4GYYA

Crystal structure of human o-glcnac transferase with udp-5sglcnac and a peptide substrate
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
715
structure length
693
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFHIYDNRIVLNGIDLKAFLDSLPDVKIVNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
total genus 274
structure length 693
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gyyA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gyyA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gyyA03
2FI7A 5LCWJ 2VGXA 3NP9A 1L5QA 1GGNA 2H1FA 4J8FA 1XV5A 1PN3A 4Z5XA 2HYZA 1XNFA 4CGWA 3NB0A 3ZGQA 2GJ4A 2F3QA 5LQDA 4WNGA 1O6CA 4RBNA 3ULQA 1FTYA 4XI9A 4U0ZA 3MKRA 2H1HA 3G2JA 1NZDA 3IA7A 3VTXA 4AM9A 1KTIA 2IW1A 2PQRA 1UQTA 1LWOA 2PRJA 3PDNA 3KAEA 1LWNA 3MTBA 3R9AB 3ASHA 2NC9A 1E4OA 3SYRA 4G24A 2GT1A 1HXIA 3MS4A 3ESKA 3CK7A 4RG9A 3RJVA 3BCUA 2R68A 4XI0A 1FTQA 4G23A 2G9QA 2WTXA 4QLBA 5JJ7A 3Q3IA 4BQIA 1NA3A 5JJTA 3IEGA 4GPKA 2X0FA 2PQNA 1Z6QA 1Y8MA 3WAGA 2PYIA 4AMBA 2ZB2A 3S29A 5BNWA 2PQ6A 4ABNA 5KJKA 2YHCA 1A17A 3MS2A 3RSZA 2HR2A 3CVLA 4H7XA 5D00A 2L6JA 4G2VA 4HOUA 1WW3A 3ASFA 1FU4A 4WNFA 3RT1A 4EL0A 2FETA 1WV1A 3E3NA 3AS8A 3TOVA 3VUFA 4NEQA 1L5WA 3E3OA 5IKOA 4HOTA 3G2IA 3ASGA 5TMBA 4RIHA 5TMEA 2PL2A 3OXFA 1P2GA 4APOA 4U07A 3E4BA 3CK9A 1W3BA 1F0KA 3OY2A 3CEHA 4BQEA 4JA9A 3CUVA 5DU2A 4CDRA 3SZ7A 3KS2A 2QRGA 2PZIA 1GZ5A 4KQMA 4HLNA 4AY5A 2UWJG 4F3VA 2QLLA 2QLNA 2E2EA 4GPBA 4J0UA 4WADA 5BW8C 1Y6FA 3WADA 5JTUA 1QZ2A 1ELWA 5C1DA 3OXLA 9GPBA 1P4GA 2X6RA 4KQ2A 1YA6A 3MTAA 3MBOA 1QM5A 3OKPA 4AIFA 2R66A 2X6QA 3ZCPA 3QDNA 2VCHA 3RKVA 1FCHA 4RG6A 1NLMA 4RELA 2FEZA 1JEJA 1V4VA 4WNDA 3MT9A 2G9UA 5GPBA 3H4IA 4WUYA 3LYAA 2QN7A 2VCEA 2G9RA 3SF4A 3ZCSA 4UI9C 2ACWA 4X7MA 5G05J 2J9QA 1L6IA 2QRHA 2O6LA 2GM9A 2ECPA 5DLDA 4N3AA 4EQFA 1GFZA 2VGYA 2QN1A 5KJMA 3Q3HA 3MT7A 2X0EA 4JL0A 5LCWC 3HBJA 3T7DA 3MRVA 4JA7A 3T3GA 2P58C 2R5SA 4I2ZA 2ACVA 3TGOA 3UQ3A 3DD1A 4LEUA 4X7PA 4AN4A 3LY7A 3QHPA 3CUYA 3OTIA 4U0SA 3CEMA 4CTOA 3FFLA 3PE3A 3TSAA 4U04A 3ZCUA 5KJNA 4HOSA 3QWPA 4L22A 2UY1A 1NVKA 2Q6VA 2LSUA 3HBFA 3CUUA 1XC7A 2F3PA 2FF5A 1YA0A 5G04C 5HQ8A 2YJNA 3CVNA 4N39A 3QWWA 3D0RA 5BT1A 3FROA 3COPA 3CUWA 2AVPA 4IN3B 1SXQA 1PSWA 4I9CA 2JZCA 4HWGA 5I45A 2Q7FA 1NZNA 3BCSA 3T3IA 1ELRA 5ARFA 4GZ3A 1J39A 1RRVA 1WW2A 2PYDA 1NZFA 4N3CA 2XA2A 3ZCRA 3NAZA 2VGXB 4J8DA 4KQ1A 2GW1A 1KT0A 4WNEA 3BD8A 3T3HA 3LY9A 3E3LA 4GZ6A 3OKCA 1BX3A 2BISA 4GA0A 1AXRA 1C8KA 1ABBA 3RO3A 3CUTA 1RZUA 2HY7A 3T5TA 3OKAA 8GPBA 2FBNA 3OY7A 4X6LA 3GZ1A 3LPZA 5D0OD 2XCUA 2XGSA 2JLBA 3DDWA 1FU8A 2VG8A 5FZRA 3NP7A 4KYOB 1UQUA 4BWRA 3Q5MA 3ZCQA 2KCLA 4N9WA 1P2BA 3O48A 1KT1A 4MHSA 4M7PA 3TG5A 1PYGA 1XKXA 4EKYA 4KBQA 1IHGA 4A1SA 4BT9A 6GPBA 3MSCA 4MI3A 3LKUA 3VDMA 4KXKB 5EX3A 4M83A 4YVOA 3OT5A 2P6PA 3GZ2A 2PRIA 4NRHB 3IAAA 3BDAA 7GPBA 3BD6A 4Y6WA 4I1AA 2QN8A 4CTMA 2KCVA 1H5UA 4Y6CA 4BT8A 2WPVA 3MEKA 3URZA 2HO1A 1UZUA 1B89A 2QN3A 4GZ5A 5DXFA 3Q49B 2C9ZA 1PNVA 3Q15A 2XEVA 3AS4A 2ASVA 4F97A 1K06A 3MTDA 3LY8A 4GCNA 3L7BA 3S7FA 4HOQA 1EXVA 1KLXA 2IUYA 3QKWA 1SXPA 1ZBPA 2R4TA 1P4HA 4CGVA 1XOIA 3WXXA 3EBOA 3QKYA 2QLMA 5CHEE 5D0QD 3RSCA 4N3BA 3KD7A 3ZHEB 1FS4A 3MQFA 3Q47B 4J8EA 1JIVA 1PC2A 5M72A 4MICA 5JJ6A 3S7JA 1HLFA 2QN2A 3VTYA 4RIIA 3VDNB 4G26A 4NQ0A 1XL1A 3U3WA 1HH8A 2XGOA 3FWVA 2VSYA 4ME2A 3GUHA 3OXGA 2AZDA 2QNBA 2KATA 4F9FA 4BTBA 4G1TA 3AS5A 3MS7A 3TG4A 3RHZA 3Q3EA 2QN9A 3G2KA 5EX0A 1FA9A 3L7AA 2XA9A 4EL5A 3RO2A 4G25A 2KS6A 1OUVA 2IV7A 5G04J 4I17A 4GA2A 2IF4A 3CEQA 3HBMA 3L7CA 4GYOA 3G2NA 2SKDA 3ZCVA 3UYKA 1L7XA 3BEOA 3L7DA 1P2DA 3D0QA 3AMVA 1Y6GA 3UPVA 2OOEA 3RU0A 4N2SA 5DIZA 2GEKA 3GW4A 4AMGA 1C3JA 2BGTA 1FC0A 3D1JA 2R4UA 2YQ8A 5CCLA 2OFFA 4I2WA 3DZCA 1ZU2A 3K9IA 4RENA 2AMVA 5TMDA 2XPIA 3BD7A 1M5RA 4YI3A 3EDTB 5FZQA 2I6HA 4N2QA 1GPBA 2XA1A 1F6DA 2QZSA 5FZSA 5FT9A 1Z62A 1FTWA 4REMA 4UQZA 4LDPA 3T3DA 4RIEA 2XCIA 2GPBA 2VQ2A 3CX4A 3OTHA 3CEJA 1P5QA 2KCKA 3UUXA 3ZCTA 1NOKA 5IKPA 1VGVA 5D01A 4WACA 5G05C 2X0DA 1JIXA 4FZRA 4B94A 4MI6A 2AW3A 4HORA 2C0LA 3PE4A 4FKZA 1IIRA 2IEIA 1WUTA 3TAXA 5HXAA 3SYMA 2KC7A 3ZHEA 4EJ2A 4MRAA 2Y4UA 3CV0A 4LEIA 1L5RA 3CK8A 2XGMA 3S27A 4UQXA 1TJCA 2VYIA 3H4TA 4W9RA 1L5VA 2FO7A 1GPAA 2XCBA 3JYSA 2GEJA 2LSVA 3CVPA 3NF1A 2IFUA 1GG8A 3LCAA 1RZVA 4RIGA 4WHMA 4M60A 2F3SA 1JG7A 2IV3A 2Y4TA 3ZFWA 4YI5A 3S28A 1E96B 3Q4AB 3U4TA 3MV2B 5A7DB 1Y8ZA 2G9VA 3UYLA 2BFWA 4NC9A 3L01A 2QRPA 3ASDA 3MRXA 5FJYA 1AHPA 1JG6A 5CCMA 2QRQA 4N5CA 1E1YA 3C4QA 3O3CA 1WM5A 1YGPA 2VSNA 1NOIA 4G2TA 2IYFA 2C4MA 2IYAA 3CVQA 3T3EA 1B4DA 2SKCA 1C8LA 4UI9J 4H7YA 3N71A 1WV0A 3MRTA 3MT8A 3G2LA 1K08A 2QFCA 1GPYA 4MHOA 2LNIA 1XL0A 3S2UA 4EKEA 4U0UA 5A6CA 1L5SA 4O6FA 5KJLA 4RIFA 4XIFA 1IYGA 4GA1A 2AV6A 1Z8DA 2F3UA 2SKEA 3CKBA 4BQFA 1A8IA 1P29A 3QWVA 2QRMA 4YNDA 3S0JA 5TVGA 3FP3A 3RIBA 3EBPA 2FF4A 2XCCA 3MA5A 1FU7A 5EKQD 2BUGA 4BTAA 1NA0A 2DBAA 4I9EA 5AYWD 4CTNA 3S7BA 1QKJA 3DDSA 4BFCA 3BCRA 3CKCA 4GYWA 3C4VA 1IXYA 4UI9K 3C48A 1C50A 2MHKA 2UY1B 5JTTA 4MI9A 3G2HA 3HYMB 4JHRA 2ATIA 1WAO1 3GYZA 5ENZA 1JIUA 5FTPA 2BGUA 3MV3B 4NESA 1EM6A 3NCHA 1NOJA 4UQYA 3VUEA 4YVQC 3ZPJA 2F9FA 5DBKA 3L79A 2IEGA 2R60A 2GPNA 1QQEA 3OTGA 4W6QA 2C0MA 3QOUA 2V5FA 3S7DA 2C1XA 3ZN3A 2C2LA 4GCOA 1Z6PA 2ONDA 2XMPA 1P4JA 4AY6A 4GYYA 5ARGA 2C1ZA 3GPBA 3NC4A 1WUYA 2GPAA 3WC4A 4YUAA 3NPAA 3HBNA 3CV3A 4F96A 3BEEA 2JJMA 1HZ4A 2WQHA 4PQGA 4X7RA 5HI7A 2FFRA
