4GZYA

Crystal structures of bacterial rna polymerase paused elongation complexes
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
223
structure length
223
Chain Sequence
KAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcriptional pausing in bacteria.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 39
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4gzyA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4gzyA01
4ZH4A 3M3YK 4A3FC 3S1RK 3WODA 5C3EC 4GZYA 5IYBC 2NVXK 4BBSC 2WB1L 2WB1D 1I6VA 3S1MC 3HKZL 4A3IC 4XLPA 4QJVB 4A3KK 4A3LK 4A3GK 5FJ8K 1TWAK 4A3DK 3S1MK 2A68A 1TWGC 2A6HA 4LLGA 1WCMC 1YNNA 4YFNA 1I6HC 3HOUK 4BBSK 5C3EK 2Y0SD 1TWHK 4LK0A 3RZDK 2R7ZK 3S17C 1BDFA 3PO3C 1Y1WC 4BY1K 1WCMK 3RZDC 2R7ZC 4QIWD 2NVYK 4QIWL 4A3KC 4A3LC 4A3GC 3S2DC 4BY7K 4C3HC 3DXJA 5M5WK 2NVXC 1HQMA 1TWAC 2A6EA 5M3MK 3GTJK 2BE5A 5IP7C 2PMZD 3PO2C 3GTQK 4YFXA 2E2JK 3M4OK 2E2IK 2JA6C 2A69A 1R9TK 3CQZC 5FLMC 4OIPA 3GTKK 3I4NC 3PO2K 3HKZD 3FKIK 3GTJC 5M3FK 3S1RC 4A3FK 1I3QC 4OINA 3EQLA 2E2JC 3HOVC 3GTOC 4Y52C 4YG2A 4YFKA 5C4XK 1I3QK 3FKIC 3H3VL 3GTGK 5C44K 4XLNA 3S16K 3S1QK 5TMFA 3HOVK 2NVYC 3M4OC 1I50C 5IP7K 3S16C 3GTQC 4NOIA 3GTKC 3GTGC 5FLMK 3I4NK 1R9TC 4Q5SA 2PA8L 5C4XC 5M5XK 3S17K 2R92C 4BXXC 4X6AK 5C44C 1SMYA 3HOZK 1TWGK 1IW7A 2O5JA 4Y52K 5IYDK 4C3IC 3GTPC 3RZOC 5IYCC 4C3HK 3HOWK 4KN4A 4MEXA 3K7AK 4OIQA 1SFOC 5D4DA 5C4JC 3HOYK 3HOWC 4BY1C 4A3JC 3PO3K 3S14C 5IYDC 1K83K 2R93K 2E2IC 4KN7A 1SFOK 2JA5C 4OIRA 3K7AC 3HOXC 2VUMC 3S15K 4BXXK 2Y0SL 4C3IK 3GTPK 3RZOK 5TMCA 2JA5K 4BBRK 1K83C 3S14K 2R93C 1ZYRA 4XSXA 3GTLC 4A3BC 2VUMK 2E2HC 3M3YC 2R92K 5IYCK 2WAQD 3GTLK 5IYBK 3S1QC 2PA8D 4A3JK 3HOZC 4A3MC 4AYBL 2O5IA 3HOYC 1I50K 2PPBA 5IP9C 3H0GK 5C4JK 2E2HK 4A3EC 3S15C 3HOXK 2B63K 4MQ9A 4Y7NK 4JK1A 1YNJA 3HOUC 2YU9K 2NVTK 4C3JC 4A3CC 4X6AC 1TWCC 2PMZL 2NVQK 2JA8K 3GTMC 4A93K 4QJVA 1Y1VK 3S1NC 4Q4ZA 4C2MK 4A93C 3GTMK 2JA7K 4BY7C 3S2DK 2B63C 3S2HK 4C2MC 1Y1VC 4C3JK 1TWFK 4KMUA 4A3MK 4Y7NC 2YU9C 2NVTC 1Y1WK 5M5YK 4OIOA 2JA7C 4A3EK 2JA6K 3I4MK 2CW0A 3H3VD 1TWCK 2JA8C 4A3BK 1TWFC 4G7OA 4A3CK 3I4MC 1XPPA 4XSZA 4LJZA 2NVQC 1TWHC 4AYBD 3GTOK 4G7HA 4G7ZA 3S1NK 3H0GC 4A3IK 2WAQL 5IP9K 3S2HC 1I6HK 4MEYA 4BBRC 4A3DC 3CQZK 4LK1A
chains in the Genus database with same CATH superfamily
