4GZYA

Crystal structures of bacterial rna polymerase paused elongation complexes
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
223
structure length
223
Chain Sequence
b'KAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis of transcriptional pausing in bacteria.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription/dna/rna
total genus 39
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4gzyA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4gzyA01
4BY1K 1I6HC 5C44K 5FLMK 3PO3K 1K83K 4BY1C 4C3JC 4OINA 3M4OK 3PO3C 3WODA 1K83C 4XSXA 1I3QC 3M4OC 3S1RK 1TWCK 4X6AK 5C4JK 1I50K 4LK0A 4A3BK 4A93K 1TWCC 4X6AC 5C4JC 2JA6K 3S1QC 5M3MK 2JA7K 3S2HK 3RZOC 4A3KK 4QIWL 4A3FK 2JA6C 5FJ8K 1TWFK 4C3HK 4A3LK 3EQLA 1SFOC 1R9TK 4QIWD 3S16K 4MEXA 3HOVC 4QJVB 2O5IA 2VUMK 4OIOA 4XLNA 2B63C 4YG2A 3S2DC 4AYBL 2R92K 3PO2K 1I6HK 2VUMC 4BBSK 3PO2C 3I4NK 3H3VL 2R92C 4A3DC 4C3JK 2R93K 4XSZA 4BBSC 3I4NC 5M5YK 1I3QK 4JK1A 4XLPA 3GTLC 1ZYRA 2R93C 3FKIK 3S14K 1BDFA 3H3VD 3S14C 3FKIC 5M5WK 3GTJK 3S1QK 2A68A 2NVTK 2BE5A 3RZOK 4YFNA 4BY7C 3GTJC 2E2HK 4A3GK 2NVTC 4LK1A 1XPPA 4A3GC 2E2HC 2A69A 3S17C 4A3IC 1SFOK 3I4MC 4Y7NK 5TMCA 4LLGA 3GTPK 3HOVK 4BXXC 2A6HA 4Y7NC 3GTOC 3HOYC 4BBRC 2Y0SL 3GTPC 4NOIA 3GTKC 4A3BC 3GTGK 2B63K 3S1NK 3S2DK 4KN7A 1YNJA 4OIQA 4C3IK 3GTMK 3DXJA 3GTGC 3S1NC 3GTMC 4C3IC 4A3DK 4QJVA 1TWAC 2Y0SD 3GTQC 4A3CK 3GTLK 3H0GC 4A3CC 2JA5C 4AYBD 1I6VA 4A3JC 4GZYA 2YU9K 1YNNA 2YU9C 5IP7K 4KMUA 3HOUK 3HKZL 4BY7K 2O5JA 5IP7C 1Y1VK 2NVXK 3HOUC 4A3MC 4Q5SA 2WB1L 1Y1VC 4A3EC 1Y1WC 1TWGC 2NVXC 3HOWC 2WAQL 4A3IK 4C2MC 3HKZD 4KN4A 3I4MK 2E2IC 3CQZC 5C3EK 4BXXK 4YFKA 3HOXK 2PA8L 3GTOK 2WB1D 1TWHK 5IP9K 4BBRK 5IYDC 3GTKK 5D4DA 2WAQD 5C3EC 3HOXC 2A6EA 3HOZC 3S15C 1TWHC 5IP9C 5C4XK 3RZDK 3K7AK 2NVQC 4G7HA 5C4XC 3RZDC 2PA8D 3S1MC 2NVYK 5M5XK 1TWAK 3K7AC 1IW7A 5IYBK 3GTQK 3M3YK 3S17K 2NVYC 4MQ9A 5IYBC 5FLMC 5C44C 4Q4ZA 3M3YC 3H0GK 4Y52K 2JA5K 4A3JK 5TMFA 5IYCK 4Y52C 4G7OA 3S1RC 5IYCC 4LJZA 1I50C 4A93C 2PMZL 4A3MK 1HQMA 4YFXA 2PPBA 2JA7C 3S2HC 4OIRA 4A3EK 1Y1WK 1TWGK 4A3KC 2E2JK 3HOWK 4A3FC 4C2MK 2R7ZK 2JA8K 1TWFC 4C3HC 2E2JC 4A3LC 2E2IK 2R7ZC 2CW0A 3CQZK 2PMZD 1WCMK 2JA8C 5IYDK 4ZH4A 1WCMC 1R9TC 3HOYK 3HOZK 3S16C 3S15K 4OIPA 1SMYA 2NVQK 5M3FK 3S1MK 4MEYA 4G7ZA
chains in the Genus database with same CATH superfamily
