4GYYA

Crystal structure of human o-glcnac transferase with udp-5sglcnac and a peptide substrate
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
715
structure length
693
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFHIYDNRIVLNGIDLKAFLDSLPDVKIVNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 274
structure length 693
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gyyA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gyyA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gyyA03
2Y4UA 3TOVA 2VQ2A 1RRVA 2YJNA 4J8EA 3HBJA 4MRAA 2IYAA 2XMPA 2BISA 3OTGA 4XI0A 3MEKA 1JG6A 4F3VA 2C2LA 2QN1A 5HQ8A 5JJ6A 4G25A 4MHOA 1E96B 3QWPA 8GPBA 1O6CA 3WC4A 4N5CA 4RIGA 2QLNA 1ELRA 4N3CA 2F3QA 4N2QA 1FCHA 4X7RA 3L7CA 1P2GA 1YA6A 2GPBA 5D0QD 3MRVA 5CHEE 3CKCA 2XA1A 3S7JA 4N3AA 4BT9A 3JYSA 1L7XA 4KQMA 1XKXA 3RO3A 5EKQD 4N2SA 1Y8MA 5A7DB 3ZN3A 4U0ZA 2MHKA 4GYWA 2QLLA 5JJ7A 1P4JA 5JTUA 3PE3A 4AM9A 3SF4A 5TMEA 3S27A 1P29A 3TG5A 1QKJA 1UZUA 2VCEA 3O48A 1V4VA 4BT8A 1E4OA 5DBKA 3LY9A 2QRQA 1F0KA 5JTTA 4EL0A 5BNWA 2FO7A 4IN3B 3HYMB 1K08A 2C9ZA 1HH8A 3L7DA 5D0OD 2GT1A 3H4IA 3T3HA 3KD7A 4N39A 2QFCA 2KS6A 4RELA 4WACA 3C48A 3UUXA 5M72A 2R60A 3BDAA 4YVOA 2IFUA 1FU4A 3VDNB 2QRGA 3DZCA 4GPBA 3GZ2A 3OY2A 3T5TA 2G9RA 3R9AB 4WNEA 1FU7A 4W9RA 4BTBA 3CV3A 4NEQA 2IEGA 3NC4A 1XOIA 1F6DA 1JEJA 1UQTA 4F96A 4RENA 3MV3B 4U04A 3Q3EA 3NPAA 5BW8C 3SZ7A 2KATA 1WUTA 3CK7A 3CK9A 4AY5A 4UQYA 3EBPA 4CTNA 4A1SA 1PYGA 2X6QA 3FP3A 1KTIA 3CV0A 4ABNA 4RIFA 2DBAA 3T3DA 2ASVA 2JZCA 3OXGA 3TAXA 4I2ZA 4I9EA 3D1JA 4NQ0A 1NA3A 5G04J 1FTQA 4Y6WA 2GEJA 3QKWA 3MTAA 3T3IA 5IKPA 3ZCRA 2Y4TA 4MI3A 3ZCTA 5G04C 4WUYA 2E2EA 3Q3IA 4HOSA 3LYAA 3NCHA 4APOA 1P2DA 2GJ4A 2QRPA 2O6LA 3QHPA 2VCHA 3ZGQA 1GG8A 1VGVA 2QN2A 3L7BA 2QN9A 3IEGA 2WQHA 3U3WA 1JG7A 5A6CA 1W3BA 2G9UA 3ZCVA 2PQRA 3NF1A 3CX4A 2XGSA 2ACVA 4XI9A 2SKDA 1JIVA 4RG6A 5EX3A 3T7DA 5G05C 4BTAA 2PZIA 1Y8ZA 3BCSA 2IW1A 4REMA 3ULQA 1A17A 2SKCA 3OKCA 2FF5A 4U0SA 3MS4A 2F3PA 3Q15A 1GGNA 1NZNA 5FZRA 2UY1A 3DDWA 3CUYA 5DU2A 3S28A 2VGYA 1SXPA 4L22A 3GPBA 3PE4A 1B4DA 3K9IA 1WUYA 3L01A 4MI9A 2PL2A 3MT8A 1NA0A 1XNFA 4RG9A 4FZRA 2V5FA 5FZQA 3SYRA 1P4HA 1XC7A 2KCKA 4LEIA 5DXFA 3E3NA 4YUAA 1ZBPA 2XCUA 1P2BA 5C1DA 4HORA 3QWVA 9GPBA 2QLMA 3NB0A 4W6QA 3CVPA 2ONDA 3GYZA 5ARGA 4M7PA 3IA7A 2VYIA 4UQZA 3LY7A 2HR2A 3MQFA 4HOTA 1JIUA 1RZVA 4AY6A 4JL0A 4F9FA 2FF4A 4YI3A 4JA7A 2R68A 3E4BA 4EQFA 4WHMA 1KT0A 2IV7A 3ASGA 4GA1A 3OKPA 2ATIA 2WTXA 4N9WA 4GCOA 4NESA 1Z8DA 1C3JA 1KLXA 1C50A 1C8LA 2H1HA 2C1XA 4LDPA 3BCRA 2BFWA 3S29A 1NOIA 3U4TA 2VGXB 2C0MA 1QQEA 3S7BA 3URZA 2YHCA 1GFZA 2HY7A 3BD6A 2QRMA 5HI7A 3G2KA 3S7FA 3ESKA 2G9VA 1IYGA 4MICA 3OTHA 2KC7A 2VSYA 1FTYA 3MT7A 3MSCA 1HZ4A 4GZ6A 1WV1A 3HBFA 3MTBA 4X7MA 3RSCA 2HO1A 4F97A 1ZU2A 4GYYA 1PNVA 4HLNA 2FI7A 4GPKA 3C4VA 3MBOA 4RIIA 4AN4A 2VSNA 4HOUA 3T3GA 4M60A 1PC2A 2ACWA 4M83A 1NLMA 2ECPA 1J39A 4BQFA 5HXAA 4QLBA 1Z6QA 1IHGA 4G2VA 4YVQC 4I2WA 2XA2A 2IUYA 2C0LA 3NP9A 3N71A 4WNGA 3E3LA 3OT5A 4RBNA 3S2UA 3VUEA 2AMVA 4UI9J 2XCCA 4H7YA 5FT9A 1GPAA 1NZDA 1XV5A 1Z62A 4EKEA 2J9QA 3MRXA 3CUWA 2F3SA 3CVNA 4KQ2A 2FEZA 1L5VA 3BD7A 3CUVA 4U0UA 3ZFWA 2QN3A 2XCBA 2IV3A 3ZPJA 1K06A 3RT1A 3UYKA 3VTXA 4G23A 5LQDA 3AS4A 1EXVA 3EDTB 3MRTA 3C4QA 5LCWC 2ZB2A 3NAZA 1FA9A 4AIFA 1P5QA 1IIRA 3CEQA 3G2NA 3BEEA 3BD8A 3QOUA 3DD1A 3LY8A 1XL0A 4KYOB 2PRIA 3OXFA 4KXKB 2GW1A 3OKAA 5KJNA 3COPA 2AVPA 4AMGA 3G2HA 4RIEA 4RIHA 3L79A 2R4TA 1GPYA 1L5QA 3FWVA 1WM5A 3LKUA 2H1FA 3BEOA 3G2LA 1ABBA 4KQ1A 1A8IA 2IYFA 1AXRA 1WW2A 3QWWA 1Z6PA 3TGOA 2KCLA 3Q4AB 2KCVA 2F9FA 6GPBA 2F3UA 1SXQA 4CGWA 2C1ZA 5CCLA 3CEHA 2Q7FA 3MV2B 1GZ5A 2PYIA 4G2TA 4EKYA 5KJMA 4GYOA 2PQNA 4MHSA 2R66A 3ZCSA 2I6HA 3VDMA 5D01A 3HBMA 2FETA 3HBNA 2QRHA 1C8KA 2XA9A 3LCAA 1Y6GA 2G9QA 3OTIA 1P4GA 3MKRA 4GCNA 4O6FA 4UI9C 3ZCPA 3RIBA 5GPBA 1TJCA 4J8DA 4FKZA 3UYLA 5CCMA 3BCUA 5G05J 1L5SA 3OXLA 3MT9A 1YA0A 3CUUA 4AMBA 4G24A 1FC0A 2UY1B 1HLFA 7GPBA 4G26A 4BFCA 3ZHEA 3D0RA 3SYMA 4UQXA 3AS5A 2VG8A 3QKYA 3RKVA 4CDRA 2QN8A 2AV6A 2GM9A 5JJTA 5ARFA 2XPIA 3O3CA 2AW3A 1PN3A 3AMVA 3GW4A 4KBQA 4G1TA 3S7DA 1XL1A 5EX0A 2JLBA 3VUFA 1B89A 3Q3HA 3DDSA 4EL5A 2PYDA 3ASDA 4U07A 3ZCUA 1YGPA 4CGVA 4MI6A 3CUTA 4CTMA 1E1YA 4ME2A 3CEMA 4NC9A 4JA9A 5I45A 5FTPA 3G2JA 2NC9A 4J8FA 4H7XA 2FBNA 2SKEA 2C4MA 5TVGA 4CTOA 5AYWD 2QNBA 1QZ2A 2UWJG 3PDNA 3L7AA 2FFRA 4GA2A 1UQUA 1WW3A 1FS4A 5KJLA 5TMDA 3MA5A 4WNDA 5FZSA 4EJ2A 3AS8A 3LPZA 4I17A 4N3BA 2JJMA 2PRJA 2QN7A 1WAO1 2L6JA 3KAEA 3TSAA 1HXIA 1GPBA 1IXYA 2P58C 3CKBA 2IF4A 2XGMA 3EBOA 4XIFA 4HWGA 4BQEA 2X6RA 3WXXA 2VGXA 1AHPA 1PSWA 4GZ5A 3GUHA 1L5WA 3Q49B 2X0EA 3NP7A 3T3EA 2XGOA 2OFFA 3MS2A 4LEUA 2OOEA 2R5SA 3QDNA 1FTWA 3IAAA 4BQIA 1LWNA 5DLDA 3RHZA 4I1AA 1QM5A 2P6PA 3WAGA 3MTDA 4JHRA 4GA0A 2X0DA 3WADA 4GZ3A 1NVKA 1NZFA 3FROA 3KS2A 1JIXA 2GEKA 2XCIA 1EM6A 2BGUA 4WADA 3E3OA 2LSUA 3UPVA 3OY7A 1Y6FA 3Q5MA 3CK8A 2PQ6A 1L5RA 3H4TA 4B94A 2YQ8A 4WNFA 2Q6VA 2LNIA 3G2IA 1OUVA 4Y6CA 4I9CA 3UQ3A 3MS7A 2XEVA 5FJYA 1H5UA 1ELWA 5DIZA 3ZHEB 4YI5A 3S0JA 4BWRA 5IKOA 3ASHA 1FU8A 5ENZA 2R4UA 3ZCQA 4Z5XA 2BUGA 5TMBA 1WV0A 2GPAA 4PQGA 1NOKA 2GPNA 3RU0A 4X7PA 4X6LA 2X0FA 3RO2A 3TG4A 5KJKA 2AZDA 5D00A 3ASFA 3VTYA 1BX3A 2IEIA 3D0QA 2LSVA 3Q47B 1M5RA 4HOQA 2QZSA 4J0UA 1RZUA 3RSZA 1KT1A 1L6IA 3FFLA 2BGTA 3GZ1A 1NOJA 3CEJA 4YNDA 3CVLA 4UI9K 5LCWJ 2HYZA 2WPVA 4NRHB 3CVQA 1LWOA 5BT1A 3RJVA
