4GZLA

Crystal structure of rac1 q61l mutant
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
175
structure length
173
Chain Sequence
b'AIKCVVVGDGAVGKTCLLISYTTNAFPGYIPTVFDNYSANVMVDKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related C3 botulinum toxin substrate 1
molecule tags Hydrolase
source organism Homo sapiens
publication title RAC1P29S is a spontaneously activating cancer-associated GTPase.
pubmed doi rcsb
total genus 57
structure length 173
sequence length 175
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gzlA00
1ZCBA 3CPHA 3K70C 3REFA 4GMXA 4ACBA 2YVUA 1XFAA 1JXOA 1RPZA 5FL7D 2BJVA 1DO2A 4ZV4A 2FZLA 4M2LA 4JSTA 2FSIA 1YZUA 3EPLA 3QY0A 5DHFA 5K8UA 1W36B 1DAFA 2ZAMA 3MAAC 1LVGA 4QHTA 2VH5R 3C14C 1JALA 3NH6A 4GFDA 2J9RA 3GLHB 3SBEA 4JKIA 2VHJA 1VG8A 4YMWA 4YMSA 5K8LA 4FXPA 3KJIA 5SZJA 4NKRA 3RANA 1RVDA 2J0VA 2OBNA 3K9NA 4NHOA 3MG9A 2ERYA 1S4QA 1UEIA 4GOXA 3LXXA 2XZLA 4I1UA 1Z3IX 4IOMA 5JS7A 3DVLA 1OKKD 3WHKA 5DO9A 2HCJB 3DDCA 3LAWA 2A5GA 1SVWA 4A0FA 3CR8A 4NU0A 2CEAA 3NBXX 4WXPA 4C0KA 3IQXA 2W83A 3AM1A 3B6EA 1AM4D 1SXJE 4JLDA 4ZCLA 4PFSA 2V54A 2R6FA 3C8UA 2OT3B 5BQ5A 3M1IA 1GNQA 1CJKC 1QF9A 3LW7A 4ZKDA 2ZU6A 3DM9B 1O87A 2R65A 3BK7A 5FL7A 2XB4A 2PBRA 1KO7A 1T8TA 1ZU4A 1W5SA 3PUZA 2N1BA 1T3HA 1FQKA 1T9HA 1NBMD 3U61B 5AJWA 1MABA 2BKEA 2Q9BA 4TYYA 4P33A 4L16A 4NYMR 4C0HA 3A6PC 5BN4A 4B43A 2Z4SA 4KVAA 4YDHB 1E0SA 3GCGA 4Q4JA 3AVVA 3UMRA 2PLRA 4XTRA 3DHWC 3K70D 1G1MA 4C7OB 1G3QA 2JA1A 3L0SA 3X1ZA 2JJ1A 2MMGA 3TLXA 2ZRIA 1IBRA 4V0NA 3WMFA 4LWZA 4N3NA 5L8VA 2GESA 2ZRKA 1A5TA 4HLUC 5DSZA 1E1QA 2X19A 2OG2A 3NEJA 1IJFA 3EZ2A 1VMAA 1RZ3A 2BBTA 1UBEA 4BGDA 2MSCB 2Q9CA 4HI0E 1XJQA 4DSTA 2C8VA 5H70A 1OXSC 3ECCA 4MGKR 1W36D 5G53C 1NJGA 2HLDD 1XMVA 2ZUBA 2NQ2C 1R0XA 3HYTA 1KDRA 3W90A 1V5WA 3WNDA 3LNCA 1UKEA 1R4AA 4BFTA 2J1LA 5EUMA 3AVTA 4UKDA 4LV5B 1XB2A 1Z2AA 1Z6YA 4XVQA 4G1UC 2HT6A 3EZFA 4QJ4A 4A15A 4DLRA 1SVIA 3EPKA 1Q1QA 2FGJA 4C0QC 2WM9B 1NIPA 1W0JA 1M2OB 3NHBA 4WIAA 3QJYA 3MWYW 4PAMA 5E4FA 3TGPA 3BOSA 5EE1A 3GFOA 1GUAA 1UFQA 1VG0B 3VAAA 3IHLA 4BRUA 1TQ6A 2YC4C 1LV7A 3L0OA 4LYAA 3QPVA 3B1YA 2P5SA 1UBFA 2J41A 4AWXA 3CWZA 2GVDC 5CDFE 4Y0AA 1CJMA 3LA6A 2W6JA 2OCPA 1C9KA 2W2TA 1YKSA 4GNKA 4G0NA 3ZIAA 4DIEA 2O8DB 1GAJA 2QTVB 3B2EA 1AS3A 3RRYA 3UG6A 2A5JA 2W00A 5H68A 3AP2A 3EC1A 2EYQA 2OLJA 1XD2B 1IN8A 4URUR 1RJ9A 1BIFA 1U0JA 4TTQA 4B75A 5A4JA 1OJLA 4LC1A 4MITA 1QHGA 2F9LA 2P6NA 4B33A 2WKPA 3QXSA 3TSOA 3R9XA 2ZVQX 2HXYA 3SEAA 5J4LA 3NWJA 4OQFA 3O47A 2FV8A 3IEUA 1NI3A 2VRWA 2ERXA 1KK0A 1NKSA 3LVRE 4DIDA 1LW7A 3THXA 2GEUA 2JDID 1NLFA 2NZ8A 4YMTA 4LC0A 2HJVA 4K46A 4M22A 1WB9A 1WDTA 5CITA 3QKRB 3THWB 1S8FA 1BMFD 2QAGC 5FR1A 1GOTA 1SHZA 3T12A 2G0NA 4QM7A 1G19A 2ZRHA 2FEMA 3W9YA 1E2PA 2YJTD 1KKLA 1P2TA 2QUZA 2L0XA 4KFRA 5A5GA 2N42A 1ELOA 1DEKA 1ONBA 2G6BA 4BZQA 2V6JA 4G5GA 5IHPA 2ZS9A 3KQUA 2ZROA 1S1MA 1UBGA 1E2HA 3D7MA 4F91B 4A36A 1AGPA 2FEOA 1E2FA 4PC6A 4CGZA 1OB5A 3HPQA 3OE7D 4Z1MD 1G5TA 3EIHA 2OFWA 2Y8EA 4HAXA 4XH9B 4B73A 3CF0A 4MH0R 4DDWA 4A8JA 2HUPA 3Q7PA 4JZKA 5FL3A 1RJ9B 3RSOA 4ZIRB 3UMFA 4JLAA 4B3DA 1Q21A 2X2EA 3O8BA 2C04A 3T06B 1QG4A 2O8DA 1N0UA 3QEOA 2HYDA 4R2HA 4QKQA 4TMXA 1SKYE 4EQ6B 4FMCF 3HYRA 4QG7A 3A1WA 3U7HB 3EXAA 1WRBA 3DOEA 4BRWA 1XXHA 1ZM3A 5LD2B 5L3QA 1N2CE 5LB4A 3I5XA 2GCOB 1ETUA 1S3GA 3BFVA 2BCGY 4CEIA 2JATA 4EPVA 4N0DA 2WSSD 3GLGA 1GZSA 4A2QA 2CCKA 1TQ2A 2Z43A 3CNLA 5EE5B 4AK9A 8OHMA 1XZPA 4FCTA 1W47A 3KFXA 5KDDA 3P4YA 4Z8XA 1M7GA 1AJEA 5LDDC 3VNUA 3SJAA 3IBGA 4R71A 2V1XA 1IAQA 2GWHA 3EZ7A 2IYUA 4JVNA 5L3RA 4W9MC 5JI3E 3L82B 3GMTA 1HUQA 4X8LA 2ASEA 4TZ6A 4AURA 5KOYA 1E2EA 3BB1A 4AG6A 4MKIA 5D3MA 5AR1A 1G8GA 5EXTA 1L4UA 1U2RA 1SKYB 4JS0A 1U0LA 4GL2A 3ZS9A 4G3XA 2IL1A 1XJ0A 5B64A 2WJYA 4QBGB 4EFLA 4HATA 4DB4A 3RS5A 3TRFA 4JLBA 1T3LA 3AKCA 4RD3A 3NDBB 3B60A 2JASA 4PPQA 4HAVA 1G8HA 3ZH9B 3I4LA 2FN4A 5CM9C 3K53A 4ZDWA 2FG5A 4GOKA 1KSJA 4HLDA 3I8XA 4GI7A 4E03A 4IJMA 1R0YA 1R8QA 2GHIA 4ERNA 2D4HA 1EFTA 1XPUA 4ZIRA 1FMLA 4KVGA 4CDGA 3PQCA 1Q12A 3D31A 5BWMA 4B3XA 3I32A 4HEJA 2C9OA 1NN0A 2DY1A 3BGWA 4I99A 4R2IA 5LBIA 5B2ZA 2IUUA 1XZQA 1ZIPA 2GXQA 3NDPA 2O8FA 3CH5A 3NBFA 4HB3A 4EFMA 3OEEA 2QA5A 2XTZA 1G4UR 3U4QA 4Q1AA 4LYFA 4F7WA 3SBDA 1DBSA 4H1VA 1JR6A 2JLYA 4PZZA 4US1R 4DHEA 5BN3A 3DO6A 4NYIQ 1HQCA 2ZM5A 5TXGA 2JJ2A 2ZS8A 5FTJA 1ZM4A 2FX3A 4HAUA 2G83A 1IY2A 2HEIA 1XJCA 2OO7A 4OQLA 2GZAA 1YZTA 2ZI5A 4ARZA 2B92A 2P6UA 2IHBA 2JLZA 3TUIC 3VHXA 3GFTA 4ARZB 2MSDB 2AD5A 3ASYA 1ZNYA 5FI1B 1N6PA 2C9CA 4P0TA 4PHFA 1YE8A 4V0OA 1VKJA 1JAIA 1XTQA 3MWJA 3C15C 3WNBA 4C30A 4C3ZA 3CIOA 1Q1ZA 4IDPA 4RD0A 1W4RA 4GT1A 3EA0A 2YOGA 3B13B 1LS1A 2XAUA 4W5HA 2PL3A 2GVZC 3W8RA 5GVSA 3ZLJA 3WYFA 3IHWA 1OF1A 3H84A 5J4YA 2HV8A 1EFRA 1XRJA 4OJQA 1VPLA 2WWGA 2I1QA 3ADDA 2O5VA 4WW0A 5B30A 3H2YA 4UXIA 3SI7A 2TMKA 1XWIA 1S96A 2HLDA 2VHCA 4U7DA 1Z0JA 4A92A 4K81B 1W0KD 3SU8A 2WIAA 3VKHA 1XU4A 1LY1A 2HF8A 1E2QA 1E94E 4F4CA 4KBFA 1R5OA 2CE7A 2QM7A 4TYQA 4C4PA 3JVUA 4DC9A 2YC2C 3QKSB 3PG5A 3K0CC 2ODBA 4OHXA 1BYUA 4Q9KA 1X8KA 1MKYA 4MYCA 1TUIA 3K0FB 