 4C9BB 4Z7JA 5BWLA 4D74A 4JUCA 5JAPA 3LUGA 5JJ7A 3G0GA 3HACA 3DBVO 4R9SA 1Q74A 4OQYA 3PNVA 1LTXA 4Z9YA 3VR6H 4V0MA 1CZUA 3O7MA 4MUKA 3RNLA 3JQ9A 1USUA 1E7YA 3IAHA 1EFVB 3PEEA 5HQ3A 3IPRA 3HWWA 2RKWA 5HKAA 5IKMA 5AAOA 3ICQB 4U2CA 1YMVA 4JJ4A 1G6HA 3GPDG 4AI6A 1K3UB 3QLVA 1IXZA 1DWOA 1RJ9B 5ENPD 2JZNA 3R3ZA 4ALJA 2E4AA 4PHGA 2AVDA 1NP3A 1QP4A 1IWPB 2GNOA 3CVOA 1H2HA 2YNMD 3D0OA 3MAAC 2YYZA 3VOTA 2F3UA 3DOCA 5K0LA 1KFKB 2MSEB 4L8YA 4I14A 2ZKLA 2HFKA 4MWEA 5F7JA 3ZV7A 3T52A 4CUJA 1EUYA 4PG7A 1GLGA 4RK5A 5THQA 1IKND 5UKDA 3W6UA 4RTMA 4LIPD 1DT3A 3RYIB 4EZEA 4FFBA 1K5GA 1WMSA 1Y7IA 3QJ5A 1AUXA 4KXLA 3RVQA 2P6NA 4QUBA 2P41A 2QIPA 4DLLA 4D9KA 3BYZA 3KKZA 5C7IO 4NPHA 4MVYA 5KSOA 2WPDD 3PNSA 4YK7A 3ANYB 4F4IA 2CKMA 5B7NA 3PVCA 5BVHB 3BAZA 2Q45A 4EFKA 2Y1OA 1JWAB 1W4LA 1AF4A 1QORA 1QWOA 1Z7YA 3ESQA 2AMVA 3HA5A 3N8DA 1HZZC 4WY8A 5A5FA 1OZ0A 1UEXC 3RKVA 3LGXA 1H2XA 5K4GA 5E7QA 1QHIA 4IILA 4DTCA 2EFYA 1D2NA 4PCAA 4PG8A 2Z5GA 4URXR 1JIIA 1MXHA 2HSGA 4B6SA 1XNHA 3HXBA 3I32A 1HNWB 1AQLA 4E09A 1T91A 3FZEA 1U8ZA 4JD2G 2CSUA 3FZYA 1RTKA 4QFMA 3L54A 4BVAA 5CNMA 1BX3A 2V7QD 1Z28A 4D4HA 4OGLA 1IU9A 1QIHA 3EXIB 1TYAE 4HCJA 3PHCA 2ONYA 1HE8A 3T34A 4PS3A 4OHXA 1T3LA 5JJKA 2XKBA 3BQMB 3CX4A 5T3RA 2RONA 3NVAA 3T0GA 4DPLA 4YT2A 4BPBA 4DLBA 5CW2A 2J6IA 5CXXA 2QT9A 3SMVA 3H1FA 3RYFA 1NUTA 3NOQA 3D43A 4RVHA 3RYIA 4FNMA 1GUDA 3FTFA 4D44A 3C3OA 1PWHA 3OLQA 1XAIA 5AHXA 2YY5A 1LF5A 4LMBA 4R3NA 1ZGHA 2NXNA 1BMDA 4UDXX 4FT2A 5AM1A 3BGSA 3VYTB 1XA0A 4YV7A 3AKYA 2O8FA 1IWBB 2H1WA 3QLUA 4OFXA 1NVVQ 4D81A 3DXYA 1PLLA 2K6GA 4YHHB 2XNDA 3RU3A 3CVVA 4ROTA 2I7TA 2CFIA 1ISFA 2LAIA 5HBRA 4L9PA 1DG9A 1ZD4A 1B0PA 5DNAA 1E79A 3ACDA 5EMLA 1G8PA 3PQ4A 2Q0HA 3O47A 3OXGA 3UW1A 2RAPA 2WYUA 4G4SO 1D9SA 1GFIA 1NVBA 4KDRA 3B9QA 4UZFA 1R0LA 3NHLA 4ATGA 4V3BA 2M9MA 1BMFD 1DFHA 2BEWB 4EVIA 1MB0A 4OQPA 5AW0A 3BIWA 5KOJA 4KR6A 2PWZA 1H6OA 1FNNA 3CMCO 3W2IA 1KZYC 1DCQA 3RRXA 4DHEA 4MRUA 1YC5A 1U7IA 3N74A 2PK3A 1YKFA 3AUXA 3CG0A 1J56A 3LAWA 4M83A 3G2QA 1RJWA 3CH4B 1PYDA 3CNLA 5ARFA 2HBQA 3MMNA 4BESA 3QYFA 2Q5QA 4TMYA 4PONA 4N5CA 4C7OA 4ENQA 4EKNB 4C0EA 1GW6A 1WCXA 2R4TA 5IT5A 2YXDA 5CB6A 2C2XA 1UBOS 1JEDA 2FN8A 3HFJA 3JQ8B 2GJ9A 3OURA 1DG3A 1FYDA 1GCGA 1YBVA 1P2VA 3DSWA 1YDEA 3G1UA 3QVVA 5EINA 5JG7A 3FDXA 3TECE 1GA4A 3ANLA 3HDYA 3HC7A 5EUBA 4Q05A 2X0JA 1LNSA 4FJYA 1HU3A 1GNLA 3G1TA 1JSCA 2CXQA 4D80A 5BYJA 4IDCA 2AKEA 3K9QO 4I55B 4EGAA 3AHJA 3M3HA 4FFNA 4QX6A 2H4WA 4C88A 4WBNF 3JQ1A 2JLSA 3GGPA 1SELA 3TLCA 2P62A 3MOGA 4F6RD 1L7VC 3C74A 1D6JA 4G97A 4RADA 5JCPA 1BH2A 1SKYE 3E7PA 2P4SA 2V7PA 3KVNA 3E7FA 4FMDF 4G81A 4W9NA 3KVYA 2FHPA 1GU1A 4DMGA 1XNRB 1G98A 3R5TA 2Q07A 5C46F 1E98A 4JL8A 1VKOA 2UZAA 5DLQC 4KFCA 1ECFA 1UZUA 4DUYB 3ZD9A 3T1HB 2ZROA 3CQCB 4KHZA 1CR6A 3O1HB 2IU0A 4G4JA 1BX0A 5EQFA 1I3NA 3WGYA 3BJRA 1I7QB 4LGCA 2R1ZA 3QVXA 4WGFA 3AI2A 1QDUA 