4GZYA

Crystal structures of bacterial rna polymerase paused elongation complexes
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
223
structure length
223
Chain Sequence
b'KAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis of transcriptional pausing in bacteria.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription/dna/rna
total genus 39
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4gzyA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4gzyA01
3GTGC 5TMFA 3M3YC 3HKZL 4OIQA 1TWFC 4A3IC 4A3EK 2JA7C 1ZYRA 5IYDK 4YFXA 2A69A 2E2HK 4OIRA 1WCMK 2VUMK 3S1NK 1I6VA 5D4DA 4G7OA 4A3KC 2R92K 4A93K 5M3FK 4OINA 3S16K 1K83C 5M5WK 4A3GC 5IYBK 5TMCA 2B63K 3S2HK 4BXXK 4A3EC 3GTOC 4G7ZA 5IYDC 2YU9C 2PA8L 3PO3K 4JK1A 4YFKA 3S1MC 3S1NC 3M3YK 4KN7A 1TWFK 3HOWK 2JA7K 3H3VD 4A93C 3S17K 3S2DC 2A6EA 1TWAK 5IP9K 2PPBA 4BBRK 4AYBL 4A3KK 3WODA 3HOZK 3PO3C 4YFNA 1HQMA 4BY1C 2R92C 4A3GK 1R9TC 1TWCK 5IP7C 3HOWC 5C3EK 3GTOK 3HOYK 3S17C 3GTKK 2YU9K 4QJVA 4QIWL 5M3MK 1TWAC 4LJZA 5IYCC 3S1MK 5IP9C 4C3HK 2WAQD 4BBRC 3H0GK 2NVXK 2JA8C 2O5IA 3HOZC 4XLNA 2NVQK 3S2DK 4A3BC 4X6AC 1TWCC 3HOYC 5C3EC 4Q4ZA 3GTKC 2Y0SD 4Y7NK 4XSXA 2PMZL 4ZH4A 4C3HC 4BY1K 3H0GC 4G7HA 4XLPA 1TWHC 2NVXC 3HOXC 5IP7K 1R9TK 2O5JA 3I4NK 1SMYA 4GZYA 4NOIA 3HKZD 4MQ9A 2NVQC 3S15C 3DXJA 3HOUC 5IYCK 4C2MC 2A68A 2JA8K 4LK1A 2WB1L 3RZOK 4Y7NC 4C3IK 4A3MC 4A3CK 1YNNA 4OIPA 3RZDC 3EQLA 3GTQK 4A3BK 4KMUA 4X6AK 5C4XK 2JA6C 3S14K 2E2JK 3I4NC 3GTPK 4LLGA 2PA8D 1SFOK 3M4OC 1TWHK 3HOXK 3CQZK 3RZOC 3HOVC 2R7ZK 3S15K 1IW7A 4C3IC 1Y1WC 4A3CC 1Y1VK 1I50C 3GTQC 4C2MK 3HOUK 5FLMC 2NVTC 3S14C 5C4XC 4YG2A 5C4JC 2E2JC 3GTPC 4AYBD 2JA5C 3PO2C 4A3MK 3S1RK 3GTJK 3RZDK 4Y52K 4C3JC 1SFOC 2BE5A 3I4MC 2JA6K 4LK0A 4A3JC 3CQZC 2R7ZC 4Q5SA 1Y1VC 3K7AK 3H3VL 4BY7K 1I6HK 3M4OK 4QIWD 4A3LK 3GTMC 4BBSK 2R93K 3HOVK 3S1RC 1Y1WK 4Y52C 3GTJC 1I50K 3FKIK 5C44C 5FLMK 4A3FK 2NVTK 3S1QC 5C4JK 4QJVB 2E2IK 4A3DC 3GTLK 2NVYC 2JA5K 3PO2K 3K7AC 4MEYA 4XSZA 4BY7C 1I6HC 1I3QK 1TWGK 4C3JK 4A3LC 1XPPA 3I4MK 4BBSC 2R93C 2PMZD 4A3JK 2WAQL 1BDFA 4KN4A 2E2HC 1WCMC 3FKIC 2VUMC 3GTGK 4A3FC 2A6HA 3GTMK 5M5YK 4A3IK 2E2IC 3GTLC 5FJ8K 3S16C 5IYBC 2Y0SL 1I3QC 2WB1D 1TWGC 2CW0A 4MEXA 2B63C 3S2HC 4BXXC 1YNJA 5C44K 3S1QK 4A3DK 4OIOA 2NVYK 5M5XK 1K83K
chains in the Genus database with same CATH superfamily
