4GZYA

Crystal structures of bacterial rna polymerase paused elongation complexes
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
223
structure length
223
Chain Sequence
KAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis of transcriptional pausing in bacteria.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription/dna/rna
total genus 39
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4gzyA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4gzyA01
2JA8C 4A3BC 5C3EK 4MEYA 3GTKK 4OIOA 4QJVB 3S1RC 4OINA 2E2HK 3H3VL 3HOZK 3FKIK 5IYCC 3S14K 2R93K 1K83K 1WCMC 4A3MC 3GTJC 4YG2A 4A3EC 5C4XK 4A93K 3K7AK 3HKZD 3RZOC 3I4NC 2R92K 3GTPK 3PO2K 3M4OK 3M3YK 4BY7K 3I4MC 5IYBK 4A3KC 4A3IC 4C2MC 5IP7K 3HOYC 4A3FC 1SFOK 3S16C 2A69A 4A3LK 1YNNA 2NVYK 3HOXK 5C44K 4YFXA 4XLPA 5C4JC 3RZDC 2VUMK 1BDFA 4LK0A 2A6EA 2E2IC 3GTQK 3GTMK 3PO3K 2B63C 3HOVK 2JA5C 4C3IC 3H0GC 4A3GC 2JA8K 4A3BK 4LLGA 4X6AC 3HOUC 1XPPA 3GTGC 4QIWD 3HOWC 2JA6C 5IYCK 1WCMK 4A3MK 1I50C 3GTJK 4OIPA 4KMUA 4A3EK 2BE5A 4C3JC 5FLMC 3RZOK 1Y1WC 3I4NK 2WAQL 2E2JC 3S17C 3S15C 1I3QC 2PA8D 2WB1L 2NVQC 5IP9C 5D4DA 3I4MK 2YU9C 4Y52C 2NVXC 4A3IK 4C2MK 1TWCC 3HOYK 4A3FK 3S16K 3GTOC 5C4JK 3RZDK 1YNJA 2E2IK 2B63K 2PMZD 1Y1VC 1TWAK 4C3IK 3H0GK 2JA5K 4A3GK 4X6AK 3HOUK 4QJVA 4C3HC 2O5IA 3S1MC 3GTGK 5TMFA 3HOWK 2JA6K 4BY1C 2Y0SD 4KN7A 3S1QC 1I50K 3S1NC 3CQZC 5IYDC 4GZYA 4A3CC 4C3JK 5FLMK 3S1RK 1Y1WK 2E2JK 3S17K 4BBRC 2NVTC 1I3QK 3S15K 2NVQK 5IP9K 2R7ZC 3WODA 3DXJA 2YU9K 3GTLC 4BBSC 5M5XK 2NVXK 4Y52K 2PPBA 1TWCK 4A3JC 4A3DC 2JA7C 4LK1A 4LJZA 3S2DC 4A3KK 4QIWL 5M3FK 4MQ9A 4JK1A 5TMCA 4Y7NC 4OIQA 1Y1VK 4AYBD 3S2HC 1ZYRA 1TWFC 4OIRA 1I6HC 2CW0A 2PA8L 5M5YK 4XLNA 5M5WK 2O5JA 5FJ8K 4C3HK 4BXXC 4A3LC 3S1MK 4YFNA 3HKZL 2A6HA 3H3VD 4BY1K 3S1QK 3S1NK 1TWGC 4MEXA 3CQZK 5IYDK 4A3CK 1TWHC 1R9TC 3EQLA 4BBRK 2NVTK 1HQMA 4KN4A 2PMZL 2R7ZK 3GTLK 4BBSK 5C3EC 4A3JK 3GTKC 2JA7K 4Q4ZA 4A3DK 3S2DK 4YFKA 3HOZC 2E2HC 3S14C 4Q5SA 2R93C 3FKIC 2Y0SL 1K83C 1IW7A 5M3MK 4XSXA 5C4XC 2A68A 3GTOK 4A93C 4Y7NK 3K7AC 3GTPC 3S2HK 2R92C 4G7HA 1TWFK 3PO2C 3M4OC 1I6HK 3M3YC 4BY7C 5IYBC 4BXXK 4G7OA 4XSZA 5IP7C 4NOIA 1SFOC 1TWGK 1SMYA 2NVYC 1TWAC 5C44C 3HOXC 2VUMC 3GTMC 1TWHK 1R9TK 3PO3C 3GTQC 2WAQD 4ZH4A 4G7ZA 2WB1D 4AYBL 3HOVC 1I6VA
chains in the Genus database with same CATH superfamily