2NUAB 3ESZA 5FBQB 2ECFA 1J8FA 1M1XB 3W4IA 4CGVA 2EERA 3NZEA 3LUCA 4LX0A 5JYEA 1ECPA 2GHRA 1ZGZA 2HWYA 3H0KA 3RVOA 3N86A 5DXFA 3OQ1A 3O4RA 5AK4A 4AF6A 3P27A 1FLAA 3VU3A 1KJ8A 3OZCA 4KO3S 4L9SA 1UW4B 4MEAA 4NK5A 2HMAA 2PXXA 3L1JA 4QXQA 4CIWA 4IOLA 4ZYYA 2JDIA 5IZCA 3MJHA 1IXRC 2OCKA 4RO0A 4C7OB 1NULA 3BHMA 1ZISA 3VZPA 2QRNA 4AP6A 2PGAA 3UM3A 2RCNA 5AKEA 4NENB 2G1UA 5DKFA 4HNUA 1QP7A 4L9RA 4YJ3A 5I4IA 3BXFA 1E64A 3LZDA 1DQSA 2L6BA 3UT8A 1LTHR 1X80A 3N8KA 4R6XA 5BW5A 3ZYLA 5HWSA 1AQUA 1HLPA 1QHHA 3RTEA 2AYZA 2O52A 3MTQA 1WY5A 3U2QA 1L9KA 1BE6A 3CV3A 4WNIA 2QA5A 3F7OA 1T1JA 1QR2A 3ENKA 4FE4A 5IG2A 4GTVA 3G5MA 3KU4A 4KAJA 4BJ5A 3PGVA 3A4MA 2UY1A 3PZRA 5B3JA 1X81A 1NM5A 2B6HA 4LJSA 1X92A 3ZW7A 1MCZA 3JYQA 3NWJA 2W43A 2WUVA 1OAAA 2YKGA 5IJ9B 3A26A 1JR6A 3A2LA 3SQWA 1L8QA 1Y1RA 5ALXA 2DQSA 4I5EA 1N6KA 1X70A 4HBZA 3HWX1 3NTXA 4M0FA 2I1KA 3MPUA 3ON5A 521PA 2PRIA 4ZV9A 1FRVA 3MK31 3T1OA 1JR4A 3PYLA 3SOPA 4CGYA 3INYA 5E1BA 3HIZA 2QN1A 3WNCA 2WXKA 4H7PA 3ULKA 3CJTA 4HXGA 2P9GA 2QRKA 3PVZA 3NT5A 5ERXA 3UBTA 3L7IA 4FFBB 3ET5A 2O8VA 3JYPA 2ZQ5A 5H80A 1ZCBA 3BN3A 4PS1A 3ZDZB 3H1TA 1L5FA 2EYQA 3IKMB 5I9SA 4V0LA 5ICSA 2B7BA 5D6OA 3BILA 5LP6A 3NXSA 5KWSA 3BULA 3KL2A 5DYTA 5A0TA 1IUPA 4OQXA 4DQKA 2Q3HA 1WQ3A 2HK6A 3V31A 2E18A 3A2MA 4OUDB 3T8KA 1R4ZA 1KF0A 3BF8A 5LQAA 1PC2A 4MV0A 3A1VA 5THXA 5KMGA 4CKXA 1UJKA 3SNHA 1COZA 3TOVA 1U8FO 4H4EA 2FZ4A 3EAGA 2I80A 4RDHA 5C8YF 1VE6A 4LHWA 1TL7C 5COBA 3UMBA 3TIFA 5HEKA 2GH1A 4D9JA 1PJQA 5BNFA 2QYSA 4Z49A 1BJKA 3OHSX 1PR9A 4LE2A 1CZHA 5BWOA 5K8TA 1PR0A 3ZVVA 1Z6AA 2YDYA 1LLDA 1JE0A 1T2NA 4DX5D 2B30A 3L1IA 4HMOA 4U9UA 3WGNA 3CCCA 4GYJA 4E5VA 4HQKA 3SKXA 3LYAA 3VR2D 1KSFX 1W5FA 1GARA 3A6JA 1T9AA 5EPOA 2WJAA 4ZREA 1E2NA 3QVKA 2PD3A 4RSRA 4UTNA 4YQZA 1C9KA 4FZRA 4KP7A 4M7PA 3QC1A 2ZXWE 1XT6A 1JZTA 2A9JA 1JYEA 2YIJA 4FXPA 1L8AA 3QVOA 1L5YA 1HZJA 4G9GA 4HS9A 4B3CA 5CCEA 3TZQA 4CKBA 2AF3C 2FZGA 4Q47A 2PV7A 4QSMA 3T7TA 4ERNA 4HDSA 3WQBA 4DLQA 3INTA 3LDUA 1ZOLA 1KDTA 2RHJA 3TS1A 1OH7A 1W44A 4XX0A 1IXSB 2Q5FA 5H3HA 5HZHA 5JQWA 5ES4B 1Y6FA 3GW4A 2FEZA 3MXOA 3TQTA 3KOMA 1U31A 2Y4OA 1MJ5A 3AK4A 3N6VA 1LK0A 4GRAA 2DWZA 1YL6A 2X58A 1XBTA 1NKTA 2R1VA 1NX9A 4J2HA 2ATCA 2F62A 5IP5A 5KNLA 3IE1A 3FDHA 3NBFA 3OLWA 4E6PA 1LSSA 2UAGA 3TWOA 1BAPA 1LDMA 4XWGA 1C1XA 3JZMA 3OT4A 4P84A 4TSFA 4D0LB 3PFCA 4PGMA 2ZBEA 4YCAA 1SO8A 2KM1A 5B4VA 2QW1A 3MJ4A 3WX0A 4BZQA 1TO2E 3FCYA 1YDFA 1WCYA 4HUQA 4JBWA 3TBHA 1L8OA 2UZ0A 1XRQA 2G5TA 2ZAOA 3EZLA 3QHQA 4N0MA 3ZNPA 4P0QB 4KN5A 2D7DA 3LYHA 4WLVA 3PEVA 3L7LA 4YUAA 4RMHA 1I2AA 1Y63A 3WVNA 4MHOA 3JYNA 2DVWA 4BLSA 4AKEA 3B1VA 1ZITA 3S2EA 4A6EA 1WSBA 4HUJA 2GBIA 3TGPA 1O5MA 2DTXA 2C4MA 1C8VB 3ZEFA 1FYFA 1W2HA 221PA 2I4LA 3OJFA 5BORA 2WXOA 1PJ4A 1J0AA 3NWEA 4D0SA 2WUFA 4G84A 3AY3A 2FO7A 1Z0UA 3FTEA 3P9CA 2X9GA 3CONA 2N0SA 1A2KC 5ETJA 3ZDFA 1CUFA 3TG2A 4L7TA 