2CFAA 1USOA 3AQOA 1WSVA 3SZYA 2RGRA 5HQHA 4C3JC 4OINA 3WODA 1ZXOA 3GEEA 1I3QC 1ISEA 2XCRB 1K83A 2ZJQS 2L3UA 4X6AC 5C4JC 2ZJRS 2JA6K 3S1QC 4A3KK 4O2DA 4KC6A 4A3FK 1EFWA 5FJ8K 1TWFK 2JA7A 4FM9A 1R9TK 1F7VA 1BJTA 3L4KA 3S16K 2R7ZA 3HOVC 2ZUFA 4KAWX 4GTLA 4OIOA 3PO2K 1F93A 2VUMC 4BBSK 3I4NK 3H3VL 4A3DC 2R93K 2R92A 4WFNS 3GTLC 3FKIK 1BDFA 3TFJA 3H3VD 4WILA 3RZOK 4YFNA 4BY7C 3LAPA 1ZQ1C 4LK1A 4IOAS 1O2BA 4A3IC 1EI6A 4LLGA 1XZPB 4BBRC 1SFOA 1VGXA 4A3BC 3S2DK 4OIQA 5CHPA 1XZQA 3GTGC 1J98A 5IOTA 1TWAC 3GTQC 4IO9S 3H0GC 4A3JC 4GZYA 1PJ6A 1UV7A 2GSUA 1IE0A 2O5JA 2L5NA 5EGHA 3PIPS 3HOUC 3GSIA 2V6UA 2GAHC 4KMDA 2WB1L 3HOWC 5JVGS 1X31C 5E68A 2EBBA 3I4MK 1IBAA 1Y1VA 2E2IC 5C3EK 3GTOK 3HOYK 2WB1D 1TWHK 3AD9C 5IP9K 5IYDC 2A6EA 3S15C 4BLAA 4G7HA 5TJ3A 3RZDC 3OPFA 3GTPA 3GTKA 3K7AC 4Y52K 5IYCK 2JA5A 4A93C 4A3MK 4KM9A 4P5BA 2JA7C 1O2AA 4A3EK 3BUEA 3GIRA 4C2MK 3T01A 1EQRA 2R7ZC 3CQZK 2JA8C 4KMHA 3TFHA 1WCMC 1XXBA 2KQ1A 3HOZK 1SMYA 2NVQK 3S1MK 4MEYA 4LOWA 5C44K 5FLMK 4BY1C 1GE9A 2NVYA 4PABA 3M4OC 4P9SA 4X6AK 5C4JK 3A8KA 2KXYA 4LK0A 1TWCC 3S2HK 3OEPA 3AD7C 4QIWL 4WFBS 4A3LK 4C3HK 3G4AA 2JA6A 1JOEA 1SFOC 1F7UA 1IL2A 4QIWD 1TWFA 4WFAS 4MEXA 4WF9S 1R9TA 2VUMK 4XLNA 3T02A 3VA7A 4YG2A 1YX2A 4AYBL 1I6HK 5CJ9A 2JH3A 4DDQA 2GSNA 5M5YK 1B4BA 2KWAA 4KM8A 4XCHA 2R93A 3JSTA 5M5WK 2ZFZA 2A68A 1PJ7A 1YCLA 2E2HC 2A69A 1J6VA 4BXXC 2A6HA 4Y7NC 2XCOA 3GTPC 3GTKC 3GTGK 2B63K 4KN7A 1DD5A 3DXJA 3S1NC 3GTMC 1VH2A 3A8JA 2JA5C 2YU9C 3HOUK 5IP7C 5DM7S 1O28A 2NVXC 3S17K 3GTJA 4YFKA 5EGEA 3HOXC 3RZDK 1PJ5A 3K7AK 3GTOA 1TWHA 5JVHS 2NVYC 1J6WA 3S0XA 4G7OA 2FQOA 1ZBSA 2PPBA 1Y1WK 1TWGK 4A3KC 3SZZA 2R7ZK 4A3FC 1VRQC 2JA8K 1TWFC 4GTBA 3T00A 1WCMK 1IS1A 1R9TC 1VLOA 3HXAA 1ZVUA 1XXAA 3S16C 3CQZA 3TTGA 1O26A 3GDZA 4GTAA 4BY1K 3BP8C 4KASA 4GTDA 3M4OK 1WOOA 1WQHA 3PO3C 1K83C 3S1RK 1TWCK 2ZJPS 1I50K 5JVOA 5M3MK 3L4JA 3RZOC 1FEUA 4BLBA 1O29A 3AQPA 4GTFA 3EQLA 1J6XA 2P8TA 4LR2A 4QJVB 2V6TA 2O5IA 2W7VA 3S2DC 4FZBA 2RH6A 5DM6S 3IPJA 2R92C 3BP3A 4C3JK 2VUMA 1I3QK 4JK1A 1O24A 3N0CA 1ZYRA 5HL7S 3LPXA 3S14C 1O25A 3S1QK 3GEHA 3GTJC 2E2HK 2NVTC 4A3GC 1F9NA 3NUHA 4G0VA 4LQYA 5JFEA 3I4MC 4Y7NK 5TMCA 4G0UA 1WOPA 4PAAA 3GTPK 3HOVK 3GTOC 3HOYC 4J3NA 2Y0SL 4NOIA 3S1NK 1V5VA 3GTMK 2FQTA 1B4AA 4RMFA 1L0WA 4C3IC 4A3DK 2Y0SD 3GTGA 2B63A 1G51A 3GTLK 4A3CC 4AYBD 1I6VA 2YU9K 1EK8A 3AD8C 1YNNA 5IP7K 3AH5A 3ADAC 3HKZL 1EH1A 