4ZH4A 3A8KA 4A3FC 4GZYA 4BBSC 1O2AA 4A3KK 3AD8C 4A3GK 1X31C 5DM7S 1WCMC 1F9NA 3AQPA 5C3EK 2ZJQS 2P8TA 3RZDK 3PO3C 1UV7A 3ADAC 4QIWD 1O24A 4A3KC 4A3GC 3S2DC 3DXJA 1XZPA 1XZQB 3LAPA 4KB2A 3GTJK 1F7VA 3GTQK 3M4OK 2E2IK 2A69A 5FLMC 4OIPA 3GTKK 3PO2K 2ZUFA 3EQLA 2E2JC 4GTAA 1EH1A 5C4XK 1AB4A 3OPFA 3H3VL 3GTGK 5C44K 1L0WA 3S1QK 3HOVK 1O27A 5IP7K 3S16C 3SZYA 2PA8L 5M5XK 2R92C 4P5BA 2NVXA 2O5JA 4Y52K 3GTPC 4AH6A 5IOQA 4BY1C 2PHCB 1K83K 5IYDC 4KN7A 3HOXC 4BXXK 4C3IK 3RZOK 3S14K 4XSXA 4C45A 2R92K 2ZJRS 2W7VA 5HQHA 5IYCK 2WAQD 5IYBK 1ZBSA 2PA8D 4P9SA 3TFIA 2PPBA 2VUMA 4KMHA 2B63K 3GEEA 4C3JC 1IL2A 4X6AC 2NVQK 1ZVUA 1O29A 1USMA 1YCLA 1EI6A 1J98A 1VJEA 3GTMK 2JA7K 2KXYA 2B63C 2FQOA 3GDZA 3GTKA 1ISEA 4C3JK 4XCHA 1EQRA 2YU9C 3H3VD 1TWFC 2XCRB 1XPPA 5TJ3A 2NVQC 1TWHC 3GTOK 4KASA 3H0GC 2WAQL 4MEYA 4BBRC 1PJ5A 5JFEA 3A8IA 4G0UA 1BS2A 3LAJA 5JVHS 3ERED 4GTDA 4PABA 2KPUA 4A3IC 4LQYA 4QJVB 3PIPS 1EFWA 4A3DK 1ZXOA 2A68A 1I6HC 2XCQA 1FEUA 4WCES 2P5MA 2Y0SD 4IOAS 2R7ZK 1BDFA 4BY1K 1F7UA 3RZDC 4BKWA 4J3NA 4QIWL 2EBBA 4C3HC 5M5WK 1HI9A 3G4CA 4IOCS 1HQMA 3AQOA 5M3MK 1WOPA 2BE5A 2NVYA 2E2JK 1R9TK 3I4NC 2GAGC 3HKZD 3FKIK 3OEPA 4WFNS 1DCOA 3S1RC 4OINA 4YG2A 1WQHA 1B4BA 4XLNA 3FOFA 1I50C 1VGXA 3TFJA 1I3QA 3GTQC 3I4NK 4Q5SA 3CQZA 3S17K 5C4XC 4BXXC 4X6AK 5CJ9A 5C44C 1TWGK 5IYDK 2L5NA 4C3HK 4MEXA 3K7AK 1SFOC 5C4JC 3S14C 2R93K 1SFOK 2JA5C 5TMCA 2JA5K 1WCMA 4A3BC 1WORA 4A3MC 2O5IA 3HOYC 1I50K 3H0GK 5IP9C 2E2HK 4MQ9A 4Y7NK 4JK1A 2NVTK 3LYWA 4LR2A 1TWCC 2JA8K 4A93K 1J6VA 2YU9A 2CFAA 4WF9S 4QJVA 3TFHA 3GTJA 3S1NC 4Q4ZA 5HL7S 3S2DK 2JA6A 1O25A 5IOSA 4O2DA 4A3MK 5M5YK 4OIOA 3I4MK 2CW0A 4WFAS 3CAGA 3NUHA 1G51A 3T00A 4A3BK 4G7OA 1JVIA 3JSTA 3I4MC 1Y1WA 4LJZA 4GT9A 4AYBD 4DDQA 1TWCA 3T02A 5IP9K 1I6HK 3CQZK 1GE9A 2V6SA 4BLAA 3A8JA 4KM8A 3S1RK 2Y3PA 1IS1A 2NVXK 2WB1L 1I6VA 1DD5A 3HKZL 4GTLA 4A3LK 2XCOA 5FJ8K 1TWAK 4KATA 3GTLA 4YFNA 1TWGC 2A6HA 3HOUK 1YNNA 1WQFA 1K83A 4BBSK 5CHPA 1TWHK 4LK0A 3S17C 2GAHC 1JOEA 1WIHA 1WCMK 4GTCA 2R7ZC 3GEHA 3GEIA 3FOEA 2NVYK 2R92A 4A3LC 4BY7K 2ZFZA 5E68A 2NVXC 4FZBA 2A6EA 1I50A 5IP7C 2PMZD 4KMAA 2CFAB 3AD7C 2B63A 3CQZC 1O2FB 1DCPA 5M3FK 3GTGA 3Q3QA 4KAWX 1I3QC 1USOA 3HOVC 1EK8A 4YFKA 3AH5A 1I3QK 3OREA 1INNA 5DM6S 4IO9S 5TMFA 4GFQA 4U67S 2V6TA 4WFBS 1WSVA 1O28A 1SMYA 3HOZK 1IW7A 4G0VA 2R93A 4C3IC 3RZOC 1J6WA 2D6FC 3HOWK 2ZUEA 3SZZA 5D4DA 4A3JC 2GSNA 2KQ1A 2RGRA 3L4KA 3GTPK 5EGEA 4BBRK 