4GYYA

Crystal structure of human o-glcnac transferase with udp-5sglcnac and a peptide substrate
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
715
structure length
693
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFHIYDNRIVLNGIDLKAFLDSLPDVKIVNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/peptide
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 274
structure length 693
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gyyA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gyyA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gyyA03
1IYGA 3IA7A 4G1TA 4KQ1A 2IFUA 4I17A 3ASFA 1P5QA 2QZSA 2O6LA 4UQZA 2XA2A 5I45A 2SKDA 3ZHEB 1FU7A 1EXVA 4LEUA 1Z6QA 3FWVA 4WACA 3Q49B 5DU2A 3WADA 4GYYA 2UY1B 3D0RA 5ENZA 4CGVA 3GZ2A 3DDSA 3OT5A 4HOSA 1V4VA 3CV0A 2IW1A 3KS2A 2R60A 5D00A 3QKYA 2QN9A 5G05J 2HYZA 1PN3A 4L22A 4HOUA 4LEIA 2PL2A 2XMPA 4X6LA 3BCRA 5IKOA 4PQGA 2G9RA 4MI9A 3Q5MA 2XPIA 3DD1A 1JIXA 2C0LA 4YVQC 3TG5A 3TG4A 5ARFA 5A6CA 4GA0A 1NA3A 1P4GA 3CV3A 2AV6A 3BD7A 3OXFA 3LKUA 3BEEA 1L6IA 4WNFA 2C9ZA 3MSCA 4N3BA 4MHSA 4F97A 1JG7A 2P6PA 3OTHA 1L5RA 2FBNA 3QOUA 5A7DB 1HZ4A 4GA1A 3CUWA 1YA0A 4Y6CA 1B4DA 4N3AA 3K9IA 5TMBA 1FU8A 3VTXA 2GEKA 2QLLA 4O6FA 3MS7A 2YQ8A 2IYFA 1KT0A 4AM9A 1NZNA 5DBKA 3AMVA 4CTMA 3VUEA 3WC4A 3GZ1A 3RSZA 2V5FA 4NQ0A 2WPVA 5D01A 3SYRA 3JYSA 2QRPA 4IN3B 4J8EA 1XNFA 2PRIA 3BDAA 3NF1A 4RIGA 1UQUA 4N2QA 3FROA 1RZVA 1IHGA 2XGMA 2QNBA 4EL0A 2QLMA 3MS2A 4W9RA 3CUVA 2ONDA 4BTBA 1ELWA 3G2IA 2DBAA 3MRTA 2QRHA 1YGPA 3ZFWA 2ACWA 3MTBA 2R4TA 4NC9A 1IIRA 3DZCA 1QZ2A 2KC7A 3L7DA 2UWJG 4M60A 4X7PA 2GM9A 7GPBA 5M72A 3QWVA 1P2BA 3EBOA 4GZ5A 5D0OD 3QWWA 2QRQA 4Y6WA 1Z6PA 4I1AA 5ARGA 1E96B 1P2DA 1Z8DA 1KTIA 4UQXA 3ASHA 4BQEA 3H4IA 4M83A 2LSUA 4UI9C 3RHZA 1FTYA 4WUYA 3HBNA 2IEIA 4HWGA 3CK7A 2IUYA 3VUFA 4BT9A 3WXXA 4EQFA 5DXFA 2PYDA 4AMBA 3LY9A 1IXYA 4W6QA 3T7DA 4KXKB 1GZ5A 3Q3HA 1O6CA 4BTAA 1P2GA 2FF4A 3L7CA 3S27A 1J39A 3MQFA 4J8DA 3G2HA 3OY7A 4EL5A 2BUGA 1XV5A 1JG6A 3NC4A 2KATA 5BT1A 1C8KA 4Z5XA 1A8IA 1FTWA 1QQEA 2XEVA 2JZCA 1JIUA 3NB0A 4CTOA 2FF5A 3IEGA 2XCIA 4RIIA 3QDNA 3NPAA 3MT7A 2FEZA 3GYZA 1ZU2A 2KCVA 1F6DA 3L01A 1AXRA 3MTAA 2IEGA 3TGOA 2XCCA 3UPVA 3EDTB 1WUYA 2R4UA 4APOA 2QFCA 3MV3B 2ECPA 4KBQA 2R5SA 4GCNA 5KJNA 3NAZA 1NOJA 2X0EA 5DIZA 4RIEA 3CKCA 3OY2A 2C2LA 2PZIA 3PDNA 5FT9A 2F3UA 4M7PA 1SXQA 2QN1A 5D0QD 5KJLA 5HQ8A 4QLBA 2XA9A 3EBPA 3VDMA 2SKCA 1ZBPA 2IV3A 4EKEA 3HBFA 3ZHEA 3DDWA 2UY1A 4YNDA 2C1XA 4GZ3A 4NEQA 3HBJA 2C4MA 4WNGA 4N3CA 2GPAA 2GEJA 3BCUA 3ULQA 4A1SA 2XCBA 4N39A 3KD7A 2F3QA 4EKYA 2R66A 3QWPA 1GGNA 4GYWA 4LDPA 1P29A 2VCEA 2P58C 3CX4A 4XI9A 3R9AB 2HY7A 5FZQA 3C4QA 3C4VA 3RSCA 4G2VA 3ZCQA 3LCAA 5GPBA 3SZ7A 2PQ6A 2YJNA 2FETA 3LPZA 3Q3IA 1L5VA 1H5UA 1QKJA 3TSAA 3OKAA 4YUAA 1GG8A 2X6QA 1E1YA 3ASDA 5AYWD 2BISA 2QRGA 5CCMA 1BX3A 3MS4A 2AW3A 1L7XA 2PQRA 3OKPA 5JJ6A 3T3IA 2VSNA 3QKWA 5G04C 4MICA 4WADA 2YHCA 5LQDA 4MI3A 2BGUA 1UZUA 4J0UA 3ZCVA 4AIFA 5BNWA 4N2SA 2KS6A 3ASGA 3CVPA 4JA9A 4HORA 1WUTA 2Y4TA 3Q47B 4F96A 3GPBA 4F3VA 1A17A 1FCHA 2C1ZA 2X0FA 1E4OA 1HH8A 3CUUA 1QM5A 3BD6A 4AY5A 3UUXA 2G9QA 3BD8A 4HOQA 2XCUA 1WV0A 2PQNA 3ESKA 1K08A 1NZFA 1ELRA 1WV1A 3VDNB 2GPBA 3O3CA 2KCLA 1PYGA 5LCWC 2Q7FA 2G9UA 2VGXA 2H1HA 4HOTA 2X6RA 3CUTA 2KCKA 1HXIA 2G9VA 4I9CA 8GPBA 1GPAA 3ZN3A 1WW3A 1C50A 4GA2A 4BWRA 3L7BA 1XL1A 3BEOA 1Y8ZA 3OXGA 2J9QA 3CVNA 3MRXA 4JA7A 1PNVA 3D1JA 2GW1A 6GPBA 4AMGA 3MT9A 2IV7A 3OTIA 3S29A 3RIBA 3ZCRA 4BQIA 2GPNA 5DLDA 2XGOA 2F3SA 5KJKA 1ABBA 1FS4A 2AVPA 3NCHA 3S0JA 3CEHA 2FO7A 4UI9J 2FI7A 4JL0A 3Q15A 2C0MA 3NP7A 3T3DA 1FC0A 1FA9A 2NC9A 1EM6A 4RENA 1NZDA 4NRHB 1RRVA 4J8FA 3FFLA 2QN7A 3T5TA 3CEQA 1C8LA 3CEJA 2Y4UA 2ACVA 5FZSA 3T3EA 5EKQD 2PRJA 3OXLA 3S7JA 4U0SA 1L5SA 1NOIA 4U04A 1L5WA 5TVGA 4KYOB 3LY7A 1VGVA 3QHPA 4RBNA 5CCLA 4U07A 3TAXA 2Q6VA 3RU0A 2FFRA 3MV2B 1PSWA 4FKZA 4RELA 5JJTA 4RIFA 2F9FA 4HLNA 3AS5A 5EX0A 5TMDA 2R68A 4YI5A 4XIFA 4AY6A 3RKVA 3RO3A 1LWOA 2X0DA 4RG9A 2QLNA 3MTDA 1Y8MA 2QN3A 3RO2A 4ME2A 4GPKA 1NLMA 4UI9K 4NESA 1SXPA 2VSYA 3S7FA 3IAAA 4B94A 1GFZA 2IYAA 3SYMA 5HI7A 3LYAA 3G2LA 9GPBA 1UQTA 5JJ7A 3AS4A 5FZRA 4X7MA 4UQYA 4YI3A 2LSVA 3COPA 1K06A 3MBOA 4G24A 3FP3A 1RZUA 4G2TA 1Y6GA 4XI0A 2GT1A 3E3NA 2SKEA 2JJMA 4BQFA 4U0ZA 3U4TA 4YVOA 3CEMA 3ZCPA 1JEJA 5HXAA 1HLFA 3CK9A 1XC7A 1PC2A 3BCSA 2ATIA 1L5QA 2QRMA 4JHRA 2HO1A 2AZDA 5JTUA 4H7XA 4MHOA 4I9EA 5CHEE 1F0KA 1WW2A 2ASVA 3ZGQA 4AN4A 1XL0A 4CDRA 3MA5A 3URZA 3ZCTA 1OUVA 1WAO1 2F3PA 3D0QA 3Q3EA 3SF4A 1FTQA 3AS8A 4WHMA 5KJMA 4MRAA 4BFCA 4N5CA 1XKXA 2XA1A 3T3HA 1P4JA 2WQHA 3CVLA 2XGSA 3G2NA 4WNDA 4G25A 3MKRA 2QN2A 3PE4A 3ZCSA 1P4HA 3RJVA 1NA0A 1AHPA 3MRVA 4CTNA 3E3OA 2OFFA 3O48A 2L6JA 2VGYA 3UYLA 3S28A 4GYOA 5FJYA 3C48A 3GW4A 1GPYA 4WNEA 3CK8A 5G04J 1B89A 1FU4A 4CGWA 2AMVA 1W3BA 4I2WA 4H7YA 4GCOA 5FTPA 3CKBA 3Q4AB 2VGXB 3ZCUA 1LWNA 3L7AA 2ZB2A 2I6HA 1GPBA 2VG8A 2HR2A 1XOIA 4FZRA 4BT8A 3E3LA 3UYKA 5JTTA 2IF4A 4KQ2A 4I2ZA 3T3GA 2MHKA 2BFWA 3H4TA 4GPBA 3OTGA 3MT8A 3KAEA 1C3JA 3GUHA 3U3WA 3NP9A 4N9WA 4F9FA 2VYIA 3S7DA 2E2EA 4RIHA 4ABNA 3CUYA 4MI6A 1YA6A 2LNIA 4EJ2A 4REMA 3MEKA 1KLXA 5TMEA 5LCWJ 4RG6A 1KT1A 1JIVA 3PE3A 2QN8A 1NVKA 5C1DA 3G2KA 5BW8C 3LY8A 3E4BA 1Y6FA 1Z62A 3HYMB 3N71A 2PYIA 2VQ2A 4X7RA 1WM5A 3RT1A 4G23A 2JLBA 4G26A 3S7BA 4GZ6A 1TJCA 3HBMA 2VCHA 2BGTA 3WAGA 3L79A 1M5RA 1NOKA 2GJ4A 3CVQA 3VTYA 4U0UA 3OKCA 2H1FA 2OOEA 3ZPJA 5G05C 3S2UA 5IKPA 2WTXA 3G2JA 4KQMA 3UQ3A 5EX3A 3TOVA