2QGZA 1IOZA 3N2IA 1TQDA 4WZ6A 1Y3AA 3RRNA 3SJBA 3T15A 2IHYA 1J99A 1II9A 4IFBA 5TB5A 5J47A 4CEHA 3OAAD 1E2LA 4PQFA 1EFUA 2ONKA 2WSMA 2B7BA 1XMIA 4Q00A 2SHKA 1Z22A 1UKZA 4IVRA 3TE6A 2FWRA 4RD1A 2FPKA 4EFNA 4YQFA 5EP2A 4BLRA 2YYZA 1N5LA 2NMVA 4Q9HA 2IT1A 3ICEA 1ESNA 2QAJA 4TTRA 1ZNZA 1KY3A 3B85A 4V0KA 3SYKA 3LDAA 4GMDA 4M0LA 5EJEA 4LDJA 5JSZB 2PMDA 4XVRA 2BMFA 5FPKA 4FD2A 3B7GA 5EXPA 1G64A 4Q7JB 3LQRA 2IS1A 3QKTA 1KO5A 4KV9A 5IK2A 4JIMA 2G1JA 4OK6A 4AY2A 3KKPA 3ZJYA 2IF0A 3EASA 3RRZA 5AWFC 1CRQA 4JBWA 2YWHA 4JL6A 4B32A 4B3FX 4JBXA 2JLSA 2GAAA 1P5ZB 1QBKC 5G41A 1P9RA 3NIBA 2F1HA 1YJ5A 1VG1A 2ZQ5A 3BXZA 5JWRA 5CM8B 3VU9B 1E0JA 3WMEA 3T1TA 2WVJA 1PV4A 3IQWA 2ZRLA 5SZKB 1Z6TA 4NE2A 121PA 2VP5A 3K9HA 3SS8A 2OCBA 1KSHA 3PEYA 2VF7A 1GWNA 4JVMA 1N0VC 2ZJOA 4Q03A 3SHWA 4H1UA 2OESA 2FFQA 5DI9A 4WOPA 1OXVA 1QHHA 4KSBA 2DWOA 2CL7X 3Q5EA 4WXRA 1RRCA 3GP8A 3LBIA 4NYJQ 4KHZA 1F2TB 3RVBA 2QBYB 4A0RA 4TTPA 3U3JA 1KTVA 2J7PD 3AH8A 1HEIA 1MO5A 2C78A 2OHFA 2FZ4A 3ZVNA 3AV0B 2QAGB 1F2UB 4Q48A 3OEHA 4JBYA 4EPTA 1IN4A 3VHLB 4QGFA 3HU2A 2HYIC 1BMFA 2F43B 3A1UA 1ANKA 5BW8A 5JS8A 3LWNA 3ZD6A 3OF5A 1S1CA 5D3QA 3FB4A 1ZD1A 2LKCA 3Q3JB 5A0FA 4B3BA 4YMVA 1S2MA 2REBA 3P26A 1ZD8A 2ATVA 2FF7A 4NL4H 2P3SA 1M6NA 3DM5A 1XTRA 1E32A 2B21A 1QHXA 3DOFA 3N5CA 5B57C 2IX3A 3CO5A 5CIWA 3EPJA 3U6KA 1K8RA 1PLKA 1CJUC 3EA5A 3QENA 1P7CA 3NBYC 5JFGA 5FPTA 3QNUA 1VIYA 4IDHA 4EJSC 3O8DA 3K0AA 4LUCA 4KCGA 4TYPA 2JAQA 4V0MA 1KO4A 2VHQA 1VHLA 2VP0A 3C5HA 3HJNA 2WPDA 4IDOA 2HJGA 3R7WA 1Z0DA 5CJ2A 1Z63A 4G5QA 3KL4A 2V8OA 4QGHA 4XWAA 5FPYA 2CJWA 6Q21A 1OB2A 2WZQA 1TMKA 1TEVA 1OW3B 1H8HA 1GIAA 1U8YA 1YQTA 4V02A 2AHOA 1IY1A 3IUYA 4JL5A 4PO8A 3VKWA 2JCSA 2FDCA 2QMOA 1KJYA 3TJZA 1G5RA 2AKAB 3B1ZA 3RYTC 2KI5A 5EUQB 5EXXA 2WSSA 2XNDA 2ZI6A 2YWGA 4QJ3A 2KBFA 4WZAE 3WYGA 1RW4A 3KX2A 5JJLA 5DYIA 1FX0B 4WA7A 5CYOA 3SQWA 1DAHA 1OYYA 4NCHA 3B9PA 5AUOB 1Z5ZA 4KI0A 2IYRA 4JLOA 4QBHA 1DG3A 1X1SA 4CEIB 1KKMA 2KJQA 2O8BB 4PO1A 1G3IA 3VX4A 4BZPA 1COWA 3SYNA 1T6NA 4Y0VA 1SVMA 3TVDA 1TNDA 3PUYA 3GPLA 4I4LA 4UNPA 4LHVA 3BORA 3DPUA 1G7RA 1KI7A 3WRYC 1JXMA 2PJZA 4CF7A 1DE0A 2QP9X 3RHFA 4BFUA 2CXXA 1KAGA 1CJTC 5JHGB 1FUKA 3TR5A 1P61B 5TDHA 4BQSA 2ORVA 1KK2A 2F1IA 3GEIA 2EYUA 5H1YA 2ZYTX 5KSZA 1AKYA 4A4DA 1QHYA 1OFIA 4P3YA 1MO3A 2A2ZA 2WKRA 2O8CB 1T5IA 5IT5A 3EX7C 3BC1A 5GJBA 4AYWA 4DLUA 4W5JA 2X8AA 4DLSA 3E5HA 3CR7A 3GLGE 4Q5IA 5FUWA 3UMSA 2CNWA 4A6PA 3GLIB 3I8SA 2RGNC 2OSBA 3WBJA 821PA 4DDTA 3PUWA 2WKQA 1OXXK 5CYPA 2A78A 3AVYA 3PCRB 1XMJA 4A82A 5F98A 2CHVA 2Q3MA 1SZPA 2XTMA 4PC1A 1AGRA 1DO0A 2IYYA 2Z6VA 1R5BA 4Z54A 1HYQA 4OQMA 4Q1DA 1UDWA 4NCJA 1TF2A 4L9WA 3QVUA 2BCJQ 5J4HA 3V4RA 1DVRA 2NO6A 3CB4A 5JWOA 1M7BA 2GTPA 3TQFA 4QNRA 1QHNA 3RS0A 4CT5A 2W2XA 3KJEA 4OK5A 3W5IA 3B82A 3I1FA 2IYQA 1NVUQ 1ZM7A 1FNMA 3QKRA 4JT4A 4TQUS 2IXFA 3THWA 2H18A 2DFTA 4JLKA 1PLJA 1HA3A 4Q47A 3V00A 3KXKA 1YZNA 3FWYA 2RGDA 3L8ZA 3F5FA 3TNFA 2J0UB 3X1XA 5B58C 4HAWA 2MMCA 1ZINA 1KO8A 3DZ8A 1G7SA 3IO5A 2VP2A 3KDSE 1NKTA 1KHTA 2V9PA 3AVQA 1CR2A 3PENA 3NHAA 2AK2A 3P27A 5HKKD 3KFVA 1Q57A 4D0NA 4O0MA 4LJAA 3BIFA 1YZGA 3PUVA 4IRUB 5FPSA 1Z07A 1IXZA 4LJ8A 5TARA 2O8CA 2PH1A 3W34A 3H4MA 2OAP1 3CRVA 2J0SA 4ESVA 2BBSA 1R7RA 2NO1A 1ZAKA 4PAQA 2P2LA 2NO9A 2ONJA 1A2BA 1US8A 1B0UA 3AP1A 3GJ5A 2QMHA 2GJKA 3EC2A 1RE0A 5LPNA 5KSPA 4LBYA 4Q4LA 3MLEA 1FL9A 1U98A 2BWJA 3PR1A 2CE2X 4XTCS 2EFGA 1CU1A 2GCOA 4YDSA 3QBTA 421PA 3K09A 3U60B 2D7DA 2R44A 2LKDA 2IEYA 2GEDA 1X8LA 3VTKA 5KU1A 2ZUCA 1N5KA 3NC1C 2J46A 1G8FA 1E79D 4P4TA 4X8HA 5AUPB 2C99A 2JEOA 2Q9AA 3N2EA 1IN5A 3KTAB 5HE9A 4B6EA 2IUTA 4GP7A 4MRPA 2W0MA 4BFYA 3GEHA 2BBOA 2V1UA 4ON9A 3ONWA 4RD4A 2VYFA 1DADA 1P6XA 1PUJA 3RS7A 3BH7A 1VYTA 1TUEA 3FHCB 4Q1FA 2WAXA 3SZRA 4D4LA 5JCPA 3SR0A 1GL7A 3VNVA 5EP3A 1GG2A 2DBYA 2O8EA 1JEDA 2QE7A 4BFWA 1G7TA 1GRQA 4LJYA 1DAEA 4RKEA 3J81k 2OBMA 3H1TA 2XB2A 2W6IA 3CWQA 4JJZA 1XCGB 2WPDD 4PSVA 2ODNA 3A37A 1GFIA 4HB4A 3U3MA 2IC5A 5KDLA 4B35A 3K0CA 2A3RA 4L4UA 5L3VA 1DAGA 4Q4AB 1U99A 5JSZA 3F8TA 2AWNA 4EPYA 4TMKA 3GLFA 3X1DA 4Q1EA 4NP6A 3EARA 4ASUD 1U9IC 2JLXA 3LX5A 2J3EA 4FMDB 1XXHE 1N3BA 2R6GA 1UKVY 3IKJA 1S9DA 2ORWA 3DMDA 2ZEJA 3K1JA 2D3WA 4LYHA 1D5CA 1ZW6A 1KMHB 1D6JA 1MRSA 4EDHA 1ODFA 3LRPA 2JIZA 3SJZA 5FBVB 2ZJYA 2Z5FA 3BH0A 2H16A 5DI3B 4O2LA 3CUEF 4QHSA 4BLPA 5HE8A 4TT3D 2JJ1D 1AS0A 3MJRA 2V4ZA 1W0KA 2ZREA 1EFCA 3KKMA 5TY0A 1Z0FA 1KDPA 4DLTA 1E3MA 2C95A 3QVVA 2J7KA 3L43A 1E98A 2ZI3A 4PXAA 2XITA 4DUGA 5F2EA 5CLLA 3GD7A 3JZMA 4BPBA 1YU9A 4B3CA 1WMSA 2H92A 1UADA 1ZMXA 2QORA 4YMUA 2VBCA 4AYXA 4AYTA 4DCTA 4II7A 1KI8A 1H8HD 4L8GA 5SZHB 3W5JA 5EE3A 1OPXA 2C2HA 5CK5A 3GLFB 4DBLC 2ZJAA 1G9XA 1WA5A 2BJWA 2F3TA 3I61A 1K6MA 1Z8FA 4XOIA 2GCNA 1OLOA 1Z29A 1XNJA 1JR3E 3QOFA 1ZVQA 3FMPB 2BBWA 3AF2A 3K9LA 4GP6A 1NF3A 1FTSA 2ZSAA 1G8YA 1LF5A 4W7SA 3AF3A 5L3SA 2OILA 1A4RA 3QI2A 3U7FB 2A9KA 4TQAA 2FMXA 1G18A 1MT0A 2IYSA 1VYVA 1VECA 4A2WA 5JZVA 1XD9A 2IBMA 2WOOA 1DELA 5FTNA 1Q22A 2NPIA 2GETA 4M9ZA 3X1YA 4JSYA 3TIFA 4D4JA 2CDNA 2J0QA 4NCKA 3EZ9A 3MUFA 4Q21A 3LFUA 4XWOA 3RWOA 2ZRPA 4AKHA 2CJWB 1P2VA 