4BY7K 3FKIA 2NVXK 4A3MC 4Q5SA 4WJ4A 1Y1VC 4A3EC 3FHZA 2WAQL 4A3IK 4C2MC 3HKZD 4KN4A 3OREA 3CQZC 3Q3QA 1AB4A 3HOXK 4BBRK 2CFAB 4A3BK 2WAQD 5IOQA 3HOZC 4AH6A 2NVQC 5C4XC 2NVYK 5M5XK 3S1MC 1JQWA 4KDDA 1TWAK 3GTQK 1IW7A 4MQ9A 5IYBC 5FLMC 5C44C 3M3YC 2PHCB 3H0GK 4A3JK 3FOFA 4LJZA 4P5AA 1VJEA 1DCOA 2PMZL 3S2HC 3HOWK 2E2JC 4C3HC 4A3LC 2E2IK 5L46A 1C0AA 2CW0A 2PMZD 1Y1WA 1TWGA 5IOSA 1DCPA 5IYDK 3S15K 4GT9A 1WCMA 3DLLS 5M3FK 1WQGA 4KB4A 1XXCA 4U67S 1I6HC 4KMAA 4BKWA 1XZPA 2D6FC 3PO3K 1K83K 4XSXA 3PIOS 4GTEA 4A93K 2JA7K 3LYWA 1TWCA 4GTCA 1KQ4A 1I50A 2JA6C 4C45A 2GAGC 3V4GA 1INNA 4KATA 1DCHA 1XZQB 4KARA 1BGWA 2B63C 2R92K 1BS2A 3PO2C 3CAGA 4XSZA 4BBSC 3I4NC 4XLPA 2R93C 3N0BA 3S14K 2XCQA 4KB2A 3FKIC 1I3QA 4WCES 3GTJK 2NVTK 2BE5A 5HL8A 4A3GK 3G4CA 1XPPA 1WSRA 3S17C 2E2HA 1SFOK 2P5MA 1YNJA 4C3IK 2ZUEA 1WORA 4QJVA 4IOCS 2KPUA 4A3CK 3GTMA 2GSOA 4ILDA 5IORA 1WQFA 3GTLA 4KMUA 3FOEA 2YU9A 1Y1VK 1IQ0A 1Y1WC 1TWGC 2NVXA 4BXXK 3CF5S 2PA8L 1WIHA 3LAJA 5D4DA 5C3EC 3MMLB 4M1XA 5C4XK 3GTKK 4WJ3M 1TWHC 5IP9C 5IYBK 2PA8D 3M3YK 2Y3PA 4Q4ZA 2JA5K 1TWAA 5TMFA 3GTQA 4G0WA 4Y52C 3A8IA 3S1RC 5IYCC 3H0GA 1I50C 2V6SA 3ERED 1HQMA 4YFXA 3TFIA 4OIRA 2E2JK 3N3YA 1O27A 3QX3A 1WOSA 1JVIA 1USMA 1O2FB 4ZH4A 3GEIA 4GFQA 2E2IA 1HI9A 4OIPA 1RU0A 4G7ZA
chains in the Genus database with same CATH topology
4BY1K 1I6HC 5C44K 5FLMK 3PO3K 1K83K 4BY1C 4C3JC 4OINA 3M4OK 3PO3C 3WODA 1K83C 4XSXA 1I3QC 3M4OC 3S1RK 1TWCK 4X6AK 5C4JK 1I50K 4LK0A 4A3BK 4A93K 1TWCC 4X6AC 5C4JC 2JA6K 3S1QC 5M3MK 2JA7K 3S2HK 3RZOC 4A3KK 4QIWL 4A3FK 2JA6C 5FJ8K 1TWFK 4C3HK 4A3LK 3EQLA 1SFOC 1R9TK 4QIWD 3S16K 4MEXA 3HOVC 4QJVB 2O5IA 2VUMK 4OIOA 4XLNA 2B63C 4YG2A 3S2DC 4AYBL 2R92K 3PO2K 1I6HK 2VUMC 4BBSK 3PO2C 3I4NK 3H3VL 2R92C 4A3DC 4C3JK 2R93K 4XSZA 4BBSC 3I4NC 5M5YK 1I3QK 4JK1A 4XLPA 3GTLC 1ZYRA 2R93C 3FKIK 3S14K 1BDFA 3H3VD 3S14C 3FKIC 5M5WK 3GTJK 3S1QK 2A68A 2NVTK 2BE5A 3RZOK 4YFNA 4BY7C 3GTJC 2E2HK 4A3GK 2NVTC 4LK1A 1XPPA 4A3GC 2E2HC 2A69A 3S17C 4A3IC 1SFOK 3I4MC 4Y7NK 5TMCA 4LLGA 3GTPK 3HOVK 4BXXC 2A6HA 4Y7NC 3GTOC 3HOYC 4BBRC 2Y0SL 3GTPC 4NOIA 3GTKC 4A3BC 3GTGK 2B63K 3S1NK 3S2DK 4KN7A 1YNJA 4OIQA 4C3IK 3GTMK 3DXJA 3GTGC 3S1NC 3GTMC 4C3IC 4A3DK 4QJVA 1TWAC 2Y0SD 3GTQC 4A3CK 3GTLK 3H0GC 4A3CC 2JA5C 4AYBD 1I6VA 4A3JC 4GZYA 2YU9K 1YNNA 2YU9C 5IP7K 4KMUA 3HOUK 3HKZL 4BY7K 2O5JA 5IP7C 1Y1VK 2NVXK 3HOUC 