2ZUEA 3TFIA 4G0VA 4WF9S 1RU0A 1J6WA 3HOZK 1VLOA 3IPJA 3GTJC 4KDDA 1WSVA 3K7AK 3RZOC 3GEEA 4GTBA 4KM9A 3GTPK 4WJ4A 3M4OK 1USMA 3ADAC 4WFNS 4A3KC 5IP7K 2A69A 3L4JA 2NVYK 1O29A 4U67S 3RZDC 2VUMK 2JA7A 1BDFA 4LK0A 1O27A 4A3GC 4QIWD 3AD8C 4OIPA 4KMUA 4C3JC 3LPXA 1O24A 3I4NK 4G0WA 3S17C 3S15C 1I3QC 2WB1L 5IP9C 3AQOA 5HQHA 2V6TA 5DM7S 3AD9C 2KXYA 2ZJRS 3GTKA 3OEPA 2B63K 1VRQC 4GT9A 1Y1VC 4C3IK 4DDQA 1XZPA 3HOUK 2R92A 3LYWA 3HOWK 4J3NA 2Y0SD 1J6XA 4KMDA 1IL2A 4GZYA 5FLMK 4BBRC 2NVTC 4GTCA 3BP3A 1USOA 4BLBA 3PIOS 4AH6A 4A3KK 4QIWL 5M3FK 5DM6S 3T00A 4JK1A 1ZBSA 2XCOA 5FJ8K 3BUEA 3S0XA 3CAGA 2XCQA 4WCES 5HL8A 2EBBA 4MEXA 1JOEA 5IYDK 1F9NA 3SZYA 3FOEA 1R9TC 3G4AA 3EQLA 4KM8A 4KN4A 4LQYA 3GTLK 2KQ1A 4A3DK 3S2DK 4YFKA 3HOZC 4KB2A 4KMHA 3A8JA 2Y0SL 5JVOA 4XSXA 2A68A 1YCLA 3K7AC 3GTPC 1B4AA 1J98A 1TWFK 3M4OC 3GTLA 1I3QA 5IP7C 1TWGK 2NVYC 1TWHK 2VUMC 2PHCB 1TWFA 5CJ9A 1WIHA 4WFAS 4GTEA 3TFJA 1WOPA 4G0UA 1Y1VA 4QJVB 2R93K 1PJ6A 3S14K 3FKIK 1K83K 4A93K 3I4NC 4PAAA 3PO2K 3M3YK 5JVGS 2GSOA 3HXAA 2P5MA 1O25A 4BLAA 2R93A 4P5BA 1K83A 4YFXA 3PO3K 2A6EA 1EFWA 3GTQK 2B63C 4C3IC 2JA8K 4A3BK 3VA7A 1XZQB 3HOUC 3HOWC 4P9SA 4A3MK 1XZPB 4A3EK 2BE5A 5FLMC 2ZJPS 1PJ7A 2PA8D 1R9TA 1J6VA 3HOYK 4A3FK 5C4JK 2E2IK 4IOCS 1WOOA 4BKWA 2PMZD 3H0GK 3FOFA 4X6AK 3GTPA 4QJVA 5TMFA 2JA6K 2W7VA 4KN7A 3AD7C 1I50K 5IYDC 1C0AA 2NVYA 2VUMA 2YU9K 3GTLC 5M5XK 4Y52K 3GDZA 4A3DC 4LK1A 2GAHC 3S2DC 4MQ9A 4C45A 2XCRB 5CHPA 1TWFC 1XZQA 2PA8L 4GTFA 2YU9A 4XLNA 4C3HK 4A3LC 3T01A 2A6HA 3S1QK 3S1NK 1XXCA 1TWGC 3CQZK 4A3CK 1TWHC 1HQMA 2PMZL 2R7ZK 1O28A 4BBSK 3A8IA 2B63A 1WQFA 2R93C 3S14C 4Q5SA 3FKIC 1K83C 4A93C 4Y7NK 1ZXOA 3S2HK 3PO2C 1I6HK 3M3YC 5IOSA 4BXXK 2RH6A 4NOIA 1F93A 4XCHA 1SMYA 1TWAC 1AB4A 3PO3C 3GTQC 2WAQD 4ZH4A 5IORA 1EK8A 2JA8C 4A3BC 3TTGA 3G4CA 3S1RC 2E2HK 4A3MC 4A3EC 3HKZD 3A8KA 3BP8C 4GTAA 5EGHA 4GTLA 4KASA 5IYBK 1VH2A 3AQPA 3HOYC 4WFBS 1JQWA 4A3FC 4A3LK 1YNNA 1DCHA 3HOXK 5C44K 5C4JC 4XLPA 2E2IC 4KC6A 3HOVK 3H0GC 3GIRA 4LLGA 4O2DA 4X6AC 4FM9A 1XPPA 5IYCK 2JA6C 1WCMK 2CFAB 1I50C 3T02A 1TWGA 2WAQL 3I4MK 1TWHA 5D4DA 4KAWX 2YU9C 4Y52C 1WOSA 4A3IK 1F7UA 4C2MK 3L4KA 3S16K 2ZUFA 1YNJA 1BJTA 1FEUA 3OPFA 1V5VA 3CF5S 3JSTA 2GSUA 3FKIA 5L46A 1TWAK 2JA5K 1B4BA 1F7VA 4C3HC 3GTGK 3S1QC 3S1NC 2GSNA 3CQZC 3S1RK 4A3CC 1Y1WK 2E2JK 1TWAA 2NVQK 2R7ZC 3WODA 1DD5A 4GFQA 4BBSC 2NVXK 3GTQA 2PPBA 1TWCK 1BS2A 3GEHA 