chains in the Genus database with same CATH superfamily
4OXKA 1U8EA 3NHMA 3GUUA 4MVJH 2ZUTA 4LHYA 3MQ2A 3M6UA 1K6JA 2IEZA 2AI1A 1J8VA 5JMPA 1CUCA 2R02A 3H5AA 4BNLA 2J3KA 2V4HC 2ZQ5A 1DQSA 5BXUA 2FA9A 5IABA 1CUYA 5HDQA 3OQPA 1JEYA 1H42A 2WIFA 5H16A 1DC4A 4QGFA 2WM9B 1WQ4A 3I9V1 1FU8A 1P75A 3DCNA 2R11A 3ESCA 2Z04A 1IOWA 4M1QA 3IVXA 4ENWA 4JMPA 1E2HA 4IN3B 1DEXA 1E9DA 5FOUA 1GG9A 5AK4A 1CG6A 1Q50A 2ZSEA 5FUVA 2Y66A 1IATA 4YBZA 3LUJA 4LK2A 3KSLA 2W6ZA 1Y4AE 1QGDA 4I4CA 1P74A 1W47A 2DPXA 2HT6A 1I14A 5J63A 3V4SA 2XNJA 1YBMA 4JSYA 4PO9A 3E8MA 4AC9A 3QKSA 4CLEA 4C05A 3EU5A 2A1UB 1S8AA 5HSGA 2A90A 3ESQA 2F6RA 5EQDA 5CXSA 3A28A 3LVRE 5I7WA 3ZX4A 1PR9A 5FBVB 1XAGA 1SXQA 3W9YA 5H5JA 4MWGA 3RWOA 2CLMB 5EILA 3AF4A 2X5KO 3ZX5A 2GEJA 3A27A 2IYQA 2VZ0A 4JWTA 4TMFA 4EZIA 5E0OA 2PEZA 1JVNA 5FFNA 1SHJA 3VU1A 5KOJA 1SC3A 4DLZA 2QDKA 1E1YA 2ON6A 3VO9A 1U2GC 4QPNA 4WY5A 1S6YA 3SY2A 3OD1A 3GEIA 1BMTA 1N95A 3JXJA 5DJ5A 1Y3BE 1HH8A 2WHRA 2A9RA 2V0CA 2I2OA 1SZPA 2GBLA 4B2LA 3TEJA 1GAJA 2YWRA 4JFAA 2J9QA 2IHNA 4XZ4A 1PNVA 2EU8A 3UIOC 3VNSA 2F62A 3PQ8A 1QMPA 1ABBA 1FS4A 1GT91 2J3QA 2B94A 3VI3B 4OQFA 3A0RB 3CFYA 4QHSA 2EERA 3PNLB 3FDZA 4ODIA 4X3CA 4FKZA 4H7PA 5LUAA 1MQ9A 2O19A 1TJYA 4H2DA 3NHKA 1ECFA 1FP1D 2R68A 3L4SO 1DAEA 2TMGA 2NUAA 1ZMRA 2VPQA 5EZYF 1HF3A 2VT6A 2B25A 4KDFA 5EIAA 5E3HA 5JPIA 1BH6A 3INGA 5LIPA 1NI5A 3GCDA 3Q2KA 3A36A 5EP3A 5EJ8A 4D4IA 3DBHB 4NFHA 1KZHA 4G5HA 1H0HA 4IDBA 1ETUA 1G3NB 3HCRA 2I1QA 6Q21A 3I9NA 4Z2AA 3GB9A 1G5RA 4WNDA 5LL6P 5BRJA 3CSSA 3JCKC 3MRVA 3GRUA 1YB7A 1D1TA 4P86A 2XVXA 2ZWOA 5D6NA 4TKUB 1CV2A 1HQKA 2FW8A 3SAJA 4J29A 5K8LA 4YRRA 2MSDB 2NSDA 2VYIA 1A9XB 3ZJYA 2QLTA 1SHUX 2YOFA 3QEKA 5BVHB 3PE3A 3BGOS 1PEKE 4OGFA 7ABPA 1J1IA 2IUSA 4AMYA 1N7JA 3GLFE 2RKOA 5JRDS 2RGUA 3HXTA 3I01M 4M0CA 4MDEA 1S2IA 1ZD2P 2NU9B 4AKIA 2YZ2A 1FYDA 3QARA 4G1TA 3LP6A 3F7NA 2VYQA 3MGBA 1XRSB 2V7UA 1JR6A 3NKFA 2Q1SA 2PZMA 4EZKA 3ZW3A 4MA5A 3OKFA 3UCEA 1Q22A 3WRWA 3U62A 4ZIRB 1KZYC 4I6JA 2FUG1 1E9EA 2ET6A 3DNPA 3L8ZA 3TG4A 3FKSD 2VK1A 4X6XA 2W6OA 5EGSA 3OX2A 3KOZA 3OICA 3ZDCA 2KI5A 3EFOA 1I8TA 5U1PA 5L3ZA 3FKSA 3JD0A 1G5PA 1FQOA 5KMGB 3B7RL 1RYDA 5LZ7A 5F4ZA 4GNRA 3FAKA 3TL6A 4WLEA 4YCDA 4OHRA 3HM9A 4PPNA 3BK2A 1BU8A 3K96A 2ADOA 2VNJA 3QX9A 1E96B 1IN7A 3URKA 4OU5A 3ZBPA 2VNIA 2BBTA 1FFCA 2GO7A 3QJYA 3KL4A 4JPSA 3SIPA 3D2LA 2YXNA 1QVZA 3K2IA 3EE6A 1LUAA 3ZDRA 2OYRA 4B45A 2HU8A 4JNKA 4II2A 5TR9A 4H59A 3SR0A 3KQQA 5I7OA 4ARIA 5J4LA 3C24A 4DA4A 4A7PA 3D9JA 1IKND 2X0EA 1TC1A 4LYAA 1CK4A 1JB9A 1Y6ZA 1TVKA 1ADBA 4D46A 3AJDA 2C04A 1MOZA 4OAQA 3KCQA 3KKZA 1QGYA 4KSYA 2ZUBA 2XKKA 1P2VA 3C4QA 3PBKA 5ILOA 2A0WA 1WO8A 3R77A 4CCWA 4H7FA 3FLAA 3BOSA 3RLFA 1GN8A 3HVIA 4JOSA 3LQ1A 1CB0A 4M0DA 1RPNA 2IDKA 2W90A 4AF8A 3BK7A 2PUHA 3FY4A 1HETA 1EFPB 3X2SA 1QQ7A 4CF5A 1EM8B 1GJRA 1M1YE 4PHHA 4OI2A 4KPYA 3LFHA 1U5CA 3KSZO 5IYZA 1J97A 4B7UA 5KSYA 1YR7A 1E5QA 2OFWA 5FBHA 4ZI5A 2AEMA 1OXMA 4OLBA 2F1IA 4M54A 1NQAO 3Q7AA 4TLMB 1E9BA 3RIBA 2HA3A 1SK8A 1HNZB 1SFRA 2AD5A 2Z58A 3JQFC 5FNVA 3R5FA 4FIDA 4E46A 1J20A 4PCUA 4FYHA 1ECCA 1VBKA 4X8LA 1WM1A 3ZJUA 3SHQA 3LG2A 1XGWA 3KTAB 1BZYA 3DMFA 3HKCB 3UK7A 5IN5A 5M5BA 3RRBA 3RU0A 3HJBA 2C7PA 2ST1A 4DDMA 2CXPA 2X40A 4HPWA 3MTDA 3QEBZ 3V7YA 4Q24A 2WM8A 3ZLTA 2I3GA 3L1KA 2HMUA 4R5HA 4PG8A 3NM5A 2MYOA 4XI0A 5JNUA 2PIDA 5AW3A 2AFIB 4GTOA 3DM5A 1AZLA 4ALJA 3D1LA 1RQNA 2QX4A 1DKRA 4BP3A 2IO2C 1R8SA 3UFBA 1YCDA 4WX2B 4H08A 5J5VA 1VHLA 3KTDA 5AJTA 3SJBA 3I32A 3OX3A 1BXRA 1FTSA 1ZBDA 2PXXA 5LX8A 5JJKA 5FJYA 2NZ2A 2EINE 4D6PA 5JW6A 1RWPA 2OKGA 4RZIA 2IOFK 3CYFA 3P1UA 2H6FA 4LNUB 2HPHA 3SXJA 4XRRA 4WV3A 1CT9A 2G28A 1E94E 4X84A 1EGHA 4QQ8A 1LC0A 1F3OA 1XD9A 5JBNA 4Q3NA 4D97A 5CJPA 3GPDG 4CUZA 4A0QA 3UTDA 4YUZA 3G2UA 3JUEA 3GAZA 1A77A 3COWA 2H29A 3ORSA 3T5BA 2YZ7A 1IZ8A 1J2EA 2OCGA 3LX4A 2R6GA 1T8YA 1TT5A 1OZFA 1G0NA 2O6LA 2HE0A 2GZHA 2VHZA 4Q4JA 3O1HB 2XPZA 2XCOA 5EIBC 4MSUA 1HLGA 4Q01A 2YFYA 1Q6ZA 1ADCA 5F7XA 4L7TA 1JGTA 1NV9A 1XNHA 2Q45A 5E3JA 3FTFA 1CRWG 5CW2A 4UBNA 1PDVA 2LIVA 1IM5A 3RQIA 1OU0A 4A27A 4Q4HA 4NE2A 4YRKA 4BPBA 1NATA 5AW4A 1TDJA 3TQIA 1A9YA 3AMVA 2R5FA 4NBKA 1G0OA 2OENG 4XM1A 4RY0A 4J8EA 3IT1A 1A9RA 2ZCVA 4U63A 5BN4B 2BW0A 4AURA 3HU3A 1KY2A 3ZWXA 1H4TA 4LZZA 5LJIA 2O8VA 4O5OA 4PHGA 1PRYA 4XRGA 3CO0S 3IUEA 5KWVA 4CMJA 4GZ5A 2QY7A 3WA6A 5ARGA 4HNSA 4BESA 4W99A 3Q6IA 3S8MA 1Y3AA 1CSEE 2QZ9A 4RA9A 5HRYA 4HH3C 2VQDA 4Z7NB 5DP1A 1LVGA 1XEWY 2IL1A 3SFVA 1G3QA 3BE4A 3OHMA 4FZ5A 4V3CA 3CLUC 3DTYA 4EX7A 1T26A 1UMBB 4CFSA 3R3XA 3HQ4O 1K27A 4CEMA 1UPXA 2JFZA 2JGKA 1E58A 3B36A 1M7HA 1AB5A 2LW7A 1TAUA 2MR6A 2IV3A 5DH9A 2MMCA 1TEVA 1CUFA 3HBJA 3DCIA 4B46A 2VOJA 2CJXA 