1WOSA 1ZYRA 3GTLC 1VLOA 2VUMK 2GSOA 2FQTA 4A3JK 2JH3A 3GTQA 4LOWA 1TWHA 3S15C 2E2IA 4P5AA 2YU9K 4G0WA 3GSIA 1IBAA 4A3CC 1IQ0A 3GTMC 2JA7A 1XXBA 1WOOA 3S0XA 4C2MK 3S2HK 4C2MC 4BLBA 1Y1VC 1TWFK 4KMUA 1Y1VA 3N3YA 5EGHA 1Y1WK 1VH2A 1TWCK 1ZQ1C 2L3UA 4A3CK 4XSZA 4G7ZA 1KQ4A 4A3IK 5JVGS 3S2HC 2KWAA 4LK1A 3N0BA 3M3YK 1TWAA 3WODA 5C3EC 3QX3A 5IYBC 2WB1D 3S1MC 1B4AA 4RMFA 4XLPA 2R7ZA 3S1MK 4LLGA 4GTEA 1SFOA 1JQWA 1C0AA 3GTPA 1Y1WC 1XXAA 4KB4A 1WQGA 3FHZA 4KM9A 1R9TA 1F93A 1PJ6A 4KDDA 1TWAC 3PO2C 1O26A 3V4GA 4YFXA 1RU0A 2JA6C 1V5VA 2RH6A 1WSRA 3GTJC 4A3FK 4KARA 3GTOC 4FM9A 4Y52C 3FKIC 3FKIA 5IOTA 3S16K 1YX2A 3MMLB 3L4JA 3GTOA 2NVYC 4WILA 3M4OC 4NOIA 3GTKC 3GTGC 5FLMK 4WJ3M 1R9TC 5HL8A 3DLLS 3BUEA 3N0CA 4ILDA 5IYCC 1XZQA 4GTFA 1VRQC 1XXCA 4KN4A 4PAAA 1BGWA 4OIQA 3HOYK 3HOWC 3PO3K 2JA5A 1O2BA 1TWGA 2E2IC 1XZPB 3CF5S 3BP3A 4OIRA 3K7AC 2VUMC 3LPXA 3S15K 2Y0SL 1K83C 2V6UA 1BJTA 2R93C 2E2HA 2E2HC 3M3YC 3T01A 3GTLK 1J6XA 3S1QC 3HXAA 3HOZC 4AYBL 5C4JK 1DCHA 4A3EC 1IE0A 4KC6A 3HOXK 3IPJA 1YNJA 3HOUC 5JVOA 3AD9C 3H0GA 2PMZL 3BP8C 3GIRA 3G4AA 1PJ7A 4KMDA 1Y1VK 1TWFA 4A93C 4BY7C 3VA7A 4WJ4A 5L46A 3TTGA 4M1XA 4Y7NC 2NVTC 2JA7C 3GTMA 4A3EK 2JA6K 5IORA 2JA8C 3PIOS 2GSUA 4GTBA 4G7HA 3S1NK 4A3DC 2ZJPS
chains in the Genus database with same CATH topology
4ZH4A 3M3YK 4A3FC 3S1RK 3WODA 5C3EC 4GZYA 5IYBC 2NVXK 4BBSC 2WB1L 2WB1D 1I6VA 3S1MC 3HKZL 4A3IC 4XLPA 4QJVB 4A3KK 4A3LK 4A3GK 5FJ8K 1TWAK 4A3DK 3S1MK 2A68A 1TWGC 2A6HA 4LLGA 1WCMC 1YNNA 4YFNA 1I6HC 3HOUK 4BBSK 5C3EK 2Y0SD 1TWHK 4LK0A 3RZDK 2R7ZK 3S17C 1BDFA 3PO3C 1Y1WC 4BY1K 1WCMK 3RZDC 2R7ZC 4QIWD 2NVYK 4QIWL 4A3KC 4A3LC 4A3GC 3S2DC 4BY7K 4C3HC 3DXJA 5M5WK 2NVXC 1HQMA 1TWAC 2A6EA 5M3MK 3GTJK 2BE5A 5IP7C 2PMZD 3PO2C 3GTQK 4YFXA 2E2JK 3M4OK 2E2IK 2JA6C 2A69A 1R9TK 3CQZC 5FLMC 4OIPA 3GTKK 3I4NC 3PO2K 3HKZD 3FKIK 3GTJC 5M3FK 3S1RC 4A3FK 1I3QC 4OINA 3EQLA 2E2JC 3HOVC 3GTOC 4Y52C 4YG2A 4YFKA 5C4XK 1I3QK 3FKIC 3H3VL 3GTGK 5C44K 4XLNA 3S16K 3S1QK 5TMFA 3HOVK 2NVYC 3M4OC 1I50C 5IP7K 3S16C 3GTQC 4NOIA 3GTKC 3GTGC 5FLMK 3I4NK 1R9TC 4Q5SA 2PA8L 5C4XC 5M5XK 3S17K 2R92C 4BXXC 4X6AK 5C44C 1SMYA 3HOZK 1TWGK 1IW7A 2O5JA 4Y52K 5IYDK 4C3IC 3GTPC 3RZOC 5IYCC 4C3HK 3HOWK 4KN4A 4MEXA 3K7AK 4OIQA 1SFOC 5D4DA 5C4JC 3HOYK 3HOWC 4BY1C 4A3JC 3PO3K 3S14C 5IYDC 1K83K 2R93K 2E2IC 4KN7A 1SFOK 2JA5C 4OIRA 3K7AC 3HOXC 2VUMC 