4LJZA 1WQGA 3N0CA 2L3UA 4Y7NC 2FQOA 3S2HC 1I6HC 5M5WK 2O5JA 4BXXC 1O2FB 3S1MK 4YFNA 3H3VD 4BY1K 1X31C 2CFAA 2RGRA 1JVIA 2ZJQS 3N0BA 4M1XA 1IS1A 3DLLS 2E2IA 4A3JK 1INNA 2JA7K 1UV7A 3H0GA 5EGEA 2E2HC 4KMAA 1IW7A 5TJ3A 2KPUA 1EQRA 2JA6A 1I50A 1ZQ1C 4G7HA 4KB4A 5IYBC 4G7OA 1O26A 4XSZA 1PJ5A 4P5AA 3HOXC 1XXBA 5C44C 3MMLB 4ILDA 3Q3QA 3ERED 3LAPA 3HOVC 5C3EK 1ZVUA 4MEYA 3GTKK 4OIOA 4OINA 3H3VL 5IYCC 1WCMC 4YG2A 1VGXA 5C4XK 1ISEA 3FHZA 2R92K 3GSIA 3CQZA 4BY7K 1G51A 3I4MC 5JVHS 4A3IC 4C2MC 2R7ZA 3AH5A 1SFOK 3S16C 3GTMK 5JFEA 1KQ4A 2JA5C 2JH3A 3NUHA 3GTGC 1SFOA 3GTMA 3GTJK 4WJ3M 3OREA 3LAJA 3RZOK 1Y1WC 2E2JC 1BGWA 2NVQC 2V6SA 3N3YA 2NVXC 1TWCC 2GAGC 4FZBA 1XXAA 4KATA 3GTOC 1DCOA 3RZDK 3GTJA 2E2HA 1IE0A 1EH1A 3V4GA 4A3GK 2O5IA 3S1MC 4GTDA 4BY1C 2D6FC 4IOAS 4C3JK 2FQTA 3S15K 1I3QK 3S17K 5IP9K 3DXJA 5E68A 1EI6A 4A3JC 2KWAA 2JA7C 4LR2A 1VJEA 5IOQA 5TMCA 2ZFZA 4OIQA 1Y1VK 1WCMA 1YX2A 4AYBD 1ZYRA 4IO9S 4OIRA 2CW0A 5M5YK 2Y3PA 1IQ0A 3GEIA 2L5NA 3HKZL 1O2AA 1HI9A 1WORA 4BBRK 3SZZA 5IOTA 2NVTK 1GE9A 3TFHA 3QX3A 2V6UA 4PABA 5C3EC 3GTKC 1IBAA 4Q4ZA 1L0WA 2JA5A 4WILA 1DCPA 1WSRA 5M3MK 3GTGA 5C4XC 3GTOK 3PIPS 2R92C 4BY7C 1Y1WA 4KARA 1SFOC 2NVXA 1WQHA 1TWCA 4LOWA 3GTMC 5HL7S 1O2BA 1R9TK 3GTOA 4G7ZA 4RMFA 2WB1D 2P8TA 4AYBL 1I6VA
chains in the Genus database with same CATH topology
2JA8C 4A3BC 5C3EK 4MEYA 3GTKK 4OIOA 4QJVB 3S1RC 4OINA 2E2HK 3H3VL 3HOZK 3FKIK 5IYCC 3S14K 2R93K 1K83K 1WCMC 4A3MC 3GTJC 4YG2A 4A3EC 5C4XK 4A93K 3K7AK 3HKZD 3RZOC 3I4NC 2R92K 3GTPK 3PO2K 3M4OK 3M3YK 4BY7K 3I4MC 5IYBK 4A3KC 4A3IC 4C2MC 5IP7K 3HOYC 4A3FC 1SFOK 3S16C 2A69A 4A3LK 1YNNA 2NVYK 3HOXK 5C44K 4YFXA 4XLPA 5C4JC 3RZDC 2VUMK 1BDFA 4LK0A 2A6EA 2E2IC 3GTQK 3GTMK 3PO3K 2B63C 3HOVK 2JA5C 4C3IC 3H0GC 4A3GC 2JA8K 4A3BK 4LLGA 4X6AC 3HOUC 1XPPA 3GTGC 4QIWD 3HOWC 2JA6C 5IYCK 1WCMK 4A3MK 1I50C 3GTJK 4OIPA 4KMUA 4A3EK 2BE5A 4C3JC 5FLMC 3RZOK 1Y1WC 3I4NK 2WAQL 2E2JC 3S17C 3S15C 1I3QC 2PA8D 2WB1L 2NVQC 5IP9C 5D4DA 3I4MK 2YU9C 4Y52C 2NVXC 4A3IK 4C2MK 1TWCC 3HOYK 4A3FK 3S16K 3GTOC 5C4JK 3RZDK 1YNJA 2E2IK 2B63K 2PMZD 1Y1VC 1TWAK 4C3IK 3H0GK 2JA5K 4A3GK 4X6AK 3HOUK 4QJVA 4C3HC 2O5IA 3S1MC 3GTGK 5TMFA 3HOWK 2JA6K 4BY1C 2Y0SD 4KN7A 3S1QC 1I50K 3S1NC 3CQZC 5IYDC 4GZYA 4A3CC 4C3JK 5FLMK 3S1RK 1Y1WK 2E2JK 3S17K 4BBRC 2NVTC 1I3QK 3S15K 2NVQK 5IP9K 2R7ZC 3WODA 3DXJA 2YU9K 3GTLC 4BBSC 5M5XK 