4GZLA

Crystal structure of rac1 q61l mutant
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
175
structure length
173
Chain Sequence
b'AIKCVVVGDGAVGKTCLLISYTTNAFPGYIPTVFDNYSANVMVDKPVNLGLWDTAGLEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related C3 botulinum toxin substrate 1
publication title RAC1P29S is a spontaneously activating cancer-associated GTPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 57
structure length 173
sequence length 175
chains with identical sequence B
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gzlA00
5DLQC 3P27A 4Z1MA 3BH7A 3I4LA 1L4UA 3QVUA 2J7PD 4AYWA 4PPFA 2D2FA 2IYYA 2QRZA 4PO8A 3FKSD 1OW3B 1OF1A 2C9OA 2I1QA 2ZR7A 1XTSA 2XZLA 2OT3B 4N0DA 3L8YA 4OL0A 2IYQA 4C0JA 4LHXA 2J3EA 4PO1A 2AN9A 3T15A 4PX9A 1QZXA 1IJFA 3RC8A 2ZU6A 4EUNA 1G6HA 2IS4A 1TQDA 2QI9C 2NMVA 2BKUA 3TNFA 2D7DA 1II0A 1FW6A 5JI3E 4CW7A 1JNYA 4CT4B 1JPNA 3K0CC 3SFVA 2CE2X 521PA 4KI0A 3QF7A 3K9GA 1KDRA 3CBQA 5G41A 3B13B 1ZD1A 4LI0A 3K70C 1OH7A 1SXJB 2I1VB 2QPAA 2ZSEA 3DM9B 5CM9C 4F92B 1T6NA 3RLFA 5B58C 1JJ7A 1RRFA 3V4RA 2XTZA 4V0LA 4EPXA 1YVDA 3H0KA 2QSYA 2V55B 4KSBA 4DZZA 4IJMA 1LTQA 3W6PA 5CLQA 1Z6GA 3RWMB 4GT1A 2FWRA 3A1TA 4URWR 3T5GA 2XTMA 1RRPA 1YR9A 4BE7B 1KK1A 1VCIA 3H4MA 4Q48A 2GXQA 5BYKA 3SC3A 4FCVA 4DVGA 4B74A 4ZKDA 3TAUA 4CGZA 1P9WA 1KI6A 2C2HA 2R62A 1Z3IX 2ZUDA 4Q4AB 3T61A 3WYAA 4YLGA 1UF9A 1ZC4A 2MSDB 1X3SA 5DISB 3W8NA 4B2IA 1RPZA 1ONBA 1VTKA 4MUAA 5FOXA 3VX4A 2LCFA 1N0WA 1ZM7A 4Q1CA 3ETLA 3UWOA 3KJIA 4A2QA 1NMZA 1T9HA 1JB1A 5JZVA 2OFXA 5FBWB 1EGAA 4MYHA 3I61A 3GLIE 4URUR 4WZ6A 4M8NE 1IN7A 1NP6A 2GESA 3R7WA 1NBMD 5FTJA 2XZPA 5L3QB 1HT1E 1WF3A 1IQPA 1ESMA 4S2EA 4RD2A 4DT1A 1L7VC 2UKDA 4TTRA 3EC1A 4D26A 4PSKA 1JBKA 2VP0A 2PLFA 1KOFA 1Z0IA 4HAXA 3FGNA 3LNCA 2Z5FA 2AD5A 3DZ8A 1E2LA 3D31A 1VG0B 4WAUA 1XWIA 4BZQA 1X6VA 5KU1A 4LJ5A 2RMKA 2FJUA 1E9SA 4TT3A 3G82C 2ERXA 1KGDA 1QHGA 2ODEA 1RRCA 4ZDIA 2GEVA 2GTPA 2HJGA 3EAQA 4UNSA 4AC9A 2RCNA 4ZIRA 3FVQA 3QG5A 1Z5ZA 3DVLA 4MKGA 3GFPA 4ASUD 4XWOA 2YWEA 2ODNA 2Q3FA 1Z28A 1Z0DA 4HDCA 4KU4A 2FSGA 1N6HA 3RSLA 2CLDX 6Q21A 1FTSA 1FZQA 3WP0A 2ZXUA 3EIQA 3W9YA 2AD1A 2ZE6A 1EFCA 3TR0A 4M9SA 3U6BA 5DO9A 3IHWA 5JJIA 1XCPA 1Q22A 4PC3A 4M9QA 1TAGA 1OFUX 4POAA 1YZGA 3GJ7A 2EFEB 4LHZA 3X1YA 1MO3A 1N2CE 3UG6A 2ZEJA 2QU8A 3WNBA 4OHYA 1IM2A 4N1AA 4EJSC 2ZVPX 2OCYC 4A2PA 2WZQA 4Q00A 4E5UA 5KYKA 2GCOA 2XB4A 2VF7A 3HR8A 3MCAA 3RWOA 1YKSA 2NIPA 1CRQA 1KJYA 2RHDA 3DOFA 3Q5EA 1GKIA 3KQNA 4TZ0A 1UJ2A 3PCRB 4IOKA 4RFVA 1Z6TA 3VMFA 2BJWA 2EWVA 3KQLA 2WWHA 2OBLA 3GLHE 2WJGA 4QNMA 4PSAA 2O8DA 2QP9X 2EQBA 2AR7A 4TYPA 2ZIAA 3WMGA 2WBLC 4JMPA 3RDPA 4M9ZA 1KI6B 4C4PA 4JT2A 2IYWA 4W5HA 2F1JA 1E9FA 5HE8A 4Q4HA 2BVNA 2XNSA 2CLCX 4RZXA 2J59A 4NDZA 5CLLA 5AWFC 2ZETA 1GNPA 1NRJB 2IF0A 4LC1A 5FTMA 2QP3A 4IDOA 4KLNA 2REXB 1H65A 2WJVA 5HPYB 1HQCA 2RGEA 2HLDD 1GOTA 2NPIA 2PMKA 1AJEA 1DADA 1FUUA 3EZ9A 3R7WB 4ZI2A 5EUMA 4DEYA 2KWIA 1UKYA 2UZ3A 4RCYA 3T06B 3WYGA 5FBLB 1KO1A 1FMJA 4LY6A 3CPHA 1E99A 2RGCA 3IO5A 3W3AA 2R6AA 4BFYA 2R6CA 2B8WA 4UQOA 1XXHE 2ONKA 1XF9A 5HE9A 2RGNC 1U9IA 4GRAA 1DO2A 4QBIA 4GBMA 1AKYA 1KY2A 2XJ4A 1E2FA 2V8OA 5G3ZA 4ZIRB 1IOZA 1WQ1R 2QG6A 2GNOA 3EZ2A 3QJYA 4BFUA 3V00A 3LBHA 1U8YA 3K09A 4URYR 3ZIAD 1XU4A 1G8HA 3U6KA 2HUPA 4MGIR 4HDOB 2GF0A 3GEEA 3RABA 4MDEA 3R9XA 2HDNB 2W6JA 4NKRA 4NBSA 3IHLA 2ZSFA 4LOAA 5E7IA 5DIFA 1YJ5A 1JR3E 1QBKC 2IYVA 3SFZA 3T12A 3BJIC 3MRSA 1NSTA 2JDIA 2GK7A 2ZI5A 1KNQA 3U3KA 2G77B 1UAAA 3NDPA 1M6NA 4IDPA 3BGWA 2AL7A 2DPXA 4Q7KA 4A0FA 1BS1A 1GNRA 1OH5A 2Q3HA 3QKUA 2JJ1A 2QMEA 1I4DD 1UFQA 2O8CA 1SZPA 5E95A 4Y0AA 5A0FA 4A9AA 1CKEA 4I4LA 4MYUA 2CVFA 3TR5A 4URZR 2ZR9A 3FDIA 2XXAA 4LRWA 4YMWA 2OAQ1 5DHFA 3CUEF 3I62A 4X8LA 4OHVA 3ADDA 4C9BA 4OK3A 5IF9A 1S3GA 3PEVA 2O8DB 1TPZA 3T35A 4HZUB 3RRZA 1R10A 2IX3A 4MDFA 1WA5A 2FZLA 5G53C 1RJ9A 3VTKA 4CDGA 3LAWA 1N25A 1DAGA 2CL7X 4BFVA 2F7SA 1GDDA 2PL3A 3FYHA 1MO4A 3W5JA 3MUFA 4JVLA 1W46A 5FTNA 3Q7QA 1E2IA 5HZKA 2IBMA 1ESNA 1JECA 2XOKA 3L8ZA 4TL9A 3KTAA 2J45A 3KFXA 1JEEA 5CM8B 1R8SA 4HLDA 5GVRA 4CYMA 3IKJA 2WJHA 2WWWA 2IXEA 2CJWB 3KKMA 3AF1A 2Q3MA 4JVNA 3ZD7A 3ICQB 3K0SA 1OIXA 2A78A 4OHZA 5L3SA 4CEHA 2BEKA 3KX2A 3BXZA 5CIQA 4M53A 1P9RA 1QF9A 3DM5A 1D2EA 4LJ4A 5GVSA 3TLXA 2O8FB 5KTYA 1LF0A 2L0XA 2ZRPA 1MABA 4D0LB 3TIFA 1QVAA 3V9PA 2OCPA 2CCGA 4G5SA 1WRBA 4V0NA 2ZSAA 1DAFA 3MGCA 3RS3A 2IC5A 2BBTA 4MA4A 3RHFA 4A8JC 1A2KC 2BM0A 3QG1A 4K8OA 4G5QA 1EXMA 5LBIA 2V1XA 1WB9A 5DI3A 1TQ4A 2GAAA 4XSGA 4Q03A 2BKEA 2VH5R 4XVQA 3WXMA 2ZREA 2VQSA 4WVFA 4ITRC 2CEAA 4UNNA 3EZFA 1YZNA 2ZYTX 3TW4A 3FHCB 4D4JA 3T1QA 4F4CA 5H8WA 2H7VA 2BMFA 4Q47A 1NVXQ 3K0EA 5BN5A 3MJRA 3TKLA 4PAMA 3GLIA 4BLRA 4CEJB 4X8HA 1U0JA 2VL7A 1FMLA 2ZRJA 3RYTC 1M7HA 3QQ5A 1WDTA 3MG9A 5EE9A 4DLTA 1QHSA 4ZKEA 2J1LA 1KI7A 3A6PC 1G3UA 3QPVA 2X2FA 4YMUA 1TX4B 2OM2A 3THOA 4C0BA 3WHKA 4V03A 2CHQA 4YMVA 1CIPA 1U94A 5KDOA 4L9WA 4NCKA 5EP4A 2QE7D 1ODFA 2FFQA 3ND8A 2O8CB 4B76A 2WKRA 3CF0A 1G8YA 3NHAA 4XOIA 4Z54A 4BFTA 2K5UA 1KK0A 3ZVRA 3A1VA 2XXAB 1ETUA 5FUVA 3TBKA 4I1VA 3OESA 2EYQA 4HAVA 