3S15K 4BXXK 2Y0SL 4C3IK 3GTPK 3RZOK 5TMCA 2JA5K 4BBRK 1K83C 3S14K 2R93C 1ZYRA 4XSXA 3GTLC 4A3BC 2VUMK 2E2HC 3M3YC 2R92K 5IYCK 2WAQD 3GTLK 5IYBK 3S1QC 2PA8D 4A3JK 3HOZC 4A3MC 4AYBL 2O5IA 3HOYC 1I50K 2PPBA 5IP9C 3H0GK 5C4JK 2E2HK 4A3EC 3S15C 3HOXK 2B63K 4MQ9A 4Y7NK 4JK1A 1YNJA 3HOUC 2YU9K 2NVTK 4C3JC 4A3CC 4X6AC 1TWCC 2PMZL 2NVQK 2JA8K 3GTMC 4A93K 4QJVA 1Y1VK 3S1NC 4Q4ZA 4C2MK 4A93C 3GTMK 2JA7K 4BY7C 3S2DK 2B63C 3S2HK 4C2MC 1Y1VC 4C3JK 1TWFK 4KMUA 4A3MK 4Y7NC 2YU9C 2NVTC 1Y1WK 5M5YK 4OIOA 2JA7C 4A3EK 2JA6K 3I4MK 2CW0A 3H3VD 1TWCK 2JA8C 4A3BK 1TWFC 4G7OA 4A3CK 3I4MC 1XPPA 4XSZA 4LJZA 2NVQC 1TWHC 4AYBD 3GTOK 4G7HA 4G7ZA 3S1NK 3H0GC 4A3IK 2WAQL 5IP9K 3S2HC 1I6HK 4MEYA 4BBRC 4A3DC 3CQZK 4LK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZH4 A;  3M3Y K;  4A3F C;  3S1R K;  3WOD A;  5C3E C;  4GZY A;  5IYB C;  2NVX K;  4BBS C;  2WB1 L;  2WB1 D;  1I6V A;  3S1M C;  3HKZ L;  4A3I C;  4XLP A;  4QJV B;  4A3K K;  4A3L K;  4A3G K;  5FJ8 K;  1TWA K;  4A3D K;  3S1M K;  2A68 A;  1TWG C;  2A6H A;  4LLG A;  1WCM C;  1YNN A;  4YFN A;  1I6H C;  3HOU K;  4BBS K;  5C3E K;  2Y0S D;  1TWH K;  4LK0 A;  3RZD K;  2R7Z K;  3S17 C;  1BDF A;  3PO3 C;  1Y1W C;  4BY1 K;  1WCM K;  3RZD C;  2R7Z C;  4QIW D;  2NVY K;  4QIW L;  4A3K C;  4A3L C;  4A3G C;  3S2D C;  4BY7 K;  4C3H C;  3DXJ A;  5M5W K;  2NVX C;  1HQM A;  1TWA C;  2A6E A;  5M3M K;  3GTJ K;  2BE5 A;  5IP7 C;  2PMZ D;  3PO2 C;  3GTQ K;  4YFX A;  2E2J K;  3M4O K;  2E2I K;  2JA6 C;  2A69 A;  1R9T K;  3CQZ C;  5FLM C;  4OIP A;  3GTK K;  3I4N C;  3PO2 K;  3HKZ D;  3FKI K;  3GTJ C;  5M3F K;  3S1R C;  4A3F K;  1I3Q C;  4OIN A;  3EQL A;  2E2J C;  3HOV C;  3GTO C;  4Y52 C;  4YG2 A;  4YFK A;  5C4X K;  1I3Q K;  3FKI C;  3H3V L;  3GTG K;  5C44 K;  4XLN A;  3S16 K;  3S1Q K;  5TMF A;  3HOV K;  2NVY C;  3M4O C;  1I50 C;  5IP7 K;  3S16 C;  3GTQ C;  4NOI A;  3GTK C;  3GTG C;  5FLM K;  3I4N K;  1R9T C;  4Q5S A;  2PA8 L;  5C4X C;  5M5X K;  3S17 K;  2R92 C;  4BXX C;  4X6A K;  5C44 C;  1SMY A;  3HOZ K;  1TWG K;  1IW7 A;  2O5J A;  4Y52 K;  5IYD K;  4C3I C;  3GTP C;  3RZO C;  5IYC C;  4C3H K;  3HOW K;  4KN4 A;  4MEX A;  3K7A K;  4OIQ A;  1SFO C;  5D4D A;  5C4J C;  3HOY K;  3HOW C;  4BY1 C;  4A3J C;  3PO3 K;  3S14 C;  5IYD C;  1K83 K;  2R93 K;  2E2I C;  4KN7 A;  1SFO K;  2JA5 C;  4OIR A;  3K7A C;  3HOX C;  2VUM