4GYYA

Crystal structure of human o-glcnac transferase with udp-5sglcnac and a peptide substrate
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
715
structure length
693
Chain Sequence
PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFHIYDNRIVLNGIDLKAFLDSLPDVKIVNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransfe
publication title Structural snapshots of the reaction coordinate for O-GlcNAc transferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 274
structure length 693
sequence length 715
chains with identical sequence C
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gyyA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4gyyA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4gyyA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gyyA03
3OY2A 3AS8A 4UQXA 3CVLA 3S27A 3Q5MA 3GYZA 1NOKA 3QWWA 5BT1A 3VDNB 4EKEA 1PN3A 2BISA 3IAAA 3VDMA 3QOUA 4UI9C 3GZ1A 3UQ3A 1GGNA 3MSCA 3MS4A 3H4IA 3CK8A 4EL0A 2XEVA 3MA5A 3GZ2A 3RSCA 1C50A 3FFLA 4I1AA 1P2BA 3S7DA 3NP7A 3T3EA 2ONDA 4U04A 3CEMA 5M72A 3ZFWA 5TVGA 2IW1A 1K06A 4JA9A 2QLMA 1WAO1 3CK7A 2FF5A 2BUGA 2X6QA 4RELA 4GA2A 3KAEA 2XGSA 4BWRA 5CCMA 4U07A 2VCEA 3OXGA 4U0SA 4CTOA 5HQ8A 3HBMA 5TMDA 1FA9A 1WW3A 2KCLA 4YI3A 3Q3HA 3T3GA 3ZCSA 1L5SA 3U4TA 1XNFA 4F97A 1GFZA 1PSWA 5GPBA 3ZCPA 2G9RA 3LY9A 3VUFA 1FTQA 2XMPA 1NZNA 4M60A 4I2ZA 3MTAA 2GM9A 3L01A 7GPBA 4GCNA 1H5UA 2BFWA 3T5TA 4F3VA 4HORA 3BCUA 5JJTA 4KQMA 3WADA 4AY6A 1GPYA 4MRAA 2QRPA 1JG7A 1AXRA 3MV2B 4L22A 3DDSA 3ULQA 2Q7FA 2QFCA 3ZHEB 3ZN3A 2PL2A 1SXQA 2LSUA 3NF1A 1C3JA 2G9VA 3MTBA 1P2DA 4Z5XA 2QN2A 1L6IA 4I9EA 1A8IA 3TGOA 1XV5A 1NLMA 4G2TA 1ABBA 4M83A 3O3CA 2AVPA 3MS2A 2R60A 3LY8A 1JEJA 5DXFA 4J8DA 2QRHA 5HI7A 3TG5A 1JIUA 2GPAA 3MQFA 4WADA 5DU2A 2FI7A 2YQ8A 2X0EA 1ELWA 1F6DA 4GPBA 4N9WA 3N71A 1XC7A 4YVOA 3OKAA 3L7BA 5JTTA 2QNBA 4O6FA 4YVQC 3C4QA 1A17A 3EBPA 3O48A 1YA6A 4GYYA 4M7PA 2SKDA 1XKXA 3QDNA 1P4GA 3S7FA 1KLXA 4EQFA 4RIIA 1WV1A 2C1XA 3CEQA 2WPVA 4FZRA 4N2SA 2F9FA 3QKYA 3AMVA 3L7CA 1Y6FA 3Q3IA 3UPVA 3NPAA 4EJ2A 1B4DA 2AW3A 2R68A 2MHKA 3L7AA 3AS4A 4BT9A 1GPBA 2XCIA 3MT9A 2VG8A 2SKEA 2O6LA 3WC4A 5EKQD 3E3LA 3BCRA 5JTUA 2PZIA 3NCHA 1KT0A 2J9QA 2G9UA 3T7DA 1EM6A 1RZUA 3ASHA 2HR2A 3L7DA 2H1FA 4J8EA 2QRQA 1ELRA 2QN9A 5KJMA 2ATIA 2C1ZA 4GZ5A 5CHEE 1NOIA 1UQUA 2VCHA 3D1JA 1HXIA 2KC7A 3QKWA 1AHPA 4B94A 3SF4A 2QRGA 3LY7A 1KTIA 2Y4TA 1J39A 1FU4A 5BNWA 4HWGA 2VGXA 5D00A 4WNEA 2KS6A 2SKCA 3MTDA 3FP3A 3EDTB 4WNFA 5I45A 3CKCA 1NA3A 4IN3B 2F3QA 3OTGA 1HZ4A 3CVQA 2PQRA 2C4MA 3CVNA 1EXVA 1FU8A 3H4TA 4N3BA 4MICA 2ACWA 1NZDA 4MHOA 3KS2A 5EX3A 5DIZA 4LEIA 3MT8A 2KCKA 3LKUA 5LQDA 2JLBA 1Y8MA 2Y4UA 3OKCA 2QN8A 1FTWA 3UUXA 2AV6A 3T3IA 1FTYA 4RBNA 2UWJG 2QN3A 3C4VA 2R66A 1TJCA 3CK9A 3PE4A 1XL0A 4WHMA 2XCCA 9GPBA 3ASFA 4J0UA 4N2QA 1L5RA 2X0DA 1PNVA 3CV3A 4I9CA 2OFFA 2P6PA 2VGYA 3WXXA 4CGVA 2DBAA 1QM5A 2XCUA 1UQTA 4BQEA 4CGWA 1XOIA 2XCBA 4KYOB 3VTYA 3CUUA 2X0FA 4RG9A 1IHGA 2GPBA 2R5SA 4AY5A 1SXPA 1K08A 4UQYA 3R9AB 5ARGA 1L7XA 3GPBA 2QLNA 2LNIA 3OTIA 5JJ7A 3VUEA 3FWVA 4RIGA 4LDPA 2AMVA 1VGVA 4GZ3A 3RO3A 5AYWD 4YUAA 3OKPA 5A7DB 2FETA 2IUYA 2PQNA 1FC0A 4G26A 1Z6PA 3JYSA 3TAXA 4BTBA 2G9QA 3URZA 3G2IA 2ECPA 4WNGA 2R4TA 1B89A 4AMBA 4I2WA 2QZSA 3G2LA 4YNDA 1Y6GA 5IKPA 3VTXA 3RHZA 1KT1A 4RIEA 2UY1B 4H7XA 5TMEA 2FEZA 3DDWA 4N39A 2R4UA 3MS7A 3S29A 2IEIA 1BX3A 3UYKA 5JJ6A 3ZCUA 2GW1A 2YJNA 3CV0A 5IKOA 3RT1A 2VSNA 4G1TA 5KJLA 4CTMA 3CEJA 1L5WA 5C1DA 5DLDA 4LEUA 4WACA 1F0KA 3E3OA 2FFRA 1JG6A 4AM9A 2HYZA 4H7YA 4Y6CA 1P2GA 2IYAA 4N3AA 4RENA 2AZDA 2JZCA 5KJKA 4KBQA 5G05J 6GPBA 1E96B 2XA1A 1QQEA 1NZFA 5FT9A 5LCWJ 2ZB2A 2F3UA 4N3CA 2P58C 3NB0A 4X6LA 1M5RA 3GW4A 2QN1A 3MRVA 2GJ4A 2V5FA 3HBFA 1P4HA 1V4VA 4GA0A 3TG4A 3OT5A 4Y6WA 5FZRA 3NP9A 2GT1A 4GYWA 4W6QA 2FBNA 4F96A 3S7BA 3T3HA 4AN4A 1GG8A 4GA1A 2ACVA 3BD7A 3S0JA 3Q4AB 4W9RA 5FJYA 3MBOA 1IXYA 4FKZA 3RO2A 1E4OA 4KQ2A 5EX0A 2VYIA 2C0MA 2LSVA 1C8KA 1ZBPA 3UYLA 4BQFA 3ZPJA 3ZCTA 4A1SA 1HH8A 5ARFA 1HLFA 2IEGA 3OTHA 4CDRA 3TOVA 3MRTA 1Z6QA 2YHCA 4GPKA 5DBKA 2XGOA 3GUHA 3QWPA 3CEHA 3QWVA 3ZCQA 3ZCVA 3G2HA 4NRHB 5D01A 5G04J 2PYIA 3L79A 2PRJA 1PC2A 3LPZA 3HYMB 2QRMA 3BEOA 2PRIA 4U0UA 1L5VA 3ASDA 3MKRA 1NA0A 4QLBA 1W3BA 4XIFA 4APOA 4JHRA 2OOEA 1Y8ZA 3D0QA 3PDNA 3CVPA 3CUYA 2VQ2A 5D0OD 2E2EA 3Q3EA 4KQ1A 1WUTA 2C9ZA 5TMBA 1Z8DA 3G2NA 2HO1A 3CUTA 2VSYA 4AIFA 2BGTA 3RJVA 2IV7A 3WAGA 3E4BA 4HOQA 1C8LA 1IIRA 4RIHA 4X7RA 1WM5A 3S2UA 4UI9J 1L5QA 3BEEA 2XA9A 2KATA 4REMA 2XA2A 1RZVA 4NEQA 2GEJA 4BQIA 2KCVA 2I6HA 3Q49B 2WTXA 4GCOA 1Z62A 4HOUA 4KXKB 3LCAA 1RRVA 2FO7A 3HBJA 2IFUA 3PE3A 3S7JA 4NESA 2XGMA 4MI3A 8GPBA 3BCSA 2X6RA 2XPIA 4NQ0A 3RSZA 2C0LA 1ZU2A 5HXAA 4UQZA 3BD8A 3CKBA 4GZ6A 3SYMA 1GPAA 3MV3B 2BGUA 1IYGA 3FROA 3CUVA 4G24A 4WUYA 1QZ2A 3LYAA 3OXFA 1YGPA 5FZSA 3RU0A 5KJNA 3U3WA 3G2JA 4RIFA 4ABNA 3CX4A 2GPNA 4G2VA 3ZGQA 2ASVA 4U0ZA 3OXLA 5G05C 1QKJA 4JA7A 1FS4A 4I17A 5LCWC 1LWOA 3ZHEA 2F3PA 1P29A 3SYRA 4XI0A 1NVKA 2F3SA 2IF4A 3MRXA 4MI9A 1P5QA 3NAZA 1E1YA 3ASGA 3DZCA 3IEGA 4ME2A 4AMGA 4EKYA 2FF4A 4NC9A 3ESKA 2QN7A 2HY7A 1P4JA 3OY7A 3AS5A 4BT8A 1WV0A 2NC9A 3DD1A 3IA7A 3NC4A 3TSAA 3BD6A 4RG6A 2C2LA 1JIVA 1WUYA 4JL0A 2QLLA 3COPA 3MT7A 3T3DA 4MI6A 4EL5A 4HOTA 4X7MA 2GEKA 4HLNA 3EBOA 3MEKA 3D0RA 1LWNA 5BW8C 4BTAA 3QHPA 3CUWA 5D0QD 4WNDA 1FU7A 5A6CA 1WW2A 2VGXB 4MHSA 4X7PA 4XI9A 2PQ6A 3G2KA 1XL1A 2IYFA 4YI5A 2L6JA 2UY1A 3K9IA 4G23A 2PYDA 3Q47B 5FZQA 3ZCRA 4PQGA 3RKVA 1GZ5A 3Q15A 4CTNA 4J8FA 1UZUA 3KD7A 5G04C 1PYGA 4UI9K 2WQHA 2IV3A 5FTPA 4HOSA 4BFCA 1YA0A 3BDAA 2JJMA 3RIBA 3SZ7A 4F9FA 4GYOA 1JIXA 2Q6VA 2H1HA 1OUVA 4G25A 1NOJA 3E3NA 3HBNA 1O6CA 5ENZA 5CCLA 3S28A 4N5CA 3C48A 1FCHA
