4GZLA

Crystal structure of rac1 q61l mutant
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
175
structure length
173
Chain Sequence
AIKCVVVGDGAVGKTCLLISYTTNAFPGYIPTVFDNYSANVMVDKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RAC1P29S is a spontaneously activating cancer-associated GTPase.
pubmed doi rcsb
molecule keywords Ras-related C3 botulinum toxin substrate 1
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 173
sequence length 175
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gzlA00
1E2FA 1NN5A 521PA 3B1WA 2GEUA 4GP6A 1FUUA 2LKDA 1GAJA 1TUIA 2GK7A 5K8TA 1KY2A 2X2EA 2XJ9A 3GCGA 3SC3A 1DAEA 2RB4A 2HT6A 2REXB 3FKSD 4P4UA 3EWAA 5FR1A 1YZUA 2YINC 3A36A 3NDBB 2BEKA 4QBGB 4Q4AA 1D2EA 2E9SA 2QMUA 2VHCA 4ZPXA 3VX4A 1HT1E 4MKIA 3AP3A 4LX0A 3ETLA 1GL6A 2P3SA 3GJXC 2W00A 3TW4A 3AF4A 1G1MA 5FOSA 1NVVQ 5JHHB 1A5TA 1FNNA 4EJSC 4JLNA 3SFVA 4PSAA 1OYYA 4BRWA 3IQWA 3O8BA 1LFDB 4WBSA 1T9HA 4E22A 1R5NA 1ZUIA 2FNAA 2H92A 3LDAA 3JVUA 2ZE8A 1E2GA 4LPSA 3CZQA 4HDOB 2IWHA 5SZHB 3GEHA 3GLFE 1Z28A 3SBDA 4XTRA 1C9KA 2NPIA 3LBHA 1Z47A 3OEHD 3W3ZB 2GWHA 3DMDA 1NG1A 1YZGA 3LVQE 4ZCMA 1W0KA 1G21E 3ZJYA 1IN5A 2FZ4A 2XNDA 4C0JA 3TSOA 2V1UA 5KSOA 3VNVA 3QXXA 2ONKA 1XXHE 1LW7A 1R4AA 5E95A 5FPYA 2B92A 4FD2A 2G9NA 3DOEA 2OUKA 2OBMA 2ZI6A 5JWHA 3NC1C 5TARA 4MKGA 4JSYA 2J0SA 3N5CA 3WP0A 1PJRA 4TMTA 4TLDA 4Q47A 1M2OB 3SOPA 3IGFA 3CH5A 3KQHA 3E5HA 4I99A 2IYQA 2QAGA 3X1XA 3ZD7A 2VSFA 2YOHA 3ADKA 2FEMA 5K8UA 4ASUA 5GVSA 1ZNXA 4PO8A 2BJWA 1JR3E 5CYPA 2F3TA 5JECA 1JAHA 4S2EA 4KFUA 4IOMA 1N6HA 4K81B 2DCUA 1PVOA 1GFIA 5FOXA 3VR6A 5HE8A 2JIZD 4ZDIA 2DWOA 5JHGB 1E3MA 4NKRA 2ZITA 3QPUA 2GA8A 1TF5A 2QTFA 3PUYA 4D0NA 3RYTC 1G5RA 2W6IA 4GDFA 2PEYA 3LVRE 5KNBA 1XEXB 2OEPA 4B32A 3BAFA 1TEXA 1GG2A 5B64A 2J5XA 3K9NA 3RS7A 2DFNA 1NMXA 4BFYA 1E99A 4DLYA 1WA5A 3AQ4A 1TU4A 2G83A 4KI0A 5CLQA 3AUYA 4DRZA 5BWMA 1E4VA 4EKDA 4Y0VA 2FPMA 1CJTC 1P2VA 5D3MB 2UZ3A 1ZUNB 1KTVA 2AKAB 1IOZA 4C0LA 3V9PA 3SQXA 2FU5C 3X1ZA 2F43B 2GJSA 4UNNA 3CB4A 5C4GB 3GP8A 2BMEA 3ICEA 3VMFA 1PUJA 3OEED 2ZROA 2W83A 2QI9C 3AGQA 4LDJA 3UKDA 1JQLB 3TK1A 2FGJA 2PZEA 1F5NA 4LZZA 2YWFA 4KYUA 4IDNA 3TBKA 4P4TA 1F2TB 5DHAA 3T35A 1GM5A 1XCPA 1E79D 4JIMA 1OHHA 1RRCA 3I62A 3TKLA 1JJVA 4JJZA 3KKNA 2R62A 4BLPA 1BMFD 1IN8A 4EJSA 3CKLA 3K70C 4D25A 1VYUA 4B73A 4MRPA 4R98A 1XEFA 3L82B 3R8CA 2W2XA 5P21A 2QAJA 4MDFA 4RZ2A 4U7DA 4JT2A 1G7RA 2ZPTX 4CEIA 3RS2A 2C78A 1XPUA 3THWA 1JPJA 2C77A 2WIBA 3MWKA 4ZDKA 2O8EB 1R7RA 3R9IA 1ZIOA 1G17A 621PA 1KYIA 2ZRFA 4ARZA 3C4JA 1QG4A 3I61A 3TUJC 1D9ZA 5BW8A 5EZ5A 3TSWA 4LV6A 5CITA 1WQ1R 3QQ5A 1CR4A 5DHFA 2JJ8A 1EFCA 4DBLC 1UKVY 2V3CC 2GJAA 1G8YA 3GLHE 1GIAA 1UBFA 1Z6YA 3NWJA 5SZJA 3ZS9A 4LSGA 3U3JA 5FPHA 1X8JA 1NVVR 3AH8A 5E3HA 3W6NA 4JBXA 2WWIA 3GLGE 2OG2A 2PEZA 3RS3A 1I4TD 2BKEA 3V4RA 1HY3A 1X8LA 4D4LA 2PMDA 4HUTA 4M1YA 5EZ6B 1Q12A 1XCGB 2W2VA 1KI3A 3KJHA 4RD3A 1KDRA 4DLSA 1Z6AA 4NCIA 3A58B 5JSZB 4B48A 3KJEA 1Z0AA 1Z8FA 4TWZA 4F93B 2PJRA 3IEVA 1Z06A 2OHFA 2V6IA 5M04A 1J90A 2C98A 1G6HA 4EFLA 1ZCAA 2ZRPA 1R5OA 4HZUA 4PQRA 2AKYA 3SN6A 2WMNB 4FCWA 3V00A 3B8HA 4F7WA 4JL5A 5EJEA 2F1JA 1G5PA 2FZLA 3FMOB 1KNQA 2YVUA 1GL7A 3LW7A 2OBNA 3MLEA 4I1SA 2JLRA 5TB5A 4U5XA 5LD2B 2QMHA 1G9XA 3QBTA 3SZRA 1NLZA 4Q18A 3WMFA 1EG7A 1R0YA 2VLIA 1N0VC 1SGWA 4LHYA 3R9XA 2PCLA 4WXRA 1W46A 3UWOA 5GJVC 1G8PA 3UMRA 4UXIA 1E0KA 1KOFA 2XOKD 3QSYA 5B58C 1ZINA 1JECA 1E9BA 2IT1A 3C8UA 3UANA 3BIFA 2XGJA 4QHSA 2GAAA 3OE7D 3P1JA 5FBQB 1NVWQ 2D74A 4PTLA 3UATA 1T3HA 3BOSA 4TLBA 4DLWA 2G1KA 3C41J 3JZMA 3CWQA 3NVAA 5LB2A 1CJVC 5FI1B 5G40A 2V7QD 4Z54A 3WMEA 3LLUA 3KUDA 1DG1G 1CR2A 1EXMA 3FTQA 5KDLA 3TJZA 3VX3A 5AUNB 3PR1A 2OAQ1 3IHWA 2QP4A 2X1VA 1YZNA 1AS0A 2Q9BA 1KDOA 4GI7A 3SU8A 4J0QA 1SHZA 3ZVNA 1ZM7A 1VHTA 1KKLA 2OXRA 1NKTA 2ZRNA 1YKSA 2O52A 2JLUA 4I1OA 1E2KA 4TL7A 1RJ9A 1OKKA 2WV9A 3CPJB 4QGGA 1Z22A 1UKZA 1XD2A 4Q1CA 1OFIA 3BB4A 4ZI3A 1PV4A 4CT4B 5L3VA 5EE1A 5DN6D 3HJNA 3OESA 2YC2C 4HLCA 1G7CA 2QZ4A 3B85A 1W44A 2EFCB 2EYQA 3CRW1 4QM6A 1MRSA 1M34E 3H86A 2OFXA 4ZKEA 2O8BA 2GXAA 4Q4AB 4YMVA 3E70C 2JDIA 4Q5IA 4QL3A 2H17A 4EFMA 2OBLA 2RCNA 1VPLA 2IYUA 3K9GA 1GTVA 2CLCX 4JLJA 4GZLA 3FGNA 3RRZA 2C03A 4FMCB 5C18A 4I4LA 2FH5B 3W8NA 4DUGD 2OILA 1QHHA 3F8TA 1G19A 2IBMA 5UKDA 1Z3IX 3L0OA 4CEHA 1DO2A 2G88A 2K5UA 2I1VB 1XMVA 1VECA 4O25A 1D2MA 5FUVA 3CF2A 3PCRB 2WWWA 3ADCA 1KDTA 1AK2A 1S1CA 4EAQA 1CJKC 3R7WA 3UG6A 2A2ZA 3A4NA 5JEDA 1JXOA 4FMDF 1NNEA 1JNYA 4DEXA 1EFRD 1BH2A 1R0XA 4B2IA 3M0EA 2RMKA 3K0CA 1TTTA 4CT5A 3TRFA 2OFOA 2XZPA 3SJCA 4AG5A 1ZVQA 2CK3D 4DC9A 3ZYCA 4D4MA 4DIEA 1U81A 4N3NA 3QVVA 1N3BA 3FMPB 4M1WA 1F3OA 2GBLC 2VP6A 3T1TA 3PITA 2QEQA 3WHKA 3VNUA 1KJZA 5TY0A 1G291 3RS0A 4RD2A 4PAQA 1MV5A 5CM8B 4D80A 5J4VA 2I3BA 1EWRA 2W2TA 4KJZA 4M1KA 4OHXA 1P75A 3K0FA 5LPNA 1COWD 2XSZD 2VP5A 2IXEA 4LJ8A 4MRVA 1AS3A 2QAGB 3PEUA 3ZVLA 4EPXA 1BO6A 2X77A 2QE7D 2H16A 5DGXA 3SJAA 4A0HA 5JWOA 1DAIA 4HZIA 1DBSA 4JYCA 1HE8B 4RKEA 1A1VA 3AVOA 4KAXA 3LRPA 4JLAA 1YHNA 2AD1A 4D0LB 5K8LA 2C9YA 1OH7A 2VRWA 4C9BA 1KI4A 1EK0A 1RIFA 2GDJA 1OFUX 