4GZYA

Crystal structures of bacterial rna polymerase paused elongation complexes
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
223
structure length
223
Chain Sequence
KAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcriptional pausing in bacteria.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 39
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4gzyA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4gzyA01
4KN7A 3S14C 1K83C 3GTGK 2VUMC 3GTKC 3PO2K 3S1MC 1XPPA 2E2JK 1I6HK 4Y52K 2NVYK 4A3IC 3S2HC 3I4MK 4OIQA 1TWFK 3H0GC 1I6VA 3HOUK 4C2MK 3S15K 3I4MC 4BY7C 1I3QC 1TWGC 1ZYRA 2WAQD 4YG2A 3WODA 1Y1VK 4C2MC 4BXXC 2R7ZK 3M3YK 4A3DK 1BDFA 5IYDK 3HOXC 3I4NC 3S1RK 1YNNA 4A3LC 3K7AC 2Y0SL 3HOZC 5IYCK 4Q4ZA 3GTGC 4A3CK 2A68A 2NVXC 5IYBK 4G7ZA 2CW0A 3GTJK 2E2IC 4A93C 3S17C 2NVTK 3S2DK 3CQZK 4A3MC 5D4DA 4OIOA 2JA5K 1TWHC 3HOVK 2A6HA 4OIPA 4X6AC 4OINA 4A3BC 2NVQK 4A3JK 4BY1K 2PPBA 4QJVB 4XSZA 1R9TC 2E2HC 4AYBL 4A3JC 1TWCK 5C4XC 5IYBC 3S2HK 3DXJA 4A3CC 4MEYA 4QJVA 4BBSK 3HOVC 4A3KC 5IP9K 2R92K 4Y52C 3S1MK 3HOWC 3RZDK 4A3MK 4A3EK 5FJ8K 3S14K 5C44C 2B63C 3HOYC 1I50C 1YNJA 4MQ9A 3FKIK 4A3EC 3S1NC 2E2IK 4LLGA 3GTMC 3RZDC 5M3MK 5M5WK 3GTOK 2JA7C 3HOWK 1Y1VC 5IP7C 4Q5SA 1TWAC 4A3KK 1Y1WC 2YU9K 4Y7NK 2JA7K 5C4XK 3GTMK 3S1RC 3HOUC 1I50K 3GTPK 3M3YC 2NVQC 4A3DC 1SFOK 2JA5C 4LK1A 4KN4A 3PO2C 2BE5A 3S1QC 3CQZC 4XLNA 3S17K 3H3VD 4YFNA 1TWFC 4NOIA 3S16C 3S15C 3RZOK 2R93K 4X6AK 5C3EK 4Y7NC 2NVYC 5C4JK 2PA8D 1I6HC 2JA8C 2VUMK 3GTKK 3GTOC 5C3EC 2NVTC 4OIRA 5FLMK 2B63K 3HOYK 2WB1L 4C3JC 4XLPA 3RZOC 4C3HK 3EQLA 4ZH4A 2JA8K 2WAQL 2PMZD 5IP9C 5C4JC 4XSXA 3HOZK 3S1QK 3GTLC 3PO3C 4C3IC 4A3GC 3HKZD 4BY7K 1SFOC 3S16K 3HOXK 3I4NK 4A3FC 4YFKA 3S2DC 4BXXK 3M4OC 1TWGK 4C3IK 1I3QK 1TWAK 1K83K 2JA6C 3GTPC 4GZYA 4KMUA 3H0GK 5TMFA 4JK1A 3GTQC 2PMZL 1SMYA 3GTJC 2NVXK 4A3IK 2YU9C 2A69A 5IYCC 2E2JC 3K7AK 2R92C 4QIWL 5IP7K 4BBSC 4AYBD 3S1NK 2PA8L 2O5JA 5M5YK 5IYDC 4A3FK 3FKIC 4G7OA 1TWCC 2R93C 5C44K 3GTQK 2R7ZC 1R9TK 5M5XK 2E2HK 3H3VL 2WB1D 2JA6K 4LK0A 5M3FK 4C3JK 4YFXA 2O5IA 3GTLK 4BBRC 3PO3K 4A3GK 3M4OK 1WCMC 2A6EA 4BY1C 4A3BK 5FLMC 4QIWD 5TMCA 2Y0SD 1WCMK 4MEXA 1TWHK 4BBRK 1HQMA 1Y1WK 4A3LK 1IW7A 4LJZA 3HKZL 4G7HA 4C3HC 4A93K
chains in the Genus database with same CATH superfamily