3GTGC 3M3YC 4A3IC 5TJ3A 2RH6A 1INNA 2E2HK 4LQYA 1I6VA 1J6XA 4KARA 5M3FK 3OPFA 3S16K 1O28A 5M5WK 5IYBK 3GTOC 1XZPB 1TWCA 2YU9C 2GSOA 3GTPA 3VA7A 2KQ1A 1B4AA 1EH1A 3FOFA 1F7UA 4BBRK 4AYBL 4A3KK 1X31C 1XZQA 2ZUFA 1XXAA 2RGRA 2R92C 1F7VA 1F9NA 1PJ5A 3GEEA 4KDDA 4QIWL 2JA6A 1TWAC 5IP9C 4C3HK 2WAQD 1WIHA 4X6AC 5C3EC 3GTKC 2PMZL 4KM8A 3H0GC 5IP7K 3HXAA 2ZFZA 3HOUC 1DD5A 3AQPA 1Y1VA 4LK1A 1PJ6A 2WB1L 3A8JA 1IL2A 4A3CK 3RZDC 4KMUA 4KATA 1WSVA 4AH6A 5C4XK 3GTPK 3OREA 4LOWA 4GTAA 2PA8D 3M4OC 5DM7S 3HOXK 3BP3A 1EFWA 1Y1WC 3GTQC 5FLMC 2L3UA 2NVTC 1WCMA 4YG2A 3ADAC 3A8IA 4A3MK 3A8KA 1SFOC 2JA6K 2B63A 3V4GA 4M1XA 1ZXOA 5HQHA 3GTMC 3QX3A 1TWFA 3GTJC 2FQOA 2ZUEA 1V5VA 4A3DC 2NVYC 1WSRA 1I3QK 2PHCB 3SZZA 3T02A 1ZBSA 1K83A 3I4MK 4XCHA 3GTKA 1JVIA 2VUMC 1XXCA 3GTGK 2A6HA 4A3IK 2E2IC 3TFHA 4MEXA 4KMAA 5C44K 3TFJA 4OIOA 3AD9C 4KASA 4OIQA 2JA7C 1R9TA 3GEHA 4OIRA 1WCMK 4GT9A 4KB4A 4G7OA 5CHPA 4OINA 2B63K 4A3EC 4YFKA 1TWFK 3G4CA 3H3VD 3S2DC 1WOPA 1DCOA 1B4BA 1O29A 1TWAK 5IP9K 2PPBA 3TFIA 2ZJRS 3GIRA 3AD8C 1XXBA 4BY1C 4A3GK 3GTJA 3HOWC 5C3EK 3GTKK 4GTFA 5M3MK 4WILA 3S1MK 3H0GK 2JA8C 4A3BC 5JFEA 3MMLB 1KQ4A 4G0VA 3HOYC 1I50A 4Q4ZA 4BKWA 2Y0SD 4XSXA 1WQHA 1J6WA 4G7HA 2NVXC 1AB4A 1TWHC 1R9TK 2O5JA 1SMYA 4RMFA 2NVQC 4MQ9A 3DLLS 2GSUA 5IYCK 4GTDA 4C2MC 2A68A 4Y7NC 4OIPA 3GTQK 3I4NC 4WFAS 2Y3PA 5JVGS 1SFOK 4IO9S 1XZPA 1WQGA 1DCPA 3S15K 1IW7A 3S14C 5C4JC 2E2JC 4AYBD 2JA5C 3OEPA 1VH2A 3GTJK 2KWAA 5HL7S 1I3QA 3CQZC 5IOTA 2R7ZC 4Q5SA 1J6VA 4QIWD 5JVOA 3GTGA 3AH5A 3HOVK 4Y52C 1I50K 1JOEA 3S1QC 2ZJPS 4WFNS 1IE0A 4LR2A 4QJVB 2E2IK 3PO2K 3K7AC 4MEYA 4BY7C 1I6HC 4C3JK 1VJEA 1XPPA 4BBSC 2R93C 2PMZD 4A3JK 1O26A 1BDFA 4GFQA 3GTOA 2E2HC 2YU9A 3FKIC 4KMHA 3PIPS 3S16C 3PIOS 5IYBC 4DDQA 2WB1D 1TWGC 1YNJA 3TTGA 5M5XK 2D6FC 2KXYA 3HKZL 4A3EK 2R92A 1ZYRA 2A69A 5HL8A 3ERED 4A3KC 1TWAA 1J98A 4BLBA 4FZBA 3S2HK 4BXXK 5DM6S 4G7ZA 5IYDC 3S1NC 3M3YK 4KN7A 3HOWK 4GTCA 3H0GA 4A93C 2A6EA 1O27A 4WJ4A 4PABA 2V6TA 5IORA 3WODA 3PO3C 4YFNA 1HQMA 1GE9A 4KC6A 5E68A 5IP7C 3HOYK 3GTOK 3S17C 4KAWX 2YU9K 4C45A 1IS1A 2NVXK 1C0AA 5IOSA 2O5IA 2KPUA 4XLNA 3HOZC 1BJTA 2NVQK 1TWCC 1Y1WA 3GTQA 4Y7NK 2R92K 1VLOA 1PJ7A 3HOXC 3N0BA 5CJ9A 1SFOA 3I4NK 4NOIA 3LYWA 3DXJA 3AD7C 2GSNA 3GTMA 4A3MC 3LAPA 4X6AK 1ZQ1C 3EQLA 3S14K 3CF5S 2JA6C 2E2JK 4LLGA 2NVYA 4IOAS 3CQZK 3RZOC 2R7ZK 4C3IC 3HOUK 2VUMA 1EQRA 4ILDA 3SZYA 3N3YA 3RZDK 