3SJAA 4B3FX 5DYGA 4CEIA 1G64A 2AFIE 4PPGA 2C77A 3TRFA 5CK4A 3RAPR 1G8GA 1XMSA 1RJ9B 3THWA 4B35A 3GCGA 4P4SB 4IXNA 1IN5A 1S2MA 3IBYA 2OESA 1VECA 3KJHA 4ESVA 4I1OA 5IRCD 4FCTA 2IHBA 1K6MA 5JEDA 4ZCLA 1XPUA 4QGHA 4JLOA 4DB4A 1NI3A 2BWJA 4WXPA 3AH8A 5FOSA 2BJVA 3AF0A 1EG7A 3J81k 3B6EA 3B9QA 3Q85A 4OHWA 1UKVY 4GZLA 3SBDA 3F0TA 3FMOB 3QY0A 2OSBA 2J41A 1T8UA 3L0PA 4IFBA 4CEHB 2H5EA 2DCUA 2EU8A 1R0WA 2HEIA 1F2TA 5D3QA 1G19A 1T3HA 2CMKA 2OXRA 3AEZA 3QXSA 3GLHA 5LDDC 1G4UR 5CK5A 1NMXA 4PO9A 4QC2A 4DLZA 3AP1A 4OI1A 4TYWA 4AK9A 1CLUA 4LPSA 1AIPA 2ORIA 1KSHA 4M2LA 1ZUIA 2R9VA 3DL0A 2N42A 1Q44A 1XTQA 3OHMA 3L0IB 2BIFA 2QMUA 3PEUA 4IXMA 3B78A 4TMTA 4II7A 4MGYR 2HT1A 4KCGA 1H8HD 2KE5A 4KXFB 2QM7A 3I8XA 1ZYUA 2NGRA 1NN0A 1QHXA 3O8BA 1E9CA 2NZJA 3B85A 4A15A 1XJQA 1H8EA 2B21A 5DHAA 1D9ZA 3KJGA 1VYVA 1E79D 4N0EA 2IXGA 2ZU0C 2ZJZA 1J8YF 2YWHA 4LBWA 2VHTA 1NY6A 4EPVA 3AB3A 4NTZA 1Z6XA 2C98A 1OXTA 4HB3A 1FOEB 4CZ2A 3NHBA 2AK2A 2QQEA 1DEKA 3PEWA 1ZUHA 3U7EB 1G4AE 3Q5DA 3QKRB 2ZAOA 3ZS9A 4TZ6A 4Y0VA 4V02A 2OCAA 1A4RA 3D7MA 2DBYA 3ZZTA 1V5WA 1XXHA 3BOSA 4JLJA 1PV4A 5G3YA 1P3JA 2LKDA 4TMWA 1CR0A 4L8GA 4DDUA 4DCSA 4LV6A 3PITA 3OZXA 4D4LA 1PUJA 1Z0AA 5IDVA 1YE8A 4MKFA 1UPTA 1U9IC 3NH6A 2CLSA 3TJZA 1XMJA 5FUWA 3FFAA 3QXJA 1EX7A 1UBGA 4R98A 2LWIA 2AK3A 3K09C 4DJTA 4LYHA 3IIJA 4XJXA 2ERYA 1W2GA 5FH9A 1ZVQA 4DLUA 3V4FA 4PQFA 3THWB 2FU5C 1JR3A 2J0UA 4GFDA 4PZLA 1GKYA 1RZ3A 3QEJA 3BC1A 2WMOB 3K70B 4AKGA 4RFSB 4KAXA 4D80A 4PPNA 4Q9JA 5JEEA 4QRHA 1HT2E 3DMDA 3HP1A 1Q21A 1P2TA 3GEIA 4B33A 4ZPXA 4MKIA 1W44A 2C95A 3A4NA 4TQUS 3NBYC 2GDJA 2F1RA 4KVAA 2QRNA 4LJ7A 1DG3A 3ZQJA 4PC7A 1P9NA 4FD2A 3KL4A 2FFAA 1ZW6A 2PEZA 4OI2A 3RC3A 1G6OA 4BRUA 3SHFA 4B73A 5TV2A 1N5KA 2QZ4A 1F2TB 1SKQA 5FOWA 4A0GA 4Q7MB 4UNQA 1AQUA 2D2EA 1DS6A 3GLHB 4R9UC 4A0HA 3ASYA 4FMDB 3IGFA 5AK0A 1GL9B 1E9DA 3KZ1E 3U3RA 4Q9HA 4PZZA 1FL9A 4Q1EA 3BH0A 2H18A 1II8B 1L2TA 1B0UA 1DBSA 2WOOA 1QVRA 4XWKA 4YXWD 1W48A 3WMEA 2N46A 1TEVA 1E9BA 3ICEA 2AWOA 1G7TA 4RZ3A 5JJLA 2IYUA 2VSXA 1K8RA 3OEEA 1S9DA 3JVVA 1U90A 1XNJA 2QTVB 2O0KA 1HV8A 3AGQA 1F48A 4EKDA 4PQYA 5JECA 1MOZA 4OQFA 1ZNZA 2ONJA 2RGGA 4B6FA 3P4XA 2OO7A 3ZQ6A 2JLVA 2XITA 3Q7PA 1KAOA 3PENA 3FFBA 5FBVB 1DE0A 4IOMA 4OI0A 4DUGA 1RIFA 1W1WA 1Q3HA 2ODWA 2VP6A 3P26A 4Q7JB 4DCUA 2OEPA 1P2VA 2J87A 1AA9A 4BRWA 2OILA 3W6OA 1PUIA 2RGNA 2IYXA 2Q21A 1NVWQ 3TW8B 3ZLJA 4PHFA 2BDTA 1N5LA 1ZM9A 1E0AA 2CL0X 1NVUQ 3H2YA 3MSXA 2AKYA 2XSZD 1W0KA 1E2JA 4JLVA 4P33A 3M4YA 4Q9KA 4D0NA 3MWKA 1OHHD 4LJ6A 4ZV4A 3O47A 4UKDA 1ZM3A 2E9SA 4DDWA 2QAGC 4BFZA 4Z1MD 2ZR0A 1KMQA 4OJKA 5B57C 1U0HC 1HY3A 5FPTA 4EPTA 2J0UB 4EJSB 2IT1A 1W36C 2NG1A 1IONA 4YQFA 4D6PA 3QBTA 3PUZA 2R6DA 3QIAA 4WA7A 2RGDA 1LW7A 2YINC 1JEDA 3W3ZB 4R71A 1P7CA 1Z83A 3NKVA 2DR3A 5C2JB 4I1SA 1CXZA 1Z07A 5K8TA 3PR1A 2HF9A 2QA5A 4P32A 2IUTA 3D8BA 4FI3C 5H70A 1T5LA 3E5HA 1ZNYA 2WTUA 4XTCS 3IILA 3GPLA 2IS2A 4PXAA 3BE4A 3CR8A 1AM4D 1FTNA 2G6BA 2GCNA 4FIDA 4GOJA 4G0NA 1FNNA 4A6XA 5FL7A 4CIDA 1T3SA 4NYIQ 3WNDA 1N6RA 5EE1A 2PJZA 4HUQA 3IQXA 3VR1A 1E0SA 2VHQA 3WNCA 1KO4A 2JAQA 4LYFA 4HYYA 2QBYA 3AVPA 3ONWA 4DRZA 2E87A 3NXSA 4NCIA 4ACAA 3CNOA 2IEYA 4TYQA 1SVLA 5E7JA 1AGPA 1GUAA 2W6ID 3NWJA 3SNHA 4LSGA 2R2AA 2XJ9A 2PJRA 2PEYA 1XTJA 1P60A 2VP5A 3A1UA 1KI3A 5ANRB 2B8TA 4EQ6A 3MWJA 4A36A 1P75A 2W2VA 1GVNB 3H86A 2CBZA 2XTNA 3K9LA 3QE0A 5EXXA 5FPYA 1AQYA 1JALA 4PQRA 5GJCA 3VNUA 4ARZA 3A4LA 1EESA 4A8JA 5GJBA 4LDJA 3UIEA 1XD2B 4A0RA 2RAPA 2CHGA 1UKEA 1R6BX 2NTYC 2G3YA 2Q6TA 1ELOA 2J0VA 3HU2A 4L4UA 4N3NA 4Q1DA 3O8RA 2GETA 2O5VA 4PAQA 5BQ5A 3QXCA 2GJKA 1KO7A 1WP9A 2ZANA 5EXSA 3PUXA 2W6IA 1NKSA 2RGXA 4LCBA 4D2IA 3AF4A 1E4YA 2X77A 4NH0A 3AVVA 4TMZA 3UWKA 1W5SA 5JMTA 4HB2A 3ZZ0A 4M1OA 1KHTA 3AKCA 4P3YA 3QXHA 4QNRA 5J4HA 3D6TB 1NIPA 2OG2A 4TSFA 4PTLA 4R2IA 3PFIA 3RRMA 1E1QA 4PHHA 3K1JA 1D2MA 1F3OA 2QORA 5UKDA 5K8LA 1NVVQ 1NF3A 1YZKA 5KDDA 1YR8A 4TT3D 1VG9B 2WWYA 3AKYA 1ZAKA 1D8TA 1OT3A 3TSWA 1XMIA 2ZSDA 2A5YB 4GDFA 1MO5A 4JLNA 1XFAA 1XEXA 4RSGA 1W4CA 1IN8A 2A9KA 2ZJAA 3NTUA 1PJRA 4K81B 1KNXA 2FA9A 5BW8A 1OXXK 4DEXA 2ZE5A 3B2EA 2R65A 2ZI9A 4G01B 4H1UA 3MD0A 1NMYA 3ZD6A 3CH5A 5CJ2A 3GLFE 2G88A 2CXXA 4Q18A 1II9A 4F4IA 1ZU4A 4TLAA 2XB2A 1LVGA 1E2MA 4NPHA 4URVR 3NIBA 5EXTA 3QF4A 1E1RD 1UM8A 3P32A 4NP6A 1ZNXA 2DFLA 2DWQA 1ZNWA 5TARA 3FMPB 4A4DA 4M1WA 1HURA 1JQJC 2DY1A 4S35A 2E1RA 4D81A 1GTVA 1GIAA 4DDVA 1G1MA 3U7HB 3QNUA 2R6FA 5EUQB 2UZIR 4HUQB 1R5NA 4UJ3A 3B60A 4LBYA 1ZIPA 3ZYCA 2RB4A 2QBYB 1C4OA 1UEIA 5JSZA 1ZD8A 5TB5A 4BZXA 4BEJA 3KUDA 3ADCA 5FL3A 5H1YA 3ZJYA 1Z22A 4QGAA 4IRUB 1E1RA 3L2OB 1CEEA 2PBRA 4YMTA 3W90A 4ABYA 4DLRA 3QUSA 3PIRA 1LS1A 1XEWX 4EQ6B 4D25A 4HSEA 1ZM4A 1W4AA 2C9CA 3SOPA 3IUYA 1GZSA 1R0XA 4ZCIA 3KQHA 4B6EA 3E1SA 1FX0A 1LF5A 2FSFA 121PA 1RYFA 5GJVC 4B2LA 4ARZB 2JLYA 4A8JB 4JLAA 1TF7A 5FTLA 1Z06A 1DVRA 5CB8A 3FMFA 1KJZA 1L4YA 4DLVA 1XTRA 1U8ZA 5CIWA 1G9XA 2Z0MA 2V3CC 3B8HA 3AM1A 2VHJA 3LQRA 4ILEA 1S96A 3SI7A 1XBTA 5TY0A 1G7RA 1OXUA 2WSSD 3FTQA 1LS6A 1NN1A 3CRVA 1TU3A 3QEOA 3U3JA 1E3MA 1LNZA 2O0HA 4B3BA 1FQKA 3SJZA 1FQJA 1WE2A 4JLBA 4F93B 