chains in the Genus database with same CATH superfamily
1MZPA 5MHTA 2HU7A 4A6PA 5TF0A 5AK0A 5KYXB 2WMNB 3PX7A 3MGBA 3W2HA 4QUIA 1DBRA 3GPCA 2O3RA 1TCUA 2HYZA 2VQ3A 4TKVA 2WJ6A 3UJ3X 1WHSB 3NB0A 4LOIA 2HMVA 4NBWA 2ZB8A 4M76B 5LA6F 2IYSA 2VJLA 5B6IA 1JJ7A 4DHWA 1CHDA 2XUPA 1O6CA 5JNWA 4LJRA 1AH2A 1OAOA 3H75A 5CA0B 3GLIB 3KP1A 1N3BA 3TGWA 4YRCA 3F6SA 4X84A 1M2NA 1QLHA 2BFFA 4K5AB 4AM9A 4E14A 1HFJA 1C9EA 1AGRA 1NM5C 2L0IA 1W0JD 1UXJA 5IJ0A 1CUWA 1USIA 5F7JA 1GZHB 2UZIR 2ERXA 1JLLA 3JALB 4GE3A 4KAXA 1CUVA 1F4PA 1R4AA 3M6MD 4MVXA 4G24A 1GGJA 2D1TA 2C7QA 1RKBA 2B78A 4K2HA 1TF5A 5LXTA 1MMFB 1XMPA 2BV3A 1YZYA 3IUMA 3WL4A 4G5SA 4YT8A 4KKVA 4DY6A 5EQTA 1NA3A 5JJTA 4OQMA 1WKCA 1E90A 2VYVA 3E18A 5HQTA 1OREA 1U9YA 1TJYA 1VB3A 2VF4X 5EIFA 4IO1A 3T4XA 1YFLA 2C7BA 1XZFA 3MUNA 4L7QA 1KDPA 1M1YA 4HN2A 4C4PA 2D2VA 2I8CA 1NXOA 4JUIA 1VZ3A 1IWOA 4ARZB 3R9WA 2M63A 2KX7A 2NT4A 2IYOA 4OJTA 1W2GA 2IVZA 2NIPA 4K2AA 4MUGA 3VAYA 3FU6A 4XVQA 4X63A 1DKNA 1QZXA 4MV9A 5TEVA 4EY6A 3KPVA 4EQ6B 1C1DB 1FFGA 3A9RA 3D4NA 3VH4A 5HZMA 3AP1A 3PK0A 5FO0A 4ZOAA 3IBEA 3Q7TA 3ULKA 4E70A 1XA0A 2AMFA 4EHDA 2ODTX 1H1TA 2VEOA 3QMWA 4BQOA 5JNRA 4LYEA 1M5TA 5LYJA 1RHMA 6REQB 3IL2A 2O05A 2WF6A 4M1OA 1Z5WA 4Y7DA 2QEQA 1KY3A 1T6BY 2P69A 3B1WA 4ZI5A 1MEOA 3A9SA 3QI7A 2AXQA 4BAUA 1QUFA 3BZWA 2AUTA 1ZL2A 1S3IA 2GCIA 1TA0A 3B52X 4EF4A 4QT4A 2QI9F 2CK3A 3B3FA 3O91A 1SKMA 1A2OA 1IJEA 4JR2A 2Y1LE 4X7BA 1Q5PA 2GRAA 3IBCA 4ENVA 4DQLA 1E2MA 3VSEA 4JA9A 1B3RA 3JV7A 3LMKA 2P2ZA 4QWMA 5FOWA 4ZHSA 2WTBA 4FP7A 2JARA 1PT5A 4FS3A 4YXFA 3DQPA 4E5NA 1DWPA 2DR3A 2TMDA 1TUIA 4G9GA 1KIFA 2CMGA 4H4DA 4OM8A 4ZCIA 2UWJG 4YJDA 5A4KA 3HP1A 4F3VA 1PR5A 3V4PB 2QR3A 2PUAA 2QLNA 1PFVA 3WB1A 2XRYA 5DP2A 2I2XB 2YJTD 2OLJA 3GBSA 3O74A 2OAGA 4LV6A 5KQGA 4YAEA 4L8FA 3EAGA 1UBLS 5CEDB 3PTAA 3AEUB 4KQ2A 4E22A 4PDXA 4AC9A 3G1TA 4EW6A 1KDYA 4HAZA 4WWPA 4IVRA 3WB2A 4EVQA 4Y2PA 1N3IA 1M2GA 3VR0A 2ROQA 1PWZA 2W9XA 2BJWA 3PDJA 2HOQA 4G0OA 1AKNA 1NJFA 1QHNA 4LBWA 4XTRA 4HDRA 4G8DA 1BJRE 4EY4A 1MQ8B 2GBCA 4WNDA 2Q3CA 2P9IG 1F9EA 1LDNA 4NIMA 4OQYA 4PYKA 1QO0A 3D0OA 5GPBA 4HNUA 5HKAA 3TTTA 2ZCVA 2G4CA 4RTJA 3ZNPA 2IZ0A 3O9MA 3P1UA 5FBVB 5JV5A 4MVYA 3ONVA 1PAQA 3GFSA 4MB0A 4ZEOA 2ZBVA 3D8HA 2IZOA 4CF3A 4K03A 1GFZA 1VOTA 2F62A 5CNIA 1COZA 5IP5A 3KV3O 4YMGA 1WPQA 1VKZA 2QORA 3MT7A 4N5LA 3L07A 4IOLA 1FT1A 3T3GA 4L6AA 2R5SA 4BKOA 4O3FA 3UQ3A 1N6RA 5LBUA 1QBQA 5MFPA 5C8YB 1ZBDA 1Z7BA 2JVJA 2XMSA 4MXDA 3WG9A 5ADHA 2J0EA 1E7VA 3CEMA 3FR7A 2YHEA 4K9KA 1L4FA 1MAVA 3N05A 3NBQA 4UHBA 4Z0NA 4AX4A 2Q6VA 1CZLA 4DLQA 4DJEC 3CUUA 2EEPA 3MWLA 3ZEIA 4M55A 1NVDA 1IB6A 3NHYA 3RK0A 2QD4A 3A3NA 4MIOA 3HVUA 4B33A 3WKEA 1R8XA 3WIEA 2WXKA 3FROA 1CY2A 4Z3DA 3TW4A 1LPNA 4F53A 4GLBA 4ERNA 3H1FA 5LX8A 1CZRA 1XE3A 4QUEA 3DCIA 1D4ZA 2ORWA 3DJYA 4HL6A 4LYYA 5EVJA 1D7AA 5HDBB 5CA0F 2Q5CA 4OGFA 2N42A 5IXSA 3T3IA 3EX7C 5G02A 4L8LA 4NMWA 1B93A 2QMHA 2Z56A 5JPIA 2PK3A 2XX3A 2LCFA 1Q0QA 5AVQA 2XA2A 4N3CA 1D2GA 4OP1A 4XRGA 2A0UA 3ZDAA 2UXDB 2Q8NA 4J03A 4HNTA 4AIRA 3FCCA 3VR5A 4BB9A 4Q9NA 4FA6A 1NNI1 2OKCA 1CQXA 3S1AA 2HM7A 2HBZA 2PSHA 1IJBA 1OLXB 3I30X 4PLYA 1NULA 2GVDC 2R7MA 4OI2A 3VPCA 1Q16A 2H7YA 2GD2A 4UAUA 1O1RA 2QYJA 4GTSA 2BISA 4KLCA 5D84A 1IJKA 1REQB 1YHNA 3PXXA 4PQRA 1WM1A 3KEAA 3F6YA 2PPVA 3KEGA 1I9CA 3C85A 4ZHQA 1WOYA 1FDRA 2FCAA 2ZSJA 1TYAE 1YR7A 2FPSA 4MR7B 4WZBB 4D4JA 2WWHA 3HCRA 3LPZA 4EKGA 4UHJA 3Q7RA 1SC6A 2HK9A 2SICE 4XWWA 3LDGA 2IEYA 4PM4A 4RDIA 4GNKA 5AW9A 3PIIA 3APFA 2IV2X 1LSSA 2AJLI 1JSLA 3F0TA 3DHYA 1BD3A 2PJZA 3GF4A 3GEIA 3ZXUB 2CHWA 1I51A 4YRQA 3TOZA 4OA5A 1LBHA 3KAQA 5C8DA 2CNKA 2KZTA 2Q5HA 1TTQB 2XNKA 3U1VA 4EX6A 3ZW7A 4MI3A 1TVKB 1JPJA 1FPPA 3AUAA 3I9FA 3SZGA 4D9IA 3OT5A 4TL8A 5J4LA 5CLJA 2AC2A 2QP9X 4Q9JA 3LBYA 3LQQA 3QLUC 3R7NA 1G8FA 4Q66C 4UCWA 4HO1X 5BV7A 1QO9A 3PNYA 2W5UA 1E5LA 2QTRA 5DGCA 2XV1A 2KCVA 4BAGA 5A2QA 1V1MA 3QWIA 1ZJZA 2I66A 2WA1A 1X7XB 1XEAA 3EVCA 5CM9C 3MEKA 1UINA 1E79D 1BXGB 4WWNA 2VJKA 4IIUA 4KE6A 4PQFA 1L5YA 5FUQA 4HNAD 5EUCA 3S7TA 1Y5NA 2JI6A 2R87A 4WOJA 5IJXA 4Q01A 4BWFB 1ULSA 1IN4A 1KF0A 1PNVA 3TW0A 1CUIA 3Q3GE 3ASZA 2PR2A 2D06A 2D0IA 4EO4A 3SPXA 1TJ3A 2DWZA 3ETHA 2P90A 1H0RA 1KLXA 3ML8A 1VSQA 3EVTA 4OMDA 4B40A 4E2XA 4DJTA 5FPKA 2ET6A 2IUYA 2A3NA 2ZB3A 5E75A 3O4HA 3V34A 1N5MA 3THXA 3I04A 2VXBA 2RGRA 3EGDB 3QEBZ 4D9CA 2HZBA 3RNOA 3LX5A 3FUHA 1CSEE 4C2AA 1Q0LA 1VFPA 2DUJA 2VKQA 4TM7A 3QX3A 5LA6A 1R6AA 2ORYA 4X65B 2VYQA 2WW8A 3EQ6A 4FTWA 4NQ0A 2R6DA 5DTRA 4ZREA 3PICA 3HGMA 5CLFA 2CFRA 1UBKS 2W6JD 4JS0A 3SJCA 1RJEA 3OXGA 3VR5H 4I6GA 4JT9A 2H9YA 2I1QA 3VTFA 4B93B 2I34A 3I5XA 4U7FA 1F3OA 3B5JA 3D4PA 4NRDA 4EB3A 3ORYA 2XSZD 3VSBA 1DJOA 3TG4A 3RHZA 4JZKA 3UW3A 1DNPA 1HYGA 1WXDA 