chains in the Genus database with same CATH superfamily
4FCTA 4IZHA 4ZI7B 4ZO8A 1NG9A 4C06A 4YQZA 4QEZA 1DIRA 3W2FA 2Y1GA 4D92A 1I7LA 2NTYC 2IPOA 2JJ8A 1M66A 4OB6A 4Z68A 2NVUA 3V4VB 1NY5A 4PZLA 1T0PA 3TLZA 2FJBB 2WD7B 4F3VA 3BB3A 1U99A 3DPDA 4FKMA 1ADBA 4G89A 3UXHA 2RE8A 3RAEC 5BWNA 4YB8A 4MIKA 1XRSB 2IA5A 3HSYA 1O1YA 5G55A 1FX0B 3CF2A 1K7YA 5BXOA 5LM3A 4QSHA 4ATGA 3PYLA 3TSYA 4TS9A 5KKAA 4B71A 2CXRA 1MB0A 3WGNA 1E9FA 1BS9A 4RIGA 2ZTUA 2RCYA 3RYHA 3BH7A 2VR1A 5C7YA 4X7RA 5L51A 2AL7A 1KZ7B 1QX4A 1QYCA 3TBHA 1KAOA 2GVDC 2GPBA 2FK8A 3WFJA 2WJIA 3JYLA 3L7JA 3M6UA 2VJQA 4FE4A 4YP0A 5FPQA 4HLQB 3OEHA 4EB3A 1UFOA 3DFIA 2O8FA 1IM8A 2XHEA 3U7GA 3RLIA 3QXSA 5TNXA 3GGDA 5I9LA 4XYBA 1QNFA 1T3GA 1GNVA 2FPWA 4D4HA 4JJKA 4L8LA 5FUWA 2O20A 5ENDA 5AR1A 3PIIA 4PGGA 4X41A 4Y6LA 3EU9A 4B4OA 3FUDA 2H2AA 3NT4A 4OMCA 2OBBA 4UYJB 2PMWB 4XB2A 4EL0A 1IUKA 3ONEA 1RD4A 5CPFA 2ZS7A 4HX5A 4B9AA 3N0VA 1I7QB 2IKSA 1JYFA 3SM3A 3AI3A 3ZY6A 4V1CB 2Z6QA 4N39A 2BBWA 5JLAA 1Z39A 3DXYA 2O2DA 3RSSA 2CHEA 3HI6A 1RQ7A 3PZ3A 1HOTA 1UBCA 4YWJA 3VHLB 2AYXA 4NSNA 3F6PA 3KB2A 2Z8YA 2AMLA 1PEKE 3SXPA 1JEEA 4EHNA 1H2VC 1IXSB 2ZXWE 1J70A 1V45E 2FPUA 3I1FA 1O5MA 4TZTA 3BRWD 3VR5A 3WMFA 4OHVA 1UANA 1NVGA 1TZMA 2FA9A 3G6WA 1A9QA 3IQXA 4G0MA 5LMCA 1E2BA 1XQ6A 5AK0A 1BMFA 2VJKA 1G16A 4PZCA 3U61B 4D0NA 3GWGA 3ZXIA 2HLDA 1UQTA 3OFKA 3NHSA 3DEKA 1ZJ6A 3CVOA 1G21E 3AUTA 3BMQA 3MOIA 5FOWA 3HB7A 1J06A 3U3KA 3GJ3A 1EG2A 4KQEA 1AMNA 1EUDA 1WUTA 5LQMA 2OKCA 5EHQA 1C9YA 3ZYCA 5LD2C 1ZQ1A 2OCCE 1P7YA 4K03A 5HF9A 1L5GB 4A91A 1PD0A 2D8MA 4CL0A 1KERA 3HVEA 3WY9A 5IT5A 1KFEB 1KTIA 1DLJA 3FPAA 2JLYA 3JQAB 5L45A 4LJ7A 3O3MB 4R1QA 1W0KA 3BWDD 4OLFA 4A26A 2HSZA 3NZEA 3WKDA 1FP2A 1EVYA 4JKIA 4Y6WA 3QKWA 5K6TA 2PUBA 3FM9A 1VHTA 4Y2JA 5G04C 1O89A 2A6PA 2J67A 3MJSA 4GMLA 4FWIB 5G41A 5JAMA 3T61A 2C61A 3IOMA 1ULZA 3BFKA 4KDRA 4RKFA 3ROTA 4DBLE 3ZIMA 3WDSA 3DAGA 4LQLA 1FDRA 1CUHA 3VYUB 1YFLA 3JQGB 1AUXA 4PLVA 4ZO7A 1V9CA 4O5AA 5CM9C 5EHZA 1GQQA 2XUIA 3OIFA 3ANXA 3AR7A 4BUJA 4TMVA 5JUWA 4HVBA 2ZE6A 4OQLA 4HQNA 5CK5A 1LJLA 5JVDA 3S55A 1Y80A 2PKWA 4HN4B 2VEOA 1MZPA 4LZPA 1HF8A 2XGSA 3EXHC 4YRDA 1D8AA 3T1QA 4FM9A 4QPJC 2H63A 5BWCA 5EX3A 3R75A 3S2GA 1GNTA 2AK3A 3HNRA 3KSMA 2AJDA 5J2TA 1Y8ZA 4N48A 1PU2A 4XX1A 4UDXX 3P9SA 1RXVA 3UMRA 3SG0A 4B6OA 4EW1A 3T9KA 3Q8MA 3JAWB 3S28A 2C95A 3N2GB 1SXPA 2BFFA 4DLXA 2GD6A 2WIFA 1TM1E 5JD4A 3GPBA 4BO7A 3HB4X 3QLUC 1G18A 4KLNA 1HE4A 2P1ZA 5G4KB 4J1NA 1M2NA 3H11A 2J0UA 1TK9A 4B2IA 3NHLA 4ZV7A 3F5SA 5K20A 3TFWA 3GFRA 3QA3E 3TQHA 4QREA 4ALIA 4KIUA 3NYQA 5BSKA 3OJFA 3JWHA 4Q3CA 1ZMXA 2WILA 2RHCA 4URZR 1TM2A 2Q4BA 4HX9A 3GGPA 5B37A 4TYYA 3D9PA 2NM0A 3I45A 4RZUA 5T57A 3UJ9A 2O48X 3PA8A 1XEFA 2DY1A 4OQZA 3G5MA 4QRHA 2EKDA 3DP7A 2ODEA 3CVPA 3ZVLA 3EXG1 2M6LA 3UWPA 1XTPA 3BE4A 1DVRA 3E8MA 2UYHA 1CVLA 2J9FA 1BIFA 4TTQA 4HH3C 4CDNA 1L8LA 3G49A 3ZZTA 3NC0C 4P22A 5HKAA 2VBCA 1MAAA 2DBYA 1MJ5A 1PNTA 1U2SA 2H2FA 2IYUA 3RU3A 2WWIA 3EGXB 4FJ0A 3K8OE 4YWHA 2OPBA 4BJ5A 2PSDA 1R3DA 4M76B 3AT1A 4WESA 1T9AA 2GBCA 3ZNNA 2OV1A 3S68A 4KPFC 1X1AA 1C3JA 2VHXA 2QMZA 2WFZA 4G09A 3TSCA 4E5YA 3WFIA 4NBSA 2ZS8A 1G19A 4EHHA 3NDBB 1EG7A 2C1XA 3OQ1A 1VMIA 3RF6A 2X9GA 4P3XA 2PU5A 3PQCA 1N2CA 3OPYA 1SXHA 3FPGA 1QQEA 4GOXA 4D79A 1T8WA 2BFMA 2QRMA 1NHGA 3E1SA 3I05A 4DLWA 1AKEA 2G9VA 4S3MA 2A57A 4R98A 3EB9A 3E32A 3KHKA 1ECFA 621PA 2HK7A 2IYEA 1RYMA 1YZQA 1HZ4A 1OI4A 4H6VA 2IBMA 2VF4X 5M3BA 1EMDA 3HBFA 1OIWA 2ZJBA 2OHFA 3D3KA 3WTCA 1QVAA 2NN3C 2X5XA 4ALKA 4E30A 1LBQA 2F8SA 1FX1A 1OVGA 4MZDA 3WGVA 3VLEA 1B0UA 3BXXA 1AO3A 1E9AA 1AOXA 1F8YA 1JQLB 3OCVA 3ROMA 4APFA 4IRXA 2CHGA 4ESHA 1UAAA 5EZYA 5GGXA 1D6JA 1P0MA 1Z13A 2HIMA 2WYVA 4KWIA 4UC0A 1QP4A 1NLUA 3AIOA 1QRUA 3ZWVA 5HXAA 2VAXA 1ZH4A 2XF2A 3EUAA 3FYTA 4RO0A 4MUHA 1IMJA 1IN7A 3FUEA 3DMNA 3QIVA 2BW0A 4ZU1X 3ZI4A 1Z6QA 1RXWA 1PUJA 4HHEA 1GAJA 2PYZA 3Q6MA 1U2QA 3E18A 1J99A 4UBOA 5C80A 1OWPA 1A5EA 3LZDA 4I46A 4QGFA 5BQFA 1OCCE 3RARA 4RTNA 3QPDA 3R0IA 4JLDA 3LFUA 1L4FA 1FT2A 4MRVA 5DYTA 4YMIA 2YR0A 4J1TC 1EI9A 4ZOLF 3H19A 3FNEA 4BNMA 1ZSNA 2PWYA 1H2BA 4Q1AA 3DB2A 3WQHA 4DIEA 1QF6A 2EP7A 4Q0MA 1HDOA 4QEDA 2F1JA 3HWWA 1AVTA 4JI5B 1KDRA 5F7JA 5CT6A 4BZXA 2IWHA 1Z06A 1N8NA 4CKCA 5BSMA 2JKZA 4J9UE 3STUA 1ZOLA 2P41A 3UYKA 1NW4A 5ED4A 1QXSA 2FMUA 4KDCA 3AKCA 3IS3A 5DSXA 1FY2A 3SXJA 3FZNA 4B6GA 4CDMA 4QGSA 1GYRA 2ALJA 2ZRIA 2J32A 4KB5A 2X7HA 4YAIA 3B8HA 2ZGGA 3KZKA 1VCNA 3SAJA 3N76A 2P40A 2PK3A 2VK1A 1MXHA 2A9RA 2Y1XA 1L4NA 2REBA 4L4RA 4CMIA 5KOJA 2W2LA 1JILA 1F4PA 1AF4A 6AT1A 4LY0A 5E6SB 1W2WB 4O4HB 1RI4A 2EQXA 1MGOA 4R40A 5ELLA 5ES3A 3WG7E 3BJMA 4UE6A 1YE8A 1ZO8A 5G2OA 3RC3A 5JAIA 2G9NA 1UK9A 2XCLA 2QTGA 2KJQA 4ARBA 2CNWA 1L5QA 2ADFA 3FWVA 3LQFA 