4A3MC 4Q5SA 2WB1L 1Y1VC 4A3EC 1Y1WC 1TWGC 2NVXC 3HOWC 2WAQL 4A3IK 4C2MC 3HKZD 4KN4A 3I4MK 2E2IC 3CQZC 5C3EK 4BXXK 4YFKA 3HOXK 2PA8L 3GTOK 2WB1D 1TWHK 5IP9K 4BBRK 5IYDC 3GTKK 5D4DA 2WAQD 5C3EC 3HOXC 2A6EA 3HOZC 3S15C 1TWHC 5IP9C 5C4XK 3RZDK 3K7AK 2NVQC 4G7HA 5C4XC 3RZDC 2PA8D 3S1MC 2NVYK 5M5XK 1TWAK 3K7AC 1IW7A 5IYBK 3GTQK 3M3YK 3S17K 2NVYC 4MQ9A 5IYBC 5FLMC 5C44C 4Q4ZA 3M3YC 3H0GK 4Y52K 2JA5K 4A3JK 5TMFA 5IYCK 4Y52C 4G7OA 3S1RC 5IYCC 4LJZA 1I50C 4A93C 2PMZL 4A3MK 1HQMA 4YFXA 2PPBA 2JA7C 3S2HC 4OIRA 4A3EK 1Y1WK 1TWGK 4A3KC 2E2JK 3HOWK 4A3FC 4C2MK 2R7ZK 2JA8K 1TWFC 4C3HC 2E2JC 4A3LC 2E2IK 2R7ZC 2CW0A 3CQZK 2PMZD 1WCMK 2JA8C 5IYDK 4ZH4A 1WCMC 1R9TC 3HOYK 3HOZK 3S16C 3S15K 4OIPA 1SMYA 2NVQK 5M3FK 3S1MK 4MEYA 4G7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY1 K;  1I6H C;  5C44 K;  5FLM K;  3PO3 K;  1K83 K;  4BY1 C;  4C3J C;  4OIN A;  3M4O K;  3PO3 C;  3WOD A;  1K83 C;  4XSX A;  1I3Q C;  3M4O C;  3S1R K;  1TWC K;  4X6A K;  5C4J K;  1I50 K;  4LK0 A;  4A3B K;  4A93 K;  1TWC C;  4X6A C;  5C4J C;  2JA6 K;  3S1Q C;  5M3M K;  2JA7 K;  3S2H K;  3RZO C;  4A3K K;  4QIW L;  4A3F K;  2JA6 C;  5FJ8 K;  1TWF K;  4C3H K;  4A3L K;  3EQL A;  1SFO C;  1R9T K;  4QIW D;  3S16 K;  4MEX A;  3HOV C;  4QJV B;  2O5I A;  2VUM K;  4OIO A;  4XLN A;  2B63 C;  4YG2 A;  3S2D C;  4AYB L;  2R92 K;  3PO2 K;  1I6H K;  2VUM C;  4BBS K;  3PO2 C;  3I4N K;  3H3V L;  2R92 C;  4A3D C;  4C3J K;  2R93 K;  4XSZ A;  4BBS C;  3I4N C;  5M5Y K;  1I3Q K;  4JK1 A;  4XLP A;  3GTL C;  1ZYR A;  2R93 C;  3FKI K;  3S14 K;  1BDF A;  3H3V D;  3S14 C;  3FKI C;  5M5W K;  3GTJ K;  3S1Q K;  2A68 A;  2NVT K;  2BE5 A;  3RZO K;  4YFN A;  4BY7 C;  3GTJ C;  2E2H K;  4A3G K;  2NVT C;  4LK1 A;  1XPP A;  4A3G C;  2E2H C;  2A69 A;  3S17 C;  4A3I C;  1SFO K;  3I4M C;  4Y7N K;  5TMC A;  4LLG A;  3GTP K;  3HOV K;  4BXX C;  2A6H A;  4Y7N C;  3GTO C;  3HOY C;  4BBR C;  2Y0S L;  3GTP C;  4NOI A;  3GTK C;  4A3B C;  3GTG K;  2B63 K;  3S1N K;  3S2D K;  4KN7 A;  1YNJ A;  4OIQ A;  4C3I K;  3GTM K;  3DXJ A;  3GTG C;  3S1N C;  3GTM C;  4C3I C;  4A3D K;  4QJV A;  1TWA C;  2Y0S D;  3GTQ C;  4A3C K;  3GTL K;  3H0G C;  4A3C C;  2JA5 C;  4AYB D;  1I6V A;  4A3J C;  4GZY A;  2YU9 K;  1YNN A;  2YU9 C;  5IP7 K;  4KMU A;  3HOU K;  3HKZ L;  4BY7 K;  2O5J A;  5IP7 C;  1Y1V K;  2NVX K;  3HOU C;  4A3M C;  4Q5S