1RI2A 3U56A 2OEWA 4LYHA 3OPYB 3INNA 3VO8A 4LJ4A 2I2OA 3FH7A 3KKPA 5JU6A 3PRHA 3SE0A 1T8UA 4IHJA 4CI9A 5CURA 1N6NA 3WRYA 5IDXA 4IEEA 3HU2A 3RS2A 4LRQA 1BFUA 4FD2A 1YZUA 2HUPA 3X3HA 4YUWA 2JB9A 1K7XB 2OVBA 3L7DA 2OOKA 1ONNA 4GOJA 5B2FA 4J91A 2EIXA 3ULEG 3B3GA 4HRXA 1P8AA 2JW5A 3P45A 4QARA 1U1IA 2PH1A 1JLMA 3AVXA 3T7IA 1Y1RA 3AEQB 1II8B 5EVCA 2BVNA 2XODA 4CU2A 1NYRA 2CHZA 4ZO6A 4HQ6A 3OQNA 4QU0A 1ESNA 3A25A 3G2PA 3ICWA 4R2WA 2AR7A 2GGSA 5J90A 3TI9A 2ID8A 3RT9A 2ZYWX 3N7UA 2YNMC 5E6SB 4PBRA 1CZOA 1T3LA 4BNMA 2Z9CA 3LUGA 3K9IA 4IL5A 3FFTA 3EZLA 4GBJA 1X7ZB 3CVOA 4TWAA 5TPWA 4R16A 3CNQS 2HPAA 1KOLA 1M5RA 4YI3A 3NNSA 4I43A 3UAGA 4D2IA 1TAQA 4CDMA 3AI7A 2OQRA 3O7WA 3A1FA 5FT9A 4JXJA 4ZV7A 4IYJA 5LD2B 5JUWA 3IDFA 4OBWA 4TQAA 1GUFA 3V2OA 3L3BA 4RVHA 1KP3A 1NBAA 1Q50A 1ZW6A 4IV8A 4LV5B 3N28A 5FX2A 4F6LA 2VDNB 2Q28A 2X6HA 2HXGA 4QE3A 1NMYA 4MVJF 3ZQKA 4FQ7A 5DWDA 3D9OA 3SGHA 2QT0A 2ZJ3A 3HBLA 4BVFA 4H4CA 3G1UA 1KC3A 5EP4A 2X0DA 2CFZA 3W5AA 4DILA 3RABA 5CCXA 4KAJA 3JQFA 1U7TA 2KM1A 3S7ZA 2ZT7A 3T61A 4F2PA 5CA1A 3HCCA 2FUG6 2HUNA 3AM4A 3CWQA 1N34B 1EGQA 4O5OA 3G0BA 3R5XA 4V1CA 4P3OA 4KAFA 1VPVA 3TAXA 2DFTA 1LLUA 3CLHA 2WF5A 1KMIY 4KLZA 4OTZA 3QG5A 5A5FA 5A6VA 3THWB 1ADJA 1GKIA 5AKEA 4X9XA 4IJWA 1N32B 1FDSA 4KL8S 2O7VA 2XYVA 3AKZA 2V7UA 1MX2A 2Y4UA 3T94A 1H69A 4HBGA 4IDPA 3SHVA 3BFJA 4CKWB 2XGMA 3S27A 1OLUB 1EFRD 2ZRFA 4GVPA 3NBXX 4BNXA 1NRWA 5FKJA 4EG3A 4CF7A 5K3OA 4AQYB 3UWOA 1W34A 3B2NA 4LGYA 3AVYA 1FYEA 2ZS8A 2O2ZA 1G3NB 1MENA 5CERB 1QR2A 3BSWA 3GOQA 1NF8A 1UN9A 1L4BA 1L8QA 4IWNA 4MW5A 1EE9A 4P7GA 3T35A 3HM9A 3VZBA 3KIPA 4YI5A 3NDPA 1SU4A 5A02A 2QB5A 5A7DB 2PWYA 5I7UA 4MS3B 3UYLA 2DVMA 4JVNA 2FPPB 5HW0A 2ZVDA 3OCCA 2RG8A 5T4FA 4D3FA 4ZD6A 1E3SA 5FJYA 1IUKA 2IYNA 2A33A 4MRPA 4YFVA 5DTIA 4DUPA 2VTDA 1GSOA 1SIBE 3OD1A 1T5TA 1WM5A 1MOSA 5EE3A 3FPFA 1NOIA 1UJ6A 4XIIA 1GYRA 2C4MA 4S1NA 4TWIA 3UG7A 5BSTA 2O1EA 4CKXA 4JLSA 1UDWA 1WL8A 3ADPA 3FCUB 3I9KA 1JFFA 3CUSA 3DNFA 3UJ6A 2VDJA 4BBAA 3MRTA 3EUVA 2H54A 3IOYA 3HJGA 2Y66A 2J41A 2ECOA 2OCBA 3QE3A 2TYSB 2W6MA 3OZDA 4U0UA 1W5SA 1L5SA 1NYQA 2N75A 4GI7A 4NJEA 4UC0A 2BW0A 4YS6A 5KI6A 3UV7A 5KSOA 4F11A 4PQYA 5DBEX 2H9AA 2OMKA 1QRDA 3V4RA 1TE2A 4XYLA 4QVIA 4CIXA 3BZUA 4BQFA 5KTNA 3DCYA 4R8SA 1X86B 1SCKA 3HB9A 4CIAA 1JYFA 3QWVA 3IC5A 4QPNA 521PA 4UVDA 4ZQGA 1LEHA 3PUJA 4OL0A 4A0RA 3W9GA 2EGUA 3LKBA 5F3WB 3P52A 1BI8B 1DLJA 2VHYA 2ZGGA 1FU7A 1YBMA 3PC8A 1OH6A 4RMNA 2RD2A 2FJDB 2J08A 3DSUA 1Z18A 4R83A 3LVBA 2C0CA 4PGMA 3TLGA 2O0JA 2DYSE 1ESEA 1UIRA 3TMKA 4YMHA 2G1UA 2ONKA 1SD5A 2ZCUA 5EJMA 2MHKA 4HTAA 1FNDA 4JEMA 4P22A 3ROTA 2PD4A 1KDTA 3NHJA 3HYMB 4PWYA 5CLHA 4EY3A 3KQKA 1JFTA 2CBXA 1JU9A 3PQEA 3WLPA 3P26A 4D6YA 3OIDA 5HRCA 3G2OA 1BD4A 1OH8A 3I9V1 2NXEA 3OF3A 2V4UA 5GY7A 3FLAA 3DEAA 1VFNA 3GRUA 4AJIA 1KQOA 5I4BA 1CLEA 3L43A 1PD1A 2Y71A 1ZY2A 3FWZA 3QVUA 4KE8A 2Q1TA 4BZWA 3AOEC 3C16C 3L4BA 3VV3A 1ND6A 2C4WA 2J0SA 2VDVE 2RCYA 2W6JA 3ONFA 4KXXA 4MJXA 3JATB 4U5XA 2QVBA 4FEYA 1TCVA 2WG1A 4XPIB 4A10A 3QNKA 1R0WA 2KJZA 2M6RA 2V9ZA 1VP3A 2E49A 2X2PA 3K7EA 1SR8A 3HKEB 5ALPA 4Y18A 3T06B 2FG5A 1MF7A 2ACKA 5FFMA 4KMOA 5AHXA 3OT4A 3AV3A 5HRAA 1TD1A 3HS3A 4QXOA 5FB3A 5AOBA 2C1ZA 5DFAA 5JMPA 3UPUA 1YIDA 1FQKA 4MWBA 1GCIA 1P9OA 3OX3A 4EYKA 1YRBA 2IPAB 3DAYA 3ESQA 3Q41A 5DCWA 1DU4A 4YUAA 1UBNA 5AIBA 2PZGA 4C6SA 5LPNA 3HV0A 5ENRD 3O94A 3WMWA 2I7XA 1O94D 3FTXA 4A23A 2J7KA 2IYLD 3OQPA 2FW1A 5KDDA 3Q73A 4H31A 2IPXA 3KVNA 3WXMA 3DE7X 3BZBA 5BUQA 2PS1A 3Q0EA 1ENYA 3EARA 2AC7A 4OBEA 4UE2A 4B87A 3JYQA 3MPOA 5CLLA 3EPPA 5EKTA 4ZDWA 2R2AA 2W8ZA 1DDGA 4CMIB 3DP9A 1B8VA 5HFJA 4TVSA 4HNAA 4RKRA 1OB2A 5F98A 4IIGA 4JD2G 1CLUA 1PWYE 2IZ1A 4FB5A 3NB2A 13PKA 2NZVG 5SICE 2ZTSA 2NZ2A 4JGGA 1QP4A 2REXB 2C03A 3IA7A 4MPRA 1NQAO 3ZYMA 5SZKB 5TR9A 4AKTA 1LWOA 1QRAA 1ZH0A 3UINC 3RJMA 1X1QA 4JC5A 4G37A 3MCWA 2WM3A 3ESRA 3NOXA 3SZRA 1E20A 1UJNA 1ZLXA 1NJ5A 2VTBA 3GOHA 4QDOA 1SQ0A 4RZ3A 3SYLA 4E5DA 4CMHA 3VPAA 5K0NA 1F4VA 5JH7B 4ABYA 3H1EA 3ZJTA 1U3TA 3BCUA 4Y9UA 1RM4A 3TR0A 4C4ZA 1JA9A 1Z5VA 2NO5A 4V0RA 3WYEA 4B4UA 1YJ8A 3Q4GA 4KPUA 4UM7A 1W52X 3PGKA 3SHWA 2GN2A 2B7LA 3LQKA 3WLMA 3RSEG 1FFWA 3HO6A 3IIJA 1V5IA 4NCAA 4JI1B 3HY6A 1X81A 3DMTA 4LW8A 4UU7A 1Z2OX 5D5HA 4AMBA 4DFDA 1MABB 2ZRDA 3ONLA 3JQEA 4IRUB 4A6DA 1DXOA 4GGOA 1C9KA 3FVWA 3W5UA 3GVPA 4OYHA 3SHQA 1KSHA 1KH3A 2RGCA 4B8YA 1PR2A 2PXXA 5C2YA 2B6NA 1XYYA 4PS0A 1MHTA 1ONBA 3BA1A 2B4QA 3AM1A 5CK4A 1US8B 2VPXA 3EF0A 3P5BA 2D59A 1MVLA 2ZANA 5GWXA 4QYXA 2AZ4A 2X40A 2YN0A 3E3OA 4NEQA 2EV9A 5AW2A 5KMGA 1XGKA 1MGOA 4H59A 2P65A 1EVKA 1DEKA 1J8VA 1DKMA 2R6R1 5TB5A 3D4BA 5A04A 4KQXA 1JDZA 2XQ0A 2JC3A 3X1DA 4YONB 4P0PB 1YDFA 1ZJ5A 4U9HS 2D5CA 4YJGB 2JVIA 3RV4A 1KDOA 1LRLA 2LD4A 1TL7C 2FXVA 2HRBA 4Q93A 1IN1A 1DC4A 1T2NA 1U9ZA 1PTJA 1UPXA 1P0QA 3QG1A 4KRXA 3H5IA 4FJ1A 4RKFA 2E82A 4TYMA 4TWRA 2PUEA 2DPYA 2V0CA 1RAGA 3KKOA 5KJ6A 3NIDB 4BFLA 1TEZA 3A6ZA 1DAEA 1TJ5A 3V55A 2A6PA 4Z9AA 3FR8A 5T67A 3FETA 1C9YA 2ZYTX 3IQGX 5KYTA 3PJFA 3CZMA 3M5CA 2EIME 1VIAA 1WEKA 2FX3A 2GN1A 1BS2A 2O3SA 1YMUA 3UNXA 