2NVXK 4Y52K 2PPBA 1TWCK 4A3JC 4A3DC 2JA7C 4LK1A 4LJZA 3S2DC 4A3KK 4QIWL 5M3FK 4MQ9A 4JK1A 5TMCA 4Y7NC 4OIQA 1Y1VK 4AYBD 3S2HC 1ZYRA 1TWFC 4OIRA 1I6HC 2CW0A 2PA8L 5M5YK 4XLNA 5M5WK 2O5JA 5FJ8K 4C3HK 4BXXC 4A3LC 3S1MK 4YFNA 3HKZL 2A6HA 3H3VD 4BY1K 3S1QK 3S1NK 1TWGC 4MEXA 3CQZK 5IYDK 4A3CK 1TWHC 1R9TC 3EQLA 4BBRK 2NVTK 1HQMA 4KN4A 2PMZL 2R7ZK 3GTLK 4BBSK 5C3EC 4A3JK 3GTKC 2JA7K 4Q4ZA 4A3DK 3S2DK 4YFKA 3HOZC 2E2HC 3S14C 4Q5SA 2R93C 3FKIC 2Y0SL 1K83C 1IW7A 5M3MK 4XSXA 5C4XC 2A68A 3GTOK 4A93C 4Y7NK 3K7AC 3GTPC 3S2HK 2R92C 4G7HA 1TWFK 3PO2C 3M4OC 1I6HK 3M3YC 4BY7C 5IYBC 4BXXK 4G7OA 4XSZA 5IP7C 4NOIA 1SFOC 1TWGK 1SMYA 2NVYC 1TWAC 5C44C 3HOXC 2VUMC 3GTMC 1TWHK 1R9TK 3PO3C 3GTQC 2WAQD 4ZH4A 4G7ZA 2WB1D 4AYBL 3HOVC 1I6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA8 C;  4A3B C;  5C3E K;  4MEY A;  3GTK K;  4OIO A;  4QJV B;  3S1R C;  4OIN A;  2E2H K;  3H3V L;  3HOZ K;  3FKI K;  5IYC C;  3S14 K;  2R93 K;  1K83 K;  1WCM C;  4A3M C;  3GTJ C;  4YG2 A;  4A3E C;  5C4X K;  4A93 K;  3K7A K;  3HKZ D;  3RZO C;  3I4N C;  2R92 K;  3GTP K;  3PO2 K;  3M4O K;  3M3Y K;  4BY7 K;  3I4M C;  5IYB K;  4A3K C;  4A3I C;  4C2M C;  5IP7 K;  3HOY C;  4A3F C;  1SFO K;  3S16 C;  2A69 A;  4A3L K;  1YNN A;  2NVY K;  3HOX K;  5C44 K;  4YFX A;  4XLP A;  5C4J C;  3RZD C;  2VUM K;  1BDF A;  4LK0 A;  2A6E A;  2E2I C;  3GTQ K;  3GTM K;  3PO3 K;  2B63 C;  3HOV K;  2JA5 C;  4C3I C;  3H0G C;  4A3G C;  2JA8 K;  4A3B K;  4LLG A;  4X6A C;  3HOU C;  1XPP A;  3GTG C;  4QIW D;  3HOW C;  2JA6 C;  5IYC K;  1WCM K;  4A3M K;  1I50 C;  3GTJ K;  4OIP A;  4KMU A;  4A3E K;  2BE5 A;  4C3J C;  5FLM C;  3RZO K;  1Y1W C;  3I4N K;  2WAQ L;  2E2J C;  3S17 C;  3S15 C;  1I3Q C;  2PA8 D;  2WB1 L;  2NVQ C;  5IP9 C;  5D4D A;  3I4M K;  2YU9 C;  4Y52 C;  2NVX C;  4A3I K;  4C2M K;  1TWC C;  3HOY K;  4A3F K;  3S16 K;  3GTO C;  5C4J K;  3RZD K;  1YNJ A;  2E2I K;  2B63 K;  2PMZ D;  1Y1V C;  1TWA K;  4C3I K;  3H0G K;  2JA5 K;  4A3G K;  4X6A K;  3HOU K;  4QJV A;  4C3H C;  2O5I A;  3S1M C;  3GTG K;  5TMF A;  3HOW K;  2JA6 K;  4BY1 C;  2Y0S D;  4KN7 A;  3S1Q C;  1I50 K;  3S1N C;  3CQZ C;  5IYD C;  4GZY A;  4A3C C;  4C3J K;  5FLM K;  3S1R K;  1Y1W K;  2E2J K;  3S17 K;  4BBR C;  2NVT C;  1I3Q K;  3S15 K;  2NVQ K;  5IP9 K;  2R7Z C;  3WOD A;  3DXJ A;  2YU9 K;  3GTL C;  4BBS C;  5M5X K;  2NVX K;  4Y52 