A;  2WB1 L;  1Y1V C;  4A3E C;  1Y1W C;  1TWG C;  2NVX C;  3HOW C;  2WAQ L;  4A3I K;  4C2M C;  3HKZ D;  4KN4 A;  3I4M K;  2E2I C;  3CQZ C;  5C3E K;  4BXX K;  4YFK A;  3HOX K;  2PA8 L;  3GTO K;  2WB1 D;  1TWH K;  5IP9 K;  4BBR K;  5IYD C;  3GTK K;  5D4D A;  2WAQ D;  5C3E C;  3HOX C;  2A6E A;  3HOZ C;  3S15 C;  1TWH C;  5IP9 C;  5C4X K;  3RZD K;  3K7A K;  2NVQ C;  4G7H A;  5C4X C;  3RZD C;  2PA8 D;  3S1M C;  2NVY K;  5M5X K;  1TWA K;  3K7A C;  1IW7 A;  5IYB K;  3GTQ K;  3M3Y K;  3S17 K;  2NVY C;  4MQ9 A;  5IYB C;  5FLM C;  5C44 C;  4Q4Z A;  3M3Y C;  3H0G K;  4Y52 K;  2JA5 K;  4A3J K;  5TMF A;  5IYC K;  4Y52 C;  4G7O A;  3S1R C;  5IYC C;  4LJZ A;  1I50 C;  4A93 C;  2PMZ L;  4A3M K;  1HQM A;  4YFX A;  2PPB A;  2JA7 C;  3S2H C;  4OIR A;  4A3E K;  1Y1W K;  1TWG K;  4A3K C;  2E2J K;  3HOW K;  4A3F C;  4C2M K;  2R7Z K;  2JA8 K;  1TWF C;  4C3H C;  2E2J C;  4A3L C;  2E2I K;  2R7Z C;  2CW0 A;  3CQZ K;  2PMZ D;  1WCM K;  2JA8 C;  5IYD K;  4ZH4 A;  1WCM C;  1R9T C;  3HOY K;  3HOZ K;  3S16 C;  3S15 K;  4OIP A;  1SMY A;  2NVQ K;  5M3F K;  3S1M K;  4MEY A;  4G7Z A; 
#chains in the Genus database with same CATH topology
 2CFA A;  1USO A;  3AQO A;  1WSV A;  3SZY A;  2RGR A;  5HQH A;  4C3J C;  4OIN A;  3WOD A;  1ZXO A;  3GEE A;  1I3Q C;  1ISE A;  2XCR B;  1K83 A;  2ZJQ S;  2L3U A;  4X6A C;  5C4J C;  2ZJR S;  2JA6 K;  3S1Q C;  4A3K K;  4O2D A;  4KC6 A;  4A3F K;  1EFW A;  5FJ8 K;  1TWF K;  2JA7 A;  4FM9 A;  1R9T K;  1F7V A;  1BJT A;  3L4K A;  3S16 K;  2R7Z A;  3HOV C;  2ZUF A;  4KAW X;  4GTL A;  4OIO A;  3PO2 K;  1F93 A;  2VUM C;  4BBS K;  3I4N K;  3H3V L;  4A3D C;  2R93 K;  2R92 A;  4WFN S;  3GTL C;  3FKI K;  1BDF A;  3TFJ A;  3H3V D;  4WIL A;  3RZO K;  4YFN A;  4BY7 C;  3LAP A;  1ZQ1 C;  4LK1 A;  4IOA S;  1O2B A;  4A3I C;  1EI6 A;  4LLG A;  1XZP B;  4BBR C;  1SFO A;  1VGX A;  4A3B C;  3S2D K;  4OIQ A;  5CHP A;  1XZQ A;  3GTG C;  1J98 A;  5IOT A;  1TWA C;  3GTQ C;  4IO9 S;  3H0G C;  4A3J C;  4GZY A;  1PJ6 A;  1UV7 A;  2GSU A;  1IE0 A;  2O5J A;  2L5N A;  5EGH A;  3PIP S;  3HOU C;  3GSI A;  2V6U A;  2GAH C;  4KMD A;  2WB1 L;  3HOW C;  5JVG S;  1X31 C;  5E68 A;  2EBB A;  3I4M K;  1IBA A;  1Y1V A;  2E2I C;  5C3E K;  3GTO K;  3HOY K;  2WB1 D;  1TWH K;  3AD9 C;  5IP9 K;  5IYD C;  2A6E A;  3S15 C;  4BLA A;  4G7H A;  5TJ3 A;  3RZD C;  3OPF A;  3GTP