chains in the Genus database with same CATH superfamily
1UXIA 1QMPA 4JQOA 5G1NA 2P68A 1EP2B 1ZA2A 1MNQA 1Q7RA 1CFZA 3DCIA 2PUAA 3T5GA 3UB4A 1V35A 5KYKA 2Z2IA 4O8CA 4UOEA 3SM3A 5FWNA 1XU4A 4DY4A 2CXPA 3WQRA 5JAIA 3L41A 1QH9A 4EHBA 4EGQA 3ITKA 2QTAA 1B93A 3ZN3A 1DPGA 2V8BA 2BFFB 2R6FA 1N2IA 2CLKB 4W5JA 1M76A 2AUMA 1XMXA 4HYTA 3R74A 2OV4A 4FN5A 4E1AA 1NMZA 4F1WA 3NEYA 2IX9A 3AEUA 3Q2KA 2AEMA 3HUFA 2WBLC 3TLAA 3DUFB 2F3TA 4PPYA 5DM70 1LZLA 3Q3IA 5AUNB 2PX2A 3OCXA 1IPEA 1AY0A 1N94A 2UZAA 1MHTA 5C80A 4PZDA 5DP2A 2IE0A 4JLUA 1JNRB 3FPKA 2IXAA 3JRWA 2CXUA 1JEQA 2C2XA 4MR8B 5CX4A 4PM4A 4P4TA 4FZVA 3GBVA 1PQUA 4R31A 4F9TA 4XIYA 3DP7A 3K5PA 4J7XA 5LCXA 3FNRA 4ZV7A 4MQ6A 2V7VA 2Q1YA 3B7BA 5EXPA 1M2WA 1WX1A 5I9LA 3UF0A 2XVAA 5BW8A 3EXFB 1KMIY 1I2ZA 1RE1A 2J08A 3T9CA 4B4VA 3VUEA 3RSEG 4FXOA 3FPFA 1WD5A 3OE1A 2Q4DA 3FTWA 1SCAA 1Q3KA 1CSEE 2JANA 4U8VD 1AN0A 3K0KA 3HH8A 1NVTA 4JL5A 1STOA 2XZDG 5A05A 4CIWA 4KQ6A 3RU3A 4M49A 1W7AA 1MQSA 3PZRA 4IIVA 3E84A 4XM2A 3SQNA 1DB3A 3W7VA 5BSHA 3UBTA 5EJAA 3IP6A 4XJVA 4CKEB 5B57C 4M4SA 1GM5A 2MSLA 5FLKA 5EKTA 4JJ6A 5EWJB 3TMKA 4KO1S 3EPRA 3OT5A 4EH1A 1CRWG 1T9GS 2IUUA 5HHTA 4PVCA 1DQYA 1D5CA 3L6RA 1KP9A 1ID8A 1UN9A 2EZUA 3L82A 3WYAA 5K0EA 1X4RA 2VT3A 3EQ9A 3HO8A 3AR3A 2G77B 1F06A 2WEKA 3YASA 3UT6A 4IVQA 1U2TA 4NRHB 1U9IA 3SZGA 4YRIA 3CNLA 4AYTA 4U8YD 1UM9B 4JHRA 1XZGA 1QP4A 3QK0A 3T1TA 1FSPA 4EG4A 2WIFA 4WKCA 2P30A 3CGGA 5AVYA 3FB1A 4QDOA 3PI6A 3E7WA 2IU4A 1O77A 3SF8B 2O5RA 2LIVA 5G55A 4XWWA 2H07A 4RZHA 2XPIA 4UQZA 3I73A 3G2PA 2WWWA 1E79A 3CRMA 4IUCS 2F1KA 1R8SA 5FCDA 1UPCA 3AR7A 1Z2OX 2QD4A 2R47A 4P3PA 2FJPA 2V0CA 3E58A 3DZGA 1TVKB 4DWOA 3HJAA 4RKEA 2OWEA 4J1TC 4M0EA 1BU8A 1TA0A 4EHMA 1L4NA 2JS7A 4TWBA 1NXQA 1HU3A 4FLFA 3K0BA 3LWZA 2EP7A 1XHEA 5FOWA 1YA0A 1BVRA 1HZZA 2OBBA 3IQEA 1JQAA 1N2EA 1QP7A 5HE8A 2JGAA 3ZW9A 2VYCA 2RARA 2TYSB 5EZYF 5J5CA 1P60A 2ZBPA 4XM0A 1NBME 4JI7B 4PS3A 3WHIA 2GZMA 1MXHA 3T3EA 1R6DA 1ZRSA 4LWQA 4R1PA 5EVCA 4O4IF 1FT1A 2SHKA 2GBFA 3GAMA 5KVVA 3NXKA 1SXJB 1RMYA 3AJDA 3Q3HA 3WK8A 2SNIE 1V4NA 4RFSA 3FLBA 2C9DA 4J75A 3D9NA 1SQ0A 3AJRA 5G4KA 1QU2A 4YIKA 5C9ZA 5DLQC 4RU1A 5LXTB 1DRVA 3BYZA 1O0CA 4JBIA 1FE8A 2ARKA 3GO4A 1ODCA 1DFHA 3B1ZA 3LHIA 1TEZA 3WNZA 2ZTSA 5EHZA 3ABSB 5KYUA 4LDRA 1NHWA 5I7HA 3JPWA 1RYZA 2XE7A 3Q40A 1AMOA 1GPBA 2YZKA 3IDAA 4LHEA 3SHWA 2IP2A 4WCFC 5KTSA 4K9OA 3EJNA 3KL2A 1LI5A 1BE6A 2AG0A 3P26A 3GQBB 2GQ0A 2H6IA 2YWDA 1V5IA 2QR3A 4BUJA 2FE4A 2YYYA 2QXTA 1P7CA 1RZRD 2E1PA 4H08A 3C6QA 3I8XA 4XKJA 3AEXA 2F8LA 4MGHA 3ITNA 3PF8A 3PZ4A 5FQ4A 3I4CA 2EXXA 4QPDA 2W2LA 2ZEJA 1CJKC 3NVDA 5CERB 2C88A 3H42B 4Q3OA 1DC2A 4RFLA 4OX9B 3KUXA 5HS6A 3UVEA 2A2ZA 5CEDB 5DHPA 3BXFA 4JX9A 5IYZB 1N6PA 1XQVA 3OSZA 4AU1A 4PX9A 3I6MA 1BQEA 1PSDA 2NSHA 5FKJA 1UMBB 3WRXC 1EDUA 1WQ4A 2C58A 3V8BA 2RK4A 4DV3B 2GYUA 5CRIA 2AD5A 2XRFA 5KNDA 4X91A 4I50B 4KWIA 2COKA 4DR5B 1QHIA 3OCCA 1YULA 1RDFA 5H3HA 1X1RA 3QH4A 4RV5A 2OZLB 1XD9A 3QMWA 2YJNA 4IILA 3IIJA 4ZI2A 2WD7A 4K3UA 3KQVA 5ED4A 4OOEA 2VJBA 3P2KA 1JG6A 1JKJA 2ZYUX 5I8WA 2ADOA 3CT6A 2QIPA 3U0BA 4BWFB 4JH0A 3AK4A 4JJIA 3C3MA 2QLFA 1QOQB 5GV8A 5A9SA 2FWPA 2GCIA 1Z34A 2L18A 4GTSA 3O8QA 4LK3A 3DTNA 4JQCA 4YT4A 3PQEA 4FYYA 1DV2A 4FN4A 5AVRA 4UDOA 5KAMA 2CZCA 4YRGA 4JROA 1G21A 3ZHVA 3R3WA 4H1HA 1HC7A 2AKYA 1NF3A 2KXPC 3OF3A 4J0JA 3S3TA 2GZSA 2PWAA 2VQ2A 4EG8A 4F60A 4TLLB 4HAOA 1AV6A 2YJ6A 2QTHA 4NCJA 4B3XA 2HLDD 4GMXA 2CFZA 2VNKA 4EY4A 4KNYA 3PL1A 2AZXA 2VDVE 3B2NA 4K87A 3JZDA 3UBMA 3GFQA 4YQFA 3DEZA 2ODWA 4JA7A 1W46A 2C00A 4GOMD 1J6UA 3IQIX 4EARA 3TWXA 3WL7A 1EUYA 1CR1A 1L8AA 3EIFA 4AKXB 2QN7A 2OP0A 5LP6F 2PT9A 3GNTA 4QLAA 3E05A 4G63A 2JKYA 1YRAA 1B6SA 4YI5A 2J9YB 5LQNA 3H8WA 5IH3A 1YS4A 4XGQA 4EW6A 1OX4A 2XB9A 4BFVA 1ZLXA 1P0QA 1U8AA 1LBSA 2V5QC 2C82A 3BU8A 3AR5A 4JXZA 3WGNA 1ORVA 1R6VA 1C1HA 2YIDA 3SEAA 1JPLA 1FUUA 4J94A 2H2IA 3MWFA 4MUNA 1PIWA 1WTCA 3M6MD 3KZVA 1LPSA 1QRSA 3ER8A 3RBXA 3EVGA 3BH0A 3RS9A 5KSZA 4DLVA 4TVSA 3UJNA 5CBKA 1SWWA 2G9RA 4OQEA 4I5IA 4M9RA 4HH1A 1H3EA 3PNYA 2GNAA 3HJFA 1XEAA 4BERA 4MSUA 2HRBA 1NVGA 2W6PA 1EK1A 3UAZA 1KO5A 1Z17A 4QQKA 3SBSA 2RGCA 4I2VA 4MAFA 1ISSA 5HI7A 1CZOA 4TYPA 3JQCA 3KTAB 3JS5A 1K98A 3CVUA 1RKVA 3NALA 1PAQA 2GJSA 3BUSA 3AFHA 2XX3A 1JDPA 2VSXE 3AESA 3D6VA 4KSCA 2ZBUA 2AJ8A 2FHSA 1TEHA 3W2TA 1BXGB 1EG7A 4AO8A 2DFPA 1FSSA 3BICA 3SICE 3MMPA 2VQFB 4QU8A 5JWHA 4KZCA 3UM2A 4J0FA 2JJQA 3L8FA 4YV1A 5C4GB 3KOOA 1ONOA 2HT6A 4B43A 2VCHA 1E2BA 5BY2A 4YPOA 3H7IA 4UAUA 1ESNA 1RWXA 3EZNA 