K;  2PPB A;  1TWC K;  4A3J C;  4A3D C;  2JA7 C;  4LK1 A;  4LJZ A;  3S2D C;  4A3K K;  4QIW L;  5M3F K;  4MQ9 A;  4JK1 A;  5TMC A;  4Y7N C;  4OIQ A;  1Y1V K;  4AYB D;  3S2H C;  1ZYR A;  1TWF C;  4OIR A;  1I6H C;  2CW0 A;  2PA8 L;  5M5Y K;  4XLN A;  5M5W K;  2O5J A;  5FJ8 K;  4C3H K;  4BXX C;  4A3L C;  3S1M K;  4YFN A;  3HKZ L;  2A6H A;  3H3V D;  4BY1 K;  3S1Q K;  3S1N K;  1TWG C;  4MEX A;  3CQZ K;  5IYD K;  4A3C K;  1TWH C;  1R9T C;  3EQL A;  4BBR K;  2NVT K;  1HQM A;  4KN4 A;  2PMZ L;  2R7Z K;  3GTL K;  4BBS K;  5C3E C;  4A3J K;  3GTK C;  2JA7 K;  4Q4Z A;  4A3D K;  3S2D K;  4YFK A;  3HOZ C;  2E2H C;  3S14 C;  4Q5S A;  2R93 C;  3FKI C;  2Y0S L;  1K83 C;  1IW7 A;  5M3M K;  4XSX A;  5C4X C;  2A68 A;  3GTO K;  4A93 C;  4Y7N K;  3K7A C;  3GTP C;  3S2H K;  2R92 C;  4G7H A;  1TWF K;  3PO2 C;  3M4O C;  1I6H K;  3M3Y C;  4BY7 C;  5IYB C;  4BXX K;  4G7O A;  4XSZ A;  5IP7 C;  4NOI A;  1SFO C;  1TWG K;  1SMY A;  2NVY C;  1TWA C;  5C44 C;  3HOX C;  2VUM C;  3GTM C;  1TWH K;  1R9T K;  3PO3 C;  3GTQ C;  2WAQ D;  4ZH4 A;  4G7Z A;  2WB1 D;  4AYB L;  3HOV C;  1I6V A; 
#chains in the Genus database with same CATH topology
 2ZUE A;  3TFI A;  4G0V A;  4WF9 S;  1RU0 A;  1J6W A;  3HOZ K;  1VLO A;  3IPJ A;  3GTJ C;  4KDD A;  1WSV A;  3K7A K;  3RZO C;  3GEE A;  4GTB A;  4KM9 A;  3GTP K;  4WJ4 A;  3M4O K;  1USM A;  3ADA C;  4WFN S;  4A3K C;  5IP7 K;  2A69 A;  3L4J A;  2NVY K;  1O29 A;  4U67 S;  3RZD C;  2VUM K;  2JA7 A;  1BDF A;  4LK0 A;  1O27 A;  4A3G C;  4QIW D;  3AD8 C;  4OIP A;  4KMU A;  4C3J C;  3LPX A;  1O24 A;  3I4N K;  4G0W A;  3S17 C;  3S15 C;  1I3Q C;  2WB1 L;  5IP9 C;  3AQO A;  5HQH A;  2V6T A;  5DM7 S;  3AD9 C;  2KXY A;  2ZJR S;  3GTK A;  3OEP A;  2B63 K;  1VRQ C;  4GT9 A;  1Y1V C;  4C3I K;  4DDQ A;  1XZP A;  3HOU K;  2R92 A;  3LYW A;  3HOW K;  4J3N A;  2Y0S D;  1J6X A;  4KMD A;  1IL2 A;  4GZY A;  5FLM K;  4BBR C;  2NVT C;  4GTC A;  3BP3 A;  1USO A;  4BLB A;  3PIO S;  4AH6 A;  4A3K K;  4QIW L;  5M3F K;  5DM6 S;  3T00 A;  4JK1 A;  1ZBS A;  2XCO A;  5FJ8 K;  3BUE A;  3S0X A;  3CAG A;  2XCQ A;  4WCE S;  5HL8 A;  2EBB A;  4MEX A;  1JOE A;  5IYD K;  1F9N A;  3SZY A;  3FOE A;  1R9T C;  3G4A A;  3EQL A;  4KM8 A;  4KN4 A;  4LQY A;  3GTL K;  2KQ1 A;  4A3D K;  3S2D K;  4YFK A;  3HOZ C;  4KB2 A;  4KMH A;  3A8J A;  2Y0S L;  5JVO A;  4XSX A;  2A68 