5LB2A 2HT6A 2XNDA 2WAXA 3B9PA 5J5CA 2C03A 3KJEA 1G5PA 1VIYA 2W00A 3MWLA 4HAWA 1CR4A 3B1YA 4W5JA 1XZQA 5BXQC 2O8BA 4BFXA 1BIFA 1PLKA 4B3CA 3IEVA 3DHWC 5DN6A 2VYFA 2ZRHA 1LB1B 3EIHA 3TVDA 1GL6A 2AXNA 3BAFA 4QHSA 4DT1B 2WSSA 3DOEA 4A92A 4EIWA 3GMTA 4NZYA 4PHTA 5BYJA 4Q4JA 2D3WA 2YJTD 1U2RA 3I32A 4JLMA 3WP1B 5CYOA 2FE4A 2W6JD 4G1UC 3ADBA 3OAAA 1KTVA 3C5HA 4PC1A 2JLXA 2A5JA 2DFNA 1TEXA 3IPYA 4XD7A 2JDID 4ACBA 3UATA 2R6GA 3MAAC 2NQ2C 3RS7A 1BMFA 3KXIA 3EPLA 2KJQA 1JPJA 2F43A 5AUPB 2QPOA 2JJ1D 1N6NA 1K5GA 4LV5B 1OIVA 4BUJA 1Z0FA 4M1TA 4FINA 1VYUA 1F60A 2A5DA 4AWXA 5KNCA 3KQUA 2HV8A 1OJLA 5JCPA 3LO5A 1NJGA 3LFUA 4E03A 1OKKD 1ZIOA 3AF3A 2O8EA 1YZUA 3IO3A 1FFHA 1OYWA 2PH1A 2GCOB 2FDCA 4JSTA 3BB4A 4D4MA 3MWYW 1US8A 1X86B 2G1JA 3GFOA 2ZJ5A 1JQLB 1U81A 2VRWA 4URXR 2ZRCA 1FX0B 2XOKD 1XTKA 2DHRA 1V43A 1VHTA 1SVWA 2Q9CA 1SHKA 3E70C 4HAUA 4DLWA 4RZ2A 1XP8A 2ATXA 2GJ8A 3TSOA 2OUKA 3IIKA 1OKKA 2RGBA 3B1ZA 5B30A 4R2HA 3ZVLA 5FR2A 2XGJA 4KHZA 1KK2A 3X1WA 2YZ2A 2R8RA 1TTTA 3LY5A 3RRNA 4ZDJA 1E94E 2VP2A 2PZFA 2OLJA 4GMDA 2FZ4A 2P0EA 8OHMA 3P4YA 4IVPA 2LKCA 4MYCA 1GG2A 3WRYC 3BFVA 3C8UA 4Q4HB 4A1FA 1YU9A 2F9LA 5JLJA 1P2SA 2ZYVX 1Z6YA 2OFOA 4XIGS 1GRRA 1X8JA 1EFHA 1KO5A 2GWHA 1CU1A 1FP6A 2XEXA 2D74A 4XVRA 4A82A 2X19A 2O8BB 4F91B 4JBXA 4TLBA 1NLZA 5FUXA 4TL8A 5FI1B 5F9FA 4NCJA 1AS3A 4IOJA 4TTQA 3QBVA 2GXAA 5EE3A 5EP1A 2B92A 1C1YA 1KMHA 3KXLA 3KB2A 5EQTA 2ZRNA 3CO5A 4JL6A 3CPEA 4RKEA 1QHHA 1ZRHA 2VTKA 4AI6A 2FPKA 1JAIA 1Q20A 4A2WA 4FWTA 2F6RA 1SXJE 4Z51A 4GP7A 2WWGA 3H84A 4KLZA 1RRGA 1P2UA 1WMSA 4I99A 1CJMA 4DWJA 2VA8A 4FMDF 2HYDA 2F55A 1KJWA 4DCVA 2JLUA 2WJIA 1EFRA 2QAGA 3EARA 4C30A 2V7QA 3OIVA 1Q1EA 1OXSC 2CL6X 1PZNA 2NOAA 3LVRE 3VKHA 1UADA 4M21A 2F43B 3KXKA 4HLCA 1COWA 2J0SA 2RH5A 1W5TA 2IUSA 3WHLA 3CRRA 2JIZA 4AURA 3AF2A 4Q9LA 2GVDC 3TMKA 1HEIA 3OFND 1J7KA 1SKYB 2GEDA 2PT7A 4MITA 4M1MA 3LQQA 4C0QC 4C0SA 1SULA 4CT5A 2FMXA 4LC0A 2QTFA 3CH4B 2ATVA 3C5CA 5JS8A 1ZINA 2B7CA 2QNRA 2WM9B 1OH8A 3I1FA 1E96A 1KDOA 1DAHA 2GJAA 2ZRLA 2GBLA 1J8MF 2O8EB 2BMJA 1CJKC 4ZDKA 1OH6A 4FW9A 3GLFA 1ZJ6A 3CRQA 4QHTA 4AIIA 2JJ2A 1T8TA 1ANKA 3QKSA 2QROA 4LHVA 2QUZA 2QT1A 1TU4A 1US8B 3BWDD 2GEUA 3HYTA 3IQWA 3OFNA 5EZ5A 3K70D 5HZHA 1GWNA 1R5OA 3ADKA 3UKDA 2OHFA 3U4QA 2GKSA 5JHHB 3BBPA 4EDHA 1M7GA 4JLDA 2XX3A 2GK6A 4QJ4A 4D82A 3I5YA 1VYTA 2D7CA 3TVTA 2BBSA 2GZDA 3EZ7A 5D3MA 3WYFA 4HAYA 1IN6A 4KVGA 3LA6A 1XX6A 3GLGE 4B71A 5TDHA 3X1XA 2ZS9A 4QM7A 3OEHA 3VKWA 4BLPA 4WZBE 4LYAA 2JASA 1R8QA 1N5JA 4PC6A 1NG1A 2WIBA 5HCIA 3KTAB 3JZAA 5TXGA 5JCZA 1ZD9A 3QENA 4KYUA 2Z43A 3R9IA 3Q9LA 3TUIC 4E07A 4B2PA 4MUBA 1W4RA 5HR5A 1E4VA 1Q12A 2CCKA 2F3TA 3NBXX 2W0SA 2C5LA 2BOVA 4JLPA 4C0LA 3MLEA 5L3SB 3EW9A 3K0FA 4DIDA 5BN4A 5KSYA 1GKUB 4CF7A 1E9RA 2WWIA 4YMSA 4NMMA 2G0TA 1MABB 2J0QA 2KSQA 3JZMA 3D3QA 1MV5A 1QHHB 4GI7A 3SS8A 1ZBDA 4QG7A 3U44A 2ZE7A 2EFGA 1H8ED 4NYMR 2YV5A 1WXQA 2BMEA 1A5TA 2CVHA 5F2EA 5DI3B 3OE7A 4Q9IA 3WBKA 1W7AA 1G3QA 1GM5A 4EFMA 1G20E 1XZPA 1CR2A 1MRSA 1BYIA 1YQTA 1XJ0A 2WKQA 1M7BA 2IYLD 2WMNB 5HKKA 1M2OB 1DARA 3ZVNA 4KSCA 3DMNA 4NCHA 4GL2A 3K8YA 3CF6R 3HU3A 4JVMA 4TTPA 4B44A 3C14C 3AP2A 3N2IA 4QJ5A 3PUVA 4C0AC 3GLIB 1W36B 4EPYA 1KI9A 1TADA 1TL7C 4PC2A 4B47A 2FX3A 4ZI3A 1BH2A 1Y63A 3PEYA 5JWOA 3TUJC 3HYRA 1TUEA 3U61B 5FR1A 3THXA 4Q01A 1MKYA 2RHMA 2WVJA 5BN3A 1AGRA 4KFTA 2FFBA 4BLQA 1N0VC 4DLXA 5JI2E 1IY1A 1P5ZB 2YOFA 4MRNA 5FOTA 1HUQA 3R8CA 3GLFB 4JL5A 1JR3D 3FB4A 1FNMA 5AUNB 3QKSB 3QXXA 1RFLA 4MQBA 4PHGA 3HU1A 4U00A 1T0JB 4QGFA 2GHIA 2G0NA 2GF9A 4RD6A 5AJZA 3U4QB 4E09A 3AVUA 1OFHA 5J4YA 2FEMA 1OB2A 1TUIA 2HF8A 3NBZC 4CEIB 1FP7A 1S0UA 2NO0A 2C8VA 2AKAB 5D3MB 5KOYA 1GILA 4AG6A 1S1CA 3PG5A 2YVUA 2YC4C 3TAHA 3LW7A 4BZPA 2FH5B 2I4IA 3C4JA 1MT0A 2MSCB 4DXAA 1VG8A 1NBME 2KBFA 1HA3A 2Z83A 2ZRGA 4IOLA 4LHYA 1OLOA 4P31A 2WWXA 1EWQA 4WIAA 3EPKA 2P65A 2JLWA 1CBUA 3KKOA 2AX4A 4DHEA 4FCWA 4Q19A 5HTKA 3AVQA 5SZKB 1J99A 1OFIA 4WBSA 1RVDA 3U7GA 2ZYWX 2FF7A 2IXFA 4WW0A 4P4TA 3K0FB 2QN6A 1J2JA 3N2EA 3G0HA 4O2LA 3OEED 4HUTA 5J4VA 2VHUA 4GNKA 1FPMA 3GD7A 1IBRA 2FSHA 1N0UA 3K0AA 5KPJA 1KSFX 1XEFA 2ZI7A 3WRXC 1DAEA 3AV0B 4C0KA 3U3MA 3MFYA 2WICA 2YC2C 2ZJ8A 2A5GA 3BD9A 5J4KA 4EPWA 2GZHA 1EWRA 1G5RA 3EASA 4M22A 1R2QA 1RKBA 4LK2A 3SYNA 4DUGD 4UNRA 1QRAA 4Q4LA 4C7OA 5M04A 1KO8A 2A2ZA 4BPBA 1GL7A 4FMBB 4TMXA 3FMIA 1YRBA 4DLSA 4LGMA 1LFDB 1G3RA 2C04A 1E2EA 4I1UA 4Q1FA 3AVOA 3CB4A 3ND9A 5LPNA 1T91A 1AZSC 1Q57A 3LRPA 2ZM5A 3UANA 3I8SA 3ZVMA 1E9EA 3LLMA 2DB3A 3A37A 1UBEA 2P5TB 4B75A 4R7ZA 1W0KD 5FUYA 4GMXA 2IK8A 2V9PA 3C16C 1P62B 5J40A 4L15A 3REFA 5CJPA 4GOKA 5DSZA 5A5GA 4TMVA 1W2HA 3CLVA 3THXB 1Z0JA 1OV4A 2GJ9A 1XD9A 1XCGB 3R9WA 1SXJA 4M1KA 3EA5A 4G3XA 4JJZA 5BWMA 4MGKR 3ZGXA 1XXHB 5A4JA 4V0KA 4NHOA 4OJQA 3I3SR 5IK2A 1KYIA 3SHWA 3M0EA 3IPXA 3LBIA 3LWNA 2X2EA 4UXHA 3FHOA 1DOAA 3KKNA 4GPTA 4H1VA 1QG2A 1IAQA 1IHUA 2FV8A 4IW3B 4OK6A 1X8KA 4BGDA 3THYA 3VKGA 4HLUA 3AP3A 5LD2C 2CNWA 1G7SA 2HCJB 2ORVA 4DLYA 1KI1A 4KBGA 1S1MA 2JLZA 1XMVA 1E0KA 3JVUA 1G3IA 2ZRFA 3GJ6A 4E22A 4Q21A 5KNDA 2ZUBA 5E4FA 2OXCA 2A3RA 3CKLA 4DBLC 4MYTA 