3Q3QA 2E2IA 4Y52K 2V6SA 3I4MC 4LK0A 3BUEA 1RU0A 1G51A 2P5MA 4P5AA 1Y1VC 3K7AK 2P8TA 4BY7K 3S0XA 1I6HK 3M4OK 4BBSK 2R93K 1XZQB 2L5NA 3S1RC 2JA7A 1Y1WK 4WF9S 3FKIK 5C44C 5FLMK 2NVTK 4IOCS 2GAHC 4XSZA 4U67S 1TWGK 4A3LC 2EBBA 2WAQL 5EGEA 1O2FB 1WCMC 4A3FC 3LPXA 3GTMK 3NUHA 3GTLC 5FJ8K 4G0UA 3JSTA 2B63C 2CW0A 1USOA 4A3DK 2NVYK 5TMFA 4GTBA 1TWFC 5IYDK 4YFXA 1WORA 3AQOA 2VUMK 3S1NK 2CFAB 5D4DA 4A93K 1K83C 4A3GC 5TMCA 3LAJA 1JQWA 4PAAA 3G4AA 3CAGA 1WQFA 1UV7A 2PA8L 3PO3K 4JK1A 3S1MC 2FQTA 2JA7K 3S17K 2NVXA 1TWHA 1L0WA 1O2AA 4O2DA 1ZVUA 3L4JA 1ISEA 3HOZK 2XCQA 2XCOA 1YX2A 1R9TC 1TWCK 2CFAA 4WFBS 3N0CA 4QJVA 2JH3A 5IYCC 4LJZA 4KB2A 1IBAA 4BBRC 3L4KA 2V6UA 3T00A 3S2DK 1VRQC 1WOOA 4P5BA 3GTLA 4ZH4A 4C3HC 1USMA 4BY1K 1FEUA 4XLPA 2JA5A 4GZYA 3HKZD 4FM9A 3S15C 4WCES 5JVHS 2ZJQS 3CQZA 2R7ZA 2JA8K 1O24A 2GAGC 3RZOK 1YCLA 4C3IK 4A3BK 1YNNA 4KMDA 3BP8C 3FHZA 1TWHK 2XCRB 3HOVC 2R93A 1IQ0A 4A3CC 1Y1VK 1I50C 4C2MK 4G0WA 1F93A 5C4XC 2W7VA 3GSIA 3FKIA 2E2HA 1VGXA 3GTPC 3PO2C 3S1RK 3IPJA 4C3JC 1HI9A 2BE5A 3GEIA 1TWGA 4A3JC 4WJ3M 4BLAA 3H3VL 4A3LK 1O25A 4P9SA 1BS2A 4KM9A 3FOEA 4A3FK 5C4JK 3GTLK 2JA5K 3GDZA 1DCHA 4GTEA 5L46A 4KN4A 5EGHA 5IOQA 1BGWA 5M5YK 2Y0SL 1I3QC 4GTLA 3S2HC 4J3NA 4BXXC 1EI6A 3S1QK 1O2BA 1WOSA 3T01A 1EK8A 1K83K
chains in the Genus database with same CATH topology
3GTGC 5TMFA 3M3YC 3HKZL 4OIQA 1TWFC 4A3IC 4A3EK 2JA7C 1ZYRA 5IYDK 4YFXA 2A69A 2E2HK 4OIRA 1WCMK 2VUMK 3S1NK 1I6VA 5D4DA 4G7OA 4A3KC 2R92K 4A93K 5M3FK 4OINA 3S16K 1K83C 5M5WK 4A3GC 5IYBK 5TMCA 2B63K 3S2HK 4BXXK 4A3EC 3GTOC 4G7ZA 5IYDC 2YU9C 2PA8L 3PO3K 4JK1A 4YFKA 3S1MC 3S1NC 3M3YK 4KN7A 1TWFK 3HOWK 2JA7K 3H3VD 4A93C 3S17K 3S2DC 2A6EA 1TWAK 5IP9K 2PPBA 4BBRK 4AYBL 4A3KK 3WODA 3HOZK 3PO3C 4YFNA 1HQMA 4BY1C 2R92C 4A3GK 1R9TC 1TWCK 5IP7C 3HOWC 5C3EK 3GTOK 3HOYK 3S17C 3GTKK 2YU9K 4QJVA 4QIWL 5M3MK 1TWAC 4LJZA 5IYCC 3S1MK 5IP9C 4C3HK 2WAQD 4BBRC 3H0GK 2NVXK 2JA8C 2O5IA 3HOZC 4XLNA 2NVQK 3S2DK 4A3BC 4X6AC 1TWCC 3HOYC 5C3EC 4Q4ZA 3GTKC 2Y0SD 4Y7NK 4XSXA 2PMZL 4ZH4A 4C3HC 4BY1K 3H0GC 4G7HA 4XLPA 1TWHC 2NVXC 3HOXC 5IP7K 1R9TK 2O5JA 3I4NK 1SMYA 4GZYA 4NOIA 3HKZD 4MQ9A 2NVQC 3S15C 3DXJA 3HOUC 5IYCK 4C2MC 2A68A 2JA8K 4LK1A 2WB1L 3RZOK 4Y7NC 4C3IK 4A3MC 4A3CK 1YNNA 4OIPA 3RZDC 3EQLA 3GTQK 4A3BK 4KMUA 4X6AK 5C4XK 2JA6C 3S14K 2E2JK 3I4NC 3GTPK 4LLGA 2PA8D 1SFOK 3M4OC 1TWHK 3HOXK 3CQZK 