3WLQA 1II0A 4ZJZA 2V0GA 4CM4A 1WQ3A 4JBIA 4OI1A 1MX4A 1KOGA 1W2HA 3FXAA 4KXLA 3FCUB 4K3VA 1WHSA 3EDRA 2P7HA 3IAXA 1KMMA 1TQ2A 4O2BA 4DBLC 1SBZA 3NOVA 1JB1A 3O2SB 1G21A 1VE3A 1X70A 1Z0JA 3F5FA 4WUTA 3U7JA 2BKVA 5EIDA 1MO6A 1X8KA 4FFSA 3TOSA 3K4QA 2RHJA 5CCLA 3C8HA 1VIDA 4FILA 5A6VA 2WV7A 3EZXA 1D2EA 1IWPB 2HQRA 5CTAA 1GZ5A 5EE5B 1DE0A 1CQXA 4ES6A 2CCKA 3CRW1 2Q45A 4Q47A 3QPCA 4X1IA 3ZGLA 2RBEA 4YRFA 4L85A 5AW1A 3FNIA 4FR5A 3SZGA 4IKEA 1QG0A 3PNMA 5KJFA 5DN6A 3V4ZA 2QRHA 1RRFA 2W90A 1E2KA 3L1JA 1BMDA 3B7RL 4ZOLB 3UMMA 3I9LA 2I6FA 3DZDA 1QH0A 2QLJA 4QTUB 4RSMA 1UADA 5AVJA 3ZCPA 1DEAA 4NU5A 2Q49A 3N6RA 3L7LA 1L7MA 4P4TA 3W8NA 5K4HA 4DBVO 2PS9A 3KUKA 4PRKA 5KSZA 3R3JA 4TL9A 3VDXA 2MDTA 3RSFA 3AHEA 4B87A 4N76A 3OUZA 1ULAA 1PL8A 3LOQA 3PNVA 1ZK3A 5H3LA 4HAIA 4AMBA 5AUOB 3V4FA 7GPBA 4LDNA 3UH0A 3IH5A 4BFCA 2IO2C 1US8B 1WOYA 3A1CA 4GG1A 3PDUA 5KTTA 5C1PA 5LKRA 2X0NA 2QZ4A 3Q79A 2OCXA 4H3KB 2YICA 4M88A 3QKYA 4JCOA 4U1RA 2CBZA 2RB4A 4PC6A 1Y81A 2EL7A 2MIIA 4OQDA 2OV2A 5JJTA 3HZOA 2QTLA 3E9YA 4X64B 4WN9A 5A5GA 4DCSA 1EFUA 3A6JA 2AEFA 1RC1A 3GIDA 4KREA 3AEQA 1AJEA 1BH6A 1DEXA 1FMTA 4JUAA 4C3UA 2ZCVA 4UVEA 1L5LA 1VG8A 1FRVA 4C0KA 3O90A 3M89A 4IVPA 4MINA 1PWXA 1OZGA 2HNBA 3KR2A 1RJWA 4E2WA 4GTTA 1SVXA 1Z4OA 3AM4A 4ZVMA 2EARA 3DMHA 3ZDEA 5JW6A 1AMUA 1BVYF 2YWDA 4GPTA 4YRIA 4M9UA 2H18A 4MGHA 2DLNA 2V45A 4HNHA 5HBGA 1WUJS 3K70C 1V9SA 1OXXK 2BZSA 3D8SA 1JQ5A 5EWLB 1T9BA 1H5NA 4K40A 1AGRA 1RWPA 2DFPA 1YASA 1Z0ZA 2AN3A 4IILA 1GTMA 5AJLA 2UZ1A 4RZ2A 3GFGA 1S8FA 4B4KA 2V4MA 1Y4DE 4OGWA 2VZ8A 2JBAA 4BWVA 4L76A 3EPLA 3M49A 4TRQA 3CXRA 2OUKA 3NRJA 5TVKA 1YVDA 2LDBA 2VT3A 2IL1A 1Q6YA 5CEDB 2FFRA 2P1RA 2WDZA 1SPBS 4KQXA 4I1OA 5T67A 3WTBA 4FTWA 1ODSA 1RAFA 2XAUA 1XALA 4YP5A 4KLRA 4F5YA 4NCHA 3CCFA 3LDAA 5L7YA 5JRJA 1PY1A 3L9XA 1EK2A 3D6TB 3AS8A 3LQ1A 1JWGA 2M6KA 5J4VA 2PRJA 1UZAA 4U7TB 5T3RA 1GQSA 3HPQA 1QANA 2BSAA 2PSJA 4WOPA 2RG7A 1BYIA 2FFJA 3CKBA 2E5FA 3PFNA 5ENSD 1DBRA 3AL0C 2JIQA 3U9TA 1WCIB 2I76A 1I6KA 4OJTA 2VWQA 3OJXA 5LZ2A 1DIAA 2OWEA 2V03A 1E3WB 2FJ0A 1RCTE 4D1YA 3PFBA 4NE7A 3ROZA 4TQGA 4CCYB 3ME5A 4L73A 4AJ9A 3FWZA 2V3CC 1E2JA 3I9OA 4O2LA 1T9ZA 1IPFA 4H18A 4NS1A 2FX2A 4QLAA 3ZJUA 1EX7A 2JABA 3LHDA 4ZFHA 2ZU0C 4XW2A 2B7BA 3PXUA 3M34A 4UVDA 2YW2A 4LI0A 4H35A 1QPZA 1FRNA 1LSJA 4I43A 4MS1B 1FFSA 1BDMA 1G8YA 4WFKA 5FTMA 2JJQA 4EDFA 5FA5A 2G3YA 1EAMA 4IXMA 2I9CA 5EXDA 2PBFA 2H1WA 2Q7XA 3IQDB 3PUXA 2X3MA 4B40A 4B74A 1JIXA 4DRXE 1NLYA 3EF3A 4AVXA 4NENB 3W5VA 1AN0A 2WF9A 2MSWA 3GRZA 3LVFO 4PZEA 3TLEA 1H1DA 3GCWA 4QO8A 3TI7A 1MB3A 1Q77A 2YV4A 1CJCA 3TAUA 4MJXA 1T13A 1U8YA 4IRUA 1K9SA 1R4NA 2B21A 4UUCA 4MWGA 4XB6B 2C1EA 1E64A 1GZ7A 1QCCA 2P3SA 2P2NA 2YZNA 2Q41A 3B6MA 2YUTA 3BWYA 3FCSB 5HTKA 3U4DA 4R0MA 5CR9A 1QDLB 4V2UA 4FQ5A 4QZVA 3UMSA 4FYWA 3HFRA 2OHJA 1ZP6A 3QEOA 4UU8A 1OBOA 2EZUA 1E9SA 1E96A 1RQ2A 1U5CA 3SI5A 3DKIA 4QYXA 1YS2X 2D2IA 1Z2OX 2Z57A 4DSZA 5ENZA 3UXEA 2P11A 5CBNA 2WSMA 3PXGA 2OZLB 2W6JD 3ZQ4A 3H5WA 3PVCA 1S2OA 6LDHA 5L4NA 1H94A 1QGAA 3K4PA 1NOKA 3MB5A 3R5XA 5EI5A 4BLPA 1HG0A 1KBQA 3RU0A 1E9EA 1ORIA 3FSJX 4R0VA 1FPPA 1CX9B 1ID1A 1PHPA 2F67A 2MT9A 1TOAA 1SB8A 4Y9UA 3VTKA 1NW5A 5JZBA 3NEYA 1ZUNA 2MOWA 5C8ZA 4HPWA 2IP1A 4V0SA 4OL9A 1C0PA 4AUEA 4XQ0A 3V42A 2CVQA 5IMBA 4PYIA 1H6KA 3ABIA 3QX9A 4CQLB 1K89A 4DV0B 1CS0B 2V9ZA 1N2SA 5IEBA 2XPYA 1ZIYA 1FLAA 2C0QA 4BE7B 4RVOA 3PT5A 1KQOA 1JFLA 3FFLA 5LFAA 1NXVA 1QX3A 3JARB 3CS3A 4JX9A 4RF4A 5JSKA 3ZHOA 3K2EA 3VGJA 3DLTA 3D0KA 3I2FA 5EQFA 1HPLA 3KTAA 3AVVA 5F3RA 2A86A 4GTOA 1QR2A 2Q6LA 3HVIA 4HXEB 4UWLA 2AGVA 2GEUA 4Q03A 3ZOKA 2BFCB 2QK4A 4YAUA 4PDXA 3EIQC 3CQ9A 3F4KA 3GCXA 2WMNB 4R41A 2OORA 1KR5A 4TXQA 2GEDA 2VDVE 2YJNA 3BKXA 3BXPA 3HBJA 4JOBA 3TJRA 3N8IA 1E6UA 2FFQA 2K2WA 4YP9A 3UV6A 3ZTWA 4ESVA 2VAWA 2QN1A 1G3NB 1N9AA 2FWBA 2GPTA 4UEJA 1B0ZA 4ZT5A 4ZIRB 1GGVA 2G63A 4D4KA 1BEEA 4HOYA 1ZNXA 3AOEA 4PFJA 2VH2A 2VYQA 2I9KA 4GZLA 1G59A 1I2BA 2Z9BA 2VTVA 4J6EA 3RS5A 4KG7A 4CN8A 1TTTA 3SEZA 1ML3A 2DMRA 1XTKA 3P9YA 2P9FA 4RV4A 5B3SE 3O9MA 3URKA 4AICA 3TW6A 2XDQB 4Y7CA 2B99A 3UKDA 1NI3A 2H6EA 4GBED 1SCKA 2Y8EA 1XU7A 2AT1A 3V1UA 1PNQA 1QCYA 5KBAA 2WSLA 5K6RA 1ZD8A 2GF2A 5A7DB 4MR7B 4PFKA 1C7IA 4RA9A 3QBJA 2YH2A 4RHTA 3V00A 5IAAA 5KJ6A 3B5IA 3Q8KA 4KNVA 4HL6A 4X3CA 3OU7A 4KFTA 3TRIA 4EGJA 3AEYA 1JHXA 1SUCA 1CCWA 4W99A 1KJIA 3RU9A 3X0DA 2A58A 4B75A 5CDHA 4DPMA 1EP1B 3CMMA 2ZB8A 4EFLA 1ZXXA 5FF9A 1I7SB 3FCXA 4PY2A 1O1RA 3SQVA 2HMSA 2O3JA 2QG6A 3GEPA 3DT8A 1PJTA 1N1MA 1ZH2A 3LUGA 3OCCA 3OPYI 1CQJA 3UM0A 4RJ2A 4F71A 5IRCD 4F2DA 3A2KA 3I2KA 1WB9A 3G9XA 2G1KA 1R0XA 3O26A 1FLDA 1QYMA 4JYAB 4ILHB 1TYBE 1YWGO 2CFCA 4NYIR 2VDMB 4WACA 5E1MA 5FH9A 4AT1A 1IJEA 2WKSA 4YVOA 5IG2A 4E6PA 3OZWA 3TZ6A 2VAMA 2IHNA 2OGUA 4FB5A 2P0EA 3B48A 2HU7A 3CLHA 3TUZC 4LDJA 1J2RA 3HCCA 3VYVA 4M8NE 5AXCA 1XNGA 3EX7C 1AUVA 1ZM4A 5JI2E 4UVIA 2X9LA 1N4AA 3SSOA 4LJ8A 5FTNA 4RXTA 1OLOA 3TR5A 4BIIA 3L43A 1XRQA 3AZPA 1VB3A 5GM2A 2XUGA 3IBTA 4Q7LA 4DLTA 2D6FA 3KQYA 5FTLA 1J25A 1YAHA 1NYTA 2ZSFA 1EEXB 4KR3A 4N8DA 3B6EA 2QTRA 3FWNA 