4NYJR 4CRWB 5EZ6B 5FL7D 1RW4A 1NJFA 3UPUA 4M4SA 1XCMA 1YZQA 221PA 5L3QA 2GBLC 2V6JA 4QFMA 2TMKA 1RYHA 2AFHE 3NBFA 4I81A 3QVVA 4QGGA 3T1OA 3RNLA 2CE7A 1I4TD 2CK3A 1N6KA 4YDHB 2EVWX 2GA8A 3VX3A 4HAZA 2JEOA 2Z4SA 3W34A 2FNAA 1TF2A 2VP4A 2QMHA 2FN4A 3TQFA 3K0AB 4AYXA 1GP2A 2QY9A 3NEYA 3O8CA 3GLGA 4QBHA 3GJXC 2P5SA 3HDTA 3PJRA 3P1JA 2H16A 3U3OA 5JRJA 1Q1ZA 5KHOC 2XZOA 2IW3A 3BFKA 2JGNA 2WPDA 3F8TA 3IDQA 4G5RA 4C7OB 821PA 5E3HA 1E98A 2IF2A 5F3WB 4L16A 4XSHA 5JBQA 1P6XA 2ZI6A 2AXPA 1G291 5KNBA 2EFCB 4AKIA 1KIMA 3CNLA 2NPFA 3OIWA 2ZRIA 4MH0R 1CF4A 3CX6A 3RS2A 4TSFD 1D9XA 1KI8A 2J7PA 3W6NA 3PUYA 1E1QD 1J70A 3LDAA 3FKSA 3GFTA 4LX0A 1N6IA 3Q72A 2A30A 3T1VA 2NO7A 2FGKA 3LXRA 1JXMA 1L8QA 3EA0A 5DNYB 1DAMA 1TNDA 5F9HA 1SVKA 1NLFA 4LBZA 5JHGB 2Z4RA 4JZKA 1S4QA 4RZUA 4GZMA 4KJZA 1AZTA 1R5BA 2QQ0A 2V6IA 3QI2A 2JLRA 1S9HA 3CPJB 2PZEA 4PZYA 4WOPA 5EP2A 4QHYA 2OCBA 5AJVB 4BLTA 2VLIA 3B82A 2HCBA 3VR3A 2IWRA 2QGNA 721PA 3CONA 4JKYA 3THYB 1XPRA 2UVQA 1ZMXA 2BMDA 4BLSA 5EE0A 2G83A 1G8FA 4JBYA 3SEAA 3CZQA 2NO9A 1GAJA 4LWZA 2J46A 1G16A 4JIMA 3SQWA 4JVSB 2VSFA 1NKTA 3A1SA 1R7RA 2WV9A 3AKEA 1Z0KA 2QPTA 1SGWA 3A36A 1Z63A 5AJXA 2ANBA 2VHCA 1WBDA 3CIOA 3CM0A 3X2SA 4FMCB 3CX8A 2FOLA 1PLLA 1Q3TA 3UG7A 5KO2A 1VCMA 4HZIA 4XTRA 3UMFA 4FN5A 4DKXA 4QXAA 2GAOA 4QM6A 3SJBA 2A7QA 4H9GA 2VO1A 1N6LA 1Z6AA 4UJ5A 3BORA 4BASA 3PXGA 2WIAA 1W4BA 1IXZA 4QL3A 3WMFA 3KDSE 1GFIA 1EK0A 2WWFA 1OB5A 1HH4A 2WJYA 3I73A 4LYJA 1JI0A 3L43A 3SYLA 4KODA 2EWWA 4TN1A 2JA1A 3GLGB 2BBWA 3L82B 1Z8FA 1CJTC 3TH5A 2H57A 2OLKA 4QJ3A 1NBMA 5CYPA 1T0HB 2QENA 2ZJ2A 4ZO4A 3K53A 2D06A 4PPQA 1Z2CA 4U5XA 1T5IA 2ZRAA 1E2PA 1XD8A 5B64A 2ZI3A 3VR4A 1NL3A 3BH6A 4RJLA 1NN5A 4A6PA 1VMAA 2X8AA 2H92A 2Q9AA 4MRPA 3BERA 3VQTA 1KDPA 2OAP1 1CJVC 2ZROA 5TVKA 4ZDWA 1SQ5A 4YDSA 5FI0B 3SBEA 1CULC 2EYUA 3CWZA 1P61B 2P67A 4NYMQ 4QKQA 2QMOA 3LX5A 2XNDD 4PANA 4ASUA 1W49A 3IIMA 2ZTSA 1VG1A 2SHKA 2GZAA 4IDHA 4DB2A 1WCV1 4KYIB 4OQMA 5DN6D 3DKPA 1DELA 1DAIA 5AUQA 1M1YE 2OE2A 5CB6A 2IS1A 421PA 4IKEA 3SYKA 1A2BA 2F1HA 1W0JD 1HE8B 2JLSA 4XH9B 2OFWA 2NZ8A 4LJ9A 3KQKA 5HCNA 3Q3JB 1D2NA 2DWPA 3LH5A 1X1RA 2WHXA 3A1WA 4HZUA 3OAAD 4YONB 1XEWY 3VU9A 4W9MC 4Q5IA 2VEDA 1Z47A 1MR3F 4XD7D 3SQXA 1F6BA 1IN4A 5P21A 3AVXA 1XEXB 1BMFD 4EFNA 3SN6A 4Z8XA 4IEIA 2WAYA 1BYUA 2I3BA 4RVCA 2C9YA 3UXMA 4TYYA 1W0JA 2W83A 3NG1A 3VR5A 3CRW1 4BQSA 3AUYA 2YWGA 3CF2A 4Q1BA 4JLKA 1Q1QA 1BKDR 3RS5A 2BM1A 4KFRA 1OFTA 2CJWA 3EWSA 4TL7A 4US0R 3T1TA 1KSJA 1IXSB 2W2TA 2OBNA 3EWAA 2PMDA 3FKQA 1E2NA 2A5FA 1NN3A 3VHXA 5CDFE 1QHYA 3PV0A 4IFEA 4OK5A 4JT4A 4BLOA 2O8FA 1SXJC 3RS4A 4LUCA 1KKMA 3OIUA 5KDLA 3U7FB 1DO0A 2ZRKA 3QF4B 4AKEA 1KI2A 4F38A 1G18A 1YRAA 5JFGA 1PVOA 3ZDQA 1A7JA 2REOA 2PX3A 4O25A 2WOJA 1BO6A 2PCLA 3GJ5A 4J0QA 2BHRA 4F4JA 1JXOA 5DI9A 1HYQA 3IEUA 3KKQA 4D4KA 1UDWA 1QHIA 2HLDA 2JCSA 1E6CA 2CHVA 4B32A 4U02A 1T3LA 2PT5A 2OBMA 3QOFA 3QPUA 2AWNA 2FPLA 4HLUC 4JBWA 2EFDB 2V54A 3R8FA 2FSIA 1C9KA 2KBEA 3B5JA 1GITA 2V4ZA 5JSZB 2KI5A 2QL6A 1Z2AA 4Q02A 5C4MA 2VPPA 5TMPA 3EXAA 3F5FA 3QSYA 1OYYA 5L3RA 4IHQA 3CZPA 3E2IA 1EFUA 2CCJA 4JYBA 1EX6A 3ZH9B 2YOGA 4CEJA 2YKGA 3LXXA 4O2RA 4M0LA 5KSZA 2BEJA 4X8MA 3S1AA 1XPOA 4BFWA 1O87A 4IDNA 4DCNA 4KITB 4B43A 4ESHA 4HLQB 5KSPA 3GJ8A 4DCTA 5JWHA 1R0YA 4W5WA 5JRZA 2FGJA 2R44A 4RD1A 1CS4C 3PUWA 2IHYA 2YWFA 2ODBA 2W0MA 2ZS8A 4RD3A 3U2QA 2QP4A 3ZIAA 1X8LA 1VDZA 2YYZA 3I72A 3P20A 1VKJA 4YC7A 2GRJA 3QKTA 2H1LA 2PX0A 1KY3A 3CWQA 4OYHA 4TLDA 5SZHB 5FFMA 3T34A 2IYSA 4BWYA 1G3MA 2IL1A 1FUKA 4TQ9A 1UEJA 2O52A 5FOUA 4PSVA 2BCGY 3OIYA 3WY9A 1U0LA 4HB4A 3CX7A 4DC9A 3A58B 4OQLA 4AG5A 1E2GA 4LV8B 4Q7LA 3VU9B 1KDTA 5FPSA 1NG9A 2G1KA 2MSEB 2Z6VA 5C4GB 4MRSA 3OF5A 4EAQA 5KPDA 1IJEA 2V1UA 4AD8A 1EFRD 1G7CA 2ZJBA 3AKDA 4P4SA 2FPMA 2V7QD 1DPFA 1X1SA 4NYIR 3PQCA 2RKOA 2EW1A 4NCNA 3C41J 1COWD 5GADl 4V0ME 3AQ4A 3FE2A 5ELXA 1KKLA 4Q4JB 3LBNA 4RKFA 2P2LA 2ZRDA 1W36D 1ZM2A 2JIZD 1OE0A 4BEBA 4MRVA 1KAGA 1R0ZA 1DTSA 2W2XA 5L8VA 2QSZA 4DSUA 4C0HA 2Q0HA 2ZQ5A 4LPKA 4P4UA 3BRWD 5C46F 2J9RA 4G5GA 4NU0A 5H68A 4X8OA 4HI0E 4AYTA 2GVZC 1N3BA 2GXUA 2JJ2D 2CDNA 1XJCA 4QOSA 4TMKA 1Z29A 1GSIA 2ECKA 2YOHA 3L0OA 3LV8A 2FEOA 2GXSA 4OQXA 1QHNA 3EX7C 4DIEA 4NYJQ 4WZAE 2QTHA 3RS0A 4MRRA 3VAAA 3KKPA 3WBJA 2BC9A 4IVRA 3VFDA 3SR0A 3W8RA 5JJKA 4TYNA 3M6AA 3AVYA 2OV2A 5K8IA 5EJEA 3I5XA 1D5CA 5FBQB 1DG1G 3BB3A 4JL8A 2ZYUX 3GQBA 2W58A 3OEHD 3MJHA 1LV7A 2D4HA 1NVVR 1YZLA 2ZI4A 2F9MA 1KK3A 2QAJA 4F7WA 4OQNA 3S1AB 5DH9A 5LB4A 1S8FA 3HPQA 2BBOA 3IBGA 4LHWA 3AVWA 3DKVA 1RC8A 3TUZC 1JJVA 1XDBA 4DDTA 1NIJA 3QKRA 2ZJOA 2MMGA 1W47A 5G40A 4C3ZA 2DFTA 3MMPA 4DSNA 1NSFA 621PA 4B3GA 3EC2A 1WBBA 3NH9A 2IWHA 2IA5A 4B34A 1KI4A 1YR6A 3B1WA 3C7KA 1BOFA 2GILA 3HPRA 3LLUA 1XTIA 4KFSA 2IEZA 1JR6A 3R20A 1U98A 1OSNA 3EIEA 3F3YA 2WJJA 4Q66C 3OE7D 3K0CA 2QM8A 3BFXA 3DO6A 2QE7A 4TLCA 1I4LD 1A82A 4OI4A 1OPXA 3AUXA 1Q1BA 1R4AA 3HR7A 4RCZA 1XB2A 5HKKD 1KMHB 3CRMA 3GJ4A 4RFSA 4AKHA 2D62A 2ZRMA 3B1VA 3TK1A 1ZCAA 4V0OA 2ZRBA 2Q9BA 4B3XA 1P72A 3A8TA 2ZS7A 1K5DA 2N1BA 3NC1C 2HYIC 1E69A 1Y3AA 1VHLA 4RY2A 3DPUA 4UNPA 3AVTA 