3T9CA 4PY2A 3WICA 4IDHA 1M2FA 5AJXA 3NGLA 5DLPA 5K45A 1V7PC 1BDMA 4NI5A 1Q2ZA 1ADYA 1F9EA 1FX0B 1ZJ4A 2GF2A 2VUSA 1SAYA 1QDLB 4H1VA 4TSFD 2MINA 3UOGA 4BKRA 1IFXA 3EPJA 1X15A 2WWRA 3NHMA 1WXIA 4J8SA 1VIDA 4L0QA 4AO7A 3RS9A 1OBCA 1KMMA 4HP8A 1ESDA 3O3CA 4XX5A 4TLLB 3Q9UC 3PR3A 5LNK1 2ZSDA 3B7PA 4YJKA 2HMWA 3NC1C 4ZT3A 4F53A 2Q5JA 1ZK1A 3IBCA 4E70A 4F3KA 1OAKA 1H8EA 4YRTA 4BAZA 3O93A 3QYPA 2QQGA 3WLJA 5E4YA 2Q5IA 2QP9X 3ZQUA 1VBNA 4BS9A 4DY6A 3TSYA 4S05A 3KRTA 5SYNA 1TVKA 1N6OA 3SZ7A 3N8GA 3VPCA 2QRPA 3CRZA 4PBRA 2FPUA 4KXVA 3ZPXA 3TPFA 4MS4B 1EGQA 1ICIA 5H70A 3D2BA 3FY4A 1IN1A 4UDNA 3ZH2A 1V8BA 1NAHA 5DCWA 4WUTA 4A6PA 1F60A 3KB8A 4F91B 4QELA 4FEYA 4QQNA 4TWAA 3DO8A 3ZYKA 4UM9B 3NBAA 4AOFA 1B0AA 1OX4B 3MZLB 2ZUUA 1PJ8A 4N01A 3DL4A 4WNDA 1KJWA 3ENVA 4FHCA 2FVYA 3K31A 3FUVA 5IVPA 4NEGA 2HQBA 4DLSA 1I1NA 4ZVTA 2V3CC 4KXFB 5DT2A 1HH8A 4G37A 3JASB 2KATA 2X0KA 4JA9A 1SXGA 1FQJA 2QIOA 1MO5A 3TSZA 3U48A 2DBAA 4KRXA 4AP9A 3JXJA 1B42A 4B6RA 3IDFA 1EXDA 3Q7QA 3HCBA 3RVJA 3M6MD 1A9XA 3GCXA 2E4YA 2C3YA 2XVAA 3DVAA 1QYXA 3A4TA 3IB3A 2QR5A 2WJ4A 1OI3A 4YPFA 4DCTA 4GEKA 4CM9D 2BL4A 5F4BA 4KR2A 2C54A 3BBPA 4GZ6A 4JYAB 3TAHA 2GPNA 3ODPA 2QBYA 2FI1A 1CPYA 3BE6A 2VEDA 2ZW9A 4G56A 2H5LA 3TCKA 4OX9B 4J1TA 4BFSA 1NZNA 1P7WA 4ZAXA 3WK4A 2IY9A 5AW1A 1Q83A 3GXOA 2RB5A 1NN5A 1TTQB 1CJBA 4N49A 4Q00A 2WU0A 3NORA 4Y98A 2B99A 2VPXA 1N0HA 1H2TC 3ONLA 3SEQA 2YVUA 5F23A 2LIPA 1M34E 3HVKA 1FXWA 2XCLA 2JFQA 5DMXA 5U4XA 1WP9A 2NP6A 4QL3A 1P73A 3UK7A 2IOFA 4UXHA 1IOWA 3FNBA 2YMLA 2PTHA 1QZZA 2BFNA 2JW5A 3EGIA 1V96A 2ATEA 1L5JA 2PGNA 2FK7A 3IXMA 4XEHA 1AHIA 4DMLA 2VUTA 3I9KA 4XDZA 4OXKA 1GZ4A 2GT1A 4W8HA 1XD8A 3QFCA 4YY3B 3ZTWA 1M2VA 1CETA 3L6UA 3FCCA 5DM1A 2WJIA 1ZVQA 3U37A 4A73A 2V0NA 1PG0A 3GMIA 3HN7A 5AT1A 4O0LA 4LOJA 3IEGA 2EF1A 4BB6A 4FJ0A 3A28A 4FQ5A 1BDIA 2JANA 3U17A 5D51S 2ZB3A 4QXRA 1EHIA 2DPHA 4KAAA 1CZLA 5G0SA 4XI9A 2HRBA 2OC4A 3B3AA 3MD9A 4UYJA 3BTOA 2PKWA 4BQFA 5EXDA 2QL5A 3M4YA 5FA6A 1EE9A 3BKWA 4BLQA 1JHUA 4EKYA 1SHLA 3B7SA 1PIWA 3QNMA 4HN2A 2JZOA 2ID7A 4XJSA 1KS2A 2FWRA 2A4KA 4PYRA 3DXXA 3TSOA 1M8PA 2W5UA 3ETEA 5H81A 4FYHA 3I92A 4AN0A 3AHDA 3F6BX 4QSHA 1M0EA 2Y93A 2C5HA 4PFSA 2HQOA 5AKGA 5DTIA 3BDIA 4LDJA 3SBXA 3NKVA 1U1GA 1N2CA 3J7AC 5AXCA 1MZPA 1RZUA 2ACWA 5AOAA 2PMBA 5FPTA 5J59A 5BSWA 5IKXA 4BNHA 4NICA 4DIOA 4I1UA 2EQAA 3JXIA 3D7RA 4U0JA 1OREA 4JR0A 3LE8A 1CQWA 4KQFA 2VAPA 5CYPA 2AC4A 3M1AA 4NG5A 2JCSA 4UBMA 1DO8A 2VJNA 4PCVA 2H16A 3RSQA 3VPDA 1G20E 3DUWA 4RK1A 3O4IA 3K0AB 5EZ5A 4LYAA 1CR0A 1ZCJA 4TZKA 3JD4A 1DDIA 3A7EA 3WKCA 1PKEA 3FTSA 3Q15A 2HI0A 2LXNA 4B75A 3HXQA 2UYCA 2M2IA 4UE3S 1XJ5A 1N6PA 4NVRA 3PNLB 4I2ZA 5EOVA 4BASA 3OE7A 4ATZD 5B36A 1AA6A 1OZGA 4TMVA 3V97A 4CKZA 3WGZA 2WUEA 1NU6A 4C5CA 3CSUA 3NHJA 4KU4A 3DE1X 2QY6A 4R2HA 1SOUA 3CPHA 5K3BA 1RYBA 5AHWA 3VOBA 1GU7A 3WBBA 2OZLB 2PZFA 3G2UA 1MABB 