1ZR4A 3NOVA 2YUIA 5EJ8A 1TYZA 1QQBA 5J2UB 2YC4C 3GLIE 1YTLA 5JBNA 3R5TA 3B48A 3ABQB 3PXGA 3UJPA 1R4NA 3ZWWA 1SOWA 1OAAA 1N5MA 1XSEA 4W82A 1P1HA 2DUNA 2B98A 3VR3D 1X92A 4M6WB 4KIJA 2ZSFA 5FB3A 5AOAA 3LEWA 3D7MA 3BJMA 5JJ7A 3A31A 4IF6A 3ZZUA 3MGAA 3VSCA 1YE5A 2QJRA 4I55F 2O0JA 1GPKA 1IEQA 4MQBA 2EKPA 1GXSB 4TLEA 1NBOA 5LYJB 5IKOA 3FNHA 5DEOA 2A1UA 4DSNA 2EP8A 4JLNA 5B1YA 4C7KA 3M2PA 4GPD1 4CEJA 3B60A 1MB0A 4PLZA 5KNBD 3GW4A 4DTIA 3RTDA 3N2ZB 3AYXB 3QMMA 2DWPA 1QVWA 5J2TA 2EU8A 1YFKA 4QOHA 1PL7A 2AXPA 3H6KA 4YBRA 3VRHA 4JCOA 3ODPA 1J9GA 2EFEB 3QI2A 1QVZA 4MZXA 5A4MS 3AR4A 4QBGB 4U0UA 1M75A 2HA5A 3TDMA 3QNMA 3TNLA 2HHHB 2E2EA 4DC9A 2BBTA 3MCAA 4J0KA 3NT4A 2ZR7A 3I72A 5ABPA 4IRMA 3Q15C 4M0KA 4RZQA 2FPIB 2P0YA 4NEQA 2NP7A 1A9OA 5KYYA 3VBCA 3ZDDA 4TQGA 4R84A 4DNFA 4MYDA 4M1YA 2NTNA 4WUVA 3W6NA 3EWNA 4HXIA 5A1TA 2PYZA 1T1RA 4PCLA 4XX5A 1JXQA 2HOQA 3BBPA 3G5TA 1L3IA 5FBQB 4EELA 1OZFA 5EIBD 2CB0A 2QD3A 1LBTA 3VSDA 5BR8B 1QOZA 4FR0A 3OX2A 3OCWA 4JDUA 3OJ0A 1ZX1A 2O7SA 1H0KA 3KQLA 1E8OB 5IUKC 1PQ4A 4FLMA 1SUCA 3A6FA 3QFCA 1P9LA 1S5PA 4G23A 2XNKA 3IAHA 1NQVA 2NPIA 1V3VA 5EXTA 5JXWA 4QXAA 3CX3A 2NLOA 3NBAA 4Z99A 4TMZA 4WZBE 1LF8A 4GX0A 3Q9UC 2XBUA 5KREA 2IP1A 4LOLA 3GVIA 4DRXE 4L1KA 1SRQA 3RYCA 1GGNA 5CLIA 3HYLA 5CBOA 4Q00A 4ZCIA 2NVUB 3LZ6A 2W2OA 1IJKA 1NLYA 3WR5A 4HNSA 1TNDA 4UQPA 2Y0DA 3MG9A 4URZR 3WSWA 3AL0C 4EF5A 3T3GA 2QM0A 3ZD6A 5ICGA 4JSTA 3P1JA 5LUBA 4RK6A 1ESMA 2X2PA 5D3MA 3HG0D 4AY6A 1NSTA 2ZI7A 2UKDA 2PL2A 1U3WA 3WWZA 4FB5A 2G9VA 3F3SA 4C87A 1ECFA 1ZC4A 3BM5A 2W4QA 4G2TA 2FZVA 3THXB 3FYUC 2CNOA 3TLMA 2PGAA 3FTDA 1PR1A 3V9PA 4LN1A 2HZBA 3E33A 4K2HA 4M0FA 2AGVA 4FGSA 2ACKA 3DBLB 1A17A 3KAKA 2GN8A 2H59A 3R3UA 4ZO7A 4KVFA 3AONB 1WXGA 2D0IA 2X8JA 5AHWA 2GPJA 1WV1A 2BGWA 5JAHA 4DHEA 1CS0A 5AYVA 2XQ0A 5CVVA 3K4HA 2JKVA 3OJOA 5FFFA 4LZPA 3WC4A 2FSUA 4IWXA 3AVYA 3IE1A 4FD3A 3TI7A 5C51B 2R86A 4U2CA 2AI2A 4OI0A 2HR2A 4TYQA 4J8EA 4QYMA 2JA1A 3OTNA 2O23A 2Z6UA 4Q1EA 1I7DA 3G7NA 1D03A 1HDGO 1EVIA 2HADA 3SCZA 2JB9A 1RJ9A 3KS2A 3QARA 3RRFA 1DKOA 4P81A 1T29A 2VJDA 3NXSA 1KFBB 2FRVA 4I6EA 1HFJA 1T8WA 3DOUA 4CR8A 4MVCA 4DEYA 4QJ3A 4TTVA 4BO9A 2LXNA 1RI4A 3RARA 1M54A 2AN5A 1SKUA 1UOPA 2Q1XA 3WGIA 4P98A 4EM6A 4U7WA 4XFKA 3HXLA 3TOXA 2HQBA 2YIMA 5B1IA 3LD9A 2SCUA 1UAYA 4YGYA 5K0SA 4KO3S 5DNDA 4FIZA 5IFKA 1Y7LA 2XWQA 3JV7A 4DDVA 2J4DA 3D43A 3EVEA 2WT9A 5IABA 3PQDA 1OAKA 3TLKA 3WB9A 4GW3A 1IZ0A 1KJZA 1Z6XA 3K0HA 1IKND 4HRLA 1XK6A 4KMSA 3O38A 3OJLA 3C87A 2QRNA 2BUCA 3IP8A 2VDQB 2OO5A 2ZP1A 4H6WA 3AHFA 3HK2A 4ZDIA 1SHJA 4GA0A 1L7BA 1E1QA 4K9LA 1VYVA 1RLOA 4YP1A 3LP6A 5B2ZA 3VC3A 1RIFA 3SNXA 1TEXA 5EFZA 2JLZA 5K3BA 3BH7A 4HAYA 4TZ0A 5LJIA 4I9UA 4LZWA 4CKWB 3A0RB 3ROQA 3NTOA 5D85A 1N7GA 3I23A 5EYLA 1LLFA 4L9WA 1M6VB 1DC8A 2KQUA 3EW9A 4US0R 2R2LA 1BLXB 1FXWF 5FOTA 4CF5A 3D5EA 2P35A 2WM9A 4G36A 3IPRA 1K9VF 2H8GA 4G1EB 4AJIA 1BDBA 2XGMA 2J3QA 3C3DA 3MWDA 4GU5A 5B3LA 2FWRA 1NI4A 3GCZA 2XUIA 1V16B 3CLRD 1U0BB 1AUXA 1QVVA 5CXUA 2BHSA 3QWIA 5BMVA 3KQOA 5CJPA 4K5CA 4JQYA 2BDEA 2OM2A 1JP7A 1X80B 2BN4A 3S1LA 4PEVA 5IAEA 3MCUA 2RHOA 4C21A 2CBXA 1Z7YA 4X7PA 2EWWA 4GKJB 4URHA 1A50B 2O2XA 1A3CA 4MW9A 2W11A 3LWNA 2R6ZA 1XN1A 4B6GA 4BO8A 3KM0A 3OTWA 3V48A 2APJA 5BYBA 4FGUA 2VT2A 1ZQ9A 4N5CA 3O8RA 1YQ9A 1M7HA 4J16C 1O6FA 3B7GA 3AP1A 3BXZA 3F67A 3FVWA 2PT5A 1O97C 1VTKA 3OP4A 5D1NA 4JR0A 2X41A 1E2DA 5DN6D 4DQUA 1R0LA 2NZ8A 5ESXA 1JDBC 1XHFA 5DTRA 3UIEA 5IAKA 4KEAA 4OVKA 4U2FA 2HSJA 3LKBA 2UVDA 1C8BA 3Q7QA 2YCBA 1IEWA 3SSNA 2Z2ZA 4DLPA 4B33A 1WMDA 4QKQA 6PFKA 1BEZA 1FNMA 3WQBA 4F6RA 4DG9A 5C3UA 1SUFA 1A04A 5BQ3A 4Z51A 4GAEA 3PENA 3R6GA 3ZRHA 4RD4A 1U2ZA 5T4YA 3C1AA 4C5CA 2YFHA 4WW0A 1P2TA 1P8AA 5EINA 3RHFA 2NTVA 2RC6A 3QDNA 1N78A 4B3DA 3WMEA 5DGDA 4CG2A 4IV0A 3L7CA 1KRHA 3WVNA 3WKEA 1JRLA 1VC2A 5EKXA 5K0NA 1QGDA 4YMTA 1LV8A 2AF4C 4S1PA 4NMMA 1VYHA 3VNVA 3DBSA 1XCOA 5H80A 4ITRC 5FUQA 4DYVA 2HGSA 1EFRD 1L8QA 4L2IB 2QZ9A 1E2LA 3CLSD 3JARB 2QRJA 4RLFA 3HCNA 2WB2A 3VV2A 4BVHA 2PUVA 4JU8A 1ENPA 4WY8A 2R6CA 3UHPA 3CPSA 2XRMA 4UVEA 5DHSA 3TR5A 1IUNA 3K05A 2H6GA 4S05A 3AT1A 3AUKA 1XTTA 1P0IA 4ER0A 2OEVA 2ZJOA 3LF2A 2P9BA 4F4DA 3FDZB 4QARA 3CRNA 1XDSA 1M5TA 2QRZA 4D02A 4ND8B 4CLEA 2UYHA 1KJNA 3SX4A 1J5XA 4RD6A 5H9WA 3Q1LA 5AJYA 4G5FA 4GTTA 3HUDA 1JHRA 1SHUX 2ANCA 2ZRJA 5H4GA 4TXQA 1O96B 3ABOB 4G07A 5KOJA 4JXKA 3RS0A 2XKKA 4HH3C 2QR2A 4CR6A 2Y1OA 1FNDA 1RAHA 2QL9A 2J7PD 2OHXA 4AKHA 2QVYX 3PTLA 2BGIA 3HJGA 4HNUA 3RUAA 2WUGA 4DLQA 2HBRA 4CV2A 5LD2C 1E62A 2OGUA 2JZCA 2XA1A 4CMEA 5TY0A 4OXRA 3ADPA 5KYGA 1VJ1A 3JR3A 3ZLJA 1QS0B 1Z56C 1T0JB 1RWPA 5IF3A 3EEOA 3B3FA 1VI5A 3L9TA 2HMUA 2OAGA 3W8FA 4A1FA 2I1LA 3MBOA 3ENEA 3ZPXA 2QMEA 3SQLA 4B7UA 3G1TA 3DFMA 1UWLA 1HH4A 3LV8A 4MTLA 2H54A 1OXUA 4HBZA 3BKWA 3VR4D 5G1OA 4GMJA 3C8HA 3AVOA 1YRHA 5HM8A 1F8UA 2QUAA 2PUBA 3RODA 1SA5A 3G2TA 4LJ6A 2WF9A 4Z7NB 1HDRA 3OIDA 5KC8A 3S2FA 2ZVQX 3WGJA 4RTQA 1RZVA 1JDJA 1UKEA 1KXZA 2VPTA 1BRMA 1OXVA 3ZDAA 1YZFA 1D1TA 4DCSA 2WMYA 2I2DA 3DTYA 3S7TA 3ZXPA 5D66A 2HNBA 4DUGA 4DZRA 3PHBE 3WTBA 4IS2A 4UYKB 4DMCA 4BJHB 3GLFB 5LVAA 4BCDA 4XI0A 