A;  1YCL A;  3K7A C;  3GTP C;  1B4A A;  1J98 A;  1TWF K;  3M4O C;  3GTL A;  1I3Q A;  5IP7 C;  1TWG K;  2NVY C;  1TWH K;  2VUM C;  2PHC B;  1TWF A;  5CJ9 A;  1WIH A;  4WFA S;  4GTE A;  3TFJ A;  1WOP A;  4G0U A;  1Y1V A;  4QJV B;  2R93 K;  1PJ6 A;  3S14 K;  3FKI K;  1K83 K;  4A93 K;  3I4N C;  4PAA A;  3PO2 K;  3M3Y K;  5JVG S;  2GSO A;  3HXA A;  2P5M A;  1O25 A;  4BLA A;  2R93 A;  4P5B A;  1K83 A;  4YFX A;  3PO3 K;  2A6E A;  1EFW A;  3GTQ K;  2B63 C;  4C3I C;  2JA8 K;  4A3B K;  3VA7 A;  1XZQ B;  3HOU C;  3HOW C;  4P9S A;  4A3M K;  1XZP B;  4A3E K;  2BE5 A;  5FLM C;  2ZJP S;  1PJ7 A;  2PA8 D;  1R9T A;  1J6V A;  3HOY K;  4A3F K;  5C4J K;  2E2I K;  4IOC S;  1WOO A;  4BKW A;  2PMZ D;  3H0G K;  3FOF A;  4X6A K;  3GTP A;  4QJV A;  5TMF A;  2JA6 K;  2W7V A;  4KN7 A;  3AD7 C;  1I50 K;  5IYD C;  1C0A A;  2NVY A;  2VUM A;  2YU9 K;  3GTL C;  5M5X K;  4Y52 K;  3GDZ A;  4A3D C;  4LK1 A;  2GAH C;  3S2D C;  4MQ9 A;  4C45 A;  2XCR B;  5CHP A;  1TWF C;  1XZQ A;  2PA8 L;  4GTF A;  2YU9 A;  4XLN A;  4C3H K;  4A3L C;  3T01 A;  2A6H A;  3S1Q K;  3S1N K;  1XXC A;  1TWG C;  3CQZ K;  4A3C K;  1TWH C;  1HQM A;  2PMZ L;  2R7Z K;  1O28 A;  4BBS K;  3A8I A;  2B63 A;  1WQF A;  2R93 C;  3S14 C;  4Q5S A;  3FKI C;  1K83 C;  4A93 C;  4Y7N K;  1ZXO A;  3S2H K;  3PO2 C;  1I6H K;  3M3Y C;  5IOS A;  4BXX K;  2RH6 A;  4NOI A;  1F93 A;  4XCH A;  1SMY A;  1TWA C;  1AB4 A;  3PO3 C;  3GTQ C;  2WAQ D;  4ZH4 A;  5IOR A;  1EK8 A;  2JA8 C;  4A3B C;  3TTG A;  3G4C A;  3S1R C;  2E2H K;  4A3M C;  4A3E C;  3HKZ D;  3A8K A;  3BP8 C;  4GTA A;  5EGH A;  4GTL A;  4KAS A;  5IYB K;  1VH2 A;  3AQP A;  3HOY C;  4WFB S;  1JQW A;  4A3F C;  4A3L K;  1YNN A;  1DCH A;  3HOX K;  5C44 K;  5C4J C;  4XLP A;  2E2I C;  4KC6 A;  3HOV K;  3H0G C;  3GIR A;  4LLG A;  4O2D A;  4X6A C;  4FM9 A;  1XPP A;  5IYC K;  2JA6 C;  1WCM K;  2CFA B;  1I50 C;  3T02 A;  1TWG A;  2WAQ L;  3I4M K;  1TWH A;  5D4D A;  4KAW X;  2YU9 C;  4Y52 C;  1WOS A;  4A3I K;  1F7U A;  4C2M K;  3L4K A;  3S16 K;  2ZUF A;  1YNJ A;  1BJT A;  1FEU A;  3OPF A;  1V5V A;  3CF5 S;  3JST A;  2GSU A;  3FKI A;  5L46 A;  1TWA K;  2JA5 K;  1B4B A;  1F7V A;  4C3H C;  3GTG K;  3S1Q C;  3S1N C;  2GSN A;  3CQZ C;  3S1R K;  4A3C C;  1Y1W K;  2E2J K;  1TWA A;  2NVQ K;  2R7Z C;  3WOD A;  1DD5 A;  4GFQ A;  4BBS C;  2NVX K;  3GTQ A;  2PPB A;  1TWC