2UUPA 2FEWB 4OK6A 4OV6B 4UU1A 1ML4A 1Z38A 1JR3E 1CC1S 1MN6A 4S1VA 3SICE 3ZU7B 1XGKA 1S0UA 5BWNA 2UWJG 2G5GX 1BE0A 1SJ9A 1SQ0A 4JLUA 2DYKA 2SBTA 1YF3A 2OV3A 4G1VA 3EDOA 4YO8A 2WQ6A 4EW6A 4JVSB 4CT0A 3B6JA 4QRDA 1KNXA 4OTZA 2NP7A 3W5HA 2IX9A 2QOEA 2WWHA 1PWXA 2I6FA 5FQNA 3EVGA 3IILA 3ASHA 2I6SA 1G20B 2YYYA 2UKDA 1KVQA 1V48A 1ZNZA 3ASZA 4UBOA 4XSVA 4LRQA 3TUIC 5C52B 3QAQA 1E6WA 1CW2B 3BA1A 2P2SA 5ALYA 1NT4A 4R6WA 1T5IA 4AKIA 1E2GA 1V4NA 4WESA 5GADl 4YDYA 1IWOA 5TB5A 4NOJA 4D46A 5LWHA 3FLMA 2HYIC 1SVOA 3TPCA 5BN3A 4N3CA 1B4DA 1VECA 2FRDA 1NMXA 3L82B 1JXQA 3ELWA 1L7BA 1SC4A 4GM4A 1X3LA 2QN8A 4Z3KA 4QT4A 1B0UA 2COEA 3DEPA 2NT3A 5CT4A 1PFQA 3LY5A 4D8WA 1DJPA 4JC5A 2FZCA 5I3ZA 5LQCA 3D6JA 1NPTO 1UBEA 2CJPA 1G8HA 1JR3D 1EFPA 3KQOA 3FSJX 2G06A 2EJWA 4TM7A 5YASA 3L13A 2HIMA 3UUFA 1FFXA 4R0MA 4YAKA 3V4RA 1B0ZA 4E14A 3SAJA 1Y5NA 2RHLA 4XTCS 1CR4A 2AJLI 3NDPA 1SUBA 4FYMA 3NBXX 3RU0A 4KLAA 3QP9A 4J7UA 5E6UB 1KSHA 3WMGA 4E31A 4PYLA 3TQHA 1R4NA 3JALA 3DNMA 3MMSA 3K94A 4LDRA 4E5SA 2PX5A 5ALDA 3WWYA 1B15A 1B6RA 2Q4EA 3RW9A 1VLVA 6GPBA 4FQ8A 3B1KA 2FG7C 4R9NA 3QJZA 1OAOA 3NTOA 3KPYA 1WMAA 3QBTA 1P5QA 4IEFB 3KE8A 4IO1A 4A1SA 1ISJA 3H42B 3SK0A 3JAWB 4HWOA 5DTQA 1Y8CA 2CFSA 1DKMA 4TKLA 4UTVA 4NYMQ 3SZ3A 4B82A 5JCXA 4A6XA 1T2AA 2OXIA 2DSTA 5FF9A 3JAMA 3JASA 3DAHA 5H1YA 5BSEA 5BSVA 4HQ6A 1G9SA 1HDXA 3GT7A 3PNTB 5JQGF 2Q3CA 3BG0B 1X8KA 2D59A 2C3OA 4CGWA 1HFJA 2A58A 1OZFA 1POWA 3KCNA 4M1YA 1KO4A 4D97A 1G42A 1ZIOA 3N2NA 3OU7A 1WXEA 4FS8A 4TT3D 5A6VA 2VWPA 4QGBA 4RPGA 4M1MA 4ZOCA 1EG7A 2V9CA 4O08A 1RQ2A 3GNLA 3VTAA 2GSWA 1WXGA 4O4LA 4M9RA 1QXSA 3Q7AA 1MH9A 1AG9A 2R17C 1OIXA 1P1IA 1RU3A 2WSIA 3UM9A 3GXBA 2R6CA 3VZQA 3AWDA 5KDOA 1Y8ZA 2GXUA 2EP8A 3LKUA 3PSAA 3BKXA 4HFJA 1QYRA 1O3YA 3QFFA 3ZJ4A 2RGDA 3ZCVA 4R2LA 4BKOA 5IFKA 4OREX 1T6ZA 1R6AA 1WUTA 1N0IA 1FYEA 2WFLA 5KU1A 5D0OD 1CDZA 4EO9A 5BWMA 3FGOA 2COUA 2WZCA 1NQVA 2F43A 1GSOA 4Y9UA 5DP2A 2CKDA 2WNIA 4XYLA 1JLKA 3BE8A 4MR8A 3UMJA 1U1DA 4D56A 4E13A 3HYNA 1S9HA 1U9JA 1W52X 3LHKA 4KXQA 4UU8A 3WL4A 4BQOA 4TV3A 3C85A 1QIFA 3C1OA 2C97A 3JQCA 4HNQA 4B8YA 2QTZA 3ADPA 3E4BA 1YL5A 1REQB 2FMIA 3AR7A 3Q11A 2CJWA 5KQSA 1FSPA 4CYMD 2MYOA 3HLKA 4MWDA 1L4FA 2OR3A 1OB5A 4HXFB 4OQDA 3HJHA 1R6BX 1F14A 2VXOA 2Z2JA 4CL0A 4OHYA 4AQ7A 4RGVA 3AFGA 3W9FA 1WKBA 1YJAA 3PC7A 3RSZA 1S6YA 4KMSA 4JLMA 3TWVA 4B3MB 1VP3A 1NXVA 3KQYA 1QJ4A 3LECA 3O94A 3R3YA 9LDTA 5F2NA 4M7WA 3ZJVA 2YWEA 4KCGA 1R4MB 4J8PA 2X1HA 4ZWNA 3F6YA 3VPSA 4DV0B 4MYCA 4YWHA 3MS4A 3LUJA 4D3XA 3HJFA 3ZPJA 3DEOA 1Q44A 3CHMA 1X13A 3JQ7B 3OM1A 4KG7A 5HE9A 1F3LA 2H9IA 3RTAA 2VK1A 3AETB 4CMCA 2GZAA 4CTOA 2PUEA 2G8NA 2G7MC 3ODGA 1BQ4A 2BUBA 2II6A 1H1LA 2XUKA 1Y81A 4UMEA 1K1BA 2C1ZA 4MRMB 5EWMA 4D8TA 2XENA 1QF9A 3QBEA 3WGOA 1BOFA 3X1XA 1SBQA 5FJIA 1IBLB 1ZM3A 4MPDA 1UANA 2F43B 1H1DA 3SX4A 3L7AA 3VO8A 3VMMA 2C3MA 4I1MA 1PK7A 3VZDA 