1MH1A 3ZS8A 1Q0UA 3K9HA 4M1SA 2GCPA 4US1R 3SJCA 1F5NA 1AN0A 2DFKB 1P73A 2PLRA 4D0GA 1E2DA 2QAGB 2ZSBA 5KUTA 3U5ZB 3QPWA 4RD4A 5LD2B 2HXYA 1HTWA 4NONA 5IT5A 4FWIB 2IS6A 3ECCA 4KO8A 2ASEA 1YR7A 4LJYA 2ZAMA 1II8A 1G41A 4AY2A 1E2KA 1QG4A 4M1YA 1RE0A 5EP3A 2XAUA 1VCOA 4L9SA 5DE3A 1TF5A 3LD9A 3LW8A 3Q8XB 4GP6A 5FBRB 2IYZA 5DGXA 2FG5A 3SDZA 1XRJA 1GNQA 4OHXA 3LVQE 3HJNA 2Y8EA 3RANA 4DSTA 1TMKA 3CNNA 4O0MA 5CDFA 1G17A 5JS7A 4NE2A 5AJYA 2P6RA 5J47A 1Z08A 2PZGA 1F2UA 3ASZA 3PVSA 4TL6A 3NDBB 1VIAA 3UMSA 2AHOA 4U7DA 2EFHB 3DEFA 3VHLB 4PFSA 4LBVA 3AGPA 3BIFA 3SZRA 1H8HA 3TE6A 2QT0A 1G5TA 5FOVA 4HDQB 1KZ7B 1ZUNB 2P6UA 3EPHA 3FWYA 1CR1A 3GEHA 1GRQA 1E79A 1SVSA 1N6OA 3DDCA 1KSGA 4TWZA 5C1BA 1D6JA 4LJAA 2BV3A 1TQ2A 1O3YA 5DYIA 4P0TA 1GRNA 1UBCA 1QDEA 5IHPA 1OXVA 2ZE8A 4IEEA 3K9NA 2H8KA 4B48A 5E7MA 1VPLA 4WXRA 3L0SA 2J7KA 3TSZA 1A1VA 1P4SA 5FPHA 1NNEA 4FMCF 3VNVA 4HB0A 1YHNA 4XWAA 1I2MA 4OKSA 5JWRA 2ZVQX 3N5CA 4KFUA 4EJSA 1PLJA 2FFHA 1UDXA 4G5OA 1VCNA 4MKHA 1S3SA 3ZZUA 1E2QA 1OIWA 4QBFA 2G9NA 2F1IA 2ZUCA 3VR2A 4TLEA 2NO6A 1KZGB 3U44B 5AJWA 1CJUC 3A4MA 1JAHA 3X1ZA 1SHZA 1ZCBA 1ZU5A 2ZITA 2RGAA 4PAOA 4KV9A 3GJ0A 3FHTA 3TGPA 2IUUA 2J5XA 4MGZR 5KSOA 3GJ3A 2C99A 1E9AA 1E0JA 4JS0A 1T4GA 1LY1A 4ERNA 1CRPA 1HE1C 4HEJA 2BCJQ 1MRNA 5GJWC 4BFSA 4KBFA 2VBCA 1N5IA 1M34E 3DZDA 5F98A 1SXJD 2ANCA 1NY5A 2WKPA 2OZEA 4PR0A 2C96A 3M1IA 4JSYA 4JKIA 2X1VA 4UXJA 5B2ZA 5SZIA 4Z8YA 3LX8A 2B6HA 5IK2D 2QEQA 5J4LA 1NLYA 2HXSA 2O0JA 4K46A 3B1XA 3NVAA 4GOXA 4IVQA 5EXPA 3UK6A 1E32A 2VF8A 2C78A 2VP9A 1U8AA 4V0MA 3I92A 1AS2A 3B7GA 1G21E 4JYCA 1N6PA 2IYTA 3REGA 4C2TA 2H17A 4RD0A 2WSMA 4EFLA 4O3MA 2CNWD 1IXRC 4HATA 2DYKA 1UKZA 2DWOA 1YZTA 2VSOA 3NC0C 3KB1A 4B3DA 3H1TA 2JJ8A 4M9XA 5AR1A 4EPRA 5L3VA 4UXIA 4YXWA 4US2R 1HQYE 1G8PA 1AKEA 4ON9A 4TQAA 1CP2A 1XD2A 1F2UB 2ZJYA 4W7SA 4BECA 1J90A 3BB1A 4LZZA 5SZJA 2P6NA 1E2HA 1ZP6A 4Q1AA 4NL4H 1AK2A 1SVIA 3G5UA 4DSOA 3UMRA 2JATA 1SVOA 3CW2A 3EZ6A 1DAKA 2ZPTX 1U99A 3EG5A 4Q4AA 3GP8A 2YNMA 1M74A 2GJSA 3BK7A 5C18A 2CK3D 3TQCA 5K8UA 2VIIA 4L5BA 1CTQA 2MMCA 1IY2A 2NO1A 4JJKA 2YHSA 4OBEA 4C2UA 4IDQA 3RVBA 4FXPA 1SVMA 3W5IA 1EFTA 3O8DA 5EE5B 1UBFA 3KUCA 2F3RA 3C15C 5FPKA 3FPAA 1TQ6A 2PCJA 2ORWA 3X1DA 3NEJA 1M8PA 1SKYE 3CR7A 1AS0A 3SE0A 5AUOB 4CVNA 2KB0A 2QGZA 2WPDD 3N70A 3T5DA 1I2DA 2HJVA 1ZC3A 2REBA 4GSYA 5FTKA 2IYRA 5CITA 3EPJA 3FOZA 3HWSA 2XSZA 2JLQA 4ZCMA 2P3SA 3VR6A 1OHHA 4LJ8A 4QBGB 4XVUA 3SU8A 2B7BA 3KFVA 1MO6A 3BS4A 3RSOA 1B23P 3U60B 1IY0A 3RRYA
chains in the Genus database with same CATH superfamily
3BMQB 4Y67A 5DLQC 1HR0B 2JAPA 4CV0A 1D6SA 5F5LA 3BH7A 4LMRA 1VOTA 3QW2A 4AYWA 5DYNA 1BRMA 4KXMA 2IYYA 4Y1GA 1PK7A 5IAJA 4ZU6X 5MN4A 3N6XA 3O2QB 5I51A 3AUFA 4R8RA 2C9OA 3OZGA 4MWBA 3R5SA 2O8DA 1SJ9A 2OG1A 3L8CA 4KO2S 4PO1A 3TDNA 2AN9A 4C0JA 3PHGA 2L19A 1OT5A 3B51X 4N8EA 3M3HA 3C48A 4GL4A 3VVMA 4G0UA 4X20A 1V16A 4LA4A 3CH6A 1GG9A 2BKUA 3DB1A 3TNFA 3P9ZA 4OSEA 4Y0NA 5KVAA 1FW6A 3WQHA 4EP1A 5EEHA 4CW7A 4I8DA 5KYVA 4CT4B 5EQDA 4KDRA 1JJBA 1VJRA 1EQAA 3QF7A 4MS1B 4O6VA 4OA5A 3N7TA 1J0EA 3O4GA 3N2KB 1USGA 3SLGA 1CE8B 3EGEA 4TOIA 1HXHA 1VRCA 5ECWA 4JBHA 3B13B 3GRPA 2HU7A 4A16A 3IKMB 4Z54A 1YVPA 1S8NA 3DL7A 3E9DA 1BXGA 3TB6A 2ZSEA 4BFTA 3P2MA 4X62B 1JU4A 2FN8A 4QPZA 5FAKA 3AR2A 1T6NA 2J9ZB 3KEGA 3KCNA 4OBBA 4UHFA 4HMQA 3T4XA 3CVXA 4O8CA 2A33A 3V4RA 2X6TA 1GCAA 2BGMA 1ZL0A 4EPXA 1YVDA 4XLLA 1U0OC 2SBTA 3FJ1A 4IJMA 1LTQA 3W6PA 1U1CA 5CLQA 1Z6GA 5G02A 4D7AA 3H5RA 3TINA 5ERYA 1BS2A 3ZD8A 5K0CA 4ZZ0A 2MJLA 1M2EA 4JJGA 4CCAA 5L4SA 4MB0A 4BE7B 4J91A 4Z7JA 4HNVA 5JS6A 1NVBA 4G0WA 2GXQA 2DKFA 5JNSA 3M6WA 4ZKDA 3RRXA 2C2HA 3RE1A 5K0SA 2O2XA 4LZJA 5I7SA 3RVJA 5FWAA 4BJHB 3CLSD 1PTJC 1GYRA 3BF7A 1ZC4A 3D4IA 2A6PA 5F64A 2H5LA 3MERA 4DVJA 2C3UA 1QKJA 1QIMA 2ZTLA 1WZCA 2IGTA 2BD0A 3DHNA 4G4SP 3TNJA 4F06A 1BHJA 1U2TA 3HVKA 5DYWA 5K0TA 3UWOA 3RUAA 3WI7A 1T9HA 2O2ZA 2OFXA 1EGAA 3AIOA 4MYHA 1JEJA 3HN7A 4URUR 1SQGA 2BFNA 1H5NA 1IN7A 1MDBA 2OGTA 3D5EA 4TRMA 3K0HA 4FX2A 1W88A 4BBZA 3H5LA 3AM4A 1HT1E 1XRSB 4BKMA 4KVZA 5REQA 4S2EA 3ZE9A 1L7VC 1XLTC 1MENA 1QZ3A 2H1SA 2O2CA 4D26A 1JBKA 3NX4A 1H2EA 3IDAA 3GCZA 1JYFA 4DLLA 4HAXA 1F14A 3FGNA 4Y2TA 5IM4F 4IJVA 2AD5A 2OL4A 3C5WP 4CG0A 5BUSA 3RGGA 2BGGA 3WYNA 2HCTA 4OREX 3CSUA 1E3JA 4WAUA 5BUCA 3MT0A 2KW5A 5K8JB 4HDKA 1QGAA 5LLTA 5HA5A 3G82C 5E4YA 4KE9A 5L95A 2ARKA 2OYRA 1O95A 1QHGA 2ABWA 4UBNA 2BF4A 2Q7OE 4RTNA 2RI1A 2HJGA 2CWWA 3EAQA 5JXWA 2CSUA 1E0DA 2RCNA 4AC9A 3QG5A 1Z5ZA 3RVNA 1M3SA 2PU5A 2CB0A 3LP6A 3JALB 4H7PA 1NJ5A 2NZ2A 2A1UB 3GFPA 4J7XA 3VSAA 4Z9BA 3EXIA 4ASUD 4KU4A 1Z0DA 3AUUA 2VSYA 2AOUB 2FSGA 3ZTTA 2QZ9A 2JH8A 4FQ8A 3RSLA 1ZHOA 2YJZA 3P45A 3B7WA 1IVYA 1DMRA 1XTVA 2C7BA 5BT8A 5JJIA 3WL8A 4G8DA 1JDJA 4YAUA 1XCPA 4PC3A 4M9QA 3F3KA 1MTZA 3NBUA 1GXSB 1C50A 2O3QA 4POAA 4BFCA 2I4NA 2QUIA 4LHZA 1N2CE 3ZU3A 2GARA 1F0NA 3E1KA 1UK6A 3ZLVA 5DTQA 2WSYB 5C5DA 4OHYA 4J16C 1UKBA 4ZOCA 4EM6A 2EW2A 4Y6RA 3L8DA 4RAQA 2JRLA 2RHGB 3CR3C 3UENA 4E5UA 3G2MA 5JVDF 3HVHA 2AZTA 3HR8A 3GJQA 2A7XA 2GK3A 2J9GA 3GFGA 3HO8A 3NWPA 4NQZA 2GKOA 1CRQA 5IP5A 4AF7A 