1EK8A 3GTGK 3GTKC 1O24A 4P5BA 2E2JK 1GE9A 2R92A 3S15K 3H0GC 3I4MC 5HL7S 1TWGC 1YX2A 3T02A 4A3DK 1J6XA 5JVGS 4A3LC 3L4JA 4Q4ZA 4A3CK 2NVXC 3CAGA 2JA7A 3S17C 2NVTK 1WQFA 2GSNA 5D4DA 3TFHA 3IPJA 2KWAA 2ZJQS 4A3JC 1J6WA 5IYBC 1TWFA 4BBSK 5IP9K 2ZJRS 4Y52C 3ERED 4A3MK 3Q3QA 3G4CA 2B63A 5IORA 2B63C 3HOYC 1YNJA 4MQ9A 2E2IK 4LLGA 3HOWK 2JA7C 1Y1VC 3TFJA 1WSRA 4GTLA 3S1RC 3LAJA 3M3YC 1G51A 3OPFA 1VLOA 4KN4A 1DCPA 3PO2C 2V6UA 2BE5A 3CQZC 1INNA 4NOIA 4WJ4A 1R9TA 4C45A 2PA8D 4G0VA 1ZXOA 4KC6A 2NVTC 2B63K 3HOYK 4C3JC 4XLPA 4RMFA 4C3HK 3EQLA 4WJ3M 1DCHA 3FKIA 3S1QK 3HOZK 3HKZD 1SFOC 1Y1WA 4DDQA 1O2FB 1WCMA 4BXXK 2CFAB 3M4OC 4LOWA 1I3QK 3T00A 3GTPA 4GZYA 2P5MA 3H0GK 1KQ4A 3A8IA 4KARA 3DLLS 4A3IK 5IOQA 2A69A 3A8JA 4AH6A 2O5JA 5M5YK 4A3FK 4G7OA 5C44K 2R7ZC 4GTBA 5M5XK 5M3FK 5IOSA 1XZQA 2O5IA 2ZUFA 5DM7S 4P5AA 1WCMC 1IL2A 4U67S 3GDZA 5FLMC 2JH3A 4A3BK 5TMCA 2D6FC 4WFNS 1USMA 1IW7A 3HKZL 4C3HC 4C3JK 1K83C 2VUMC 3PO2K 4Y52K 3S2HC 3I4MK 1I6VA 4C2MK 4BY7C 5L46A 1I3QC 2WAQD 4YG2A 4KB2A 1L0WA 3M3YK 1BDFA 2KQ1A 3I4NC 3AQOA 5HL8A 3HOZC 2RGRA 1F7VA 4IOAS 5TJ3A 1J98A 1BJTA 4OIOA 1WOPA 1TWHC 3PIOS 3HOVK 4X6AC 4A3BC 4A3JK 1USOA 4KMAA 1R9TC 4QJVB 4J3NA 5C4XC 1B4BA 3DXJA 4A3CC 4MEYA 4QJVA 1FEUA 3HOVC 3TFIA 2GSOA 4KASA 3S1MK 3A8KA 3AD9C 5C44C 3GTOK 4A3EC 3RZDC 1O28A 5M3MK 2R7ZA 3GTMK 1XZPA 1HI9A 2V6SA 5EGEA 3GTPK 4O2DA 2NVQC 1WIHA 2JA5A 4XLNA 3AH5A 3S17K 3H3VD 4YFNA 1TWFC 3BUEA 2RH6A 3GIRA 4G0WA 4KM8A 2JA8C 4KATA 5C3EC 5FLMK 2ZFZA 2FQTA 2WB1L 4ZH4A 2PMZD 2P8TA 5IP9C 4A3GC 4C3IC 5E68A 3L4KA 4KB4A 3I4NK 1EH1A 1JVIA 3S2DC 4YFKA 1O2BA 4C3IK 1BS2A 1TWAK 3FOEA 2XCQA 5TMFA 2VUMA 4JK1A 3GTQC 2PMZL 1SMYA 4G0UA 3GTJC 1XXCA 3TTGA 5IYCC 3K7AK 2R92C 4QIWL 2EBBA 2Y3PA 3QX3A 3GTQK 5IOTA 1R9TK 1Y1VA 3GEEA 2JA6K 1X31C 4A3GK 3FHZA 4KM9A 3NUHA 1TWHK 1WOOA 4LJZA 4A93K 2XCOA 4WFAS 3S1MC 4BLBA 1TWCA 1I6HK 4A3IC 4ILDA 1TWFK 4PABA 2GAGC 3LAPA 3HOUK 4GTFA 3GTLA 4GFQA 1B4AA 1TWGA 1SFOA 1ZYRA 3WODA 1ZBSA 4BXXC 3ADAC 2R7ZK 1JQWA 4GTEA 3GTOA 3GEHA 3AQPA 5EGHA 3K7AC 5IYCK 1F7UA 3GTGA 3GTGC 1IBAA 3GTMA 2A68A 3BP8C 4G7ZA 2CW0A 5IYBK 2E2IC 4A93C 4KAWX 4A3MC 1DD5A 2V6TA 4FM9A 3V4GA 2NVYA 4WF9S 3S2HK 4LR2A 2R92K 3N0CA 3HOWC 1O27A 1EFWA 4A3EK 3S1NC 2ZUEA 1RU0A 3JSTA 5IP7C 4Q5SA 1TWAC 1XZPB 1Y1WC 4Y7NK 3HOUC 4KMHA 1K83A 2GAHC 1SFOK 4LK1A 1WQHA 1ISEA 3VA7A 3S16C 1J6VA 1PJ5A 3RZOK 2R93K 4X6AK 1F9NA 4IOCS 2E2HA 5JVHS 1I6HC 4GTDA 3GTKK 3GTOC 