1XFAA 3FKQA 2ZRHA 2L0XA 3QXJA 2C99A 2CVHA 2XAUA 4FN5A 5HKKD 3ZDQA 3MJRA 4MKFA 4OHZA 2N1BA 5DYIA 1F6BA 2R6FA 4B76A 1KI8A 2JGNA 1GRQA 2YOFA 2YC4C 1CF4A 2KI5A 2GKSA 1JBKA 3EZ7A 2YWEA 3OAAA 5JBQA 1MOZA 421PA 4JBYA 2GXUA 3ZS8A 4QOSA 2VBCA 4G3XA 4XSGA 5JCPA 1LVGA 1NBME 2NG1A 3ZH9B 2O8FA 1JR3D 1EGAA 3C5CA 4TMXA 5L3QA 2NQ2C 3NBYC 2ORWA 2IYTA 2WSMA 2VO1A 3PVSA 4ZDWA 1X8KA 1OXVA 3EPHA 3CR8A 4D81A 2RGDA 4TZ0A 3LH5A 1UJ2A 1NSFA 1E1QA 4BLSA 4HAYA 4LJAA 2ODNA 1Z83A 2NOAA 2REOA 4UXHA 4XD7D 4A9AA 5E7MA 1NL3A 4B43A 2UVQA 4Z1MD 4Q48A 5JRJA 1E0JA 1U94A 4MRSA 1UADA 1YZTA 1EFUA 4L4UA 4LV5B 3FKSA 4Q9KA 3AVWA 5JWRA 1ETUA 3GLIE 1E2IA 2GEVA 3C14C 3EIEA 1KO4A 2ZJOA 4TTRA 4KFRA 3A1UA 4BLQA 4D0GA 1KI7A 2B8WA 3BC1A 4RZUA 2XTMA 2R9VA 1ZCBA 3M4YA 1S96A 1UBGA 3EC1A 3QXCA 2GXSA 3KX2A 4EJSB 3IIMA 2FWRA 3WY9A 2ZJAA 4ACBA 1TUEA 2WJJA 1QVRA 4EDHA 4M0LA 1S9DA 1M1YE 3THOA 2BBWA 4TTPA 4TLCA 4DDTA 3WBJA 1N5LA 1Z08A 3DM5A 1ZD8A 3VR5A 5GVRA 2ZE5A 2DR3A 2F9MA 3EWSA 5AJWA 3WYFA 3K1JA 1T8UA 1OXSC 4HLQB 3ND9A 4AG6A 3TUZC 3DKPA 2A5DA 3TVTA 3TAUA 4ARZB 2RGCA 3OEHA 4L9SA 4LJ9A 1NSTA 2ZUCA 2F1RA 5FL3A 3NHAA 4XOIA 2CCGA 4KVGA 1AGRA 3SS8A 3QKUA 1TEVA 3WNDA 4IHQA 4V0KA 1KAOA 4FI3C 2J1LA 1J2JA 3SNHA 1SXJC 2Z6VA 2F9LA 2YWHA 3S1AA 2GCNA 3L0IB 2JLZA 2QP3A 4NDZA 2GK6A 3N2EA 1I4LD 2FMXA 4DB2A 4KLZA 2ZRBA 1XF9A 4IDOA 5FPTA 4D26A 1IJEA 4JJKA 2QTVB 1IN7A 1ZIPA 4W7SA 3QENA 1WBBA 5FTJA 3AF1A 3AKYA 1TF7A 3NXSA 4FXPA 4TYWA 2CHQA 2WSSD 2IS6A 2WWHA 2OFWA 4NYMQ 5FBLB 2RGEA 4TN1A 4OQXA 5EXSA 2N42A 2F6RA 1CULC 3R9WA 3LBIA 4MKHA 2VYFA 4HZUB 3EZ6A 6Q21A 1OIXA 1OB2A 1G3MA 2JIZA 1E9CA 1XTSA 2V8OA 2J59A 3PENA 3TSZA 2DYKA 5CK4A 3W90A 3AM1A 3MRSA 3L2OB 4Q7JB 3WNBA 3G5UA 2W0MA 4OHYA 2VP9A 2MMGA 2WKQA 4U00A 3Q7QA 2R8RA 3KB1A 3T5DA 2QMOA 3QY0A 2GETA 1T8TA 5JMTA 2ORVA 2PL3A 1ANKA 4KHZA 4CF7A 1JR6A 2F7SA 2NO7A 5JJIA 4HB4A 1OH8A 3B9PA 4Q19A 5FTMA 1CEEA 1NLYA 1EESA 1KZGB 3NBZC 1NRJB 1AZTA 3KFVA 3A4MA 1LS1A 4YDHB 2QL6A 2BMFA 1EWQA 2R44A 1OLOA 5H68A 4NTZA 4C30A 2WWYA 2OO7A 4Q4LA 2J41A 1FP7A 2VHTA 5AR1A 1XDBA 2P67A 1F2UA 1GRRA 4Q1BA 4JVMA 4IVRA 4EPWA 4XSHA 1RRPA 5AJZA 4QJ3A 1ZYUA 1DE0A 2J46A 3QF4A 2V9PA 1GP2A 3PUVA 4PSKA 4EPTA 1RJ9B 3FHCB 1XD2B 4NYJR 5JS8A 2BV3A 1QDEA 1E79A 4II7A 3SQWA 5F3WB 1E0AA 3J81k 3VFDA 4ZKDA 4A6XA 3PIRA 2XJ4A 1N0WA 1W1WA 2NZJA 4W5JA 2WIAA 1BMFA 2NO1A 3VTKA 3K70B 3ZZ0A 5CYOA 2CCJA 2IXGA 4G0NA 4M1MA 5CB8A 3EX7C 4F4JA 1JALA 1SVKA 4IOJA 2O8BB 3MAAC 2CL7X 4M21A 1LTQA 4ILEA 2Q6TA 2ZYUX 821PA 3A6PC 1GNRA 2OE2A 4DDUA 1N6OA 4XIGS 4OHWA 2ATVA 3QNUA 1GWNA 2VP2A 5EE3A 1FOEB 4TL9A 1YE8A 3C7KA 5E4FA 1QHHB 1E4YA 2V1XA 1T3SA 2ZSFA 4LPKA 4CEHB 4JVSB 2ZI7A 3LBNA 3LXXA 3MWLA 3KL4A 3IILA 3LNCA 3H2YA 5D3QA 2ZE7A 2IYRA 3AV0B 4V0ME 1MO6A 4NCKA 3HR8A 3R7WB 2HDNB 5JCZA 5FPKA 4PPFA 1NN1A 4BZPA 1KO7A 1QF9A 1CR1A 2ZS8A 1AZSC 2J9RA 1I4DD 2QQ0A 4QNRA 4UQOA 3B1YA 4BEBA 1Z0KA 2HJGA 4BASA 1VG9B 3OZXA 1Z2CA 2CNWA 4JYBA 2FJUA 2AFIE 2IYZA 4BQSA 3EA5A 1E2MA 3TQFA 4E03A 2D3WA 1G5TA 5CK5A 1FMJA 4EUNA 1H8EA 3ICQB 3CF0A 2DWQA 4LRWA 4AKHA 2H18A 2ZRAA 2IS2A 4PSVA 1S2MA 2R6GA 1TADA 5L8VA 3R8FA 1NI3A 1YU9A 4B3XA 2FE4A 2G3YA 2PMKA 2PX3A 3B6EA 2PX0A 4PPGA 1C4OA 1KK1A 3SJZA 4URWR 1KZ7B 2ZI5A 3K0FB 5G3YA 3EIHA 4P33A 4BPBA 4CGZA 1FPMA 2B7BA 1OXUA 2QM7A 1IAQA 2DFLA 4GMXA 1JAIA 1E2NA 1QRAA 2AD5A 1KSGA 1ESMA 1H8HD 1RE0A 1ZRHA 2BWJA 4LHWA 4QC2A 4TL8A 5LBIA 4B2LA 2WZQA 2EU8A 2VHUA 2IF2A 1XCMA 4ZCLA 3RRMA 3B2EA 1J7KA 1SVIA 3FMFA 4EPRA 1NF3A 4P0TA 1ZC3A 3QKSA 1KMHA 4Y0AA 5JFGA 3PUWA 2ZJYA 2V54A 3SYLA 3CZPA 4RJLA 2XOKA 4HI0E 1IY1A 4FCVA 1KJYA 3AVTA 1IXRC 2I4IA 3OE7A 3VR4A 1VCMA 3KKPA 3TR5A 4NBSA 2ZSDA 3P20A 4FWIB 1M7GA 2AR7A 2V7QA 2R6DA 2Z5FA 4NYMR 1GRNA 1N6IA 4G5RA 1GZSA 5FOVA 3VQTA 1OW3B 5KNDA 2JASA 3VAAA 1P2SA 2IEZA 3LX8A 3CPHA 3CNLA 2O8FB 4HLUC 2QGNA 4AYWA 5J4KA 5L3QB 4QJ4A 2P6RA 1NIJA 5L3RA 5IDVA 2HXSA 1L8QA 3IO5A 5DSZA 2IWRA 1Q1BA 4KLNA 1ZM3A 1K5DA 1N5KA 3AP2A 3FFBA 5CDFA 3PEYA 4NCHA 4PZZA 4F4CA 2VSOA 4GOXA 4HB2A 3FHTA 3GFOA 4PPQA 1UPTA 2ZUDA 2J7KA 4NCJA 3UMSA 2BM0A 1HEIA 2OV2A 5DN6A 3X2SA 3TR0A 3VKHA 3OF5A 2FFAA 4ZO4A 1JB1A 4Q02A 2RKOA 4BFTA 2QPTA 4C0BA 3X1DA 4TSFA 3B5JA 2FEOA 2YKGA 3K0EA 2P6NA 4TLEA 4HEJA 1NBMD 4YLGA 4DVGA 3B60A 4TT3D 1NVUQ 4WAUA 3NHBA 4US0R 1TX4B 1E9AA 1IONA 4WA7A 4O2RA 1D6JA 2EFDB 4MGIR 2GESA 4LHXA 2C95A 1P62B 3HPQA 4TLAA 3RNLA 2QP9X 1HQCA 2HCJB 4OHVA 3KKQA 3OIWA 4DUGA 2A5YB 4OI0A 4IFEA 2OCAA 1FUKA 5FFMA 1OPXA 2CJWA 3DL0A 3MD0A 4B35A 4CYMA 1DADA 3GJ3A 4Q01A 721PA 3TQCA 4DZZA 1KGDA 2HUPA 2F3RA 1FTSA 3IBGA 4DB4A 1II8A 4BFSA 1EFRA 1XBTA 4LGMA 2IYWA 2SHKA 2ANBA 2Q3MA 2WAYA 1W4AA 3QI2A 1VTKA 2QT1A 5FUYA 1AM4D 2HJVA 4F4IA 4A6PA 4OL0A 2OCYC 3GMTA 2ZJBA 2CK3A 4E5UA 5L3SA 4C2UA 2R65A 5TVKA 4S35A 3EPJA 1TQ4A 2ZVPX 2P5SA 2QPOA 5J47A 1XJCA 3QXSA 2J7PD 1F48A 1VIYA 2VP4A 3IDQA 3S1AB 2HEIA 2RGAA 1ZAKA 1U9IC 3W5IA 4ZDJA 5JJKA 2IS1A 4H9GA 1Q44A 3TUIC 4DLZA 1E2JA 2Y8EA 3GLFA 1K8RA 4JKIA 1BS1A 1COWA 4YQFA 3ASYA 2XSZA 2ZS7A 4A2PA 2D06A 3H1TA 4BFZA 2QE7A 1VMAA 4IXMA 2CDNA 4L15A 4B34A 4L5BA 4DHEA 1TQ2A 2WBLC 1XMIA 1SXJD 2EYUA 3L0PA 3Q5DA 