6REQA 1QP8A 2RHDA 1KQPA 1ZZEA 4AJ9A 4EKGA 3KQNA 3DE6X 4HBGA 4AP5A 3AHCA 3LDGA 1UJ5A 2BM8A 4RFVA 4DARA 3GDHA 4Y1FA 1FSPA 2Q4DA 1JHVA 4ZAGA 3GLHE 4RXTA 4CCWA 3HWX1 2HLHA 4R54A 4F3CA 3I9KA 4PSAA 3V7YA 1KXZA 5JD6A 3K71B 1SOVA 4TYPA 2BI8A 1NW3A 1BCRA 5CPFA 2XCSB 3R7FA 3I8OA 2WBLC 3I2FA 1P39A 4WTOA 2I3ZA 1T2CA 1FEZA 4PLYA 1SCAA 4YT4A 4PRKA 3GWGA 4HZGA 2IYWA 4LX8A 2VP3A 4GICA 1ZN7A 1P2DA 1UWCA 1JSZA 1EUZA 3P9YA 3TZEA 2XNSA 3TECE 1MDFA 4NDZA 3UT0A 1FP4B 1QRRA 2Z5LA 3D9QX 2IF0A 3DFZA 2EDAA 3VNBA 2REXB 3GOHA 3IIIA 1H65A 2H2DA 4YJ2B 1HQCA 2RGEA 1UM9A 1MPTA 2HLDD 1V8OA 2YV1A 3KNZA 1P31A 1AJEA 3HP7A 1EFVB 1H4VB 3R7WB 4EG6A 4ZI2A 3SLKA 2I03A 4UATA 4WLOA 4PNPA 3MWEB 4CQJA 1D6MA 2H4XA 2FMKA 2KWIA 2UZ3A 3LT5A 1KETA 3EGOA 1RI3A 1XXLA 2M1XA 1UP6A 3NTQA 4FCCA 2CNDA 4S2UA 4QARA 1KO1A 4G5FA 1A72A 3T1HB 3IS3A 2EZ4A 4DZRA 2A8YA 5AD1A 3DEJA 3L7IA 1HSZA 2I76A 2JANA 3K1TA 3ZHUA 2RGCA 4KKVA 3W3AA 4PG5A 3WWPA 2Y4NA 4JC8A 2B8WA 4B83A 5LQAA 4UQOA 1XXHE 3F1KA 1TM7E 5ESWA 2RGNC 4RMGA 1JF8A 1UL1X 4EA6A 2OZPA 3UF0A 4QBIA 4GBMA 1AKYA 1HKUA 5G3ZA 4ZIRB 1IOZA 1WQ1R 5DCLA 2GNOA 4BFUA 2IZ5A 1KJ9A 2C4VA 1H2HA 3N8GA 3FDXA 3WYCA 1MX9A 3U80A 2IEDA 1XMQB 3ZIAD 4GOLD 1QFXA 3KDAA 3P94A 4FJ0A 1XALA 2Y1DA 4J3NA 2BFPA 5KI6A 3UQYS 2GF0A 2NV2B 3BYZA 3RABA 4NKRA 4X64B 3TLBA 1U3TA 4GBED 4DV2B 2TECE 5KQPA 3GFFA 1QBKC 2IYVA 4Q7EA 4L2IB 3MRSA 4CG1A 1NSTA 3LT0A 4IICA 1HRKA 4EX6A 4C7BA 3U3KA 3CKKA 3KYCA 1KZYC 4YO7A 3TYXA 3NDPA 2CF5A 3ETHA 4OXXA 4CKBA 3EG9B 3ZNPA 3BGWA 2X5KO 2GDZA 1U1FA 3ZJTA 1A27A 3INGA 3O7MA 4PBTA 3LP5A 4ALKA 1RXVA 5HBRA 4PZCA 3HUDA 3OFKA 4ID9A 4X3CA 4PZEA 4WPGA 5TS2A 1UFQA 1SZPA 4Y0AA 1T24A 1EAYA 3WR5A 4XUEA 3VU3A 4MYUA 5B55A 2CVFA 5CAEA 3E2MA 1A9QA 4OQDA 1PK9A 2ZR9A 1TT5A 2JJMA 4U6QA 3VNAA 2D8MA 5DHFA 2XV1A 3ELBA 4WNCA 1CUVA 4PYNA 1PQYA 4BAZA 1QX4A 3ADDA 1WB5A 4OK3A 2BFEA 4NARA 5IF9A 4U7FA 1Y82A 3QUBA 4H6VA 4HX9A 4BMNA 4ZYTA 2IX3A 5JZBA 1N2BA 4R4JA 1XZAA 4CDGA 4Z49A 5B3JC 1NXWA 1N36B 4WLNA 1MW8X 2ZUWA 1UMDB 1N25A 1DAGA 2H8GA 3KLMX 3ZW7A 1OFVA 2X5OA 4CU5A 1WEHA 2VQ3A 1P4GA 4GM1A 1EEHA 2AG5A 2X3FA 2X7HA 3MUFA 3LT2A 4ALMA 1Q92A 1YHYA 3UXEA 4TL9A 3ETCA 1JECA 5HZKA 2PE5A 3SF0A 2UYGA 2YYYA 3R7BA 3N75A 1Q84A 1Z4QA 2C8JA 3COPA 3QBEA 2O3TA 2ZDQA 1PW5A 2OV3A 1FNDA 1W87A 1WCIB 1XDSA 2FWAA 3R0ZA 3ZHXA 4AXXA 4B6GA 1CWUA 3C24A 3K6SA 3BGSA 2CJWB 2IP4A 3EH1A 3KKMA 5F3RA 2JCXA 4BOYA 4F5YA 2DEUA 3D6VA 1DSSG 2V7PA 3K0SA 1OIXA 5HM6A 2OENG 2QTMA 4TXMA 3ZD7A 3ICQB 2AQHA 4CEHA 1XP5A 2HQOA 3AHJA 3BXZA 4M53A 1P9RA 3DM5A 2GYUA 1D2EA 4KH0A 5GVSA 2O8FB 1QG6A 3HKCB 5I7AA 5KTYA 1YS2X 2GAJA 3DBRA 1PWHA 4BNUA 5IDWA 4CM6A 4D0LB 2PKQP 3NV9A 1AKRA 4QQFA 2CCGA 2CMHA 1IL0A 2R7AA 4G5SA 4BMDA 4HGPA 4MKRA 4U2KA 1XKQA 3RS3A 1U8FO 4YUVA 1N2SA 4DCCA 1TJ4A 3GCXA 3U09A 3HN2A 4WFQA 1RPNA 2F8MA 2JI9A 5GONF 3S2FA 3EZGA 4LS3A 4HAIA 1A7AA 2IPOA 5DI3A 1E1LA 3STXA 2VUUA 1KRHA 2BKEA 5AW0A 3I64A 1SG0A 1TZJA 4GX0A 3WXMA 3G9UA 4WVLA 4CE6A 4HNUA 3JAKA 5DNUA 1GZHB 3BXOA 4UNNA 5A4DA 1VRVA 1T36B 5BSEA 2ZYTX 1GQFA 4RDHA 2WR8A 4YJKA 4R1PA 3T1QA 2PUWA 5H7XA 4F4CA 4F1KA 2H7VA 5FI5A 5ELLA 4P3KA 4PVDA 4QRDA 4LXXA 4GR4A 3OQPA 2QVGA 1E1CA 4Q47A 4RA6A 3V2GA 1Z0ZA 1TK3A 3GLIA 1R9NA 4BLRA 3OOJA 2VL7A 2ZWMA 4CKCA 2O7NA 4OFXA 4WKGA 1WDTA 5EE9A 2J1LA 1KI7A 3NALA 1G3UA 2X2FA 4ISBA 1F20A 1PR0A 4HN4B 5HDQA 3UMGA 3L8FA 3T38A 1P44A 4V03A 3L7MA 4HD8A 1R6VA 2UYQA 2QQ5A 4KPFC 1ZSNA 1L9KA 1TGVA 5D1NA 2XQFA 5KDOA 4KYTA 1GA4A 1OVMA 4L72A 2YVAA 3PGJA 4HTFA 5T4EA 3RK1A 2O8CB 3MAJA 4BFVA 3QMWA 1SPXA 1A77A 3KPUA 3L4SO 3CF0A 1G8YA 1TFRA 2P2DA 4NCXA 4NABA 1ULUA 1TM2A 1BD4A 2QR3A 2Y0DA 3IIEA 2WTXA 2ICAA 3ABSB 1A4IA 1EX1A 1T6ZA 3V3TA 3HZOA 2Q5JA 4B8WA 1ETUA 3IQIX 4IO1A 3USES 1EFDN 4HAVA 4B3FX 1QV9A 1VE3A 2WRZA 3R41A 3ENWA 4W7IA 2E5LB 4U9HS 2IITA 1XLWA 4LZNA 3KRTA 1S7CA 4M8KA 2OBBA 4ONEA 1XMSA 4WK4B 1RJ9B 3AX6A 4MR7B 3THWA 2ZWVA 4J1NA 1P6UA 2OKGA 5K09A 3L4JA 3NZEA 1PJ8A 3H4IA 3EZXA 1S2MA 1N2CA 1U3WA 2X8WA 4FILA 4RL4A 4OXIA 4WKBA 5AIAA 4CTKA 5JXHA 2VWGA 4FCTA 4IKOA 4AB1A 5IRCD 1K6MA 1K5PA 1XPUA 3QJGA 1GCGA 2PWAA 1Z8HA 3K6JA 1NI3A 2BWJA 3MIIA 2BJVA 1KWGA 3QEMB 4W9RA 1K89A 1QPGA 2C57A 1TO6A 4IZIA 3B9QA 3J81k 2QR2A 1C3EA 2ID9A 4M0PA 1RQ7A 3FUTA 3GO4A 3SBDA 3UB4A 3AERB 3WE7A 4IFBA 5CXUA 5C5EA 5C81A 1R0WA 2AIRA 5JTUA 3UGTA 3BVPA 2O3RA 1FLVA 3IEXA 3X2FA 3AEZA 4IUCS 1CY4A 4PX2A 3GLHA 1B8OA 4JI3B 1WXGA 3WP1B 2EATA 4YH1A 2B20A 1BDMA 4GVXA 4OI1A 3B5EA 4AK9A 1CLUA 2H1FA 3KR2A 4EW2A 4Q9DA 2ORIA 4FWBA 3TI7A 1Y1RA 1KSHA 2EERA 1L3BA 3Q7RA 5ERXA 3OHMA 2PL9A 3Q8WA 1PGQA 3ZC3A 2ZJ3A 5DU2A 4ZOAA 1K86A 3PA6A 1KZ1A 4IXMA 3QITA 2H3HA 3CPSA 4C4YA 3KKEA 5FRDA 4HWOA 4KXFB 5LBUA 2QM7A 3PDIB 4Y9TA 5HQ3B 2DBVO 1Q7GA 4NENB 3T9FA 1K0UA 3FSGA 4GH5A 4A15A 1H42A 2QNIA 4DUPA 1BQEA 2FSSA 2AOWA 1R0BA 3JYOA 1L7QA 1MN6A 1L7XA 1RM4A 4N0EA 2G1PA 3LRTA 1YRHA 2A59A 2ZJZA 3MT9A 2VHTA 4EPVA 1I7PA 2ZQZA 3AB3A 3KEFA 2FWJA 4NTZA 4HB3A 4LXQA 5GY7A 3NHBA 2O1XA 4FGLA 2FPGB 2QPLA 1D8AA 3GAFA 3PEWA 3U7EB 2H0RA 2HPVA 3Q5DA 4K9LA 4AFNA 2G72A 3QKRB 3ZS9A 4CR6A 1YWGO 2OCAA 1N77A 4M7PA 4M7OA 4CL0A 1BSVA 3DT9A 3ZZTA 