3RZOC 4XCHA 3GSIA 4GTAA 4XSXA 3GTLC 4P9SA 4WCES 1VGXA 3N0BA 1O2AA 2L5NA 2JA6A 3GTPC 4KMUA 3GTKA 2E2IA 2NVXK 2YU9A 1O26A 5IP7K 5CHPA 2PHCB 4AYBD 1VRQC 2PA8L 3LYWA 1TWHA 4GT9A 3S2DK 3FKIC 4WILA 2WB1D 1TWAA 4KDDA 2XCRB 3GTLK 4BBRC 1VJEA 3M4OK 1I3QA 4BY1C 4BLAA 1C0AA 3LPXA 4QIWD 2Y0SD 1WCMK 4MEXA 3SZZA 2NVXA 4BBRK 3CQZA 1HQMA 1Y1WK 4A3LK 4G7HA 4KN7A 1YCLA 3S14C 4IO9S 1XPPA 4GTCA 2NVYK 1WOSA 1BGWA 4OIQA 4BKWA 1Y1VK 1PJ6A 1I50A 4C2MC 1DCOA 3SZYA 2GSUA 5IYDK 3HOXC 3S1RK 1YNNA 1VH2A 2Y0SL 3GTJK 5HQHA 4WFBS 1AB4A 1JOEA 1UV7A 2CFAA 3CQZK 1EI6A 3G4AA 2JA5K 4PAAA 2A6HA 4OIPA 2R93A 4OINA 2NVQK 1EQRA 4BY1K 1XXBA 2PPBA 4AYBL 4XSZA 2E2HC 1IQ0A 1TWCK 1WSVA 4A3KC 3RZDK 5FJ8K 3S14K 3FKIK 1I50C 3CF5S 3AD7C 1IE0A 1PJ7A 5M5WK 3GTMC 1XZQB 2YU9K 4A3KK 2JA7K 5C4XK 1I50K 4A3DC 2KXYA 1O29A 2JA5C 3T01A 3S1QC 3GTQA 3S15C 2KPUA 5CJ9A 5C3EK 4Y7NC 2NVYC 5C4JK 3GTJA 2VUMK 4OIRA 1ZQ1C 2JA8K 2WAQL 3H0GA 3MMLB 5C4JC 1O25A 5JVOA 2W7VA 3PO3C 1V5VA 4FZBA 4BY7K 3AD8C 3S16K 3HOXK 3OREA 4A3FC 2L3UA 3N3YA 1TWGK 3HXAA 3FOFA 1IS1A 1K83K 2JA6C 1WQGA 4KMDA 2FQOA 3OEPA 2YU9C 2E2JC 3BP3A 5DM6S 4BBSC 1F93A 3S1NK 3S0XA 5IYDC 2R93C 1TWCC 4M1XA 3H3VL 2E2HK 2ZJPS 1WORA 4LK0A 4LQYA 1ZVUA 4YFXA 3PIPS 3PO3K 2A6EA 5JFEA 3GEIA 1XXAA
chains in the Genus database with same CATH topology
4KN7A 3S14C 1K83C 3GTGK 2VUMC 3GTKC 3PO2K 3S1MC 1XPPA 2E2JK 1I6HK 4Y52K 2NVYK 4A3IC 3S2HC 3I4MK 4OIQA 1TWFK 3H0GC 1I6VA 3HOUK 4C2MK 3S15K 3I4MC 4BY7C 1I3QC 1TWGC 1ZYRA 2WAQD 4YG2A 3WODA 1Y1VK 4C2MC 4BXXC 2R7ZK 3M3YK 4A3DK 1BDFA 5IYDK 3HOXC 3I4NC 3S1RK 1YNNA 4A3LC 3K7AC 2Y0SL 3HOZC 5IYCK 4Q4ZA 3GTGC 4A3CK 2A68A 2NVXC 5IYBK 4G7ZA 2CW0A 3GTJK 2E2IC 4A93C 3S17C 2NVTK 3S2DK 3CQZK 4A3MC 5D4DA 4OIOA 2JA5K 1TWHC 3HOVK 2A6HA 4OIPA 4X6AC 4OINA 4A3BC 2NVQK 4A3JK 4BY1K 2PPBA 4QJVB 4XSZA 1R9TC 2E2HC 4AYBL 4A3JC 1TWCK 5C4XC 5IYBC 3S2HK 3DXJA 4A3CC 4MEYA 4QJVA 4BBSK 3HOVC 4A3KC 5IP9K 2R92K 4Y52C 3S1MK 3HOWC 3RZDK 4A3MK 4A3EK 5FJ8K 3S14K 5C44C 2B63C 3HOYC 1I50C 1YNJA 4MQ9A 3FKIK 4A3EC 3S1NC 2E2IK 4LLGA 3GTMC 3RZDC 5M3MK 5M5WK 3GTOK 2JA7C 3HOWK 1Y1VC 5IP7C 4Q5SA 1TWAC 4A3KK 1Y1WC 2YU9K 4Y7NK 2JA7K 5C4XK 3GTMK 3S1RC 3HOUC 1I50K 3GTPK 3M3YC 2NVQC 4A3DC 1SFOK 2JA5C 4LK1A 4KN4A 3PO2C 2BE5A 3S1QC 3CQZC 4XLNA 3S17K 3H3VD 4YFNA 1TWFC 4NOIA 3S16C 3S15C 3RZOK 2R93K 4X6AK 5C3EK 4Y7NC 2NVYC 5C4JK 2PA8D 1I6HC 2JA8C 2VUMK 