4C7BA 3ABME 1T6YA 3V80A 3MHTA 1D2GA 1Q15A 2XQIA 3ADPA 4I4NA 2FZGA 2FSSA 4QUBA 3GHYA 1S4QA 3R7NA 3DW3X 4B6OA 1R5NA 4O8CA 3GJZA 5L3QA 4FTWA 4QKQA 1FRNA 1M6VB 3P2MA 5EZYB 821PA 5IYZF 4IHKA 3H2GA 3PJEA 2CLLB 1PKEA 2BH2A 3L5KA 4NYMR 1EE2A 1W581 1Q14A 4J6EA 1DC7A 3SF8A 5D2CA 2NTEA 2XSZD 4OMFG 3GZJA 1YR6A 1IY8A 3Q9UC 3BD6A 5FNVF 2XNSA 1WV0A 4LZWA 3TN7A 4CIWA 5AQ1A 2SCUB 4PG5A 2WZCA 5LCWC 5TEVA 3AR3A 1Y81A 3BJMA 2JLAA 1ORTA 2KZTA 1THZA 4M7WA 5KTPA 4NBLA 4GL4A 3KB8A 5JS6A 3C5WP 3MRXA 4GIBA 4MKRA 4GQIA 4PG4A 1U0OC 3K6JA 3SFXA 1LS6A 4RF2A 3UY4A 4EW2A 2E18A 4QVGA 4JL0A 2C0MA 3AG3E 1HE4A 1PGOA 2ZYGA 2XE8A 4C6HA 5IT5A 2O3TA 2VWGA 4EABA 1SB9A 3PTLA 1ISSA 1Y7LA 2FLVA 3NDIA 1L1RA 1W8DA 4HQDA 1ABEA 1Q5PA 3HNOA 4GZDA 2X8LA 1KDTA 3Q8WA 3LYAA 3WISA 3K1AA 3L0ZA 1JEYB 5BWBA 5EHXA 1Y6GA 3CLSD 1SOUA 4WWNA 2XKJE 2NUPA 4LY9A 4JB0A 3F6QA 4JHKA 3VR5H 3BICA 3DKRA 2D3WA 1N4QA 1NLYA 3DYIA 3FUNA 1EFHA 5K51A 4G1BA 3BXGA 3O48A 3NB2A 4JXTA 3OX4A 1GZ7A 2H31A 5FL7D 4KRYA 4TMYA 3MM4A 2IWRA 5TT0A 4R1TA 3AHHA 4BVEA 5IC5A 3QV2A 5B3KA 3A70A 1W35A 1KC3A 2VSXA 1MORA 4FKMA 2OBLA 3KB6A 3BWCA 1E7UA 3KR0A 4R0MA 2IXEA 3QKSB 1VKNA 2GZ1A 3FDFA 1AKWA 5FL7A 1AHHA 1S8NA 4KPGA 3A9VA 1YFZA 5H81A 4AF6A 5BV7A 2GJ4A 1WHTA 1QC5A 2X5OA 1CJMA 2EATA 1V5EA 3A25A 1BQ4A 2V55B 4D4JA 1PLLA 1Z38A 4ABYA 1M34B 3PWSA 3EIQA 4EO7A 3ZW9A 3RI3A 4IRUA 4CGVA 8AT1A 2D5AA 3SE0A 3GBSA 1QAQA 2VRNA 1PN3A 1S3FA 1OXSC 4CUKA 2PXAA 4IRXA 2GH1A 1OAAA 4YVQC 1LU9A 3ONNA 5KOJB 3DM9B 3R5JA 4IIDA 4G0UA 621PA 4TKLA 1QGZA 1I3LA 4MI1A 2NYVA 3OLWA 1TZMA 3BSYA 3UNXA 3BE5A 5AW9A 4IIYA 1KZ7B 4RF3A 2ECOA 4XYEA 2ZB4A 4NY1A 4I3HA 3V34A 2ZWAA 1DJPA 3EPLA 2WQZA 2QRJA 4RK7A 3LKVA 2E0IA 4GMXA 4P6VF 1RBZA 1DQNA 2WNHA 4ND6A 3LCVB 2ORWA 2VDQB 3WV5A 1GZSA 3AL3A 5KYUA 3ASHA 2VF5X 2H63A 1ILWA 1ZNYA 4A1FA 1EP1B 3DWIA 1U28A 2JH8A 3AKDA 4HX2A 1BYIA 3UATA 1QG4A 4E1AA 1NRWA 1OYOA 4DT1A 3B8HA 1SAYA 1WW8A 5TF4A 1EEHA 2HTFA 2NUAB 3C39A 2A6PA 4HR7A 2JI7A 4QOFA 5F33A 5GIOE 3UT5B 4ZZIA 4UVGA 1Y7TA 3NCTA 1GGVA 3RNOA 3BCUA 5IBRA 2ZSUA 1J1UA 4I1PA 3WRVA 1RAEA 1R0XA 1OTYA 1M5TA 5IT9A 4Q05A 5K4GA 4QVKA 4Q3OA 1SQ5A 2Z3ZA 3W5UA 4RK6A 4UE2A 3AF1A 3NH6A 5I8PA 3AVVA 1KKUA 3BE6A 2REOA 3GRAA 4G8CA 3FRJA 3GFSA 1ZRMA 2V3VA 1RMYA 1UJKA 5KNLA 2WE7A 2IZZA 4NJMB 3UUXA 3VZRA 3LXXA 5FOSA 1M2GA 1EE1A 1SIOA 1AK9A 5C8XA 3UT4A 2J9ZB 1FDVA 1Z6XA 2ZWVA 1XZHA 3JYNA 5IJ9A 2W00A 2EV9A 2HPAA 2CV0A 5E0KB 1J8MF 1DIAA 4D3FA 3M89A 2XTZA 2GKOA 3FFLA 5CXQA 4UMEA 4K9OA 3PP8A 1A2KC 1QQ6A 3O8CA 3OZUA 3ML9A 1S02A 3TLZA 5B1EA 4ZT7A 1SXPA 1M2NA 3PNKA 3JAMA 1PT8A 3Q15C 5HKKA 3FZQA 1DELA 3IJ5A 4CZ2D 5IP5A 1COZA 1PK9A 2BGRA 4GM1A 2PUCA 1S9HA 1MC4A 2PIAA 2WAMA 1W4BA 1PJ2A 2WFAA 2HO1A 1C41A 1UXOA 2GPYA 1N8SA 3EUFA 4OHKA 4XM2A 3EFOB 2CHWA 4IJQA 2F3PA 4CV0A 4BTEA 1M2EA 3UC9A 4CZ2A 2V0NA 4CXMA 2M2IA 5ITVA 3PNVA 2DFNA 4EA9A 5IAKA 3NR2A 3HP4A 3OHSX 3HXOA 2WR8A 5FO0A 1EFKA 4JB3A 4HVAA 2A84A 1RTTA 4JBYA 3ROFA 1AQIA 4DPMA 1NXXA 1ZM7A 3K9FC 4DZTA 2ZI5A 5ALNA 4P5EA 1S8FA 3GZSA 1QYVA 1L5OA 1Y98A 2DLCX 3UBTA 2AJAA 4K0KB 4G1EB 1EG2A 4WEOA 2YW9A 4OQQA 4FW9A 4R1NA 4NJOA 4IDQA 1QPBA 1W2GA 2JFGA 5LKAA 5HIJA 1O1TA 4JXZA 2PKXA 3MMZA 1XXHE 4EY3A 1DL5A 4J2TA 2MT9A 2ZS7A 1TVKB 3RCBA 4I46A 4GYYA 4FLHA 4Y1FA 2CHEA 4NZZA 2GA8A 2HDHA 2X5XA 2JGLA 1RPAA 1MH1A 1YULA 3CCCA 4YQZA 1TYEB 2HLDD 3WIBA 2OHGA 1P91A 3JZDA 1W6UA 3GLHE 4P3OA 4JWKA 1CQXA 3H04A 4N3AA 1AKQA 1PLKA 4GE0A 1PQ4A 3LCCA 1ULZA 4LOIA 2Y99A 4HSGA 2YS7A 4NG5A 3ENKA 2HLDA 1QHIA 4ZI2A 1EZ4A 4K0RA 5LBIA 1E0SA 2QJTA 2YVLA 1ZJZA 4D81A 3G2IA 4V02A 1INZA 1V2HE 2DG2A 5IYZB 3LD9A 2HF8A 4Q93A 1QIKA 1TD1A 1ZKMA 1JDSA 5IXJA 1H1LA 1ONSA 2X4GA 4NZOA 5MF6A 3EBOA 2B4QA 4OQNA 5A5FA 1AKYA 3R7AA 4ZCIA 3MB5A 4OAPA 2BMDA 4LXHA 5FNVB 4Q9AA 1GYQA 4FFBA 1N1MA 4BQOA 4CGZA 4CM9D 3E3AA 1WXWA 1CERA 3MD0A 5BNTA 4DLPA 2FR8A 1HUQA 2D1SA 4WNIA 5A05A 3EGOA 3LQRA 3O3OB 4J07A 4A16A 2VT3A 4C6RA 2ZBQA 1TA9A 5IJ0A 4TMWA 4CM9A 3KOMA 4JI3B 5D0QD 5HQ8A 1M8FA 4UM9D 1NF3A 4L27A 2BDEA 4NEQA 4CEHA 3WDMA 3BBPA 3O21A 5BN1A 1ZJ6A 2BUCA 3K16A 3EWNA 1P29A 4NK4A 1CJSA 2RHJA 3SJCA 1NPTO 3EPPA 3IVGA 5JYBA 1XCBA 1M2OA 3CRNA 3A1SA 2ONCA 3ZWYA 2CUZA 2QTZA 1LV8A 3RRUA 4P7FA 2X4IA 4I5GA 3R5XA 3OP1A 3SJ7A 2FSIA 5TC4A 1BXRB 2C0QA 4C4OA 2NZXA 4OLJA 4N8SA 9ABPA 4RD3A 4JYPA 3L0YA 1V1RA 3SBOA 3AVQA 4CCYB 2J4DA 1EINA 1DG3A 1K6MA 2XMBA 1N3LA 4P31A 3V9AA 3V6LA 1K4YA 3O3CA 4XWYA 4OHUA 1GGJA 2CXTA 1XFDA 4EAQA 1J00A 3PDIA 3C7CB 4ETWA 5SYAA 4JJGA 1ID8A 2NVUA 5LB2A 1XRNA 3KJIA 2BM8A 3FYUC 2WWVD 1NNSA 1P9OA 3AOEC 2ZBRA 5K0BA 1XZJA 3QSYA 1TM1E 1N7GA 4HH0A 2OLJA 1USUA 3OU2A 1RYNA 3ZIAD 5FZSA 5ANLA 3WTBA 3ZU5A 3UOAB 2I2FA 1TT5B 2WF6A 2ZW9A 2CSUA 3FTYA 4S2UA 4Q4JB 4AY6A 4JUCA 2G72A 4C21A 5HA5A 4BNJA 3H75A 2VDMB 3ZIAA 3U3RA 3JQ9C 3VNUA 3ZWKA 3NVDA 2IPLA 1VZ2A 1G5IA 3LF2A 4YIKA 1P7VA 4DPLA 1ZH0A 4KXMA 3MBOA 3HLKA 3CRVA 4XVUA 3T38A 2DPMA 5HILA 3R20A 2XDAA 4MGZR 2JKZA 3BULA 4EW3A 1R9MA 1PGQA 5G2NA 2AWOA 3TW8A 4E70A 1NVXQ 1YCHA 2WQHA 4XDZA 1B93A 4QBIA 5EHZA 3BHIA 2WMDA 4WOPA 4CCSA 5A9SB 3QH4A 3B5EA 4O4JA 3JATB 3EK2A 4C2AA 2WSBA 2QJOA 