K;  1BS2 A;  3GEH A;  4LJZ A;  1WQG A;  3N0C A;  2L3U A;  4Y7N C;  2FQO A;  3S2H C;  1I6H C;  5M5W K;  2O5J A;  4BXX C;  1O2F B;  3S1M K;  4YFN A;  3H3V D;  4BY1 K;  1X31 C;  2CFA A;  2RGR A;  1JVI A;  2ZJQ S;  3N0B A;  4M1X A;  1IS1 A;  3DLL S;  2E2I A;  4A3J K;  1INN A;  2JA7 K;  1UV7 A;  3H0G A;  5EGE A;  2E2H C;  4KMA A;  1IW7 A;  5TJ3 A;  2KPU A;  1EQR A;  2JA6 A;  1I50 A;  1ZQ1 C;  4G7H A;  4KB4 A;  5IYB C;  4G7O A;  1O26 A;  4XSZ A;  1PJ5 A;  4P5A A;  3HOX C;  1XXB A;  5C44 C;  3MML B;  4ILD A;  3Q3Q A;  3ERE D;  3LAP A;  3HOV C;  5C3E K;  1ZVU A;  4MEY A;  3GTK K;  4OIO A;  4OIN A;  3H3V L;  5IYC C;  1WCM C;  4YG2 A;  1VGX A;  5C4X K;  1ISE A;  3FHZ A;  2R92 K;  3GSI A;  3CQZ A;  4BY7 K;  1G51 A;  3I4M C;  5JVH S;  4A3I C;  4C2M C;  2R7Z A;  3AH5 A;  1SFO K;  3S16 C;  3GTM K;  5JFE A;  1KQ4 A;  2JA5 C;  2JH3 A;  3NUH A;  3GTG C;  1SFO A;  3GTM A;  3GTJ K;  4WJ3 M;  3ORE A;  3LAJ A;  3RZO K;  1Y1W C;  2E2J C;  1BGW A;  2NVQ C;  2V6S A;  3N3Y A;  2NVX C;  1TWC C;  2GAG C;  4FZB A;  1XXA A;  4KAT A;  3GTO C;  1DCO A;  3RZD K;  3GTJ A;  2E2H A;  1IE0 A;  1EH1 A;  3V4G A;  4A3G K;  2O5I A;  3S1M C;  4GTD A;  4BY1 C;  2D6F C;  4IOA S;  4C3J K;  2FQT A;  3S15 K;  1I3Q K;  3S17 K;  5IP9 K;  3DXJ A;  5E68 A;  1EI6 A;  4A3J C;  2KWA A;  2JA7 C;  4LR2 A;  1VJE A;  5IOQ A;  5TMC A;  2ZFZ A;  4OIQ A;  1Y1V K;  1WCM A;  1YX2 A;  4AYB D;  1ZYR A;  4IO9 S;  4OIR A;  2CW0 A;  5M5Y K;  2Y3P A;  1IQ0 A;  3GEI A;  2L5N A;  3HKZ L;  1O2A A;  1HI9 A;  1WOR A;  4BBR K;  3SZZ A;  5IOT A;  2NVT K;  1GE9 A;  3TFH A;  3QX3 A;  2V6U A;  4PAB A;  5C3E C;  3GTK C;  1IBA A;  4Q4Z A;  1L0W A;  2JA5 A;  4WIL A;  1DCP A;  1WSR A;  5M3M K;  3GTG A;  5C4X C;  3GTO K;  3PIP S;  2R92 C;  4BY7 C;  1Y1W A;  4KAR A;  1SFO C;  2NVX A;  1WQH A;  1TWC A;  4LOW A;  3GTM C;  5HL7 S;  1O2B A;  1R9T K;  3GTO A;  4G7Z A;  4RMF A;  2WB1 D;  2P8T A;  4AYB L;  1I6V A; 
#chains in the Genus database with same CATH homology
 2JA8 C;  4A3B C;  5C3E K;  4MEY A;  3GTK K;  4OIO A;  4QJV B;  3S1R C;  4OIN A;  2E2H K;  3H3V L;  3HOZ K;  3FKI K;  5IYC C;  3S14 K;  2R93 K;  1K83 K;  1WCM C;  4A3M C;  3GTJ C;  4YG2 A;  4A3E C;  5C4X K;  4A93 K;  3K7A K;  3HKZ D;  3RZO C;  3I4N C;  2R92 K;  3GTP K;  3PO2 K;  3M4O K;  3M3Y K;  4BY7 K;  3I4M C;  5IYB K;  4A3K C;  4A3I C;  4C2M