C;  3S15 K;  4BXX K;  2Y0S L;  4C3I K;  3GTP K;  3RZO K;  5TMC A;  2JA5 K;  4BBR K;  1K83 C;  3S14 K;  2R93 C;  1ZYR A;  4XSX A;  3GTL C;  4A3B C;  2VUM K;  2E2H C;  3M3Y C;  2R92 K;  5IYC K;  2WAQ D;  3GTL K;  5IYB K;  3S1Q C;  2PA8 D;  4A3J K;  3HOZ C;  4A3M C;  4AYB L;  2O5I A;  3HOY C;  1I50 K;  2PPB A;  5IP9 C;  3H0G K;  5C4J K;  2E2H K;  4A3E C;  3S15 C;  3HOX K;  2B63 K;  4MQ9 A;  4Y7N K;  4JK1 A;  1YNJ A;  3HOU C;  2YU9 K;  2NVT K;  4C3J C;  4A3C C;  4X6A C;  1TWC C;  2PMZ L;  2NVQ K;  2JA8 K;  3GTM C;  4A93 K;  4QJV A;  1Y1V K;  3S1N C;  4Q4Z A;  4C2M K;  4A93 C;  3GTM K;  2JA7 K;  4BY7 C;  3S2D K;  2B63 C;  3S2H K;  4C2M C;  1Y1V C;  4C3J K;  1TWF K;  4KMU A;  4A3M K;  4Y7N C;  2YU9 C;  2NVT C;  1Y1W K;  5M5Y K;  4OIO A;  2JA7 C;  4A3E K;  2JA6 K;  3I4M K;  2CW0 A;  3H3V D;  1TWC K;  2JA8 C;  4A3B K;  1TWF C;  4G7O A;  4A3C K;  3I4M C;  1XPP A;  4XSZ A;  4LJZ A;  2NVQ C;  1TWH C;  4AYB D;  3GTO K;  4G7H A;  4G7Z A;  3S1N K;  3H0G C;  4A3I K;  2WAQ L;  5IP9 K;  3S2H C;  1I6H K;  4MEY A;  4BBR C;  4A3D C;  3CQZ K;  4LK1 A; 
#chains in the Genus database with same CATH topology
 4ZH4 A;  3A8K A;  4A3F C;  4GZY A;  4BBS C;  1O2A A;  4A3K K;  3AD8 C;  4A3G K;  1X31 C;  5DM7 S;  1WCM C;  1F9N A;  3AQP A;  5C3E K;  2ZJQ S;  2P8T A;  3RZD K;  3PO3 C;  1UV7 A;  3ADA C;  4QIW D;  1O24 A;  4A3K C;  4A3G C;  3S2D C;  3DXJ A;  1XZP A;  1XZQ B;  3LAP A;  4KB2 A;  3GTJ K;  1F7V A;  3GTQ K;  3M4O K;  2E2I K;  2A69 A;  5FLM C;  4OIP A;  3GTK K;  3PO2 K;  2ZUF A;  3EQL A;  2E2J C;  4GTA A;  1EH1 A;  5C4X K;  1AB4 A;  3OPF A;  3H3V L;  3GTG K;  5C44 K;  1L0W A;  3S1Q K;  3HOV K;  1O27 A;  5IP7 K;  3S16 C;  3SZY A;  2PA8 L;  5M5X K;  2R92 C;  4P5B A;  2NVX A;  2O5J A;  4Y52 K;  3GTP C;  4AH6 A;  5IOQ A;  4BY1 C;  2PHC B;  1K83 K;  5IYD C;  4KN7 A;  3HOX C;  4BXX K;  4C3I K;  3RZO K;  3S14 K;  4XSX A;  4C45 A;  2R92 K;  2ZJR S;  2W7V A;  5HQH A;  5IYC K;  2WAQ D;  5IYB K;  1ZBS A;  2PA8 D;  4P9S A;  3TFI A;  2PPB A;  2VUM A;  4KMH A;  2B63 K;  3GEE A;  4C3J C;  1IL2 A;  4X6A C;  2NVQ K;  1ZVU A;  1O29 A;  1USM A;  1YCL A;  1EI6 A;  1J98 A;  1VJE A;  3GTM K;  2JA7 K;  2KXY A;  2B63 C;  2FQO A;  3GDZ A;  3GTK A;  1ISE A;  4C3J K;  4XCH A;  1EQR A;  2YU9 C;  3H3V D;  1TWF C;  2XCR B;  1XPP A;  5TJ3 A;  2NVQ C;  1TWH C;  3GTO K;  