5ERYA 4IJUA 4QNRA 4L07A 3ZLVA 1CETA 3SHVA 1BVHA 2Z9CA 2QQFA 1A8PA 3P9ZA 4RIFA 1JH8A 2A9VA 3F9RA 3SF8B 3T3DA 1OY1A 4CIBA 5EJ2A 1P1JA 1ZUNB 2J6HA 1FMJA 4MV0A 2ZWIA 5IP5A 2O8DB 1YNSA 3W8RA 3TLYA 1P31A 3NNNA 1H2YA 3MTAA 2AWIA 5CDUA 1GILA 4NBRA 3ZCRA 4L9AA 5FBZA 1QV7A 4A6EA 2PM8A 3CG0A 4Z4QA 10MHA 2R2LA 4OQYA 1XROA 3HYRA 1BI8B 2HM8A 4EYOA 1XMSA 4FDAA 3CBGA 1E0AA 4APOA 4KXUA 2GRMA 3AJIA 3O84A 2PLFA 5G0SA 5BSHA 2GILA 5A5VA 4G4SO 1P72A 3R41A 1G2IA 2OR3A 4LWQA 2VCHA 4N9QA 1T0BA 4ROTA 3OTQA 4DG8A 4C9BA 5AOXA 4IVNA 3BK1A 2WQHA 3ICWA 4RD6A 3BCHA 3N28A 2EX1A 4CLRB 4TVOA 4JB8A 3OT1A 3B3AA 2CG3A 4Q3LA 1PWZA 1NL4A 3BHNA 3ENQA 3R3SA 1SKYE 4FLBA 4GOLD 4R6XA 4OP3A 2DQ4A 1QH1A 5G1OA 3I76A 1WCWA 2Q8QA 1XIVA 3PNLA 4H6PA 5D6NA 5CXSA 3SI7A 5AJYA 5BW6B 5F12A 5FULA 2YOHA 1SY7A 2EAUA 4WA7A 2V4HC 4GEGA 2XPCA 2PLWA 2IHYA 4XYLA 4FYJA 3DVSX 4MS1A 4YFYA 3ZX5A 3FWKA 2IQCA 3VU0A 3Q88A 3GH1A 4RG9A 3EZ6A 3SSNA 5FZQA 4DDMA 1FXWA 1SVIA 1G8PA 2W98A 4N5LA 1B26A 3SNXA 1A7JA 1N5JA 3C1TA 5FA6A 4YUVA 1L5YA 3RAGA 1XVAA 2H48A 1VJ5A 1XVTA 3FDIA 4UTRA 4B3SB 4W6QA 4A10A 1FE8A 4C6RA 5CX1B 4RL6A 3T9AA 4QXAA 4OLBA 3VI3B 2V9PA 5JV5A 5F78A 4HH4A 1PJSA 1RWQA 1JXQA 4A8JC 5E9WA 2JGDB 5CFLA 2HB6A 3RW9A 4B8ZA 2R1UA 1XJ0A 3ZH9B 3DUFB 4INOA 3LVQE 4LZWA 2FF4A 1DKLA 1JDPA 4ZICA 4ZHQF 5LQCA 5LQKA 5AM3A 3LUDA 3EFBA 3ASGA 2LV8A 3AOEC 3SS9X 1VIMA 5FOXA 4GMHA 3WI7A 1Z8DA 4R1MA 5IXYA 4W5OA 4KN8A 1KLXA 2HSWA 3DOJA 3ZH2A 1OVMA 5JZOA 1VDYA 3A06A 4EJ6A 5LL6P 4MCHA 3QITA 3CA8A 3ISMC 3L07A 3ZHUA 2JLXA 2IS2A 4YRAA 3HKEA 3P2IA 1L4BA 1SXJD 1JTEA 2CHQA 2A33A 3PCTA 4ZGWA 3GA0A 2JRLA 5HS0A 2BL4A 3HJUA 2QD3A 3EIQA 5EXPA 1VSBA 4WNAB 1B2RA 3GFTA 4IHJA 1K6MA 3ZKJA 3A8TA 3NTOA 3NXSA 4HB3A 1EFDN 2Y0CA 2BYTA 1Y5NA 1FTYA 1C2YA 3F98A 3QU2A 3KQUA 5GQSA 1XZKA 4NFYA 3R7NA 4NEHB 1H23A 3RRUA 2OGWA 4EVQA 4HRNA 4KCGA 3E15A 3CLUC 1AHNA 2MR6A 3KT8A 5J63A 3G79A 3G0BA 2YDXA 3NH9A 4TV9B 5AKEA 5LP6A 1JFSA 3C4VA 5LXTA 1D2GA 2G0NA 4XQGA 3I6ZA 3N2NA 3OMLA 3PQ5A 2DY0A 1QRRA 3W6OA 5IANA 3UINC 1NDUA 1QPGA 2A3RA 2G5GX 4D74A 7MDHA 1BGXT 4CI9A 1DRUA 4OA8A 1X9HA 3PC2A 4IIJF 1VHQA 2WWTA 4ZARA 3DBOB 1B23P 4YVQC 3TPZA 4P4UA 2Z5LA 1V5WA 3OJWA 2IYVA 1VKHA 2OEPA 4OHYA 2B6NA 3N71A 2CMDA 4GRAA 3N07A 3WRWA 3J80A 2AZXA 1J8MF 1DRJA 3ZHXA 2W22A 5B4TA 5BN3A 1Q0LA 3HACA 3G2WA 1KZGB 1UM9B 4Q93A 2J3EA 1D2MA 4Y2UA 4CF5A 3F73A 4H7YA 5FT9A 4DMHA 4ZVUA 3B3QA 4XKCA 1SNYA 1N2ZA 1XO1A 2CFIA 4II3A 1D04A 3ISTA 3MRXA 3PUJA 3CGWA 4HDKA 2GWHA 4I4TB 4IV5A 3CVNA 4IZOA 1QVVA 4QT4A 3TIXB 2F3RA 2R00C 2XF8A 4OQFA 4N8SA 3Q7AA 2I22A 1U81A 4YRPA 4IJQA 3W7BA 1Y7IA 5D3MA 2NTEA 4X6YA 3AVXA 4YS6A 2Y4OA 3DZFA 3DOUA 4L4ZA 3E2MA 1QRTA 3BDIA 4GFDA 4PG6A 4QODA 2XEXA 3EDTB 3DEOA 5NULA 1KH3A 3C98A 1B8UA 3C5CA 1XR3A 4JU9A 4YP7A 4X9XA 3RU2A 4Z7NB 2NXJA 5CFMA 1KVTA 4UNSA 2R751 4GI7A 1EYZA 3TW8B 1L5HA 1KETA 1F17A 5D1NA 4CFZA 2CV1A 3LUPA 4GSYA 4OHUA 1DQZA 2PA3A 1O8CA 2XITA 3AR2A 4F5DA 1P62B 5JWHA 3GJ0A 3FOBA 4YH1A 2BMFA 2A5FA 2LGJA 4I1YA 1DKUA 3G8AA 1PT9A 1G21B 3CLVA 4RX1A 3VTFA 5KNLA 3ROQA 1ADCA 1RJ9B 1BMQA 2BLNA 3BEOA 3IEIA 5E7IA 4YK7A 1RAGA 5LA6B 5A2GA 1QKIA 5BNTA 2B0JA 1ABBA 3Q11A 4AQ7A 1V4BA 3RRJA 1QP7A 1KI8A 4AKIA 2Q8PA 3QPBA 4LCJA 1VOTA 1RC8A 3H0KA 2CHWA 4L78A 2KCVA 4QYTA 2QTWB 4XE5A 3T5XA 4DUZB 4IUDS 6GPBA 3LC2O 2A0WA 5JALA 1F2DA 3IBEA 1J0AA 5KOYA 2XBMA 1NMSA 4FI3F 4AJ4A 4S2EA 3W3AH 5CBPA 3L0CA 4JBHA 2OZPA 5EJ7A 5K8CA 1UC9A 2ZPUA 4BU1A 1CPYA 3PQ7A 3IMEA 1XI2A 1V9LA 3RGGA 3UO8B 3K5WA 1SGWA 3KAQA 1EFTA 4Q01A 3TB6A 2MSNA 4AD8A 3AI2A 5IBQA 3UW1A 1ZK0A 4OYRA 5TT1A 2Z5VA 4EY7A 1D4AA 2HDOA 2ZSHA 4PF1A 1EWVA 3UTCA 4Q69A 2KYRA 3PD7A 3WAKA 3UT8A 4BE9A 3GV0A 4HS4A 3VR5H 2IH4A 4G5HA 4Z0PA 4ZQEA 5CCDA 3STHA 3UWOA 5ERXA 3T12A 1YDHA 3V5NA 4B3BA 1RQGA 4UDYX 2N46A 4C4TA 1A5BB 4UTZA 4ENWA 3DE2X 2V5VA 1CTQA 3M5DA 2PKRA 4MVJE 2Y99A 4N5MA 4PYLA 3U3MA 1FMFA 3SHOA 5GIOE 5DNCA 2C82A 3X1XA 5HCNA 4CEHB 3MAGA 3ZU5A 3G8BA 2W2MA 4LC0A 1H8ED 5LB2A 2UZ4A 3HHMA 1NBEA 4L0QA 4L2IB 5EMMA 4B5LA 4BO2A 3ITKA 4YJ2A 4MGEA 3EODA 2C2BA 1FFXA 1ODIA 3M4YA 2WMYA 1FB5A 2OENG 4FJ2A 1QORA 4UMVA 4WZAB 4Z6KA 4JITA 5KSWB 4IM7A 4JI2B 5PGMA 2FWIA 3S70A 5CITA 2AEMA 2BDEA 2Z09A 3ORHA 4PAMA 4G1TA 4OLJA 5JH7B 1TJNA 3MJEA 4BV8A 5BVHA 1QHIA 4P5EA 1ZCZA 4L51A 4OGKA 1F2TB 3PC3A 4KAFA 2XE7A 2PYDA 3ND6A 3ZCUA 5H8WA 2I3ZA 3DEFA 5A7GA 3GLGA 3F6QA 1U98A 1ZESA 1K5DA 2L2QA 2YBDA 3UHAA 1H0SA 1GQFA 3K9HA 3ER8A 1YB2A 4EKDA 1XZQA 4AF6A 1RWNA 2P5UA 5FNVB 3RRFA 3ILYA 4Y1RB 3D9OA 3MUOA 4Q9LA 4DXAA 1XA3A 3IE1A 4AG5A 2VDLB 2P5TB 2H5JA 1PX0A 2ZIGA 3BL6A 1D2HA 3GNLA 3KU4A 5TVGA 2G76A 3AR5A 5DLQC 1MVNA 1COZA 2EERA 2IUEA 3A6DA 3DW1X 3H6KA 3P4UA 4B0OA 3L0OA 2ATVA 3UHPA 2PMFA 1EFVA 1QFMA 1IXRC 3I8OA 3HVHA 5KJLA 1EWYA 2F9LA 2QJWA 3CLTD 1LI4A 3HU2A 3M1AA 5LYJB 5I7UA 2UUCB 1TT5A 1YRWA 4WXHA 1UF9A 4YDYA 4L02A 3D4PA 4XEHA 1V16A 2PSHA 5EJIA 3HFSA 4JA0A 4DADA 1GPBA 3UWMA 1J5XA 1U7UA 4AF8A 4LYYA 5FWYA 2EKZA 1BN6A 1MD9A 1XELA 5JU6A 2PVCA 1THZA 2YMQA 3NC1C 3I62A 2GROB 2GAOA 3SQNA 5KPDA 1A88A 1TVKB 1UG3A 2WXJA 4RKEA 4MDYA 1OQAA 1K0UA 3UPUA 3HMQA 5LKAA 1E2EA 