C;  5IP7 K;  3HOY C;  4A3F C;  1SFO K;  3S16 C;  2A69 A;  4A3L K;  1YNN A;  2NVY K;  3HOX K;  5C44 K;  4YFX A;  4XLP A;  5C4J C;  3RZD C;  2VUM K;  1BDF A;  4LK0 A;  2A6E A;  2E2I C;  3GTQ K;  3GTM K;  3PO3 K;  2B63 C;  3HOV K;  2JA5 C;  4C3I C;  3H0G C;  4A3G C;  2JA8 K;  4A3B K;  4LLG A;  4X6A C;  3HOU C;  1XPP A;  3GTG C;  4QIW D;  3HOW C;  2JA6 C;  5IYC K;  1WCM K;  4A3M K;  1I50 C;  3GTJ K;  4OIP A;  4KMU A;  4A3E K;  2BE5 A;  4C3J C;  5FLM C;  3RZO K;  1Y1W C;  3I4N K;  2WAQ L;  2E2J C;  3S17 C;  3S15 C;  1I3Q C;  2PA8 D;  2WB1 L;  2NVQ C;  5IP9 C;  5D4D A;  3I4M K;  2YU9 C;  4Y52 C;  2NVX C;  4A3I K;  4C2M K;  1TWC C;  3HOY K;  4A3F K;  3S16 K;  3GTO C;  5C4J K;  3RZD K;  1YNJ A;  2E2I K;  2B63 K;  2PMZ D;  1Y1V C;  1TWA K;  4C3I K;  3H0G K;  2JA5 K;  4A3G K;  4X6A K;  3HOU K;  4QJV A;  4C3H C;  2O5I A;  3S1M C;  3GTG K;  5TMF A;  3HOW K;  2JA6 K;  4BY1 C;  2Y0S D;  4KN7 A;  3S1Q C;  1I50 K;  3S1N C;  3CQZ C;  5IYD C;  4GZY A;  4A3C C;  4C3J K;  5FLM K;  3S1R K;  1Y1W K;  2E2J K;  3S17 K;  4BBR C;  2NVT C;  1I3Q K;  3S15 K;  2NVQ K;  5IP9 K;  2R7Z C;  3WOD A;  3DXJ A;  2YU9 K;  3GTL C;  4BBS C;  5M5X K;  2NVX K;  4Y52 K;  2PPB A;  1TWC K;  4A3J C;  4A3D C;  2JA7 C;  4LK1 A;  4LJZ A;  3S2D C;  4A3K K;  4QIW L;  5M3F K;  4MQ9 A;  4JK1 A;  5TMC A;  4Y7N C;  4OIQ A;  1Y1V K;  4AYB D;  3S2H C;  1ZYR A;  1TWF C;  4OIR A;  1I6H C;  2CW0 A;  2PA8 L;  5M5Y K;  4XLN A;  5M5W K;  2O5J A;  5FJ8 K;  4C3H K;  4BXX C;  4A3L C;  3S1M K;  4YFN A;  3HKZ L;  2A6H A;  3H3V D;  4BY1 K;  3S1Q K;  3S1N K;  1TWG C;  4MEX A;  3CQZ K;  5IYD K;  4A3C K;  1TWH C;  1R9T C;  3EQL A;  4BBR K;  2NVT K;  1HQM A;  4KN4 A;  2PMZ L;  2R7Z K;  3GTL K;  4BBS K;  5C3E C;  4A3J K;  3GTK C;  2JA7 K;  4Q4Z A;  4A3D K;  3S2D K;  4YFK A;  3HOZ C;  2E2H C;  3S14 C;  4Q5S A;  2R93 C;  3FKI C;  2Y0S L;  1K83 C;  1IW7 A;  5M3M K;  4XSX A;  5C4X C;  2A68 A;  3GTO K;  4A93 C;  4Y7N K;  3K7A C;  3GTP C;  3S2H K;  2R92 C;  4G7H A;  1TWF K;  3PO2 C;  3M4O C;  1I6H K;  3M3Y C;  4BY7 C;  5IYB C;  4BXX K;  4G7O A;  4XSZ A;  5IP7 C;  4NOI A;  1SFO C;  1TWG K;  1SMY A;  2NVY C;  1TWA C;  5C44 C;  3HOX C;  2VUM C;  3GTM C;  1TWH K;  1R9T K;  3PO3 C;  3GTQ C;  2WAQ D;  4ZH4 A;  4G7Z A;  2WB1 D;  4AYB L;  3HOV C;  1I6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...