4ZVSA 1A8PA 4E1VA 1XXHA 3FCSB 4FFRA 3VH2A 3L84A 2DH5A 2P2ZA 2C2KA 4RDCA 5G3YA 5T6MA 2BP7A 4KR7A 1CR0A 3EOBI 3I0MA 4LV6A 2ZFUA 3OZXA 4K9DA 4D4LA 1Z0AA 2MINB 1WLYA 2CJXA 3SEZA 4MKXA 2Y2UA 5AO9A 3TJZA 5AIBA 3N9IA 1WHSA 1TVEA 4WDQA 2V7XA 2P41A 1WVGA 4HVCA 1T2FA 2CUNA 2H9IA 5DZSA 1UBGA 2R1ZA 1FFBA 3TB4A 1EJ2A 1ZJ5A 1IQRA 2YHUA 3OU2A 5DASA 1BN7A 1D6NA 2M98A 4LYHA 3IIJA 4XJXA 2ERYA 1W2GA 5FH9A 2WB2A 4PQFA 1NOKA 1YDMA 4HNRA 4BO0A 1X15A 2RHHA 1SUCA 3E0QA 3NYRA 3OOEA 4X44A 3VU1A 4TV9A 4BGIA 3JAMA 2V0GA 1U0SY 2IVFA 1T8WA 4LNAA 1I1NA 4Y2VA 5AW6A 3ZVKA 4K28A 4D57A 5JEEA 2YICA 1HT2E 3KR9A 2VUIB 3GH3A 1YS1X 1QH9A 2G63A 3VNQA 3GEIA 4B33A 4WASA 4ZPXA 1ICEA 4W1QA 4TQUS 3A4NA 3D7KA 3NBYC 2HZBA 3KALA 3UK7A 4QEZA 2PTHA 4LJ7A 5DX8A 1DEAA 3ESXA 3SHVA 4BN0A 1YS9A 1EVYA 2ZJFA 3JQBC 4PC7A 3QLJA 2E48A 2FFAA 3LA8A 5D1HA 4TZTA 1TIKA 3BWVA 5GONB 1N5KA 2Z1DA 4PNZA 5FOWA 1I10A 4C14A 4UNQA 1YS7A 3P9IA 4R9UC 5U9CA 2FCAA 4MUNA 3SDSA 1GL9B 3KZ1E 1XLUA 3G68A 3I01M 3L7NA 4N5DA 2E49A 4PZZA 1IY8A 2CDRA 3BH0A 3A26A 2D1YA 1II8B 3CZAA 4BO9A 4ZCPA 1B0UA 5FLYA 1HL3A 2YY6A 3COJA 1J07A 1RMYA 4YXWD 5EKDA 3WMEA 5TPWA 1L0BA 3LLVA 1YF3A 2N46A 3EBOA 5CT6A 1G7TA 2C9MA 2QL9A 1RZRA 1JHRA 3LCUA 3HVIA 1B0ZA 5L51A 2RC6A 3JVVA 1Y3IA 3LPMA 4QQRA 4RW0A 4UUNA 3WLNA 2Z8XA 4JJ4A 2QTVB 5LUBA 3UOWA 1DMSA 1H3NA 3OMXA 4P82A 3AGQA 4IIUA 4PQYA 3PIDA 3W78A 4EKDA 2P3LA 4F3RA 2QYHA 3SGLA 3NP9A 3L7KA 2YNMD 1IZ9A 5AM4A 4D4GA 4LVOA 4UFOA 4R7GA 2P9QA 4WJZA 1K4MA 3C1AA 4QQKA 3LPLA 4BMVA 3FFBA 1J5XA 4EA9A 6ADHA 4ZI7A 2BMVA 2IHVA 2P6MA 2HRRA 1ZJYA 3DF7A 1W1WA 2QD2A 1A9XB 1P2GA 3P96A 4FFVA 4DCUA 2J87A 4I55A 1HG1A 3H04A 4E2XA 1Q6ZA 3GJZA 3QELA 2EQ5A 1KC1A 3G0GA 2BDTA 1ZM9A 1E0AA 1IZ8A 2CL0X 2Q6OA 4ETIA 4RHEA 4B46A 2I1WA 4AZ0B 4E4RA 1M8KA 2YWJA 5DBOA 2XSZD 1R6AA 5HXAA 1E2JA 4RHTA 4UAUA 4MPDA 5AESA 5JANA 3HSSA 5DM0A 4ZV4A 1UIRA 4KTVE 1H2ZA 3O7WA 1EUCB 3BJEA 1ZM3A 3STYA 1ORRA 4CL8A 4DDWA 3LKBA 1E4EA 4TUYA 4JI4B 1A2QA 1RE1A 2QAGC 1KFBB 4BFZA 4CUKA 4Z1MD 2RJOA 3DNPA 2ZR0A 4L5AA 3UN1A 5A02A 5CVTA 4LYDA 4YFYA 1YT5A 3P7MA 2RHOA 3OJCA 3BN3A 1GPMA 1GGKA 1WWKA 4YO8A 3TX6A 1JA9A 4ZAZA 3JR3A 3CLUC 4EPTA 2PGXA 4Y1RA 3EYAA 2XXJA 1LKZA 1U28C 2H11A 2XYHA 3PHJA 4D6PA 2GF2A 1U0NA 2R6DA 4J1TC 3T9DA 1IZZA 1MTOA 4LNUA 4WA7A 2E6KA 2W6MA 3KOYA 3PNBA 2RGDA 1CT9A 4JLUA 1J0BA 3TX2A 4F45A 2KLBA 4F1WA 3JQEA 3LQKA 4HLNA 1VPEA 2FQ1A 1E20A 1O94C 2DR3A 1Y8RA 3DCYA 3EF1A 4UD2A 1GNLA 4I1SA 1CXZA 4XJVA 4GLBA 3SXJA 1Z07A 4J0KA 2HF2A 3OC6A 1UR5A 3KE8A 3PR1A 1MCZA 2HF9A 3BT7A 2PWPA 1FFWA 4IUDS 4P32A 4YPFA 1QS0B 2Q5LA 1SCNE 3D8BA 3HHEA 5LQCA 1CY7A 1RXWA 4CIBA 3RRFA 4NIMA 3GLKA 1ZNYA 4WDRA 4A03A 4XTCS 5E9JA 1P0MA 1XK7A 2IZZA 4PXAA 4P0QB 2WABA 3CR8A 5EKUA 1FTNA 4FIDA 4IRXA 1N4AA 4YV1A 2R6HA 4G0NA 2PGOA 1LPMA 2QVLA 3ZE1B 4D3FA 5IKXA 4CIDA 4KZKA 1M2VB 4M0EA 3WRYA 4BB0A 4LIPD 3E3MA 4JJIA 2PJZA 4NK4A 3HWRA 3VO9A 1WOMA 1XI2A 1JDBC 7REQB 3VR1A 1E0SA 2HA7A 2YS6A 3WNCA 4Z7OB 3U81A 4HYYA 3AVPA 3C3EA 1JB9A 4TTSA 4YRTA 1YFLA 1YUBA 2RH4A 3MILA 4GPD1 1QFZA 1B14A 4RJIA 1G4HA 2EBWA 5KQRA 4WOJA 2IEYA 4XR9A 4I2NA 5DOVA 1WUTA 1ZNQO 4LSGA 3A11A 3WLRA 3DE7X 3NUGA 3A1UA 1C9JA 4UAVA 5ANRB 4Y2QA 4EQ6A 2I54A 4EWLA 3H86A 4YJHB 3AF5A 2CBZA 1L7RA 2V7GA 3Q3CA 3TQSA 3DLAA 4COKA 1YU6A 3ZJ4A 2DT8A 4N7JA 4A8JA 5JAOA 1UBLS 2W5UA 4RIEA 5GJBA 1B93A 3C0KA 4A0RA 3R5FA 1Z12A 1U3FA 4WGFA 1AUQA 2J5BA 2Q2OA 2J0VA 4L4UA 4RV4A 1JNXX 1OAOA 4FS3A 3K9WA 3O8RA 3DS8A 3FZEA 4NC9A 1Y7IA 5EXSA 5JALA 3IAFA 1S3FA 1Z56C 4YR9A 4LCBA 4K6GA 3AF4A 1PE0A 2BFWA 2CUTA 2HD4A 2X77A 2P9GA 1OASA 3LQYA 4TMZA 1W5SA 5E3JA 3UWKA 3VBCA 2CN1A 1NVMB 4PZPA 3CV3A 4MUMA 4KG7A 4ZYZA 5CDUA 1KHTA 2GLXA 3V55A 1F8YA 4P3YA 4AG3A 4C2BA 4MQFB 1J39A 1RBYA 1NIPA 1YQQA 2DSNA 3INRA 4FOLA 1FYEA 3F6PA 5EC8A 3ZKWA 4PHHA 2AJ8A 3S8EA 3K1JA 2HQSA 2OUIA 4UOQA 2ACKA 3L7CA 4XB1A 4LEIA 1X3LA 5UKDA 1BH6A 5A4KA 5KDDA 1ID8A 2PT9A 4ZQIA 4TT3D 3RVMA 1VG9B 2PYZA 2O2IA 3PC2A 3JQDA 5C8XA 1TMGE 2SECE 1RBZA 4NBRA 1S8AA 4GDFA 4ZGGA 1QTNA 1PG0A 3IR6A 3EUWA 1XEXA 1DWOA 4RSGA 1IN8A 4WV3A 3IE0A 5AI9A 2AX3A 1PJRA 2AJDA 2PZJA 3V3KA 3WB9A 1CDOA 5CGZA 4CMGA 3TDKA 4CQMA 1MQSA 3DJFA 5KX5B 5BVHA 1J24A 5IDQA 2HH9A 3A7EA 1BJTA 2C0QA 1VM6A 3DMGA 3FA2A 3PWKA 5DK6A 3MD0A 3WWZA 4YIHA 1NMYA 3TRIA 1G8AA 5IVIA 3HDQA 3ZWAA 2UZ0A 3CH5A 2Y0CA 3GLFE 3I1IA 4DDKA 3Q7TA 1YXMA 5A1TA 3RSCA 4O0LA 1KH2A 3IHKA 2EG9A 1D2RA 4YP0A 2IHKA 1AO0A 3NANA 3E7DA 3A9WA 1BEUB 2FSUA 1TLTA 3AJ9A 3WNVA 1IOLA 4DGQA 3T9CA 4NAVA 1OLSA 4C4SA 1SXGA 2HPZA 2FN9A 1ADFA 4OGWA 3P32A 3W5AA 2D54A 2O1EA 4MCJA 1X39A 2AFIB 1X80B 2IZ1A 2QDKA 2J5QA 4HFNA 4NMLA 5EWLB 1Z25A 4A4DA 5EESA 4C29A 3BMOB 3OWXA 1X7WA 1O96B 1QIKA 3K5WA 4GVPA 5CXSA 1QH8B 1GIAA 2C9DA 4H3HB 1G1MA 4RLFA 5DTIA 1FFCA 4IFTA 5JH7A 3GP3A 3JY6A 1F51E 5EUQB 4HUQB 4J4HA 4UJ3A 1JJFA 1DUSA 2ZAYA 5JJ5A 1CUIA 2EL7A 2RB4A 4PYIA 5CLFA 1CS0A 5MF6A 2QBYB 3ITDA 2I80A 2FHPA 2P8SA 2VNKA 1Q6YA 4ICIA 2CXSA 4JR0A 2LIPA 5EHNA 5H1YA 1OTHA 1JVBA 2BI4A 1RTTA 2JBAB 3L2OB 2W8BA 5T4FA 1VMEA 3L6OO 3W90A 3WZ2A 4ABYA 4DLRA 5JAIA 1KU0A 1J0DA 2Q7XA 3DUFA 4TTTS 4XLTA 1KDVA 2XCOA 5A5EA 1CD5A 