4ENRA 2NPOA 3TLXA 4R7ZA 4F86A 3UXGA 2V7GA 4RA9B 1PU2A 1WY7A 1BWSA 4URUR 5L8VA 1KP2A 3LMKA 4A92A 2BELA 1QORA 2GXSA 3DDHA 2H4HA 3L02A 1MC1A 1FFAA 3FAZA 4ZJYA 3EYWA 1GQRA 1OCOE 1WY5A 3F8TA 2PE5A 5EX3A 4WOJA 1G3IA 2O0JA 4UXIA 5CPBA 2ZBFA 3DPIA 3ASFA 2FFGA 4RHEA 4HQNA 4G0XA 4U2BA 1LJLA 3FPJA 5BNIA 1VIMA 2FRXA 1DCKA 4OYLA 1Q7CA 3Q5DA 5H7XA 5DM70 4UC0A 1D2AA 1FVOA 3HP1A 2FXVA 1OFGA 1DIGA 4FINA 4WBXC 3KR9A 4MAFA 4OGGA 3UK0A 5L3QB 3QF7A 1ORVA 3L08A 4BWVA 1ILEA 1E2MA 2J3LA 2VDNB 1V8BA 1N2CA 2E82A 4KNYA 2NSHA 2CMDA 3EDRA 1W7AA 2A86A 2FSPA 3AY3A 3SF8B 4WCFA 1UAYA 2A5GA 2NU6A 3BDAA 1DAPA 1YFLA 2XYQA 2P5TB 2IQ5A 1X9IA 1UL1X 3ZFWA 1NX9A 4I81A 2QE6A 4TVKA 4IL5A 4S0XA 3VOSA 4N54A 2KZTB 4JJAA 4F72A 1P44A 3ZQ4A 1OWLA 1UJNA 3RVJA 5IKMA 1MLDA 1K9VF 2EAUA 1DTEA 3MSXA 1E60A 1RZ3A 3AIKA 2IBTA 5ALMA 3TXYA 5HFAA 1V3VA 2Q5LA 4AMBA 1GZ5A 3WB2A 4PHCA 2I8LA 2A57A 2AG1A 3ZOKA 4RHXA 2YHUA 2LKDA 4XD7D 1Z06A 3AR6A 3IALA 3L49A 1SELA 3TZKA 1YQEA 4DILA 1F48A 1BU9A 2YNMC 2R6R1 2J0VA 3UCXA 3ZDXB 4DUZB 1GQFA 1DARA 2AFHB 2C2GA 2ETAA 3P0HA 5ALPA 4XD7A 5JROA 3DDWA 2RAUA 4DQUA 1LD3A 3NDRA 1UMDA 2CZGA 2LUOA 3IEIA 1TZ2A 2LAHA 2P2YA 5B3AA 3LP8A 1ESEA 2WWIA 2NUPB 3KDSE 3SLRA 4EUSA 2YYAA 2VAWA 1BX0A 3M5CA 4MGKR 4FADA 1CZOA 1P39A 2N9UA 3TIIA 4AS2A 2W7TA 4CLDA 5FJIA 1RYEA 2X15A 5K99A 4CMEC 1K6EA 4YR7A 2ZIAA 4JL8A 1QV9A 2PLNA 2ZI4A 1FW6A 3VNBA 2AEJA 1NR5A 1RRGA 4AKGA 4CMIA 1TUBA 5GOTA 5IZ4A 4HOQA 1KFJB 3PNPA 2BFFB 5HIKA 3BEOA 2V7EA 2F1KA 4RHTA 1N77A 2GPJA 2B2CA 5D1NA 3TUJC 4YACA 4BQIA 4IGAA 1HT1E 4PONA 2DWZA 2YHBA 5BVGA 5C31A 3OQBA 1XYGA 1WHTB 1YKSA 3KG2A 1PT5A 4BJHB 1QC5B 2ZXWE 2C2XA 2AOTA 2CZQA 1L5WA 2V0GA 5EL0A 1WL8A 4ZV7A 4HS9A 3M83A 3VZSA 2ZS8A 3VKVA 3P2KA 2CLOB 3BMCA 4FQ5A 4UZEA 1PW5A 4BJ6A 5K01A 3RFXA 1L9KA 1W4ZA 3S7FA 1Q2UA 5HI7A 1BRMA 1F2DA 3GJ0A 4UU7A 4Q82A 2GT1A 1FUUA 3UJHA 3I30X 3EEFA 3L07A 1LJ8A 1A50B 2FPGA 4O4JF 3UWSA 4BUCA 4D57A 2OGWA 3IAEA 1H0SA 1T6BY 3ZCTA 3X2QE 2GASA 1G8YA 1JQBA 4Z3KA 4HGYA 1IJEA 2IP4A 3WOVA 1Y89A 5HBRA 4KK3A 1JUQA 3ADDA 1CP3A 5KYUB 1EKXA 1LWNA 4C7MA 1N5OX 4E14A 1PBNA 4J1TA 4BNWA 4QO7A 4A8PA 1VYTA 1H6BA 4BU0A 5M04A 4LC0A 4HI0E 4RPHA 1XDDA 3VU9A 4ANVA 2H1VA 4KODA 1LRLA 1K1EA 3TKYA 4MVJD 2DZNA 1R50A 2R25B 1UJBA 1KZGB 1N5DA 5FUXA 2B1GA 3KU4A 1I6LA 1HMPA 4PHFA 1T1RA 2FK7A 3DZDA 3JZAA 3CZ9A 1APBA 3FNHA 1N4AA 4N5DA 1KTVA 1OVMA 4MVJA 5G4LA 5F52A 2FZCA 3LYLA 4II3A 3TFWA 1X14A 1W5BA 4BN5A 3EAFA 4TRQA 1ODCA 2DAPA 3HL0A 3DD1A 3IT3A 2WTAA 4WZBB 1MV5A 2QAJA 3TW4A 3CV3A 2Q4DA 2GRRB 1M2JA 1GVNB 1QOPB 2ZIXA 3KQPA 3DHEA 4JLMA 3GJ5A 4LZOA 1YA0A 4WXEA 4P8RA 1G5TA 1X92A 2PLAA 4UZFA 4JXXA 4Y0AA 4B3MB 1PNTA 4W5QA 4RA6A 1FNNA 2JD2A 4WNYA 3QFTA 5ALGA 1S9DA 2B3DA 5AM4A 2YWBA 1SCDA 4E6EA 2QJFA 2RGCA 2ES4A 4LXIA 4F2DA 3FOWA 2ZE6A 2ZM5A 1Q2ZA 3EXHB 4E51A 1JG4A 5IJ9B 1U9IA 4EQFA 4X92A 2GN0A 1F38A 2XVMA 1JKFA 1U81A 1EAMA 4G5RA 1FX0B 3S99A 4PM4A 2PUTA 5JS8A 2DQZA 3IUMA 1JWGA 3SSMA 3IIEA 4EJFA 4RIEA 2VT7A 2JLRA 3TM4A 4LSMA 1RZ4A 4GNKA 1N1EA 2BMVA 4QQFA 2W2LD 1E61A 1CNMA 2PUFA 4PZLA 3KUCA 3RSHA 2QQ5A 1Y1QA 1TO2E 3E58A 1C0KA 1KK1A 3NV9A 3BQ9A 2W2LA 1AK1A 2YL2A 1WXQA 5TX7A 4PAGA 4FD3A 2JJQA 4WADA 2ZYAA 2PUDA 1FUEA 1YDWA 5BMOA 2Z6VA 4J0UA 1OQAA 4MPPA 3PEWA 2BR3A 4DRXA 2NXWA 1NGSA 3ZUVB 1CZHA 2RC5A 3GDFA 4M21A 2XDYA 2VDWA 1U0EA 5JD6A 3J81A 5JXGA 3VR2A 1GITA 4MS1A 3AJEA 5EIWA 4F38A 5DIFA 3GP3A 1L7EA 1G5FA 2W4MA 3DKVA 3EIJA 2Y8EA 2FJPA 2HUNA 4NOKA 1XCPA 1F8XA 1RWOA 2R05A 3P0RA 2A9FA 2B8TA 3BHNA 3ILXA 5EZQA 3ZKAA 1WHSA 3V4FA 3NTXA 2DPHA 1BJTA 3PUXA 3RV3A 1USVA 5ALUA 4U0SA 2R5NA 5E6SA 3AONB 4M8SA 1T8WA 3ZLUA 4MHTA 5C9ZA 4L50A 2Y2VA 3DEYX 4OQDA 3ZK8A 1RYYA 5KDDA 5G1PA 5DSXA 3QVMA 1M75A 1T4GA 5CMWA 1MR3F 3DEHA 4TSRA 2M9MA 4OK5A 5AW5A 4QBKA 5I7RA 1PWEA 3CW8X 4R54A 4QU0A 4UHDA 4AAYA 2QRMA 2F1OA 2BKAA 4DX1A 1QDUA 3AUKA 3KT0A 3Q3GE 3B7BA 2I03A 3U4QA 1QK4A 2C03A 4DSNA 4OAOA 2YINA 3TRHA 2K7ZA 2B69A 1AHPA 1QAOA 3G2SA 2X5HA 1UFVA 2DBYA 3H17A 2XZOA 4BAUA 4RMHA 1H1LB 1TVMA 3ZDYB 2B2NA 1ZAYA 1JB1A 4ZAWA 2K7FA 4ITVA 4OMUA 2VJKA 4UE6A 1YK0A 4ZV9A 3RVQA 3TMAA 3SK0A 5AXAA 5BSTA 2LKCA 1KKLA 3OFKA 4MVJF 1Z0FA 2ZRPA 5LNK6 4JGIA 2B2XA 3CH4B 3GARA 3O4RA 1IK6A 3P9QA 3FNBA 1SR8A 4KU4A 5A9TA 2ACEA 5IJ0B 5IKPA 3KT8A 2IOFA 1QIIA 3LFTA 1NIJA 4UXJA 3EXFA 2BEVA 1XLVA 4URHA 3KKQA 2IW1A 4HRLA 4DB2A 4DYVA 4IIUA 1QUEA 4J49A 3NGXA 3ASVA 1Q1EA 1R1DA 2C2OA 1H23A 3OBIA 4DY4A 2JFNA 1J8DA 1M2OB 1VBFA 4UM9B 4DB4A 3MINA 1Y80A 1WETA 2VXYA 1TJ4A 1OLSA 4NE7A 4RD4A 4Z8XA 2KLBA 4ZJZA 3CSDA 5A1TA 4QDZA 2Y3AA 3ZHUA 2WJJA 4HEJA 4DMLA 1U7WA 1V1RB 2RB5A 5EUQB 1RPJA 1P1JA 2RHTA 3BTSA 5C52B 5ALFA 2RG7A 2HWXA 3LUDA 3LA6A 1XQXA 4I9NA 2BDTA 4N7BA 1IIRA 2HMTA 4UEKA 4CM7A 2V65A 3KOUA 4LERA 2NVUB 3IR6A 5M72A 4K9KA 1GDTA 1KYWA 2KQUA 1U6KA 3RM3A 4G0MA 1UBTS 4X1IB 1YXMA 5T8KC 1O57A 4H77A 3SFZA 4J8DA 4JP3A 1KP3A 3IR5A 3TWWA 5CBPA 5T41A 5J43A 3M0EA 5G0TA 5BW4A 4AJOA 3N39C 4AWBA 4APOA 3FTEA 5EWLA 3W8FA 1YS2X 3CT6A 4FCTA 2EZ9A 3NHLA 3DWFA 2JAPA 5LU9A 2H2GA 5E7IA 4MITA 4OQMA 1A3CA 2POCA 1E0KA 2V9ZA 3ZR4B 2FRDA 3OEHA 4KSBA 3GJ7A 3EGDA 3NHSA 