4Q66C 3FKSA 2QI9C 3OIVA 4XSHA 2ZE7A 2QM8A 3DKPA 1MR3F 4TWZA 3QXCA 1SQ5A 2QT1A 3CKLA 3K0EA 4WAUA 1MOZA 2D2FA 2QZ4A 3NG1A 3K09C 2CLCX 3LLMA 4TLDA 2IYVA 4ZPXA 2UZIR 2CL6X 3ND8A 4HAZA 3CRRA 2V6IA 2HF9A 1XTKA 2V55B 4L5BA 2ZRAA 1T3SA 1T5LA 4LYJA 5H8WA 2OCYC 4JVLA 1FX0A 3BWDD 1FUUA 5JBQA 5KUTA 4FWTA 3O8CA 1XP8A 3QXXA 1JI0A 5FTKA 1IY0A 1G3MA 3M0EA 1VCNA 2I4IA 1SVLA 4AKEA 2NOAA 3U6BA 3FTQA 3QEJA 1N25A 4DZZA 1II0A 2WMOB 4OHWA 2KWIA 5FOVA 1N6RA 1ZP6A 1G4AE 1G20E 3KKNA 3KXIA 1IXRC 4TLCA 3ZGXA 1VCIA 2GRJA 1E9SA 3KKOA 4P4UA 3RWMB 4ACAA 3THOA 1YZQA 2ZRGA 4NZYA 4Z51A 3T61A 2ZXUA 2WJJA 2F9MA 4A8JB 4AKGA 3BB4A 1Z2CA 1NP6A 4DCVA 3E70C 3FVQA 2WICA 3W6PA 4IW3B 1KO1A 4GDFA 2BM1A 4JKYA 3MJHA 2XEXA 4NCIA 4A8JC 1R2QA 3MD0A 2QG6A 4M8NE 3TAHA 1E1RA 3VKGA 3HDTA 4NDZA 3OFND 4KXFB 4LY6A 1D9XA 2D06A 5AUNB 2IEZA 1SULA 3ZVRA 4TLEA 5TV2A 1HT2E 2F43A 4HB2A 1AQYA 4A0HA 3K70B 4LGMA 4B74A 5CDFA 4HUTA 1OH8A 2CBZA 2QN6A 1TU4A 2XSZD 2CLSA 2BMDA 4N1AA 3ICQB 1SVKA 2RGNA 4EPWA 1CRPA 1NNEA 1B23P 4PO9A 3WP1B 2QROA 3VMFA 3REGA 1IHUA 1NBMA 5GJVC 2RGBA 4LX0A 2P6RA 1G41A 2YWEA 2PJRA 4B6FA 1C4OA 4B3GA 1UAAA 4FMDF 4PC2A 2BMEA 4MGIR 4KSCA 4FW9A 4BFXA 4YC7A 3T1OA 1OT3A 1G17A 1CR1A 1M34E 4RCZA 4ASUA 3QPUA 3ZD7A 2ODEA 2VP6A 1HH4A 3K0AB 4HZIA 3MWLA 1PVOA 1FPMA 4RZUA 3QG5A 2DYKA 3VR4A 3SNHA 1NJFA 4R9UC 3PEVA 2GXUA 4OHZA 4M9XA 3VU9A 4MKGA 5KSYA 1XPRA 2WHXA 4OQXA 2AXNA 2QENA 1NLZA 3AB3A 3EG5A 5KSOA 1ZUIA 4Q4JB 1X86B 4OHYA 3AKYA 3EWSA 4C0BA 3MMPA 5BXQC 2BEJA 2VEDA 3KQLA 3SYLA 3HPRA 4GZLA 2XGJA 1G6HA 1T0HB 2PZEA 2WJVA 4M1WA 5DHAA 3IIJA 4CIDA 5AJXA 3RC3A 1FFHA 1Q1BA 2Q6TA 2IYZA 2JGNA 4C2UA 4XIGS 3IIKA 4US0R 3U3KA 3HR7A 4FINA 2V3CC 1OXTA 4YLGA 5GVRA 4XVUA 1GP2A 4NCNA 4M1MA 2GXAA 2H17A 2J87A 4K8OA 2YOHA 4OI4A 5ANRB 3SJCA 1CULC 1M74A 4M1TA 3FDIA 1CBUA 2LWIA 1YVDA 2ZRDA 3KJGA 4S35A 1P2UA 4TMTA 3B1XA 1L7VC 2CVHA 5C4GB 1Y63A 3KQNA 3FHOA 4CEJB 3TK1A 2JJ2D 1OXUA 1ZC4A 4OJKA 4CEJA 5JRJA 2UVQA 5EQTA 3LBHA 4HZUA 4HUQA 4B34A 3CONA 1RRGA 1AIPA 3AVOA 4CVNA 3K9GA 3IPYA 4IKEA 2BMJA 3HU1A 3SFVA 4BE7B 4OYHA 3IGFA 3PJRA 2ZTSA 1OHHA 3FFAA 4F4IA 2J0UA 1L8QA 1U8ZA 5FBLB 1JB1A 4MUBA 4TN1A 3NXSA 1M8PA 1A2KC 1XX6A 1M1YE 2W0SA 4RFSB 1CLUA 1E0KA 2GF0A 2QMEA 4RZXA 1SKQA 1JJVA 1XEXB 3QF4A 3ZQ6A 4DXAA 1LFDB 5J4KA 3QBVA 1KJZA 5AJVB 2G9NA 5DN6D 1VTKA 1WF3A 2R6CA 3IBYA 3MCAA 1XTIA 1CKEA 4DVGA 2XJ4A 4JL8A 3R8FA 2EW1A 2ZRBA 3QXHA 4Q01A 4Q4AA 4UXJA 2ZRFA 5KNDA 4LBWA 5C4MA 4GRAA 5HZHA 4HAYA 2ZJZA 2XZPA 2FFHA 3SN6A 3AVPA 4AIIA 4KAXA 3THXB 1YHNA 1KJWA 2GJSA 1TPZA 5DLQC 2CCJA 1OV4A 2QEQA 3PVSA 5AK0A 5KHOC 4PTLA 4Q1CA 4LHZA 1YRAA 2B7CA 3LLUA 1OIXA 4I1SA 3BFXA 2BC9A 2OXRA 3EAQA 4LJ5A 3QKSA 3R8CA 3KB1A 2WWYA 3CNOA 3BBPA 1ZNWA 3QF7A 4DSOA 5DI3A 3WYAA 2R8RA 2YNMA 4A9AA 5HKKA 2QU8A 3T5GA 2NO0A 5KPDA 1KI2A 4PSAA 3H86A 4B47A 5IF9A 1NG9A 2BVNA 3GJ7A 2O0KA 5IDVA 4D2IA 2FSGA 1S9HA 1QG2A 1XEWY 3CNNA 3I92A 3FPAA 2MSEB 2QNRA 2A5YB 3Q85A 3T1VA 3AVUA 4KYUA 4DSUA 1R10A 3VR1A 2PZFA 2AD1A 1P75A 2GJ9A 4JMPA 5FOTA 2AK3A 3L2OB 3BH6A 2C77A 2WAYA 1XEFA 4URYR 4BLSA 4UQOA 4Q7MB 3FMOB 1TQ4A 1KSFX 3V9PA 2ZRNA 2O8FB 1JECA 2VO1A 4QC2A 1PLLA 2Z4RA 3U44B 2E9SA 1G3RA 3GEEA 1XBTA 3IDQA 1Q20A 5UKDA 4UNRA 5HPYB 1KIMA 2FH5B 3SC3A 2QTFA 5JI2E 1BOFA 4RVCA 4WZBE 3ZQJA 2O0HA 5HR5A 1EGAA 2QQEA 3U3OA 1MRNA 2F7SA 5FOUA 5JEDA 1N5JA 4B2LA 4BFVA 2A5FA 2OZEA 2OLKA 3PXGA 5LD2C 3OEED 2DPXA 4ABYA 2H8KA 5P21A 4EPRA 2EWWA 4JYBA 1CR4A 3ZIAD 1NVVR 2ZJ2A 4A2PA 1NN1A 2AX4A 5K8TA 3A8TA 4DLYA 4Q4HA 1EWQA 5FUXA 1II8B 2QL6A 5CLQA 3OESA 5C18A 2GK7A 1FP7A 2QSYA 4OI2A 1FW6A 1NSFA 1W4AA 1TX4B 4OBEA 1ZBDA 2QE7D 1E2MA 1O3YA 3QE0A 5JJIA 1W4CA 2QMUA 3CM0A 1Q44A 3Q72A 1ZM2A 1TU3A 4BWYA 2H7VA 3CPEA 4ZO4A 5KO2A 1IJEA 2BOVA 3OIYA 2GA8A 1E2NA 1E6CA 3CW2A 4RY2A 1GM5A 3U7EB 4AC9A 2OE2A 3UKDA 2AR7A 1Z83A 2QY9A 4M21A 5JRZA 5DGXA 2ZRMA 1MV5A 2C96A 2WV9A 5F3WB 3CZQA 3R7WB 2O0JA 1K5DA 2ZI9A 2VTKA 1I4LD 4BLTA 4CW7A 4IVPA 1CXZA 4MGYR 1KI3A 2WJIA 1U94A 1Q1EA 2IW3A 4U00A 3QKUA 2VL7A 2OEPA 1KI4A 1J8MF 4M1KA 4DUGD 2ZSBA 4KLZA 1JQJC 4BLQA 2DWPA 2ZRJA 1JR3A 1SHKA 1W2HA 3CH4B 1EWRA 1P4SA 2KBEA 1E1QD 4GBMA 4LJ9A 4NYJR 1GVNB 2ZYWX 4QXAA 5SZIA 2R6AA 4ZI3A 3L0IB 3PIRA 2X2FA 2VIIA 2J59A 4MQBA 4QFMA 1R0ZA 1VG9B 3CX6A 3FGNA 2F1RA 3AF0A 3RLFA 2WWIA 3RSLA 5JEEA 3X1WA 4Q4HB 2F55A 2NG1A 3THYB 1VCOA 1UM8A 1NVXQ 1HTWA 3AP3A 4PANA 2O8BA 1F2UA 4JLNA 1ZU5A 3A1VA 3WNCA 4DCSA 3A36A 3W8NA 5ELXA 1WQ1R 221PA 2G88A 3LQQA 1SVSA 4LSGA 4X8MA 4BEJA 4IFEA 1G291 1E99A 2OXCA 1QVAA 3GJ6A 1RYHA 2CK3A 2VP9A 4HLUA 1SXJB 1GNPA 3AQ4A 2ZYVX 5DYGA 1OFTA 1J70A 4DKXA 4MDFA 1H65A 1VYUA 2R6DA 4EKDA 3I3SR 3P20A 2QPOA 4KODA 1HE8B 4UJ5A 2Z83A 3FHTA 2ATXA 2WWWA 5KNCA 5IK2D 5GJCA 3WMGA 1ZYUA 2FFAA 1E2IA 1A1VA 1F60A 2ZSFA 3ETLA 1YRBA 1I2MA 3RDPA 2OFOA 2A30A 5EE9A 1V43A 3OIUA 3OIWA 1F48A 1MABB 2UZ3A 3K0FA 2VSXA 3WY9A 4PPFA 1DARA 1AKEA 3MSXA 3B8HA 3FKSD 3THYA 3GJ3A 4QBIA 3Q5DA 3GLHE 3ADKA 3MWKA 3GLIE 3TW4A 1W1WA 4NYMQ 1P2SA 2RCNA 4OL0A 3VR5A 4A6XA 3B1WA 4KYIB 4HB0A 1YZKA 2EU8A 1ZC3A 3D8BA 4ZKEA 4V03A 1J7KA 2WWHA 2ZE5A 5GJWC 3BJIC 1KYIA 3A1TA 4MYUA 3NVAA 1N6LA 2VSOA 