4NDNE 2WXHA 4WZAA 4JPSA 4QDUA 5DW3A 2A88A 5BVGA 3RF6A 1ODFA 3T9FA 2FN3A 3GK3A 1WUYA 3BMXA 5F5LA 3NPMA 4M86A 1GARA 3NOQA 3VOAA 4ZJZA 5JD4A 1C4KA 1N5DA 3IQDB 1DXQA 3PKIA 3K9FC 5E2AA 2ZJ8A 1UZUA 4U9IS 3WYEA 2AB0A 2JFVA 2NYJA 3MGCA 2B3TA 3GFGA 2Q1TA 3H19A 4OJYA 2WSBA 3A3PA 1PJ8A 1AO3A 3RJTA 1M34A 2PRKA 3F96A 1KVSA 1J23A 3ONFA 2A9JA 2EGHA 4H7IA 3R0JA 1Q3TA 3VM6A 1VZ3A 4MKFA 2CGEA 2XE4A 3CF2A 5LKRA 1S2NA 4E14A 4DAOA 3KLNA 4MOWA 2CXOA 2JCBA 3P7MA 5ES3A 4YAWA 4REQA 3ZZ0A 3KFVA 5D7NA 3K1AB 1SXQA 1E2IA 1L7QA 3HZHA 1XQYA 4B93B 4ARVA 4M2LA 3HO6A 1V11B 4GIBA 4TS9A 5HOQA 3ESLA 2CJXA 1P61B 3O8LA 3TG5A 1FRNA 3PA6A 1N6RA 5JYBA 2RHBA 3VYWA 2P7HA 1N11A 4OQFA 4KQKA 1JKXA 4HT3B 2QQGA 1ZZEA 3K20A 4WOBA 2AD1A 5C5IA 4MV5A 1YUBA 3ZIMA 2JCVA 3L7AA 2BONA 5AW1A 3AG3E 5AJZA 1ZU4A 4QEKA 4EW2A 2WAYA 3EZ2A 4QOIA 2GWRA 4QM6A 1CQXA 2J5RA 4D3XA 3FMVA 4FC6A 1G8FA 1M7BA 5JPCA 1GPH1 1AGRA 3GEDA 4B3HA 2VHUA 4PVDA 4AECA 2FTKE 1KDPA 4FYJA 3HR8A 4OHOA 4CQLB 4TZ6A 4TXRA 3DBVO 5HQTA 4EHFA 4RORA 1R6BX 3HBAA 5AKEA 3P71T 4G4SO 1NNUA 3CLUD 4L5YA 4R1TA 5L3QA 2X2FA 2GXUA 1QR2A 3PE4A 1UINA 4J2TA 1B16A 1UJRA 1N5IA 1IG3A 5L3ZA 4BLQA 1UBTS 3QMVA 3W3AD 2AFIE 2FFGA 1EFTA 2WWGA 1E9AA 1DEAA 3IBGA 1FJGB 1H2WA 3L0OA 2OHOA 3H11A 3QJGA 4ZRMA 3G5AA 5TMEA 3SGHA 1M6WA 4OHUA 3RT1A 4MPDA 5CR9A 2P6MA 3DB1A 3TE7A 1RMQA 4X85A 5C1DA 1ZM4A 4C6TA 5JSZA 3JATB 4O0MA 4OQZA 5EUQB 4P58A 4YXWD 2ZYRA 1DARA 4GLJA 2ZBVA 4G8KA 5KWIA 2VNIA 3NHWA 1G2IA 3ZIAD 1E5QA 4A2WA 2ZZMA 4C5BA 2GJAA 2GM3A 3KXLA 2PUWA 4LUNU 3IDOA 2B69A 3GFBA 2IGTA 3EPKA 1VM6A 2YTZA 4JXXA 4F3CA 1N52A 2X5OA 5HFNA 3MF4A 2EIME 3M4YA 2FWMX 3OU7A 2B4AA 3DXZA 3P2YA 5ALNA 2P1RA 2UZ3A 2C2ZA 2Q29A 4UTOA 4TXPA 2GLTA 1L5LA 2V6MA 1U1GA 2VZEA 4POAA 4B8ZA 1PFKA 5K99A 3ONVA 1NT2A 3N74A 2P2SA 5B53A 2GOYA 2OORA 2H5JA 4BO4A 4HL6A 4RMNA 2QU8A 4BMDA 4KREA 1GYQA 1I3MA 3O7MA 1NW7A 1GGEA 4LWPA 4RLQA 3BIFA 1LS1A 3VDQA 5HKOA 2GEUA 3SZ3A 1TN6A 4TTTS 3UV6A 2F3SA 5TDHA 1JFVA 1GOTA 2JFZA 2VJNA 1E3QA 3LECA 2J9GA 1TYDE 3VSEA 4TT8A 5FBHA 4ZFHA 2HHLA 1Y8RB 3IVXA 1GL7A 4ITUA 1IHDA 3OIYA 1QNLA 2C5BA 3CR3A 4UVGA 4FE3A 1ADJA 3RKSA 4D2IA 2P4HX 3QXSA 1U1DA 3NAGA 1PJAA 4KIUA 1FNCA 2ON6A 3U5ZB 4P8RA 2JJMA 4GSYA 3RIBA 4RTOA 2YS7A 5JXGA 3BAFA 3GLGA 1DKRA 1NOJA 1FW8A 5JD6A 5EEHA 4B3IA 4DQXA 3GYZA 1JHXA 1KEKA 4C4OA 1MO6A 3UQ3A 3HYSA 2XZTG 2G63A 4PS8A 3CG4A 3K70B 3EULA 4ZCQA 2IYUA 3GMTA 3LKDA 4NZOA 4M8NE 5JADA 4YLYA 2A92A 4MV4A 1PNTA 3RU9A 3B36A 2WHPB 4C2UA 2GXAA 4LJYA 1L5NA 4X45A 4V0RA 5L3VA 3O31A 4P2BA 1QC5B 4AMZA 4KQMA 3WADA 1ONPA 2WMOA 2QYSA 5LJLA 3TO5A 2QORA 3F98A 4D80A 5ICCA 2J0QA 3ZU4A 3MJSA 3ZHTA 5I7OA 2GESA 2VF2A 4E30A 3QU2A 1ACMA 4J0IA 1A4XA 3K3PA 2LUHA 1OCCE 3DBRA 1NZJA 3KHSA 4J8DA 2ODQA 1T8YA 3WWOA 2FN9A 5JQGF 3FAKA 3N71A 2FFQA 4HG2A 4HAZA 3P9QA 1HR0B 1E9CA 5ALSA 4WXPA 3A2MA 2QUBA 4XWOA 4ZVNA 4HHEA 4HZUA 2OUIA 3ZV5A 3ESRA 4CT0A 1J33A 5A2GA 1A7AA 2JH8A 3D6UA 4MYTA 2G09A 2ZVPX 3WMWA 2RK6A 4HB0A 3AAAC 3ZW7A 3HR7A 4CM5A 3NCHA 3SU8A 2R751 2PGLA 3ASHA 2PS1A 1UP4A 1HE2A 4NYJQ 4JC5A 2QZPA 3TLBA 4JFRA 3Q88A 4JUIA 3IIKA 2Y1XA 5HZHA 4Q4LA 4YRMA 2J9FB 3OPVA 4UMFA 5E2BA 2MMGA 1T35A 3D6NB 4PAGA 1Z5UA 2CV1A 4E5YA 4JEIA 5H83A 3CZQA 4OL9A 1HUQA 3OWOA 4RMJA 2BVNA 1XEFA 4LCJA 4V1CI 1S1CA 2Y1WA 1FEZA 1LSOA 4X63A 1YIAA 1FBTA 3K16A 5DT2A 1QFSA 4WTOA 4MIYA 4H7DA 5KKAA 3GJRA 3E03A 3OU2A 1Z3IX 2QT9A 3GG9A 3TJRA 1IN8A 4DSAA 3CHRA 4TRQA 2QVBA 2QZSA 1IDN1 1LF5A 5K4HA 4TXNA 2QC9A 2JAPA 1KT1A 4RIEA 4Y6LA 2G40A 3EG9A 1OIVA 3HKBB 3ZCUA 2NPFA 4TRRA 5JJ6A 4D41A 4A9AA 5A23A 3ZTTA 2JHPA 3CEJA 6YASA 2O7NA 2HDOA 3QB2A 1Z7EA 4GL2A 5JEEA 3H1PA 4TOIA 4LX0A 2BP7B 5K4AA 1HTWA 2CSXA 2YHSA 1OFTA 2AG1A 4KZKA 4LKOA 3EFOB 5A0VA 2HUNA 3RT9A 2VYVA 1A2KC 2R65A 4LYDA 4LNGA 1DWPA 1WCIA 3DMNA 1RQRA 4RK1A 4B0ZA 5EDSA 2YHIA 1O1TA 3ZJVA 3AQ4A 3B70A 4V1CA 1V5FA 1VJGA 3SKVA 1UADA 4ENTA 3WXMA 2PKCA 1V1RA 3UJBA 5A9RA 2WI8A 4Q7LA 3KKOA 3LUCA 3H9CA 4X95A 3LLSA 3E8MA 4UZEA 1E64A 4GZLA 5FNVF 3PEEA 3LCAA 2RGYA 3H4MA 2AT1A 5I7VA 1EFUA 2AHOA 3GQVA 1XX6A 3LWDA 4G24A 3AV3A 2C2GA 3K0FA 4ZYUA 2PPLA 1PTJC 1DRWA 4MX8A 4B6RA 4EY7A 2CUNA 1ZNQO 3AU5A 2PGDA 4YJFB 4C07A 2KM1A 1ABFA 4HC4A 1J00A 3F90A 1TIPA 2JHFA 1JH8A 4EG6A 3M4JA 1T13A 3FJYA 5IHXA 4ZO9A 3CO0S 4G81A 5A6CA 4V0OA 2F62A 2XUGA 5TJHA 3SX2A 3KR1A 5LZ7A 4HH4A 4NH0A 4MJLA 4NMXB 2PS0A 4HXEB 4OGKA 4F9FA 2VJLA 1JIXA 2ZYGA 3F5SA 3SIWA 4Z7OB 3IDFA 5A4FS 3GJZA 4QUIA 3LLVA 4LZNA 2QWXA 1YVDA 2RJOA 1M6NA 1ZNYA 2A0XA 4HQNA 3ESBA 5DULA 3H0CA 2X8BA 5ITZF 3JUEA 4ZYXA 1QP8A 2EJVA 2R25B 1M8KA 4UTZA 3QWHA 2X9QA 4FQ5A 3AI7A 4WAUA 1Y6IA 1P6UA 2COEA 1U1CA 1H1LB 3A6ZA 1DG3A 1Z0KA 4FMDB 1UBFA 5K8CA 2GILA 3ONEA 3JQ6A 4LSMA 4YRKA 2GZ1A 2Q3LA 5JUWA 3UC9A 1BCSA 4YCDA 5AVXA 4OHXA 3VPDA 4I19A 5IVPA 2YZGA 1RWVA 4CQMD 5GWXA 4U00A 4Y2QA 4XWYA 1EM8B 1SB9A 2JARA 2BKKB 4PS0A 5K05A 1EUDB 1BCRA 1RM3A 2LPMA 5WRFA 1MJ0A 2J5QA 5K8UA 3TQFA 1QUFA 1THTA 2ZI3A 1KZ7B 1XJ5A 3VZBA 1N3IA 3U09A 2EKDA 1GAQA 2R6GA 5IAJA 2AFHA 1FVFA 5CEEA 1WPXA 2NZJA 3E2IA 3V31A 4LYHA 3I0ZA 4E4TA 3PNTB 2B4QA 3LKUA 1W0KA 2QOEA 2QTLA 3FUEA 4L8GA 1LUAA 2HL6A 3IERA 3AKCA 1SVIA 