3Q3JB 1LF0A 4O0MA 2FPLA 4H1VA 1ZNWA 2P5TB 2IYYA 3WBKA 1D9XA 1E6CA 1S0UA 1G8HA 2CNWD 2PJZA 5EP1A 4V02A 4OK6A 1UBCA 1JQJC 1K5GA 4F91B 1H8ED 4PO9A 5HKKA 5F9HA 4RD6A 4KXFB 2KB0A 3FOZA 4JS0A 3P4XA 3SI7A 3AVUA 3BK7A 4FMDB 5IK2D 1XTKA 3H84A 1LV7A 4BFWA 1E2HA 3W8RA 1U8ZA 3I4LA 3QVUA 1QZXA 3TE6A 2QBYB 3DVLA 3UG7A 2CLDX 4GZMA 2IK8A 1JR3A 2CE2X 1E2PA 1KSHA 3LA6A 4URZR 4CW7A 5HR5A 4KBFA 4UNQA 1DVRA 4ABYA 5TV2A 1CIPA 1RYHA 1JI0A 1W48A 2VEDA 5H8WA 3F3YA 4DWJA 1VKJA 1FQJA 3MJHA 3PUXA 1M7BA 3SHFA 4MRNA 3TVDA 4TTQA 5J4LA 3NIBA 2ZRIA 1NJGA 3GJ7A 1F2UB 3RSLA 4XD7A 2CVFA 4YMUA 5FUWA 1E96A 4ESVA 3VU9A 1IXZA 4KFSA 2YWGA 2AXNA 3K9HA 3QF4B 4Z1MA 2RGBA 5B2ZA 5IF9A 1U90A 3P26A 2QENA 4HUQA 3SBEA 4PHGA 4M22A 2A5FA 1MT0A 2QSZA 4OQFA 2BC9A 4PHFA 1MO4A 3IPYA 5KHOC 2FG5A 3I5YA 3KQNA 3RS4A 1T0JB 3I5XA 1G16A 3ASZA 5KPDA 1E2LA 1OIVA 1JXMA 1HT2E 1KO8A 4DT1A 3VKGA 1WDTA 3U7EB 2RAPA 5B57C 3I1FA 3GEIA 4KBGA 5FTKA 2NPFA 1QG2A 2QM8A 1U8AA 1XP8A 5CIWA 2G0NA 3NKVA 1E9EA 1R8SA 3IO3A 1RVDA 2HCBA 2REBA 1P7CA 1IY2A 4OYHA 1VDZA 1RPZA 4B3FX 3IUYA 1T5LA 3PQCA 1XMSA 1XRJA 2GF0A 1IHUA 3GJ8A 5FBRB 3I8XA 4TQUS 1OFTA 4RY2A 4TSFD 2OZEA 2W6JD 1LNZA 3CR7A 4OK3A 1C1YA 4PQYA 1ZD9A 1Q3HA 4C0AC 2OLKA 3TW8B 3U3OA 3CUEF 4R2HA 3WHLA 1A2BA 2Q3FA 2XTZA 4YDSA 3AGPA 2AWNA 1L4YA 4DCUA 1MH1A 4IEIA 5F2EA 4DEYA 4XWKA 4AKEA 4TZ6A 4POAA 4M9ZA 4FWTA 2IUUA 1N6RA 3U7HB 1AIPA 4YMWA 5HZHA 4LHZA 3U44A 1LY1A 1R6BX 1U9IA 1CXZA 221PA 2A7QA 4US1R 4AYTA 2QQEA 1Z0FA 1P60A 2NO6A 1OH6A 4GPTA 5J5CA 4TYPA 1R0ZA 2HF8A 2MSCB 1IN4A 2D2FA 4UNPA 2QSYA 1QHNA 1W49A 3A4LA 4LWZA 1WBDA 2ZE6A 3VKWA 3W6PA 3BH6A 3KQUA 4IOKA 1GDDA 2WSSA 4CEJA 2YV5A 3ZZUA 2FOLA 3HU1A 2JATA 4MUAA 3W6OA 1MO3A 2XB2A 3O47A 1D5CA 5FUXA 3GLHA 4M9SA 3CPEA 4XWAA 1KY3A 5FR2A 1RRGA 4Q9JA 3VHLB 3IQXA 4BLRA 4P32A 2NTYC 4PAMA 2CBZA 3GFPA 4GMDA 4KFTA 5BYKA 5IHPA 3FVQA 2KJQA 1ZC4A 4NYIQ 4NZYA 3QKSB 1KMHB 1OXTA 2EFEB 1GVNB 1G20E 3CRVA 3D8BA 4PC1A 5AUPB 5JS7A 1M7HA 1XD9A 1X1SA 4HB3A 3PG5A 2BBTA 3I72A 3SHWA 3REFA 5KNCA 3Q9LA 2QNRA 1FTNA 2VHQA 1A7JA 2IHBA 2PT5A 4MITA 3CIOA 1ZM2A 1S4QA 2C5LA 1XTIA 4URXR 4UKDA 1ZU5A 1O3YA 4O3MA 1U8YA 2QUZA 2ORIA 1TMKA 2A9KA 4JKYA 1CRPA 2ECKA 2VPPA 3KKMA 1OB5A 2CLSA 3QOFA 2AXPA 1P5ZB 3CWZA 5JLJA 2VQSA 1US8A 2IF0A 3BH7A 4KV9A 3MWYW 5SZIA 1YZQA 4AKGA 3NH9A 1Z5ZA 1SKYB 2BJVA 4LOAA 2JA1A 4FMBB 2RH5A 4PHHA 3PEWA 4C2TA 3U7GA 3ZLJA 1FQKA 3KXLA 4QHYA 3L43A 4M1TA 1UFQA 3PFIA 3FHOA 1YR7A 4B75A 2BIFA 2ZJ5A 3AEZA 4A82A 2QRZA 2ZREA 4XWOA 3VHXA 4X8MA 3KUCA 5DI3A 4IRUB 5KO2A 2FN4A 2OAP1 4XH9B 4ESHA 1E9FA 1ZP6A 4JLBA 2BMDA 1R0WA 3LY5A 1WE2A 4W5HA 2ZYWX 4ITRC 1J8YF 4JLOA 2VF7A 4KCGA 4LI0A 3EA0A 4CDGA 4RZXA 1J99A 1DO0A 1R5BA 2C8VA 1RZ3A 2CXXA 2CL0X 2KBFA 3DMNA 1YZLA 4G1UC 5BYJA 2IC5A 4OJQA 1DAHA 1E1RD 1NN0A 1Q1ZA 4NH0A 1W36C 1KKMA 3SDZA 1R8QA 1DOAA 4WZAE 2XEXA 3MFYA 5H70A 4FCTA 3TNFA 2CJWB 4CVNA 2PBRA 5EXPA 4RD1A 3LW8A 1CJMA 3WNCA 3D6TB 2Q3HA 1II0A 3CRQA 2JLQA 5EQTA 1OF1A 5SZKB 1G3RA 1P72A 3OIVA 3EPLA 1II8B 1G3IA 1GNPA 3C16C 5A4JA 3T34A 1CRQA 1CJUC 1KSJA 2JLXA 1N6KA 1VIAA 2JLYA 3AUXA 4WXPA 3O8CA 1WMSA 3D3QA 3M6AA 5TXGA 5L3SB 3I8SA 4A92A 2Z4RA 2V55B 3AKCA 4RVCA 1A82A 1PLLA 4TYQA 1TPZA 2GILA 4PANA 1W2HA 2IW3A 1RYFA 1EFHA 2WVJA 1NMYA 2F1IA 3BXZA 2WMOB 4ON9A 5KSZA 3Q5EA 3GD7A 4AURA 2P65A 1DS6A 2RHMA 5CB6A 2QGZA 2EWWA 1Q57A 3GLFB 2HYDA 1S3SA 3FPAA 4URVR 4EQ6A 1YR6A 1AQYA 4PC7A 4C7OB 4DSTA 5JZVA 1T6NA 2FSHA 2A30A 1H8HA 3A1VA 3CX6A 1PUIA 3B82A 2GF9A 4B3CA 1M6NA 5EUMA 5GADl 1BYIA 3I32A 4Z51A 2FPKA 3ND8A 1E32A 3E2IA 4B6FA 4PX9A 5FBWB 2GBLA 3LLMA 4LUCA 1E94E 2NO9A 1XD8A 4X8OA 1I2MA 4GOKA 3QEOA 4CRWB 2VHJA 5AK0A 4B3GA 3EC2A 1CTQA 3KFXA 2KE5A 5EE9A 1ZBDA 4GNKA 4XVQA 3W5JA 1QHIA 3BERA 4QGAA 3BJIC 3SFZA 4OBEA 4DLTA 4Q9HA 1N6NA 1X86B 2QTHA 2ZSEA 3HR7A 5FL7D 3KQKA 4P4SA 5F98A 2VP0A 1W5TA 3ZGXA 5DNYB 1H65A 4KSBA 2F55A 2H57A 3Q8XB 1TU3A 4RD4A 5KSPA 2WJIA 1KNXA 3FB4A 2OM2A 1P9RA 3KKOA 2QMEA 5JJLA 1XTQA 5KOYA 5AJVB 1N6PA 2O8DA 1N25A 3IPXA 2CHGA 4A2WA 5C4MA 2OESA 3OIUA 3LQQA 4LYAA 3RLFA 4LJ6A 2ZSAA 1BKDR 3DM9B 2P6UA 1NVXQ 3QUSA 1UEJA 1NY6A 2ANCA 1MABA 4NYIR 4PC2A 4PHTA 2IXFA 3M1IA 4QXAA 5KTYA 1W5SA 1KSFX 3A37A 1XZQA 1ZNYA 3JZAA 2ASEA 4DCVA 1DAKA 4M9XA 4M8NE 2YJTD 3EG5A 3VU9B 4KO8A 4V0NA 4AD8A 2QBYA 3RAPR 1HE1C 4JVLA 3UIEA 4PXAA 4HUQB 1CLUA 3QF7A 2NO0A 3F5FA 3W34A 1NBMA 2FSIA 4Q4HA 3PEVA 3RANA 4TT3A 4MH0R 5FTLA 3X1YA 2ZJ8A 2FDCA 4H1UA 2D7DA 4URUR 2X2FA 1S9HA 1P2UA 2CMKA 4ERNA 3REGA 2J0VA 2VH5R 1HH4A 3EXAA 3PV0A 2H7VA 3KB2A 4DT1B 1M8PA 2ZAMA 4MUBA 3RDPA 2Z4SA 4M1OA 4LJ5A 3BE4A 3D31A 4BZQA 3RVBA 1CP2A 1X6VA 2BOVA 3NDPA 1NKSA 2B7CA 2LWIA 5FOTA 1Q3TA 4E07A 2QAGC 3LFUA 3AB3A 3BFVA 4QBHA 1MO5A 1OYWA 5HCNA 3X1WA 4BFXA 2EW1A 3GLIA 1KAGA 1ZUHA 4OI4A 4QHTA 3U4QA 2AL7A 2VIIA 3QPVA 3NBXX 2NMVA 1RRFA 1FMLA 4AYXA 5BN3A 5FBVB 3AVQA 2LCFA 3I92A 1QHSA 4LY6A 3IBYA 3B1VA 4QJ5A 4DLUA 4B33A 2AX4A 1Z0IA 3KXKA 2GJ8A 3Q72A 2Q9CA 4NONA 5J4YA 4N0DA 2BVNA 3D7MA 4MYCA 4V0LA 2ZU0C 1IY0A 1ZMXA 3QJYA 4D4JA 5IRCD 5EP4A 2J7PA 3U44B 2W0SA 1HQYE 2ZJZA 2DPXA 4DDWA 2FF7A 4DCNA 3WRYC 1KI9A 3MCAA 1B23P 1GUAA 1OT3A 