2GKSA 4CKWA 2F90A 3AY7A 1EGMB 1KSJA 2XUZA 3KB8A 2HIAA 3WNZA 4JHJA 4OAQA 3VR1A 1RWQA 1M33A 5BN3A 3PDWA 4LYJA 3CSTA 1ZNZA 4D8YA 3OKPA 1CDOA 2A9FA 2VK2A 4HEA6 1H1LB 2Z1MA 4IJVA 2FN3A 4OAPA 3QOXA 2BFPA 2NNLD 2Q9AA 4PPGA 2H31A 2B20A 3MLAA 2P2CP 4RG6A 2OECA 1E1RA 3MJHA 1OX4A 1RJGA 3EC1A 3PR2B 5JCJA 4ARIA 1LB1B 4FGLA 1PKEA 3KCNA 3W6ZA 3FKSA 3ZWVA 5BT8A 3ZKWB 2Q8PA 3DV9A 3GROA 3WGQA 2F64A 4MI1A 3BAFA 4UI9C 4KX3A 3ZHVA 4P84A 5E3HA 2IHBA 1JCRA 3MA0A 2ECPA 2XVMA 1WY7A 3L16A 4QSMA 1VJCA 4BO4A 5CDSA 1WAMA 3GLFA 1RXCA 5BUZA 2P68A 3MJDA 1L7RA 1VCOA 2NZYA 3NH9A 4JA7A 2GCEA 1WXGA 2R5WA 1JPNA 1QOPB 3QRWA 1CTQA 1BRMA 1NU8A 3SSNA 5KREA 3H2HA 4URZR 1P8JA 1PHRA 1HE1C 4JR0A 3ODGA 3OJFA 3UUWA 3UMCA 2YKGA 3PHGA 1TYCA 1MU0A 2IEBA 5D66A 3G8CA 3UM1A 1CR6A 5D2CA 3NHKA 4LXUA 2JFWA 5TSDA 3B36A 1F2TB 1QIIA 2X5JO 5DVZA 2GA8A 5LA6B 5TQ2A 3S40A 3DMYA 5JS2A 4A0FA 4EQZA 2FFGA 5CH8A 2MSCB 1FP2A 3ZLBA 5K0EA 1XZDA 4DG5A 1NAHA 4IO0A 4J1SA 2VSXA 2ZYSA 1JAIA 4ZIRB 4QREA 2GA9A 4R51A 3CGGA 2CK3D 4EO9A 3LW7A 5G0WA 5BR7A 2DQ4A 3OLCX 1DG1G 1VI2A 2I1JA 1E5DA 2PWZA 3RH0A 1ELRA 3G82C 2OXTA 1S1MA 1IWPB 1CIJA 3RLIA 1Y7HA 2CJXA 2QZ4A 1M7HA 2ZRJA 3VYUB 1YFJA 3QKRB 1W4AA 5KCMA 1EFKA 1PJ8A 1Z4NA 3K5PA 4YTEA 2PD3A 3T9BA 2C8VA 2BF4A 1AIPA 3LP8A 3QW2A 1KFEB 4U63A 1Q83A 1R8JA 2IDJA 5BW6B 4DCNA 3D4OA 4LHYA 3L6CA 5LYJB 3U4CA 1UADA 1KJ9A 3FWPA 4RS3A 3RG8A 3DBHB 4BO6A 3IAXA 1OI7A 3F46A 1NE2A 2J6BA 1IUPA 4AG5A 1FZTA 3ZWKA 4DX6D 3K0EA 1NDQA 2BR4A 4BNYA 5C4GB 4EMTA 1OH7A 3EPHA 2C58A 1H6OA 4AY3A 5CFOA 3OKAA 8GPBA 1T1EA 1F38A 4YDYA 1ISPA 1TNDA 5CCEA 1SFRA 1NL4A 1SD1A 1T2DA 2VNAA 4MMZB 3P0RA 4RY9A 2IHUA 2NU6A 3NJ8A 2VYVD 4KYIB 4JIMA 2HIHA 2XKAA 4MQEA 4PICA 2QUIA 2ZUWA 4II2A 4MVJG 4E33A 1NVVR 2AYYA 5H1YA 5UKDA 3FB1A 3I6YA 1IOLA 3CVYA 5FTMA 2RH5A 4N9WA 5JS7A 2RGEA 3BHNA 1NUSA 2QBYB 2NZ8A 5GZ3A 1CR1A 1EAYA 3IT3A 1JT2A 4MR9B 4AICA 3TG5A 1XKXA 4JJ7A 4L6CA 4PHTA 2BYTA 3H83A 2JGJA 1IHGA 3TEMA 1B0UA 4LDNA 2AUNA 2TRSB 2X77A 1TYEB 1EFVB 3EXFB 3ASUA 2JL1A 4FFDA 5A6SB 2OY0A 1GZDA 3MB8A 3DLBA 3RBAA 1GVNB 2V6MA 1WB9A 3E84A 1QK4A 3LKVA 3WIBA 4M7CA 1OYWA 3C3YA 4J1TA 4BO5A 2NO1A 5K0FA 1ISHA 4U8GA 3HEAA 2V74B 3REFA 4D79A 2OEVA 4KN6A 3QLEA 3TKYA 3PU6A 2R1UA 4LYAA 2B8TA 2NOAA 2IKSA 4QGFA 5CT9A 4ATNA 1BMFA 3I05A 3I58A 3BG0B 2JJ8A 3DXYA 1MX3A 4IXDA 4QHYA 5L3ZA 3FHEA 4GZ5A 3COWA 4F7AA 3DMDA 1ZCBA 2CLSA 3QGMA 2C9ZA 4Y9TA 3CZ4A 4JSTA 3RF7A 4Q1EA 4OQDA 1YJQA 2IE0A 2I6XA 2YW9A 3UPDA 5INTA 1PJAA 4ND8A 5BPPA 4EG6A 1IWBB 3MFYA 5I7HA 3ES9A 3PA6A 5KQLA 1CFZA 3IUPA 2AUMA 1F1JA 2QMOA 4TL7A 4QPJC 1Z74A 4BEBA 1Z5GA 5DM2A 4PO3X 4ZT5A 3MJ4A 5D1HA 3HABA 3FH5A 3ETCA 1ZI9A 1XRQA 3RSQA 4JENA 4BEVA 4TV9B 5M72A 2ZJ6A 5BW8A 4GR5A 2FJEB 4JJAA 1A97A 3PNOA 4LXTA 4WOCA 1HPLA 1XYGA 1PT7A 1QH8B 3S1AB 1QKKA 3VTYA 2NUTB 2OZLB 2Q6IA 4RIIA 1IG0A 3SLGA 1WKBA 1ZI8A 1J0DA 2WWTA 4F5WA 4I4LA 1QOZA 2R79A 1GYQA 4F2WA 4QJIA 3DBVO 3BMCA 1H6AA 4ZHQB 1E98A 1GARA 2GWRA 2ZB4A 4EPVA 2YV5A 4R6XA 4YRRA 1UWLA 2MINB 3DKIA 4AROA 2CHQA 4DYVA 2ZISA 4NOLA 4HLCA 5DNCA 4O2BF 4UWHA 4DUZB 4M53A 3PVSA 2OV8A 1YC2A 2NPOA 3WYBA 4UTVA 1UG3A 1YIAA 1UPUA 2QK4A 3E5NA 5IFLA 1R6UA 4KO8A 1AKVA 1O7JA 1ZN9A 1QGED 2B21A 2OB1A 3BL8A 3H3XA 4KVGA 3V8PA 2II6A 2EL7A 4RD1A 1B73A 1J9GA 4L6IA 4J29A 5HIIA 4BQQA 1WXWA 3ZIDA 4W8HA 3VR4H 3R9KA 3ETGA 5AJXA 2I0FA 5IVIA 2VUHB 4X3OA 4C3UA 3AU4A 1VJTA 4I9HA 3UPVA 1KBOA 4LGMA 2OOEA 4YMVA 4R9UC 4GMDA 4FJYA 4EI8A 3C24A 4HYEA 3R7FA 1Q2XA 2RH4A 4MVJE 4AJHA 3AG6A 3DZDA 1DIOB 4GZDA 3EEBA 3IUNA 5K0TA 2VWGA 2FSPA 4IOMA 1Y4UA 1ZJYA 3EGIA 2O3QA 4EITA 4G4SP 3RRBA 2M6SA 2I80A 3PD7A 1VLQA 4G1CA 4IJQA 2YZ2A 1YI8A 3OM1A 3WLOA 4BCBA 4YRZA 3WQHA 1CJCA 2WKQA 1H4VB 2E87A 1ZB1A 1ISRA 4MUKA 2TS1A 1OPRA 4CXMA 3TM4A 4JASB 2PM8A 3O8NA 1EF1C 1Z4IA 2F8LA 2PUDA 2I33A 4TLEA 5BSUA 4REMA 2R17C 4F84A 5T7BA 1VI5A 1RQGA 1TVMA 4GMHA 4K9NA 3KLOA 3HV2A 4RHYA 4RU1A 4EA6A 4CRWA 5JBQA 2WFLA 1V7QA 4OU4A 4XGNA 5KU7A 3X2QE 1LQUA 3TZEA 3EXEA 4FMDF 1ODFA 4B71A 1SQMA 4BV2A 4E11A 2J3QA 3T7JA 3UUXA 1T4GA 4L4XA 4LJ6A 3HUTA 5U4XA 2PAFA 4F5DA 3B20A 2IQ5A 3BF7A 4RGVA 1OV4A 1UJ5A 3DZBA 2NQ2C 1Z3YA 3EZYA 4ZGWA 4Z4GA 4PLPA 4IMIB 4DADA 3E33A 1TKCA 5F7OA 1YVEI 2CMHA 4EGCB 2DR0A 4YYEA 4BFZA 1PO7A 4KPUB 1M0TA 4UJ3A 3VPGA 4DM4A 4HWSA 2RKBA 2FJBB 3CRMA 3SYNA 3LOQA 3NT2A 4AK9A 4AZ3A 5KNGA 3FZGA 1JSCA 3ORSA 3JU3A 4GXNA 2EQ5A 4EB8A 1O94C 2G06A 5AQ7A 1LDBA 1V7ZA 1AGXA 1Y5RA 2BT4A 3ISTA 5SYNA 5C7LO 1Z0SA 2V59A 3D5EA 3FUMA 4DV4B 5K3FB 1JAHA 1H0SA 1OAKA 2CVPA 2HNBA 1E7SA 3IAM1 3KQYA 4LEIA 4OIFA 3U7QB 1FBNA 2IRWA 3GCDA 4I19A 1NVFA 3C8DA 5L9AA 1GNLA 4PBSA 3SSMA 1QQ6A 3H7AA 1PIWA 4YQFA 4GX5A 3BORA 2QPLA 3UMGA 3IKTA 3W1WA 1GG8A 4DTIA 5IF9A 5EJ6A 1W1WA 2J4BA 3DL2A 4OSOA 1VSBA 3EQ2A 3OURA 3FOEC 1QX3A 4RJIA 1TFUA 2XTAA 1Y7TA 3CX7A 4HFRA 1R0KA 5COBA 3UKDA 4ZKDA 2WIBA 2EJVA 1ENOA 2QD2A 5HDQA 2HR1A 1Y9ZA 1UJCA 1XEWX 2A94A 2WHQA 1YDHA 3D43A 4AD8A 3HNOA 2VP9A 3JSXA 4ARUA 4ZJYA 3Q0IA 2Q3DA 3O75A 4AU1A 1KMHB 3KDSE 1Z6YA 1ADBA 2VSNA 1OGYA 3HCNA 4XJSA 3HDJA 4IICA 4C07A 1ULUA 4EVIA 4TXPA 2HO4A 1IRIA 1XT6A 3ABIA 3FJOA 1NBME 