1CY1A 4YRGA 4CM9A 5BR7A 2Z8YM 5M34A 3DDOA 2Q3MA 3ABSB 4JYBA 3CVYA 3GBVA 3ISJA 5AI6A 1A96A 2DLDA 4J0IA 3TXMA 4CIBA 2OGWA 3THXA 2QUIA 5CVCA 1JU3A 4FX2A 4JI4B 4CEIB 4WWNA 2FLWA 1HQDA 2PJRA 2DHCA 3IOBA 4QWWA 1F0KA 2AN3A 3DM5A 3NIFB 4WFKA 2YJ4A 4C1NA 6Q21A 4N82A 2QAGC 4I36A 5GIOE 1LB1B 1H2ZA 4OEHA 4F86A 5BYKA 5CFMA 4I5GA 5GOZA 3R5SA 2G0AA 3L6CA 3VTZA 1IQPA 1JJ7A 3BSSA 4RJTA 1P74A 3JARB 3RSLA 4YMUA 3H2YA 2ZPTX 1FU8A 1JQ3A 2B61A 3H9EO 3LUKA 4IHKA 7REQA 5TT0A 4NJMA 5ALLA 3AF0A 4IJ6A 3TZ6A 4BRZA 1PVDA 1C7QA 1PQPA 2WTXA 2O7NA 1VDZA 4MUMA 3WSVA 5EQDA 2WQHA 1K3FA 2JAHA 3ASUA 3HJCA 3NHKA 1BJRE 1XVLA 2X7JA 5L6LB 1Z83A 3F8WA 4V1CA 2FLVA 3QEOA 4HI9A 2AWNA 4S1PA 1RXVA 4UQZA 5AVOA 1U8EA 2DTEA 2WIFA 3Q6IA 2HIHA 3ROZA 5IKPA 1U6IA 1E1LA 1FOEB 2X5KO 2WYHA 4XGIA 2AK3A 4G8CA 5EZYF 2HMSA 4LDNA 1T2EA 3WZMA 2REQA 2WDPA 3DLPX 3OCYA 1WKCA 4DA7A 5HIIA 3NWBA 2H2GA 1IHYA 5DSTA 2OXFA 2FW1A 5HW0A 2B94A 4HZIA 1IHXA 2P0AA 2Q9BA 3FU0A 1AXEA 3MRTA 3TD6A 1QQ6A 1OBFO 1QHSA 4JAVC 4PZEA 3UQZA 4U39A 5LD2B 3PKZA 5CDFE 3PJRA 4ZVSA 5LMNB 1VLQA 3BEEA 2VP4A 1I7PA 2GERA 1SGWA 1EFRA 1E8DA 5BO5A 4DM4A 4KREA 3F9RA 1ZFNA 2IYSA 1O1YA 2ZJ2A 3TH5A 1BN7A 3U7JA 4F7DA 4BLTA 4P31A 2W2KA 3OIWA 1XTQA 2IZ5A 1T6YA 4QPCA 1MTZA 4HDKB 3I73A 2BTOA 1U0LA 3AVOA 2O5VA 3P45A 3FWZA 1YB1A 2RAFA 1YUBA 3B1XA 5CBNA 3DKVA 1WM5A 2Z56A 1HDRA 3SYNA 3VTFA 5EYPA 4B5LA 4LAFA 4AUMA 2EILE 1SHKA 2XDYA 4B4DA 2IHNA 4HGYA 5ECYA 1D5CA 3G0BA 4RH1A 4JJGA 1WTCA 4DI3A 3IAM1 4IQ0A 1WSAA 4UCFA 3DO5A 3TLAA 1AGXA 3MAJA 1JDPA 3AG6A 1ADJA 2IYEA 3R0ZA 1XIVA 1Y1SA 1ZM4A 4TMXA 1IB6A 4B74A 1TEXA 2GXQA 4GF5A 1CE8A 1OC4A 1Z08A 4QDXA 4G36A 4LCBA 4ZJZA 1N5KA 4MROA 3WGGA 4LBZA 1PUXA 2HM7A 4JBIA 4PZPA 3BDVA 1WHSB 3GT3A 3Q3EA 2QDXA 4HFNA 4OYLA 2P27A 3ZOKA 1HORA 1M2GA 1U2SA 2B82A 3MEKA 1KYXA 4JOSA 5L7WA 2VBGA 2ERCA 1KDRA 2EBWA 2XWSA 2VSXE 1J8DA 3CUVA 2EEZA 3D4IA 1U94A 2WHRA 3BDAA 3GJRA 3O8OA 3ZHRA 4Z4FA 2FWMX 3OZRA 2VXBA 3MKQB 2P1DA 4X1IB 3O74A 5CA0F 2D0PB 3H83A 1RLTA 1N0QA 3T7KA 4LRSB 4ZU3A 4YFVA 2BH2A 1JIUA 3GLIB 3CW2A 1JG4A 3KZ1E 5FLKA 3AGPA 2CLFB 4DUGD 1EKXA 1W76A 4L78A 1J07A 3DULA 2CLLB 5LWQA 2QVLA 1B3BA 2WJZB 2XSZD 3C41J 1RI4A 3QE0A 2FJAB 1K68A 2YBEA 3M2PA 1NP6A 3Q6MA 2NU6A 1NP7A 2XF2A 1UIRA 4YT4A 1V39A 1T1GA 1UBHS 4G5SA 3T0IA 4IMIB 1PR6A 4QJBA 1JHOA 2GAJA 2HLDA 1P3Y1 3A9TA 1ISGA 4TV8B 5CT8A 4M54A 3PRZA 1CJTC 2HLPA 4GXNA 4Q6BA 3O8QB 3QKWA 3R7RA 4BFUA 3MJCA 1CDDA 5LQSA 4KPUB 2APJA 3HYSA 4GB9A 1SCIA 2GZRA 2WJ3A 4IFIA 5FIOA 2B0JA 3K5HA 1QQEA 4L72A 5IDWA 2VHQA 1S2GA 3AM4A 1NUPA 1BSVA 2V3WA 5TGDA 1Q1NA 5AFSA 2UUOA 1G2IA 3DKPA 3S8EA 2RGUA 4BC1A 3FFLA 3ZYQA 3OPQA 3KYDB 1FDWA 4CMHA 5KYXB 4ME2A 3OPYI 3W8NA 5CFPA 1S4QA 4RVDA 3K9IA 2PH1A 2R00A 1N7GA 1GPAA 3PGXA 3RFXA 4DARA 1IQ0A 4B0ZA 1U28A 1PYOA 1LNQA 1QPBA 1I33A 1R0ZA 3CMMA 1W49A 2KPOA 2XYRA 4HGOA 3SGHA 2YQ4A 5B6PA 5EJEA 5FTNA 1U0HC 2FW7A 5TMEA 