2A5GA 3H4MA 5KDDA 4JLKA 4WOPA 4GBMA 1DTSA 2GNOA 2IYVA 4G5QA 5BXQC 3AVVA 4XJXA 4Z8XA 2GCPA 3FE2A 1KI6A 4BUJA 4DLXA 1XJ0A 2WKRA 5CJPA 2XTNA 4RZ3A 4CEJB 2JJ1D 4PPNA 5JRZA 1AGPA 4BRUA 2ZI3A 4KODA 1SXJA 4QGFA 4JSTA 2HF9A 3CW2A 4HSEA 3GLHB 4FW9A 3TLXA 3WRXC 1Z6TA 3HYTA 4B2PA 1HV8A 3SYKA 3A1TA 4LBZA 4LBVA 3NEJA 3CLVA 5LB4A 1ZJ6A 1OH5A 2ZR0A 1UF9A 1VG1A 3GLGB 1T3LA 2RHDA 1D2NA 1JEEA 2IA5A 1X3SA 5BN4A 1XZPA 5J40A 5BN5A 4A1FA 1DAMA 2YNMA 2QG6A 3CBQA 3K0AA 4LYHA 3WYAA 5IK2A 5TMPA 2ZYTX 4NCNA 4DDVA 2ZANA 5CJ2A 1BYUA 4Q1FA 1GNQA 3MG9A 5DLQC 3WP1B 2N46A 4HLDA 4N0EA 1ZM4A 4I1VA 1F60A 1N6LA 1Z6GA 3R20A 3T06B 2B8TA 4NPHA 5G3ZA 2Q0HA 4U02A 4NHOA 3MGCA 1YRAA 3ADDA 2BCJQ 2G77B 4R9UC 1VYVA 4C0SA 4BECA 1IXSB 3BBPA 4YXWA 2H1LA 2ZRCA 1NP6A 4HDCA 2ZAOA 4QG7A 1G4UR 4BLTA 2PZFA 4HATA 1NJFA 1US8B 3BGWA 2ATXA 2RGNC 3BWDD 3GJ6A 4NU0A 3QXHA 4FIDA 2P0EA 4L9WA 3KZ1E 1SZPA 2ZRGA 1UEIA 3K8YA 1RFLA 1AS2A 4GSYA 2IYXA 4R2IA 3RWMB 4URYR 4P3YA 2PLFA 4IKEA 1II9A 1XB2A 1YRBA 4GFDA 4JL6A 4OQLA 3HWSA 2ZRMA 2NIPA 4TYYA 3MMPA 4OI1A 4A0RA 4IDHA 3DDCA 4F92B 2HT1A 2FX3A 4TL6A 5DI3B 3K09C 3T1QA 3NH6A 4JT4A 3ZIAD 4MRRA 3CX8A 3KDSE 4BGDA 1Z29A 3P32A 4OQNA 4M4SA 1HURA 2C96A 3C5HA 1YVDA 1Q21A 3IIKA 2ZUBA 2PH1A 4WVFA 2NZ8A 4JLPA 4O2LA 2VTKA 3FYHA 1E2QA 1OFHA 1ODFA 1JPNA 1P3JA 4DLRA 2ZRLA 2DB3A 2CHVA 3ZVRA 4Q66C 4YC7A 4PQFA 1XEWY 4RFVA 5EXXA 2GTPA 5G53C 3F0TA 1AKYA 3MSXA 4HAZA 1E9RA 2H8KA 4KITB 1O87A 1VYTA 1OIWA 1QBKC 2ZJ2A 4C0KA 1CKEA 1MKYA 3AVYA 2W6JA 1JJ7A 1Z0JA 3CRRA 2XZOA 4MA4A 5FOUA 1ZU4A 2KSQA 4Q1EA 3Q7PA 1KO5A 2GZAA 4IEEA 4GL2A 3RC3A 1HTWA 2IEYA 4A15A 3OFNA 2HV8A 4HAUA 4LBWA 2WOJA 3U7FB 2JJ2D 4LBYA 3CNOA 2Q9AA 1N5IA 3BFKA 1XWIA 2PZGA 2WTUA 4FINA 5C1BA 1Z0DA 1W36D 5F9FA 3QIAA 2EVWX 2E87A 4OQMA 4G5OA 4QBFA 1E0SA 5EP2A 4A8JC 2AHOA 4Z8YA 2Z43A 3EW9A 5DYGA 2QORA 3IHLA 4MGZR 4N1AA 5HPYB 1VHLA 1P61B 3E1SA 4R71A 2V4ZA 4R7ZA 5KU1A 4V0MA 1PLJA 5EE5B 4IVQA 3UXMA 2X19A 5ELXA 4EQ6B 1OE0A 2F1HA 4D2IA 3RRNA 3QKRA 2OXCA 3DOFA 4BEJA 1ZNZA 2XXAA 4G5SA 3NTUA 4Q1DA 1XEWX 2DFKB 4YMSA 3U60B 3PJRA 4OI2A 4B47A 1VG0B 2J3EA 3AVPA 2AK3A 2GJKA 2QA5A 2WICA 2A78A 3KTAA 1FFHA 3GFTA 2AN9A 1FL9A 4NP6A 4DSUA 1P9NA 1FX0A 1U98A 2HXYA 3A8TA 4OK5A 4IW3B 4AWXA 1X1RA 2D4HA 3DPUA 4P4SB 2GZDA 4RCYA 4C7OA 1U0JA 2JLWA 4D4KA 3T15A 1IM2A 2VA8A 1T91A 2VF8A 2EFGA 2WPDD 3EZFA 3IKJA 3LV8A 1SVLA 2IL1A 3N2IA 3G0HA 3ZZTA 3IIJA 4D6PA 2ZS9A 4P31A 2ZRKA 3AKEA 1XXHA 4JLDA 1R10A 5DI9A 4EIWA 4TYNA 4MYTA 3G82C 1KK2A 1NN3A 2RGNA 4Q4JA 2WJVA 2O8DB 4LJ4A 4NE2A 1NY5A 2R6AA 3QPWA 1YZKA 3V4FA 2DWPA 4QM7A 3CM0A 2FFHA 4K8OA 2Z83A 4IVPA 4EFNA 1AN0A 4UNSA 3THYB 1RC8A 1SVOA 4XVRA 1MABB 2QROA 1YQTA 2BHRA 1K6MA 3Q85A 2XX3A 4IFBA 1S3GA 3WMGA 2IS4A 1J8MF 1OXXK 4IOLA 4BFUA 1E98A 2ERYA 2J0UA 3QEJA 3EAQA 2LKCA 3BS4A 3GEEA 4G5GA 2WM9B 2D7CA 1W4CA 2IUTA 2QT0A 1N5JA 2PCJA 3K09A 4HLUA 3K0CC 3AVXA 2OCBA 3EIQA 3KXIA 4JLMA 4AC9A 2I1QA 4Q4HB 2KBEA 1Q22A 3PXGA 1UM8A 5GJCA 2YOGA 1SVWA 1HA3A 4I81A 4YXWD 4KVAA 4XVUA 1T5IA 2H5EA 1Q1QA 2QPAA 1E9SA 1Y3AA 3LQRA 4DSNA 1AJEA 2OCPA 2XB4A 1Z07A 8OHMA 5EP3A 3ADBA 3QBVA 1E1RA 4TMVA 1XNJA 5IT5A 1W36B 1Q20A 4QNMA 1SULA 1W0KD 4TMZA 1XTRA 3KJIA 1G4AE 2B21A 2GVZC 5A0FA 2XNDD 3B1XA 4RSGA 1OJLA 1UAAA 3P4YA 4AI6A 2EWVA 4OKSA 5C2JB 1P2TA 2O0KA 4M2LA 1ONBA 2OT3B 5AUQA 1DAFA 2QN6A 3W9YA 4W9MC 1PZNA 3CX7A 3QE0A 3GLIB 2UKDA 2ZVQX 2ZETA 4M9QA 4RFSA 4LK2A 4EPYA 3U4QB 2O8CA 1BIFA 4HYYA 1AA9A 2C04A 2BMJA 4GT1A 2ZU6A 3AF3A 3QG1A 4A36A 1G64A 2FFBA 2C2HA 3TH5A 5GJBA 1TQ6A 4RKFA 1ZD1A 3K53A 2VSXA 1TF2A 4LC0A 4A8JA 3UK6A 2GCOA 3OHMA 4US2R 3H0KA 3DHWC 3BH0A 1B0UA 1KDPA 2O5VA 4M1SA 1DPFA 4ASUD 2QU8A 2XITA 5HZKA 5KDOA 3TMKA 1GILA 1CR0A 4DSOA 3EPKA 4PR0A 1P73A 2X8AA 1DEKA 4K46A 4HAWA 3B9QA 4X8HA 3GQBA 4Q03A 1IJFA 4CZ2A 1KI6B 2ZM5A 4NL4H 2DFTA 2W6ID 2HYIC 2P2LA 3SYNA 3OFND 2JEOA 1SXJB 2ZEJA 4B3BA 4V0OA 4ZIRA 2RGXA 2FGKA 2XNSA 3CONA 4PO1A 4V03A 4IXNA 2R2AA 3THXA 1YR9A 2GEDA 3UWKA 2MSEB 3KQLA 3RWOA 4MGKR 1UKYA 2AWOA 2YZ2A 2DHRA 5AJYA 4JZKA 5FL7A 2Z0MA 1ESNA 1YJ5A 4PFSA 1FNMA 4L8GA 1W0JA 4C0QC 3CF6R 1G8GA 1ELOA 2ZSBA 3K0AB 1D8TA 2BKUA 2DBYA 4MGYR 2GJ9A 2HLDA 1LB1B 3T12A 4DCTA 1EX7A 4ZI2A 4DLVA 1S1MA 4GP7A 4Q7LA 2IUSA 4TQ9A 2WWFA 4EPVA 2G6BA 4WZBE 1Z63A 3IEUA 4ZV4A 5E7IA 4WIAA 4HB0A 3FDIA 3RHFA 4C3ZA 3GLGA 1V43A 2EFHB 2KWIA 1HUQA 1E2DA 1AKEA 3T61A 3AP1A 4Q21A 1G8FA 3ZQ6A 1OHHD 3UMFA 3U2QA 5J4HA 3U6KA 3B13B 5JI2E 2ZTSA 1G6OA 4UJ3A 5KUTA 4UXJA 4LYFA 1A4RA 2FSGA 2RGGA 3RSOA 1WP9A 1HYQA 5KYKA 4B74A 5E7JA 1E69A 4JMPA 4RCZA 5AJXA 4CIDA 3ONWA 3NG1A 3BORA 3VR1A 4QKQA 2JLSA 2ODEA 4BZXA 5ANRB 4LCBA 1W2GA 5DIFA 3BRWD 3GJ4A 3LXRA 4I1UA 1GKYA 1U0LA 1VCIA 1E9DA 1KK3A 3DZ8A 3KJGA 1MRNA 2ZIAA 3QG5A 2ZR9A 1ZM9A 4KSCA 3TAHA 1L7VC 5FPSA 2PLRA 3AF0A 2GXQA 2WJYA 2ZR7A 4F38A 5LDDC 4PAOA 4UJ5A 3RC8A 2B6HA 3TGPA 1G41A 2IYSA 1GOTA 5JI3E 3HU3A 5BQ5A 3DKVA 1G3QA 1Z2AA 2WWGA 1AQUA 5HTKA 2ZI4A 1U99A 1U2RA 4GRAA 4B44A 1W7AA 2FA9A 3VR2A 5B30A 4Q9IA 2ZI9A 4JL8A 2BDTA 5A5GA 3U3KA 2C9OA 1EFTA 3LX5A 1Y63A 4WZ6A 4A2QA 3O8DA 4HAXA 4QBIA 1LF5A 3AKDA 4WW0A 4LC1A 4DXAA 5FI0B 4RD0A 5CLLA 4M53A 