3RZOC 3HOVC 2R7ZK 3S15K 1IW7A 4C3IC 1Y1WC 4A3CC 1Y1VK 1I50C 3GTQC 4C2MK 3HOUK 5FLMC 2NVTC 3S14C 5C4XC 4YG2A 5C4JC 2E2JC 3GTPC 4AYBD 2JA5C 3PO2C 4A3MK 3S1RK 3GTJK 3RZDK 4Y52K 4C3JC 1SFOC 2BE5A 3I4MC 2JA6K 4LK0A 4A3JC 3CQZC 2R7ZC 4Q5SA 1Y1VC 3K7AK 3H3VL 4BY7K 1I6HK 3M4OK 4QIWD 4A3LK 3GTMC 4BBSK 2R93K 3HOVK 3S1RC 1Y1WK 4Y52C 3GTJC 1I50K 3FKIK 5C44C 5FLMK 4A3FK 2NVTK 3S1QC 5C4JK 4QJVB 2E2IK 4A3DC 3GTLK 2NVYC 2JA5K 3PO2K 3K7AC 4MEYA 4XSZA 4BY7C 1I6HC 1I3QK 1TWGK 4C3JK 4A3LC 1XPPA 3I4MK 4BBSC 2R93C 2PMZD 4A3JK 2WAQL 1BDFA 4KN4A 2E2HC 1WCMC 3FKIC 2VUMC 3GTGK 4A3FC 2A6HA 3GTMK 5M5YK 4A3IK 2E2IC 3GTLC 5FJ8K 3S16C 5IYBC 2Y0SL 1I3QC 2WB1D 1TWGC 2CW0A 4MEXA 2B63C 3S2HC 4BXXC 1YNJA 5C44K 3S1QK 4A3DK 4OIOA 2NVYK 5M5XK 1K83K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTG C;  5TMF A;  3M3Y C;  3HKZ L;  4OIQ A;  1TWF C;  4A3I C;  4A3E K;  2JA7 C;  1ZYR A;  5IYD K;  4YFX A;  2A69 A;  2E2H K;  4OIR A;  1WCM K;  2VUM K;  3S1N K;  1I6V A;  5D4D A;  4G7O A;  4A3K C;  2R92 K;  4A93 K;  5M3F K;  4OIN A;  3S16 K;  1K83 C;  5M5W K;  4A3G C;  5IYB K;  5TMC A;  2B63 K;  3S2H K;  4BXX K;  4A3E C;  3GTO C;  4G7Z A;  5IYD C;  2YU9 C;  2PA8 L;  3PO3 K;  4JK1 A;  4YFK A;  3S1M C;  3S1N C;  3M3Y K;  4KN7 A;  1TWF K;  3HOW K;  2JA7 K;  3H3V D;  4A93 C;  3S17 K;  3S2D C;  2A6E A;  1TWA K;  5IP9 K;  2PPB A;  4BBR K;  4AYB L;  4A3K K;  3WOD A;  3HOZ K;  3PO3 C;  4YFN A;  1HQM A;  4BY1 C;  2R92 C;  4A3G K;  1R9T C;  1TWC K;  5IP7 C;  3HOW C;  5C3E K;  3GTO K;  3HOY K;  3S17 C;  3GTK K;  2YU9 K;  4QJV A;  4QIW L;  5M3M K;  1TWA C;  4LJZ A;  5IYC C;  3S1M K;  5IP9 C;  4C3H K;  2WAQ D;  4BBR C;  3H0G K;  2NVX K;  2JA8 C;  2O5I A;  3HOZ C;  4XLN A;  2NVQ K;  3S2D K;  4A3B C;  4X6A C;  1TWC C;  3HOY C;  5C3E C;  4Q4Z A;  3GTK C;  2Y0S D;  4Y7N K;  4XSX A;  2PMZ L;  4ZH4 A;  4C3H C;  4BY1 K;  3H0G C;  4G7H A;  4XLP A;  1TWH C;  2NVX C;  3HOX C;  5IP7 K;  1R9T K;  2O5J A;  3I4N K;  1SMY A;  4GZY A;  4NOI A;  3HKZ D;  4MQ9 A;  2NVQ C;  3S15 C;  3DXJ A;  3HOU C;  5IYC K;  4C2M C;  2A68 A;  2JA8 K;  4LK1 A;  2WB1 L;  3RZO K;  4Y7N C;  4C3I K;  4A3M C;  4A3C K;  1YNN A;  4OIP A;  3RZD C;  3EQL A;  3GTQ K;  4A3B K;  4KMU A;  4X6A K;  5C4X K;  2JA6 C;  3S14 K;  2E2J K;  3I4N C;  3GTP K;  4LLG A;  2PA8 D;  1SFO K;  3M4O C;  1TWH K;  3HOX K;  3CQZ K;  3RZO C;  3HOV