1OT3A 1DAEA 2FSVA 2VFAA 1RRMA 3A6LA 1QNLA 1LS1A 4GR5A 1P80A 3B8EA 4FHZA 3OCWA 3OJEA 3QKUA 1WXHA 1GXSB 4N7JA 1ZH0A 2GDZA 2F1RA 3BGIA 1CYDA 3DLIA 4LMBA 1KPSB 1IHYA 1NUPA 2DUWA 4U7PB 2Z0MA 3CZQA 5ALYA 3I0MA 4CF7A 3VSEA 5IDWA 4BQIA 4ABTA 1N2XA 2GD0A 5CB0A 1ESNA 3LPLA 4JHXA 2KLHA 4LKRA 4TXJA 2UV8A 4BKRA 5I01A 2LPMA 1R10A 1WXIA 1EX1A 1NU6A 3HKBA 1X2EA 4M9QA 4MQFA 3CN9A 1TQ6A 3W9YA 4RCVA 4RA6A 4B93B 2Q2NA 2O5CA 2QDKA 4Q6BA 3K15A 4A3TA 3CVYA 1YA4A 2HA4A 3BRWA 3O9VA 3E3OA 4NFHA 2R8ZA 3OY7A 3UH1A 3LGAA 3GUYA 4I6JA 1T1IA 1W1IA 2P2LA 2V4ZA 3B6JA 2BAGA 1E4YA 3BH0A 3DOIA 3RBXA 5AOVA 3A1UA 3RPEA 4CF3A 1N5RA 4E3WA 2FN8A 4Y2QA 1TA0A 4X61A 2P65A 1UJNA 1EESA 1DJNA 4M8LA 3HPRA 1AKTA 3UQZA 5MDHA 1CZOA 1YQDA 1POWA 4EBAG 3KV1A 5K9ZA 1FPMA 4TKZA 3WLSA 2IX3A 2B4TO 3PNOA 1E1RA 1RQPA 3ZHEB 4G65A 2HHAA 2PMCA 4NAUA 1LNQA 5KYWB 1NV8A 2LBPA 4Y2YA 5AK6A 2L0XA 1SVSA 3I73A 3E05A 5JBQA 3WGIA 3AFNA 4PQRA 1YHZA 1YU9A 3ETJA 3EHRA 3BTVA 4R51A 5ALRA 4B7ZA 2PS0A 2OORC 1MA0A 1S02A 1LQUA 3OLVA 4US2R 1Y3IA 5FLXA 1UBOS 4XGQA 3SK1A 1MLDA 2EJCA 1OKKD 4JEHA 1D5CA 1Y9AA 2HHCA 1T35A 1XYYA 2IOFK 4CR7A 3QF7A 1L7QA 1HRDA 5DB4A 3I5MA 1GA1A 1R15A 3AIKA 2KLBA 1YS6A 4LHYA 1J8VA 1ZQ9A 5G0UA 1NT2A 4ZU3A 2WXRA 4OUKX 1ES9A 3C45A 4C78A 5DP1A 5DM0A 1J0EA 3SFZA 1AS2A 4OMFG 4W1PA 5DHPA 2FCAA 5B55A 3R5HA 1NR7A 2WIAA 3R2JA 1CDEA 2VWHA 2D1SA 1AQJA 2Z08A 3HN2A 5BN5A 5K0ZA 1WHTB 3L46A 3EIJA 2Q4DA 5EKSA 4GTSA 2R6R1 3ANMA 4KYVA 1TEXA 5COAA 3UOWA 4LDAA 4M7OA 2SBTA 1M2VA 4DCCA 5THKA 2LP4Y 1E3SA 3GRYA 3OTGA 5DP2A 1TNDA 3V7UA 3F3YA 5CIYA 2ZUUA 4LBZA 4IDOA 2I6XA 4TS4A 3PXDA 3AUJB 2IF0A 9LDTA 4NJEB 3ZKAA 3A4NA 4A2WA 4C5BA 3Q6NA 1OY3D 3FB4A 3ENVA 1K1AA 5EC8A 5C46F 1YR2A 2Q4EA 1ZNZA 3CJTA 3U48A 1GT91 4JLPA 1X42A 3F8WA 4D6XA 5ITZA 3MERA 3K09C 4YMUA 1RXSA 1VDZA 5HRCA 3O8QB 1NJ5A 1ZONA 4N40A 3HGTA 1GUDA 1GYQA 2I6QA 3D6VA 3QQ5A 5F7OA 2GZDA 4OXQA 3ZVMA 3V79K 2A1IA 4O4IB 1C1XA 3NT5A 2ZSJA 3DMRA 4WECA 5JY6A 1FBNA 1VSQA 3F7TA 4KQIA 5HE8A 3S7JA 3O8DA 4X60A 3WMGA 2VGEA 2LAIA 2WIBA 3FKQA 3QMMA 4D0LB 1IZ0A 4OKIA 421PA 1F48A 1MW8X 2GXSA 2E5WA 3HCWA 4GMDA 1DKPA 1GA6A 4TRMA 1G6Q1 2FW1A 5HJ7A 3ZVVA 2Z98A 1PG0A 4JJIA 4IVRA 3ONVA 5JJLA 1E3EA 2C5GA 5H82A 1WCXA 1XNRB 2WMDA 2GJKA 2QRQA 1E60A 4AP2A 5JTTA 3S2EA 1KEVA 1R5NA 2UVDA 4XWYA 4KL8S 1U4SA 1BDIA 3KJIA 1JA9A 3EVNA 1UINA 3MMSA 1OTHA 3MK31 5D0OD 3VU1A 3ST7A 2NLOA 4K26A 2I67A 4ZEMA 5KC8A 4NXMB 3GY0A 4RM3A 3T8KA 1OAKA 1YIAA 3FSRA 2HT6A 4C3OB 4R8SA 4RGVA 4PSVA 3L4JA 1P2VA 4R1PA 3IDAA 1QGOA 3W6NA 4UFPA 3VTAA 3N8KA 3FPSA 4PLGA 2QX8A 2CL5A 2WIDA 4TKMA 1TEHA 2GAFA 2PT7A 3JQAA 1BW9A 3EHQA 3HJNA 1OLUB 4ZT4A 1RWBA 3SXUB 3GRPA 3OJLA 4A8JB 4Y6OA 3ZE6A 4L0CA 1F6DA 5AVYA 3QPVA 1JEJA 2B2XA 1GTSA 3KLPX 4IYJA 2QY9A 1E1RD 2BC9A 3QVKA 3REFA 2QPLA 5LLTA 4JHKA 1NM5A 1PT8A 4KVFA 2QTHA 5HNKA 2XI4A 4PO1A 1PVVA 1VMAA 4L0MA 5BRJA 3SX0A 5ARBA 2XTZA 3PZ1A 3II6X 2D7DA 5DHRA 5CXXA 4DCJA 1JRLA 1NIJA 2BGNA 4OQ4A 1WHTA 4AUKA 4ZO9A 2FSHA 2NOAA 3LEWA 3OZTA 3V8EA 1O1SA 3ETCA 3QEBZ 3SO8A 3EUFA 5G3YA 1X80A 3Q7EA 4XA8A 3WJAA 4JJ7A 1MR3F 4DLBA 5J3JA 3UGKA 3V7YA 1MDBA 1SFRA 1U1EA 1JVBA 2YJ3A 4N18A 3V7FA 1JFTA 5K6AA 3TLBA 4MVJH 2PR7A 3KAPA 4LMRA 4LG1A 2PXCA 1T0JB 1M8GA 1AB6A 5DMXA 1J4AA 3O31A 4UYJA 2ABWA 3C15C 4BVJA 1GHTA 2CW5A 5F77A 2D5BA 3ZE0B 3ZHYA 4DF3A 4ZK2A 5ITVA 3W3ZB 4LV8B 2N3ZA 1MOQA 1ETUA 3VI4B 4YMWA 4L5IA 4YASA 5ICGA 4JI0B 3T5BA 3SE0A 4IOKA 4U2CA 1FYXA 2IHZA 4LSZA 5L4SA 3D5TA 1TYZA 1V1RA 1KMHA 2JKYA 2R87A 3KT3A 1XCMA 1P9OA 4IDHA 4RWZA 3W5HA 3AHGA 2YZ7A 5E9JA 4IX1A 3SJAA 1V96A 1GV1A 1GAWA 2WT9A 2XVXA 4M22A 4EMSA 2G77B 1ECGA 1FJXA 1ZFNA 1EVEA 3F1KA 2MSKA 3HNOA 1QHHB 3ZLBA 3AHCA 2ZQZA 1WXDA 5DRYA 3TTYA 1LCIA 3NM5A 2AMJA 2C7PA 2GRLA 3F4BA 4BGVA 1PZEA 2FUG6 2JAQA 3HCPA 4CDGA 5HRAA 3RYFA 1M6HA 1VG0B 1NVXQ 2CDBA 2WF5A 3NR2A 4YROA 3KFVA 3RS3A 3U17A 5HKKA 3FWYA 1KSHA 4JEUA 2V8BA 4TZ6A 1RSZA 2P9HA 2FZKA 2JGRA 4IIFA 3IRVA 4PAOA 4P4SB 4AN0A 1YR9A 2IZ0A 2IS4A 3RIHA 2H11A 4MYCA 3SYKA 3FOZA 1JDUA 3FVQA 1E5VA 2XVZA 1NQWA 3AUFA 3T99A 4CV1A 1UR5A 2VKTA 1MQ8B 4YUAA 5JS6A 2BT4A 5TV2A 4C2AA 3G6KA 5GY7A 3JALB 4P9NA 5JDIC 3VHRA 1N8KA 5LXTB 3FA2A 1SVMA 3OIVA 1KZHA 2FYTA 3IT2A 1ORRA 2AD1A 2D4AA 3D6HA 4JBYA 2A5JA 3H7AA 2JLZA 4DUIA 3PX2A 4HOTA 1JIUA 3I04A 1PS8A 3BIJA 4RGQA 3WSTA 1HTTA 1KVQA 1SZPA 3C3DA 2RC6A 4G6ZA 4F9FA 1UPTA 4ODIA 4ARZB 4CG1A 4N6OA 1Z88A 3GA7A 3HZHA 3M9LA 5FLEX 3RUHA 4ZKEA 4OREX 5A6SA 2HIAA 1IN8A 2J07A 2HGZA 2A4ZA 1DUSA 4I6GA 3UT6A 3FYUB 4GMRA 3MJRA 1YR7A 2ZIFA 4F91B 5DH9A 3R7WA 1NXOA 4LF5B 4C48B 4KGVA 3SX4A 3T41A 4MUAA 4OXYA 2FRDC 3N2LA 3WLIA 2QUKA 2GZHA 1TA9A 1UWKA 4CQMD 5BRAA 2PNFA 1CUZA 1YRYE 1SBCA 5HI7A 5K0FA 3EEOA 1EXDA 5DW0A 3D6MA 3AZQA 5T41A 1VYUA 5SYMA 2WFMA 2AOUA 1NP3A 1CJBA 1T10A 1J2JA 4B6RA 2HCRA 5T5QA 2F2TA 4PRLA 4UAVA 5KNHD 1QVWA 1V16B 3G0GA 3OCJA 4BP3A 3JARA 3NJ8A 4TL7A 5EPUA 4C4SA 3HY3A 5IC4A 2PT9A 1ZEJA 4YTEA 4ZRDA 3QSYA 4MUJA 4UJ5A 2VWPA 2W6CX 3AEUB 4CQLA 4YDQA 1K7CA 4Z0NA 2HKIA 4MUFA 5AHRA 4M0PA 4ZMSA 3WIUA 5M29A 1LTQA 1V1MB 5KYUA 5AKZA 2C2MA 1HDCA 2K4MA 3IP7A 2JHAA 4PHFA 4E32A 