1RC1A 3A05A 4J8PA 2JI4A 4D25A 2C9CA 1XG5A 1N0HA 3RFCA 3GEDA 4FXOA 1R0XA 3D4BA 4JBLA 2QLMA 1C3OB 3LUGA 3VBEA 1LF5A 4KXVA 2JLYA 121PA 5GJVC 4B2LA 4ARZB 4AUEA 4JLAA 1TF7A 1AHPA 1GQSA 1QGDA 2P90A 3GXOA 1CUBA 1SD2A 2CKMA 4ZCSA 4W6QA 1KJZA 1L4YA 2AYYA 4YK7A 4RENA 1C1DA 3EXEB 3FY4A 1O2DA 4DLVA 9ATCA 5NULA 1G9XA 1L5WA 4TRJA 3AM1A 3LQRA 4LOJA 1Y34E 5J1SB 2HBYA 3EIUA 3G2NA 3ST7A 5JD4A 8GPBA 4M7RA 4HNGA 4KQFA 4CM9D 4HYEA 1A95A 3VTAA 2VKQA 2CD9A 5C5CA 3E22B 4G1FA 1TU3A 1DC4A 3BHNA 4MARA 2DR2A 2IXAA 3P9CA 2FEXA 1LNZA 2O0HA 3ZW9A 2OXEA 4ENVA 3SJZA 1FQJA 3E5RA 2R7KA 5LB2A 3B9PA 1I8TA 1P1HA 3KJEA 4M9CA 3KQTA 2Q28A 2C42A 5HYVA 2W2QA 3UCFA 1BX3A 2XUZA 2IHZA 5DHQA 1KDYA 4DMKA 3TGWA 2BR3A 4RGQA 3TVDA 2AXNA 1ESCA 1GNVA 2AEMA 3BAFA 4A92A 4EIWA 3JTMA 3ZPXA 3GMTA 4NZYA 1JPUA 4PHTA 5K0BA 1C9DB 5HDBB 3I1JA 4Q3OA 4G4IA 1MV8A 1U2RA 3I32A 4GX1A 4Q3BA 2GS9A 2TRSB 1HMYA 1V8DA 2R4TA 5CYOA 2W6JD 3RJ9A 1K63A 2O48X 3FFTA 4J6EA 1IUOA 4E4YA 3ADBA 4HEQA 2Q6IA 3MLBA 2A5JA 1LEHA 2DFNA 2V98A 4MMXB 4QYIA 3FOCA 5JMPA 3TD9A 3MAAC 4QVKA 1LBQA 2C2WA 4HBZA 1WPXA 4HFJA 4UC0A 3H8JA 3LK6A 5IBCA 1YDEA 3EPLA 3U4DA 4GKKB 3CUWA 3VM6A 4F8JA 2F43A 1FDVA 2I29A 1M54A 3PPXA 2UYYA 3QA9A 2G36A 2JJ1D 3I2YX 3RIMA 2NU9A 1N6NA 1K5GA 1UPFA 3TD6A 1PNOA 1RC0A 2XWSA 4NAHA 2OV1A 1DP4A 2BONA 3D7LA 4JT8A 1X1DA 3RQIA 5L3ZA 5EMKA 4L85A 1AE1A 2H1WA 2GPAA 1OIVA 2ZUSA 5C80A 2PSFA 4LF5B 2AEFA 1Z0FA 5IASA 4MI1A 1VYUA 3BZWA 4AWXA 5KQMA 1UDCA 3FHLA 1OJLA 5JCPA 4BO6A 3HCEA 1ZVMA 3LO5A 1NJGA 2OVFA 2ZYSA 3G3EA 1NA5A 4BJ1A 2X6RA 3WFJA 1OKKD 4E03A 2O8EA 3A3PA 3IO3A 5FQOA 1ZXXA 2J6HA 4TRRA 1AKTA 1OYWA 4AX4A 3DXYA 2FDCA 3I34X 4BMSA 3D4NA 5JO0A 4GOOD 1X86B 2G1JA 3GFOA 2B99A 3GEBA 1JQLB 1MZPA 3PF9A 4GXNA 4URXR 2UVPB 2PGJA 2RG7A 2XOKD 1SC9A 2DHRA 4HQRA 1SVWA 1QWOA 1EQUA 1WM1A 3GP5A 2F90A 1SC4A 1CUZA 4DF3A 4EB6A 4MXDA 1G59A 3ZJUA 1SD5A 1GGHA 2N0SA 1XDDA 4F9GA 2C07A 1A7UA 1VRWA 1OKKA 2RGBA 3V4ZA 13PKA 4QREA 3HDJA 2EZUA 1KK2A 4GECA 3V1NA 4PN3A 4U39A 3IAS1 5B7PA 5LQKA 1SHUX 1PS8A 1V4NA 1RP1A 1U2GA 4PX3A 4ZJZA 1X87A 4IVPA 3IE1A 2YV2A 1C9EA 1U4NA 1ODJA 1NOJA 3BFVA 4IDFA 2Z5VA 1A97A 2Y1KA 2F9LA 4MV9A 4OM8A 4Q4HB 4A1FA 3JQ7B 5ICSA 2VTVA 1L5FA 4JASB 2XGSA 4OHBA 2BGLA 3K9CA 3T7KA 3HZHA 1JFSA 3WL4A 3GRCA 1R6UA 4IBOA 4R0VA 1S2LA 1GRRA 3B89A 5LZ9A 5ERGB 1EFHA 4KO3S 1KOJA 1CU1A 4A82A 1OTYA 2X19A 2LZ0A 4BIMA 4LZPA 2XTAA 1E8MA 2B35A 3ES9A 1NLZA 1JTVA 3T3PB 4JQZA 5F9FA 1NXQA 2DGDA 3F6RA 3LQ2A 3LDFA 4IOJA 4DNPA 4EHKA 3E03A 1TYBE 3EUAA 3ZV6A 4KIJA 4R1UA 1U7ZA 1UMBA 1PSDA 3CO5A 1E8DA 1QHHA 1ZLYA 1ML4A 1L4MA 2GZ2A 2VTKA 3BZBA 1DBQA 2FPKA 3KTOA 3RIHA 1JAIA 3NIFB 4XX0B 1TC1A 3SE7A 4G67A 2PRYA 2DBQA 4FS8A 1NWCA 4FWTA 1YK1A 1LRJA 1Y5MA 2LBPA 1P3DA 4PYJA 5BSWA 5CFNA 1RWNA 2AUNA 3KQWA 3V2IA 1P2UA 2GJ4A 3FIUA 1T1SA 4I99A 1RCFA 2VA8A 4NEQA 4BFLA 1TVMA 2XBUA 3HKBA 2F55A 1KJWA 3UK0A 4DCVA 2JLUA 4LRQA 5AM1A 1CZRA 1JZQA 4MB2A 2V7QA 3OIVA 3EXHC 4MQFA 4C30A 4BDSA 2CL6X 1Z82A 4J3JA 1ZN2A 1M2OA 1JHQA 1G5IA 1L8XA 2VQDA 3ETGA 4YR7A 3BBLA 1GTSA 2RH5A 1W5TA 1JG2A 2XUHA 4Y30A 5EJIA 3WK6A 4JHLA 4C6TA 3CRRA 1FU4A 1VE9A 1SURA 3ORFA 3CTMA 4MLPA 1I7NA 1CUCA 1R12A 3C85A 1TTQB 3OFND 3DXXA 4LSZA 4KR6A 1J7KA 2GEDA 1T6BY 1PR5A 3DWGA 3DEAA 1KEWA 5TPZA 4MA5A 3LQQA 4DC1A 3FWHA 4NV1A 4EYEA 1NMSA 2VZEA 4UUQA 1KAEA 4WKNA 1RQNA 2ATVA 4N82A 5BWBA 4GUDA 5KMGB 3AWIA 2WM9B 1OH8A 2ECQA 4WI1A 1E96A 2PRZA 3F4LA 2FR8C 2XGOA 1L1EA 3HZRA 3VR4H 1RAIA 2GBLA 1GPDG 1CJKC 4CM7A 1GPNA 3LHIA 4ZDKA 2NZWA 4FW9A 5BQFA 3GLFA 1ZJ6A 3CRQA 1OH6A 4MS4B 3ZXUB 4QHTA 1OA1A 3S44A 4JR1A 4AIIA 4KRGA 1ANKA 2OHHA 4LHVA 4O4JF 4U2GA 4PFQA 3BWDD 4RXMA 3OFNA 3K70D 4Y98A 2IV7A 1GWNA 6YASA 3ADKA 3RUFA 2B36A 4BNLA 3UQZA 1E3TA 3U4IA 5DX1A 5ULLA 3BBPA 3ZE2B 1M7GA 4IH1A 4P2BA 4JLDA 1NULA 1CNEA 1RI4A 2GK6A 2XX3A 4QJ4A 4PFKA 3ZWMA 3NRJA 2BFMA 8ADHA 5HJ7A 3TVTA 2AOTA 3WYFA 5D3MA 3FMVA 2JAOA 3ABIA 3DFUA 1QHFA 3I0ZA 3L7YA 4U7GA 3VMMA 4QA9A 4KVGA 1CZLA 1E63A 3CLSC 1LBSA 1J22A 1XX6A 1QYIA 4IDDA 5BW4A 4P1ZA 5TDHA 3GLGE 3E3LA 4QM7A 1UINA 2AJLI 4ZTZB 1KYQA 2RI6A 3MQ2A 4KR2A 2JASA 1R8QA 3EN0A 1RLMA 1T0PA 1Y6JA 1JIQA 4ZU3A 4A5OA 1ITZA 4YT2A 2LD4A 2Y1EA 3F7MA 1QIDA 4J43A 4PS1A 4XGQA 2QTWB 3DBLB 1EG2A 1M2FA 3PXUA 4Z9AA 3ZEAA 2Z43A 3EVNA 1E7WA 4JJ8A 3HP4A 4U8GA 3C74A 3H2BA 1X0XA 3MEQA 4B2PA 1P2FA 4GZ5A 1FQOA 1W4RA 2C4MA 2O3UA 5DT2A 3V7NA 3WJ2A 2EP8A 3AYXB 2F3TA 3NBXX 2C5LA 2BOVA 5DKFA 5IJ9A 2PRIA 4RKYA 4OGFA 2Q46A 1ECBA 2OP0A 1XAIA 3FCCA 1NFFA 2EEZA 2D3TA 2I65A 2WWIA 4KC0A 1L8OA 4X95A 2CV2A 4J0GA 4NMMA 1LLCA 4KWIA 3Q3IA 2KSQA 3VR5H 3OZUA 4AJEA 4IILA 3IYLW 1MV5A 3AYZB 9LDBA 1WCWA 2A57A 4GI7A 3N0TA 2XMPA 3CKMA 1IBKB 1F1BA 4ME6A 4O3FA 2YIMA 2YV5A 2IZOA 4RJ2A 2OHIA 3H75A 2C1EA 1GZ4A 3KSRA 5KYUB 3UGQA 3WBKA 4A6DA 4EFMA 3L6CA 1HZZC 1YCGA 3PE4A 4D9NA 2NP7A 1VFNA 3V97A 1R4ZA 4UZEA 1LQTA 3O91A 5AXBA 4ZVVA 3VZSA 2WKQA 2IYLD 2YVLA 4X85A 5HKKA 3F8SA 1DARA 3DPIA 5A71A 1CVIA 2IEBA 1FRVA 5JR3A 3HU3A 1VHJA 5D8DA 3C14C 1GTRA 4JSRA 1C7QA 3S27A 4QJ5A 5IPFA 3SDBA 1NJ8A 5EUBA 2GN2A 4EPYA 1TL7C 3I28A 1X77A 5B5SA 5J2UA 4H7EA 2PNJA 2Z58A 5ITVA 4YI3A 4L7VA 3UWSA