A;  3GTK A;  3K7A C;  4Y52 K;  5IYC K;  2JA5 A;  4A93 C;  4A3M K;  4KM9 A;  4P5B A;  2JA7 C;  1O2A A;  4A3E K;  3BUE A;  3GIR A;  4C2M K;  3T01 A;  1EQR A;  2R7Z C;  3CQZ K;  2JA8 C;  4KMH A;  3TFH A;  1WCM C;  1XXB A;  2KQ1 A;  3HOZ K;  1SMY A;  2NVQ K;  3S1M K;  4MEY A;  4LOW A;  5C44 K;  5FLM K;  4BY1 C;  1GE9 A;  2NVY A;  4PAB A;  3M4O C;  4P9S A;  4X6A K;  5C4J K;  3A8K A;  2KXY A;  4LK0 A;  1TWC C;  3S2H K;  3OEP A;  3AD7 C;  4QIW L;  4WFB S;  4A3L K;  4C3H K;  3G4A A;  2JA6 A;  1JOE A;  1SFO C;  1F7U A;  1IL2 A;  4QIW D;  1TWF A;  4WFA S;  4MEX A;  4WF9 S;  1R9T A;  2VUM K;  4XLN A;  3T02 A;  3VA7 A;  4YG2 A;  1YX2 A;  4AYB L;  1I6H K;  5CJ9 A;  2JH3 A;  4DDQ A;  2GSN A;  5M5Y K;  1B4B A;  2KWA A;  4KM8 A;  4XCH A;  2R93 A;  3JST A;  5M5W K;  2ZFZ A;  2A68 A;  1PJ7 A;  1YCL A;  2E2H C;  2A69 A;  1J6V A;  4BXX C;  2A6H A;  4Y7N C;  2XCO A;  3GTP C;  3GTK C;  3GTG K;  2B63 K;  4KN7 A;  1DD5 A;  3DXJ A;  3S1N C;  3GTM C;  1VH2 A;  3A8J A;  2JA5 C;  2YU9 C;  3HOU K;  5IP7 C;  5DM7 S;  1O28 A;  2NVX C;  3S17 K;  3GTJ A;  4YFK A;  5EGE A;  3HOX C;  3RZD K;  1PJ5 A;  3K7A K;  3GTO A;  1TWH A;  5JVH S;  2NVY C;  1J6W A;  3S0X A;  4G7O A;  2FQO A;  1ZBS A;  2PPB A;  1Y1W K;  1TWG K;  4A3K C;  3SZZ A;  2R7Z K;  4A3F C;  1VRQ C;  2JA8 K;  1TWF C;  4GTB A;  3T00 A;  1WCM K;  1IS1 A;  1R9T C;  1VLO A;  3HXA A;  1ZVU A;  1XXA A;  3S16 C;  3CQZ A;  3TTG A;  1O26 A;  3GDZ A;  4GTA A;  4BY1 K;  3BP8 C;  4KAS A;  4GTD A;  3M4O K;  1WOO A;  1WQH A;  3PO3 C;  1K83 C;  3S1R K;  1TWC K;  2ZJP S;  1I50 K;  5JVO A;  5M3M K;  3L4J A;  3RZO C;  1FEU A;  4BLB A;  1O29 A;  3AQP A;  4GTF A;  3EQL A;  1J6X A;  2P8T A;  4LR2 A;  4QJV B;  2V6T A;  2O5I A;  2W7V A;  3S2D C;  4FZB A;  2RH6 A;  5DM6 S;  3IPJ A;  2R92 C;  3BP3 A;  4C3J K;  2VUM A;  1I3Q K;  4JK1 A;  1O24 A;  3N0C A;  1ZYR A;  5HL7 S;  3LPX A;  3S14 C;  1O25 A;  3S1Q K;  3GEH A;  3GTJ C;  2E2H K;  2NVT C;  4A3G C;  1F9N A;  3NUH A;  4G0V A;  4LQY A;  5JFE A;  3I4M C;  4Y7N K;  5TMC A;  4G0U A;  1WOP A;  4PAA A;  3GTP K;  3HOV K;  3GTO C;  3HOY C;  4J3N A;  2Y0S L;  4NOI A;  3S1N K;  1V5V A;  3GTM K;  2FQT A;  1B4A A;  4RMF A;  1L0W A;  4C3I C;  4A3D K;  2Y0S D;  3GTG A;  2B63 A;  1G51 A;  3GTL K;  4A3C C;  4AYB D;  1I6V A;  2YU9 K;  1EK8 A;  3AD8 C;  1YNN A;  5IP7 K;  3AH5 A;  3ADA