1HOTA 4ZTZB 3IBSA 5CLLA 2FX5A 1YZHA 2W7TA 5L4SA 3L4SO 4EO4A 4BO7A 1Y3DE 3MAJA 2FZGA 3L8YA 3QA9A 4JVMA 1KERA 4JB8A 2XUKA 5FTWA 4J1QA 1QG6A 5AP9A 4A6PA 2FWBA 5L95A 1YSCA 5LMCA 3U7QB 4MB0A 1YZ3A 1XVTA 2OL4A 2VYND 3R7DA 5I7FA 3TCKA 3I04A 4BMSA 1EFKA 3UV7A 3BE6A 3S29A 1MB2A 5DNCA 4OLFA 4QOSA 2Q9AA 3K6SB 1OIXA 3G1WA 3PQ4A 1JNXX 1UBNA 1C7RA 4PBTA 2WXRA 1C0KA 1F0KA 1CZUA 1IN1A 4XKBA 4RXUA 3GLKA 1KO8A 4LGMA 5B1AE 3AM4A 1DBIA 5CFLA 8LDHA 4EYEA 3E9CA 3BN3A 3PBKA 1UF9A 4CI9A 4CM8B 1Z29A 1WLYA 1VMAA 4NIKA 1IG0A 4PLGA 2GERA 3HJUA 4J91A 4HEHA 4N47A 1IC6A 3UTCA 4PN3A 3F3KA 5CEJA 3NOOA 2ABWA 4RKQA 1JPUA 1HH8A 4OKSA 3U49A 2CFUA 2HA6A 4YP7A 1I9GA 4OGFA 1EQUA 1PG0A 5B3KA 4TV9F 4Q01A 4UTPA 5T6BA 4XIFA 4NU6A 2AMLA 2JZOA 3D0QA 2XDQB 2FMTA 3DF7A 4KQ1A 3H6GA 3BC1A 4OB8A 4BO1A 1TZMA 2Y1KA 2PXHA 4N1AA 5AMXA 2Y1GA 4E6HA 1X7DA 3NC0C 3HVJA 3Q7AA 3UK1A 2GETA 3TL3A 3WK9A 1SC9A 3V2HA 2W58A 4JLKA 4CLOB 3PUHA 3TH5A 2NXWA 3CO5A 1U5CA 4O60A 2YHAA 3APFA 1LLDA 4LY0A 5HW0A 2XADA 2FZ5A 1RYDA 2VOEA 1Y8QB 1WVGA 2GVNA 1XCJA 4KV7A 2PSHA 1LV7A 2YWJA 1AQJA 4EG0A 3PZBA 4B81A 4L8YA 1O94C 2IO2C 3DEIA 1KEVA 1SU4A 5KWVA 3TD2A 1YKGA 3DR5A 3LUAA 3OM0A 4H6VA 4HAUA 4MWTA 4KR2A 3FJ1A 4KDFA 5IS2A 3GRYA 4JYAB 1SOUA 3O4GA 5TX7A 2Q5OA 4KW7A 2FR0A 3CISA 1CJTC 3K9NA 1Z4QA 3PFWO 1OI2A 4OJNA 3F6RA 3ZY3A 3CVLA 3FTSA 5DYTA 4TKMA 2AHRA 5EWLB 1Z68A 4AYXA 3SVLA 3FFLA 4B85A 1W5EA 4OK3A 2CNWA 1I5RA 1UXJA 4MH0R 1SBQA 2WZBA 4PC3A 4LSZA 3N39C 4OD0A 3TW6A 4E2ZA 4ZREA 4GTVA 4IIBA 1KBZA 3AI1A 5AUPB 4IS3A 3V80A 1JBKA 4IY1A 3C1OA 1VJDA 1OXBB 2Y4NA 2BFMA 3L84A 2DQZA 4QT0A 3EGCA 3DT6A 3GZ4A 2YDYA 4TMWA 4R2JA 2H06A 3THYA 4C89A 4UYJA 3P2IA 3CCFA 3GC6A 1A9ZA 1ZJ4A 3MJTA 1PJZA 1XI2A 1U2QA 4URXR 3O8CA 5L45A 3IMFA 2BH9A 4G5HA 3U4DA 1P33A 1J22A 1NBWB 2QYOA 5G53C 4EVSA 3FWHA 5G4LA 1SCUB 3K15A 3LP5A 5DLPA 3H2KA 3HXMA 1UR5A 3V2UA 4IZHA 4XWGA 1KEEA 2W2VA 5B30A 1NNI1 4P86A 2ZWVA 2H1FA 1R5BA 4RTRA 3LX5A 5AHKA 2EEPA 4M9ZA 2L2QA 4NS1A 3DZIA 2Y2VA 1XLUA 1MG5A 2XZLA 2XE6A 4TTPA 4Q3EA 1LRKA 1R6TA 3JYQA 3T9KA 2YV1A 1T0UA 2I34A 4LEIA 2KCKA 5IT9A 4OTZA 2H1VA 3VAZA 2VNHA 2A9RA 3FCCA 1QHHA 3CV3A 4RC9A 4BFSA 1HZJA 3I6IA 4ALNA 2PZLA 1Q7CA 1Z12A 2GN9A 1I9CA 1XTUA 4EVQA 2WV7A 5T5QA 3B7UX 1Z07A 5ADVA 3RC2A 5AVUA 3T3PB 1JXMA 2HU2A 4JC4A 4DA7A 2JK0A 2QF7A 2WRZA 4MW1A 3EHDA 1ZJ5A 3FUUA 1PLKA 4TLBA 2Y0EA 2OGTA 4RCZA 3BMOA 3IALA 4KGZA 3B13A 1RW2A 3LNCA 1KK0A 2XOXA 2R7KA 1DVPA 1Y7HA 3UAYA 4U8HA 2V0GA 4FA6A 2PM6A 4EMBA 2VDRB 1GSIA 2CDNA 1BAPA 3GAFA 1VJRA 2XD4A 4BCBA 2ZRDA 3CSSA 1K4YA 4YJ3A 4AY3A 4QODA 1RRCA 1IM5A 4F2GA 4FDTA 1SD5A 4YR9A 4JI2B 3VFDA 4JV5B 3IODA 3ZCQA 4KITB 2ZW9A 1P5ZB 3BEOA 2FFAA 3KZMA 5FQ8A 5I01A 1W4BA 4DC0A 2F48A 3LS2A 1T2FA 4RETA 2DHEA 4PG8A 4I5FA 1QZUA 4O4HA 2QTZA 2ZS8A 2ZYHA 3EIJA 1KQFA 3LXRA 1ISIA 4JD2G 2VTEA 1T6YA 3ZYQA 4BNMA 4CMAA 3HY6A 4XSHA 4UTXA 5DBFA 4RADA 4MVJF 2WFLA 3OEED 4QHTA 1KI4A 3QVKA 4H4CA 1T3GA 1QPGA 1V47A 1FCJA 2PMDA 1GKKA 2BFOA 4HLLA 3L6AA 2I6UA 2KBEA 5L40A 1TNOA 4TWRA 1O87A 2ASVA 1FSGA 3L93A 4JA0A 1LW7A 1NVKA 3WOVA 1SVSA 5AVVA 3ASGA 2EATA 2QG9A 2Z56A 4PF1A 3CE6A 3K96A 3D7RA 5CFNA 3OQNA 3HVEB 1ZJWA 3PJDA 2NZUG 5HF9A 3EDYA 2V7WA 3TFQA 1A8QA 1RBYA 1V0JA 4KE6A 4WE3A 3LI2A 3LCUA 4WZ6A 1PYGA 2X9GA 3N6RA 2Z30A 1PS9A 4UAVA 4B8YA 2JAOA 3HJNA 4X3CA 2BJHA 5DYWA 2F00A 4NY1A 1IXVA 2QR5A 1A27A 4MVJE 2BEDA 3PLRA 3X1DA 1D8DA 3SXJA 4RY8A 5DZSA 5JAUA 4IRUB 4TKLA 4H1WA 1MOQA 4FDAA 1U11A 2FR1A 3S4YA 3R44A 2ZUBA 2WILA 4QFDA 3PC3A 2YMMA 2A33A 3NVMB 3BE5A 1DV1A 3ZWPA 4BWRA 1WG8A 3ITDA 1U28A 4YI3A 3HCDA 1B26A 1EVLA 2AZMA 3TQQA 2KB0A 2VDMB 5ETJA 3GARA 4ABTA 3OF5A 2BTQB 3LT0A 3W9BA 3TQIA 4M9UA 4KCGA 3RIHA 3VPXA 4DOMA 2BFNA 2JD1A 2I66A 5FTNA 4G8BA 2QYUA 4QYWA 2AI3A 3PKZA 3PNLA 4KFUA 3W5UA 1E6UA 2Z8YA 1E4YA 1JEJA 3IC5A 3LQ1A 1GZ3A 1MVNA 4L02A 2DIWA 2XKJE 4WLVA 3TLGA 4ATZD 5AM4A 4AZWA 4S0ZA 1AKUA 4P35A 2V74B 3PGMA 1UDRA 3B7TA 2G06A 3C3XA 1HDOA 4CHGA 2CYBA 1CETA 3MT9A 1ECPA 5EIAA 3QXHA 1XD8A 1Z4NA 1NPDA 1EJ2A 5AK5A 2MT9A 3ZN2A 1UKZA 2RB4A 4HX5A 5DM2A 3VKVA 2FK8A 2JASA 1E96A 5DN9A 5ALGA 4F4IA 5BR1A 1ZD1A 1CF4A 2IYZA 3EZYA 4E07A 5ITSA 2VBGA 3KOZA 4JT8A 1HZ4A 1E5VA 1AF7A 5HQ3B 3SJCA 3HKCB 2AJTA 3AOEA 4KWCA 3MT8A 2C4TA 3ENQA 2I9CA 3RFCA 3CKLA 3RI3A 4ZOBA 5A3QA 1XXLA 4MCJA 1JHQA 2BBWA 2OUKA 1H2AS 2WJYA 2FJ0A 1IZYA 2QZJA 4PRZA 4EA7A 2JJ1D 4UQYA 2WYOA 4OI2A 5JSYA 2VTBA 4L5CA 4UATA 2H31A 4HX9A 1U3DA 1ZONA 3P0IA 5P21A 4PHTA 2GK6A 4YRNA 3JTMA 4S12A 4E32A 4NTZA 5GIPE 1RXSA 3ZG6A 2GO1A 3X1ZA 1TNYA 2JDID 3MAGA 1NJ6A 4Q9JA 4MDYA 2RAVA 4Z0NA 1HQDA 3NR2A 3RG2A 3JYHA 2IYAA 4RK7A 1H85A 2X13A 3GLRA 2GF2A 2D54A 5ITWA 4H6PA 1QONA 1DWQA 3WISA 2RAUA 2WXPA 1RWBA 3DG9A 1IXYA 2JEKA 3WQHA 1BQ4A 4DWVA 4LJSA 1J5PA 1UEIA 3LSYA 3SYLA 2FLWA 3GJXC 1P9OA 3U7GA 1O95D 3MRTA 3UWSA 1F2VA 2SECE 4NYMQ 1DO8A 2OC9A 3HYNA 5D01A 4A5SA 3CHOA 1RYEA 1E2KA 1PQPA 1VPVA 4QU0A 4YDEA 2Z95A 2NN3C 4ER5A 4AWBA 2FQWA 5KQPA 1B74A 2CJWA 1MFZA 4KLZA 1ZN8A 4RD0A 3T38A 2R7AA 1ICEA 3SOZA 4ZQBA 3RVDA 2IFUA 2RC5A 5HGJA 3S2SA 2J3IA 3X0DA 3QJ5A 1A4IA 1QZ2A 4RIFA 5T3YA 2XGJA 1C9EA 4XE5A 2HJSA 3GRAA 2I8CA 5DSTA 3QLEA 