1FZQA 4NYJQ 2JAQA 2QY9A 1KHTA 3GJ5A 1KMQA 5JEEA 2IYLD 2NGRA 1KO1A 3EZ9A 3HPRA 3NBFA 1LS6A 4IJMA 3UPUA 2BBSA 1BOFA 4LJYA 4GOJA 1Z6XA 1CBUA 1NG9A 1KI2A 4DKXA 2WKPA 2MMCA 1G7TA 1GITA 2DY1A 1GKUB 3ZVMA 3CH4B 3U3MA 1VCOA 4PC6A 2JJ1A 5DE3A 3HP1A 2ONJA 4A0GA 2D2EA 4KYIB 5LD2C 1XEXA 2QRNA 5K8IA 1XTJA 5DISB 3P27A 2W58A 4E09A 5AWFC 1P4SA 3ECCA 2A5JA 3QKRB 2FV8A 1WF3A 1IBRA 3HYRA 2R6CA 2IHYA 2ZRDA 5HE9A 2XXAB 2G1JA 4XTCS 4B6EA 4FMCF 4MYHA 4IDPA 4LYJA 3SEAA 1OSNA 3DZDA 3MUFA 3KTAB 4BFVA 2ZYVX 5D3MA 3C15C 1KIMA 4JVNA 3VR3A 1FX0B 2F43A 2CL6X 1GKIA 4AKIA 4PZLA 2IX3A 4A0FA 3ZQJA 3ZD6A 3U6BA 4Q7MB 1CU1A 2FFQA 4ZCIA 4X8LA 1UDWA 4PZYA 1XX6A 2TMKA 4DJTA 4W5WA 2UZIR 5DH9A 3W3AA 5CM9C 3N70A 4CEIB 2PT7A 3FMIA 2ZXUA 3CRMA 4ACAA 3K0SA 3THWB 1OKKD 1WB9A 3A1SA 1SVSA 2VL7A 4HAVA 1F2TA 3GPLA 1XXHB 4LHVA 2OLJA 3EASA 2CCKA 4NMMA 3RRYA 2AFHE 2WJGA 4Q4JB 1XPRA 5DO9A 3QKTA 1PLKA 2BBOA 4B71A 2C9CA 1IN6A 2J87A 2ODBA 3EARA 1W4BA 3K70D 1UKEA 2WHXA 4YMTA 1W0JD 5AUOB 4C0HA 1L4UA 3CO5A 1N0UA 1GSIA 1L2TA 4QRHA 1QHGA 5CIQA 3U5ZB 1SXJE 2JDID 2J0UB 2HLDD 1SHKA 2GHIA 3FWYA 4D82A 4BLOA 1QHXA 3T1OA 1E2EA 3I3SR 3SR0A 3LAWA 5GJWC 3TIFA 2O8EA 2GZHA 1NIPA 5EE0A 4TQAA 3ZIAA 3GJ0A 5KPJA 1TNDA 1NLFA 1Q1EA 1WXQA 1JEDA 3THYA 1GL9B 1SKQA 3T1VA 3EZ2A 2JLVA 3DEFA 5HCIA 3CNNA 1FP6A 1U0HC 2JCSA 1XU4A 3LWNA 5G41A 1IQPA 2Q21A 4DCSA 1N2CE 1P9WA 3O8RA 4QGHA 3U61B 1M74A 2BM1A 1NMZA 1VCNA 2AK2A 2GVDC 4Q00A 1WRBA 3BB3A 1T4GA 4MQBA 1MR3F 3K9LA 1DARA 3L8YA 3NC0C 1TAGA 1UDXA 1KJWA 2MSDB 3B78A 3DO6A 1J70A 4BE7B 5FH9A 3HU2A 4AIIA 4RFSB 2O8CB 5JSZA 1ZW6A 4G01B 2JJ2A 1SVMA 1DELA 3I73A 4PC3A 1P6XA 3WXMA 3RS5A 4LV8B 2ERXA 2OSBA 4DIDA 2XZLA 2ZRJA 4QFMA 3LO5A 4C4PA 1Q0UA 4A8JB 3OIYA 2GCOB 1G7SA 2CE7A 5KSYA 3SJBA 2GRJA 5C46F 3B7GA 2D62A 5EUQB 1YR8A 2WOOA 2YYZA 2GAOA 5TDHA 1V5WA 121PA 1TL7C 3NEYA 1XMJA 1WCV1 5H1YA 2J0QA 2E1RA 4JLVA 1W47A 1DG3A 1SKYE 1DAGA 2J45A 2WJHA 3FFAA 3L0SA 4TMWA 1FW6A 3BFXA 3OEEA 5CDFE 1A2KC 1UBEA 3MWJA 1OV4A 2ZQ5A 1QHYA 4AK9A 2O0HA 1CS4C 2WWXA 1RKBA 4L16A 3T5GA 3WYGA 5FOWA 2A3RA 3HDTA 2EQBA 3SE0A 2G0TA 2V6JA 4AY2A 2FSFA 4ZIRB 3L8ZA 4Q7KA 3U3RA 1EX6A 1SQ5A 3OAAD 4OJKA 2WAXA 1QVAA 3JVVA 3THXB 3LD9A 1G18A 2CEAA 2YHSA 1T0HB 2O0JA 3BB1A 4HDQB 1R2QA 4MYUA 1RW4A 4LJ7A 4YONB 3PUZA 1VG8A 2BCGY 3AF2A 5FTNA 4UNRA 1XPOA 4BWYA 3B1ZA 4Q9LA 4A4DA 1TQDA 1KK0A 1G3UA 2ODWA 3BD9A 1I2DA 3A1WA 4MDEA 2WPDA 4TMKA 1XJQA 1S8FA 3RABA 4IDQA 4Q1AA 5EXTA 1E1QD 2BEJA 4KU4A 1KI1A 1W4RA 4JBWA 4B3DA
chains in the Genus database with same CATH superfamily
1Q11A 3KETA 1C80A 4I5DA 4XQGA 2EDCA 2QYTA 3GUUA 1OX4B 2Q46A 4O6VA 1MX5A 3PD7A 4ZZ2A 1USKA 3U5TA 1YVUA 1SUIA 3WLRA 1D2RA 1L8AA 2X2EA 3SC3A 1D04A 1DAEA 4FGLA 2HT6A 4K5QA 2WD7B 2NQTA 1T5DX 4WINA 4PCVA 2REXB 3TCXB 4MCAA 2H4JA 3FKSD 3MSCA 4QGSA 4DLBA 3W2EA 2YINC 3A36A 1XMXA 1YVRA 1QBGA 2ET6A 2QXUA 2WTEA 2QMUA 3VX4A 2VT7A 4NULA 2P4SA 3MELA 1SC9A 2WG0A 1S2GA 3AP3A 3AUUA 3F3KA 4HRAA 2BYTA 3GJXC 1VJ1A 1WTCA 3L3BA 1A5TA 2D5BA 2YZKA 3IUPA 3L7MA 2LGJA 2WJAA 1X80B 2GEBA 4PSAA 2C5FA 1OYYA 3LA8A 1MTOA 2ARKA 2QYHA 2WU0A 1S4MA 3P71T 4O2BF 4TZKA 3ANXA 4UBKA 5BUZA 2QL5A 1KVRA 1M2EA 3UT6A 1MB9A 4UVIA 4WBSA 1T9HA 1A77A 3R7DA 2FNAA 1M2NA 2AJTA 2ZE8A 3ZN2A 5H4GA 4DRXA 1PS9A 5K99A 5K6TA 1XAHA 3KJFA 4RIFA 4RV9A 3IFSA 3FYDA 2IWHA 3GEHA 2WW8A 4H35A 4XTRA 1C9KA 3U4DA 4WK2B 2C9MA 3OEHD 2H1CA 1GR1A 5DTQA 4JGGA 5KQLA 1K2WA 3DMDA 2V0NA 3V7FA 1R6UA 1P33A 1KETA 1G21E 3HACA 3LQ2A 3E15A 4LAFA 3OOWA 3DWEX 1SRRA 3JQPA 4WY2A 2VWPA 2V7TA 3TSOA 2ECPA 2I5PO 2IUYA 1SZJG 3QXXA 3VNVA 4G8CA 4ZFNA 1DCFA 4FD2A 2Z58A 3N7UA 5JH7B 1HX7A 4HBZA 2UYQA 2OBMA 1U5AA 3O93A 1B8NA 5KC9A 4U6QA 2CVZA 4X1YB 4F11A 1JIUA 4O33A 4MKGA 5K45A 3G7SA 4OB8A 3N5CA 1LLDA 3SZ3A 1PJRA 3A6HA 2Q45A 1O97D 3TIIA 4E5NA 1Y4SA 4H3VA 3IOEA 4CR7A 4MVJD 2G9RA 2BW0A 1T1GA 2XUZA 5AICA 2ADOA 5AKKA 1DQPA 3RREA 1CUIA 4F6RA 3KQHA 3CG0A 4FM9A 1P80A 3BYZA 2DCMA 3UXEA 2QJTA 2KMLA 5COBA 3E03A 3FX2A 4AQYB 3LQYA 4FC6A 3H9UA 3PPYA 2VSFA 3VVMA 4M54A 3ADKA 4NZNA 2JFBA 3C6XA 4C4AA 4ZQGA 1JE1A 3ZOKA 5K8UA 2PS0A 4PO8A 4EJFA 2OHVA 3U3DA 1JR3E 2A88A 5CYPA 2F3TA 4XCXA 1MH9A 4S2EA 1N6HA 3E27A 1CUUA 1DMRA 2RH8A 3E9NA 5U9CA 4NMWA 4WESA 1NI4B 2XA1A 3K5PA 3M4NA 3W8DA 4X41A 5TEVA 1RM3A 3C1AA 4NJEA 1E3MA 5EJ9A 1J0EA 2ZITA 1F2VA 1N2EA 1XNHA 3QELB 4BV9A 3ANSA 2HGZA 3DYIA 3PUYA 3ZDFA 3RYTC 2OLEA 4G25A 5IHXA 3NJRA 2AQHA 4YLYA 4B32A 2PK3A 3BAFA 3G0CA 4R8SA 1TEXA 2HSJA 3K0BA 4Q3DA 4UAJA 1GG2A 2C9ZA 3CZAA 3NT5A 3O31A 4MX8A 3K9NA 4QYSA 2XT9A 3VRHA 1PP4A 1U3DA 3Q6IA 4X1IA 2J3IA 5IYZB 2IXDA 1CFZA 3AQ4A 2R47A 3VZQA 3QTBA 4ZVUA 4KI0A 1CE8B 2QRLA 1CS0B 4XWGA 5CLQA 2NT4A 3KRTA 3V8MA 2A59A 2FUKA 3GNTA 3TINA 2NSHA 1LFAA 3GAMA 4IX1A 2ERCA 3R3SA 3L06A 5JQGA 4O4JB 3V9PA 3SQXA 1L5HA 2FU5C 5JD6A 1QC5B 1CQJB 3JU3A 3RT9A 4UNNA 2VYCA 2WILA 2QUJA 4OXQA 1A8IA 1JW9B 1Y82A 4JYMA 3ICEA 1K68A 1PZGA 1PUJA 3UKDA 2ZROA 1ZRSA 2W83A 4YJGB 3ZWKA 3K6SB 1JQLB 1CVLA 1PR1A 2NO4A 2WG1A 3EE6A 4GU5A 2PANA 4GR9A 4MULA 2PGDA 2PGLA 1P1RA 2P41A 1NKVA 2WA2A 3K3PA 4JJAA 2YWFA 3GJTA 1RCTE 2W37A 2MDTA 3PFFA 3DOHA 4OM8A 4P4TA 