2XNSA 1T8UA 4MA4A 1JPNA 3LXRA 2QPAA 2GKSA 4BFZA 4YXWD 4DWJA 1AN0A 4JJKA 3CRQA 4TLBA 2J5XA 4TMZA 5CB6A 3EIQA 2ZPTX 3PITA 1BS1A 1N0WA 3A4LA 1U90A 2BIFA 4Q7LA 4HZUB 2F6RA 2V7QD 4GSYA 1XCPA 4KBGA 3ZZ0A 4C0SA 3UATA 1OKKA 4G5SA 1OFUX 5FBWB 4DLVA 1CTQA 4EPXA 3AVXA 5IRCD 2HCBA 2GXSA 3KB2A 1Q3HA 5KPJA 4CYMA 1KSGA 1YR9A 5FTMA 2WJHA 3UK6A 1MO6A 3CX8A 3RAPR 4FMBB 4Q9LA 2ZJ8A 3R20A 1AZTA 4TYWA 2G3YA 2OV2A 4IHQA 3UWOA 4XSGA 3QF4B 1LTQA 3SDZA 1G21E 3OAAA 2VSFA 1LNZA 3IPXA 5G3YA 2C5LA 1DS6A 4D0GA 1XEXA 2Z0MA 4JLJA 2JLQA 5HCIA 3HP1A 1JJ7A 4EUNA 4DCNA 3VR3A 1XXHB 3BERA 5FH9A 4LI0A 1JBKA 5L3QB 1XD2A 2RGEA 4M1YA 3WXMA 2CK3D 1RFLA 2OBLA 3FKQA 1NRJB 4EAQA 3VR6A 3OFNA 2YKGA 2F1JA 3BFKA 2C9YA 5BYJA 3TH5A 1CF4A 1PZNA 1WE2A 1C1YA 2PLFA 3TAUA 1VDZA 2ZAOA 5FTLA 1GKIA 1DG1G 4M9SA 1E9EA 2G1KA 3I72A 3DEFA 1CIPA 3RS2A 3DKVA 3RC8A 1SVOA 4KFTA 2A5DA 1FNNA 4PC3A 2ZR0A 4C0JA 2FU5C 1L4YA 3C16C 4HUQB 4DT1B 2D74A 3PEUA 5JJKA 4XJXA 4DT1A 2XOKD 2GCPA 3BS4A 3PV0A 1ZUHA 1ZUNB 3UWKA 1U0HC 4V0ME 3UG7A 2GZHA 4O3MA 1N5IA 2NZJA 1KDOA 4TMWA 3PEWA 2DB3A 2ZR7A 2GILA 3KJHA 1MO4A 3LX8A 1YR6A 2CCGA 3A4MA 4W5WA 4RZ2A 1NMXA 1IXSB 1W5TA 1ZIOA 2Q21A 4LJ4A 4TYNA 1E4YA 1W48A 4NMMA 2ZI7A 4F92B 2IYLD 1EX6A 1KGDA 1CP2A 1XDBA 5AUQA 4B44A 1KNXA 1OH6A 2F3RA 1Z06A 3CRMA 4FIDA 5EZ6B 4A1FA 1TTTA 4HLQB 4U02A 1E9DA 1IQPA 2GAOA 4PQYA 4KJZA 4QRHA 1YZLA 2CNWD 2ZI4A 3FMIA 3U7GA 1U8AA 1X1RA 2W58A 4QM6A 1DTSA 4PPGA 4DRZA 1F5NA 2WIBA 5JHHB 1A82A 2AFIE 1I4TD 1E69A 5FPHA 2FPLA 2FOLA 4XWKA 1SGWA 1R5NA 3WHLA 4MKHA 1DAKA 3LW8A 1GNRA 2ZE6A 4B48A 1HV8A 3VR2A 1E2KA 4C9BA 4DDUA 4MDEA 2AKYA 2JLUA 5JLJA 2PZGA 1NMZA 1KK3A 1HY3A 2N46A 3B9QA 1JAHA 3W6NA 5C1BA 1NBME 2QTHA 2RGAA 1HE1C 1JQLB 2Q0HA 1IN6A 4DJTA 2QPTA 2QRZA 4WVFA 1A7JA 5JMTA 5FR2A 3M4YA 2H1LA 5HZKA 5F9HA 4TL9A 4HDOB 4ZDKA 2A7QA 2WTUA 2RB4A 4QJ5A 3I62A 2QP3A 4TL6A 5JCZA 1NL3A 1NY6A 4QNMA 4TQ9A 1OFHA 3TVTA 2VA8A 3QQ5A 2RMKA 1W44A 1KAOA 4C2TA 1E2GA 4XD7A 4WBSA 4ZDIA 1W49A 3ZVLA 2RGXA 3QUSA 4DEYA 1UEJA 3AF1A 2PT5A 1KK1A 1M7HA 3EIEA 4R7ZA 3D6TB 4RD6A 3SE0A 1XTSA 2PCLA 3X2SA 5FOXA 1NN3A 1D2NA 3CF6R 2D7CA 4D81A 1XF9A 3ND9A 4M1SA 1UJ2A 4QGAA 1X3SA 4IDQA 1XTJA 3EZ6A 2B8TA 2W6JD 3RS3A 4A0GA 4LPSA 2HDNB 4LJ6A 1KI9A 4AI6A 2Q3HA 2PMKA 4E09A 1N6NA 1TADA 3E2IA 2W6ID 1E2DA 4DSNA 1Z0IA 3GJXC 3GLFE 1G16A 4LBVA 2XXAB 1US8B 1Z0KA 3JZAA 4UXHA 1IONA 3NC0C 1P60A 2IYTA 4MRVA 1N6IA 1GKUB 5AJZA 5EXSA 4O2RA 4HDCA 1S0UA 2JLVA 4ZI2A 1EG7A 1D2MA 3KZ1E 2WBLC 5FUVA 5E7JA 4LZZA 1E0AA 1OYWA 3IILA 4OQNA 3QXJA 1EFHA 4LV6A 4KITB 1DOAA 1AA9A 1E79A 1H8ED 4PR0A 3G82C 3FOZA 3L0PA 3I5YA 3KTAA 5G3ZA 1QHIA 4C7OA 4TL8A 4JLPA 4DB2A 2DFLA 3SQXA 2ZS7A 4Z8YA 5F9FA 1P62B 3VFDA 2CLDX 1NIJA 4I1VA 2NGRA 1NVWQ 1WCV1 2IXEA 3G0HA 4BECA 3M6AA 1W36C 2W2VA 2QP4A 2WWXA 1OSNA 3T34A 1D2EA 1U9IA 2IYWA 1R8SA 2FFBA 1Z6AA 1J2JA 2O8EB 2GJ8A 2CL0X 4MRSA 4B2PA 2VHUA 2FSFA 2XZOA 2IUSA 1E2JA 3KUDA 4GOJA 4JLVA 4KU4A 5JWHA 2GNOA 1J8YF 2XNDD 3LBNA 4LBZA 2ZANA 3W6OA 4JT2A 1TAGA 2QT0A 4GZMA 3PUXA 4QHYA 1BYIA 3F0TA 1VIAA 3AGQA 1LS6A 1SXJC 1CR0A 3AVWA 1WBBA 5C46F 1DPFA 1COWD 2NTYC 4YONB 3R9IA 1KY2A 4IVQA 4L9SA 5KTYA 2XXAA 1KZ7B 4DLXA 4OI0A 1W7AA 2P65A 2GBLC 2D2EA 1KNQA 4IDNA 1R6BX 4FWIB 4URZR 1BH2A 3DMNA 1EESA 3TMKA 1RRFA 2QQ0A 2ZR9A 3UANA 1GITA 1XPOA 4O25A 3RS4A 4XD7D 1P73A 1PUIA 4TZ0A 2XX3A 5TMPA 4D82A 3T5DA 2NIPA 4PZLA 621PA 4D4KA 1FP6A 4MKFA 4KFSA 2VP4A 3TKLA 3VQTA 5K8IA 3TSWA 1FMJA 3BD9A 3I73A 3C41J 1NSTA 3ZZTA 2J7PA 4DLWA 1UPTA 1TEXA 1JNYA 4QOSA 1Q3TA 4LJ7A 2ORIA 4MRRA 1OE0A 1Z6XA 5KYKA 3H0KA 4BUJA 1G7CA 3QIAA 3T1QA 3AF4A 4POAA 1F3OA 2KB0A 3QG1A 2DR3A 1OH5A 1P3JA 4MYTA 1G8PA 4F38A 3W3ZB 1AQUA 3SHFA 5E3HA 2O52A 1Z28A 5DISB 1NN5A 3AGPA 4U5XA 2ZU0C 1ESMA 2EFEB 2AFHE 2IYXA 2DCUA 5L3SB 4AKIA 5DE3A 3NEYA 5CB8A 1QVRA 4ZDJA 2WWFA 3CPJB 1RRPA 2BDTA 2CHGA 3DZDA 1FQJA 2FE4A 3GJ4A 4Q9JA 2IXGA 1YR8A 4LPKA 2YZ2A 1H8EA 4FI3C 1N6HA 4IOJA 2FPMA 3RRMA 1OHHD 2R2AA 2VF8A 5FOSA 3U5ZB 1EX7A 2REOA 4RFVA 4IXNA 1GL6A 3FE2A 1P9WA 3TW8B 3EPHA 4KFUA 3LH5A 4TMVA 2BHRA 2XOKA 1I2DA 4R98A 3L8YA 2KE5A 3Q7QA 1EXMA 721PA 2P67A 3P32A 2D62A 4QBFA 4US2R 1U81A 2VPPA 5DN6A 3W3AA 3KQKA 1G3UA 1E9AA 4RSGA 3FYHA 5BYKA 2CVFA 3U2QA 1QZXA 1ZCAA 2ZSEA 5FOWA 3MFYA 1Z0AA 1TF7A 1FZQA 1F2TA 1L2TA 1X6VA 3NBZC 4LHWA 4UJ3A 2QBYA 3UXMA 3AUXA 1AS2A 2EFCB 4LOAA 2H57A 2PT7A 1VHTA 4D0LB 1KZGB 3DL0A 3AKEA 3GLHA 4G01B 3GLGB 5E95A 4URWR 3B78A 1E9FA 1HQYE 1I4DD 1MH1A 2XTNA 2ANCA 4AG5A 4CT4B 1E96A 3P1JA 1RIFA 5E7IA 2BV3A 1R0WA 2OUKA 2IS4A 4DEXA 4UNQA 3SOPA 3ZVMA 1SXJA 3GQBA 3U3RA 4URVR 2IA5A 4M9QA 5GADl 1IM2A 2IS6A 1G6OA 4OK3A 4CRWB 2QSZA 1EFRD 2YWFA 5JECA 4TSFA 2PX3A 5C2JB 4NH0A 2ZETA 3CX7A 3ADCA 3AKDA 1WP9A 1AK2A 4ESHA 2VHTA 1T91A 3B5JA 1KMQA 2EFHB 5G40A 4OI1A 2IK8A 1E9BA 3ZZUA 2P0EA 5KDOA 2RHMA 2ZJ5A 1DAMA 2JLRA 2WJGA 1VCMA 4PX9A 3TR0A 4BZXA 2GBLA 3JVVA 4Q02A 5LB2A 1OIVA 2NPFA 4FMCB 3WBKA 4E07A 1ZNXA 2DFNA 3HR8A 1WBDA 3HWSA 1XD8A 4KO8A 4F93B 4I1OA 4E5UA 3GLIA 1QHHB 1QHSA 2C98A 2I1VB 2YV5A 2OFXA 1Z08A 4HSEA 4P31A 3TSZA 1GRNA 1Z47A 4EQ6A 3K0SA 4GPTA 3GJ0A 4KLNA 4TLAA 4OHVA 3VX3A 1E1RD 2AWOA 2B6HA 