C;  3HKZ L;  1EH1 A;  4BY7 K;  3FKI A;  2NVX K;  4A3M C;  4Q5S A;  4WJ4 A;  1Y1V C;  4A3E C;  3FHZ A;  2WAQ L;  4A3I K;  4C2M C;  3HKZ D;  4KN4 A;  3ORE A;  3CQZ C;  3Q3Q A;  1AB4 A;  3HOX K;  4BBR K;  2CFA B;  4A3B K;  2WAQ D;  5IOQ A;  3HOZ C;  4AH6 A;  2NVQ C;  5C4X C;  2NVY K;  5M5X K;  3S1M C;  1JQW A;  4KDD A;  1TWA K;  3GTQ K;  1IW7 A;  4MQ9 A;  5IYB C;  5FLM C;  5C44 C;  3M3Y C;  2PHC B;  3H0G K;  4A3J K;  3FOF A;  4LJZ A;  4P5A A;  1VJE A;  1DCO A;  2PMZ L;  3S2H C;  3HOW K;  2E2J C;  4C3H C;  4A3L C;  2E2I K;  5L46 A;  1C0A A;  2CW0 A;  2PMZ D;  1Y1W A;  1TWG A;  5IOS A;  1DCP A;  5IYD K;  3S15 K;  4GT9 A;  1WCM A;  3DLL S;  5M3F K;  1WQG A;  4KB4 A;  1XXC A;  4U67 S;  1I6H C;  4KMA A;  4BKW A;  1XZP A;  2D6F C;  3PO3 K;  1K83 K;  4XSX A;  3PIO S;  4GTE A;  4A93 K;  2JA7 K;  3LYW A;  1TWC A;  4GTC A;  1KQ4 A;  1I50 A;  2JA6 C;  4C45 A;  2GAG C;  3V4G A;  1INN A;  4KAT A;  1DCH A;  1XZQ B;  4KAR A;  1BGW A;  2B63 C;  2R92 K;  1BS2 A;  3PO2 C;  3CAG A;  4XSZ A;  4BBS C;  3I4N C;  4XLP A;  2R93 C;  3N0B A;  3S14 K;  2XCQ A;  4KB2 A;  3FKI C;  1I3Q A;  4WCE S;  3GTJ K;  2NVT K;  2BE5 A;  5HL8 A;  4A3G K;  3G4C A;  1XPP A;  1WSR A;  3S17 C;  2E2H A;  1SFO K;  2P5M A;  1YNJ A;  4C3I K;  2ZUE A;  1WOR A;  4QJV A;  4IOC S;  2KPU A;  4A3C K;  3GTM A;  2GSO A;  4ILD A;  5IOR A;  1WQF A;  3GTL A;  4KMU A;  3FOE A;  2YU9 A;  1Y1V K;  1IQ0 A;  1Y1W C;  1TWG C;  2NVX A;  4BXX K;  3CF5 S;  2PA8 L;  1WIH A;  3LAJ A;  5D4D A;  5C3E C;  3MML B;  4M1X A;  5C4X K;  3GTK K;  4WJ3 M;  1TWH C;  5IP9 C;  5IYB K;  2PA8 D;  3M3Y K;  2Y3P A;  4Q4Z A;  2JA5 K;  1TWA A;  5TMF A;  3GTQ A;  4G0W A;  4Y52 C;  3A8I A;  3S1R C;  5IYC C;  3H0G A;  1I50 C;  2V6S A;  3ERE D;  1HQM A;  4YFX A;  3TFI A;  4OIR A;  2E2J K;  3N3Y A;  1O27 A;  3QX3 A;  1WOS A;  1JVI A;  1USM A;  1O2F B;  4ZH4 A;  3GEI A;  4GFQ A;  2E2I A;  1HI9 A;  4OIP A;  1RU0 A;  4G7Z A; 
#chains in the Genus database with same CATH homology
 4BY1 K;  1I6H C;  5C44 K;  5FLM K;  3PO3 K;  1K83 K;  4BY1 C;  4C3J C;  4OIN A;  3M4O K;  3PO3 C;  3WOD A;  1K83 C;  4XSX A;  1I3Q C;  3M4O C;  3S1R K;  1TWC K;  4X6A K;  5C4J K;  1I50 K;  4LK0 A;  4A3B K;  4A93 K;  1TWC C;  4X6A C;  5C4J C;  2JA6 K;  3S1Q C;  5M3M K;  2JA7 K;  3S2H K;  3RZO C;  4A3K K;  4QIW L;  4A3F K;  2JA6 C;  5FJ8 K;  1TWF