5IUKC 5K0GA 2WKSA 3RSQA 4XR4A 3RFVA 1RRCA 4NBUA 1X0VA 3C3KA 1Q1NA 2QVXX 4N0PA 5GV8A 3I62A 1SUAA 2NPOA 3QEKA 3L7AA 4YB8A 4MAFA 2EAUA 3FVWA 3P0IA 3WWPA 1JWBB 1BMFD 1IN8A 4OHRA 3SY8A 1NHWA 2H1FA 4KN8A 4B73A 4F71A 1XEFA 3R8CA 3T5TA 3EDYA 3WYDA 1C7FA 1JA0A 4Y67A 3QWFA 3T5BA 4U7DA 1MC8A 4OFZA 2FRDA 3PQEA 4XA8A 2C78A 4EA9A 2GCEA 3BRWA 3MWKA 1FYEA 4JNKA 4ZDKA 2JI9A 1IB0A 4P7BA 2PZLA 5HK9A 1PX0A 3P9SA 5KI6A 4I5EA 3MVEA 3PGLA 5EHGA 1ZIOA 3ZV4A 5JRDS 3C3AA 3IRUA 1J0BA 2P6PA 3IBCA 1SIOA 4N0MA 2XB6A 3S7ZA 2D8AA 3PF9A 3EMDA 3CGGA 3VJRA 4ZHQB 1D9ZA 5BW8A 4CL2A 2X6TA 5EZ5A 2V5VA 3JQ8A 5CITA 1JBEA 5KKCA 1H2ZA 1QGDA 1IATA 1CR4A 3QQ5A 3DC2A 3ZW7A 1J2EA 4FC7A 4EYOA 2V3CC 2IYNA 1L9KA 5JD4A 5BQXA 3GLHE 3NWJA 1C1DB 1P1BA 4LCEA 3ZS9A 1QLWA 3KAJA 3OOJA 1L8OA 3A9TA 2W2KB 1DEAA 4F3RA 3C39A 1NVVR 5CW1A 2I76A 4HTFA 5D3KA 5DEIA 4EABA 5HVNA 1E5XA 2JIDA 2PEZA 2WTMA 1I4TD 2BKEA 5ER9A 4F1KA 2WSLA 1WEKA 3F8SA 3MMNA 3PGKA 4XM1A 2CYCA 1S01A 4WNYA 4D4LA 4M1YA 1DTEA 4HUTA 3KVNA 3VU3A 1D8AA 4RD3A 3HKCA 4LYEA 4G1BA 4DLSA 3DZIA 2G9QA 1Z6AA 2QTVA 3ZGLA 1RJEA 2UYHA 3OJXA 5LQAA 2DERA 3KJEA 4L7QA 1FFXA 4N5LA 1GKKA 2GD1O 2A9RA 3A6FA 1L7BA 2XQFA 1GUFA 4BKMA 3HKDA 5DJ5A 2QE6A 1SXHA 4C4RA 1FK8A 3KXPA 4MRMA 3RHTA 1FLNA 2QJWA 3A25A 5I7EA 5KVSA 3NS7A 1CFJA 4IG4A 3SSOA 4ZN6A 1G6HA 1UFRA 1EX1A 1QSGA 4NV1A 4DUPA 1UBUS 2FEKA 4HZUA 3RTEA 1THGA 1LRJA 1Y98A 3B8HA 4JL5A 4WZAB 4Y18A 3VH4A 4TVSA 1C30B 5JG7A 2FZLA 1EVYA 3FMOB 3IEIA 4R1QA 5ALGA 2YVUA 1GL7A 4RKQA 1R4ZA 4Q6WA 3PWZA 5DBHX 2PKCA 3FCSB 5LP6C 4BC1A 4DWWA 5TB5A 1BE8A 1G9XA 2IVFA 3UB3A 1EG7A 1RQPA 2D3TA 3FZQA 3UUEA 4OKNA 1SGWA 4TM7A 1DIBA 4AJEA 2PCLA 3D4OA 5IJ0B 5C1PA 4WXRA 3UWOA 1OWOA 1SG0A 2P8JA 2R5WA 5GJVC 3V1LA 4PU0A 4EI9A 2FMUA 1E0KA 4CUZA 4AX4A 3M2PA 3NHYA 1ZINA 4TMFA 1B1AA 3WLAA 5A5DA 3VH3A 1D2HA 1OZFA 2P9QA 2HD4A 3P1JA 5FBQB 1NVWQ 3UATA 4ZYTA 1T3HA 3BOSA 1CZNA 1XDZA 3I9NA 3MTIA 4TLBA 5GV7A 2G1KA 4BJHB 3JZMA 1YRQA 3NVAA 1CJVC 4BJ1A 2V7QD 4NZ9A 1DJQA 2JKYA 3LLUA 1KEEA 1NW6A 2OBXA 4Z9YA 5CPBA 4IZHA 1U80A 3WWOA 1W8IA 3I64A 1CR2A 3LCJA 1EXMA 4GOOD 4KIFA 4NVRA 3HRIA 5DNVA 4HRYA 2J3JA 3PR1A 5KDLA 4AF7A 1XPJA 2YS7A 3WLNA 4EGAA 1FJ2A 3AIOA 3HO1A 2Q9BA 3RYCB 5LYJF 5ISMA 4GI7A 1T0BA 3HCWA 5E1MA 3RK1A 1UQTA 4OJTA 3LYLA 2EZUA 2Y1FA 2P9YA 1GZ6A 2PKQP 1FUIA 2BTQA 2OXRA 3BICA 1RXEA 1SUWA 1E2KA 1X70A 1RJ9A 1OKKA 3AJDA 3CLTD 4KXMA 1PV4A 1UKZA 1XD2A 2FMHA 2HRCA 4Q1CA 4X44A 4O4IF 1QFSA 4P7FA 5L3VA 4C89A 3HJNA 1WU7A 5TT1A 1ZGCA 3GFVA 5JNTA 2DE0X 1XALA 4KWTA 1JHRA 3B85A 3ADPA 1JU3A 1OZAA 1OREA 1G8MA 3P4UA 3WLLA 3KLNA 4MVJF 1IEVA 4UM8B 3ZXXA 1N8NA 3AJ9A 5GADl 3JWHA 2AC4A 4Z9AA 2O7QA 3GMIA 3S29A 9ABPA 1NRIA 2P75A 2AOWA 5DK4A 3WIDA 2RCNA 1VPLA 1YS7A 5AW1A 3H75A 1B41A 4PCLA 4B8ZA 4WADA 2WF9A 2IYEA 1FFDA 4A73A 1NYTA 2OHOA 4PLHA 1VL5A 4FEEA 4FMCB 4GM0A 2EJCA 3W8NA 2FH5B 3M6LA 1W1UA 3ZU5A 5THXA 4M49A 3NNDA 2IBMA 4KXLA 1LTHR 4HADA 1JJBA 1FUYB 2YWBA 3ZJUA 2G88A 2K5UA 4S1VA 3KZXA 3UAOA 3X2FA 1XMVA 3U4GA 4KX5A 2Q4BA 2WQ7A 2A67A 1CPYA 5FUVA 3CF2A 3CV3A 3O92A 3PCRB 4L51A 4DRXB 3IHKA 3GUYA 1CJKC 5HF5A 4I19A 1EVEA 2FQ1A 4UVDA 4GUDA 1CQWA 2NNLD 4L4YA 1JNYA 2QTGA 1D4OA 4P5EA 3QY9A 3CW8X 4H0CA 4P2BA 1OBFO 1EFRD 1M76A 1BH2A 4JYPA 3TSYA 1R0XA 4B2IA 2O3UA 4TRJA 2R68A 4R9VA 1U6IA 1P9LA 4Y6OA 3N8NA 3SJCA 4ZZIA 4DZTA 1NOIA 2CK3D 3CLSD 2IH4A 3S8EA 1A1SA 2BRUC 2DT5A 3H6HA 1OASA 4G1MB 3GCWA 3BJRA 3QFCA 3T1TA 3ENQA 3EVZA 3DNPA 4K2AA 5TY0A 3VO2A 1OAOC 2GSDA 1LXCA 4L7VA 1LI4A 4G0MA 2PGAA 4RD2A 2Q8PA 3UMBA 5J5AA 5DWQA 4DCGA 2IU0A 2H2DA 1MV5A 2GTHA 3HCBA 2W2TA 3AHJA 4E70A 2VF5X 5B1YA 1P75A 4DYHA 3K0FA 2Z3WA 4F6RB 5LPNA 4BB6A 2NUBA 2XSZD 2FMTA 1J00A 2SKDA 3QX9A 4LJ8A 4MRVA 2Y2UA 5ESRA 3ZVLA 3PEUA 4GKKB 3INYA 1BO6A 3CTPA 2QE7D 5DGXA 3T94A 5HEKA 3A27A 1DAIA 1DX6A 1DBSA 2I6UA 2VDNB 3ET5A 4HZIA 3T4UA 3WLQA 4F04A 4LE0A 1GPDG 3LVFO 4RKEA 3AUAA 1FJGB 4MTLA 4TLLB 9MHTA 3WK7A 4WESB 4BGIA 1SCIA 1YIDA 2Y6VA 1FVXA 4I50A 1EK0A 3L05A 1RIFA 1AK9A 4NJEB 4P5PA 4DJFC 1C9JA 3D64A 2ZRHA 1TZCA 2L0XA 3GPCA 4IDFA 4V0RA 1A96A 1I3CA 3A9VA 1UANA 3A9SA 2YHIA 1RYEA 2EOAA 4FN5A 3AUSA 1F0YA 5JYEA 2R8OA 4NECA 5CFQA 1WZ2A 1F7UA 4I5GA 5AHKA 2N1BA 5DYIA 1F6BA 5TT0A 4HFMA 1KI8A 3ZV6A 3D6NB 2Z2JA 3H8JA 3U9LA 4ODIA 3CRZA 2LR0A 1FNSA 4W1PA 4X1IB 1MA3A 5CVDA 1KQ3A 4NOJA 4QOSA 2QAIA 2VBCA 3AM4A 1YSCA 1LVGA 2OHGA 2NG1A 3U1TA 3TZ6A 5JCPA 2VR1A 5MN6A 4TMXA 1SHUX 4ZCSA 4NBNA 5JOQA 3OJLA 2WSMA 2X0EA 5HKBA 2DECA 4UQLA 3ABZA 4GE0A 5JQGB 1QNFA 3EXIA 4QELA 1L5HB 2RGDA 1XCBA 3DC7A 3DMYA 4YMGA 5K0BA 4UHCA 2QX8A 4N48A 3I6ZA 4LZWA 1V11A 1WQ3A 2GLTA 4Y1RA 5AI6A 4L3VA 2W4MA 4Q3CA 2MWMA 2EL7A 2VXYA 2NOAA 4CKEA 1Q16A 3HO8A 5CRIA 1A5ZA 1NONA 5DSTA 3DR5A 2H1SA 4B43A 3V3KA 5KTTA 2UVQA 3C1UA 3A1FA 4Q48A 1BW9A 2JHGA 1PL6A 2NYVA 1UADA 4FEAA 1EFUA 4I1RA 1YR1A 2Q6OA 1Z33A 1L4FA 4X3PA 5HA5A 4F12A 2IHJA 3OPQA 1GEGA 1ZRNA 2I71A 1EDEA 3OSUA 2PM8A 4Z3DA 3VJKA 4YRRA 4FFLA 3NUGA 2HBZA 2WF7A 3A1UA 4D0GA 1KI7A 2A0WA 1W9MA 4UOQA 3DLCA 3BC1A 2P9GA 2R9VA 1ZCBA 4FWBA 2WYOA 1HE4A 1QRRA 2QD3A 4JU9A 3IOCA 4AL4A 4B1FA 1WXGA 3JVIA 4MS1A 3SIRA 5EZSA 4EDHA 4FDTA 