1CJBA 5LMNB 1NJGA 2AQHA 2UZ1A 4P92A 3W4JA 1RYBA 2OCPA 3C6MA 1ZM7A 3UK7A 4C4XA 4RA9A 3MAAC 2A9FA 3Q7FA 1CE8A 5CK4A 1AQLA 5EJEA 2P5YA 5GONB 2AZTA 2ZM6B 2KHZA 5HPYB 1DHRA 2R2GA 5DI3B 3UMRA 4WIAA 3UMMA 3A1WA 3WIOA 1Q1EA 3C3KA 5KQMA 3IKOB 4BGUA 2EBWA 1GTMA 2Q3JA 2COUA 3WRYA 3DL0A 1O58A 2B82A 4B3FX 1ADFA 1SCJA 2GAJA 4UI9C 5J1SB 3H4IA 1GJRA 1H9BA 2GXSA 1JJVA 3C6ZA 3RAUA 3JYPA 5JU6A 3VJMA 3ETHA 1HMPA 1BD3A 1PGQA 4YDYA 2WE8A 3KZKA 4CG0A 2YX1A 1PL8A 4LHVA 3J5PA 1WBJB 4JLVA 3JVVA 2AE2A 4QVIA 3ZS9A 221PA 2I33A 3TJPA 3IHWA 4JI1B 1KAOA 1AZLA 4KYUA 2AOXA 3CB4A 1ZCFA 2F3RA 4IIJB 2FPGB 4ZOQI 5JMTA 2ERXA 1M72A 4AJPA 2FI7A 4DNQA 1DAEA 3K8QA 5KCZA 3I42A 4QICA 2CHGA 1V7CA 3N75A 4NBSA 3FB4A 1XD2B 4YXFA 4YAJA 9MHTA 2R1ZA 3WLEA 3ZZ1A 4CUJA 5AJDA 3OEYA 3IJ5A 3F7NA 3HY3A 1OOEA 4TKVA 3IAS1 5LQAA 3KX2A 3C5CA 3ZNNA 3P2EA 2EFDB 1JSXA 2PSEA 5JRDS 4F5EA 2ZBGA 2R3SA 4HS9A 4BVEA 1C41A 4Y9RA 3N8NA 4MS1B 3PNOA 4LNUB 1P74A 4UJ3A 4O2BA 1UBSB 1CIPA 5E3IA 1O54A 2SKCA 1QO7A 2I8AA 3A70A 1TX4B 3GLQA 4JEMA 2ACWA 3EGEA 3OSUA 2CLHB 3DZHA 2LO6A 3FPEA 1OGIA 3BZUA 2NXPA 1KY3A 1P3Y1 4BX0A 3LW7A 4EW1A 4KQWA 3N7AA 3TWWA 3KUDA 2ZYVX 4DIDA 2BHRA 1TM4E 2OFFA 1OASA 2XXAA 4RG9A 1LJLA 1UQRA 1UZNA 5K3FB 4RE5A 5ENSD 2C3YA 2ZPUA 1Z16A 1GSAA 2KW5A 1FQKA 4FJYA 4GZ3A 1G6OA 3DOHA 2DM6A 4PH4B 2LR0A 1AKQA 1Y4AE 4ETIA 5IUJC 3KAQA 2CVHA 4EGJA 4BY9E 3LYUA 1CRLA 1U7WA 2X3MA 3JVIA 7AT1A 2IELA 3OT4A 1EUQA 3TGPA 1IWPB 3WJAA 3ABKE 4A15A 2RJNA 1FMTA 4DLOA 4F7DA 2ZVDA 4RH3A 4XB6B 3NQ41 1OI4A 3G7SA 3FFBA 4K6FA 4AWXA 5AXAA 5JATA 3NGMA 3W1VA 2B0OE 4NAUA 2QL6A 4TV8B 4HTFB 1VDZA 4Y2TA 2XCOA 4O2LA 2AEJA 4PXSA 1N25A 4O33A 4XJXA 4FK8A 1M8PA 2PO7A 4NQZA 4YRSA 5DBEX 1NW5A 5E4JA 1PK9A 4ZZ2A 2C7QA 2Q8PA 3MD0A 3HXOA 4NOLA 1VPTA 4C1NA 5ICFA 1Z5GA 4GECA 4R01A 4ZVLA 2C57A 1NRWA 2I4IA 1YQTA 3C43A 3RADC 2A0UA 4LXIA 1TZKA 2YHEA 4ZYTA 1H6BA 3RJVA 4B6PA 4MQFB 5ALRA 5HJEA 4UWFA 3GU3A 1N1EA 4EPRA 1XZAA 1CVLA 3TM4A 4MVJP 2QTBA 3BT7A 2V5UA 3DKIA 1ZIYA 3E5RA 5KYWB 1MRZA 4N7JA 3G9QA 1GQFA 4V3BA 2YWHA 2FRDA 2WSYB 3WKDA 1RU3A 3UGQA 4L4ZA 4OA8A 4C7OA 2TMKA 2WF6A 3NG1A 4JITA 3HHPA 1X3LA 2DETA 1WV0A 2X22A 3TSAA 5JYCA 4Y1RA 3ORSA 3X2EA 1Z6YA 4JOBA 1YDEA 2QW8A 1Z15A 3U19A 2HQSA 2XMDA 5CCDA 1M0EA 2VH1A 4DHWA 4WNYA 4QFBA 2LXLA 4L2YA 2XI4A 2GZAA 4LOHA 1AJEA 3TZKA 4AS2A 1CC1S 4EPXA 3RYTC 1SG0A 2JFYA 3H75A 3TG8A 3COVA 2J87A 4F71A 1X7XA 1KI8A 3BB4A 1L3CA 2FQXA 3SBXA 2RE8A 3DT9A 1JVSA 3WYDA 3PC4A 1RM0A 2BDTA 2DJIA 3I2JA 4EX6A 4RELA 2CW5A 3DBOB 5HQ8A 3BF7A 4KG7A 2ZU0C 4Q48A 5IC4A 2XMPA 1LB1B 3N7UA 3L8DA 4KQIA 1AXRA 2WYVA 4Y67A 1LPOA 4GAAA 1PWYE 3EVFA 3UATA 4DTCA 1L4KA 4ZCTA 4FUTA 4II2A 1H3NA 2FEAA 2RHCA 2WAMA 4NDAA 3KDAA 1DBQA 1Z5OA 1D3AA 1G21E 2ERCA 1GO2A 1OHHD 1VLZA 1Z6GA 3FNFA 1DELA 1KLXA 4O4LB 2VHEA 3H5WA 3AMVA 1LDGA 1KR2A 3AJ9A 3VU9B 1XTPA 2HLHA 2R00C 1E4VA 3HVKA 1HL3A 2D1RA 4N0DA 4FR5A 4WGGA 3TW8A 2OP1A 2VJCA 2PVPA 5C31A 2H52A 1GQYA 3O83A 1X70A 4P84A 1WXQA 1VL1A 4BWYA 3G9UA 4AZ0B 5C4IA 2PBLA 4J9VA 2OBFA 1XE3A 3GLUA 3LPLA 4E7OA 4J3NA 1IWOA 1LVHA 5EL0A 4IKOA 4UUNA 1OI7A 1DT3A 4QTXA 2GBPA 1FFDA 1QGUA 1C7JA 2E3JA 5IW8A 1D6SA 3SAJA 3I9JA 3OMLA 1ONBA 1E5DA 4P7FA 4IVNA 2VH2A 3IJEB 3T8KA 3DL2A 3ASFA 3E9MA 5C2YA 2XKAA 3HXBA 1P73A 1GRVA 2WZQA 5EQTA 3QF4B 2R5NA 3ZVKA 4AY5A 2Y0BG 3FTYA 5SICE 4PSAA 3U3RA 2I76A 4LNBA 5LYYA 4FHCA 4C08A 3F49S 2HQOA 2NXJA 2AN3A 1R0WA 4INAA 4B44A 3DLHA 4TWZA 3FCYA 2VP5A 1B89A 3KWLA 3FHLA 2D8AA 1P3DA 2VJAA 4M8KA 3TSZA 4P6VF 4IULA 1MOSA 4LWOA 4YO7A 3QIVA 2JLAA 1W30A 1YAJA 4LHXA 4ZEWA 1LJ8A 4K81B 3E9DA 1YOBA 3O1JC 4AZ3B 2HA0A 1M2VA 1V4VA 3GGSA 1H2RS 2HLNA 4IF4A 1MIOB 3JQDA 4OI4A 1THGA 4LXGA 4A6DA 1UBMS 2G4VA 1RCFA 3GVPA 5BW4A 4HDNB 4US2R 4F0JA 4Y6PA 3C7AA 1HS6A 1L4GA 1FRVA 1ZUWA 5AVZA 5EJ6A 3VPFA 2HMAA 3DMRA 4U7JA 1EGAA 1UJ2A 2PUCA 3PIDA 4IDEA 2RGDA 1QO0D 4MUHA 1YMVA 4BRUA 5K0CA 3K2BA 4LSGA 2ISSD 1OFVA 5M7EA 2NZXA 3STTA 2I6HA 1Q0ZA 3NHAA 2W6CX 4ZEOA 4YRPA 1YB6A 4KI0A 4UNIA 4BBPA 4OYYA 3MRSA 1N9GA 1NV9A 1RQGA 3RGWS 5KQGA 1KYIA 5CIQA 4UPDA 1XIVA 3KOYA 2FCAA 4QWWA 3S68A 4G1VA 3LOPA 3EMVA 3I3NA 1LNSA 3AU9A 2D1YA 3QKSA 4AMGA 2P9YA 2IYNA 5AAOA 4GM0A 1IN4A 2P2LA 5BYJA 4RFVA 1N77A 1Z4LA 5FBWB 2W98A 3IUQA 1HG0A 1VDYA 4JL0A 1QV6A 4LE2A 4EL5A 3WLLA 1U3FA 3QBTA 2UVPB 4DBLC 4BTAA 1MW9X 2BJVA 2GRAA 1EMDA 4JN6B 3G2KA 1Z8FA 5J2TF 4BE9A 3WO1A 3U4HA 2VSFA 1Y7IA 5THQA 3OQ6A 3O4FA 4QM7A 5K6TA 2O1EA 3DVAA 5CB0A 3HABA 3EY4A 3OZEA 2EKZA 1SCDA 2Q6VA 2VZ8A 5FHQA 3WP1B 1MJHA 3OCZA 2O2DA 4LAFA 4PCUA 1AQNA 3AEQB 1EBBA 4A8JB 1U9CA 2EAUA 4M21A 5DB4A 5ENTD 3MA5A 2PZ8A 3OFJA 3U4QA 2C9BA 3KJEA 3I64A 3S7DA 1ZVKA 1Y6QA 4BNTA 2PH3A 4NKRA 5TJ9A 4HI8A 5CG1A 4TSFD 1HG1A 4UXHA 5F2OA 1A2BA 1VMDA 2V1XA 2IPNA 1K0UA 3W5DA 1QXSA 2NQ2C 3AR9A 3D9IA 5FAKA 3IE2A 4D5EA 2HUPA 3A04A 5BW6B 2TECE 4MINA 2AYYA 1GTVA 4H7PA 5H81A 5KJCA 4ZRNA 4LF5B 3APDA 4BO0A 3CQCB 4QT4A 4EEZA 1Z4PX 3X1YA 3MQFA 4DSUA 1PE0A 4DABA 3E1GA 1IXKA 1JQJC 4Q82A 4YT5A 1T5BA 3K9HA 1PK7A 2VDUE 4YQYA 3U37A 2WVHA 4YBZA 2H65A 4MLDA 2F59A 4B6JA 5JZOA 2R05A 1VI6A 2XRZA 3WICA 3RC1A 5A4DA 1YDMA 2ZR9A 1XALA 1I4OA 4EFNA 2E21A 3TRHA 