3EGXB 3TRIA 4UI9J 2V54A 4PBTA 4L4ZA 5GADl 4ZI7A 2UYOA 1IULA 2XNJA 3QNWA 2RFAA 1VIYA 2P6RA 3AEKA 3DWGA 1VJ0A 3QU9A 4I3GA 5ADVA 2XHZA 4IUBS 4YB8A 2FHSA 3WLFA 4YREA 1UP6A 3ESLA 2PHZA 2DLDA 4U0JA 2HF9A 5AW8A 3OU7A 1HFAA 3ET5A 3NHRA 4WK2B 4MVJI 2IPMA 4OLHA 1ZK0A 2PUWA 1LRKA 2XS1A 2OVFA 5CIWA 3ZHXA 3WLLA 2F1IA 3EUFA 1CQIA 1X14A 4EHKA 3U4QB 3ZQUA 3HZRA 5JQGB 2D1FA 3QEMA 3CX3A 1YYHA 3MA5A 4NOJA 1XEFA 1YZFA 5EKQD 2Y2UA 3HNRA 4DDHA 1K86A 4JHKA 4HVCA 1Y6ZA 4RV9A 3DBHA 1RYZA 3PFNA 4IIEA 3OEHA 1IY0A 2ZDQA 4BKMA 5KWJA 5BW4A 3JVEA 3RVJA 2V7QA 1CEQA 2JA1A 3ZYLA 1R2QA 2I2CA 4G0XA 1W2HA 3TWXA 2W2KA 1PS0A 1IBLB 4TV8B 2V7QD 1Y4ZA 3T5DA 3MBKA 4FFNA 4JBXA 1J8MF 3UK2A 3WFIA 1XQYA 4PH4B 4IGIA 4XOUA 1FX0B 5BOSA 3OG9A 2OOSA 1DGQA 2CMKA 3ZXSA 1S2IA 3LF2A 4KWCA 4ZI3A 5K0JA 2NTEA 4MUYA 4R8MA 3OQMA 5CGQB 4PZZA 4HI9A 1VHJA 4ZTZB 3LOUA 3RYFB 1R0LA 4J8PA 5CA1B 2J09A 2BTQA 1MX5A 1EFPB 2X13A 2Y0PA 4BFUA 2YXNA 4C7OB 1HL3A 2VPPA 2VQ6A 4AUEA 1GP2A 1JH8A 1H2XA 1QB8A 3NKLA 3PC8C 1ZJ6A 3QVVA 3V31A 1XZKA 2QWXA 2WNSA 4LV8B 3E34A 4OQQA 4WA8A 4XGQA 2MSWA 1BWQA 1J5XA 2DKOA 4F0JA 5A6SA 2WLSA 2V5QC 1CW2B 3GP5A 4UTZA 1ODLA 4KO3S 1E0KA 1GCGA 1FRNA 3NIBA 3PYMA 1H2WA 5A9RA 3LU1A 1ZUNB 4X62B 4C6TB 4LECA 2GPAA 1BXZA 1P9LA 2H17A 5ES3A 2JFZA 1WZ2A 2NYUA 4F96A 4RZIA 5J4VA 1UEXC 4X7RA 4C22A 1A5ZA 4B2IA 2G9NA 3X0DA 3NP9A 3T4UA 4Y1GA 1RXSA 2BBOA 1OVGA 2W93A 5ECWA 2HCTA 2PRZA 1A4IA 5DSTA 3PYXA 1IATA 3NJ4A 4D81A 1SC9A 3UM2A 2GKGA 3QFFA 4LBYA 3C5HA 3MEQA 3K1YA 3QBDA 4IIVA 4LNAA 1RLJA 1E6CA 4MR9A 1C0KA 4OUDB 5DHPA 3HXCA 2D8AA 5HKPA 3DFFA 1SHUX 3SKXA 1ZZEA 3V7YA 1PVOA 4XXHA 3H2ZA 2F7SA 3LQ4A 4DLWA 1N4PA 3AL3A 2XE8A 3I73A 2GNPA 3OFKA 4O25A 3TI7A 1RAHA 3WJAA 2SCUA 3DWLG 4I9FA 5BXUA 2A5JA 2FXIA 2PRJA 4AVYA 4ZVQA 4N65A 4MAMA 1E7MA 3ZG6A 4FS8A 4DCSA 1N8KA 1G38A 1GAJA 3VR3D 1LW7A 1QH8A 2IOSA 1LWNA 1SVOA 2FSVA 2Z8YA 3U9SA 3SIRA 3CH4B 5EYLA 4E09A 5L7WA 1RSZA 1YKSA 2D0DA 4L27A 2GT1A 2JIDA 2G5TA 1R10A 4Q7MB 4HUQA 5BXOA 2GJKA 3SR4A 1JU4A 5J2UB 3ZWBA 2G9QA 1RU3A 5JBIA 1ABEA 2RONA 4RLFA 3PFBA 3Q3IA 2GBFA 3DBRA 3P9CA 4W99A 2CLOB 3EXG1 1E60A 3E8SA 4W8OA 3HVIA 1MJFA 3ORFA 3UMSA 1QCYA 2X1LA 4HDKB 5IDQA 1SB8A 1PGNA 3VDRA 2RHCA 3GMDA 2B0OE 4FX5A 2C7VA 3G79A 1XEXA 5A4JA 3R44A 3PA8A 1BNCA 3V42A 1J33A 5FJIA 3MS2A 1C80A 1Q14A 4JVSB 4A0SA 3HWX1 4PZUA 3ZTWA 3SY2A 1T36A 1PK8A 1AQYA 1CD5A 2Z0MA 3GJ7A 3GXBA 1Z25A 4IFIA 1I1QB 2ODWA 5EE9A 5FOSA 4F3CA 3AESB 3C6ZA 4U7HA 5DGIA 3AHFA 4NHEA 2W6ID 1CBUA 1ZSYA 4MR8A 1P80A 1V7CA 3R6DA 4LRUA 3DH0A 1WQ3A 1JA1A 1JI0A 1UWCA 2MJLA 4URHA 1G8JA 1G41A 2IXGA 4L9PA 2CG2A 1BE0A 4ZT3A 3K5HA 2FZGA 3DE6X 4F12A 3K2QA 3FCSB 4IDAA 1GSHA 4DRXA 4CLOA 3FSRA 4YP5A 1X2EA 3PR3A 1N9KA 3RJZA 4UU0A 1SNYA 1AA6A 1HSOA 4ZVOA 3GLHA 1KC1A 2C2WA 3K3PA 3QVLA 4LSMA 3RYTC 2RSFA 4FILA 3R9IA 2IQIA 4M1KA 1RRGA 3NJRA 1S7CA 3QI2A 4N49A 1P31A 4IM7A 4CDRA 1R9JA 2Q99A 4ZVPA 4RW0A 5L7TA 3FSGD 1R50A 2JLXA 5JAIA 1L7MA 4GSYA 2NU8B 1QFSA 2RB5A 3QVJA 1DC2A 3SX0A 2H2GA 5EMHA 4FFPA 4L3WA 4QASA 4AI6A 2DPMA 3X1KA 1KFCB 4CMEC 3WADA 1PUIA 4OQ4A 2ECFA 1TNUA 3HXFA 1CRPA 4X1IB 3ZWDA 2AD5A 3LD9A 2B2CA 5D3MB 5EUMA 2R3SA 2LR0A 1ZOLA 4JYPA 3C0KA 1NP6A 2R66A 4L76A 3K9HA 2HT6A 4WCFA 3PDIB 2IIQA 4KWEA 3QDNA 3LHDA 3VHLB 4BE9A 1SMKA 1PGQA 3ZU2A 4L15A 2Y8EA 2JJ2A 1RBQA 3ZGOA 5JDIC 1ZOPA 1JS1X 1TNZA 3UWKA 2OHHA 3U44B 1U5CA 4H1UA 2JBAA 3EN0A 3IOMA 2G9RA 4QJBA 1E8YA 4UNNA 3GGSA 1SD2A 3RRMB 2V7BA 2BHSA 1XPOA 3MCZA 5G05J 4OVKA 3G68A 2GRQB 1HTWA 5TT0A 1ECLA 2O1SA 5LSAA 3WGUA 4X1YA 1T29A 1E8OB 4WX2B 4JL0A 5F2OA 3X1WA 5EE1A 3CG0A 3VC2A 2XGGA 2P58C 3NU1A 2F2TA 4XSVA 4MWTA 2IW3A 4DDKA 2AJTA 1P19A 4MEJA 2R96A 4XX5A 2ZIFA 3I5UA 4BX0A 4D6PA 3B13A 2FCRA 1W0KD 3TSAA 4DZTA 4KWTA 1ZZGA 4PZDA 3WDSA 4R8KA 3WHPA 4DANA 5TGZA 2VJMB 3C6KA 4QBFA 1MCZA 2C84A 4CM8A 2FLWA 3REGA 3R0VA 1NXPA 5FPYA 5M34A 2HU2A 3SNKA 1DIHA 5D6OA 3RAUA 3DC7A 3FPCA 4YACA 3LJ3A 2E1PA 3MAAC 5B3KA 3LC1O 5AJYA 3K32A 4XIJA 1E1LA 1DTWA 4Z0TA 4B6GA 2WOJA 1H2AS 2AKAB 1DG3A 4AP9A 3COPA 3GNTA 5BV1A 5KKCA 1BMFD 1PSWA 2CLCX 2C9MA 1PEYA 5ALQA 3SYKA 2E0IA 1GN8A 2OCKA 5FI0B 3VJKA 1EVYA 3IR7A 2C4KA 1ZCJA 5DOZA 3NYWA 3LRTA 3V8RA 4EYQA 3O8OB 1SCNE 1VPEA 3WV4A 4YECA 1QHFA 3GRFA 1K2VN 3BREA 3JQCA 4NZYA 5AI4A 1S2LA 4JODA 4HX2A 2C98A 5CFPA 5KTTA 1OZ0A 1RQ7A 4QPZA 4CM9A 1CCWA 4M9XA 1UJKA 1GUAA 1MT3A 5AKKA 2L17A 3T3OA 2J9FB 1XU9A 1TZCA 4J0DA 4PS1A 4S2UA 4MZXA 5F5LA 5LZ5A 4AT1A 3DA8A 1HDYA 2FR8A 3T0IA 4UVHA 1WDLA 4IDCA 2APJA 3V7UA 1TYBE 2X0IA 4GUAA 4PC2A 4JUCA 1KJJA 4KAAA 4RK6A 2A35A 1AS0A 3ZYQA 1YAJA 2BUAA 4WLUA 2ZI3A 3HH8A 5A9SA 1XO1A 5ITVA 4QDKA 4NF2A 3GVCA 2QQ5A 2YS6A 3C72A 3R40A 4RTKA 5BMVF 1YL6A 2HY7A 2HMAA 4Y30A 4Y6SA 2XCRB 1L7VC 3AVWA 2PZFA 4OQPA 3RVQA 3AJIA 2FPLA 3GZ1A 1H9CA 1ECFA 2OP1A 3TTXA 3QELB 3B7WA 4WKBA 4V0QA 3HCFA 4LMBA 2GBLA 1CB7A 3UJ9A 3WLNA 3MKQB 3Q40A 1JQBA 3ABLE 1OBCA 3MUOA 4JLKA 5FI5A 3PF9A 2J48A 4MWGA 2QW1A 3RAPR 2BFCB 2WNHA 5AXAA 3EJWA 3HJCA 3QTTA 5JARA 2HV8A 1KT1A 3DPUA 3ENNA 5M29A 2H1VA 4A8JB 2C59A 1AMUA 3IQIX 2IUSA 1JQ5A 4O4HB 5AT1A 1TCCA 4WMLA 3O4FA 3TH5A 3MSCA 2E4XA 2VPWA 