2Q7FA 2PUFA 2IDJA 3VR6A 3MHTA 1G6OA 4R1UA 5DJ5A 1DUSA 4WIAA 1ZH0A 1K75A 4XX0B 4M1SA 1JQJC 3SZRA 2AX3A 5KTSA 3BGDA 2P9YA 1XQ6A 3IXQA 3CX3A 3PXCX 1OHHD 1VLMA 2YNMA 1NYRA 1Z2NX 3QEJA 4QTTB 1Z22A 3FAZA 4C0LA 1N2JA 3CNBA 1JJIA 1V8PA 4I66A 3R0XA 2XCTB 1Z2OX 4FI3F 5DDIP 1FCHA 2H2DA 3SYLA 2HU2A 2QPOA 4NEHB 4PAQA 4YJHA 1VCOA 4NH0A 2XRMA 1C7JA 3ZHSA 2GCOB 3QU5A 4M0UA 4MULA 4ADSG 2DQKA 3LCVB 4B34A 3O90A 5DYNA 5CB4F 3NKLA 1II9A 3HEMA 2WYVA 4C7JA 1W4RA 4GZMA 2FU5C 4BNKA 5JPCA 1T6XA 3SFZA 4C2UA 2EW8A 3DUFA 4KBFA 2VYNA 4KIWA 1DADA 4M9XA 3W7AA 5B7GA 3BMNB 1SOWA 3PRKE 1C41A 4OL0A 1IK6A 1MJFA 1P60A 5L45A 1H5QA 2I2BA 1HE1C 3EVTA 4MP8A 2A7XA 3IP1A 1GA1A 1WWKA 2YZ7A 2ZE5A 3JARA 3RVLA 3DYIA 3DZ8A 3CGGA 3JRWA 4Q66C 3T4XA 2IHUA 4H31A 4AKTA 5A3VA 2WYIA 3FSGD 1QF7A 4GZDA 2XIQA 3KHKA 5G3YA 2A9KA 3I05A 2XHEA 2Q46A 2ZYAA 2E4VA 3I1JA 4JBYA 2CMKA 4QBHA 5JMND 2CLIB 1PS8A 1UC5B 1U7XA 3IUYA 1KO1A 4OK5A 4JI6B 3W3AD 1NR1A 2GVZC 4Q4HB 3VU8A 1Z4LA 5F78A 4I8IA 5LQJA 3AS8A 1PR4A 3OBIA 4OIMA 4YV0A 4JV5B 3GLFA 5FYQA 1QIMA 3AR9A 3AQ4A 3RD5A 4L3OA 2J5BA 2GKSA 4PHHA 5TT1A 3W7VA 3AEUB 4UOZA 4JXXA 2I8LA 5IXJA 3S4YA 2B78A 2J85A 2NG1A 4O4HA 5KREA 3DE3X 4D6YA 1T5HX 4LJ5A 2ZRJA 1ACLA 1N7JA 3KYBA 2OP1A 4PHFA 4ZOEA 1XN1A 2A1TS 3JW8A 1KJZA 4RV5A 3R7SA 2HJ9A 4NFLA 2X86A 4FHFA 3DTVB 2JGRA 4P5DA 2UYHA 3G59A 3L0IB 4HG2A 5IVDA 1NVWQ 2VT3A 3G2PA 2J08A 3B7GA 5BV7A 3ULQA 4FLMA 2GNAA 3FOAA 3N59A 5BPPA 2FOXA 3CRNA 1WULS 2W6IA 4YVFA 1YNSA 3JCZA 4KOEC 2UXCB 5J2TF 2O54A 3DSUA 1NRJB 3L7BA 3W9BA 2XJ4A 2AOTB 3KEAA 1WV1A 4RMJA 2YWJA 2KBXA 4FYPA 4JW1A 4JIMA 4QD3A 5FH9A 1FUUA 2JGAA 3DBRA 3N8NA 1AC5A 4UCWA 5G4LA 3SQNA 1EM6A 3HE3A 1BDBA 4GCNA 3TGWA 2V6GA 1UPXA 3I04M 4UTRA 3CPJB 4RD1A 4JJIA 2COKA 3EVNA 1EIWA 2XKKA 5A5GA 4ZC1A 4UEOA 1TAHA 4JVMA 4LKRA 5CYOA 5I01A 2RK3A 4RYDA 3MLBA 1KQFA 3WTCA 1M75A 2I2AA 1C8KA 3IESA 3GLQA 3T9AA 3ZVRA 4ED9A 1JLRA 1T8UA 1V4VA 2CV1A 5A23A 1PZMA 4DT1B 3SHVA 1BDJA 3OBBA 4OX9Y 1ULAA 4FWTA 3K8YA 5JAOA 2J4BA 3OQBA 4F2PA 2WUGA 5JZMA 3P8ZA 1AKWA 4UPEA 3O2SB 1CY2A 4G5HA 3R2JA 2BRUA 2A5YB 4UHJA 5HZMA 6YASA 2O7SA 5K6AC 3I83A 5D7NA 5MGBA 4PX9A 1IPEA 2Q2WA 1NU8A 4JKOA 4K46A 4RVNA 4DCGA 1PUIA 2C9CA 3WXXA 4FDTA 1D8EA 3RBAA 5CYFA 4EI8A 3RHZA 5CCDA 1XNQB 4O1PA 3CO5A 1Q7TA 5FUXA 1QC5B 4AD8A 3NB2A 3IIEA 1MC5A 2D2EA 3OZ7A 4ZQEA 3ZY3A 4CQMA 4INOA 2X5NA 2VDOB 1QH9A 5DI3A 1ZH2A 2PUHA 3MLEA 3GEPA 2WZDA 1HPLA 4Y7CA 4DZZA 2XUZA 1MDFA 2KW5A 2HJVA 4QDUA 4XE5A 3VNAA 1GEEA 2PZMA 1GPKA 3VSCA 2WICA 3M4JA 4HHEA 5A2GA 1DX4A 1KJYA 3TB6A 5L4LA 2OPBA 3GLSA 1E5VA 1A77A 2VP5A 3NP9A 1D8AA 3DVRX 2CCGA 2D62A 1J23A 1ICEA 5K01A 3HXPA 2NO4A 2Z4TA 2ZRHA 1WABA 2F9FA 2LUOA 3M2TA 3WDLA 2ZI6A 1ORRA 3AP2A 3B9BA 4NOKA 1SXJD 4NG4A 3R6WA 4L5CA 3SX0A 2Z0MA 3V1UA 4FIZA 4EHAA 4EJSB 1WUKS 2I3BA 3OFND 4P08A 3C1AA 3EQ8A 4FT4A 5AJUA 1TPYA 1S4MA 4LC1A 1YVDA 3KXIA 1Q84A 1J8QA 1GZ7A 4RL6A 4WXHA 