3GTKK 3GTOC 5C3EC 2NVTC 4OIRA 5FLMK 2B63K 3HOYK 2WB1L 4C3JC 4XLPA 3RZOC 4C3HK 3EQLA 4ZH4A 2JA8K 2WAQL 2PMZD 5IP9C 5C4JC 4XSXA 3HOZK 3S1QK 3GTLC 3PO3C 4C3IC 4A3GC 3HKZD 4BY7K 1SFOC 3S16K 3HOXK 3I4NK 4A3FC 4YFKA 3S2DC 4BXXK 3M4OC 1TWGK 4C3IK 1I3QK 1TWAK 1K83K 2JA6C 3GTPC 4GZYA 4KMUA 3H0GK 5TMFA 4JK1A 3GTQC 2PMZL 1SMYA 3GTJC 2NVXK 4A3IK 2YU9C 2A69A 5IYCC 2E2JC 3K7AK 2R92C 4QIWL 5IP7K 4BBSC 4AYBD 3S1NK 2PA8L 2O5JA 5M5YK 5IYDC 4A3FK 3FKIC 4G7OA 1TWCC 2R93C 5C44K 3GTQK 2R7ZC 1R9TK 5M5XK 2E2HK 3H3VL 2WB1D 2JA6K 4LK0A 5M3FK 4C3JK 4YFXA 2O5IA 3GTLK 4BBRC 3PO3K 4A3GK 3M4OK 1WCMC 2A6EA 4BY1C 4A3BK 5FLMC 4QIWD 5TMCA 2Y0SD 1WCMK 4MEXA 1TWHK 4BBRK 1HQMA 1Y1WK 4A3LK 1IW7A 4LJZA 3HKZL 4G7HA 4C3HC 4A93K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN7 A;  3S14 C;  1K83 C;  3GTG K;  2VUM C;  3GTK C;  3PO2 K;  3S1M C;  1XPP A;  2E2J K;  1I6H K;  4Y52 K;  2NVY K;  4A3I C;  3S2H C;  3I4M K;  4OIQ A;  1TWF K;  3H0G C;  1I6V A;  3HOU K;  4C2M K;  3S15 K;  3I4M C;  4BY7 C;  1I3Q C;  1TWG C;  1ZYR A;  2WAQ D;  4YG2 A;  3WOD A;  1Y1V K;  4C2M C;  4BXX C;  2R7Z K;  3M3Y K;  4A3D K;  1BDF A;  5IYD K;  3HOX C;  3I4N C;  3S1R K;  1YNN A;  4A3L C;  3K7A C;  2Y0S L;  3HOZ C;  5IYC K;  4Q4Z A;  3GTG C;  4A3C K;  2A68 A;  2NVX C;  5IYB K;  4G7Z A;  2CW0 A;  3GTJ K;  2E2I C;  4A93 C;  3S17 C;  2NVT K;  3S2D K;  3CQZ K;  4A3M C;  5D4D A;  4OIO A;  2JA5 K;  1TWH C;  3HOV K;  2A6H A;  4OIP A;  4X6A C;  4OIN A;  4A3B C;  2NVQ K;  4A3J K;  4BY1 K;  2PPB A;  4QJV B;  4XSZ A;  1R9T C;  2E2H C;  4AYB L;  4A3J C;  1TWC K;  5C4X C;  5IYB C;  3S2H K;  3DXJ A;  4A3C C;  4MEY A;  4QJV A;  4BBS K;  3HOV C;  4A3K C;  5IP9 K;  2R92 K;  4Y52 C;  3S1M K;  3HOW C;  3RZD K;  4A3M K;  4A3E K;  5FJ8 K;  3S14 K;  5C44 C;  2B63 C;  3HOY C;  1I50 C;  1YNJ A;  4MQ9 A;  3FKI K;  4A3E C;  3S1N C;  2E2I K;  4LLG A;  3GTM C;  3RZD C;  5M3M K;  5M5W K;  3GTO K;  2JA7 C;  3HOW K;  1Y1V C;  5IP7 C;  4Q5S A;  1TWA C;  4A3K K;  1Y1W C;  2YU9 K;  4Y7N K;  2JA7 K;  5C4X K;  3GTM K;  3S1R C;  3HOU C;  1I50 K;  3GTP K;  3M3Y C;  2NVQ C;  4A3D C;  1SFO K;  2JA5 C;  4LK1 A;  4KN4 A;  3PO2 C;  2BE5 A;  3S1Q C;  3CQZ C;  4XLN A;  3S17 K;  3H3V D;  4YFN A;  1TWF C;  4NOI A;  3S16 C;  3S15 C;  3RZO K;  2R93 K;  4X6A K;  5C3E K;  4Y7N C;  2NVY C;  5C4J K;  2PA8 D;  1I6H C;  2JA8 C;  2VUM K;  