4JVSB 4PAOA 2UKDA 4CZ2A 1GL9B 2EQBA 1GKYA 1D8TA 5EE0A 2E1RA 521PA 5M04A 4HYYA 2ECKA 3OHMA 4HLCA 2G77B 2QRNA 2ZE8A 3C4JA 4IXMA 2JJ8A 3OEHD 1JPJA 4C0AC 4M53A 1ZM9A 2V7QA 2OAQ1 2PX0A 2R62A 1TF5A 2ZYUX 3ASZA 5HTKA 4YXWA 3TUJC 5CIQA 1RC8A 3IEVA 2NO7A 4TL7A 1NVVQ 4JLMA 1BKDR 4UNSA 3TBKA 3C7KA 1GSIA 4PZYA 5D3MB 1DAIA 3E1SA 2YOFA 3OE7A 4LHYA 3BE4A 4FCVA 4Z1MA 4BLOA 4EIWA 4ZCMA 1XMSA 1CS4C 1FOEB 1KI6B 4D80A 2K5UA 3R9WA 3A1SA 1KI6A 4TT3A 3WRXC 2PCJA 3WP0A 2EWVA 1GDDA 2IF2A 1Z6GA 2I3BA 2ANBA 4C0LA 3MGCA 2FGKA 5DNYB 2HXSA 4PPNA 4NBSA 3ADBA 4RJLA 5EZ5A 4QGGA 2AL7A 3A58B 3SFZA 2RGGA 1D9ZA 5KNBA 4I81A 4D4MA 1UKYA 3QPWA 2XJ9A 3FFBA 1NG1A 1GRRA 4X8OA 3CF2A 1CJVC 2FNAA 2OCAA 4ILEA 2GF9A 4IOLA 1IN7A 4DDVA 4FCWA 1AZSC 2VQSA 3FMFA 2FA9A 2LCFA 2IS2A 2J45A 4EJSA 1OH7A 5J40A 4EJSB 2RH5A 3IIMA 1W0JD 5AJYA 1HT1E 2E87A 4ITRC 4V0LA 4Q18A 1T4GA 3TQCA 2IWRA 2FSHA 3CZPA 4BEBA 3N70A 4NONA 1TL7C 4RCYA 1LB1B 4J0QA 4MUAA 2R9VA 1P72A 4S2EA 4MGZR 4G5OA 2B8WA 4TSFD 1KDTA 4PQRA 1E9CA 4B2IA 2JDIA 4Q1BA 4NPHA 5DH9A 1HURA 4PHHA 4LRWA 3V4FA 2X77A 2QGNA 1J90A 5BN5A 1LF0A 1WXQA 2ZUDA 2ZVPX 2CMKA 1T0JB 2Q3FA 4LCBA 4B71A 4UNNA 2YHSA 1E4VA 4URXR 3UIEA 1JEEA 2RAPA 3O8RA 3PFIA 4QL3A 3LD9A 2JIZD 1W46A 2WOJA 3ZYCA 3BAFA 4N0EA 2ZITA 3ZS8A 2ZIAA 1OIWA 2WMNB 3IO3A 3BRWD 3MRSA 1XEWX 2ZJBA 4RFSA 2IWHA 4G5RA 4LHXA 5EP1A 4PC7A 3RABA 2BEKA 4D26A 3LV8A 4P4SA 2BM0A 5HCNA 2ZSDA 4P4SB 3C5CA 5J4VA 2XSZA 2X1VA 4Q9IA 1CEEA 3GFPA 1W4BA 2BKUA 3KXLA 3GJ8A 1GILA 5FUYA 2GJAA 3NTUA 2DWQA 3CBQA 4E22A 3U44A 2AXPA 4RKFA 1UDXA 1QRAA 5FI0B 3Q9LA 3G5UA 3KKQA 1XCMA 5FBQB 2G0TA 4PHTA 4P32A 2CHQA 2VLIA 4HDQB 1E9RA 2P5TB 3K8YA 4IOKA 3QSYA 2OM2A 3ZDQA 2RKOA 4H9GA 1F6BA 1FTNA 1JR3D 4LK2A 1RYFA 1KMHA 3OZXA 2PEZA 4LV8B 1KI1A 4D6PA 2RHDA 1UBCA 1NY5A 1UF9A 2H5EA 2ODWA 2AN9A 4JYCA 1S3SA 3B1VA 1SXJD 2FJUA 4DCUA 2DHRA 5TVKA 4AD8A 4M4SA 3AEZA 1P9NA 4BFSA 4MRNA 3AUYA 4PSKA 1K5GA 1KOFA 1II8A 3NKVA 2REXB 5FFMA 5EP4A 4IEEA 3BB3A 2QAGA 4PHGA 2YINC 2GDJA 5FBRB 3HU3A 2EFDB 1QDEA 1NLYA 2ZRCA 4CEHB 5CJPA 4Q7KA 5J5CA 2GZDA 2GK6A 3CRW1 3KUCA 5E7MA 4IEIA 4RZ3A 1W2GA 2HT1A 1G5PA 3LY5A 4B76A 1Q0UA 3TUZC 1EK0A 2PEYA 3S1AA 3F3YA 4NYIR 3LO5A 3S1AB 1NMYA 1N6OA 3EW9A 4BASA 4ZCIA 1BO6A 4L15A 4Q19A 5CK4A 1GTVA 1YR7A 4D25A 4F4JA 2GEVA 4NTZA 1ZRHA 2JLWA 3EWAA 1RKBA 3RNLA 3UPUA 1ZJ6A 4FN5A 4MYHA 5DIFA 2EVWX 1X8JA 4M1OA 3T35A 3KQHA 4RD2A 1PJRA 1N6KA 3U4QB 2KSQA 3A4NA 3P4XA 3Q8XB 3NH9A 4DLZA 3LVQE 4OKSA 2C03A 2RGCA 2DFKB 3D3QA 1ZD9A 3CLVA
chains in the Genus database with same CATH superfamily
1ZCBA 3K32A 2PO7A 3K70C 5LU9A 4GMXA 4Q1VA 3IQIX 4EHJA 1RPZA 3FJ1A 3PCTA 1GKLA 3RKUA 4O6VA 2OHXA 4QYMA 3V55A 1HK7A 1Z25A 2PPLA 2ZT8A 4AQ7A 3V7NA 3Q2KA 2OHIA 3B3FA 5IU6A 1G20B 2I6TA 2RBEA 3ZC3A 1S3IA 3PUHA 3SIRA 5IDQA 1W36B 3L92A 2GWRA 2NXJA 3WLTA 4MVJD 5LOVA 3QU4A 3LY8A 3FZQA 2Y1XA 3HRHA 3ZTWA 1ES9A 1JALA 1F1BA 4DGQA 4GFDA 2J9RA 1FDSA 3N0VA 1T6YA 1MW8X 3KSUA 2G04A 4YT2A 1NQVA 1ND5A 4NKRA 3C8DA 2OBNA 4J1TA 3TOZA 3YASA 3KOXA 3WL3A 1UEIA 3ICOA 4I5IA 3RVKA 1M1NA 1TXGA 2XZLA 1ZXBA 1Z3IX 4FFWA 1SIWA 1BE0A 3TE7A 5DM1A 3FY4A 4X6LA 5KQRA 4LXUA 2A4MA 2PD4A 1BCRA 4A0FA 3MTDA 3CR8A 3I2HA 3CKYA 3ST7A 3SYTA 5JCJA 3ND7A 4DBLC 2O7QA 3TW8A 1UFVA 4CM3A 5BYAA 1EG2A 4ZCLA 4PFSA 3OFSA 3BF7A 2R6FA 3HVKA 1J1ZA 1NJ1A 3C8UA 3USZA 4BCDA 2GCGA 3TQQA 2VBFA 2ZU6A 3O4FA 5C1IA 1X7ZB 3DM9B 4G4JA 1ZGHA 3BK7A 1BQ3A 3ECSA 3N7AA 3Q5GA 2EDCA 3A26A 4LNHA 4PZPA 1ZU4A 5FL7A 1W5SA 4BWVA 1PDOA 4LY9A 3FOAA 3U61B 3TRHA 2CKDA 1FU7A 3L79A 2ZWOA 3TN7A 4BC0A 1LI7A 3PI6A 4NYMR 1OA0A 4P93A 5BN4A 5IKPA 3E9YA 2Z4SA 4KVAA 5KHAA 5TJ9A 3UHOA 4HDRB 3NOXA 1TCBA 2G08A 4Q4JA 3UMRA 5A3QA 3ZGZA 3IOEA 1G1MA 3AILA 1I7QB 3ZJ4A 4RTNA 3L7JA 1ZDMA 5L8VA 3K96A 1E1NA 3KKKA 4HLUC 4B7ZA 1PR9A 3S27A 2UXDB 1IJFA 4QLOA 5IAKA 1HXHA 1PYGA 1U3WA 1NU8A 2OYSA 4ZOBA 2PVCA 4BGDA 5FUMA 2Y6VA 2VWHA 3PXEA 4I0WB 2Z2JA 3EEQA 1N8TA 4MGKR 3U0BA 3DBHA 1ZISA 3RU7A 3ZY4A 5HQJA 1BRTA 2NQ2C 3UMGA 1HDGO 1VKRA 2QRLA 1LQTA 4HF7A 1QGUB 2PG3A 3ACCA 5KJCA 3IVCA 2E89A 1LGYA 5CVEA 3PT5A 5CH8A 1Z2AA 1DC8A 3E23A 5AK3A 2KM1A 4BNVA 4ETIA 4ARIA 4ZK6A 3ZWMA 1TA9A 4YUXA 3HJHA 4G1UC 3LUFA 4MQ5A 1YZHA 3WGJA 2L17A 1AMOA 2HT6A 4G5XA 3KL2A 4DG9A 3G9ZA 5LN1A 3OZCA 4DLRA 1GPWB 3H4TA 4NNPA 4UVIA 2I65A 5C52B 2FQQA 4WIAA 3GGCA 1M2OB 3OZDA 1AOXA 3H5RA 3MWYW 3E15A 3TGPA 1LK0A 1KZ9A 3BHNA 2BFBA 3L9WA 5K3DA 2HQBA 3G59A 3LC7O 1NRWA 2JS7A 2O07A 1Z4OA 2CVQA 2XUOA 5TQ2A 1D4AA 3RC1A 3ANTA 3UJAA 4BRUA 2YC4C 2QVCA 1LV7A 4N65A 1EXNA 1H1LA 3EF1A 1WZ2A 1V7CA 4LYAA 4AN0A 3Q8KA 2UUCB 1WNTA 1XMQB 1XTZA 1HL7A 2CWWA 1L6IA 2H00A 4UVGA 3NO4A 2X9GA 4ZALA 4QZVA 3CWZA 1YZ3A 2A1UB 1FE8A 1M2WA 3JTEA 4E5KA 3MCTA 1VLQA 2TSYB 2C7RA 4IDEA 4GNKA 4ZV9A 2FMUA 1GCUA 1V1RA 4G0NA 2HREA 2DBRA 3PFHA 2HHAA 3OCZA 3I6YA 2XD9A 1SY7A 2A5JA 2HO5A 4PZCA 4GMGA 3SVZA 4OVKA 1XD2B 1IN8A 3GAZA 4BO9A 2PGNA 3U26A 4LC1A 4KMOA 5JNUA 4MITA 4ZXPA 3OLVA 3QEKA 1LI5A 3UJ6A 1X80A 4HXEB 1JHPA 2EJTA 5IJAA 3QXSA 6LDHA 1UR5A 1A76A 3R9XA 3KHTA 2XRFA 1A8PA 2V74B 2X0IA 1UMBB 3DW1X 3N58A 2WW8A 3IEUA 1LK5A 1NKSA 5L6MB 1DEHA 1BZYA 1LW7A 1TKCA 