4RS4A 1L4YA 3TVYA 2BFEA 3DFMA 1SZJG 3T7CA 5IZCC 1W4CA 4X8QA 4QOJA 4F4FA 3K9HA 5AQBA 2BR4A 5FL7D 1THGA 2O8EB 1MAWA 1OBHA 3LA6A 1SKAA 4G5FA 3H8JA 2AZXA 5A3SA 1KI7A 4OL9A 3SMQA 5JD5A 5M7EA 2WB2A 1DKLA 3I5YA 2H85A 1C30A 2Q1WA 3IVAA 5EZ6B 4F97A 3WWCA 5EWLB 2PX2A 5CB4A 4OKSA 4U2KA 1N0RA 1KH1A 2IQIA 2QP4A 4R40A 2QX6A 5EHNA 1YQEA 2IE8A 4MI9A 1IEXA 3SC6A 2IYRA 4PQRA 5IDVA 4TXPA 1O4VA 3E48A 3FNQA 1XZGA 3CUWA 3IHKA 4JQSA 4JWKA 4CKCB 4WN9B 1L0BA 2UVPA 3PHIA 4Q69A 1MB3A 1Y80A 1RP1A 2YFHA 1KK1A 1EUCA 1WCWA 2V0CA 1LBIA 1UZNA 2HIAA 4HRVA 4IUYA 1T9DA 1DSSG 4YT5A 3VR0A 4FYVA 2PUGA 1ZGBA 4XCQA 4YMTA 4QJ3A 5JJIA 4F4UA 1UBMS 3RIEA 2R44A 3ORQA 3U4HA 3U4AA 1FNSA 4G63A 3PG5A 2GM9A 3G0OA 3A1SA 3ZDRA 3FLEA 2KMLA 4JCOA 5H5JA 821PA 1ZZGA 2DULA 3HB7A 1WDWB 4HEA1 5LVAA 2P9EA 3M4ZA 4DC9A 4F5WA 4BQRA 3CTMA 3D9MA 2VJQA 3GG9A 4DGSA 4TV9A 1RW4A 1H2UA 3E2MA 4ALNA 3RU9A 3V4ZA 4KL8S 1S3GA 4CDMA 2PSHA 4DV4B 4EWLA 1NJFA 2FFRA 4RWEA 1Q0LA 3P9RA 3S2UA 4Q9NA 4DSNA 3L07A 4CTMA 4FB4A 1J49A 3N7AA 2LE0A 2BONA 3DOJA 5LQDA 1TYQG 5D2MC 2VDQB 4EQZA 2GBGA 4NJEA 3WBJA 3OM9A 4ZALA 3WLHA 3ZRHA 1H0SA 2YX1A 4G2NA 3ZU5A 4BQIA 5K6AA 2XUGA 3BCUA 1G8KA 2RIPA 2VAWA 4F2DA 2PUTA 4KQXA 1L5QA 2JFGA 1PY1A 1Q2XA 2Y4TA 1DRVA 3D2LA 3EFOA 3I4FA 3MTJA 4PFJA 4Q7JB 4RD6A 4XYBA 5BOVA 2QRHA 4BE4A 5BN3B 1OCEA 8OHMA 5DWVA 3L3BA 4ARBA 2HRQA 4QBGB 4OLFA 2NV6A 4P3XA 3WADA 5KHLB 3SSMA 1VL2A 1E3WA 4O25A 1ZH8A 2YV1A 2PSDA 3IEIA 5LA6B 4P35A 3CS3A 2WJVA 4RFSB 4U9IS 3HJGA 4JEMA 3R8XA 1QPZA 1ORVA 5BW6B 3JSXA 3THWB 2QTHA 1ZOPA 2WILA 2D74A 3I4LA 4OAPA 5ES3A 1Z4PX 1OVMA 4R2MA 2C2ZA 2GHIA 4ZCPA 3ZE0B 4EZIA 1WTAA 3D6FA 4RJKA 1G8AA 2Q9UA 4W1SA 4HLLA 3ILXA 2JFUA 1RC0A 2NUPB 1UPUA 3CF2A 3HFRA 4G9BA 4P4GA 1NF2A 1ESZA 1LGYA 2VAMA 3CSSA 4A8JA 3O95A 4HX9A 5E6UA 1WUYA 4EUSA 1TU4A 4QOSA 1G1AA 1RWMA 1I01A 4UAVA 1B8VA 3GI1A 1RE0A 2Q6TA 1FY2A 5FOUA 4EPVA 2H18A 5FHRA 1G291 3IT3A 4MAAA 4LK2A 1B3RA 4F3CA 4OBXA 4G07A 1ZU2A 1U9YA 2GVNA 4PX2A 1K6XA 2GVDC 5DF1A 2EWWA 5J63A 2CXHA 1AS3A 1T5BA 3DOFA 3G0IA 2ZGDA 2L42A 4IFTA 2FPXA 1O87A 1YKGA 3UMCA 2V59A 1RAEA 4DT1A 4FJZA 4KNYA 2YCLA 4WDQA 5ALSA 3OOJA 1I3OA 4GR4A 1JG3A 3KD3A 5ENSD 5CURA 3KQMA 1914A 3EVBA 1TNOA 3FNGA 2JFVA 2HNBA 4J16C 3PEFA 4E03A 3GG2A 2WJGA 5AW6A 4X94A 1XTJA 3M6AA 2VSOE 4QASA 3WRXC 3AR8A 1DJLA 1F6WA 1J70A 5A6CA 2V54A 4Q34A 1OH8A 1P2SA 4LISA 4ZKEA 2FFJA 2D06A 1FDIA 4B35A 4OYSA 1QB8A 2ZAGA 3JWEA 2KBFA 4GICA 4DCPA 4TKVB 3Q8WA 4WDRA 1G2PA 1FNCA 5LOVF 1QBQA 3DWEX 1SZAA 3CA8A 5JJBA 4W5NA 4U2FA 3I9MA 2VJAA 3LM8A 3EJ6A 3UKRG 2HK9A 4LHZA 5JY6A 1GQFA 2JCVA 5KTTA 3CKCA 3MCTA 4I8XA 1TYEB 3RV4A 1XKTA 2CDAA 2IEDA 3IBSA 4JODA 1ZGCA 4QJ4A 3TIIA 1KBOA 2VJPA 3QA3E 4PPFA 2WEKA 1UWVA 4L22A 1J2RA 1DIHA 4MCJA 4N8EA 4ZEXA 3ZNNA 2VHEA 1H6KA 2QRVA 2LV8A 1K4YA 2O1SA 3BWMA 4CMKA 3VNVA 3SI7A 3QG5A 1CUBA 3CLKA 3NVDA 2FQ1A 4RZ2A 1D2MA 1FB5A 3RTCA 4Y6WA 2HBZA 