3GEMA 4G5HA 3A3YA 1C5KA 4U9UA 3VISA 3LRXA 4WWOA 2P6PA 3F9CA 3H99A 5LOZA 2A0KA 5NULA 5T3RA 1TKRA 3VKVA 4TKVB 5T41A 3RTBA 3ZY5A 4M1MA 4Q02A 4CTMA 3K70C 4ENRA 2XJ4A 4RD4A 3NBAA 5IUJC 5IKXA 1TRHA 5IJ9A 3RS5A 1GVHA 1N7HA 3TS1A 3HR4A 3B9QA 2J3HA 2PL1A 1B89A 1D6JA 1WXQA 2OFXA 3NTLA 4JY7A 3RRXA 2GNAA 4FEEA 5FI1B 1Z5NA 2NYVA 4D25A 2CL0X 3ETLA 5DNDA 2XY4A 1BD8A 4JP5A 3AIKA 2LCIA 1R74A 1NXQA 5FFFA 1AOXA 2ALJA 2BDTA 2DH5A 1Z8NA 2WOOA 2X1VA 1L4LA 1ISFA 4QVKA 3R3XA 5IK2A 3S7FA 5IK2D 1SOAA 1YQXA 2CXXA 1CF9A 1LS1A 1BSVA 2CDCA 2DHQA 3CKMA 4HQRA 4RHEA 3ORRA 5CJPA 1J8YF 1FSPA 5F21A 4U3JB 4RSRA 3BT3A 1GGFA 1QZ3A 1R66A 1DTEA 5KNHD 3DVQX 4DLTA 3VQTA 4OK5A 1W8DA 4YGXB 1L1FA 3EB9A 1FS4A 3EZ9A 3NDJA 4EPZA 1QCZA 1QRRA 1N2HA 1SG6A 2HPVA 2ODBA 4WE3A 1Z75A 1MBZA 3OJCA 3RU3A 5FI3A 1NY6A 4DOMA 4EG1A 5KBAA 2N47A 4ZMSA 3DHEA 1ANKA 1S8OA 2VPYA 4ZAXA 2OFOA 1UM9A 1W85B 4HXFB 4MGKR 1O97D 3KTAB 4L4SA 3KUCA 3P9ZA 4BUZA 1K5HA 2O8NA 4BLUA 4DV6B 3FKSD 1R4MB 2JFQA 4ZYUA 3MRSA 1JFRA 1V9SA 1DX4A 1IQUA 1J22A 2IL1A 2PSJA 3V1TC 4E2YA 2Y4OA 3KKQA 3RFCA 3FRIA 4OP2A 2VJQA 3OZFA 1DXHA 1P9NA 2XVXA 3AS5A 1LVGA 2P5UA 5G40A 4M6WA 3FTYA 3BMQB 2VNJA 3FZEA 5EX0A 2PN1A 4NURA 1J25A 1JPVA 2ZYDA 1HK7A 3F2VA 2LIPA 3L0CA 4TWBA 5CITA 1SBYA 2WTAA 5E3IA 2ARKA 4JLBA 4B82A 1MV8A 3N2YA 5G04J 2Q4TA 4FHDA 3BHIA 3QXHA 3SZOA 2QL9A 4KITB 1YV9A 3QV1A 3ONDA 3W4IA 1TMKA 2GN0A 4G81A 3ZCVA 2QT1A 3P2YA 1NRJB 1P2DA 2DGDA 3BA6A 3N07A 3N2IA 2D2IA 3CF4G 3DLAA 2GAJA 4AP5A 1RTTA 3H8VA 4JLMA 1NE7A 2TECE 3EULA 4NYMQ 1HE4A 4Y1FA 5IT9A 3DONA 2CUNA 2AFHA 2CXOA 2OKGA 1D04A 1NURA 2N1MA 4BNJA 1DC6A 2H6GA 3AESA 5ALLA 3A1SA 4QNMA 5FBQB 4FBGA 4AECA 3I9OA 1EWKA 1MVNA 4ZQFA 2MSDB 4UHCA 4YP1A 4KXLA 1A1SA 2FR0A 2OAQ1 3KEZA 1K8XB 1KAMA 4P80A 4CM3A 5JNTA 2VRWA 1MO6A 2ILTA 2QMQA 1LI5A 4G2NA 4W7HA 1A9PA 3GUUA 2PMCA 1F2TA 3FJYA 4J0GA 2RD0A 1JI3A 4N2QA 4R2HA 1E1KA 1KVUA 1PGPA 3MJVA 4JJFA 3AY6A 4BUCA 1H9BA 3APDA 5BWOA 1FTWA 1W9HA 5FBRB 4K6GA 4S0XA 3DEZA 4C87A 1EUDA 4K88A 4PYQA 1G4HA 1LGYA 5LXTF 1GZVA 3KAJA 3MW8A 1EDBA 4AN1A 4ESOA 3CEJA 2GCGA 4LMRA 1YHYA 3ZCTA 2SHKA 2OK7A 2J4DA 3VGPA 1E9SA 3QVMA 1SAYA 4YAKA 1EVQA 2B5VA 2GXQA 4ODIA 4Y2VA 1E58A 2F6RA 2Q1YA 4M1TA 3RR2A 2IY7A 3CF2A 4EYOA 1P2SA 4M9RA 2WXGA 4Q4DA 4OAUC 3M6LA 1KDVA 4B3TB 3CUEF 4TVBA 2ZWMA 4KZCA 3HUFA 4YAIA 1P73A 3MJCA 1SA0B 1MGPA 3ZD6A 4FR2A 2EP8A 2WVGA 1J49A 4D8XA 1Q15A 2QHXA 3AJAA 2VP3A 3E32A 3CKYA 4GEGA 4ARAA 1P2UA 2Y99A 1IHXA 3K53A 1S1CA 2HA0A 4EHJA 4Y6PA 1VJ5A 5CB8A 1J42A 3CRZA 3CK8A 3W6UA 3D9MA 2IHJA 2OQIA 1WD7A 3O92A 5DSZA 1R8YA 2CW5A 3AXTA 3KB2A 2ANBA 4WKNA 3CVWA 2O2JA 4I1OA 4PAGA 4WI1A 3HB1A 4DKXA 2HCJB 5SYAA 3LUDA 3WK5A 3CVPA 3X1JA 1LBEA 3OJLA 2D13A 4UJ5A 2ZJOA 4WW0A 5U4QA 3DZHA 3V97A 4EEXA 1ZK2A 4P0TA 1JG7A 3ZFWA 2QR2A 5H4GA 3QKSA 3B7SA 3NIWA 1EYHA 1TECE 2OCCE 2HJHA 2Q07A 4XKBA 4M9ZA 4HADA 3NRBA 3SR0A 5JSHA 4WDRA 1CIVA 3IPCA 4FYWA 1I3CA 3H9EO 3OPVA 1LV7A 1J0XO 4LTDA 2GGFA 3E82A 3KXDA 3UJCA 1AHPA 3EHRA 4CV0A 1SUAA 3OQHA 4CLOB 2GYWA 1E1YA 1P2FA 4I36A 4PPNA 2G5GX 5EIWA 3PIRA 3TQTA 2ZYRA 4WERA 5CJJA 1O94A 3VH2A 3OQ1A 4PE5B 1A5AB 5FPSA 3D8NA 2I6SA 3F5DA 1GTVA 1U2TA 4M7OA 4U2GA 1W30A 1VMEA 2GF2A 1CIPA 4GZLA 2A9KA 1WLSA 3BIXA 3OQIB 1E6EA 3NRCA 3E5MA 4XYBA 2Z2IA 1XJ0A 4O2AB 3L1JA 4YV1A 1VLJA 2WUVA 4MCAA 1L8LA 2ZAYA 3RSOA 5K6AA 1CJMA 4B7UA 1VKHA 1T6NA 1DFIA 4EG5A 1RQ2A 5C8YF 4QFMA 4CTJA 5FWQA 1XTIA 3IB6A 2XZOA 4WGGA 4IXMA 4AUMA 2PIDA 2XRZA 3EXEB 3HYTA 4RL4A 5HIMA 5CMWA 1WX1A 3F74A 1L4MA 4HDKA 2A4KA 2PMDA 4MQLA 1HDCA 1R9GA 2WHEA 1T1GA 4P4TA 4KZPA 5TT1A 4WCFB 3WWEA 2DC1A 3B78A 3O4JA 1RZ4A 2A4ZA 4K46A 4V03A 1T3ZA 4F3TA 1SURA 1PBTA 2BM1A 2KBEA 4W1RA 2XNCA 5JSFA 2J33A 1LK5A 1VSVA 2Y0BA 3UMMA 5KYUA 3C4VA 3IV6A 1C0EA 1M6VB 4OI4A 1YS2X 4KQ6A 2ZSHA 1MC5A 1SCUA 1MOPA 3GRZA 4Z2YA 3AVVA 4S04A 2ATIA 2V7GA 3Q5EA 5HQJA 2XUFA 1UAGA 1E4YA 5FTPA 2JANA 2Q0QA 3ABRB 3DAPA 3H3FA 3KEFA 3MF4A 4BFWA 4FLBA 1OXVA 2FEWB 3GLGB 3E2IA 3NCHA 3T8KA 1NQWA 5DBGA 3P0HA 4ILIA 2PMKA 4M22A 5I48A 3DV0A 4RXUA 1C9MA 3SKVA 5JAUA 2P9PG 5SZIA 1RI3A 3G8DA 2F9FA 4GXRA 4E03A 3QTBA 1JKIA 2X2OA 1YRLA 1I6WA 3SI5A 3EXHB 1PFQA 1MLDA 4N0PA 4DC0A 3M8KA 5CXSA 3EZ7A 4HCJA 6ADHA 1QGAA 1P91A 1E3JA 2OP0A 2QLTA 3F71A 4XUDA 4A8TA 4AWXA 1SCDA 2OL4A 1CUEA 4OHXA 3L0ZA 4YDSA 1A72A 4FWTA 3WDLA 3WYCA 1NBWB 5IABA 2RFMA 3GVXA 2B4RO 4G1BA 3SMVA 3VYVA 5FH9A 3O8QA 4RXTA 3SD5A 1N3LA 4KIUA 2EBHX 2W2XA 3ZGYA 4F04A 3Q9UA 3CLSD 5DW0A 3D6FA 1D1PA 2JJMA 1CJTC 4LQ4A 4TMKA 1SOVA 2CJPA 1ZVQA 1TC2A 2JK1A 3OIWA 1CUYA 2CYBA 2HHAA 2JH3A 3PQCA 4IJMA 2YJ5A 4IZHA 4OL9A 2GPSA 4WN3A 3VVLA 3T9AA 2YYYA 1TFRA 3K16A 3PDCA 1XTPA 3WGMA 2EG9A 2HD4A 1EWVA 4J2TA 4QUHA 1ZNQO 2NQ8A 3LHIA 4UBKA 2RHDA 5AKJA 3QF7A 4HYTA 2BCJQ 3ZUGA 2F3QA 1M1UA 3LVRE 2H1IA 1NN0A 1QYXA 5ENPD 3T5VA 2R47A 2ZR0A 3I62A 4QECA 1T2VA 1AO3A 3LTNC 4Q47A 5HQ3B 1D2NA 2YJ3A 3K0CA 3EEFA 4NV1A 4PAOA 5DE3A 1PQWA 5AXDA 2E3JA 2JGRA 4MS1B 2PKCA 2GJ9A 1RHUA 5IDVA 1X7GA 1BGVA 1KKUA 1WXFA 2OXCA 2Q3EA 3L6AA 1NUTA 1T8WA 3NHFA 2UYCA 2IH5A 4YCLA 2JFYA 4ANFA 3R9AB 1PLLA 2Y0EA 1UT6A 3RSHA 1W4BA 5JCOC 4LNBA 