3GTK K;  3GTO C;  5C3E C;  2NVT C;  4OIR A;  5FLM K;  2B63 K;  3HOY K;  2WB1 L;  4C3J C;  4XLP A;  3RZO C;  4C3H K;  3EQL A;  4ZH4 A;  2JA8 K;  2WAQ L;  2PMZ D;  5IP9 C;  5C4J C;  4XSX A;  3HOZ K;  3S1Q K;  3GTL C;  3PO3 C;  4C3I C;  4A3G C;  3HKZ D;  4BY7 K;  1SFO C;  3S16 K;  3HOX K;  3I4N K;  4A3F C;  4YFK A;  3S2D C;  4BXX K;  3M4O C;  1TWG K;  4C3I K;  1I3Q K;  1TWA K;  1K83 K;  2JA6 C;  3GTP C;  4GZY A;  4KMU A;  3H0G K;  5TMF A;  4JK1 A;  3GTQ C;  2PMZ L;  1SMY A;  3GTJ C;  2NVX K;  4A3I K;  2YU9 C;  2A69 A;  5IYC C;  2E2J C;  3K7A K;  2R92 C;  4QIW L;  5IP7 K;  4BBS C;  4AYB D;  3S1N K;  2PA8 L;  2O5J A;  5M5Y K;  5IYD C;  4A3F K;  3FKI C;  4G7O A;  1TWC C;  2R93 C;  5C44 K;  3GTQ K;  2R7Z C;  1R9T K;  5M5X K;  2E2H K;  3H3V L;  2WB1 D;  2JA6 K;  4LK0 A;  5M3F K;  4C3J K;  4YFX A;  2O5I A;  3GTL K;  4BBR C;  3PO3 K;  4A3G K;  3M4O K;  1WCM C;  2A6E A;  4BY1 C;  4A3B K;  5FLM C;  4QIW D;  5TMC A;  2Y0S D;  1WCM K;  4MEX A;  1TWH K;  4BBR K;  1HQM A;  1Y1W K;  4A3L K;  1IW7 A;  4LJZ A;  3HKZ L;  4G7H A;  4C3H C;  4A93 K; 
#chains in the Genus database with same CATH topology
 1EK8 A;  3GTG K;  3GTK C;  1O24 A;  4P5B A;  2E2J K;  1GE9 A;  2R92 A;  3S15 K;  3H0G C;  3I4M C;  5HL7 S;  1TWG C;  1YX2 A;  3T02 A;  4A3D K;  1J6X A;  5JVG S;  4A3L C;  3L4J A;  4Q4Z A;  4A3C K;  2NVX C;  3CAG A;  2JA7 A;  3S17 C;  2NVT K;  1WQF A;  2GSN A;  5D4D A;  3TFH A;  3IPJ A;  2KWA A;  2ZJQ S;  4A3J C;  1J6W A;  5IYB C;  1TWF A;  4BBS K;  5IP9 K;  2ZJR S;  4Y52 C;  3ERE D;  4A3M K;  3Q3Q A;  3G4C A;  2B63 A;  5IOR A;  2B63 C;  3HOY C;  1YNJ A;  4MQ9 A;  2E2I K;  4LLG A;  3HOW K;  2JA7 C;  1Y1V C;  3TFJ A;  1WSR A;  4GTL A;  3S1R C;  3LAJ A;  3M3Y C;  1G51 A;  3OPF A;  1VLO A;  4KN4 A;  1DCP A;  3PO2 C;  2V6U A;  2BE5 A;  3CQZ C;  1INN A;  4NOI A;  4WJ4 A;  1R9T A;  4C45 A;  2PA8 D;  4G0V A;  1ZXO A;  4KC6 A;  2NVT C;  2B63 K;  3HOY K;  4C3J C;  4XLP A;  4RMF A;  4C3H K;  3EQL A;  4WJ3 M;  1DCH A;  3FKI A;  3S1Q K;  3HOZ K;  3HKZ D;  1SFO C;  1Y1W A;  4DDQ A;  1O2F B;  1WCM A;  4BXX K;  2CFA B;  3M4O C;  4LOW A;  1I3Q K;  3T00 A;  3GTP A;  4GZY A;  2P5M A;  3H0G K;  1KQ4 A;  3A8I A;  4KAR A;  3DLL S;  4A3I K;  5IOQ A;  2A69 A;  3A8J A;  4AH6 A;  2O5J A;  5M5Y K;  4A3F K;  4G7O A;  5C44 K;  2R7Z C;  4GTB A;  5M5X K;  5M3F K;  