C;  2R7Z K;  3S15 K;  1IW7 A;  4C3I C;  1Y1W C;  4A3C C;  1Y1V K;  1I50 C;  3GTQ C;  4C2M K;  3HOU K;  5FLM C;  2NVT C;  3S14 C;  5C4X C;  4YG2 A;  5C4J C;  2E2J C;  3GTP C;  4AYB D;  2JA5 C;  3PO2 C;  4A3M K;  3S1R K;  3GTJ K;  3RZD K;  4Y52 K;  4C3J C;  1SFO C;  2BE5 A;  3I4M C;  2JA6 K;  4LK0 A;  4A3J C;  3CQZ C;  2R7Z C;  4Q5S A;  1Y1V C;  3K7A K;  3H3V L;  4BY7 K;  1I6H K;  3M4O K;  4QIW D;  4A3L K;  3GTM C;  4BBS K;  2R93 K;  3HOV K;  3S1R C;  1Y1W K;  4Y52 C;  3GTJ C;  1I50 K;  3FKI K;  5C44 C;  5FLM K;  4A3F K;  2NVT K;  3S1Q C;  5C4J K;  4QJV B;  2E2I K;  4A3D C;  3GTL K;  2NVY C;  2JA5 K;  3PO2 K;  3K7A C;  4MEY A;  4XSZ A;  4BY7 C;  1I6H C;  1I3Q K;  1TWG K;  4C3J K;  4A3L C;  1XPP A;  3I4M K;  4BBS C;  2R93 C;  2PMZ D;  4A3J K;  2WAQ L;  1BDF A;  4KN4 A;  2E2H C;  1WCM C;  3FKI C;  2VUM C;  3GTG K;  4A3F C;  2A6H A;  3GTM K;  5M5Y K;  4A3I K;  2E2I C;  3GTL C;  5FJ8 K;  3S16 C;  5IYB C;  2Y0S L;  1I3Q C;  2WB1 D;  1TWG C;  2CW0 A;  4MEX A;  2B63 C;  3S2H C;  4BXX C;  1YNJ A;  5C44 K;  3S1Q K;  4A3D K;  4OIO A;  2NVY K;  5M5X K;  1K83 K; 
#chains in the Genus database with same CATH topology
 3GTG C;  3M3Y C;  4A3I C;  5TJ3 A;  2RH6 A;  1INN A;  2E2H K;  4LQY A;  1I6V A;  1J6X A;  4KAR A;  5M3F K;  3OPF A;  3S16 K;  1O28 A;  5M5W K;  5IYB K;  3GTO C;  1XZP B;  1TWC A;  2YU9 C;  2GSO A;  3GTP A;  3VA7 A;  2KQ1 A;  1B4A A;  1EH1 A;  3FOF A;  1F7U A;  4BBR K;  4AYB L;  4A3K K;  1X31 C;  1XZQ A;  2ZUF A;  1XXA A;  2RGR A;  2R92 C;  1F7V A;  1F9N A;  1PJ5 A;  3GEE A;  4KDD A;  4QIW L;  2JA6 A;  1TWA C;  5IP9 C;  4C3H K;  2WAQ D;  1WIH A;  4X6A C;  5C3E C;  3GTK C;  2PMZ L;  4KM8 A;  3H0G C;  5IP7 K;  3HXA A;  2ZFZ A;  3HOU C;  1DD5 A;  3AQP A;  1Y1V A;  4LK1 A;  1PJ6 A;  2WB1 L;  3A8J A;  1IL2 A;  4A3C K;  3RZD C;  4KMU A;  4KAT A;  1WSV A;  4AH6 A;  5C4X K;  3GTP K;  3ORE A;  4LOW A;  4GTA A;  2PA8 D;  3M4O C;  5DM7 S;  3HOX K;  3BP3 A;  1EFW A;  1Y1W C;  3GTQ C;  5FLM C;  2L3U A;  2NVT C;  1WCM A;  4YG2 A;  3ADA C;  3A8I A;  4A3M K;  3A8K A;  1SFO C;  2JA6 K;  2B63 A;  3V4G A;  4M1X A;  1ZXO A;  5HQH A;  3GTM C;  3QX3 A;  1TWF A;  3GTJ C;  2FQO A;  2ZUE A;  1V5V A;  4A3D C;  2NVY C;  1WSR A;  1I3Q K;  2PHC B;  3SZZ A;  3T02 A;  1ZBS A;  1K83 A;  3I4M K;  4XCH A;  3GTK A;  1JVI A;  2VUM C;  1XXC A;  3GTG K;  2A6H