1ZRHA 1JV2B 3I2HA 1E9SA 2G28A 2UV8A 5EZYB 2XUFA 5DPMA 5FUVA 3N2GA 3WSVA 1VIVA 3E1KA 4PYMA 1H19A 2IF0A 4WNEA 3IESA 4KO4S 4W7HA 2YZ7A 4YONB 4GOXA 4LZAA 4O4IB 5DIZA 3NHKA 4PAWA 2GBLC 4WLOA 5LQJA 4PUCA 3LHDA 1D2CA 1KAMA 4QYIA 1IN5A 3IKLA 3BTUA 3GDHA 1QIKA 3LT4A 3L6OO 4HDAA 1U8UA 4C3VA 1XYVA 2FEMA 5ALFA 4IDOA 4RSMA 1TZBA 3MINB 4OB7A 1E59A 1EE2A 2FW9A 4TXHA 1T4CA 1KOJA 4FJ0A 3OPQA 5KJEA 1SXJD 2AX4A 1Z0UA 5JCJD 4OP1A 3FZNA 4INPA 2JI4A 2G9QA 2IIVA 2JIDA 3OX1A 3H18A 5KTPA 5IKPA 1T6ZA 4AMYA 1XZQA 4WOCA 1B6RA 4TS3A 1NKSA 3A1VA 3AFGA 4LUCA 5B55A 1GG5A 1TADA 3BSFA 5AQ7A 2PKXA 2VUSA 5LU8A 3IS3A 4RTNA 1LTQA 1DIOB 1J8QA 1S8NA 3PZ1A 1XTBA 3CN9A 1YVPA 1UCFA 3PEUA 5T57A 4X92A 4J6FA 1W93A 4P4GA 5JE8A 1LDNA 3REQA 1JA1A 3I62A 2O50A 4TLDA 3F7MA 2EKQA 1XFDA 1WXHA 2JK1A 3BK2A 3ML8A 3IVMA 1UJ4A 1NATA 3E9RA 2SICE 4RH0A 4TT3D 3ZE1B 2XQFA 1TMKA 3G0CA 3JQ7B 2DHQA 4BPBA 4PBSA 4GFDA 1PVDA 4JYMA 3EIHA 1OJLA 3RAPR 2EJUA 1WM5A 5TPZA 4ZCSA 3L40A 1Z62A 3SSOA 2RAFA 2DBRA 1ZJ6A 2X6RA 1NF9A 3KSRA 1EHIA 2YV3A 3IPAA 3GROA 5FUXA 3I5XA 3QVLA 4ESHA 2VUTA 1D1PA 5I3CA 4YDHB 3IBEA 4K7JA 1IY1A 1AX9A 1D04A 4H0CA 3PUVA 4PIMA 2W2XA 2IDMA 5ALLA 3OPMA 4JB3A 1H0SA 2V0PA 4AZSA 3VYVA 1A4RA 2ZAIA 1H2UA 3BREA 2PXAA 1G3IA 5EEGA 1Z83A 4WNCA 1O1YA 1OZGA 3D59A 3QJZA 4E5NA 4N0EA 1BE8A 1S2DA 2CDBA 1BS1A 3KSUA 4P4LA 2W2KB 4L0CA 3K8OE 1EXWA 4ZZ1A 2E4UA 5FWDA 3RB8A 1HDZA 5K20A 1IMJA 4G25A 4EPWA 1KEZA 3TINA 1B76A 3QU5A 4GP7A 5JROA 1FP2A 1P5HA 1YMPA 3MS4A 1KC3A 1ZSVA 1T2EA 3H3XA 3WV5A 4M1KA 3ZQUA 2IBTA 1HKHA 1VCIA 2QTNA 3FWZA 4C3OB 5EMMA 1PNQA 3HBMA 1KMMA 1XMJA 1DEOA 3U4TA 1IEVA 4CF4A 4MPPA 3KU1A 3G0OA 4LYAA 2CFTA 4L4SA 2XE8A 1FP6A 3DWFA 4DLUA 4JT4A 2XIQA 1L6IA 4UDXX 1G64A 2AH5A 1JEAA 5L6LB 3QRWA 5BMVF 1CQIA 4I0WB 5ALEA 2Q45A 4YAKA 4MVYA 4PQRA 3NEPX 2X3FA 1N6OA 5LP6B 4QPJC 1HDYA 3OJCA 5B1BE 4AL4A 1U8FO 2CDAA 3BULA 1YAHA 3IQGX 4DLWA 3HA5A 4UTRA 3TR0A 4ARCA 1OLSA 4WEOA 4HDSB 3CIFA 2MYTA 3KTDA 1QH8B 1H22A 1XZLA 4YCSA 1W87A 3L13A 1ACLA 1G291 2JBAA 3PXEA 3QVWA 2JBHA 3R9XB 2ZJ0A 4L3WA 2MSCB 2BGRA 2QY7A 2FR8C 2V4ZA 2ZYIA 3RK6A 2AG5A 2X14A 3H4TA 2OQVA 4DIBA 3QY0A 1L6RA 1BGWA 2GFQA 1RC8A 2CHVA 2ETCA 2ZSUA 3JAWB 2V3VA 4U02A 4ZAWA 5KWJA 1ZCZA 3MB5A 2XCCA 5HYVA 1Q16A 1SW6A 5BSUA 3ZWXA 4A0RA 2P62A 4IJ6A 2J8SD 5LP1A 4DY6A 3LQFA 2IS6A 5HR5A 4AKGA 3MIIA 3FGPA 4FC8A 2Q21A 3R23A 4P3XA 4RLSA 4MCHA 2PKQP 1BXKA 3V1NA 1XK7A 3SC3A 3ITWA 3ONNA 3C3QA 3FH7A 3EGWA 5JNUA 4YQZA 1KQPA 4E5VA 4FYXA 4BUZA 1PKEA 4E46A 4UE2A 2Z8ZA 1VGRA 5BV0A 1WLSA 4XVRA 4KFTA 3R3YA 3KEMA 4RZ3A 5KMGB 1YS2X 1KYWA 4MBGA 5BWBA 1IPHA 4DIEA 4ARZA 1AA9A 5B7NA 5CRVA 3K09C 3C6XA 3L8EA 3GRZA 2QYJA 4UUQA 3T5MA 3TWQA 2BMJA 3K72B 4LDAA 1SBCA 2YHUA 2QI9C 5I9IA 2GKOA 1TVEA 3BD7A 4XD7A 4MITA 3CHMA 4IXNA 3H5NA 4S04A 4F4HA 1YB2A 3ANTA 1BU5A 1WA5A 1MA0A 1GZHB 2Q49A 2YYZA 3DYIA 3OMXA 2R2AA 4E12A 3KSZO 2PCLA 1SIWA 3KWFA 4LF6B 2V7UA 4E6PA 2HTEA 4PHFA 1RXIA 1CY7A 2ZR0A 3HEAA 2YWCA 3SOPA 3UW1A 1QK4A 5HFJA 1E18A 3X2FA 3UN1A 1MYOA 4HFMA 1QRAA 4HQKA 1W85A 1V9LA 1KHTA 2GPSA 3U16A 4HOQA 4P3OA 1B6TA 1CULC 1CY8A 3CLTC 3ZXYA 4Y3UA 2OCAA 3P0JA 3MSXA 5E6RB 4HMPA 4NE9A 3KJNA 3EASA 3NWBA 4GXNA 2EARA 2DHCA 2GLXA 1H69A 1M1YE 2H48A 4HDRA 2D1FA 2FXVA 4F9GA 4H16A 2Y0PA 5DI9A 4AXXA 5C18A 3I5AA 2GD0A 4A1GA 1Q22A 3JWJA 2IEDA 1PR0A 5A0TA 3P2OA 1P0FA 3M7IA 5HP4A 4RNCA 5HIIA 3EXG1 4BFXA 4KODA 2VGXB 5JSKA 3TWRA 2RH5A 3PEWA 2YJGA 2AXZA 4ERNA 3PXDA 3NLLA 3TUJC 5HDBB 4MYUA 3M8KA 1P6QA 3K53A 4FINA 5AARA 1VHDA 2Z2YA 4WFJA 4Z2AA 1SZPA 2JGNA 2FX3A 3AINA 1RHQA 4H7KA 4B8CB 4BVKA 1QGOA 4BJ5A 3TB6A 1DTEA 4WZBB 3BS4A 1G5RA 1YWGO 1ELKA 2X4GA 3MERA 3FAZA 3FVRA 4R8RA 3F73A 3QXGA 4DRXB 4J1TA 2PMFA 1NDQA 4OAVB 4FFWA 1N2ZA 2CV2A 4GZMA 3IAM1 1SA0B 3K5IA 4MARA 5IDVA 1BDJA 2PFGA 3TSYA 2CLDX 1A96A 3MBIA 3OF2A 2BZGA 4D0RA 1OXMA 3URMA 4LF7B 3C3BA 1U6KA 4YT8A 2MR5A 4XEHA 3SS7X 2PL9A 5GIOE 1ZNWA 3CW8X 4I36A 1O8BA 2WXIA 5AK6A 1V95A 3IEMA 1E20A 2WOJA 2LAHA 5FPYA 4LJ8A 4LQLA 5JFGA 5IG2A 1XPJA 5HUHA 4I1MA 3GZNA 2QW1A 3M82A 5JH7A 3R0IA 5FLYA 4O02B 3MJFA 3T3OA 4WXHA 3T7DA 2XVYA 2QRVA 5CVTA 4HRXA 2CXSA 1CJUC 5ANRA 4FZJA 4BZWA 4KRFA 1GCIA 2V9PA 5JAOA 3U3DA 1KZGB 3E22A 4NNJA 3TJMA 2ZTUA 1W4CA 1ZEJA 4P5DA 1IATA 2FEXA 4WZAE 4JI3B 5FTKA 1DX6A 2Q4RA 1HTBA 5BPHA 3WLIA 4UBNA 1I7LA 3PSHA 1VE9A 1CRZA 2O4UX 3KQQA 4N7RA 4GUDA 5BSFA 5JZVA 2J7KA 3OURA 3NRBA 2RCYA 2TRSB 4XUEA 3VKGA 1J8DA 2C97A 4Y2JA 4WNAA 2D7CA 3SNKA 2HWKA 4WCFA 4Q4CA 5TQ0B 3SXPA 4NQRA 3R5SA 3EDQA 4LJKA 5K3AA 1YRQA 5HIKA 2KWIA 3NNNA 1JHDA 1R9MA 1U9ZA 4IIHA 5KTRA 1B1CA 5DHUA 2LWIA 1PR5A 1Z28A 1RQLA 4IEFB 1VCHA 4MVJM 1M34E 3RUPA 1EJBA 2Y68A 3P2JA 2VWQA 1ZY2A 2ZPAA 4FWBA 1ODSA 4LERA 1I2AA 3DOEA 4IMRA 4EMUA 4IYRA 4LRZA 3BTSA 5B7PA 5JJBA 1BG6A 4OHZA 1JT2A 4F8YA 4I4LA 4R7GA 4GE0A 1ST3A 5DNWA 5IAGA 4LV8B 1A8HA 1VHLA 2FZLA 5BW5A 2H5EA 3JVUA 3ROEA 4GPEA 3LU1A 2P2DA 3WRXA 2JGMA 1B00A 1D0VA 3ZHZA 2O3SA 4NAVA 2AKAB 3UIOC 1VPWA 5THXA 4LE0A 2J49A 1Q0QA 5FWQA 2QRMA 4GSKA 2J09A 2G7MC 4KDCA 3U7FB 1PEYA 3L7YA 1X86B 3CPHA 4EWLA 1RQXA 1W47A 2GEFA 4NJEB 3VZDA 2FB9A 4L16A 4QGAA 5KDLA 2FX2A 4Z2YA 4XUDA 2WTXA 