2FCAA 1TMYA 2A5LA 3HKBB 5CB4F 1A96A 1PTJA 1XDGA 2A0WA 4OH7A 5EGNA 2XCRB 1WB9A 2ES4A 4KN6A 2WUWE 3PFKA 3QWFA 3DO5A 4MCJA 4ZODA 3QX3A 1S8FA 1BMFD 5FLKA 5JSFA 1WTCA 1GOTA 1SHZA 3T12A 2G0NA 4CKBA 2DXIA 5AW5A 1U2ZA 3E2PA 3G9TA 3FZYA 1DBPA 1M6EX 5ILQA 2A88A 1F2DA 1UXIA 1BS9A 2OO5C 3A6KA 1J49A 2A9JA 3ZY6A 3ER8A 3A05A 2DFDA 2QUZA 4RELA 5A5GA 2N42A 5BT9A 1DEKA 2P2ZA 4RMIA 2Z3WA 3M83A 4EW3A 1SU7A 1SBYA 4ZGGA 5KQLA 4L7VA 3D7MA 4A36A 3LLVA 1V8DA 1BEZA 2IHZA 4QUDA 4ZT4A 2NZWA 1OVGA 4OYRA 2Y8EA 3ZV3A 4C03A 1ORIA 3CF0A 3Q3VA 3L3BA 4MH0R 3VH4A 4KL8S 5CX1A 1RJ9B 1ECPA 1HZZC 2HRRA 1GARA 3A7DA 3LUKA 5IJ9B 1N5RA 4GMHA 2ODTX 3OTIA 4OMCA 1XXLA 1KP9A 2YV4A 1KU0A 3PD0A 3DYBA 4MV3A 2C5EA 3E0XA 1E0DA 3AU8A 1C3OB 2HYDA 3P9CA 3QEOA 1KY5A 2RAVA 3L7BA 3A2LA 3A4YA 4QKQA 3S7TA 3DEZA 3BWVA 1V6CA 4MEBA 3WSVA 4NZOA 4BRWA 2OORA 1Y3IA 4ZRDA 5AW8A 3CKKA 4AN1A 3VSCA 4BNJA 1O4WA 1A8IA 2ODPA 4FT4A 2I6SA 3A1FA 4R31A 4EPVA 1T4BA 4ZYWA 1GZSA 2IIBA 1J4AA 4A2QA 1V8PA 1CQJA 4NG4A 1B2RA 2CFOA 2FPIB 1P80A 4X62B 3O2JA 1WDKA 1HDCA 1NOIA 4FCTA 5CNJA 2GNPA 4F1JA 3P4YA 4Z8XA 3TOSA 3SOZA 4UHDA 1WMDA 3H2SA 4R71A 3RRXA 1Y7TA 2IYUA 1GEGA 1R6XA 4HGNA 3GMTA 3ETGA 4FUQA 4QFDA 4RTSA 1E2EA 1VL8A 2Z4TA 1SJ9A 4MO9A 3T7EA 5IKEA 2V8BA 5CT9A 4BAGA 2RGYA 2BHTA 5JNRA 4GL2A 3PC4A 2HIHA 5JCJD 1N75A 2WJYA 4LRYA 4QBGB 2GPAA 5LQDA 3VR6D 1HDOA 1L7OA 4OJNA 4AJKA 3TRFA 2YJ5A 3R5JA 3PX7A 5THQA 1M0WA 3NDBB 4XCXA 3ZZNA 2YX1A 1VL1A 4HAVA 1G8HA 2FN4A 1LPMA 2Y4NA 3HB1A 4ZDWA 4PN7A 1MC5A 2FG5A 2W43A 3DLTA 4GXNA 2W6OA 1BXGB 1HM5A 4HCJA 4IJMA 4Q37A 2GHIA 1R8QA 1V41E 2IDMA 1UC8A 1EFTA 1NWHA 4ERNA 1ZK0A 1CCWA 1J8DA 1IATA 1TEHA 4ZIRA 2GK3A 2ZTMA 3IAAA 3EZYA 3PQCA 1JDZA 2BRUC 5D3ZA 1M2VB 4Z0TA 5FNVB 2FZGA 4HEJA 2J07A 4F84A 4Q12A 3C1TA 3WK6A 1KFBB 3ZCUA 5IABA 2C9OA 5LL6P 2DY1A 1WETA 1OMOA 1RAFA 1LPBB 3H5WA 2OFPA 1P0IA 2C29D 1P91A 1SD1A 5DFAA 2IUUA 1XZQA 3UJPA 2A9PA 4RMHA 3DB2A 4JVOA 4KUGA 5EUBA 3NDPA 5JAQA 3T1YB 3DWIA 2V0NA 2EGHA 4HB3A 4J9VA 4EFMA 5TT0A 3OP1A 1RZRA 2XLBA 3LLSA 5A9RA 2OORC 2XXJA 4F06A 4KAJA 3L41A 2QA5A 2XTZA 3BX1A 1DKUA 5MFPA 2XGSA 3U39A 1AKQA 1YHYA 1KQFA 3GCDA 1L5FA 4HNHA 1AMUA 4DHEA 5BN3A 3DO6A 2ZM5A 1TCUA 4JZYA 4ND8A 4PNHA 1V8ZA 2JJ2A 1DMSA 3QU2A 1ZM4A 2FX3A 3GNTA 2PKYX 5K2MA 5JTTA 1Z4QA 5AI6A 3GDFA 3PRYA 1MX5A 2OO7A 2YBDA 3ILXA 4HDKA 2P6UA 4NIMA 4BVGA 1NXSA 3L6EA 5KYUA 4DA9A 1B8PA 3GFTA 1RRMA 1DUIA 2MSDB 3K9BA 3BAZA 4JR0A 1Y7HA 5ALQA 4D0SA 4XB2A 4ZZ3A 1T34A 5FWDA 3HHEA 2FPXA 4AS1A 4PHFA 2HR1A 1YE8A 1BDBA 1R6DA 1JAIA 2CF5A 3MWJA 4H35A 4MYRA 2B30A 3UMVA 2G70A 1BFDA 1KJ9A 4N9QA 1IZZA 1L5QA 3GUZA 3DE2X 4IDPA 1Z8HA 1O1YA 5I9IA 1EX9A 3N1UA 3U7JA 3LVFO 2PL3A 4QARA 3HACA 1SCJA 3WIUA 4CKEB 4R1LA 3ZLJA 2HRZA 5I7AA 5A6VA 3IHWA 4PXYA 3BXEA 3ZTTA 3ENVA 1KEWA 3H84A 1E5XA 1Y8QA 3NVKI 3ICCA 5LUBA 2HV8A 3EVEA 3ZNQA 1XRJA 3BE6A 1VPLA 4ENWA 2BN4A 4OP1A 2LTAA 2O5VA 4ONEA 4JQOA 2VHCA 3UYKA 2P40A 4D0RA 4K81B 4NFLA 1XU4A 1LY1A 3JQEA 3R3ZA 1MU0A 1UQTA 1VPDA 1IU9A 2MSNA 3KK0A 4LY0A 3VR6H 4CM8A 2QB5A 4OTZA 1CP3A 1W93A 3KR0A 4JN6B 4IPTA 3HCRA 3GH1A 2VRCA 3JVUA 2JW5A 1BH6A 2WTXA 3QKSB 1Y5NA 1L1EA 4QT4A 3PG5A 3HNPA 4D9IA 2ODBA 2V0CA 3PDCA 1BYUA 4U0KA 3SGLA 2DOKA 3U4CA 1QS0A 1BNCA 1PL7A 1X8KA 3EIFA 4HDNB 4M0CA 4MV9A 2CMFA 4YIHA 1K0UA 2PBFA 4UBOA 4RKWA 5IT4A 3RRNA 4Z4EA 1MCZA 4PY2A 4X7MA 3SJBA 4JB8A 2IHYA 4LWOA 3T15A 5G0WA 5TB5A 2LUOA 3G1UA 3SS7X 3BHJA 3OAAD 2QJFA 4PQFA 1EQ2A 2BELA 1P0CA 1KYQA 1TVEA 2IU4A 2ONKA 2WSMA 2HSDA 4G4GA 3LBYA 3H0EA 4LDAA 4NZ9A 1IOVA 1SHJA 3CA8A 4D7AA 4ETMA 1X92A 4IVRA 1WEKA 4J0FA 4XVCA 3FOFC 4WK6A 2UZ4A 5FBZA 2VJDA 4QPDA 4NR0A 4CIWA 4Q9HA 2IT1A 2X4GA 4XCQA 1N7IA 1QKIA 2ZDGA 2XDQB 4TTRA 4V0KA 3S4YA 1GXSB 1RP7A 4D9HA 3DCIA 4GU5A 3ZHCA 3F73A 1SWVA 3P4UA 4GMDA 4M0LA 2PMDA 3AO0B 3ILVA 1KRHA 4FJ1A 3B7GA 5EMNA 3SIXA 3ED5A 3VR2D 1G64A 4Q7JB 3LQRA 1AV6A 3QKTA 1KO5A 2PUJA 3AEKB 4KKXB 3F3MA 1E77A 3OURA 2R6ZA 4BWFB 1G1AA 4V39A 1QFYA 4Q3BA 5LA6A 3RRZA 5AWFC 3V46A 5KNDH 2BTEA 4JBWA 1J5XA 2YWHA 2HSWA 4MVCA 2JLSA 2GAAA 1P5ZB 1QBKC 2P11A 5I45A 1P9RA 1VJRA 4X9XA 1U0RA 5AFSA 1Z8DA 4FHCA 4LMBA 2ZQ5A 3BXZA 5JWRA 5CM8B 3VU9B 2C1XA 4WD3A 4JUBA 2Q7OE 2I2FA 2X7XA 3RV3A 1E2UA 4QDTA 4D9NA 2NUTA 121PA 3A4TA 3VYWA 4UMFA 1QIIA 3AM3A 2C83A 3HS3A 4DIUA 2YDYA 1TFRA 2OCBA 3KWMA 1ULSA 2OK8A 1FTWA 1N0VC 4J2TA 3V8PA 4V0QA 5AVTA 1HDIA 3WGHA 3PIDA 1B8UA 2FFQA 4YUVA 4A1OA 3D3KA 3OTOB 1YB5A 1FDRA 2C4KA 5HSGA 2QRQA 4NYJQ 3LXMA 3M4JA 3H13A 4TTPA 4GX2A 4CKZA 5CIYA 3AH8A 1HEIA 3ZVNA 4DS3A 3DV9A 4R1MA 3TECE 1J2UA 4BCCA 1ZONA 4FPXA 1XTUA 4WFKA 4E5SA 1WHTA 1BMFA 4WBNB 1OTXA 1ANKA 2G67A 3A1UA 3JZFA 3LWNA 4HMQA 4R0VA 5JS8A 5CX4A 1IULA 2L69A 1ZD1A 3FB4A 3EGDA 3U40A 1FJ2A 5KREA 4NE9A 3TGLA 1THGA 1S2MA 2REBA 4A10A 5I4CA 1OX4B 1NR7A 1T24A 1TTQB 3AR9A 4FDAA 3WLFA 3PTAA 3SX2A 2P3SA 4ZU1X 1QONA 1WD7A 4LOHA 5DK6A 3N5CA 2B21A 3BL6A 3DOFA 3PUJA 4MW7A 4GXRA 4MS4A 3CLRD 5CIWA 3NHSA 1CJUC 3QENA 5I6DA 4KPEC 3P52A 4J1TC 4IDHA 3EEFA 2VQ3A 2X2OA 4LUCA 4OQPA 1BKYA 2GX6A 1W2WB 4ZCRA 2VHQA 4NCXA 3B3QA 1YMQA 4Y2GA 3WWZA 4IDOA 3JATB 4WGGA 4J49A 4E6PA 5CJ2A 2GS9A 3RBVA 3O4GA 