2WXGA 1L8AA 3JPWA 4BTLA 2QN6A 2BZ1A 3E7PA 4LUCA 5D6OA 4F45A 4JI1B 1R37A 1RZ3A 2BY4A 2Q4TA 4FXPA 2X5HA 1BCSA 5FNVA 3GT4A 4B45A 1B7GO 2RGNC 1N4SA 3EWAA 4TXRA 1UKAA 1VE6A 1RCFA 5EEGA 2CVPA 2GEBA 3O38A 3PLAE 2X2OA 2NQ8A 2FJAB 3UAYA 3ABZA 2QOEA 2ZWOA 5FJJA 5KYNA 2XCCA 3VH3A 2CZQA 3FMGA 4EITA 4EKEA 2X7JA 4LWPA 1D6NA 3AB7A 2WFLB 1QTRA 4JGIA 4JI6B 4BHTA 4BBJA 2W2KB 4YPVA 4AECA 1Z6ZA 4P83A 3T5GA 2QRVA 4DY6A 3UXGA 3FCYA 3KSZO 3LUHA 4F2HA 5E9QA 2NXNA 2QR3A 4OGFA 2NO7A 3OE7A 1K06A 1KJ8A 2JJ2A 2HMYB 3W06A 5FKJA 3T9DA 3ILSA 4ANWA 5A0VA 1NQTA 4PVCA 2WAMA 4JY7A 4BY6A 3QLTA 3DNFA 4QOSA 2O7QA 1Q74A 1P5QA 1ELKA 1A04A 1MJFA 2VOEA 3GPIA 4M8KA 5ALSA 5H80A 4S1PA 3W3AD 2FFGA 2ONKA 4BP9A 5K3OA 1MX5A 1T8TA 2R44A 1XL0A 1TZKA 1HDGO 1ZGJA 5SICE 1NKTA 4B0PA 2H6GA 1N9KA 1R5JA 2A94A 3KLBA 3LHKA 3O2JA 3ZOZA 1TECE 3B7SA 1UMKA 1NL3A 4V3CA 4XQCA 3UKJA 2R0QC 2C31A 4QTXA 3MILA 5EXEA 4WY8A 1T6YA 1FDOA 2W0SA 3JYHA 4DI3A 1QP8A 3R6TA 1PFUA 3JR7A 4OK6A 4YAJA 4D8TA 4EWLA 4MB6A 1UWVA 1ULUA 1ZYUA 4X94A 2Z4RA 4EG1A 5KMGA 3SCZA 2E6KA 2FWMX 1T2EA 2X4GA 2BI7A 1AD2A 1SKAA 2ZYHA 3MM4A 5BO5A 3VPXA 1Q17A 1Z4IA 4A6DA 4B6SA 3S5UA 4L5YA 3Q4AB 4NU8X 3RVLA 4YCAA 4JVMA 2NACA 3T8MA 4FMCB 2AF3C 3OIWA 4FA6A 5CYOA 1YSCA 4Y98A 3TKAA 3CRQA 2Z6UA 3LS8A 1XU9A 4OU5A 4RAQA 3UJ3X 5CA1A 1APBA 3U1BA 4I3FA 1R6XA 3ISVA 1EINA 4DLYA 2FGJA 1TPZA 2OYSA 2WVAA 2R79A 3PLRA 1KEKA 3CRRA 2GXUA 4ZYTA 3G85A 4O1MA 4CLHA 4L8GA 4EY6A 1ABEA 1JDVA 1IZ9A 2X1LA 1TKBA 1G8HA 1ORTA 1ORDA 3CZCA 5HFJA 4TKUA 1JWLA 2FJPA 4LJSA 4BC1A 4DCTA 2OFXA 4LOJA 4WNCA 2NXPA 3QLUA 3J7AC 1WMDA 4F0JA 4YIHA 3H2IA 4C30A 3ZRHA 3HG7A 2ZJ1A 4I4CA 3OXLA 1GCUA 1S63A 3CGHA 1TW2A 1C0EA 2FKAA 2GASA 3CZRA 3CUUA 2HNAA 1W9HA 3EJWA 3GUVA 2FZLA 2VDWA 3L49A 1VGQA 2QVLA 2C9DA 3PQ4A 1SCNE 2Z04A 2H4FA 1I2MA 3TX6A 2ONYA 3UI2A 2WTBA 1MH1A 5KNDD 5CEJA 5ABPA 3CE9A 4GLBA 4PE5B 4G4SP 4O60A 3IHYA 1Y0BA 2WJ4A 2XKJE 1II9A 3C0KA 3E5NA 2H4XA 3EXHA 3IMFA 4K9NA 4BYMA 1Z2PX 4IEIA 3SIRA 3VR6A 3JQBC 1AM4D 1RPTA 1DIOB 1QUFA 1S9HA 2O1WA 3O7WA 1SHUX 1GSAA 2JD0A 2Z56A 4FSXA 1GJRA 5DMHA 1WDMA 1REQA 3ZHVA 4KMSA 4MCAA 4RKWA 1BTOA 4R68A 1SKUA 1N9ZA 4CJXA 4HPXB 2X40A 3QLVA 4O5OA 2D06A 4AJEA 4HXGA 1FQWA 1LW7A 1BXGA 2NO5A 5AAOA 2WTAA 3AAAC 3M4JA 1MTOA 3AJ8A 2FMKA 3KZNA 4KV9A 5IJZA 5SY9A 2DP4E 3DAPA 4IDEA 4R81A 1L8QA 2DXIA 1HLDA 1YB7A 2A4MA 5CA1B 5GGYA 4Z51A 2GHIA 1ZI9A 2FSSA 3PEFA 2ZJ4A 3QWFA 5E3HA 4RKYA 4J2OA 3HZRA 2ZK7A 3GG2A 3MWEB 5KNCD 1PR5A 4K9OA 2A1TS 4J8FA 4MYHA 4RVDA 1OBCA 2C4MA 3EPJA 3KQLA 4BVFA 2P9CA 4KFCA 3QRWA 5AYWD 1V8BA 1XP5A 2HRBA 3IBFA 1CR2A 4H2DA 5BXUA 1F4VA 1GCOA 1I13A 3O21A 3HNPA 4O1OA 1OBFO 1OUMA 1R9MA 3RE1A 2RGUA 1LK0A 4YCSA 1BE1A 1T0UA 2GBPA 3LJ3A 2HWXA 3PXAA 4GKAA 4FSDA 4JB3A 3ROXA 1YRBA 3PENA 3SDZA 3A1NA 3ZBPA 4BB6A 4BNLA 1YDFA 4JI4B 5FQ8A 1WZIA 2ONCA 1WAO1 1FDWA 1WZNA 1EA7A 3KDAA 1SULA 2H5IA 4JJAA 2CDCA 4UAGA 3C3OA 2VK4A 3H9CA 5EWMA 1CJMA 5KB3A 3ZVNA 1PT5A 5B7PA 4GPAA 4Y8VA 3P7MA 4XIFA 1U0BB 1DGQA 5I7HA 1AS3A 3S8MA 1Z5NA 4PM4A 2VDKB 3E1GA 5JYDA 1SIUA 5K0CA 4DOMA 5IT9A 2WWGA 2EWVA 3LBNA 4WL0A 3C6ZA 4L5BA 3FTFA 1RE0A 4WWPA 1J20A 3WL8A 1KZYC 3AI7A 3P0JA 1N4PA 2F6RA 1U3TA 1FFAA 2CCGA 3BJZA 4AJNA 2GLUA 3DZHA 4LXGA 4QOJA 2XS1A 4EHJA 1TM4E 2N0SA 3OOYA 1K8RA 2P78A 1MH9A 3OF3A 3OBBA 4W1SA 3IVGA 5CX4A 3WKBA 1N77A 4MIEA 3QAQA 2WNSA 3MWDA 4DJ5X 4JHRA 1NTRA 4NFLA 3GVXA 2VP3A 5IYZA 3CVJA 2PCJA 3GEBA 4LE2A 4OU4A 4HBGA 4JT4A 2BM0A 1R6TA 3EOZA 4WINA 4YO7A 3MT0A 2OFWA 2LSUA 1PJRA 2CVHA 2QHXA 4IO1A 5I8ZA 1L4YA 5HF5A 4D4LA 1RHJA 1X94A 2PQ6A 3TXYA 1ZNQO 3H4TA 3G7UA 1DCKA 3VDQA 5JISA 5FWAA 4B94A 2PZFA 2BFDB 1UXKA 1V3QE 5F2KA 1E63A 1SCUB 4DAEA 4I5FA 2BGWA 2DR2A 2I71A 2YINA 3EEFA 1M1XB 2HV8A 2LNIA 1YCHA 4ANUA 2D2XA 4MRNA 3RRMB 2JFHA 1C3XA 2YYSA 1OUVA 4U0JA 5D3QA 1Y3HA 3GFFA 1XJQA 4I9CA 2WJWA 1USIA 1P7ZA 5LP0A 4QQIA 1JBKA 1NRIA 1V5IA 5KQRA 3JV7A 3HDYA 3L05A 2CY0A 2YFKA 1HDZA 1ZD2P 2YVUA 2O2IA 2EQBA 5B7GA 2CUNA 1CVRA 1GKYA 1LPSA 2PZBA 2VT2A 5JMTA 3FKJA 3PBKA 4JNKA 1ZGHA 3F3SA 3T5CA 2PVSA 3IX7A 2CLDX 1U8ZA 1ZI8A 5FFFA 5TC4A 4UUPA 2JA2A 1KWGA 2ZJAA 2XZOA 3TG4A 1PFQA 4UHKA 2AZDA 2CL7X 4QU0A 2PPLA 1UEJA 2AF4C 1FDSA 3W7AA 3NDPA 3A1FA 1FXUA 1K68A 3FNFA 4FDLA 4QPCA 1DAFA 5EZYB 3BBPA 2HJHA 5KNDA 1W25A 3ENNA 3R3YA 3O8QA 1HE2A 2JG3A 1CY8A 4DMFA 5CCEA 3R6DA 1MGPA 2UUAB 2DZDA 3X3HA 4ZQBA 1K8KG 1HNNA 4JB0A 4N5HX 1QIHA 3V80A 4ZYWA 4IIYA 3CEJA 4B3RB 2W2PA 2ZSKA 4AVYA 1U7WA 4FGZA 4MP8A 1O77A 2QS9A 2YY5A 3IO5A 4YJDA 4AC9A 3U2QA 3NW9A 4K5QA 3RUFA 1QQAA 3IKTA 3FGNA 3PZ2A 2JNWA 3R44A 4MLDA 4DR4B 3AXTA 1BD4A 2J46A 4F8EA 3CWZA 2J8SD 3QEMA 3QYAA 3S2FA 2IPMA 4CQMB 3N8HA 2AH5A 4S1NA 3T3MB 5ICCA 4FFDA 3AJDA 1NQOA 3S3TA 3T7JA 4MWOA 1P1IA 4Q00A 5L6LB 1FYWA 1S3IA 2Z1NA 5FPHA 1B2LA 4WCFC 4DUPA 1HFJA 2YXBA 2AOTA 5IULC 1AHHA 4X8LA 1M2GA 1RXIA 2PZ8A 3GUCA 3R3ZA 3FPKA 3VVMA 5F23A 1WF3A 2G1JA 4MEBA 1N1DA 5CG1A 4Q34A 4RE5A 5MGBA 2C07A 3B13A 3NXKA 2XJ9A 3ISJA 2MRIA 2WXFA 3RKSA 3AF6A 5DE3A 5TY0A 4MW9A 1VKJA 3B60A 2XV1A 3FW1A 4BT9A 2QM8A 4YXWA 4YMTA 4GZDA 4X65B 4JVSA 2ID9A 1FS5A 2JCXA 4KZCA 2VT6A 4M99A 