1GXSA 4EKIA 4YAUA 2GLXA 2BMWA 1ZH8A 4URWR 1WXHA 3H6KA 3ECSA 3K0KA 4JU8A 2XUDA 4GX1A 1N9GB 2VNHA 4KO2S 4ZODA 2R68A 4XI0A 1E3MA 1VRWA 1AKEA 2WTXA 1L4NA 3ASVA 4KDRA 4J6IA 3EXIB 4KPYA 2YOGA 1H2BA 2RGUA 4M9UA 3HJAA 4ZQCB 4PSVA 4LJ5A 3GQBB 1GDTA 4RUKA 1Z6QA 2P8JA 3BB1A 1CUXA 1N5DA 4NATA 1M2VA 2FJPA 3QARA 3CBQA 1AK1A 2QE7A 5FYQA 1GSIA 2QL6A 2CDBA 1PBNA 3AG5A 4BTLA 4KNYA 3VO9A 2AI2A 4YY3B 5K01A 5FF9A 3DSSA 3BILA 2KSQA 4X64B 1NN5A 2J5RA 3ADDA 3GWGA 3A2LA 4UUQA 2L6JA 5DX8A 2E6UX 1L5ZA 1SKYB 2A58A 3A3KA 2HDHA 3B7PA 3OZWA 1AU9A 2IPNA 2WQZA 1PJRA 2YXBA 2H2DA 5HMLA 1W2WB 4JL6A 4TUYA 1N8TA 5CGZA 1U80A 3W8EA 4YT2A 1J99A 3SVLA 1IEVA 3SOPA 3D2AA 2HQ1A 1SO8A 1RMTA 2VPTA 4I55A 1V11B 3C7DB 4L07A 1Y1SA 1DKLA 1JMKC 2YHAA 1TEHA 2FK7A 3BMNB 3R20A 4GBMA 3SJZA 3W6NA 2DK6A 4Z7JA 1Z56C 2VDMB 3E6AA 4RV5A 3QV2A 4L4YA 2Q45A 2HCBA 3C98A 5IVHA 5F64A 3ZD9A 5EFZA 1GQQA 5A3SA 2Q3HA 4DA9A 1TRKA 1PG5A 3DCNA 3EF3A 3HMQA 5DBIA 3VSAA 3QU4A 1LBTA 1VJDA 4EHFA 3KD3A 2AN5A 3SZ7A 1PE0A 1Z0AA 2QRGA 3C3EA 1W4CA 1U9CA 2E4ZA 2R9VA 3RKUA 4BHTA 1TZBA 4AJKA 4I1MA 5JADA 2PJDA 1Y34E 1R4MA 4BB0A 4CF4A 1YS6A 1DOAA 5A3QA 5EIDA 3DDOA 1SHLA 4RVNA 2H57A 1UDXA 4B3CA 3CCBA 4ZV4A 4DI4A 2IS6A 2XYPA 2F8YA 2X0RA 4HH1A 5LQJA 3TWRA 1JIJA 5C1DA 2EU8A 3FPLA 3ABKE 4FI3C 1ZD8A 4HRVA 5HGXA 4N82A 2J67A 1X8XA 5KNCD 3T0GA 4ILHB 2M6KA 4F38A 2XSZA 1PR1A 5AHWA 2FEMA 3ZVRA 5CTAA 4D0SA 4LHEA 3ZDZB 4PYJA 3IHVA 3NHLA 4RO0A 5HR5A 2XCOA 4YGYA 3I2FA 2HK6A 2KWIA 2MYTA 1E9DA 2X7HA 3MT9A 1NVUQ 4YHBA 1W5AA 2Q5QA 2VCEA 3SF4A 3LBAA 3OOHA 4JP3A 2J0QA 1S9DA 3P2BA 3CHQA 1L7PA 4K6MA 3Q15C 5IASA 4A2CA 4XLTA 4LY6A 3LDHA 3LQFA 3M81A 3U49A 2DZOA 3E15A 2HH9A 1I5RA 2J9RA 2IKQA 3W9SA 2ZJ7A 1W4LA 4ZAYA 1VCNA 1RE0A 3L92A 2QVLA 3AB8A 2WT8A 3O31A 3ANNA 3GT7A 5DHRA 5MF6A 4L5JA 1OY3D 1DC3A 1ML3A 2QYTA 4CKZA 2WTUA 5KTKA 1KBZA 3QXJA 3VJLA 5FULA 5HRUA 2BGNA 4QRDA 3TXYA 5HIJA 3QX9A 3AFOA 4RD6A 4UQOA 1XHLA 2VJBA 4L22A 3P97A 1K97A 1GM5A 5DM70 1DO0A 1IUOA 2C31A 2C8JA 3OM0A 5DNAA 4BN4A 1DEOA 4YP6A 5TIIA 1YA0A 5G04C 1AQIA 4D6XA 5F1KA 1XAGA 5H80A 2TMKA 1R1DA 1UEJA 3I6IA 2FSVC 2PGAA 4LRZA 3DLPX 2H0QA 4J07A 4L50A 3T1YB 4H1HA 4F8EA 3L93A 1O0CA 1JFFB 1HDRA 1JQ3A 1OCEA 3LT5A 3N5KA 2RG1A 5JASA 1E79A 5DGXA 5KS2A 2AXPA 3LFTA 4ZZ1A 1EK2A 4IZOA 4BKRA 4G5XA 3W4JA 1KKMA 3O2QB 5B7GA 5FORA 1WW2A 4YIHA 4BVBA 1ULAA 4MUJA 2L0TB 5CAEA 5DLQC 4ZVRA 3V8BA 3WXBA 3I8OA 1U4NA 3PUXA 4JB3A 4O4JF 4A2PA 3ZDDA 3UT0A 3LJKA 1KT0A 4FCVA 5JWRA 1RHQA 2AWOA 1E9RA 1ZGBA 4HLEA 2OD7A 1I4LD 3PFWO 3LY9A 5BP7A 3NVKI 2HHJA 2IPOA 3VBCA 4CKBB 3K2IA 3O3OB 1NJ6A 2GJ8A 2HB6A 3CX6A 3ASYA 3UH1A 5DN6D 3THYB 1WF6A 1MO2A 2AK3A 2OPBA 1N0IA 2Z4SA 5I7FA 1GKLA 1STOA 2IBSA 5F9HA 2R05A 1XMSA 3NWJA 2CVOA 3IJPA 3FGOA 4KW7A 4CL3A 3TG2A 5JA4D 1ZCZA 2G8NA 2EFCB 4KSBA 1WTAA 3KJZA 5HS6A 4O4JB 4UXIA 3PVLA 2IFTA 2O6HA 2XB8A 5TLSA 5MN6A 4YRFA 3DE3X 3LAWA 3CH5A 4ESEA 2B82A 4MROA 4ZOLF 1HOTA 4FD3A 2GK7A 2GESA 1AUXA 1HFEL 3I6MA 1K89A 1QGUB 4M1QA 3FTEA 2EFDB 3OEWA 4AO8A 4DIUA 3UK1A 1JEOA 3L8FA 3VZRA 4DMGA 5HS0A 2PO7A 4Z0HO 1F8FA 2BFAA 5GAJA 2OZEA 3M4XA 3GZNA 5JAHA 2O06A 2OA0A 5CK5A 4KQGA 4ASUD 2FSSA 3JAKB 1N4RA 4JEUA 1TF7A 4PXSA 4QQKA 3VR5D 4WBSA 2P4HX 1QP0A 1JQKA 4YVOA 3PI6A 4K9QA 3HKCB 4UBNA 4NRHB 5AW1A 3A1CA 2PE5A 1XHFA 1U3WA 4Z86A 3PC2A 3KLBA 4QOFA 4RF3A 4CQMA 2WR8A 2DFNA 3I32A 3OCXA 4KJXA 3MCAA 1Q17A 4DPLA 4Y6CA 3W2FA 2V0NA 3WIVA 1K6IA 2CHXA 3CU5A 3MVEA 3L8MA 2HADA 3N2NA 5DXJA 1DZIA 2O52A 4R2KA 4WXEA 2FB9A 4N41A 2YHUA 5HFNA 3ZXYA 1KY2A 3LUHA 5DXFA 1WPRA 4YDEA 2HA3A 1K98A 2OBYA 4ZJZA 5H3CA 3DE5X 1R3DA 4LYGA 2Y67A 3WRVA 1PT8A 5GJWC 3TCKA 5LU9A 1VE9A 2AZMA 2F8XK 3FOWA 4RJKA 1NONA 2OZVA 3A9TA 4LYDA 3H42B 2HSDA 1P4HA 2PTGA 4UFNA 3GCZA 1FXUA 5ULLA 3CRW1 5AKIA 4BE7B 1BKYA 1FSSA 3LF1A 1WABA 3AM3A 1K8KG 4RMJA 1BA3A 3Q3JB 5DP1A 4TLBA 4MEBA 3TBHA 1G6Q1 1Q21A 3PQ8A 1UOPA 4KPGA 2B8WA 3QLVA 4UWFA 4C3VA 2NSZA 4G26A 1HL7A 2R6JA 2XB4A 4QXRA 3VTKA 5HEKA 6LDHA 1AV6A 4OATA 3U3WA 1QH1B 4XGIA 3FHLA 5D5PA 3SHOA 1U99A 4JP2A 4Q16A 3FUNA 3QAQA 4DQKA 3OOYA 2XGOA 3LGAA 4WV3A 2VSYA 1F0NA 1XXHA 3GJXC 3I6QA 3KE9A 4G8KA 2CCKA 4KXUA 3RS3A 1DQRA 2YH2A 3L41A 5LZ9A 5IPFA 2VUSA 4F9FA 4HRNA 3K0AB 4U39A 1YS7A 4N47A 2AHRA 1EX9A 2WU1A 4G1TA 3Q1LA 3AL2A 4ALIA 4ZI7F 4RANA 9ATCA 2DETA 2QN9A 1RQXA 2Y68A 4JXKA 3JARA 1N0QA 2G0AA 2I1WA 3HVEB 2JABA 2G4LA 1SVXA 4X41A 5CA1F 2FPKA 1N92A 3GX1A 4CKCB 2FRVA 2L82A 1P9WA 2DUWA 5A9TA 5AESA 2IF4A 5AICA 3S2EA 1XLUA 4PLHA 2WMNA 1KL7A 4DQVA 2V7VA 4JITA 1UDAA 4BMVA 1T8RA 4UNPA 2EZTA 3H11B 4M9CA 2ABWA 1PG0A 2YIJA 3MINA 4PC6A 5BWLA 3FUEA 5G3YA 2D0PB 2HXSA 3W2GA 6PFKA 3ZJUA 1DRKA 1J8FA 5DLEA 4MQUA 1EUZA 1KI6A 3KR0A 5EXPA 4ARSA 4EWLA 4IIFA 1NKVA 2UZ3A 5TY0A 3GLFE 1SN7A 4O2BB 4RE5A 4G0NA 1X13A 3DXKG 3HXLA 4U0KA 1N2XA 2R8OA 1W36B 1SXJE 5B1YA 4LVOA 2XEEA 1JEYA 3SM3A 4DCVA 1GA1A 4MPTA 4BRUA 1ZESA 3HKBA 1OI2A 1ZS9A 3KZKA 4NAUA 4R01A 1FRZA 4B4VA 4FP9A 4RK0A 4BVLA 4BX2A 1GTMA 3HU1A 3MCUA 5MN4A 1C4KA 4E2FA 4V02A 2C4HA 3PENA 2F4NA 3V4VB 2E6KA 4XVHA 4D3SA 1QG4A 3W1VA 5IT4A 2JZOA 3QWFA 5HQ3A 1SIUA 1TO1E 2IH4A 2CUTA 4TQ9A 