4Z0PA 2Y9MB 4QGHA 3PR3A 5FPYA 1OB2A 5KTTA 5I51A 5DGCA 4KPFC 5KQPA 3WGZA 3GZNA 1A3CA 1U8YA 4LN1A 3WHPA 2CMHA 2AHOA 3FMVA 1IY1A 1JDSA 2FI1A 3O83A 3QJ5A 1Y4DE 4BJ1A 2JCSA 3UBTA 2HHHB 3FTPA 3PUKA 4F8JA 4UEOA 1YUBA 2LBPA 5KAMA 1LUAA 3RYCA 1BQ4A 5GY7A 3D7KA 3GPBA 2WSSA 2ATIA 4JYMA 5DULA 4TPKA 4YMIA 1MB2A 3N8KA 1MVLA 3O2QB 4I3FA 5CBPA 3NJRA 4MCHA 4GUDA 1SPBS 1ESCA 2J5BA 4J43A 4RHEA 3HO8A 1ICIA 4NCHA 2C4VA 3H1FA 1DG3A 3FNFA 1TKBA 3H1AA 2O8BB 2UYGA 4PO1A 1H2XA 2GAIA 4YT5A 1OWLA 1COWA 1T36B 3PQDA 1T6NA 3C3EA 2A0FA 4RVDA 1TNDA 5E6RA 3TVDA 2I33A 4FDVA 4IJWA 1CUGA 3GPLA 3DPUA 4RCVA 5FEUA 4K3UA 1KMNA 2BEVB 3LYHA 2IZZA 4OUDA 2PGLA 1DSSG 2YVAA 2ZSIA 4J7CA 5DX1A 4CF7A 1EM8A 4KQ1A 1ZCJA 3RHFA 4BFUA 3CUUA 3DMRA 2O19A 3EZNA 4IUBS 2VWPA 3TR5A 1A77A 5I9MA 3G13A 5TDHA 4MICA 5REQB 1VSTA 3CH6A 1KK2A 3EFBA 2EYUA 2ZW9A 1ENPA 2I78A 4PV7A 4YGYA 1T2AA 2HK6A 1SZJG 5IC5A 1SC6A 5L7TA 3F9IA 3W8FA 2VPXA 4QX6A 1DUSA 1EH5A 3KYCB 2WUDA 2C7OA 4WXMA 1YDGA 2OV3A 3INRA 4W5JA 3N87A 3WXBA 2HRQA 4BX8A 4WQMA 5FUWA 1U2SA 3JSAA 4K28A 4MO2A 3N8IA 4YRDA 3NONA 3UMSA 2GM4A 2CNWA 3BT7A 3I8SA 3ROMA 4WBXC 1XRRA 3OTWA 4FR5A 5CYPA 2H59A 3INNA 4NBLA 3AVYA 1LZLA 1XMJA 3MCWA 3MTBA 3PCRB 1UBUS 4FNGA 4K6HA 1WD5A 2ACVA 4L8YA 4MVJM 4XGRA 4YA6A 4C5BA 1AGRA 2IYYA 2Z6VA 1R5BA 4C4XA 4LY3A 3VSEA 5EKXA 2B1JA 3T3DA 2BKLA 4YAUA 3SBOA 4UATA 4NCJA 4BNFA 1Z4MA 3L7IA 3RS9A 2E4WA 1YS2X 2NVUB 3RIXA 5J4HA 2X0NA 3CB4A 5DMXA 3LG2A 1GNTA 2NQTA 3I30X 1NLUA 3WRVA 3NTOA 1QP7A 2UZAA 5U4XA 5KKNB 2HHJA 4I7EA 4UDXX 3I1FA 1UKBA 1MAHA 3QTLA 4GM1A 2IXFA 2ZBPA 4JT4A 4CCSA 2BI7A 3GB9A 3JQCA 4Q6WA 2AMLA 4D5GA 2PUBA 3V00A 2JLCA 3JAWB 1YZNA 3GJQA 1L8XA 3FWYA 1XAJA 3TNFA 2IYEA 5B58C 5T8KA 4QREA 1KQPA 1ZINA 2BM9A 2PU5A 4GVXA 1M2GA 1SU6A 3TMYA 1G7SA 1NBWB 2CLFB 1KHTA 3L6BA 2WHYA 3AVQA 4KX3A 3OI7A 2HY7A 2Q1YA 1QORA 4OMFG 1IRIA 3NHAA 2YNMD 4RTPA 2VQEB 2DGDA 1VI6A 3KFVA 3RF7A 4WKNA 4O2BF 2Q5QA 1T9BA 4H31A 1ICEA 1CVRA 3BKXA 1ZHOA 3STVA 2GZMA 2AFIA 4L9AA 3T3PB 3COWA 5TARA 4X84A 1DIRA 3ET4A 4KQMA 4D42A 4O4IA 4OHKA 3B1KA 3H4MA 1WL8A 1WUTA 3BULA 4TKVB 4EG5A 1K9VF 5CGZA 5JSUA 1R7RA 3QPDA 2P2LA 4INJA 2NO9A 2ONJA 1GQYA 4J0KA 3F98A 3L4KA 3MWEA 2J30A 2W4QA 2CYBA 2C58A 3KHSA 4MW6A 1QM5A 4J91A 1RE0A 3KSDO 4LZWA 5ALXA 1VPTA 3NP7A 4HNQA 4DR5B 1Q0TA 4Q4LA 1L4GA 1F4VA 1PGQA 1U98A 4B4DA 2HN9A 1O94D 4XTCS 4H0NA 4YNBA 1FUYB 4YGXB 421PA 3E8SA 1K08A 2D7DA 3FLAA 1H23A 2RBGA 1ADGA 1X8LA 4M9RA 3VTKA 4YJ3B 1CDEA 3NC1C 3PDJA 2ORED 2J46A 3LQ4A 4UBJA 4JBLA 4X85A 4X3CA 3X43A 4P4TA 2ZVJA 1IK6A 4FM9A 5IMBA 2Q9AA 1DAOA 3MAGA 3N2EA 3KTAB 3QLTA 4J0IA 4LCEA 4HVTA 2JIRA 2HL6A 2W0MA 5P8WA 1LBSA 2BBOA 3N28A 1QHEA 4Q4DA 5DB4A 4ON9A 3IQEA 3DBOB 4MVJP 2VYFA 2GRAA 4RD4A 5HF8A 1Z37A 3GLSA 3PLRA 4GEKA 3RS7A 4KNYA 1TUEA 3WGOA 2CKMA 3SZRA 1JXAA 4YCSA 2H2FA 4C4OA 5B36A 4Q3AA 4CMGA 3DUWA 3C3CA 3SR0A 1COZA 2O8EA 2C20A 2XVMA 4NJEA 4PGHA 1QCYA 2FSVA 1G7TA 4RF3A 5IEBA 1DAEA 3N7UA 4RKEA 3J81k 3H1TA 4GRIA 3D6NB 2GPWA 2WILA 3OE1A 5CNIA 3DKKA 2RBKA 1YWGO 1XCGB 4UREA 2O5RA 3OOEA 4HB4A 2V7GA 2G4LA 3M3DA 2JZNA 3OT5A 1CUDA 4MQ6A 5SYMA 1JTFA 2X8LA 1WVMA 1MEEA 1ABEA 1ZVJA 5KDLA 3SC2B 1BA2A 5DF1A 4BO1A 4ENSA 4KR6A 1H5QA 3NPMA 4TMYA 1OWNA 5ELMA 5I7FA 5B4UA 1T4DA 2QW0X 3N07A 1ZN2A 2O2EA 4R84A 4E7OA 4RL6A 1QFMA 4EPYA 4TMKA 5TQ0B 2XECA 3GLFA 3X1DA 3IOCA 2PRSA 4EABA 2G9RA 1KDZA 1QNFA 1T2CA 4CIAA 4PX2A 4EKEA 1EVJA 1IRXA 3PJDA 4YAEA 1N3BA 3IS3A 3W5UA 2ZUSA 3NEAA 3IKJA 2GOYA 1H2YA 3RJ5A 4LYHA 2OCDA 3E7XA 4YP9A 1GZHB 1Y5LA 4K87A 4R8VA 1MH9A 2RAUA 2ALJA 3LIIA 4L73A 1O6FA 4EDHA 5F77A 1ODFA 3MCVA 3MGGA 3JZDA 1POWA 2JIZA 1IBSA 3MSCA 4E4YA 2H16A 3JQ6A 2IQ5A 4J4TA 3AIKA 1IHYA 4O2LA 4QHSA 5B4TA 1DRWA 4EJ2A 2FWMX 5CVUA 1AS0A 4K03A 4CQJA 1PT6A 2V4ZA 4H59A 1IZ8A 2NYUA 2V6BA 5JO0A 2FE1A 4BZWA 2OV6A 3MD9A 3OZGA 4HFNA 1WUJS 4Y6GB 3L43A 1E98A 3D3WA 3ZNPA 4I55A 5CD9A 5CLLA 2XNHA 4E5DA 1WXXA 1AO3A 4BX2A 1RWMA 4LOLA 5JD4A 3ILHA 1YQGA 4KRGA 5LLTA 3OPMA 1XV5A 1UADA 2OTCA 3G9XA 1ZQ9A 2OD7A 4YMUA 2D3TA 4ZYLA 1N4DA 2H7YA 2YFHA 3LT5A 5LUAA 3P0JA 4ARVA 3AY6A 1ISJA 1H8HD 1RXVA 1DOZA 3H3XA 2FRVA 5SZHB 3TXXA 5EE3A 2JIQA 1GN8A 2VUUA 5DEIA 1GRCA 1L4KA 4GD3Q 5CK5A 4PBTA 1SC1A 3CLTD 4O4LA 2ZCVA 2CEKA 3UHPA 4KWIA 2PL5A 3PKJA 1BC5A 1RHQA 4D9GA 4ENRA 3RAEC 4WXYB 1K6MA 2RAFA 3BBLA 3HMQA 3OZWA 1OAOA 1WLYA 5A5DA 1Z29A 1XNJA 4ZCPA 1LTHR 1FY2A 2X7JA 3JRWA 3UGJA 3FMPB 1T6XA 2ZJ4A 3BZWA 5LXTA 3FDZB 1J0EA 3DFZA 3K9LA 1WV1A 2HMVA 4GP6A 2ZSAA 3MT0A 4PIVA 4G9EA 5IX8A 3A28A 4JBGA 2OILA 4UE2A 1PNOA 4WLFA 3CLKA 3D6AA 2GB4A 1BD4A 2FMXA 1G18A 1MT0A 1AF4A 2IYSA 1DC6A 3KOYA 4QO8A 4DM7A 3LLCA 1X77A 5A6SA 5JZVA 4FYMA 5HEKA 1XD9A 2R6JA 3NHKA 2IBMA 3F6CA 3PHBE 2NPIA 3GDHA 1B16A 2FAXA 2QDXA 4INAA 5FBKA 3UICA 3AF6A 5T5QA 2IBTA 5D01A 5JH7F 1N1MA 4AN4A 2AG5A 1DV1A 5TMBA 4DR7B 4L6IA 4PG4A 2J0QA 2XOEA 2ETVA 2V98A 5BP7A 3FPSA 1K97A 3AETA 3M6UA 3MUFA 1SXPA 4XFKA 3RWOA 3GO4A 4XWOA 2F9FA 2NZUG 1TUBB 2HMWA 2IOFK 2QKYA 4CKCA 3WMWA 5LZ9A 3FKSA 2EF1A 3DJFA 2H2HA 3DKPA 1U0FA 4W9NC 1YS4A 3AHCA 3CKLA 3K0EA 4WAUA 3DZCA 2R60A 4GKJB 3NG1A 1ZOPA 3K09C 2CLCX 2Z30A 2IYVA 4LXHA 