2HL6A 2I4NA 1UZLA 3B3FA 3KEQA 3PQ6A 2ZBEA 4GBJA 4HS9A 5KX5F 2ODPA 3WR5A 4Y9TA 4AURA 1I3MA 3TLCA 3SZLA 4AM9A 1Q2XA 1S5PA 3M9WA 4AMZA 1P29A 3T1TA 2O5RA 3EXEA 1AN9A 1ZWLA 2GEVA 1VE5A 1OYVA 2JFOA 1TUIA 2LWIA 2RHGB 3SQMA 3LY9A 1Z15A 2Q3EA 3L0YA 3OM1A 1L5ZA 5EYLA 3OPMA 4ROSA 3X1JA 4JXZA 2R17C 1QR6A 3L0SA 3L6CA 3KD7A 1Z3YA 1TVMA 3TNFA 5GM1A 3P2KA 4WPGA 5EIWA 1BFDA 4LBVA 1E7SA 2CXTA 2JJ2D 3OFNA 4U2EA 5DX1A 4ZEOA 2FKNA 1UKCA 2E85A 5EIOA 3BGVA 1NXWA 1XNHA 1DQYA 3BJEA 1FSFA 3WOVA 3HYLA 4X63A 1COWA 2QRGA 4HCJA 5B12A 1HDYA 4RJKA 4EGAA 3OY2A 2G08A 4ZQCB 5TEVA 3ZDDA 1NVUQ 3P2BA 4MUNA 2GFQA 1XWWA 3WK4A 3CVXA 1T34A 4RVHA 5HCUA 1XA4A 5JDCA 1MCZA 1P45A 5E6RA 2QAIA 1XOIA 1ZCAA 2FQYA 1FFGA 2O2YA 3GC6A 4HGRA 4Z9AA 4F96A 4C7OA 1JR4A 2B78A 1K3ZD 1EU1A 5EEHA 1JEDA 1XZIA 3RRYA 1OASA 3VOBA 4KE8A 3U1TA 5K6AC 3WMRA 4Z7JA 4UQYA 3EBPA 5TJ9A 1GXSA 3TWQA 2C2WA 5DTJA 2V7UA 3G2UA 4CXMA 1D6SA 3DEIA 5BNIA 1XDZA 2D2FA 2WU3A 1YR8A 4LPKA 3D6NB 4I4IA 4ISCA 4LISA 2N9UA 4MW5A 4EAQA 3MN1A 5JD6A 1IVSA 2FN4A 4RD4A 1EWQA 5C8YA 1WZ2A 1E66A 1S2IA 1VLMA 5A4DA 5JLJA 3U56A 3ZCTA 4MI3A 4WZBE 2VH1A 4RQTA 1JNZB 2MYTA 2SCUB 2Q5IA 4Y6SA 4QTTB 3KLMX 1G2QA 1UIMA 1HBJA 1H66A 5FB3A 1JFRA 1U7TA 1KFBB 1YI1A 1XLTA 1XQ9A 2C88A 2GAAA 2XE4A 1F1BA 4UZFA 1FTSA 1BQEA 2JCYA 5EINA 3WA7A 4CUKA 1CE8A 3HU3A 4E5MA 4F2GA 1NN0A 2P2CP 3PFKA 3LDUA 4KYUA 4TWZA 1NXPA 3K70D 2AC7A 4EKIA 1COWD 2QNRA 1JQDA 4FGUA 1XK6A 4XOUA 3CR8A 3NF1A 3N87A 4K5AB 4Q9HA 2CNDA 1PQUA 5JS7A 1L8XA 1JIVA 2HD4A 2NO1A 2YNMC 1DPGA 3VZSA 4FGSA 2KBFA 2PZIA 2PGDA 4PG5A 4W9MC 5G53C 4MVYA 4O2AF 4WKPA 2FF5A 4MW0A 4IDCA 1MC4A 4KVOA 3MZLB 3FNBA 4AROA 1SXJE 4BFLA 4QM6A 4Y6RA 4M55A 2GYUA 3ROFA 1PGNA 3PHHA 4FJYA 5H81A 3KPJA 3P4YA 2WOOA 3NAGA 4FYKA 3JQ9A 4XASA 4ISBA 1YS7A 1Z4JA 5A1TA 2J9RA 4L3OA 4WXEA 3ZNGA 3SNKA 1YR6A 2IKQA 2C4HA 3M1YA 2DZNA 1LQTA 4WW0A 3ZZNA 3UCFA 4QUHA 5ILGA 4LE0A 4RTQA 4BSZB 2DKOA 3RF7A 1FFXB 3ITWA 2OL4A 1RHMA 3F5DA 3A1WA 4GWGA 2RHDA 2ZI9A 4NK4A 3NTUA 3UVEA 5JEDA 1Z0DA 4G5XA 2XYHA 4Z3KA 1YBFA 3PWKA 4YALA 5IM4F 3I5XA 4EZEA 3FHLA 4LOLA 1A1VA 3AWDA 5LJLA 4NOMA 1MO4A 5K3SA 3MQFA 3EZYA 1S3SA 1DI0A 3O8LA 2D0IA 3UY4A 1OOEA 4BUZA 5BN1A 3FI9A 1PJAA 2ZRQA 1ZLXA 5J58A 3S2ZA 3NGXA 1INLA 4CLEA 3T9BA 4YNBA 4FHCA 1YBVA 1TNOA 4WZBB 3OA0A 3DM5A 3N2KB 4C0HA 1M8PA 1ZJYA 2XADA 2K4NA 3AEKB 1PS9A 2WUDA 4HPJB 4X8HA 3NYRA 3S1LA 2CLEB 4MV7A 4DSTA 2VOJA 3T1YB 3WGTA 2ZZNA 1G5QA 2YHAA 2F64A 4Q7EA 3QPUA 1Y1SA 2VYNA 3ZXSA 4ZOBA 3A1VA 3HLTA 3GAFA 4D5EA 3THSA 1B8VA 4BKPA 4LNHA 3KVRA 4R83A 4URHA 1VBFA 3QB2A 1SURA 3FD8A 1KK0A 4G9BA 4KQKA 4OL0A 4F60A 1IYGA 3VKHA 4KQ9A 3TIFA 2C92A 4TMWA 2IFTA 5ALWA 1CUSA 2OB2A 4R9VA 5H4HA 4NYMR 1HNZB 4LG6A 2ZW9A 3G8DA 5JYCA 1KZ1A 4L7VA 1L4LA 4Z53A 3LLMA 4I5EA 1TM3E 3VO2A 4AEZC 3WB0A 3U09A 2ZYWX 3D43A 5CBOA 3LXRA 4KBFA 5AQEA 3VR0A 1AT1A 1NJGA 4NQZA 4EHBA 5L8VA 3U7HB 2VJYA 1RI3A 2ZYUX 4YBRA 4KZ0A 1ZRNA 2WJZB 5FOVA 3SNHA 3ET5A 1JX6A 5IU6A 2W11A 3GLRA 1WDLA 4KYTA 1X1DA 3HDGA 1HH4A 1G7CA 4W8GA 1PQPA 3IQGX 4N65A 4XKBA 3IB6A 4DX7D 1KI9A 2XT6A 5LP6F 4I9GA 5LP6B 4O02B 5EJGA 3JS5A 1MRSA 1TAHA 3PNPA 3G8YA 2WWVD 3QKRB 3R5KA 4DCOA 1OH5A 5K3DA 3OT5A 4FEEA 5GTDA 2A4KA 2IU6A 2OKGA 2ZR8A 4K6OA 3VXKA 4E2YA 2IY7A 2CXHA 3REGA 2JAHA 3GUUA 1NZDA 2VA9A 4YJGB 5CLLA 5CYGA 3CR3A 2RGNA 2B1GA 3CWQA 3JQ8A 4RU1A 3MJDA 4YAFA 4B7UA 4CGYA 2KM1A 3QA9A 4EUFA 1K63A 2V6GA 3H2SA 4TRJA 4N0QA 3MNFA 3RRMA 1BYUA 1T0IA 2K87A 2VC2B 2YY6A 3OE1A 4ARUA 1KI6B 3LP5A 4BS9A 3BOSA 2E21A 3ADOA 3WRXA 2KM4A 4XWTA 3OX2A 1XU4A 1YZGA 2BFDA 1Q11A 2W4MA 4MQMA 4XM1A 3SHTA 5K45A 1CUIA 1ZC4A 4ALNA 3H2BA 1WBJB 2AXUA 3TECE 1JL3A 1I10A 1MN6A 3J5PA 3CO0S 3MRTA 2XNKA 3PCXA 2GN0A 2Z1MA 3IDQA 1ZK1A 1P8JA 3BEEA 1E8XA 1KFCB 2BFBA 3VGPA 4C6HA 5TSDA 2JS7A 4U96D 1BX0A 3HYNA 5B2FA 1MW9X 3OQHA 5F2NA 4E4TA 4C0WA 1ORVA 3FJOA 1HKHA 1OIXA 2YJZA 2B98A 5GJCA 3FY4A 2V7XA 3QBVA 3S2IA 4RV9A 5FNZA 1HF3A 1GFWA 2O0LA 4FFBA 4JC8A 2PZGA 3EU5A 2GJ9A 3VVBA 2H1FA 1ST2A 5DT2A 1OMOA 4JWTA 2H7CA 2WWFA 3EH2A 1WMEA 5EN4A 4ZU6X 4GX1A 3OCYA 4FOOA 2VDOB 2B1RA 2PMKA 5J4KA 2YIDA 2HNKA 4J0KA 3HJHA 4ZMRA 4OV6B 2ZETA 3PUKA 2VLIA 3FZGA 3CPEA 1BD8A 1BU9A 3R6GA 4PO9A 2W9XA 4K9LA 3RRNB 1ETHA 1V7QA 3C3JA 2C1ZA 3EGEA 2OK7A 5U4QA 2DE0X 1GQYA 2IT1A 5AHXA 5ALHA 1YZ3A 1KOLA 2D2EA 1W1UA 2OAP1 1E58A 3MJVA 4V0LA 4MIOA 4I5GA 4ZC8A 2CK3A 1K6IA 4WNAA 2R66A 3IELA 4OQQA 2AE1A 3BRQA 4H08A 4UCWA 4M3OA 1FFCA 3PREA 3VQTA 3ZI0A 3A4IA 2RG1A 4XTRA 4I1VA 2ZT8A 1Q0RA 3D3MA 3AJ9A 2QGNA 2YXPX 1X7XA 3GCZA 1VCIA 3KWLA 4RMJA 4DA0A 3JRXA 4QPZA 5HQTA 4AY3A 2IDMA 3LO8A 1YXMA 4QQFA 3C8DA 1VGRA 3PJEA 1SCDA 2AIRA 3LX8A 4WD3A 4D46A 4TWRA 4ZAFA 5C8VA 1SMKA 3S7ZA 2Y68A 3JAWA 2DK6A 3IMCA 2B9EA 2WJ6A 4GPD1 4RDHA 5DBHX 2DQYA 2PL3A 4FULA 4G63A 4E70A 1PS0A 2O19A 2VQFB 3NBNB 1LQ2A 2DPYA 5HM8A 3KQOA 3IV0A 2GM9A 2J9XB 1XCLA 4HVTA 4TMFA 1XEAA 3U4HA 3T0FA 4YR7A 4HWKA 5JSZB 2Q5OA 5IBCA 2FG5A 1BN7A 5KTOA 3OZCA 1HLPA 5LDHA 3HXCA 1TDJA 4GLJA 1XDSA 4EQ6A 1IC6A 2EZ4A 2I2BA 4J16A 5C0OE 3S7DA 3D9LA 3EXHB 5HPYB 5ECWA 5ICSA 3VCXA 4WE3A 4C08A 4OAUC 1GPDG 3AF1A 1IONA 3QP9A 4EL5A 