4KUEA 3RNLA 3N2NA 4BBAA 4RVFA 2A5LA 2NO9A 4UUBA 5KYXB 4DCNA 1SQSA 1YGPA 1K63A 2PGJA 1QCZA 1OXXK 3SKXA 2P65A 5JRJA 3OZXA 4C0SA 4MI9A 2XWPA 3F46A 1H2BA 3G8AA 3PQFA 1DAGA 3ESKA 1JAHA 2NM0A 4Q03A 1EWVA 3GH3A 5E9QA 4ILGA 1PR9A 2PVSA 3S8EA 5DNYB 3G2SA 2XCRB 1XZDA 3DFIA 1XL1A 4W1PA 4O2AB 5FR1A 3S8MA 4R1SA 3MWGA 1EA5A 2F2TA 2QVZX 3KVVA 3GEIA 4G0ZA 3QVMA 4XCVA 3G2UA 1YL7A 2WKSA 1C9NA 3AZPA 4ARIA 3AILA 3T7CA 4LDNA 4IMIB 3W6PA 3TXAA 3LUHA 4UWKA 1VRCA 3PNVA 5EIBC 1LJUA 4WY2A 3ADOA 1II8A 1JFFA 4FYIA 4FCTA 4LHWA 5BRJA 3VPCA 3QXXA 4G11A 5L3SB 2ONDA 2JD2A 4HPJB 3OC0A 4L4UA 2GAIA 3B1XA 4MKIA 1XRQA 4JLMA 1PT5A 5NULA 1W4ZA 3AW8A 3VHQA 2Q3FA 3K9CA 1FVHA 1ZN2A 2NZVG 1R0XA 1JNYA 3I05A 1MJGA 3ELWA 3EPHA 3QLVC 2R96A 1MQAA 5BRNA 2DR2A 2QN2A 2CXQA 3HZZA 3EYWA 3GWZA 2VHQA 4UC0A 3H87A 3NEAA 2PBZA 4DYDA 1ZITA 1L4FA 2UXDB 1FFCA 1ZKMA 3H05A 3KPYA 4GMLA 1F8GA 4FFBA 2BF7A 4EB6A 1HT3A 5HGXA 2I4MA 3ZWYA 3KSMA 3UPVA 4GI1A 5IU6A 2P2NA 3RKRA 1CUSA 4I4TA 5KX5A 5EY5B 3CJQA 1JZSA 4W9MC 3P5SA 4ZO8A 1OT8A 5DHTA 5IMBA 3LC7O 3EXEA 3PGA1 3INRA 3QU7A 3IA2A 3RO7A 2V58A 3KYDA 3ZK9A 2BM8A 5JANA 6CHYA 3COSA 5DP1A 4RQTA 3ZY6A 5LZ5A 1BE1A 2IHNA 4M87A 3R3JA 3D4LA 2Q0HA 1Y4SA 3A6EA 1ULSA 5KHOC 4R5HA 3OT1A 2L69A 2HN9A 1E3TA 4CZ2A 5I48A 3ZHBA 4B09A 5TGTA 3DTVD 4GWKA 4MQLA 4EQ6B 5CTAA 1GTL1 3RM3A 1DCTA 3CZ4A 4HSGA 3USCS 1E1CA 2YY5A 1NU8A 5AJHA 4ILKA 4F04A 3GLGE 3CZCA 3N76A 3URZA 2A9PA 1DS6A 2AA3A 1PFWA 1KO4A 2GMWA 1OCRE 4PFSA 4N39A 4QYSA 1FMJA 1VSTA 5BSTA 1LGYA 4EHHA 3PNKA 1QYWA 1JDTA 1F4LA 3CURA 2YNMD 1DG9A 5TR9A 5A62A 2EFYA 1V45E 2RBGA 3HI6A 4YRRA 2IY9A 2ILTA 4YJDA 5JO0A 1M2KA 3EGOA 3JQ0A 1Z18A 3MJEA 4ENWA 2H7YA 2HJRA 3KVRA 3MIZA 1R16A 1O57A 4KQCA 4HGNA 4N5NA 5FJYA 5DNAA 3I52A 2XNDD 4KQ2A 2LSVA 1U81A 4RJTA 5A02A 5C5EA 2LCFA 2ZUDA 2VA8A 3LKVA 1QIEA 2Q3MA 4DI4A 4HNQA 1GZ7A 1I3CA 4R7ZA 4IHAA 1R2QA 4BXOA 4ICIA 1VE7A 2W90A 3S1AA 4OLAA 4OM8A 1XVLA 2HWYA 3QZUA 3GCXA 3FD8A 3VAAA 1YR3A 4K1LA 4NHEA 2FH5B 2C9CA 2P9TA 4D9KA 3TLXA 2QE7D 3DFZA 2OLEA 5JSHA 1G6HA 3OHSX 3DDCA 2PX5A 1YJ8A 4A63B 3PQ7A 4IYJA 4QECA 2Z2XA 1E3WA 2FUG1 3BFKA 4BU1A 3AVWA 4Y9UA 4BNDA 1QZZA 4FB4A 3NJRA 1CRPA 2D00A 4UEOA 1FOEB 1Q0RA 5EESA 3SYRA 4K9MA 1WMAA 3TMYA 4EZJA 3CUSA 3UT0A 1X7GA 4K46A 3K2EA 4QREA 4HYQA 4KNWA 2QJFA 3F6QA 1XJWA 4ZOLA 3DD5A 4XASA 5T4HA 3KJZA 2NTJA 3TU3B 4EB3A 2GEKA 3DYVA 4RS4A 2FI1A 4B79A 2WA1A 1MX4A 1L5YA 2QAIA 3BWVA 3FI0A 3WLMA 5AWFC 3VR6A 2ZJ7A 3Q15A 2IYXA 3AKEA 5DGXA 3QOWA 2XS8A 2IWHA 5JNSA 1JR3D 1NBAA 4GTMA 2H2AA 4EAAA 3CLRC 4MJ7A 3RFFA 3LT5A 2VJMB 4AQ7A 5YASA 1BDHA 4XWKA 3CZMA 1QDLB 4QJ5A 4H77A 1TO2E 1L4EA 4DQDA 2FSIA 1CUUA 1TUBB 4XQ0A 4OYRA 1VYTA 4L8WB 4YV0A 3NDIA 1DIBA 3IO5A 3U9WA 3C14C 4EBAA 1WJGA 1CQPA 4ZHSA 4ZPXA 1R5OA 2OFWA 4QELA 2EG5A 3BGWA 3SIRA 4ZVUA 3VVCA 4TS4A 3KVYA 4AIRA 4OJMX 5JLJA 2IH5A 1HFEL 5F3RA 4RYLA 4N03A 3MV2B 1PGOA 1PR6A 1ZAYA 2C20A 3EMKA 2RHGB 3NM6B 3FNGA 4F92B 5KTOA 1NR7A 1ISGA 2NZWA 4TTAA 1NULA 3DXYA 1OWOA 3Q9UA 5AUOB 3DSXA 1RAAA 1F2UA 3GL9A 3P0EA 1IQUA 3F2IA 2FV8A 2UZ4A 2PA3A 2WNSA 3BOSA 2WPDD 1WABA 5FYDA 1IK4A 4OY3A 3D7SA 4JODA 1L7NA 1OWMA 4MWDA 5B12A 3QKYA 1HE1C 4I9NA 2NO5A 1KSFX 4ZGGA 3VC1A 1SH7A 1E7VA 3HGTA 5IJ9B 3O4HA 1SCBA 3ORHA 2NTYC 3SJZA 2R1UA 1DCMA 3Q72A 4I8DA 5EG5A 2H1LA 4JJ7A 2Y4TA 5BNWA 3ZDRA 2HWWA 1AT1A 1PWXA 1Z75A 4E7PA 3FYUA 5KTTA 2D5LA 1Z4JA 2WWTA 1R9GA 4FYHA 3OI7A 1XMVA 4II3A 1OC4A 1V4BA 4RSYA 3FOCA 1JHZA 4QO8A 2AC7A 2F43A 3S5UA 1CJVC 3LVRE 1Z25A 4MS3A 3DBHB 3AHHA 5TLSA 3CLSC 3MJWA 3GYGA 3ELDA 2I29A 1J4AA 4S2UA 2AMVA 3ZWNA 1JA0A 2OKGA 4H0FA 5HMMA 3U39A 2PQNA 1FFEA 1MVOA 4Z4FA 2R7LA 2AFIB 5K3CA 1FX1A 2PWZA 3KQYA 1AB6A 4F1PA 4D8WA 2R4UA 4EJSB 4QC2A 5KTKA 4X65B 4WDRA 3IJPA 3RUIA 1CZKA 3L43A 5BVHA 1GUDA 4N3NA 4Y6CA 4JP5A 5KJKA 1NWHA 3PDCA 4IG9A 1IY0A 4GBED 1Z13A 2DHDA 3I83A 5LCWJ 2GO7A 1VHTA 3G68A 2QAGB 5JW6A 1YT5A 4K5AB 1JWLA 2WXOA 5EGSA 2WXKA 1XTJA 1NJSA 5U4QA 4BKMA 4YJGB 4GKKB 1NVUQ 2H2DA 2DZOA 2MWMA 1X7ZA 5M29A 1WF6A 4H35A 5M04A 2IHTA 3GEPA 2WABA 3QKIA 4WN3A 2HCBA 3B3GA 3QFSA 1H1TA 3EHQA 1TNBA 2QTCA 3R1IA 3L79A 1F3OA 4LISA 5CDTA 3OEWA 3RK1A 2W0SA 2IS4A 5K0JA 1QAOA 2X19A 5CVUA 2WXJA 5HDQA 1SGWA 2ZJ6A 3HDHA 2O2YA 4AIFA 2CWWA 3HYTA 1NNEA 3CR7A 3IIMA 1IIRA 1DJLA 1L5QA 2WIAA 2D5IA 2WR8A 2FFJA 2RHRA 2QL5A 1RRPA 1G59A 5J63A 3SPXA 3V5NA 2DCPA 3ZDEA 3NOXA 4DPRA 2OV1A 4M9QA 4CG1A 3ECCA 2C2WA 3ZYLA 5H82A 3B85A 3OXFA 2N46A 2MR6A 2HFKA 1JR6A 2XIJA 4X6YA 1SU6A 1AMNA 2QXYA 3BUAA 4NNPA 1PZFA 4C20A 1XJQA 4NFYA 3RUEA 4BRWA 2R1TB 5E38A 4YX9A 7ADHA 3KQHA 4KLRA 4LRQA 4RE6A 2NVWA 4B3SB 1UKCA 2IVFA 4YLEA 1U5BB 2OV2A 5CA0A 5HA5A 4QASA 1WQ1R 2GKGA 2ZT7A 3Q3JB 4CXMA 4J1NA 5ENZA 1U4OA 2CHZA 3R5XA 4EQZA 3OY2A 3WMRA 3ZVRA 1AZTA 3GEMA 5AI4A 3FRIA 3TSCA 1AUQA 3UB2A 3HYRA 4DDMA 3I28A 2YVKA 1QFYA 4XX1A 4KV9A 3ZK8A 2OMEA 2ZYWX 1M2FA 2KCLA 4Q3KA 5JI3E 4OJKA 3TRIA 4GSLA 3ZHRA 4K6OA 1UMDA 5CT6A 3L01A 1JHYA 4OKIA 5F4ZA 1Z0FA 2V7XA 4LYJA 1QQ6A 3QOFA 3N6VA 4BFZA 1QGAA 4CM4A 5ILOA 3V1TC 2JGKA 5DNVA 3E9EA 4J16A 1C7ZA 2PWPA 4HNHA 4BLOA 3E1SA 3AEZA 3DH0A 1UWVA 4KAFA 4ROSA 1P8JA 4CR7A 4KXQA 3R8XA 3FU3A 2FKAA 4BETA 3ZXIA