5IOS A;  1XZQ A;  2O5I A;  2ZUF A;  5DM7 S;  4P5A A;  1WCM C;  1IL2 A;  4U67 S;  3GDZ A;  5FLM C;  2JH3 A;  4A3B K;  5TMC A;  2D6F C;  4WFN S;  1USM A;  1IW7 A;  3HKZ L;  4C3H C;  4C3J K;  1K83 C;  2VUM C;  3PO2 K;  4Y52 K;  3S2H C;  3I4M K;  1I6V A;  4C2M K;  4BY7 C;  5L46 A;  1I3Q C;  2WAQ D;  4YG2 A;  4KB2 A;  1L0W A;  3M3Y K;  1BDF A;  2KQ1 A;  3I4N C;  3AQO A;  5HL8 A;  3HOZ C;  2RGR A;  1F7V A;  4IOA S;  5TJ3 A;  1J98 A;  1BJT A;  4OIO A;  1WOP A;  1TWH C;  3PIO S;  3HOV K;  4X6A C;  4A3B C;  4A3J K;  1USO A;  4KMA A;  1R9T C;  4QJV B;  4J3N A;  5C4X C;  1B4B A;  3DXJ A;  4A3C C;  4MEY A;  4QJV A;  1FEU A;  3HOV C;  3TFI A;  2GSO A;  4KAS A;  3S1M K;  3A8K A;  3AD9 C;  5C44 C;  3GTO K;  4A3E C;  3RZD C;  1O28 A;  5M3M K;  2R7Z A;  3GTM K;  1XZP A;  1HI9 A;  2V6S A;  5EGE A;  3GTP K;  4O2D A;  2NVQ C;  1WIH A;  2JA5 A;  4XLN A;  3AH5 A;  3S17 K;  3H3V D;  4YFN A;  1TWF C;  3BUE A;  2RH6 A;  3GIR A;  4G0W A;  4KM8 A;  2JA8 C;  4KAT A;  5C3E C;  5FLM K;  2ZFZ A;  2FQT A;  2WB1 L;  4ZH4 A;  2PMZ D;  2P8T A;  5IP9 C;  4A3G C;  4C3I C;  5E68 A;  3L4K A;  4KB4 A;  3I4N K;  1EH1 A;  1JVI A;  3S2D C;  4YFK A;  1O2B A;  4C3I K;  1BS2 A;  1TWA K;  3FOE A;  2XCQ A;  5TMF A;  2VUM A;  4JK1 A;  3GTQ C;  2PMZ L;  1SMY A;  4G0U A;  3GTJ C;  1XXC A;  3TTG A;  5IYC C;  3K7A K;  2R92 C;  4QIW L;  2EBB A;  2Y3P A;  3QX3 A;  3GTQ K;  5IOT A;  1R9T K;  1Y1V A;  3GEE A;  2JA6 K;  1X31 C;  4A3G K;  3FHZ A;  4KM9 A;  3NUH A;  1TWH K;  1WOO A;  4LJZ A;  4A93 K;  2XCO A;  4WFA S;  3S1M C;  4BLB A;  1TWC A;  1I6H K;  4A3I C;  4ILD A;  1TWF K;  4PAB A;  2GAG C;  3LAP A;  3HOU K;  4GTF A;  3GTL A;  4GFQ A;  1B4A A;  1TWG A;  1SFO A;  1ZYR A;  3WOD A;  1ZBS A;  4BXX C;  3ADA C;  2R7Z K;  1JQW A;  4GTE A;  3GTO A;  3GEH A;  3AQP A;  5EGH A;  3K7A C;  5IYC K;  1F7U A;  3GTG A;  3GTG C;  1IBA A;  3GTM A;  2A68 A;  3BP8 C;  4G7Z A;  2CW0 A;  5IYB K;  2E2I C;  4A93 C;  4KAW X;  4A3M C;  1DD5 A;  2V6T A;  4FM9 A;  3V4G A;  2NVY A;  4WF9 S;  3S2H K;  4LR2 A;  2R92 K;  3N0C A;  3HOW C;  1O27 A;  1EFW A;  4A3E K;  3S1N C;  2ZUE A;  1RU0 A;  3JST A;  5IP7 C;  4Q5S A;  1TWA C;  1XZP B;  1Y1W C;  4Y7N K;  3HOU C;  4KMH A;  1K83 A;  2GAH C;  1SFO K;  4LK1 A;  1WQH A;  1ISE A;  3VA7 A;  3S16 C;  1J6V A;  1PJ5 A;  3RZO K;  2R93 K;  4X6A K;  1F9N A;  4IOC S;  