A;  4A3I K;  2E2I C;  3TFH A;  4MEX A;  4KMA A;  5C44 K;  3TFJ A;  4OIO A;  3AD9 C;  4KAS A;  4OIQ A;  2JA7 C;  1R9T A;  3GEH A;  4OIR A;  1WCM K;  4GT9 A;  4KB4 A;  4G7O A;  5CHP A;  4OIN A;  2B63 K;  4A3E C;  4YFK A;  1TWF K;  3G4C A;  3H3V D;  3S2D C;  1WOP A;  1DCO A;  1B4B A;  1O29 A;  1TWA K;  5IP9 K;  2PPB A;  3TFI A;  2ZJR S;  3GIR A;  3AD8 C;  1XXB A;  4BY1 C;  4A3G K;  3GTJ A;  3HOW C;  5C3E K;  3GTK K;  4GTF A;  5M3M K;  4WIL A;  3S1M K;  3H0G K;  2JA8 C;  4A3B C;  5JFE A;  3MML B;  1KQ4 A;  4G0V A;  3HOY C;  1I50 A;  4Q4Z A;  4BKW A;  2Y0S D;  4XSX A;  1WQH A;  1J6W A;  4G7H A;  2NVX C;  1AB4 A;  1TWH C;  1R9T K;  2O5J A;  1SMY A;  4RMF A;  2NVQ C;  4MQ9 A;  3DLL S;  2GSU A;  5IYC K;  4GTD A;  4C2M C;  2A68 A;  4Y7N C;  4OIP A;  3GTQ K;  3I4N C;  4WFA S;  2Y3P A;  5JVG S;  1SFO K;  4IO9 S;  1XZP A;  1WQG A;  1DCP A;  3S15 K;  1IW7 A;  3S14 C;  5C4J C;  2E2J C;  4AYB D;  2JA5 C;  3OEP A;  1VH2 A;  3GTJ K;  2KWA A;  5HL7 S;  1I3Q A;  3CQZ C;  5IOT A;  2R7Z C;  4Q5S A;  1J6V A;  4QIW D;  5JVO A;  3GTG A;  3AH5 A;  3HOV K;  4Y52 C;  1I50 K;  1JOE A;  3S1Q C;  2ZJP S;  4WFN S;  1IE0 A;  4LR2 A;  4QJV B;  2E2I K;  3PO2 K;  3K7A C;  4MEY A;  4BY7 C;  1I6H C;  4C3J K;  1VJE A;  1XPP A;  4BBS C;  2R93 C;  2PMZ D;  4A3J K;  1O26 A;  1BDF A;  4GFQ A;  3GTO A;  2E2H C;  2YU9 A;  3FKI C;  4KMH A;  3PIP S;  3S16 C;  3PIO S;  5IYB C;  4DDQ A;  2WB1 D;  1TWG C;  1YNJ A;  3TTG A;  5M5X K;  2D6F C;  2KXY A;  3HKZ L;  4A3E K;  2R92 A;  1ZYR A;  2A69 A;  5HL8 A;  3ERE D;  4A3K C;  1TWA A;  1J98 A;  4BLB A;  4FZB A;  3S2H K;  4BXX K;  5DM6 S;  4G7Z A;  5IYD C;  3S1N C;  3M3Y K;  4KN7 A;  3HOW K;  4GTC A;  3H0G A;  4A93 C;  2A6E A;  1O27 A;  4WJ4 A;  4PAB A;  2V6T A;  5IOR A;  3WOD A;  3PO3 C;  4YFN A;  1HQM A;  1GE9 A;  4KC6 A;  5E68 A;  5IP7 C;  3HOY K;  3GTO K;  3S17 C;  4KAW X;  2YU9 K;  4C45 A;  1IS1 A;  2NVX K;  1C0A A;  5IOS A;  2O5I A;  2KPU A;  4XLN A;  3HOZ C;  1BJT A;  2NVQ K;  1TWC C;  1Y1W A;  3GTQ A;  4Y7N K;  2R92 K;  1VLO A;  1PJ7 A;  3HOX C;  3N0B A;  5CJ9 A;  1SFO A;  3I4N K;  4NOI A;  3LYW A;  3DXJ A;  3AD7 C;  2GSN A;  3GTM A;  4A3M C;  3LAP A;  4X6A K;  1ZQ1 C;  3EQL A;  3S14 K;  3CF5 S;  2JA6 C;  2E2J K;  4LLG A;  2NVY A;  4IOA S;  3CQZ K;  3RZO C;  2R7Z K;  4C3I C;  3HOU K;  2VUM A;  1EQR A;  4ILD A;  3SZY