3QE2A 1E66A 4GOXA 1H2ZA 3UWPA 1YZFA 3ZWVA 5C1OA 3EOBI 5DXJA 5TSDA 3ESDA 2ZAOA 2Q4TA 3HYNA 4RFSA 4NBVA 1QYCA 3PLAE 2RFMA 3ZUGA 3L92A 1RVDA 4B5LA 2QZAA 1KPGA 4B4KA 3AKEA 1NNLA 2JFXA 1UZUA 3R7RA 2H5LA 2D7CA 3LHFA 4B76A 4P4LA 1J7JA 1JHUA 5IF9A 3N6XA 1IVSA 4P08A 2XKBA 1C7RA 2QT9A 1XR3A 4CDGA 1R6AA 3IEKA 2Z8XA 1HLDA 4YJHA 1I1NA 4AKSA 4OPMA 2X6RA 4DEVA 3PQDA 3CH5A 4H18A 2OQVA 4HAWA 3WLHA 4B5KA 2ODTX 1NN1A 5HFNA 4INAA 3GEHA 3M81A 3ENVA 1MJGM 4MUNA 5KYGA 3OSUA 4UI9J 1XZLA 1MN6A 3U1TA 2A0YA 2ZBDA 1UINA 3KFVA 2VKTA 2NGRA 4G4SO 3PXEA 3EGCA 2PAFA 1JAYA 1Q1NA 2FPRA 1IBSA 4RYDA 4M88A 3WP1B 4PZUA 4PZYA 3OI7A 3T1OA 3GCWA 1JA0A 4ER7A 1V47A 1QONA 3QXHA 3HU2A 5COAA 4AZ0A 3KPJA 2QVZX 4F9GA 2V7PA 5EC8A 1HFEL 5DK4A 3ZWMA 3TLEA 4FFWA 2ATIA 2HA2A 3UBMA 4WCFB 5AVXA 1MT0A 4LJ8A 2NU6B 1RJFA 1GHTA 3IPLA 1P5RA 5FYQA 4MV7A 4UCQA 3RB8A 4AJ2A 1V8ZA 5JHBA 3UICA 4XYBA 4X85A 1U0TA 2H1IA 4YAOA 3ONEA 4ZEMA 2Z5VA 4BB6A 6ABPA 4DV6B 1WX1A 1GXSA 3NBQA 2BFWA 4EH1A 5AVRA 3ABIA 3SYTA 1V1JA 4OI4A 5TMEA 1QGED 4ZVRA 4KZCA 2JGMA 4BX9A 5AM5A 2XB6A 3HACA 3WE7A 2C4UA 4X00A 1TFUA 2JVJA 2BGTA 3E27A 4IDHA 4ALKA 1RXEA 4JC8A 2L42A 3AL0C 5EQFA 5ELLA 3I8OA 3CMCO 2R8PA 2JIOA 1T10A 2WWHA 5HS0A 2XRMA 5JLAA 1JR3D 3C6QA 1UMDB 3GCXA 3V79K 5EJ4A 4N8DA 4MCIA 1H6PA 2ZGGA 1H2XA 3T52A 4TXMA 1LFAA 2Q6IA 1TIBA 3O4FA 5GONA 4HMPA 2VYVD 2P9KG 3ZY4A 3BEEA 2VTKA 3OETA 3ZKJA 1JR3A 3RS2A 2PSFA 4A8JC 5B1BE 1M1UA 1VG1A 5KTRA 2PUBA 4D4HA 3ET4A 5KJEA 3G8AA 2CDBA 1CNEA 2ID7A 2DR3A 2VYVA 1TUBB 1HI9A 3PA8A 1Y1SA 3FULA 1N5MA 5FOVA 3QFFA 5PGMA 4UWKA 2ALJA 2FEKA 3UHAA 1YB1A 2EX4A 5AR1A 3MK31 4OG2A 4QDJA 3PGJA 2LSUA 5FTJA 3HK2A 4D2IA 2I3ZA 3VPXA 2I3BA 3ZTWA 2C58A 2JIPA 5HKBA 5BVGB 3VJLA 1RTKA 3NOXA 2W48A 3QVLA 3FYCA 1MCZA 1EQUA 4JX9A 3AFMA 1MIHA 3UAXA 2AOTB 4NCKA 1J8QA 2P75A 2AXUA 1R15A 1XALA 3H5TA 3HO1A 3MTAA 1JUDA 5AKLA 1VP9A 4NFLA 2L18A 3UG7A 3BMCB 5DBOA 4DN6A 4CKBA 4U5QA 1TAQA 3RTGA 2UUAB 5CLQA 3ESLA 3R74A 1B8OA 2FPGB 2QTAA 5G1OA 2XVYA 3SBDA 3GLSA 2XZPA 2P9ZA 4RTSA 1L7XA 4GVLA 1KAMA 1G8KA 5JJ6A 3DNMA 4MW9A 4C0LA 2HA6A 1OSNA 4CIXA 2BLNA 3ASGA 1X0VA 4NV1A 3G0OA 5HQTA 4OM8A 4JBNA 2GFQA 3K0CC 3VJRA 1JCRA 3UAYA 2QT0A 3Q4GA 3TMYA 1MAWA 1E8YA 4PWYA 2NU8A 3CUTA 3VC3A 4G5GA 1VYUA 4FCVA 3UAOA 2QM0A 4LTMA 3KJEA 2E5LB 1GFWA 3VU9B 4H7DA 5CVEA 3QVWA 4M1OA 2WXIA 5FADA 4LRZA 2Q9AA 4IM7A 5ILQA 2I62A 2XB4A 1BPOA 1ZOOA 3TWSA 1G21E 1A5SB 4R4JA 1AG9A 3D6HA 1H2BA 1UOOA 3GXBA 4QWWA 3QHPA 1A8PA 2CVOA 3CKLA 5JJTA 5FBQB 4FYJA 1M66A 3N86A 2YJZA 2CFZA 1ZGZA 3KUDA 2O1XA 1OREA 5A62A 3GELA 3BORA 2CDRA 3VR5D 2H54A 4DY6A 5C7OO 3HA3A 3JD4A 2FF7A 1LTQA 2AN9A 5ITSA 1RZUA 4IRMA 2SKEA 2H7VA 5EJGA 1QU2A 2BC9A 2ZIXB 2QTLA 2FP3A 4IQ8A 3VR5A 1T3TA 2CBZA 4JW1A 4M0PA 5FQOA 4OKNA 4RA6B 3E2IA 2FUCA 4J7UA 1ZMTA 4EZJA 1XJWA 3U5ZB 2IDZA 3JQ8A 3SVLA 2FN7A 3FUJA 1V95A 2H1CA 5DE3A 4FW8A 4JLJA 4UU8A 3CPSA 1OUMA 1I2CA 1Q7TA 2OGSA 4G3XA 4XQ9A 4DREA 4KOAA 1Z5ZA 4LMBA 1JIVA 1O6FA 4QNNA 5C1DA 2XNKA 2ODBA 1YL7A 3O47A 5ECYA 3U17A 3WOHA 4G23A 4F7AA 4D96A 1GKKA 3L79A 3DPYA 3QEJA 2B5WA 1DXHA 4YR9A 1AKTA 1FNBA 5GONF 4BB5A 5CG2A 1SIUA 3GLIE 1P5QA 4HVCA 3B7TA 2X77A 1GCAA 3Q49B 2GRPB 1I13A 3U60B 2XIQA 1O1YA 1W46A 4HEHA 4W7IA 5EINA 3C6KA 3ZU2A 4DA0A 3RRFA 4P9NA 1Y9DA 2Q8NA 1ECPA 1PG5A 3WGZA 5F12A 4W1QA 1E9AA 4U0KA 3LKUA 3FI9A 4KFCA 1K88A 4IZOA 3OHPA 2DR2A 1D3AA 5BR7A 1YS7A 1PX0A 4NTZA 3PKZA 1PGNA 2JASA 2PT5A 4K3VA 2NTJA 1N57A 1T3SA 4DRXB 5CMLA 2WPVA 4X1KA 3AZPA 4KPUA 1YQTA 3J81k 2Q50A 1Y5RA 4JROA 1P9WA 1TYZA 5HTKA 2VDWB 2B6NA 3QW4B 2IU4A 3F4LA 4MS1B 3P0EA 2EG9A 3RK1A 4IP0A 2BE9A 1HEUA 4BQEA 3B5IA 1HFWA 3OE4A 2RDMA 3I6YA 1NT2A 2X3UA 3BIOA 4K8OA 1VI6A 3DKPA 3A4YA 1SD2A 3DVLA 3OM0A 5AUQA 5C37A 1IHBA 3ZDFA 4MW2A 5CTAA 1WHSB 3H5RA 3M3DA 4ZARA 1MU0A 4C0SA 3A9RA 5JQGA 1PV4A 4OI0A 2WD7B 3Q79A 1ML3A 2PUAA 2B1IA 5KYKA 2GZ2A 1MX5A 3NYQA 1ZGGA 2SKCA 3VH1A 1MTZA 5CT5A 4L3OA 4MUYA 2CNLA 1YZYA 2V8BA 3ZU4A 3FGZA 1IE3A 3EVAA 2XWBF 2IPOA 3PK0A 2G09A 1PI3A 2IA5A 4FCWA 5AOXA 2D4HA 4EECA 1T36A 2YJNA 5KKNB 3U4QB 5ICSA 1UJJA 1FBTA 3U40A 4N7JA 3C6MA 2QZJA 1FSZA 3FGNA 1FYEA 5IC6A 1SKYE 2GD2A 3MELA 1EVYA 4QWMA 3HBLA 4NXNB 2GYYA 2NU7A 1OAOA 4IGEA 2OESA 4RPGA 1EBBA 4Q7LA 1HA3A 4RHCA 3COZA 4J3NA 1LA2A 3LQYA 2WVJA 4TXNA 1VSBA 4UEJA 3BCHA 3MGCA 2G9UA 2AXEA 1DUSA 1WD7A 1FJGB 2G9VA 2PSDA 4UNNA 3QRWA 4QLOA 3HI6A 4V0SA 3MAGA 1EIWA 1X8JA 4PYIA 2H9YA 3OUZA 1JWFA 1EFUA 3SOPA 3HJUA 1RYMA 4HUQA 1PQWA 3LHKA 3LIPA 3MOIA 1R4ZA 4DMUB 1W4AA 1SBZA 4ZYYA 3W5HA 2AYZA 3MXTA 2O14A 5FLKA 2IXTA 2E4AA 1RYZA 3DJFA 1M73E 3EXFB 2BEVB 2QG6A 1ZOPA 4B31A 4JQOA 4AQ7A 4V0MA 4WXPA 5KNDH 3N59A 3OE1A 2HRDA 1EVZA 2PL9A 1G3UA 1EWQA 1T1SA 4PGFA 4HGNA 1X70A 1VCIA 2F00A 4N5IX 1E6MA 3MINB 4C7VA 5C7IO 2OYCA 5HE8A 4BERA 3MNFA 1OLSB 2H3EA 1HRDA 3CB2A 4ZO8A 1F0YA 1KMMA 4AN4A 4OHWA 3NOCD 2QGFA 2EF0A 1A98A 2OCKA 2RC6A 4FN4A 4OFWA 3UJDA 4G1CA 5D5QA 3SVZA 3PHHA 4WY2A 3NVMB 3R4VA 3W34A 3RJ9A 2PGLA 3VISA 4EHHA 1CYEA 1CBUA 4A2CA 4GYOA 5JT1A 5DTRA 1E2PA 3EG5A 4V39A 1N75A 2ZGVA 4DL9A 1U0SY 1T5OA 2PZEA 4RJKA 2JG3A 2Q2NA 4BNUA 1F14A 3QU4A 1N36B 1D0VA 