3SK0A 3O1JC 1U7DA 1Z5GA 2ORIA 4M4SA 1KY4A 2QUZA 1E77A 1EWKA 3BU8A 1BA3A 1CZKA 4PONA 2Y9MB 1O9GA 2AWOA 3PC7A 4KMOA 5AT1A 4NC9A 3WLNA 4HUTA 1L2TA 1GCAA 1XTIA 3LP6A 2YJTD 2PHZA 3BG5A 4GH5A 2QTVB 4MKZA 5FTPA 1T25A 1M75A 2SKEA 3AJAA 3G2JA 4XUDA 5T4FA 5BN4A 2H2IA 1VHLA 4QECA 1U6JA 5KVQA 1FRZA 1M2WA 5CVJA 3DZGA 2H51A 3PDNA 1VL5A 3PRYA 4Q4HA 3LIPA 4YRJA 5A9TA 4IR7A 1N33B 3B7BA 4Z86A 2HSJA 4EOGA 3STWA 4C4OA 4NE2A 2ZYAA 5TMDA 1EHYA 3FH8A 5ULLA 2V3VA 4Q05A 1S1CA 2I7DA 5EVCA 2EWWA 3NBQA 2VJMA 3ANNA 2FQWA 2REQA 3EAFA 3ZJTA 1XTSA 1TLLA 1JALA 1IHUA 3KAEA 1X4RA 1MC5A 2XT9A 3EIUA 2I87A 4M0UA 3TSAA 4M87A 5EIEA 4DMMA 1RCUA 2UZAA 3AERB 3O83A 3FCOA 3V2XA 2PM7A 3PEVA 1TN8A 5EIFA 4BB9A 5C4IA 1EYHA 2PKQP 5AK3A 1VKRA 3LQ2A 2A30A 2QM7A 3SOZA 3IALA 3ULKA 1TZ2A 4ZHQB 1L5FA 1A50B 2LUOA 4ZYZA 1JGTA 3GUHA 4U8YD 2C4WA 2QU8A 3H0EA 3T4EA 4OTZA 2IXGA 4PYQA 3FYSA 2OQIA 1Y5MA 1Q0ZA 1VZ3A 2JDID 3K9WA 3KUUA 3T3EA 1YAJA 1AZTA 3D1VA 4GZMA 1N3LA 4HZUA 5AW4A 1XSEA 3P0RA 3QDNA 1BGVA 1PJ2A 4OB7A 1FTWA 2AHOA 4HRAA 2NO4A 1SU8A 4M8IA 4DLAA 1HU3A 1X8LA 3NHUA 4LGCA 1E3IA 1UJBA 3OCUA 3DZ8A 1OXKB 4IHKA 4KRYA 2RH4A 4LJKA 5TF4A 3ICQB 1EXMA 2YCBA 1A97A 3DPYA 1VRWA 4UNPA 1XPUA 4FN4A 5A06A 2RHOA 3M82A 3BT3A 2PUWA 4OSOA 4R3WA 1GW6A 1ENZA 3S5JA 1EM6A 2ZAGA 4FW9A 3EEBA 1W7AA 5AM4A 4R71A 1S96A 2TRSB 2PGAA 3H42B 1HA3A 2IYLD 4NG4A 3WSWA 3TRHA 2Z4TA 4ZQIA 4EPZA 2Y1LE 3ZY2A 5DWQA 3E7FA 2FX3A 1HE8A 2GN1A 3Q75A 1U9JA 3OG9A 3TKYA 2O23A 3Q85A 1Z5VA 4ZYUA 2ECQA 4Q1VA 1GG2A 3UJPA 3G2IA 1HKUA 3LOUA 3IXQA 1NW9B 4FFRA 4J8PA 4UREA 3HK2A 4Y6CA 1F2VA 3QJGA 1NZJA 4IHQA 2OCAA 4WQMA 3QENA 1XDGA 2ZBVA 2AFHB 1ZVVA 4PX9A 4DRZA 2P9EA 1DZ3A 3C87A 3UMFA 2J3IA 1KJ9A 4B3DA 3L6BA 4F4DA 1MKYA 1BMFD 2GZRA 4KWEA 1IN5A 4DZZA 4R5MA 4KMMA 1YFKA 3M70A 4HFJA 2BFAA 1HORA 1MT0A 2WVJA 2X0FA 3VR5D 3DNPA 3GT0A 1CUWA 1E9VA 1SUBA 2FF7A 1T2DA 4KC0A 4WH0A 5IVDA 3UK2A 5B36A 3EISA 4DJFC 3U64A 3HKEB 3RAPR 4KZPA 7MHTA 2V5UA 4UWFA 3I23A 5I7VA 2HU8A 2NPOA 1XNQB 5ALLA 3T7RA 3ZWBA 4C6TA 4ZK6A 1SQ6A 3CKMA 1Q0HA 2VSOE 2WE7A 4XAQA 5EE3A 4ZAVA 4FMDB 1SUPA 5FR1A 3UAZA 4DV6B 2YRXA 4GE3A 1CUEA 1WKCA 5LD2B 3T7IA 3CVLA 4QKQA 4CIAA 1NSTA 3BFVA 2DVWA 1EX6A 4E4YA 1QPBA 1PZFA 3QOYA 5F1YA 4Q7QA 4CIXA 3KS9A 5AIBA 5F5NA 1U3CA 3DFUA 2QY7A 1KMIY 1EVJA 2AG1A 3DWFA 4HMQA 5AKLA 2DCPA 4MKTA 3SKXA 5TLSA 1T4MA 4LOAA 1AQLA 1BA2A 1QUEA 1YUNA 3CW9A 4U95D 3QF4A 3BXHA 5IAJA 1T2NA 4JEMA 3CF4G 1JDZA 1LDBA 1QQBA 2IPLA 2I8AA 4GICA 1WU7A 4O2RA 1Y3AA 5DHTA 3BORA 5EFZA 3AR3A 5FPPA 4Z0HO 2A9OA 2IY8A 2UVPB 3EF0A 3WIDA 1X86B 3BMQB 1EK0A 4CEIB 5IVPA 4GTQA 2YZMA 2PANA 4CZ2D 3W2IA 3CVVA 1MXFA 1ZY2A 1JPLA 4FLHA 3INRA 3KHTA 4RC9A 3OQBA 5TPWA 2BMWA 5JQGF 1R6VA 1M6VA 4P08A 4U9IS 2QB5A 4E2XA 3CNEA 4R6WA 4ZVLA 2HF2A 5DW3A 3MWLA 1BEZA 1E7RA 1QFJA 3ZLUA 5EJ6A 5IM4A 3S2AA 3L7CA 3PRKE 2WSBA 4NARA 5JXGA 2J3HA 4CR6A 1C7QA 1Z7BA 3ASUA 3PD1A 4IF4A 4HYTA 4DHEA 5A2QA 4JL8A 4HLCA 4J4BA 1YJ8A 2XS8A 1L7XA 5HIKA 4FFPA 4P5DA 4HNSA 5ADWA 2QAJA 1YMVA 4QASA 3O4GA 4HEHA 1SHTX 4HFNA 4BIMA 5CUQA 4NMXB 3PE3A 4EFKA 3ER9A 5CLGA 1YCFA 1EZ1A 4MKXA 5TMEA 1NE2A 4E07A 2P4HX 5DOZA 4B6EA 2B8EA 2ZYRA 1M7GA 1N9GB 5K09A 1WXEA 2XXJA 3ABSB 3AP3A 3BA1A 2NNLD 2IYTA 3H4MA 5GJVC 3VO8A 1NGSA 4ZA2A 1NXQA 2IEYA 2D59A 4N8EA 3RC2A 5C1BA 4K81B 1E4EA 2ZRCA 5JSFA 2B4YA 3OETA 3VJLA 3H4IA 1D07A 1BU5A 3H9BA 5FO0A 2WM3A 5GV8A 3F4LA 2I2CA 5DM60 1Q1ZA 2QJFA 4QOFA 3PHLA 4YGXB 4P8RA 4RELA 4MQ5A 4DIMA 2NVBA 3K5IA 1L5MA 4MKHA 4G0YA 4JQOA 4ML3A 3O74A 1ZL2A 4MUBA 2WU8A 4WK0B 3U3ZA 2DC1A 3L0PA 1DKRA 5IUJC 4X92A 3U26A 4WLNA 3DMFA 5AW8A 4JLSA 2OC4A 3T5TA 3CF4A 3R5JA 4NCJA 4D02A 4A6XA 3G13A 1DC5A 2ZGVA 4KX3A 3GLSA 4BNTA 4N5QA 4O59O 2PTHA 2OGSA 3HXTA 1GDHA 3NHMA 2P9GA 1BU8A 1J23A 1VBMA 3D8TA 3FIUA 13PKA 3LSYA 3ESYA 1T1RA 2XKBA 3L8YA 1E0DA 5KINB 5F2OA 1A9XA 1A4RA 3GI1A 4LJ5A 1T2UA 2ZUVA 5AI8A 3D3QA 3SZ7A 3AI1A 4NCAA 1ELOA 1EVLA 2ATEA 3PS9A 3AF5A 3NZUA 4NTZA 5FBWB 3H84A 1D6MA 1JSCA 3CX7A 2W2XA 3MWYW 3PSAA 3AL2A 3AWIA 5AXDA 1XFDA 5FUQA 2X4IA 5C5EA 4TWAA 2CLIB 3F3MA 4NMLA 1E8ZA 1RQNA 1Z5PA 1MB4A 3E03A 3QEJA 3L1UA 2VF5X 2NXEA 2X77A 1MF7A 3O8OB 1VCOA 4WWNA 3LL4A 3MVEA 3U3JA 4AS1A 1WJGA 1E5XA 1E6EA 2YQ5A 1EHCA 1B8NA 2O6LA 2QA5A 2O8BB 2COEA 16PKA 3RGWS 3S1AB 3TQFA 4CG2A 1DLIA 1SIOA 1WM1A 1GG8A 3PNBA 1QMPA 2PUJA 1BI7B 2FVYA 3H9GA 2ZVJA 4K87A 5FFMA 1PL7A 3PFGA 3ZU2A 4MCJA 3WGUA 5FWNA 3KO8A 4PYOA 4BLRA 4ZALA 4GT1A 4L6IA 4UQPA 4K28A 1OA0A 1IB6A 2CB9A 4Q21A 2D5LA 1DU4A 2ZIXB 1BS2A 1KNXA 5ENOD 1QAMA 3B9PA 4UE3S 5AKKA 1E2PA 1SVWA 2J85A 2O0MA 3BCSA 4B32A 1KFKB 5K0SA 2SKCA 3EUVA 4QXQA 3ASVA 3ZYLA 4YQEA 2DPHA 3K0AA 3T1OA 2EWMA 2VL7A 4MDEA 4IDQA 3UMYA 5BP7A 4HS2A 3Q15A 1GGNA 1YRHA 2TECE 3ELYA 1N4DA 3F0TA 3FTCA 5DXAA 3CHQA 4WOJA 4KR0A 2H59A 3R3VA 4E31A 3NUGA 4LV5B 3K6JA 1NVTA 2IITA 4KV7A 5HUJA 5ADUS 1W85A 3R7LA 2OBXA 2ZB7A 3FMIA 3OC0A 4V24A 1ZMOA 3WJ7A 3GFBA 1IQ0A 1DRWA 2QIPA 1P0IA 2D8AA 1RBZA 1DC3A 3A10A 4PHGA 1R7RA 1MYOA 5DXFA 1ZBPA 3ZDRA 5JCXA 2XCUA 2OGTA 3B1JA 3QWVA 5DDIP 2J4FA 1PFWA 1QMGA 2BFCA 2FEWB 2NZUG 4PTLA 4BFRA 3SJUA 4BNJA 2Y1OA 4BNVA 3WLJA