A;  3N3Y A;  3RZD K;  3Q3Q A;  2E2I A;  4Y52 K;  2V6S A;  3I4M C;  4LK0 A;  3BUE A;  1RU0 A;  1G51 A;  2P5M A;  4P5A A;  1Y1V C;  3K7A K;  2P8T A;  4BY7 K;  3S0X A;  1I6H K;  3M4O K;  4BBS K;  2R93 K;  1XZQ B;  2L5N A;  3S1R C;  2JA7 A;  1Y1W K;  4WF9 S;  3FKI K;  5C44 C;  5FLM K;  2NVT K;  4IOC S;  2GAH C;  4XSZ A;  4U67 S;  1TWG K;  4A3L C;  2EBB A;  2WAQ L;  5EGE A;  1O2F B;  1WCM C;  4A3F C;  3LPX A;  3GTM K;  3NUH A;  3GTL C;  5FJ8 K;  4G0U A;  3JST A;  2B63 C;  2CW0 A;  1USO A;  4A3D K;  2NVY K;  5TMF A;  4GTB A;  1TWF C;  5IYD K;  4YFX A;  1WOR A;  3AQO A;  2VUM K;  3S1N K;  2CFA B;  5D4D A;  4A93 K;  1K83 C;  4A3G C;  5TMC A;  3LAJ A;  1JQW A;  4PAA A;  3G4A A;  3CAG A;  1WQF A;  1UV7 A;  2PA8 L;  3PO3 K;  4JK1 A;  3S1M C;  2FQT A;  2JA7 K;  3S17 K;  2NVX A;  1TWH A;  1L0W A;  1O2A A;  4O2D A;  1ZVU A;  3L4J A;  1ISE A;  3HOZ K;  2XCQ A;  2XCO A;  1YX2 A;  1R9T C;  1TWC K;  2CFA A;  4WFB S;  3N0C A;  4QJV A;  2JH3 A;  5IYC C;  4LJZ A;  4KB2 A;  1IBA A;  4BBR C;  3L4K A;  2V6U A;  3T00 A;  3S2D K;  1VRQ C;  1WOO A;  4P5B A;  3GTL A;  4ZH4 A;  4C3H C;  1USM A;  4BY1 K;  1FEU A;  4XLP A;  2JA5 A;  4GZY A;  3HKZ D;  4FM9 A;  3S15 C;  4WCE S;  5JVH S;  2ZJQ S;  3CQZ A;  2R7Z A;  2JA8 K;  1O24 A;  2GAG C;  3RZO K;  1YCL A;  4C3I K;  4A3B K;  1YNN A;  4KMD A;  3BP8 C;  3FHZ A;  1TWH K;  2XCR B;  3HOV C;  2R93 A;  1IQ0 A;  4A3C C;  1Y1V K;  1I50 C;  4C2M K;  4G0W A;  1F93 A;  5C4X C;  2W7V A;  3GSI A;  3FKI A;  2E2H A;  1VGX A;  3GTP C;  3PO2 C;  3S1R K;  3IPJ A;  4C3J C;  1HI9 A;  2BE5 A;  3GEI A;  1TWG A;  4A3J C;  4WJ3 M;  4BLA A;  3H3V L;  4A3L K;  1O25 A;  4P9S A;  1BS2 A;  4KM9 A;  3FOE A;  4A3F K;  5C4J K;  3GTL K;  2JA5 K;  3GDZ A;  1DCH A;  4GTE A;  5L46 A;  4KN4 A;  5EGH A;  5IOQ A;  1BGW A;  5M5Y K;  2Y0S L;  1I3Q C;  4GTL A;  3S2H C;  4J3N A;  4BXX C;  1EI6 A;  3S1Q K;  1O2B A;  1WOS A;  3T01 A;  1EK8 A;  1K83 K; 
#chains in the Genus database with same CATH homology
 3GTG C;  5TMF A;  3M3Y C;  3HKZ L;  4OIQ A;  1TWF C;  4A3I C;  4A3E K;  2JA7 C;  1ZYR A;  5IYD K;  4YFX A;  2A69 A;  2E2H K;  4OIR A;  1WCM K;  2VUM K;  3S1N K;  1I6V A;  5D4D A;  4G7O A;  4A3K C;  2R92 K;  4A93 K;  5M3F K;  4OIN A;  3S16 K;  1K83 C;  5M5W K;  4A3G C;  5IYB K;  5TMC A;  2B63 K;  3S2H K;  4BXX K;  4A3E C;  3GTO C;  4G7Z A;  5IYD