K;  4C3H K;  4A3L K;  3EQL A;  1SFO C;  1R9T K;  4QIW D;  3S16 K;  4MEX A;  3HOV C;  4QJV B;  2O5I A;  2VUM K;  4OIO A;  4XLN A;  2B63 C;  4YG2 A;  3S2D C;  4AYB L;  2R92 K;  3PO2 K;  1I6H K;  2VUM C;  4BBS K;  3PO2 C;  3I4N K;  3H3V L;  2R92 C;  4A3D C;  4C3J K;  2R93 K;  4XSZ A;  4BBS C;  3I4N C;  5M5Y K;  1I3Q K;  4JK1 A;  4XLP A;  3GTL C;  1ZYR A;  2R93 C;  3FKI K;  3S14 K;  1BDF A;  3H3V D;  3S14 C;  3FKI C;  5M5W K;  3GTJ K;  3S1Q K;  2A68 A;  2NVT K;  2BE5 A;  3RZO K;  4YFN A;  4BY7 C;  3GTJ C;  2E2H K;  4A3G K;  2NVT C;  4LK1 A;  1XPP A;  4A3G C;  2E2H C;  2A69 A;  3S17 C;  4A3I C;  1SFO K;  3I4M C;  4Y7N K;  5TMC A;  4LLG A;  3GTP K;  3HOV K;  4BXX C;  2A6H A;  4Y7N C;  3GTO C;  3HOY C;  4BBR C;  2Y0S L;  3GTP C;  4NOI A;  3GTK C;  4A3B C;  3GTG K;  2B63 K;  3S1N K;  3S2D K;  4KN7 A;  1YNJ A;  4OIQ A;  4C3I K;  3GTM K;  3DXJ A;  3GTG C;  3S1N C;  3GTM C;  4C3I C;  4A3D K;  4QJV A;  1TWA C;  2Y0S D;  3GTQ C;  4A3C K;  3GTL K;  3H0G C;  4A3C C;  2JA5 C;  4AYB D;  1I6V A;  4A3J C;  4GZY A;  2YU9 K;  1YNN A;  2YU9 C;  5IP7 K;  4KMU A;  3HOU K;  3HKZ L;  4BY7 K;  2O5J A;  5IP7 C;  1Y1V K;  2NVX K;  3HOU C;  4A3M C;  4Q5S A;  2WB1 L;  1Y1V C;  4A3E C;  1Y1W C;  1TWG C;  2NVX C;  3HOW C;  2WAQ L;  4A3I K;  4C2M C;  3HKZ D;  4KN4 A;  3I4M K;  2E2I C;  3CQZ C;  5C3E K;  4BXX K;  4YFK A;  3HOX K;  2PA8 L;  3GTO K;  2WB1 D;  1TWH K;  5IP9 K;  4BBR K;  5IYD C;  3GTK K;  5D4D A;  2WAQ D;  5C3E C;  3HOX C;  2A6E A;  3HOZ C;  3S15 C;  1TWH C;  5IP9 C;  5C4X K;  3RZD K;  3K7A K;  2NVQ C;  4G7H A;  5C4X C;  3RZD C;  2PA8 D;  3S1M C;  2NVY K;  5M5X K;  1TWA K;  3K7A C;  1IW7 A;  5IYB K;  3GTQ K;  3M3Y K;  3S17 K;  2NVY C;  4MQ9 A;  5IYB C;  5FLM C;  5C44 C;  4Q4Z A;  3M3Y C;  3H0G K;  4Y52 K;  2JA5 K;  4A3J K;  5TMF A;  5IYC K;  4Y52 C;  4G7O A;  3S1R C;  5IYC C;  4LJZ A;  1I50 C;  4A93 C;  2PMZ L;  4A3M K;  1HQM A;  4YFX A;  2PPB A;  2JA7 C;  3S2H C;  4OIR A;  4A3E K;  1Y1W K;  1TWG K;  4A3K C;  2E2J K;  3HOW K;  4A3F C;  4C2M K;  2R7Z K;  2JA8 K;  1TWF C;  4C3H C;  2E2J C;  4A3L C;  2E2I K;  2R7Z C;  2CW0 A;  3CQZ K;  2PMZ D;  1WCM K;  2JA8 C;  5IYD K;  4ZH4 A;  1WCM C;  1R9T C;  3HOY K;  3HOZ K;  3S16 C;  3S15 K;  4OIP A;  1SMY A;  2NVQ K;  5M3F K;  3S1M K;  4MEY A;  4G7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...