4UJ5A 2R5SA 1XZBA 3F5QA 2RK6A 4I55A 3UJBA 4YDOA 5HFAA 5HF8A 1VHLA 2CUTA 2O3JA 4XKJA 3ASFA 3UK1A 2CDBA 1KR5A 4Z4IA 4RV9A 2X3FA 3V46A 2BFEB 2R1VB 3N9IA 3MA0A 1P2DA 2L0XA 1BEUB 1LD7A 4MQFA 3ZS9A 5JQGB 5A5VA 1FNMA 2VVTA 1ML3A 4B6JA 1GG9A 4C08A 3RIMA 3PKIA 3RKUA 1RI5A 4MKFA 2ET6A 3B95A 1IBCA 4B46A 1FK8A 2IYNA 5EYPF 2QX9A 3DTNA 4U7GA 1N95A 1M0SA 2PL3A 1TFUA 1TMYA 3GLHB 3Q3JB 5IAEA 3QE9Y 1PK9A 1U8UA 1I4TD 2YYAA 3UW3A 2P9LG 3ZYMA 2PX4A 2Z6VA 3NUGA 2YWFA 1R74A 5AVKA 3AF5A 4OVUA 1ZM9A 3WGIA 5DN6A 1U4OA 1V3VA 3T9EA 3GAAA 2WBLC 3GLRA 3TLJA 3PTAA 2IO3C 1WA5A 1VSQA 2Y2VA 2ZVDA 3ABRB 4HYYA 3D8SA 4TWRA 4AM9A 3VKWA 1YCDA 2RC5A 2ZT5A 4EO7A 3V32A 3X2QE 5KCMA 1AB6A 2F3QA 1YB5A 4B3HA 2B5VA 4F7WA 1THZA 2ZT7A 3LVBA 3OD5A 4U7PB 4I4TB 2IQCA 2A94A 1NVKA 2FMKA 3LQQA 5I7AA 2P9UG 4LSZE 1ULZA 2AFHB 2HPAA 2XXJA 1KORA 3C3CA 5D6NA 4AJ2A 4DCCA 1RLMA 2GO1A 4QXOA 4HFMA 5F2OA 1LV8A 3WMXA 3A4LA 3IB6A 3HVEA 4CM3A 2D5LA 4G1TA 1QHYA 2J9YB 2J3KA 4BV3A 2JC3A 2VOJA 2IYFA 5H8WA 4WOCA 4CDNA 5HTOA 1O03A 3ZVLA 1NMYA 3U61B 1GGEA 1DE0A 5HZGA 3I9LA 2GJ8A 2WC1A 4DG5A 3EMDA 3C3DA 3CZAA 4JN6B 2PL2A 3VVLA 1U7OA 2PLNA 2W2OA 3EC2A 1KKUA 2W6JD 1O95D 3QX7A 4RFVA 3EFBA 5C8YB 4A82A 3EWAA 4X66B 1O5IA 1NQOA 1W85B 3H04A 3CZRA 2OCBA 3FPSA 2FXVA 3KWJA 2Y4UA 2IP4A 4MYUA 3UHOA 4D2IA 3FCAA 1BD4A 4C05A 3MWGA 3WGUA 3U4QA 3ZGQA 4YCBA 1U7PA 1XVUA 1IZYA 1IBRA 1L1QA 1EXNA 5ITZF 1SU8A 4NR0A 4R8VA 1M74A 4D9EA 1U9IA 5EKDA 3D9JA 1PNOA 4ARCA 2AEFA 4BMZA 3F0TA 4C0QC 4RGQA 3F4BA 1NRXA 2Q5EA 4KQGA 5F9MA 1APBA 3VBEA 1JHPA 3EY9A 1FUIA 1WAMA 2KCKA 1WB4A 4Y6QA 3BICA 3SQDA 3ORYA 3VAAA 1VA4A 1PZGA 1UBNA 2A35A 4M55A 4ATNA 2R66A 5FBVB 2AZDA 1K06A 1QGED 2OFPA 4LJ8A 1NI4B 3JYOA 3PI6A 2P2CA 3IKLA 3B9RA 2F2TA 3VSBA 2OBFA 3BXXA 4F4HA 4N2SA 1DV1A 3TI7A 3IKVA 5TGTA 4GECA 4TYPA 3GJXC 3IVGA 3UXHA 3ZUPA 3NTRA 4A8JB 2R02A 3QU7A 3MBOA 1SRQA 5KYUB 4ETIA 2R79A 1KC1A 1SBNE 1XEXA 5EYPB 3D59A 5CT9A 2X9LA 2C2GA 1RWBA 3IOYA 2XOKA 3R5FA 3Q7RA 4CLEA 4OXNA 4FYWA 4YUXA 4TXQA 2ZZKA 1C3OB 1G38A 3LXMA 2VTVA 1XPRA 1LTKA 1G3UA 3AVVA 4HDAA 1L2TA 4L6AA 4RPIA 1TU0A 4L8VA 4D57A 4E3ZA 2AXPA 4ZHQB 3JXEA 3MQ2A 5AVTA 1S02A 3RK4A 5ALIA 5TQ0B 3KKMA 1IDN1 3K05A 3O3MB 2ILTA 3NV7A 4A8TA 1TU3A 2GAOA 4EPTA 1R0XA 1E1QD 3FW1A 3ILYA 2YVAA 2ERXA 1A7JA 4YP9A 3ISVA 3LGAA 4R0VA 3KVRA 1LJUA 4S1NA 5J1TB 4DLTA 1WHSA 3I39X 2OVFA 1WNFA 3G9XA 2NZ8A 3H2IA 4BMCA 1NWCA 2XQGA 3BUSA 3ICVA 5E7JA 1RLOA 3TW8B 5CRUA 3F4LA 3PCXA 3VI4B 4AQYB 1E0JA 5C0OE 1K8XB 3BC1A 1GLVA 4OHCA 3IQGX 3FFBA 1EDUA 1ADGA 1B89A 1KSJA 3CWCA 3E82A 1Z17A 4K9QA 4X1IA 4QARA 5JFTA 4J0EA 1M7HA 4DCVA 5CDTA 1H4SA 2PKEA 1PJRA 3RKRA 5I7SA 4JMPA 3RF7A 4KPEC 1EUQA 2BGKA 4FGKA 2N1BA 1FJ2A 1MAHA 3L06A 4O2AB 2Q27A 4QHYA 4F1WA 2J4DA 1SBYA 2XY4A 2XMGA 5AWFC 3OFSA 2XOKD 1FQWA 2C94A 4BBJA 2PA0A 2QROA 1E2IA 2XPIA 2E6UX 2YQ5A 5REQA 1N36B 2CK3A 1C3OA 3WWDA 1WO8A 2XH8A 1MH1A 2FRDC