C;  2YU9 C;  2PA8 L;  3PO3 K;  4JK1 A;  4YFK A;  3S1M C;  3S1N C;  3M3Y K;  4KN7 A;  1TWF K;  3HOW K;  2JA7 K;  3H3V D;  4A93 C;  3S17 K;  3S2D C;  2A6E A;  1TWA K;  5IP9 K;  2PPB A;  4BBR K;  4AYB L;  4A3K K;  3WOD A;  3HOZ K;  3PO3 C;  4YFN A;  1HQM A;  4BY1 C;  2R92 C;  4A3G K;  1R9T C;  1TWC K;  5IP7 C;  3HOW C;  5C3E K;  3GTO K;  3HOY K;  3S17 C;  3GTK K;  2YU9 K;  4QJV A;  4QIW L;  5M3M K;  1TWA C;  4LJZ A;  5IYC C;  3S1M K;  5IP9 C;  4C3H K;  2WAQ D;  4BBR C;  3H0G K;  2NVX K;  2JA8 C;  2O5I A;  3HOZ C;  4XLN A;  2NVQ K;  3S2D K;  4A3B C;  4X6A C;  1TWC C;  3HOY C;  5C3E C;  4Q4Z A;  3GTK C;  2Y0S D;  4Y7N K;  4XSX A;  2PMZ L;  4ZH4 A;  4C3H C;  4BY1 K;  3H0G C;  4G7H A;  4XLP A;  1TWH C;  2NVX C;  3HOX C;  5IP7 K;  1R9T K;  2O5J A;  3I4N K;  1SMY A;  4GZY A;  4NOI A;  3HKZ D;  4MQ9 A;  2NVQ C;  3S15 C;  3DXJ A;  3HOU C;  5IYC K;  4C2M C;  2A68 A;  2JA8 K;  4LK1 A;  2WB1 L;  3RZO K;  4Y7N C;  4C3I K;  4A3M C;  4A3C K;  1YNN A;  4OIP A;  3RZD C;  3EQL A;  3GTQ K;  4A3B K;  4KMU A;  4X6A K;  5C4X K;  2JA6 C;  3S14 K;  2E2J K;  3I4N C;  3GTP K;  4LLG A;  2PA8 D;  1SFO K;  3M4O C;  1TWH K;  3HOX K;  3CQZ K;  3RZO C;  3HOV C;  2R7Z K;  3S15 K;  1IW7 A;  4C3I C;  1Y1W C;  4A3C C;  1Y1V K;  1I50 C;  3GTQ C;  4C2M K;  3HOU K;  5FLM C;  2NVT C;  3S14 C;  5C4X C;  4YG2 A;  5C4J C;  2E2J C;  3GTP C;  4AYB D;  2JA5 C;  3PO2 C;  4A3M K;  3S1R K;  3GTJ K;  3RZD K;  4Y52 K;  4C3J C;  1SFO C;  2BE5 A;  3I4M C;  2JA6 K;  4LK0 A;  4A3J C;  3CQZ C;  2R7Z C;  4Q5S A;  1Y1V C;  3K7A K;  3H3V L;  4BY7 K;  1I6H K;  3M4O K;  4QIW D;  4A3L K;  3GTM C;  4BBS K;  2R93 K;  3HOV K;  3S1R C;  1Y1W K;  4Y52 C;  3GTJ C;  1I50 K;  3FKI K;  5C44 C;  5FLM K;  4A3F K;  2NVT K;  3S1Q C;  5C4J K;  4QJV B;  2E2I K;  4A3D C;  3GTL K;  2NVY C;  2JA5 K;  3PO2 K;  3K7A C;  4MEY A;  4XSZ A;  4BY7 C;  1I6H C;  1I3Q K;  1TWG K;  4C3J K;  4A3L C;  1XPP A;  3I4M K;  4BBS C;  2R93 C;  2PMZ D;  4A3J K;  2WAQ L;  1BDF A;  4KN4 A;  2E2H C;  1WCM C;  3FKI C;  2VUM C;  3GTG K;  4A3F C;  2A6H A;  3GTM K;  5M5Y K;  4A3I K;  2E2I C;  3GTL C;  5FJ8 K;  3S16 C;  5IYB C;  2Y0S L;  1I3Q C;  2WB1 D;  1TWG C;  2CW0 A;  4MEX A;  2B63 C;  3S2H C;  4BXX C;  1YNJ A;  5C44 K;  3S1Q K;  4A3D K;  4OIO A;  2NVY K;  5M5X K;  1K83 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...