4KAS A;  3H0G C;  2WAQ L;  4MEY A;  4BBR C;  1PJ5 A;  5JFE A;  3A8I A;  4G0U A;  1BS2 A;  3LAJ A;  5JVH S;  3ERE D;  4GTD A;  4PAB A;  2KPU A;  4A3I C;  4LQY A;  4QJV B;  3PIP S;  1EFW A;  4A3D K;  1ZXO A;  2A68 A;  1I6H C;  2XCQ A;  1FEU A;  4WCE S;  2P5M A;  2Y0S D;  4IOA S;  2R7Z K;  1BDF A;  4BY1 K;  1F7U A;  3RZD C;  4BKW A;  4J3N A;  4QIW L;  2EBB A;  4C3H C;  5M5W K;  1HI9 A;  3G4C A;  4IOC S;  1HQM A;  3AQO A;  5M3M K;  1WOP A;  2BE5 A;  2NVY A;  2E2J K;  1R9T K;  3I4N C;  2GAG C;  3HKZ D;  3FKI K;  3OEP A;  4WFN S;  1DCO A;  3S1R C;  4OIN A;  4YG2 A;  1WQH A;  1B4B A;  4XLN A;  3FOF A;  1I50 C;  1VGX A;  3TFJ A;  1I3Q A;  3GTQ C;  3I4N K;  4Q5S A;  3CQZ A;  3S17 K;  5C4X C;  4BXX C;  4X6A K;  5CJ9 A;  5C44 C;  1TWG K;  5IYD K;  2L5N A;  4C3H K;  4MEX A;  3K7A K;  1SFO C;  5C4J C;  3S14 C;  2R93 K;  1SFO K;  2JA5 C;  5TMC A;  2JA5 K;  1WCM A;  4A3B C;  1WOR A;  4A3M C;  2O5I A;  3HOY C;  1I50 K;  3H0G K;  5IP9 C;  2E2H K;  4MQ9 A;  4Y7N K;  4JK1 A;  2NVT K;  3LYW A;  4LR2 A;  1TWC C;  2JA8 K;  4A93 K;  1J6V A;  2YU9 A;  2CFA A;  4WF9 S;  4QJV A;  3TFH A;  3GTJ A;  3S1N C;  4Q4Z A;  5HL7 S;  3S2D K;  2JA6 A;  1O25 A;  5IOS A;  4O2D A;  4A3M K;  5M5Y K;  4OIO A;  3I4M K;  2CW0 A;  4WFA S;  3CAG A;  3NUH A;  1G51 A;  3T00 A;  4A3B K;  4G7O A;  1JVI A;  3JST A;  3I4M C;  1Y1W A;  4LJZ A;  4GT9 A;  4AYB D;  4DDQ A;  1TWC A;  3T02 A;  5IP9 K;  1I6H K;  3CQZ K;  1GE9 A;  2V6S A;  4BLA A;  3A8J A;  4KM8 A;  3S1R K;  2Y3P A;  1IS1 A;  2NVX K;  2WB1 L;  1I6V A;  1DD5 A;  3HKZ L;  4GTL A;  4A3L K;  2XCO A;  5FJ8 K;  1TWA K;  4KAT A;  3GTL A;  4YFN A;  1TWG C;  2A6H A;  3HOU K;  1YNN A;  1WQF A;  1K83 A;  4BBS K;  5CHP A;  1TWH K;  4LK0 A;  3S17 C;  2GAH C;  1JOE A;  1WIH A;  1WCM K;  4GTC A;  2R7Z C;  3GEH A;  3GEI A;  3FOE A;  2NVY K;  2R92 A;  4A3L C;  4BY7 K;  2ZFZ A;  5E68 A;  2NVX C;  4FZB A;  2A6E A;  1I50 A;  5IP7 C;  2PMZ D;  4KMA A;  2CFA B;  3AD7 C;  2B63 A;  3CQZ C;  1O2F B;  1DCP A;  5M3F K;  3GTG A;  3Q3Q A;  4KAW X;  1I3Q C;  1USO A;  3HOV C;  1EK8 A;  4YFK A;  3AH5 A;  1I3Q K;  3ORE A;  1INN A;  5DM6 S;  4IO9 S;  5TMF A;  4GFQ A;  4U67 S;  2V6T A;  4WFB S;  1WSV A;  1O28 A;  1SMY A;  3HOZ K;  1IW7 A;  4G0V A;  2R93 A;  4C3I C;  3RZO C;  1J6W A;  2D6F C;  3HOW K;  2ZUE A;  3SZZ A;  5D4D A;  4A3J C;  2GSN