1SAYA 2FPSA 3IH5A 1Z88A 4M0LA 4QDJA 4ZYUA 1IFXA 5FKJA 5JI3E 1QIKA 3R2JA 4ES6A 4TLCA 5LZ2A 4U4AA 2JEZA 3OQOA 3QWAA 3DM5A 1LSJA 2CMFA 3K9BA 1EUQA 3MCTA 1H1TA 4OB7A 4WERA 3VOBA 4DG8A 3FGPA 3FBGA 1F9AA 2QTAA 2C7VA 1L3CA 3OVMA 4FHZA 1VKHA 4PYRA 4EW3A 3PHLA 3HBNA 4XQ0A 5JVDF 5EAIA 3ND9A 3TUZC 3AFMA 4GWLA 1KFCB 5CHEA 3RU3A 2IDJA 3CUTA 2RBKA 3I2IA 4W1SA 1G2PA 1JQ3A 4L9SA 4ZO6A 5EY5B 2ZUCA 2PIDA 1O2DA 2F1RA 3RIMA 4ZGGA 3NHAA 2OCDA 3JQ8B 4M98A 3ESYA 4DM4A 5JZOA 1ECFA 3H7IA 1AGRA 4KVGA 4WCFC 3EVFA 1XUOA 2IW1A 1QUFA 1TEVA 3G59A 3JWIA 4V0KA 4TSRA 4R5HA 5F7ZA 4W1RA 1I2AA 2JFXA 3DKKA 3T7JA 4ZEXA 2Z6VA 4O5AA 3SNHA 3ESRA 3L0IB 4I4CA 5JSFA 1HDYA 1K66A 2GK6A 3D0KA 4HTFB 1XEAA 1QZ3A 1I7PA 5JDIC 3SFTA 4DB2A 2VNJA 4BJ5A 4Z2YA 1Q0TA 1TYZA 5ENZA 4JLUA 2QQGA 4CMCA 3HKCB 4QDKA 1P39A 5FPTA 1KMCA 2QTVB 5E8JA 3HY3A 4WOJA 5BUQA 2GUWA 1WZIA 2ID7A 3BCSA 2FMFA 4CCAA 5J2UA 1TF7A 3NXSA 3DOIA 4FXPA 4TYWA 3G9QA 2WWHA 3HKDB 7MDHA 4OQXA 2H5LA 5CVVA 5HQTA 4YWHA 1CULC 1R18A 1VE6A 3Q7TA 4MRMB 3VOAA 3LBIA 1RWBA 2VT2A 4XCQA 1Y3IA 3KPVA 1JDNA 4HZUB 5DM4A 1OIXA 4JWTA 1G3MA 4QOGA 2JH3A 5AVSA 1E9CA 2WJ6A 4F3TA 4YRFA 1XTSA 3PENA 2I62A 1DUSA 3BE5A 3C5EA 3LY9A 3MRSA 1ZMOA 4Q7JB 1NUPA 1O4WA 3HRKA 4BIMA 1LPSA 4A10A 5LSAA 1WPQA 1IG0A 4W9NC 1GGHA 3OKFA 3O6VA 1GR0A 4LXIA 2CKMA 1T8TA 2GETA 1RPTA 1OAKA 3O1JC 5CUQA 3LE8A 2ORVA 4UBJA 4O4LA 3OLWA 4HH0A 4CF7A 4H3HB 1YTUA 5JJIA 4R6WA 3ITEA 1AKUA 2PZAA 4HB4A 1BROA 2NACA 3JD1A 4UEKA 4GECA 1QGED 4UUQA 1YJBA 3BHIA 4DV7B 1EFLA 1W94A 3NBZC 5F1OA 1AZTA 3K20A 5KSWB 1KC3A 4N3AA 2EKBA 4YDHB 4BVJA 2Z5LA 1EWQA 1KEEB 1RBYA 3GVHA 5FXMA 3G2KA 2PZMA 2Y27A 2BR4A 4Q4LA 1C2TA 5TMDA 1RXWA 2VHTA 4PYIA 2C7GA 1IWPB 1W29A 2C84A 2P67A 4Q1BA 4EPWA 4KPYA 1RRPA 2Y76A 2ZJ6A 4RJKA 4ZVRA 1XROA 3GRCA 3GT4A 4C14A 4EX7A 2MR6A 3R3WA 1DE0A 4XYLA 3FCEA 2ZYIA 2BTQB 3N0WA 2C4NA 4PSKA 4S1WA 4EPTA 2R7NA 1THTA 1RJ9B 2O2SA 4MHSA 3VSBA 1XD2B 4FGZA 3KB6A 2P2DA 1OA1A 2BV3A 3L8MA 1DQZA 1HEUA 4OFXA 5IBPA 1QDEA 4D6YA 1TAQA 1PK9A 2P2NA 3OY7A 4RPCA 3INTA 1R8JA 3AZQA 3EEIA 3BXHA 1E0AA 2C8JA 3L4EA 3WICA 4BMVA 5D5HA 1NBEA 4ZKDA 3J81k 3EBPA 1N0WA 2NZJA 2V8BA 3ZIUA 1IL0A 3A1DA 3DMHA 3ZI4A 3HH8A 2NYUA 3VTKA 2PE5A 5L4NA 2IIQA 3L04A 4H7HA 3ZZ0A 4RGBA 4LMBA 5BSUA 1KJ9A 4BIIA 4E21A 1PEAA 1JALA 1KEPA 1P2FA 3BWXA 2H3HA 2D4AA 2KQUA 3CF4G 2D5CA 4G09A 3C3XA 3ZOZA 1LQUA 3L92A 2E4WA 4ILEA 5CHYA 2HK7A 1XN4A 4KN9S 2VG8A 1VLZA 4OUKX 2OG1A 3R1IA 4EJ2A 3Q1KA 1FMFA 2ATVA 2CXTA 3AUJB 2VP2A 1PWXA 3C7KA 1B1CA 5TMEA 4WXMA 1RZVA 2DUJA 2ESRA 3ZIDA 2YY7A 1TYCA 2V1XA 1T3SA 3MEQA 1DPGA 4P08A 2GN9A 5A6VA 4CEHB 1TK3A 2V65A 1V5IA 3LTNC 1PJ3A 1LBEA 2WHRA 4JUAA 4PE5B 4X24A 1MG0A 2IZ6A 3OCZA 3AERA 5MF6A 3TW8A 5C5DA 2IYRA 3B1JA 3TOXA 5DCYA 3ZWCA 4B17A 4UVGA 1ZH0A 3HR8A 2HDNB 3O94A 1NN1A 1QF9A 1CR1A 3A7DA 1SNYA 3T99A 3QMVA 1YIAA 3O90A 2ZWPA 1TYDE 1Z0ZA 2VQDA 5T5QA 8MHTA 3RGWS 1DRKA 2QTNA 1IZZA 4BASA 1CERA 2CNWA 2JLBA 4KW7A 2IYZA 1B7GO 1IH8A 3AY0A 2JFUA 1E2MA 2GVNA 1VE1A 4LOHA 5LQDA 3TQFA 2E5WA 5F4BA 1FRFS 1H8EA 3KYCA 3VPCA 3IP7A 5IUNC 2DAPA 1MJNA 2IDMA 2LBPA 3DDHA 4F72A 2AJCA 1YASA 4OREX 4WKCA 1XC7A 4RWEA 4LRWA 1I7NA 2ZRAA 2VYND 3MS7A 3D4BA 3NEAA 3TM4A 3B6EA 4EA6A 3N87A 4MYRA 2PX0A 1QE0A 1KK1A 2H59A 1JQ5A 2ZI5A 3EVNA 3K0FB 4XYBA 1TJYA 2WMDA 1N2CA 3OFVA 3SKVA 1FPMA 2B7BA 4ER0A 4EEKA 1IAQA 1ZH6A 2C92A 1QRAA 2AD5A 3B9BA 4K05A 9ATCA 1ESMA 1MXHA 1URPA 1ZRHA 4LHWA 4B2LA 1Z39A 3EIFA 5LLSA 2OTCA 2WZQA 3U31A 4D9NA 1L5ZA 5IMBA 5K0JA 3MUEA 2VHUA 2IF2A 4CU5A 1NW7A 3GJYA 5EHIA 3FYUA 3RRMA 2DHEA 2E49A 2EBUA 3B2EA 4HDKA 2DUNA 2NSDA 4EPRA 3OURA 3MGAA 4TXHA 5EFZA 1ZC3A 1KMHA 3WIBA 1JIXA 1GT91 4I50B 1BE1A 3SYLA 2Q1YA 1NVEA 1OLSA 2BEWA 3H0EA 4DOMA 2GPJA 2XOKA 1BEEA 1L3IA 4HI0E 2VDVE 1IY1A 1V7ZA 2CLHB 1IHXA 2O1WA 3IBSA 2YHIB 3EH2A 3CVOA 3PFGA 3OE7A 1W2WB 5LU8A 3URMA 2PWPA 2AZTA 1WU8A 4JA0A 5FIUA 4CPDA 2ZSDA 1GGNA 4JLWA 5FAXA 3ROMA 1M7GA 2AR7A 5DGTA 2Z5FA 3PU6A 5HW0A 3T7EA 4KQ6A 1K89A 1N6IA 2FUG1 3JQFA 4ICIA 2XKBA 2Y66A 4LVCA 5FOVA 5HBRA 2COKA 4L85A 3VQTA 4R1MA 4ONEA 4MV7A 1CUZA 1ZZEA 1Z4JA 2IU4A 3QPAA 1YL5A 2GZSA 2J6CA 3IRVA 3K7EA 2WDPA 3ZWXA 3EFOA 2AN3A 1N5KA 3O74A 3S2ZA 1MLDA 2GZ1A 3EXIB 4PQEA 5CDFA 4J9VA 4TT8A 4F4CA 3BSWA 1GTL1 1WDLA 2YL2A 1U2PA 1V11B 4FE7A 3GFOA 5F77A 5KX5A 1UPTA 2RONA 3SX4A 2BM0A 2DLNA 4CKEB 2BFEA 5DN6A 2FI1A 3FPLA 2EJWA 1E1YA 3OF5A 1T1EA 4RIIA 5KZMB 3GGCA 3R74A 2DWCA 1C81A 1XZAA 2DPYA 1HG1A 4YMLA 1BW9B 4C0BA 1HL7A 1N75A 4TSFA 3HZRA 3W2TA 1G59A 2YKGA 1OBOA 1KR2A 1U6KA 3AZOA 4Y9DA 3FOEC 4OAQA 1NBMD 1EFAA 2RARA 4DVGA 4LIPD 4LVOA 4US0R 4GH5A 5KB3A 4UU7A 3FWKA 2RGWA 1E9AA 1VPWA 4ZMSA 4JXXA 3IE0A 4WA7A 4O5OA 5BSVA 5I5EA 1F14A 4LHXA 3LL4A 4EUFA 1LK7A 1SQ0A 3OX2A 5DRYA 3HPQA 3G1WA 1RNLA 4M8SA 1TKRA 1QIDA 3ZTYA 4MS1B 4OHVA 4FDUA 2A92A 1N7GA 1SC3A 5JSHA 2HPVA 3AW8A 3E7DA 4FHEA 4H6VA 2WIKA 1FUKA 2CJYA 1BX3A 2EX0A 5FQNA 5ECWA 1UWCA 1XA0A 3A9CA 3OG9A 3ESZA 4KMRA 2QN1A 2Z6QA 3TXAA 1HTTA 4CYMA 1M3SA 4LA4A 5B53A 2BKXA 3GJ3A 3AY3A 4Q01A 4UTOA 4DZZA 3CVWA 4TROA 3V8EA 4CM3A 3TFQA 5ALIA 3V1UA 1J5EB 2AOVA 4H77A 1FSGA 4LGMA 1ZD4A 1Z7EA 1E3IA 2IYWA 