3C74A 4RVOA 3TZQA 3VNSA 3TUIC 2G72A 2VQ2A 3DR3A 4LHSA 1PU2A 3CLUC 3FBWA 1M2EA 3D3NA 3UXEA 4FXPA 2HHLA 4RABA 4JBNA 3SC2A 4DLLA 2CHEA 1OZAA 2H3HA 2Z9DA 2ZUVA 1TYDE 2RCNA 3I3OA 4IJ6A 1NG9A 4LWOA 1W87A 1Z35A 2PGNA 2WC1A 3C15C 3C7TA 2QTNA 1KETA 5LQNA 5F12A 3M3HA 1H2ZA 5FOQA 1R4ZA 1LDEA 2ZI4A 4BWGA 1EG7A 3LIPA 4FKZA 5AI9A 3ZV3A 1E6LA 2Q29A 4NH4A 4C5CA 4D0NA 4AXXA 1B6SA 3D7RA 1KSGA 1O77A 1ESZA 3UKRG 1OT5A 1TOAA 2Z8XA 4O4HF 1EK5A 1E6WA 3CY6A 3X1YA 2IZ6A 3SSAA 4FHGA 4ENQA 3OQOA 2JCSA 1HLPA 1PWHA 1Q0PA 4E31A 4DNXA 3FDHA 4TYQA 1XTUA 3GAFA 4XDZA 4HZUA 2DFVA 1AXGA 1V6CA 4QODA 5K4AA 5K0GA 2NTNA 3DTVD 3O7MA 3EIOA 5IWAB 3LOPA 1U3VA 3KQOA 1GPAA 3VZSA 2Z3WA 3DW3X 3P32A 2Y0DA 1W0JA 5JSKA 1WPXA 3A36A 3H87A 4I50F 1BHQ1 3ZHTA 1Z33A 1SK9A 1RMQA 2EILE 1UANA 4RIGA 3AR6A 4B44A 1G20A 4M0MA 2Q5JA 4LXXA 1ZU5A 2XDAA 1YBHA 2IV3A 1PI3A 5HCUA 2X0NA 4N3NA 1G0NA 2VT2A 2I7VA 4LXIA 1C81A 4QULA 3ZN2A 3L0DA 1R7RA 4XQ0A 1GPKA 4PPYA 3UAXA 1CY0A 3ELWA 3BKWA 3ZY3A 3W77A 3AEYA 5HJEA 2Z04A 1IXVA 1P74A 3L9WA 3D9PA 4ZT4A 1XKQA 2C96A 3OM8A 5HKKA 3JSAA 4HLLA 1Z63A 3UHAA 2P9KG 4BBJA 5A1JA 4GTOA 1U0OC 1SU7A 2QAGA 4WXRA 1CUCA 2GO7A 4QDTA 1Z2DA 5EUQB 4CI0B 3GNLA 5CDHA 3NGMA 4TQUS 2A88A 3NVAA 1MH9A 3AI3A 2V6GA 3FX2A 2R86A 3TNYA 4PHFA 2WYWA 1FP4B 1P0MA 3UTCA 4F3NA 2X3MA 4XIFA 4D9EA 1IDOA 2O2YA 2H1SA 2YIDA 3D9QX 5BN1A 2ZAGA 4I4TF 1R8QA 4IQGA 7ABPA 1ZGAA 3PS9A 4TYYA 2FQWA 1PNOA 1DTSA 2QI9C 1G42A 3INGA 4JI6B 3WRXC 3ZE7A 1C7RA 1M74A 1RCUA 3V2UA 2FPOA 1KWKA 4YNDA 3KUDA 1P75A 5EHIA 1TTTA 1HKUA 2IUEA 2W6CX 4NAVA 3L0YA 1LQTA 2B8JA 2BP7A 4DLZA 4HGNA 2REQA 1NNLA 3LK6A 1VMIA 5C7IO 2PZEA 2FDCA 1KYVA 1QIKA 3P2KA 1CY6A 1VJGA 3A3PA 2BUGA 2P2CA 4GHWA 4UU1A 2VPZA 2DBAA 4Q4HB 1CUHA 3JQAD 5K0BA 3AFMA 3D6HA 4MJLA 4CTNA 5ITZF 5K45A 4HDOB 3BUSA 1LTKA 2BEUA 1RPNA 1T0JB 3OZSA 5BSVA 3FF1A 5JROA 1U2GA 1QXSA 3KYDB 4DSZA 4IIJF 2WBLC 3QYFA 2I55A 3GYZA 1NLUA 2GDJA 4PIPA 2XYHA 4OMUA 5AUPB 3KSBC 1BG6A 1NMSA 1EM6A 3RWOA 3E4CA 3ZUPA 5I01A 1OLXA 1KAEA 2RC5A 1HT0A 4LMAA 5B6JA 3RTCA 3P27A 1LLCA 4UQYA 1EGAA 2XDQB 3M4NA 4OLBA 1A9TA 2QSZA 1KEVA 2R1TA 2V3CC 4F7DA 1G8KA 5F77A 3TTSA 3ENKA 1YO6A 1IEWA 4FFBA 4W6QA 3R4CA 5IF3A 2VHZA 4MEAA 2JDIA 2NG1A 3W8RA 1A4RA 3JWIA 4DNFA 3SF8A 3SJBA 1K4KA 1RI4A 4I50B 4BRWA 4PRLA 1OFGA 2WFAA 4RTNA 1IHUA 4QYIB 3GYXB 3G59A 5JJLA 2ZG6A 4AY6A 1KQ3A 4B09A 1CC1S 3VKHA 2AG6A 2DLNA 1V5WA 3TQOA 1AQ6A 5JY1A 4ENUA 3I8XA 1D2EA 3NM6B 4II3A 3X1ZA 1RXYA 3SU8A 1N2OA 4LZOA 3H9GA 1T43A 2ASEA 2O7NA 3CJRA 4J0HA 2F17A 4OV6B 4PS3A 2HGZA 2WU8A 3OF2A 1RJDA 4CV1A 4R3WA 1WR8A 3PX3A 4ZOEA 4O2LA 5DXAA 5CDUA 1ITZA 1KJZA 1YNSA 5EEHA 1Z08A 1L5QA 1Z16A 1URPA 2B92A 2EW2A 1CUZA 5FLKA 4C0JA 4D44A 1ZN8A 4J8FA 4TMYA 1QYRA 3R4VA 1PN3A 1SKAA 3QBTA 1OZFA 1IN5A 4WZBA 1WZIA 1J56A 1DIRA 4TTPA 4Y9RA 3LFUA 3VX3A 2R25B 3HXQA 1JHMA 4R0MA 2NO4A 5CXXA 3MMXA 4ZPJA 4ALNA 1U7XA 4MJ3A 4O1MA 5LQDA 3C7CB 3QK7A 1RZRD 2YRFA 4LXGA 3E7FA 4OGWA 5TQ0B 3UQYS 3D2LA 1CPYA 2GETA 5BQOA 3MMSA 1EH5A 4GOKA 1EUDB 4TX1A 3TBFA 1PQ4A 1QGYA 2BZSA 3LNCA 3PWZA 2UDPA 5I51A 1DO2A 4DCPA 4TWZA 3TIIA 3GN2A 3RO7A 3GC6A 1Y1KE 4U6QA 1CJSA 2C82A 1HT3A 4GPIB 1TM4E 3JUIA 4FYYA 4PONA 1QOQB 3MS4A 3E5HA 5CH5A 4GXTA 5T3UA 1IBSA 1A1VA 4AKHA 3DPIA 3WDMA 4ZC8A 4JOCA 3ADKA 1UIMA 3JQ6A 1X7XA 4HG2A 5HF9A 5JDCC 3ZS9A 5LCXA 1TM1E 2I6QA 4X20B 3O8CA 3WWPA 3IEGA 1N2ZA 1A2BA 3BIJA 3BG1B 2AE2A 3RS0A 1LSUA 1RBZA 3U3MA 1TZMA 1PJBA 2PX4A 2EKZA 3ZK8A 3UMYA 5F9FA 1E3IA 5C35A 4J7AA 1Z06A 5EIHA 3RSSA 4P93A 3W9FA 3AOGA 4CMKA 1NVEA 1A7KA 4TXLA 3VLFA 1OSNA 1R0RE 1YASA 3ILSA 5AQEA 3N6RA 1PG2A 2V7XA 4PVDA 4AJ9A 2Z98A 4PXYA 3FOFC 4IX9A 1H8HA 1SUCA 2QUHA 1SBQA 3DFKA 4FE4A 4CHGA 1QGUA 5HG0A 5KIAA 2VJDA 1PWXA 3F3YA 4DQXA 1W6UA 5EMMA 1OFUA 5ESXA 1KPSB 4LC1A 3EVGA 4OVUA 3M3DA 1LZKA 1JG2A 3OFSA 5ADWA 2BD0A 5JCZA 3INYA 1F8GA 4YQZA 3R7WA 4ZZ3A 1H3FA 3AGQA 3R74A 4MTCA 1WY6A 2X9LA 4ZGBA 1VPWA 4GMGA 5ESWA 4O63O 1VDYA 2R03A 4IDFA 5AN8A 2B0CA 2ZU6A 3B13B 5CHEA 3E4DA 4PC7A 5LYJF 1XMOB 2NYAA 4Z9YA 5BOVA 1JQEA 4KFCA 1WU7A 1P7ZA 2XTZA 1KJYA 1LKZA 3NEYA 4PGGA 2CBGA 4F45A 3G5TA 4AB1A 2WJ3A 1QLJA 4F4UA 1DAKA 1EJ2A 2ZDHA 3HXBA 1CRQA 5CB6A 5C9ZA 2ENWA 3HL4A 4NCNA 3OMSA 3LRPA 1XPJA 3N3AC 1QFXA 4A5SA 5KVVA 8MHTA 1GZ5A 2ATEA 5NLLA 1XXHE 4JXTA 2DULA 3F5SA 3F7TA 1N5OX 3B89A 3TPZA 3UJHA 4D9JA 1CJVC 4HT3B 2R8BA 4IIDA 3W79A 4EZBA 1F7UA 1M1XB 3NBMA 1AGYA 1E3WB 4O2RA 4UZFA 2IDMA 5EE5B 4P2BA 3FDZA 4EGJA 2HA4A 3K31A 3L8CA 3ILYA 1LJUA 3PQFA 4HFJA 4DWVA 2F9LA 5B4UA 5LM3A 3ZGLA 5BR4A 5LMNB 1YVUA 3IOCA 3S8EA 1SVMA 2EKQA 2K4MA 3DT6A 1DAMA 1SOMA 2VCHA 4R40A 3M1AA 1NLMA 1EZ4A 2OPHA 4MRSA 5FQ8A 1L3BA 1RWNA 1GNSA 2OBNA 2PWBA 2UVQA 1PVVA 2NW6A 3F5FA 4BL5A 1V4VA 4WAUA 1VA4A 4D80A 1RDFA 5D86A 2C5HA 1H0KA 4MAFA 4NY1A 4WCDA 3WB9A 5K8UA 3AKEA 1P4AA 4FHCA 4L1BA 4OJMX 4AZ0A 1ZXXA 3RDPA 3KV1A 3O8OA 1OMOA 1T5SA 5ALXA 4C0LA 4RTRA 4J1QA 5DLDA 3Q8WA 1FDTA 1XI2A 2ZREA 3SBXA 1BDIA 2J6CA 1IEXA 5L7YA 3L6EA 3P4YA 4UBIA 3WSTA 4EOGA 1PYDA 2ACVA 3WMGA 4LXYA 5ALRA 2X8WA 1OYOA 2ANCA 2WJWA 3LVQE 3D2CA 3C1UA 4XWAA 5JD3A 1QCCA 4F92B 3CUYA 4J8YA 5E38A 4F8YA