2DHEA 1O89A 2Y0BA 3D6MA 3EB9A 5CBPB 4LTDA 2HHJA 3LDFA 3TVTA 1O1SA 1JXQA 4C9BA 4IIGA 2O2ZA 2QZ4A 4TL6A 1GPJA 5EN4A 4HNTA 5EWLB 2H1FA 1EK2A 3FDZB 3OJCA 1HE2A 4GB9A 4JAVC 2JK0A 3L1IA 4PGGA 2HJVA 4UOEA 4LNHA 3P9YA 2WB4A 1PJCA 2VUIB 3IDQA 3PC7A 3F5SA 2IZOA 3RARA 3TD9A 4R1MA 2B92A 2QRVA 2ZPAA 2OHOA 1GNTA 1SUSA 4EHBA 3A7EA 3EGDB 1A8UA 4QUEA 2ZUFA 1BE8A 2C83A 5AIBA 5AVKA 4Q1DA 1LD8A 4F97A 3IRVA 2FBNA 4V1CA 2WG0A 1MVNA 4EHFA 1N0WA 1ZGAA 1CUAA 4DC0A 3UUEA 5I9MA 2YQ8A 4DTIA 1E62A 2VP5A 4U7HA 5JAUA 4RIGA 4EZBA 1WDMA 1ZSNA 2W11A 4DR6B 2QY9A 1PUIA 4MV1A 2WIJA 4YJHB 2NOAA 1ZVVA 4ZXFA 5LM3A 4DG9A 1TXGA 4QT4A 1VIAA 1GU0A 1SC4A 5ALEA 5G0VA 1P62B 1TNDA 1UZMA 3KPVA 3TI9A 2QE7D 4BVBA 1N5LA 5A4AA 1XRQA 1L5NA 5GVRA 3Q7QA 3HLYA 1T0IA 1TEZA 3M1IA 3D0KA 4HWPA 3JR7A 1QZ3A 4MV6A 10MHA 2W22A 4WBSA 2QE7A 3W1EA 4R84A 2I29A 1INLA 2V6BA 5EMHA 4HADA 4BKMA 1ISPA 1DO8A 4LOKA 4IZ6A 1L4BA 1RDFA 3VLDA 5HKKD 5EHQA 4L8WB 3G7NA 3KQHA 4E7PA 4XVCA 3E4DA 5IZCC 1JBKA 3KZCA 1ZIDA 3IBSA 4AZ0B 3OA0A 3T9KA 5JNTA 2F8YA 3HVKA 4UU1A 2PZJA 4JU8A 1L7OA 1KU0A 3EHDA 4PCLA 3OCYA 2I54A 4Q1CA 4ZK6A 1J2TA 3NOQA 3LDAA 2E6KA 1WZ2A 2RHHA 1MVOA 1J2RA 3CLRC 3L8HA 3NDJA 3OIGA 4R71A 2QROA 3ELUA 3N3AC 3BYZA 4A3SA 3W9GA 1MBZA 1IOLA 3WWDA 2YY7A 3IUQA 3AESA 1PYGA 1GXSB 3A1DA 4MWDA 1HO8A 2HGSA 4J94A 3MIIA 2C97A 3BN3A 4CIAA 2MINA 4X8HA 2RG1A 1CJCA 1F4PA 4LYFA 1JQDA 2E4YA 5JAMA 1SK9A 3TOXA 3CONA 4F7DA 1AGYA 1P7PA 4MGEA 4CFZA 3U48A 3CRRA 3Q7TA 3E35A 4I8XA 3ED1A 3O3NB 1TL7C 4GAEA 3ROPA 3D9NA 4J0HA 1IEQA 1QSGA 4U07A 3L5OA 2GZSA 2ZP1A 3FTXA 3GFTA 1914A 4AP9A 2X0DA 2OFXA 4BV8A 4RGBA 2VSYA 5GONB 1AV6A 4XDYA 3LBNA 4LBWA 7YASA 3IP9A 2QPLA 2H17A 1ZK0A 4FHFA 3I2GA 3CEMA 1OBVA 3DW1X 3CVWA 3K2EA 4QPJC 4XTCS 2BUBA 4B0ZA 1XHLA 3BJRA 4DA7A 1PWZA 3U7EB 2Z98A 2E2WA 3EPHA 5LQJA 5F5XA 3C3CA 3ND6A 1NJ6A 1P4JA 5UKDA 2WTNA 4MS3A 5D66A 2C9MA 5AJVB 2PJRA 1K6XA 4LGYA 4IVNA 1H6AA 4YTEA 2PVSA 4JHLA 1BHQ1 3UTMA 3UGQA 2JCGA 3C6YA 5DNDA 2OL4A 4BX0A 2YJ3A 4KZ0A 3RC8A 5ULLA 1KLXA 3GAMA 1RQPA 3EAQA 3HHEA 3EF1A 4XIYA 1WMSA 2FWBA 4MPDA 3VJMA 3BG0B 4AEZC 3L0SA 5JC8A 4F8EA 3GVXA 2Q1WA 3DEAA 2FPPA 3IP8A 2KPOA 2GROB 4UNPA 2YVUA 1XHEA 4JIMA 4CKBB 2MRIA 4X93A 1FE8A 1Z5WA 4LEUA 1V8FA 4Q9JA 3ZEFA 3TWQA 1XZIA 4DMRA 3X2EA 2ZJFA 3WYBA 4XLTA 4AFNA 5JDCC 2GN6A 2IC5A 3OLQA 4OBEA 3PX7A 4QDUA 2FPSA 2PD3A 3BCRA 4ND3A 1MX9A 5MN6A 1OXJA 2I4OA 3BFJA 3SZGA 4C0KA 1V96A 1PCXA 3RF6A 1E2IA 4V24A 4I8DA 3HP7A 1E9VA 4OP2A 2ONKA 4Q34A 2FPMA 1IN5A 3GA7A 2R1TA 2BJVA 2P2CA 4K9QA 3QFRA 1HFKA 2ONDA 2PL3A 4I55A 2P6UA 1UG3A 1CVLA 5AHRA 4MKTA 3R0ZA 3LZDA 3ZE2B 3RAPR 4A10A 5DLQC 2AYXA 4NYIQ 4QC2A 3G88A 2GR9A 1P0FA 3UT8A 2Q5OA 2X42A 4GKKB 1QK3A 1E0JA 3ORFA 2IBSA 1XN1A 5CBKA 3N0WA 4OEHA 4KN6A 4EDFA 1DFGA 5DCLA 2IHZA 5IX8A 2GX6A 5HMLA 4TRRA 1X8LA 3WMRA 1VECA 2QVCA 2P35A 4QFDA 2G8NA 3OCXA 4OJKA 3WLIA 1VLJA 1TTHA 2ODNA 4N39A 3WYAA 1DTSA 1QNLA 3F49S 1JNYA 5D3QA 3C4VA 1SVOA 2GN2A 4BO6A 3TH5A 4TQGA 4Q4HB 5AUPB 3UT0A 2PQRA 4BQQA 4NIKA 3UHJA 4G9EA 4Q15A 1DKLA 4CHGA 5CDUA 3TVYA 1MRSA 3EFEA 3DXKG 3JQ8B 3RSEG 1QBGA 3DFIA 4YJKA 3H6HA 4D4LA 4PANA 4Z3OA 2UZ4A 2IWHA 1Z16A 1ZCFA 4EFNA 2V5UA 1HT0A 4L8GA 4Y9UA 1W87A 2ZGDA 3UMSA 4OKSA 3WL8A 4MLZA 2FEWB 3FHLA 3MT9A 5JCJD 2FQYA 3BFKA 3LBIA 5JEDA 4BZPA 3G3EA 1C7JA 3NH9A 1QPGA 1E3LA 1KEZA 5TNXA 4R3UC 4RNCA 1E7WA 3N7UA 3E8XA 4XX1A 1L5SA 2W9JA 3AVYA 4Z9AA 2ZSDA 4J4HA 5H02A 4RTNA 5JCJA 2YJ6A 4RTJA 1U7HA 1TK3A 1R16A 2DPYA 4ER3A 1NLMA 1DKPA 4MA4A 3I9FA 5A1JA 1DRKA 4XWTA 1XA4A 4B8YA 2Z2KA 3UKUG 1R0SA 5JD5A 3N2LA 1JXMA 1SEPA 5T8IA 3ZCPA 4LSZA 4TSFD 1Y9AA 3FYSA 1B26A 3X1XA 2ASVA 2JJYA 4XKBA 1ZUWA 1VPEA 2Q28A 1U0FA 4X1KB 1ZB1A 1MB3A 1JBEA 3G2NA 4JYMA 2J4CA 1W1WA 4R9UC 3VLEA 4TSFA 1PE0A 4QSHA 3STVA 4DMGA 2WIAA 4B84A 3UYLA 3FZYA 4BP1A 4BO9A 5G04J 2Q5EA 3QWHA 4CKEA 1JJVA 1AD2A 2WXMA 1R6UA 1QV7A 5JSFA 1B23P 2HO5A 1IZYA 2IF4A 3FA2A 4I8IA 3S7DA 3GHHA 1XD8A 1Z4OA 4RVFA 2F9LA 3FTPA 2VK8A 3G13A 2GF2A 3KTOA 3B1FA 2WIGA 1RJ9A 4L6CA 4DCTA 1TYDE 3LW7A 5KTKA 4YCJA 3P9PA 3M6AA 2ANBA 3ABZA 3E9RA 2PNNA 4HDAA 4IS3A 4AUMA 1B6TA 1ZICA 3O2SB 1L3IA 4R1LA 2X3FA 3FPBA 3EDCA 2BMEA 4QUHA 5G05J 5J3JA 2DKNA 4L22A 1DAOA 4ENUA 3K1AB 2P3SA 5AOXB 3AR8A 4Q1AA 1T36B 2IY8A 4I55F 5KAMA 1BLXB 3WZMA 1OWMA 4HNQA 3DOEA 5J2TA 4ZDJA 1Y7PA 4B17A 1I2DA 3WSTA 4Y6CA 4V0NA 4EI8A 4M89A 4BMYA 1R8XA 5D51S 2KM1A 2VSOA 1VDYA 3DPSA 2NU7B 4NPAA 1MP0A 3PC4A 1XTKA 4MQMA 4AW9A 5AK3A 1R4NA 1H94A 3PCTA 2FYTA 4QM7A 1CUEA 2J9RA 3OZBA 3QX7A 5E3IA 3MTBA 2AF3C 4UJ3A 3EQ2A 1RIFA 5DHAA 2JI9A 5B53A 1L5ZA 1XDWA 1FSGA 4COKA 4HD8A 1J56A 4Z9FA 2B4YA 2YRFA 3LOUA 5DM1A 2HH9A 3D9PA 4PRYA 3AUYA 4HUQB 1WG8A 1HNXB 1FLAA 4BZZA 1H9BA 5KIAA 3UMCA 3KHUA 1Q7BA 1UJRA 2FZVA 4ZVUA 3HVRA 1Q19A 4NMHA 5FHQA 1C9JA 2H4JA 3TWTA 1ZHFA 2WIDA 3GEMA 4FXOA 2A94A 1KPHA 5HS6A 4IOLA 3LVBA 3CKCA 1D07A 5KJLA 5DMHA 1V4BA 2W6MA 3EBPA 4IRUB 2O8EA 1Q44A 2R9VA 5JZSA 4PSUA 4HN2A 2JAOA 3S2GA 4TXQA 3ZS9A 2O2YA 1M0EA 5HW0A 3KD7A 3ZZ1A 2VT2A 5K0SA 4C2TA 5A3VA 1S89A 3IQZA 4P5PA 1V45E 4GI3A 2YUIA 1YR1A 1LEHA 4NK5A 5ENRD 4Y6SA 2BEDA 2P9GA 3NALA 2P6NA 2O1SA 