A;  2KQ1 A;  2RGR A;  3L4K A;  3GTP K;  5EGE A;  4BBR K;  1WOS A;  1ZYR A;  3GTL C;  1VLO A;  2VUM K;  2GSO A;  2FQT A;  4A3J K;  2JH3 A;  3GTQ A;  4LOW A;  1TWH A;  3S15 C;  2E2I A;  4P5A A;  2YU9 K;  4G0W A;  3GSI A;  1IBA A;  4A3C C;  1IQ0 A;  3GTM C;  2JA7 A;  1XXB A;  1WOO A;  3S0X A;  4C2M K;  3S2H K;  4C2M C;  4BLB A;  1Y1V C;  1TWF K;  4KMU A;  1Y1V A;  3N3Y A;  5EGH A;  1Y1W K;  1VH2 A;  1TWC K;  1ZQ1 C;  2L3U A;  4A3C K;  4XSZ A;  4G7Z A;  1KQ4 A;  4A3I K;  5JVG S;  3S2H C;  2KWA A;  4LK1 A;  3N0B A;  3M3Y K;  1TWA A;  3WOD A;  5C3E C;  3QX3 A;  5IYB C;  2WB1 D;  3S1M C;  1B4A A;  4RMF A;  4XLP A;  2R7Z A;  3S1M K;  4LLG A;  4GTE A;  1SFO A;  1JQW A;  1C0A A;  3GTP A;  1Y1W C;  1XXA A;  4KB4 A;  1WQG A;  3FHZ A;  4KM9 A;  1R9T A;  1F93 A;  1PJ6 A;  4KDD A;  1TWA C;  3PO2 C;  1O26 A;  3V4G A;  4YFX A;  1RU0 A;  2JA6 C;  1V5V A;  2RH6 A;  1WSR A;  3GTJ C;  4A3F K;  4KAR A;  3GTO C;  4FM9 A;  4Y52 C;  3FKI C;  3FKI A;  5IOT A;  3S16 K;  1YX2 A;  3MML B;  3L4J A;  3GTO A;  2NVY C;  4WIL A;  3M4O C;  4NOI A;  3GTK C;  3GTG C;  5FLM K;  4WJ3 M;  1R9T C;  5HL8 A;  3DLL S;  3BUE A;  3N0C A;  4ILD A;  5IYC C;  1XZQ A;  4GTF A;  1VRQ C;  1XXC A;  4KN4 A;  4PAA A;  1BGW A;  4OIQ A;  3HOY K;  3HOW C;  3PO3 K;  2JA5 A;  1O2B A;  1TWG A;  2E2I C;  1XZP B;  3CF5 S;  3BP3 A;  4OIR A;  3K7A C;  2VUM C;  3LPX A;  3S15 K;  2Y0S L;  1K83 C;  2V6U A;  1BJT A;  2R93 C;  2E2H A;  2E2H C;  3M3Y C;  3T01 A;  3GTL K;  1J6X A;  3S1Q C;  3HXA A;  3HOZ C;  4AYB L;  5C4J K;  1DCH A;  4A3E C;  1IE0 A;  4KC6 A;  3HOX K;  3IPJ A;  1YNJ A;  3HOU C;  5JVO A;  3AD9 C;  3H0G A;  2PMZ L;  3BP8 C;  3GIR A;  3G4A A;  1PJ7 A;  4KMD A;  1Y1V K;  1TWF A;  4A93 C;  4BY7 C;  3VA7 A;  4WJ4 A;  5L46 A;  3TTG A;  4M1X A;  4Y7N C;  2NVT C;  2JA7 C;  3GTM A;  4A3E K;  2JA6 K;  5IOR A;  2JA8 C;  3PIO S;  2GSU A;  4GTB A;  4G7H A;  3S1N K;  4A3D C;  2ZJP S; 
#chains in the Genus database with same CATH homology
 4ZH4 A;  3M3Y K;  4A3F C;  3S1R K;  3WOD A;  5C3E C;  4GZY A;  5IYB C;  2NVX K;  4BBS C;  2WB1 L;  2WB1 D;  1I6V A;  3S1M C;  3HKZ L;  4A3I C;  4XLP A;  4QJV B;  4A3K K;  4A3L K;  4A3G K;  5FJ8 K;  1TWA K;  4A3D K;  3S1M K;  2A68 A;  1TWG C;  2A6H A;  4LLG A;  1WCM C;  1YNN A;  4YFN A;  1I6H C;  3HOU K;  4BBS K;  5C3E K;  2Y0S D;  1TWH K;  4LK0 A;  