2E2H A;  5JVH S;  1I6H C;  4GTD A;  3GTK K;  3GTO C;  3RZO C;  4XCH A;  3GSI A;  4GTA A;  4XSX A;  3GTL C;  4P9S A;  4WCE S;  1VGX A;  3N0B A;  1O2A A;  2L5N A;  2JA6 A;  3GTP C;  4KMU A;  3GTK A;  2E2I A;  2NVX K;  2YU9 A;  1O26 A;  5IP7 K;  5CHP A;  2PHC B;  4AYB D;  1VRQ C;  2PA8 L;  3LYW A;  1TWH A;  4GT9 A;  3S2D K;  3FKI C;  4WIL A;  2WB1 D;  1TWA A;  4KDD A;  2XCR B;  3GTL K;  4BBR C;  1VJE A;  3M4O K;  1I3Q A;  4BY1 C;  4BLA A;  1C0A A;  3LPX A;  4QIW D;  2Y0S D;  1WCM K;  4MEX A;  3SZZ A;  2NVX A;  4BBR K;  3CQZ A;  1HQM A;  1Y1W K;  4A3L K;  4G7H A;  4KN7 A;  1YCL A;  3S14 C;  4IO9 S;  1XPP A;  4GTC A;  2NVY K;  1WOS A;  1BGW A;  4OIQ A;  4BKW A;  1Y1V K;  1PJ6 A;  1I50 A;  4C2M C;  1DCO A;  3SZY A;  2GSU A;  5IYD K;  3HOX C;  3S1R K;  1YNN A;  1VH2 A;  2Y0S L;  3GTJ K;  5HQH A;  4WFB S;  1AB4 A;  1JOE A;  1UV7 A;  2CFA A;  3CQZ K;  1EI6 A;  3G4A A;  2JA5 K;  4PAA A;  2A6H A;  4OIP A;  2R93 A;  4OIN A;  2NVQ K;  1EQR A;  4BY1 K;  1XXB A;  2PPB A;  4AYB L;  4XSZ A;  2E2H C;  1IQ0 A;  1TWC K;  1WSV A;  4A3K C;  3RZD K;  5FJ8 K;  3S14 K;  3FKI K;  1I50 C;  3CF5 S;  3AD7 C;  1IE0 A;  1PJ7 A;  5M5W K;  3GTM C;  1XZQ B;  2YU9 K;  4A3K K;  2JA7 K;  5C4X K;  1I50 K;  4A3D C;  2KXY A;  1O29 A;  2JA5 C;  3T01 A;  3S1Q C;  3GTQ A;  3S15 C;  2KPU A;  5CJ9 A;  5C3E K;  4Y7N C;  2NVY C;  5C4J K;  3GTJ A;  2VUM K;  4OIR A;  1ZQ1 C;  2JA8 K;  2WAQ L;  3H0G A;  3MML B;  5C4J C;  1O25 A;  5JVO A;  2W7V A;  3PO3 C;  1V5V A;  4FZB A;  4BY7 K;  3AD8 C;  3S16 K;  3HOX K;  3ORE A;  4A3F C;  2L3U A;  3N3Y A;  1TWG K;  3HXA A;  3FOF A;  1IS1 A;  1K83 K;  2JA6 C;  1WQG A;  4KMD A;  2FQO A;  3OEP A;  2YU9 C;  2E2J C;  3BP3 A;  5DM6 S;  4BBS C;  1F93 A;  3S1N K;  3S0X A;  5IYD C;  2R93 C;  1TWC C;  4M1X A;  3H3V L;  2E2H K;  2ZJP S;  1WOR A;  4LK0 A;  4LQY A;  1ZVU A;  4YFX A;  3PIP S;  3PO3 K;  2A6E A;  5JFE A;  3GEI A;  1XXA A; 
#chains in the Genus database with same CATH homology
 4KN7 A;  3S14 C;  1K83 C;  3GTG K;  2VUM C;  3GTK C;  3PO2 K;  3S1M C;  1XPP A;  2E2J K;  1I6H K;  4Y52 K;  2NVY K;  4A3I C;  3S2H C;  3I4M K;  4OIQ A;  1TWF K;  3H0G C;  1I6V A;  3HOU K;  4C2M K;  3S15 K;  3I4M C;  4BY7 C;  1I3Q C;  1TWG C;  1ZYR A;  2WAQ D;  4YG2 A;  3WOD A;  1Y1V K;  4C2M C;  4BXX C;  2R7Z K;  3M3Y K;  4A3D K;  1BDF A;  5IYD K;  