3M6LA 1H66A 4AVYA 2QLFA 4DBLE 4YAIA 2DK6A 3OTNA 5DTEA 2C5LA 3R6LA 3ZXYA 1RRKA 4RAQA 3PS6A 3DXXA 1CPYA 4Q4LA 4F3VA 2NIPA 1MD9A 4MYRA 2XV1A 1XCOA 4R2HA 2NV0A 2CD7A 4QOGA 1HXIA 4GPIB 3ONKA 1PZHA 1A9OA 4MYSA 1SHTX 4PVDA 2FPUA 3F8WA 3W4IA 2BKGA 3LCRA 2HT1A 1QF9A 1XCLA 4C9BB 2ZRLA 3WK6A 2GZMA 1Z4KA 2IPNA 1OLOA 3EGEA 3TRKA 2QQGA 3B1VA 2AI3A 5EKQD 5IKXA 4DT1B 5ALKA 4CKZA 3L6UA 1XCMA 2AE1A 5IVDA 1V54E 5JMWA 2C5FA 4G5OA 3FPFA 1ZG3A 3NI2A 3G2VA 2DWUA 2Y1EA 4BAZA 3SQDA 2QRVB 4XUEA 4BFRA 1Z5SC 1AP7A 3PDCA 4YGYA 2ZBGA 3KVNA 4IWYA 3AR7A 3DA8A 3DULA 4L6IA 1L5QA 1BA2A 1NUHA 5B2ZA 5LQCA 2K2WA 3SJAA 3HZOA 4WUTA 1IVYA 3NUQA 2W5UA 2OO5A 2H8KA 2YXDA 3I28A 3G6KA 4Q4AA 2R8BA 1U9JA 2UYOA 1ONNA 4MVJI 3VSAA 1KY4A 5MGNA 1ZN9A 1OI4A 2QA5A 2HZ7A 4OXNA 4EFLA 1N3YA 1AQJA 4RM3A 4GPEA 4L7QA 5IUKC 2EP5A 2QTGA 4N6OA 4RG6A 4XDHA 4UEOA 3BWYA 1PG0A 5DW3A 3E9MA 2GAFA 1J09A 4L4YA 5K0JA 4L75A 4H60A 4YAUA 4Z7OB 4G9BA 1HSOA 3APFA 3L0PA 4E08A 3MYYA 4DGQA 1GG5A 4ATNA 1Z34A 5J2TF 5GVSA 1W4LA 2X2PA 3ZW8A 1V4VA 3QJZA 2EDCA 3CCBA 5LWQA 3G5AA 2XMPA 2EKZA 2FJAB 4CLXA 5ARFA 4QBHA 4S12A 4AN0A 1KI8A 3NWOA 3H1GA 2B1JA 2QAIA 4RORA 4FS3A 3PJDA 2ZCUA 2I22A 1L1QA 4GFDA 4OJNA 2X2FA 1Y4ZA 4DYDA 2IY0C 1UJ6A 2G0NA 3EZYA 3PQ5A 4R8VA 3BZBA 2JAQA 4RDXA 3VR2D 1MH9A 4KO3S 1K8KG 3SM3A 3SHOA 1C7IA 4OQZA 1L7PA 1OXUA 4GMKA 2RKWA 1A4RA 2WKPA 3TR5A 2Y0CA 1NIPA 2UWJG 4M60A 3CUSA 7GPBA 1U7XA 1SUDA 4EI2A 2RH4A 3P27A 3PGMA 3SLGA 4LRSB 4MRPA 4WE3A 2VFAA 3OJFA 1E8NA 1I4DD 1SCIA 3WK5A 3HRHA 2F1JA 3PYXA 5LP6A 3PZDA 2EBWA 2G1AA 4KN5A 1UJ2A 4HLUA 2PZKA 1YBVA 1QB8A 3S27A 1N4RA 4K05A 2BUGA 5KVAA 3REGA 2R4QA 3H87A 4JJEA 4J0QA 3B3GA 2Q9CA 3EWSA 2O2JA 1UPBA 2JI4A 3WBBA 4CLRA 4L07A 3EW7A 1R6XA 2Y69E 2AMYA 3TLYA 1MENA 3OM9A 2X9NA 4EARA 2FJDB 4QPPA 1NW8A 4ZQGA 4CPDA 3LC1O 3TQRA 4DLYA 4YUYA 1FVFA 3KSRA 2PMBA 2ZBUA 3OQHA 4BO5A 1DHRA 3ZDAA 3WWYA 3EVNA 4URXR 5JCPA 1RYBA 5LU8A 2VTVA 4KFSA 3AFNA 4ZO9A 5IULC 1VLVA 1J99A 4NZPA 1Z6TA 3ZH9B 1M33A 2BGWA 2VZ9A 5CFPA 3GLQA 4MS3B 4OBBA 3RS7A 1H85A 4JA9A 3LGSA 4L5CA 2O52A 2V7WA 3RSOA 3OPQA 4OL9A 4JQZA 4J7WA 4U0JA 4MV5A 4NICA 1S4MA 1F6WA 3DZHA 1OJLA 1Y1RA 4OQYA 1SD1A 4Z4GA 3U0VA 4I3FA 4FFBB 2CNKA 3KYJB 1KHTA 1U8AA 5B57C 2Q99A 5EJ6A 4OUKX 2FPPB 3ZI4A 3HUDA 3DSUA 1M0SA 4NWIA 4BFZA 4GG1A 3PYMA 4GGMX 1UP6A 2XUAA 3OOJA 2IYTA 5B6JA 2A30A 4JC0A 2ODPA 4FP9A 2B0CA 4ZI7A 2VK2A 5B4VA 5K6TA 2CBXA 4KWIA 2W4IA 4FGZA 2ZTVA 3PXAA 3QI2A 4GKJB 4CEHB 2CXRA 4EUNA 4H35A 5CGZA 4RSRA 2VPIA 5E9QA 1AB6A 1M8PA 5JZMA 3F6EX 4N0MA 2HMYB 5JWOA 2P8JA 3Q85A 4DDKA 3KEZA 2RK3A 4LCTA 2VJMA 1GKUB 4UDXX 1Q2XA 3E30A 2MMGA 4CBVA 2NACA 4OB7A 2AJDA 2R1TB 1GNRA 2O48X 3AR2A 4I55B 5HDBB 5ICEA 5BW8A 3UV3A 4HG2A 3ZQJA 4LGMA 1DC3A 5YASA 5SYNA 3KQSA 4L9SA 1WDWB 3I6MA 3A26A 3RF7A 2W8BA 2XT9A 2VXCA 2I6HA 3PDIB 4KDEA 1NMQA 3KAEA 2A8YA 1TT7A 1IUNA 2Z3WA 3G0IA 2TRSB 3KZOA 3P0FA 4REMA 1E2GA 1P6QA 3UA3A 4MUJA 4B3IA 4P2GA 3GZNA 1DOHA 3N71A 1NZJA 5EMJA 1R6BX 3GT3A 2C88A 1CR6A 3H1PA 2GBLC 2W2KA 3JQPA 3UHFA 2ZI6A 3RQSA 2NAPA 4BFTA 2B8EA 1E8WA 3L0OA 3IGFA 5HIMA 4HGPA 2IFUA 2PM6A 1JWLA 2GVNA 2R59A 3U2QA 3WZLA 3OEHD 1EP9A 3PD1A 1U8UA 4ILIA 3NIDB 2WUGA 4K88A 3DMGA 2CJYA 4AS3A 1FYXA 4EG5A 3SQXA 1V55E 1D9SA 1NYRA 5KJCA 2G6BA 1ZOLA 3JVUA 5LC1A 3R3SA 4BYGA 3WB9A 4M8LA 2JVIA 4U8YD 5ESRA 2GMWA 3G8DA 5B3SE 1FDWA 1Z33A 1H3FA 4JGBA 1NW6A 3TW8B 1U02A 2ZRNA 1OWNA 1AUVA 4R8KA 1K8QA 4HWOA 1L5JA 3N70A 4Z1OA 3FUFA 1U90A 1MA0A 5LP6F 1DT3A 1KIFA 4O4JB 4NMMA 1JNRB 1U6IA 2EZ4A 1MQAA 4YO7A 4F11A 1PT9A 3JRXA 2ONJA 4MLPA 2NUTA 4FN5A 1B1AA 3NHYA 3N0RA 3H83A 2ZYSA 1QHYA 2HWYA 4DLQA 1PDOA 3IAM6 4LJAA 4RMJA 4U7PB 5F9MA 3GUVA 5E2AA 2FN8A 4E5DA 2EFCB 3O7WA 3GJ8A 2O5CA 1YRQA 1KSHA 2R1UA 4I9UA 4B6JA 3A1TA 2KCVA 3CKKA 2GILA 3UPVA 4RK4A 4GXQA 4KFTA 3ML8A 3NT4A 3J5QB 3OC6A 4C88A 4AS1A 1PQUA 3G1WA 4FHEA 4C4PA 3FCXA 4XVRA 3I0NA 3OO0A 4X9XA 4XI9A 2ASEA 5KBYA 5FINA 1WWKA 1QFYA 3S4YA 4D3YA 3ZBUA 1N2CB 3VQTA 4QEDA 1GP2A 2LCIA 4EGFA 4E5UA 3BA1A 3IMCA 2EWWA 3KZMA 2JJ8A 4N6NA 2IHTA 4CKEB 1ZVQA 1T0HB 1GNSA 1U3DA 1KY3A 2ZPTX 4FQ7A 3HL4A 2EYUA 3WLOA 4RM2A 4EHAA 3HKDA 2UYQA 1ZXBA 3ZRHA 3LWZA 3USES 1NP6A 3GW8A 4Q6WA 4HEA6 3TTVA 4PAQA 2GW1A 4GP6A 2GRUA 1RJ9B 1UK7A 2YXPX 4BVHA 1E1KA 3KWMA 4TROA 1ODIA 3NUZA 2WHYA 4ZI7F 2YYSA 2AVPA 2DYKA 1MX4A 4H27A 4TTPA 1Q20A 3HWSA 4HXGA 3K70D 4FNGA 1KL7A 1SXJE 3G2PA 4RKEA 4XE5A 5C2YA 3H0CA 1SQ0A 4C78A 3BDIA 1UANA 2A33A 2H1RA 4JYZA 3T54A 4YRZA 5IXSA 3IMGA 2WJ4A 1X4RA 3IL2A 1Z5VA 2KXPC 1EB8A 4RVNA 3CBGA 2W93A 3KQWA 1WLSA 5EJ2A 2BR5A 2C9YA 4G24A 5EWMA 3SJZA 5J2TB 1RAIA 1KI4A 3IUYA 1MGOA 1TM7E 4OP1A 2ZRAA 3CZCA 3ZD9A 3MA5A 1ZD5A 4AF7A 1UPUA 4B85A 1ONBA 5HQ3A 2Z2IA 4WHMA 4FYKA 4YN3A 2FFAA 4FE3A 2I8AA 2C31A 2D62A 1N0IA 4QYXA 1R4NB 1NA0A 3RRNA 5EKDA 3EXEA 1I7LA 1XZKA 4CMIB 3URMA 4PV7A 4EEZA 4DVJA 5CDYA 3L40A 4H7HA 4AJEA 4M4SA 2XW6A 3CSFA 1Z2EA 4L0QA 2JIDA 4F9FA 5BOSA 3K5PA 2QMHA 1W5TA 4OA5A 4JOQA 1B00A 3ADKA 3OF5A 3B9BA 1GVHA 1YJXA 1ICEA 1L8OA 3IVRA 2EFDB 3V8NA 1DRJA 5K8IA 4ZOCA 3ABLE 3V1NA 5B7GA 3UOGA 4UAJA 3Q41A 4Q16A 1UBHS 2XA2A 5EYLA 4TTIA 4HUJA 4ZT4A 