4ZPXA 5ALYA 5TMDA 4NXNB 5IJWA 1Q92A 2RHRA 3CRRA 3Q6NA 3H3JA 3AY0A 2V55B 1EP9A 1N8KA 4QVIA 4ETWA 4L5BA 1NUSA 4AUKA 1T3SA 3O91A 2O2CA 3GIWA 1UQRA 1OASA 1N9ZA 4MQUA 3PVZA 3TNJA 5E8RA 3AUSA 1FUUA 1VE7A 1YQWA 4YR9A 1O6CA 1A5SB 4FWTA 1XP8A 3NRCA 1AKNA 1JEAA 1JI0A 5DASA 5FTKA 1IY0A 3I58A 1T36A 4JEHA 3DFIA 3BSFA 4KPYA 2I4IA 3EQ6A 1SUCA 1SVLA 4TZTA 5GTDA 1WXFA 4AKEA 3HCOA 5J5AA 1XN4A 3AUUA 1N25A 3O0TA 1U7DA 3NNNA 2OY0A 1X1EA 4IJVA 2WMOB 4OHWA 3FGPA 1X13A 1U3GA 1YCFA 3GZ4A 1N6RA 4QO7A 5BV8A 5LZ7A 3HVRA 3C24A 4XUEA 5I9BA 1IXRC 2ZYGA 2VHVA 2PMWB 1E9SA 4F5DA 2R0QC 3COPA 5D84A 1PEKE 2CBGA 3RWMB 5CLGA 1BXKA 3KVRA 1XVTA 1YZQA 2PNJA 3PT9A 2JH9A 1P81A 2F9MA 3C8ZA 3HFGA 3CTPA 3E70C 4PCVA 4HQKA 4IG4A 4JP1A 4KIFA 1X7ZA 1N9GA 3MMNA 1RHUA 3W6PA 3C1AA 2GR9A 4AUMA 4GDFA 4HXYA 1W5BA 4AX4A 2XEXA 1NC3A 4NCIA 4KQ6A 1CY8A 5JCOC 2F4VB 1EGVB 2I76A 1NQWA 3MD0A 1X38A 2QG6A 5GPBA 1B8VA 1PR6A 5KYXB 1R9MA 3DMTA 4XM2A 2QTCA 5LYJA 1GV0A 3HDTA 2CD9A 3LA8A 2PV7A 3NOQA 3QUTA 4MA0A 4LMRA 4MARA 4WNYA 4D9JA 1BJRE 3W6ZA 5AUNB 1Z5UA 2YJ4A 2VSQA 1O5OA 1U31A 2A92A 3KR2A 3MTAA 4TLEA 4ZC8A 5I7UA 1MAAA 1U5BB 1YS1X 3QMVA 4K9NA 5E6RB 4HUTA 1GSHA 3K70B 2CBZA 2FWBA 1IHXA 5EWMB 1VRWA 4EG0A 4PE5B 4N40A 3RYIB 2BMDA 1DX6A 2ZIGA 4S1PA 4ZJUA 1X9HA 3WP1B 2QROA 3WLSA 2FWPA 2XYGA 4D9FA 3ULKA 4KO1S 2X6QA 4XZ3A 3U13A 5GV8A 3Q8MA 4LX0A 1JDJA 5AUPB 3HKCB 4QPPA 2BSAA 1C4OA 4P81A 3WL6A 2VVTA 3CT6A 4MGIR 4KSCA 1XLTA 4LK3A 2X0DA 4IGAA 1JQBA 4YRIA 3FGOA 1ZJ5A 1SKUA 2O3RA 4TT8A 2Q2QA 1CR1A 1M34E 4ASUA 1MXHA 3JW8A 3QPUA 4BKMA 5JAPA 3A3YA 1O0CA 3ZD7A 4P7FA 1HH4A 4HZIA 1A95A 2GZ3A 2XMCA 3MUEA 1FPMA 3SIPA 3QG5A 4O4IF 4M8SA 2A1UA 5KOHA 2VHXA 1XAGA 2WTNA 3QEAZ 5BXYA 4OQXA 4YT4A 1Y6ZA 2I62A 1NLZA 1PFWA 2B4QA 4Q4JB 4RXTA 3DL2A 2P2SA 3EWSA 3PNSA 4OXKA 1K8YB 2FPPA 4R2JA 1FSSA 3AKZA 2AG6A 4Y1EA 2W2LA 4BGUA 3LPNA 3KQLA 3PA6A 5GONA 1G6HA 4CIDA 3GUYA 1DINA 4M1WA 4CHTA 5J43A 4UU1A 5K0FA 4OBBA 1Q1BA 2Q6TA 4M88A 2JGNA 4HBGA 3ES9A 1UUFA 1VB3A 1XRQA 2A58A 3IPLA 1U9YA 2P7HA 4XIGS 4AJEA 4US0R 4PINA 4RKQA 2Z9CA 5D1NA 3AESB 4FINA 2B25A 2Q1XA 4TKLA 1H94A 5FWYB 4YLGA 1TJ4A 4YWHA 2V3CC 4G0XA 2I8AA 4M1MA 3DVAB 1BDHA 2YOHA 1IVNA 4UU7A 4BX0A 3FA2A 3MRTA 1M74A 3KV1A 2VCEA 2PFKA 2RHBA 3LUPA 5AKHA 3TQRA 3ZHYA 1D7OA 5JDIA 2P4SA 4D9MA 3FDIA 3WKCA 4RANA 2C5HA 4JC4A 1L5LA 3H5NA 3K31A 4U2BA 3IUMA 3IERA 1L7VC 2CVHA 4GZ5A 4CEJB 1DKRA 1GZ7A 2P90A 2YCLA 4MTCA 4RE6A 2P9JA 2VRNA 3FDXA 2JGAA 2MU1A 1N7GA 4TV9F 2UVQA 1KZHA 3N6RA 4EYSA 5JRJA 1FUEA 1FK8A 3LBHA 1JHAA 1F7UA 1AIPA 4LIPD 1F0KA 3VDQA 5I9NA 3IPYA 4IKEA 4YRAA 3HU1A 3PPIA 4AZWA 3QE2A 3DEYX 1DCFA 3DHYA 4QT0A 1OHHA 4HDMA 3VHXB 1AHNA 4X7RA 4JP8A 1OROA 1PR2A 1SA0B 2WFAA 1GQQA 4HD8A 4L5CA 1FSGA 4AY5A 4EYQA 3REQB 1JB1A 2IPLA 1UJNA 5AIBA 2FEXA 1R1DA 1UMDB 2I22A 4P8RA 1M8KA 4ND2A 4U9IS 2NSJA 1XX6A 1Z0UA 3NV9A 1R8XA 5HMMA 4ZEXA 4KRFA 1JRLA 1JMKC 2V7TA 1LCIA 1CLUA 3AL3A 2YYYA 3OZSA 1E0KA 3LRXA 2GF0A 2X86A 4J94A 2QMEA 4PZUA 4QWWA 4XM0A 4DNPA 1BQEA 4RZXA 5I8PA 1SKQA 1TDJA 3VU1A 1T2DA 2W2NA 3OMXA 4DXAA 1LFDB 5B6IA 3WIEA 1AV7A 5DN6D 4LZAA 4EZIA 1VTKA 2BEWA 1IQRA 4ER7A 3AR4A 1GLGA 5CDYA 2J6CA 2DVMA 3HI6A 1TD9A 1ACJA 2BFDB 2EW1A 2ZRBA 3HBMA 4Q01A 4UXJA 3VSAA 1XNGA 1CZKA 2WIKA 3KEQA 5KNCD 5MN4A 1RQPA 2JIMA 3KWJA 1BWPA 1VKNA 1VBFA 4XIFA 3D2AA 5AVRA 5TNXA 1H5NA 1NWCA 1UP4A 2H4XA 4BBJA 3WGLA 3SN6A 4FIZA 4KAXA 3THXB 1YHNA 3TD9A 5AM0A 1A9ZA 1KJWA 2AF3C 4R40A 5FAKA 1YU6A 2GJSA 2WNIA 1U11A 1USKA 3H8WA 4FFVA 3UUFA 4AF6A 4MMYB 1ISFA 1OV4A 5KYWA 1WUHS 2C54A 4PTLA 3EZLA 4JA2A 1VM6A 5A3VA 2C8JA 4RX1A 1CVLA 1YRAA 2HCTA 5FADA 2PXCA 2EJUA 5GIPE 3FTFA 2OXRA 4LJ5A 4NNOA 1BVUA 5ALGA 5C3UA 3UEOA 5KYTA 1BAPA 2Q0XA 3CNOA 4BJ3A 3R40A 1ZNWA 2ZB8A 1HDZA 1RQXA 1I7NA 3WLMA 1RI3A 2VJQA 4WPGA 4X1YA 2PUDA 2YNMA 4DBVO 3SKYA 3ZE6A 4EDFA 4DV6B 4HY3A 4AJ4A 1QP0A 4YBZA 3T5GA 3OQJA 3TEJA 4IEFB 4GF5A 1X94A 3OM1A 1V48A 5L4SA 1NG9A 3DLBA 2PZLA 2X8WA 3KJFA 3SCZA 1TRKA 3VKVA 2O0KA 4DYVA 2HJRA 1I9CA 2B99A 3REOA 2ID9A 5K3SA 2GMWA 3NCHA 1S9HA 1IVSA 5CA1A 1IEXA 4MUMA 4G6ZA 2I03A 3FSJX 1R10A 2LXNA 4RQBA 2GHRA 4AZ0A 4RZQA 3ZHRA 2BHLA 5EJFA 2WRZA 1R8JA 2HA7A 4QXRA 1JHRA 1P75A 1ZVVA 1XCJA 2PLNA 2AK3A 2C77A 2XGOA 4KZPA 1E6EA 3T38A 1XEFA 2JFGA 3WGYA 3WZLA 2YHIB 4YPFA 3O9MA 1N4AA 2HPHA 3D6FA 1IXYA 1SCAA 3IXQA 1KSFX 5T64A 5JZOA 3L8FA 2ZRNA 2O3JA 1JR4A 2WHQA 5C9ZA 4KXVA 1B6GA 1ZL2A 3JX9A 4LCJA 5F4BA 3GEEA 3L4BA 3M1LA 2P9QA 1M10A 4QTTB 3TPZA 2JJYA 2X6TA 3D9QX 4W8GA 4F8YA 2QTFA 4C22A 1BOFA 3AI3A 5F23A 4EUFA 1PRYA 1PEDA 1ZEMA 1IN1A 4ILKA 2OGWA 2JGLA 4CV0A 4JI1B 2OHVA 1QWOA 2F7SA 2JVJA 4RTRA 4EHIA 3AI2A 4EHFA 5HP4A 2H4ZA 5AQEA 4FYPA 1UODA 4GWLA 3PXGA 4IHAA 1DLJA 1OZAA 3PNMA 4YJ2B 1H2ZA 5KTSA 2H8KA 4PWYA 5JC1A 4JYBA 1J39A 1L5VA 3MW8A 4LRXA 4Z9AA 3ZU4A 1P5FA 3QLUC 1NN1A 3CEJA 3DDOA 4A2PA 4AF8A 4D92A 5K8TA 5LQNA 4DLYA 4QDUA 5JS2A 1EWQA 5AW4A 4Q9NA 3GJTA 2QL6A 4CIBA 1X2BA 5KU7A 3OESA 2HA5A 2QSYA 4FS8A 4OI2A 4QD3A 2YZGA 4B0OA 3PJFA 4A5SA 1W4AA 3VTFA 3BTOA 1TX4B 4OBEA 2QE7D 3GW8A 2I29A 4RY0A 1O3YA 5JJIA 1NE7A 3N0WA 1W4CA 5EJ4A 4NMWA 3ESXA 1ZM2A 1T8WA 4JP2A 4YECA 1M1YA 1TU3A