3HOX C;  3I4N C;  3S1R K;  1YNN A;  4A3L C;  3K7A C;  2Y0S L;  3HOZ C;  5IYC K;  4Q4Z A;  3GTG C;  4A3C K;  2A68 A;  2NVX C;  5IYB K;  4G7Z A;  2CW0 A;  3GTJ K;  2E2I C;  4A93 C;  3S17 C;  2NVT K;  3S2D K;  3CQZ K;  4A3M C;  5D4D A;  4OIO A;  2JA5 K;  1TWH C;  3HOV K;  2A6H A;  4OIP A;  4X6A C;  4OIN A;  4A3B C;  2NVQ K;  4A3J K;  4BY1 K;  2PPB A;  4QJV B;  4XSZ A;  1R9T C;  2E2H C;  4AYB L;  4A3J C;  1TWC K;  5C4X C;  5IYB C;  3S2H K;  3DXJ A;  4A3C C;  4MEY A;  4QJV A;  4BBS K;  3HOV C;  4A3K C;  5IP9 K;  2R92 K;  4Y52 C;  3S1M K;  3HOW C;  3RZD K;  4A3M K;  4A3E K;  5FJ8 K;  3S14 K;  5C44 C;  2B63 C;  3HOY C;  1I50 C;  1YNJ A;  4MQ9 A;  3FKI K;  4A3E C;  3S1N C;  2E2I K;  4LLG A;  3GTM C;  3RZD C;  5M3M K;  5M5W K;  3GTO K;  2JA7 C;  3HOW K;  1Y1V C;  5IP7 C;  4Q5S A;  1TWA C;  4A3K K;  1Y1W C;  2YU9 K;  4Y7N K;  2JA7 K;  5C4X K;  3GTM K;  3S1R C;  3HOU C;  1I50 K;  3GTP K;  3M3Y C;  2NVQ C;  4A3D C;  1SFO K;  2JA5 C;  4LK1 A;  4KN4 A;  3PO2 C;  2BE5 A;  3S1Q C;  3CQZ C;  4XLN A;  3S17 K;  3H3V D;  4YFN A;  1TWF C;  4NOI A;  3S16 C;  3S15 C;  3RZO K;  2R93 K;  4X6A K;  5C3E K;  4Y7N C;  2NVY C;  5C4J K;  2PA8 D;  1I6H C;  2JA8 C;  2VUM K;  3GTK K;  3GTO C;  5C3E C;  2NVT C;  4OIR A;  5FLM K;  2B63 K;  3HOY K;  2WB1 L;  4C3J C;  4XLP A;  3RZO C;  4C3H K;  3EQL A;  4ZH4 A;  2JA8 K;  2WAQ L;  2PMZ D;  5IP9 C;  5C4J C;  4XSX A;  3HOZ K;  3S1Q K;  3GTL C;  3PO3 C;  4C3I C;  4A3G C;  3HKZ D;  4BY7 K;  1SFO C;  3S16 K;  3HOX K;  3I4N K;  4A3F C;  4YFK A;  3S2D C;  4BXX K;  3M4O C;  1TWG K;  4C3I K;  1I3Q K;  1TWA K;  1K83 K;  2JA6 C;  3GTP C;  4GZY A;  4KMU A;  3H0G K;  5TMF A;  4JK1 A;  3GTQ C;  2PMZ L;  1SMY A;  3GTJ C;  2NVX K;  4A3I K;  2YU9 C;  2A69 A;  5IYC C;  2E2J C;  3K7A K;  2R92 C;  4QIW L;  5IP7 K;  4BBS C;  4AYB D;  3S1N K;  2PA8 L;  2O5J A;  5M5Y K;  5IYD C;  4A3F K;  3FKI C;  4G7O A;  1TWC C;  2R93 C;  5C44 K;  3GTQ K;  2R7Z C;  1R9T K;  5M5X K;  2E2H K;  3H3V L;  2WB1 D;  2JA6 K;  4LK0 A;  5M3F K;  4C3J K;  4YFX A;  2O5I A;  3GTL K;  4BBR C;  3PO3 K;  4A3G K;  3M4O K;  1WCM C;  2A6E A;  4BY1 C;  4A3B K;  5FLM C;  4QIW D;  5TMC A;  2Y0S D;  1WCM K;  4MEX A;  1TWH K;  4BBR K;  1HQM A;  1Y1W K;  4A3L K;  1IW7 A;  4LJZ A;  3HKZ L;  4G7H A;  4C3H C;  4A93 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...