3RZD K;  2R7Z K;  3S17 C;  1BDF A;  3PO3 C;  1Y1W C;  4BY1 K;  1WCM K;  3RZD C;  2R7Z C;  4QIW D;  2NVY K;  4QIW L;  4A3K C;  4A3L C;  4A3G C;  3S2D C;  4BY7 K;  4C3H C;  3DXJ A;  5M5W K;  2NVX C;  1HQM A;  1TWA C;  2A6E A;  5M3M K;  3GTJ K;  2BE5 A;  5IP7 C;  2PMZ D;  3PO2 C;  3GTQ K;  4YFX A;  2E2J K;  3M4O K;  2E2I K;  2JA6 C;  2A69 A;  1R9T K;  3CQZ C;  5FLM C;  4OIP A;  3GTK K;  3I4N C;  3PO2 K;  3HKZ D;  3FKI K;  3GTJ C;  5M3F K;  3S1R C;  4A3F K;  1I3Q C;  4OIN A;  3EQL A;  2E2J C;  3HOV C;  3GTO C;  4Y52 C;  4YG2 A;  4YFK A;  5C4X K;  1I3Q K;  3FKI C;  3H3V L;  3GTG K;  5C44 K;  4XLN A;  3S16 K;  3S1Q K;  5TMF A;  3HOV K;  2NVY C;  3M4O C;  1I50 C;  5IP7 K;  3S16 C;  3GTQ C;  4NOI A;  3GTK C;  3GTG C;  5FLM K;  3I4N K;  1R9T C;  4Q5S A;  2PA8 L;  5C4X C;  5M5X K;  3S17 K;  2R92 C;  4BXX C;  4X6A K;  5C44 C;  1SMY A;  3HOZ K;  1TWG K;  1IW7 A;  2O5J A;  4Y52 K;  5IYD K;  4C3I C;  3GTP C;  3RZO C;  5IYC C;  4C3H K;  3HOW K;  4KN4 A;  4MEX A;  3K7A K;  4OIQ A;  1SFO C;  5D4D A;  5C4J C;  3HOY K;  3HOW C;  4BY1 C;  4A3J C;  3PO3 K;  3S14 C;  5IYD C;  1K83 K;  2R93 K;  2E2I C;  4KN7 A;  1SFO K;  2JA5 C;  4OIR A;  3K7A C;  3HOX C;  2VUM C;  3S15 K;  4BXX K;  2Y0S L;  4C3I K;  3GTP K;  3RZO K;  5TMC A;  2JA5 K;  4BBR K;  1K83 C;  3S14 K;  2R93 C;  1ZYR A;  4XSX A;  3GTL C;  4A3B C;  2VUM K;  2E2H C;  3M3Y C;  2R92 K;  5IYC K;  2WAQ D;  3GTL K;  5IYB K;  3S1Q C;  2PA8 D;  4A3J K;  3HOZ C;  4A3M C;  4AYB L;  2O5I A;  3HOY C;  1I50 K;  2PPB A;  5IP9 C;  3H0G K;  5C4J K;  2E2H K;  4A3E C;  3S15 C;  3HOX K;  2B63 K;  4MQ9 A;  4Y7N K;  4JK1 A;  1YNJ A;  3HOU C;  2YU9 K;  2NVT K;  4C3J C;  4A3C C;  4X6A C;  1TWC C;  2PMZ L;  2NVQ K;  2JA8 K;  3GTM C;  4A93 K;  4QJV A;  1Y1V K;  3S1N C;  4Q4Z A;  4C2M K;  4A93 C;  3GTM K;  2JA7 K;  4BY7 C;  3S2D K;  2B63 C;  3S2H K;  4C2M C;  1Y1V C;  4C3J K;  1TWF K;  4KMU A;  4A3M K;  4Y7N C;  2YU9 C;  2NVT C;  1Y1W K;  5M5Y K;  4OIO A;  2JA7 C;  4A3E K;  2JA6 K;  3I4M K;  2CW0 A;  3H3V D;  1TWC K;  2JA8 C;  4A3B K;  1TWF C;  4G7O A;  4A3C K;  3I4M C;  1XPP A;  4XSZ A;  4LJZ A;  2NVQ C;  1TWH C;  4AYB D;  3GTO K;  4G7H A;  4G7Z A;  3S1N K;  3H0G C;  4A3I K;  2WAQ L;  5IP9 K;  3S2H C;  1I6H K;  4MEY A;  4BBR C;  4A3D C;  3CQZ K;  4LK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...