4GWKA 4YCAA 4TS3A 1BDHA 1FNMA 4GA0A 1EF1C 2YTZA 2H1LA 4GECA 1K5DA 1Z8FA 3IP3A 2A14A 8ABPA 4GMHA 1LFDB 5CBOA 4KXYA 5BV8A 4E3ZA 4E33A 1QANA 4MDYA 4C0AC 5K8TA 1NY5A 3KOOA 4U3JA 3KJXA 2RKKA 5JA4D 5T3UA 3WLNA 2OV3A 1XZNA 3DXFA 1KQPA 2WTBA 3DMPA 4OYYA 4DV1B 3U7FB 4X7PA 4MB0A 2WYUA 4YDQA 1YB6A 1RW2A 4MJXA 5DCWA 3IFSA 4ZPXA 2ZBPA 1K63A 1WCIA 3MJ4A 3T41A 4DLKA 1C7ZA 2KJZA 3VUFA 4C3UA 4H3SA 3DE0X 3PWKA 5DI9A 2HTEA 1UODA 1NUQA 3FJYA 4BVKA 3WTCA 3G2HA 3MCTA 3A3NA 1E2NA 1B6RA 1Z0ZA 3WYGA 1XZGA 2XUDA 1QHNA 2GF0A 2YWCA 4HDRA 3CF2A 5KJNA 3ZWOA 1T2AA 5F64A 1H93A 4RW0A 3LPAA 5BSUA 1U94A 2FFQA 3PS9A 2WMYA 3AUTA 3OIYA 3HA5A 1M8GA 3MHPA 2A9KA 3FSGD 1H8HD 1T6NA 3N3BC 4GI2A 5ENNA 2ZE5A 1E7QA 1YBHA 3U80A 4AJJA 3HDJA 4KLAA 2D59A 3R24A 3W2HA 3LUBA 4KLNA 4M8IA 3QPBA 1FDIA 4YA6A 2FETA 4RE6A 4AO8A 3A3KA 1ZBQA 1ZM2A 2YMLA 1RWBA 3FSGA 2R6HA 1H8HA 4C0WA 2DWPA 1UDCA 3QVJA 5KDOA 2AGVA 4Q4AB 2O7QA 1JSRA 4BJ1A 3C7KA 3W5CA 4JKIA 1SBYA 4NBWA 3D54D 1QJCA 6CHYA 3TYXA 2P77A 1RWVA 1QM5A 4I5DA 5J4HA 3ZHBA 4BC1A 2Q3EA 2WXFA 1AMOA 3T5AA 4JEHA 2XS1A 2Q7FA 3IP1A 2P41A 4MP3A 4R31A 4FFRA 3B6KA 3TIGA 4RKYA 1NVDA 3OIVA 3LLCA 1QBQA 1W8IA 1D2MA 4KWCA 3Q9SA 4K3UA 1UC8A 3O26A 4TYQA 1GSHA 3USZA 5KNDD 2Y1CA 3CZMA 1JCQA 4DJFC 3UK2A 2GERA 4YAWA 2A0UA 4FOTA 1ODKA 1EZZA 1P9LA 2I91A 3EA5A 3LHSA 4KR7A 1I6WA 5ERXA 4JJ8A 1Z68A 1JSZA 3GBVA 5EX0A 1AX9A 3T4EA 2B6HA 2UUOA 1JHZA 5KNDA 3B1KA 3G2LA 4Y6RA 5JSYA 5A3JA 4HI9A 4C04A 4P98A 3UMFA 2O5VA 1V26A 5GM1A 1BE1A 3CSTA 2BONA 2IUUA 4OHXA 4CGYA 3B7WA 3TFOA 4Z3DA 2GM5A 1W73A 4DWJA 2XKAA 4LJSA 5AVTA 4FFSA 1GLVA 2RFLA 4Z99A 1P45A 4ZGBA 1V8PA 2IF0A 3DD5A 4NAUA 2FW7A 5LCXA 2OZEA 3B3AA 3D7MA 5EJMA 1T9DA 4QGGA 1ZFNA 4PIPA 1ISRA 1FQKA 3L13A 2X13A 4I2WA 2VS1A 3CJQA 1XOIA 1N4DA 2AOVA 2EIME 2UUCB 1R37A 2VF8A 3RIHA 2MYPA 3LYUA 4D9FA 1BN6A 5LP6B 1YVRA 1DG1G 2ZISA 3DZGA 3NZUA 2GYVA 3ASUA 3U56A 4R3WA 1JJ7A 3DB2A 4KI7A 3E53A 4EB3A 2P4HX 5H4HA 5FORA 2V6MA 3QVKA 2DGDA 4J0DA 5E6SB 3C1UA 3KTFA 2WW8A 5AKXA 1HBJA 1YI0A 2Q3CA 4KL8S 2W2XA 4ACBA 3SIRA 3QWFA 4XFKA 2FPWA 4ZOQI 721PA 3Q8MA 4J1NA 3IMFA 2DUJA 3RJMA 5AM3A 4LXTA 2B7CA 4AULA 4YP7A 1N0UA 1QTRA 4M9RA 4F56A 2MSCB 1E1RD 3AVTA 3PHCA 1FJXA 1OU4A 5BQ5A 3HA2A 4C07A 4YMGA 3OOWA 2ZSKA 4TT3D 1XPJA 2QY6A 2EQBA 4CV2A 4QDOA 3OEED 2RONA 1E1RA 1LK7A 4MLDA 4CKWA 1IXVA 1YGPA 3EEQA 1ZITA 3KE9A 3ZGVA 4TT3A 2YN0A 3S40A 3CHQA 3VNQA 3WMGA 3ZDEA 4L72A 5CEDB 4EUFA 1H2TC 3OEEA 1EFVA 2FDXA 3CLSC 4PDXA 4RQIA 1JN0A 2NYUA 1I30A 4MRVA 5FV4A 3B7UX 2LR0A 1JFRA 2WUDA 2Q6KA 1KJQA 3FOCA 1N7IA 3ZE0B 2L6BA 1UWLA 4LKRA 3HN7A 3ROKA 4EI7A 5JXHA 3OLVA 4I36A 2FJEB 4XASA 3HBAA 4ZI7B 2Z4TA 5K0LA 3WG9A 4FMPA 5IMSA 2QTVA 4JVSA 1DX9A 3I58A 2R44A 2FWRA 4HDOB 2WVIA 3QLUA 4LWQA 3F6CA 5ECGC 3TIFA 4HS2A 2VYCA 5BN5A 1M74A 2XCBA 1Z4MA 3TQOA 4CEJA 3PNOA 4YRCA 4EA7A 3W4JA 3FFBA 1XPOA 1DX4A 1TGVA 3RUEA 5AI4A 3EIQC 1E5VA 3RTCA 1DNPA 1KJNA 1KSFX 1D5WA 5ALZA 2C77A 1BOOA 4OXYA 1WEHA 5CNMA 1XA0A 3CY6A 1W93A 3PGLA 1GNLA 2NUBA 5DTMA 1F2UA 1ECLA 3WHLA 3DONA 1QKKA 2H2FA 1NFFA 1CUGA 13PKA 3KQYA 2Q9UA 4A73A 2W8BB 1DZ3A 4DJAA 1U7PA 2QYTA 2V96A 1HQDA 2IKQA 4AD8A 3BFXA 3TO5A 1HR0B 3ITDA 3HUEA 1C5KA 4FHGA 3GNQA 4AWAA 2Z5LA 4B6PA 3IV9A 2PR2A 1CD5A 4PYLA 3PT9A 3NT5A 1S3IA 2QD1A 3IDAA 1G7SA 3ZGNA 2XGOA 1A69A 3M4XA 5JIBA 4I4IA 2GCPA 2W2KB 4DR3B 1AIPA 1K7SN 4U2GA 1KFKB 2Q21A 4IQ4A 4A1OA 3WGIA 2P6MA 3TSWA 1R7RA 1MHQA 1ST2A 4RH3A 1F7UA 4EJSA 2A9VA 1U28C 3FU0A 4EGAA 2G67A 1MJ5A 1M5UA 4XWAA 1XRPA 5IVPA 2P7HA 5E2IA 3MUEA 3IUBA 1VXOA 1ESCA 4K6MA 4UAGA 2JAHA 2VHQA 2QW0X 3WWOA 5DGDA 3RUFA 3ELYA 1NBIA 4RFSB 2FPKA 4DIMA 4KR2A 4N5CA 4YWHA 1XKXA 1QHXA 3M33A 2FSUA 3ETLA 4GE3A 2ONZA 3G6WA 4QU5A 4QDKA 3A9UA 1T3LA 1VMEA 3IAS1 5B58T 2NUTB 4Z49A 1B89A 5C5IA 5HPYB 2OCCE 1FRFS 3FPSA 4B80A 2JNWA 3ICOA 4QJ4A 4M9XA 1HX7A 5JQGF 4ZHSA 1DJMA 1E6CA 4GZCA 2VJAA 3ESBA 2R48A 4M2LA 3MEKA 3HV0A 3U39A 1GUDA 2WDPA 1C1DA 4BY6A 1POWA 3BMQA 3N5KA 1PIWA 1OFUX 3CRW1 3T0FA 1DDOA 3RIMA 1DCTA 4PGHA 4DAOA 2CVHA 4M9QA 2LRHA 2ORYA 4RKRA 2A7QA 3EXHC 3NHZA 3AUFA 3PXUA 4HFNA 3N2YA 3VR6D 1SO8A 5D7BA 1GPH1 3MC1A 4F3CA 1JYSA 3CIFA 2AX3A 1EVEA 4GOJA 4JDPA 1XMIA 3VR6A 4Q3DA 1JG7A 5JLJA 4IIJA 1VSUA 5DNYB 1HE5A 3ICWA 3IKLA 4PWZA 1K92A 3VTXA 3IPYA 4Q3EA 3KR2A 1HG0A 4KITB 4F2GA 4HI8A 1L4KA 2WB2A 2MWMA 5KPJA 4Z4FA 4N2QA 4EL0A 1YIAA 1D4ZA 1NRIA 5DNAA 5K4HA 1AA9A 4HOYA 1J0EA 4YREA 3BL8A 4NYMQ 2GJSA 3PYLA 4MVJM 3VR3D 3CA8A 5EAIA 3AM1A 1T29A 2OV2A 2V5AA 3L7CA 3SZRA 3WWCA 3WK9A 3R9WA 5JY1A 3VSBA 2COEA 1T2CA 3VR3A 3TQFA 1N78A 3IJPA 2IEGA 3WQBA 3V1TC 2QSUA 4YAFA 1KYQA 2ZI9A 1O6GA 5IK2D 3ZWBA 5KQSA 4KIFA 4RVSA 5HKOA 3HPQA 4DUPA 3K70B 2NAFA 5CCBA 2DHCA 4XB2A 5BV0A 5EWMB 3N87A 1A5AB 1YS1X 1C9NA 3W9SA 1KZ6A 4UVHA 4C03A 4RVCA 5IK2A 2FWAA 3WGMA 2CLFB 1BHO1 1WF3A 2CBGA 4ID9A 5K0FA 3LCAA 2QSYA 5KCMA 3QPWA 3LPZA 2FO1E 4YUAA 2YN2A 1IDN1 4MV3A 1QFSA 3RRNB 3FBWA 3WO1A 4IUCS 3E18A 2WFMA 3EXEB 4K6FA 5LXTA 1XJ0A 5B7QA 3KEMA 3C1TA 3FVVA 2PD6A 4DW8A 3TTWA 4GT1A 4N0DA 3L4KA 1U98A 1HKHA 2OV1A 4NAVA 1NHGA 2MHCA 4XOUA 1YVPA 3HRAA 4GKBA 2D7JA 4Q37A 4ZCMA 2YW2A 1XTJA