3NWEA 4L9AA 4B6QA 1AB6A 2C54A 2WAYA 1W4AA 4M87A 4X5OA 5C31A 4CNQA 5ARCA 5LMCA 1ZL0A 3D7NA 2DPHA 2HMUA 2OCYC 1ONOA 2ZJBA 3WK9A 2HMYB 4EITA 4W7HA 2CMDA 2PR2A 1JAXA 4ZCRA 2P5SA 4P2GA 2WHYA 1TE2A 3ZC3A 3V1NA 5HYVA 1VIYA 3P9PA 4ISCA 3TQRA 1ZAKA 2I2BA 5DHUA 4ZDJA 3JWEA 2NU7A 4H9GA 3HZHA 2WFZA 3PPVA 3PNYA 5ILOA 2FVXA 2Y8EA 2L42A 1KXJA 2Z2YA 3L1UA 1B6SA 1BS1A 1T9ZA 1COWA 1SUDA 2YWDA 3ASYA 3PI7A 4RK4A 4YQFA 3EF1A 1NUUA 3EGXA 4RGQA 1EQUA 1C9MA 5J2UB 4BFZA 1IIBA 1NUQA 4IXMA 4L15A 3C24A 1TIKA 4IMPA 2A9VA 4FFPA 1XF1A 2J08A 2PSEA 1RC1A 1Z8DA 1ILWA 4G23A 1N1EA 2EYUA 3L0PA 4M3NA 1IUOA 4DM7A 4K6KA 4HRVA 4GL4A 2PRJA 4L8FA 5IBQA 1DQYA 1KDVA 5GY7A 4DN6A 4E1AA 3HUEA 5EP1A 3DT6A 3NHLA 1PGJA 3ONNA 5ENDA 2J3HA 4QFCA 3BSYA 3M1AA 4RGVA 2VJKA 1JHDA 4J03A 2B0JA 3OJOA 3NT2A 5F9HA 4B81A 3BWCA 3G5AA 4JS0A 4TN5A 1GCAA 4LJLA 3AVUA 4FMDB 1MU0A 3DYVA 3RARA 3GBVA 3H84A 4QEZA 5EKSA 4O4LB 2FR8C 4Q7QA 3FPGA 3QVUA 1QZXA 2DQSA 4QFBA 4DXHA 1MPTA 3RLIA 2XCTB 3EFEA 3WTBA 3WLSA 1Z6PA 4A03A 5ICSA 4GZMA 2ZBQA 4CW7A 1KSHA 2QUHA 4QU0A 4UBIA 4X7MA 2JEYA 3LWZA 4KBFA 1X38A 3DEAA 5CXXA 3AZPA 2NP6A 1UK7A 5TV2A 1WZNA 3PTZA 2FRVA 4M1QA 5BSMA 4DWJA 1A4UA 4FZ3A 2Y0EA 3PUXA 4H3SA 4PZPA 1FBTA 4FYKA 4MRNA 4JI7B 1TCBA 2WYHA 4MW0A 5AVOA 1DUIA 3FM9A 3WNVA 5BNZA 5CDUA 5LLDA 3KE9A 3DXZA 3B7PA 4M6WA 1QPGA 4YMUA 4RMGA 3B48A 3AR9A 3VU9A 4KFSA 4MI3A 4LKOA 4PAWA 4Z1MA 5AW4A 1U90A 2O2IA 4GMKA 5TC4A 4LOJA 1Q0RA 3T7CA 3QLUA 2ZQZA 2R85A 2X6RA 3PQ6A 5C53B 2J3DA 3JD2A 4M22A 1C8VB 4U2FA 1NU6A 2QSZA 2ZT5A 3JCZA 4J1QA 2OENG 4OQFA 1P7WA 2CNLA 3C4VA 4WGGA 5BSRA 4ZJYA 3A3OA 4R8VA 5CBKA 2IIBA 3KQNA 2FSSA 4E2YA 5AIBA 2GN0A 3KELA 1OC2A 3RVDA 4E3ZA 1E2LA 1T0UA 4YH1A 2X7HA 1JLHA 1AK1A 4KLCA 2N0SA 3ABQB 3U7EB 4LZNA 3I1FA 3GEIA 5FTKA 2NPFA 2X76A 2GPYA 4Z1OA 4UUAA 4AECA 2EHDA 1A72A 4OD0A 4R81A 4YRJA 3V32A 2QM8A 1XP8A 3LT2A 1PW7A 1FS4A 1TT7A 1E9EA 2ZR8A 5HJ7A 3KXDA 3RJMA 4HPWA 3KEFA 2NZ2A 5K4GA 4X9XA 2XUKA 4M7PA 4MDYA 3HZOA 6PFKA 4DV5B 2CXHA 2HK9A 3Q8MA 3UT5A 3KQWA 2C7QA 1IHUA 1L7QA 2PBZA 4KE7A 4TQUS 3RB8A 3OCJA 3O3OB 4Z4FA 2CYAA 2R96A 2WM3A 4OK3A 4PQYA 1Y6FA 1V2HE 1WMEA 1ZD9A 3AERB 1Q3HA 3SSNA 4C0AC 3TW8B 3U3OA 3LHIA 5A1TA 2I2AA 4R2HA 4CKZA 1UBHS 1A2BA 1GA1A 2WWRA 2XQVA 3AGPA 1L4YA 1PT7A 4ZJZA 5DM2A 2YVLA 4TZ6A 2FPWA 4M9ZA 1TECE 4QE3A 3X3HA 4A16A 5CPFA 2E4VA 1AIPA 5AW9A 1PFKA 1OCEA 3AXTA 1NMQA 3K2BA 4DLKA 1R6BX 2ZYGA 221PA 2C57A 1WXXA 3W1WA 1ZVMA 1Z0FA 2NO6A 3MM4A 1MB0A 1JLKA 2HRBA 3D5TA 1KQOA 5KYVA 4C7XA 4ENUA 1QE5A 2MSCB 1KAHA 3KYCB 3H3XA 3TOVA 5F76A 3D54D 2ZZMA 3VU1A 4KAFA 1C7JA 3ESQA 4B6JA 3PWTA 3SR4A 3KQUA 5L6MB 2Q5QA 2HA3A 5TGTA 1MP0A 4FT2A 4CEJA 3SHOA 3ZZUA 2FOLA 4PZUA 3NTVA 2R7LA 1SOAA 5DLYA 1MO3A 1N2CB 1R9GA 2WJPA 3NTLA 4GICA 4C0XA 4DWVA 3HJCA 2VRNA 1U6JA 4WKNA 4E13A 1Y9DA 1G0OA 3EUEA 2Y0BA 3WB0A 3ZDEA 3PTAA 1CX9B 2BP7A 3VR0A 4MVYA 3AIIA 1ZI9A 3TG2A 1E5VA 2NSLA 2DETA 1SELA 1HE2A 3FYUB 3ELYA 2A1IA 1Q7EA 4HDKB 4LDZA 2QMQA 4UU8A 4G0OA 2RHOA 3IKLA 4ISBA 3RVPA 3VYSB 1ECCA 2A1TS 1JKJA 1WCWA 2Y2VA 3A3YA 1KMHB 1WDKA 2EFEB 1KMNA 2HHJA 3C3WA 3IP5A 5DM0A 3D8BA 4RK7A 3TFWA 5TGZA 2ZSIA 3DP7A 1CVRA 4MWDA 1M7HA 1R64A 1OLSB 1X1SA 3HCEA 3R5XA 3P2JA 3PG5A 1HC7A 1KP3A 2P2ZA 1UBOS 1A8UA 3REFA 1IBLB 4RMHA 2QNRA 3IT1A 1V8PA 2JHAA 3TX2A 3ZK7A 1A7JA 1ZD5A 3ETJA 5DLEA 1ZHOA 2PT5A 4J1NA 1J8QA 3FAZA 1S4QA 4RL4A 1B0PA 5JJ5A 2C5LA 1MHTA 4PSUA 3K6JA 1QZTA 5LZ4A 1ZU5A 1O3YA 1U8YA 3N53A 3O0TA 2ACKA 5IBCA 5DF1A 1TMKA 1ESZA 3QEBZ 4H7IA 1OB5A 3AI2A 1ZK4A 2CLSA 1H3NA 1BDJA 2JPDA 1U8TA 2Q4EA 3IT2A 4TKZA 1P5ZB 3CWZA 2ZKIA 2B5WA 4BMDA 2O2ZA 2GPSA 5TQ0A 5JLJA 1SJ9A 1O8CA 3F7OA 1I24A 4IIDA 3BH7A 3PP8A 3N0RA 1GPYA 4KV9A 3HVRA 5FEMA 4AKGA 4BDTA 1GT6A 1Z5ZA 4I7EA 4MWBA 4XRRA 1ISHA 3D6VA 3VTFA 4B9EA 2WM2A 1M10A 3EFOB 3K15A 1X2BA 2AE1A 5FI3A 3PEWA 5CG2A 5ALJA 3WLFA 4E32A 3EGIA 3FRIA 4MVWA 3ZLJA 2VBFA 3VBEA 5KX5B 1SQ6A 2OCKA 1NW9B 2BFEB 1THZA 1OVMA 1T5BA 3PFIA 3FHOA 4E7PA 2X3FA 4B75A 1JFFA 2AF3C 2BGJA 1NBAA 1QKIA 3PGVA 3P9RA 4KJXA 1SCDA 1UUFA 4ZVVA 5B7PA 1K5HA 2UV8A 1IPFA 1LBSA 1ABFA 3QUBA 4LJKA 4LY3A 4XH9B 4DUYB 2R6ZA 1DRVA 2AN5A 3RAGA 3IT3A 1ZP6A 4Q9NA 5IABA 3LY5A 3QYAA 1XVUA 2BUBA 4K6CA 5TGDA 2QLLA 4RU1A 5DGHA 1ST2A 2X9NA 4JLOA 3RBXA 2FWIA 1HDGO 4LI0A 5BXYA 4CDGA 5EIWA 1W0CA 3K4QA 1VJ0A 1RZ3A 2CXXA 2YXLA 4MWTA 1SXQA 1ZOIA 3DMNA 3AG5A 3CPSA 3EG9A 1KKMA 2C8LA 5I45A 3S6JA 4R0MA 2XAAA 4RLSA 3I12A 2YIDA 4FCTA 1Q7BA 1VBKA 2XYVA 3M3PA 3FSJX 1Z74A 3B6ZA 1NMSA 1DNPA 2PBRA 3KYBA 4YJ3A 1K7XB 2H4HA 4CVNA 4RD1A 3UMGA 1CJMA 3W4JA 1M34A 3HDVA 2O1XA 1YQDA 2AEJA 3GDGA 4YR9A 4H08A 1KZHA 4H2DA 2PO5A 1DC8A 4BNTA 4Z4HA 1K6XA 1JXAA 3O2JA 3OIVA 3R9KA 1Q17A 3I42A 5SYNA 1E9VA 4HDSA 5ELMA 4CLEA 2W43A 2PUHA 3LBYA 4KP7A 3T0FA 5HUQA 4MUNA 2OQIA 2JLXA 1N6KA 2CXPA 3BMQA 4AKSA 2HLPA 3OZ7A 3CZ9A 1F8GA 1WMSA 2FWAA 4ZEOA 2ZB3A 1TT5A 3MYYA 5BSFA 3PQFA 2V0GA 2K7FA 1YRWA 5JZMA 1YF3A 3PR2B 4MVJP 2Z4RA 2KLBA 3I9OA 1AUPA 2I29A 3ZNOA 4IGAA 2QRQA 1CR6A 1PLLA 2RAVA 3WISA 5LMNB 5AKIA 2A9JA 3CEPB 1AO0A 1PJCA 1W2HA 4K2HA 3W5HA 2YJ6A 2NU7B 4NS1A 4BO6A 3AV3A 2L69A 1DS6A 3T95A 2B61A 1O5IA 4RAQA 2C0PA