4H0CA

Crystal structure of phospholipase/carboxylesterase from dyadobacter fermentans dsm 18053
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
210
structure length
210
Chain Sequence
SNAMYTHSKQIITSGVPVQRAKKAVVMLHGRGGTAADIISLQKVLKLDEMAIYAPQATNNSWYPYSFMAPVQQNQPALDSALALVGEVVAEIEAQGIPAEQIYFAGFSQGACLTLEYTTRNARKYGGIIAFTGGLIGQELAIGNYKGDFKQTPVFISTGNPDPHVPVSRVQESVTILEDMNAAVSQVVYPGRPHTISGDEIQLVNNTILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of phospholipase/Carboxylesterase from Dyadobacter fermentans DSM 18053
rcsb
source organism Dyadobacter fermentans
molecule tags Hydrolase
molecule keywords Phospholipase/Carboxylesterase
total genus 72
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h0cA00
3H18A 4U2FA 3M81A 4PF1A 5JD5A 1N5RA 5AM4A 1ZD4A 3E0XA 3I6ZA 2OQIA 2YH2A 3FYTA 5ALLA 1XZCA 3W05A 3I2GA 4F0JA 4QDXA 3C45A 2Z3ZA 3QPDA 5EGNA 1LLFA 4JYMA 1W75A 2XMGA 3C6BA 4H7JA 2YXPX 2XLCA 2QTBA 3ILSA 4F5ZA 2WSLA 4BDSA 1XRQA 3G0DA 2HFKA 4RE5A 2R8BA 3RLIA 4J0KA 4GI1A 4J0DA 2Z8ZA 1XRRA 4QDOA 3STYA 2ACKA 5A6VA 2O7VA 4I3FA 1MX9A 4BP8A 1CQZA 4Q82A 1O6FA 5JYCA 4DGQA 1O6GA 1EX9A 4N8DA 4Y2SA 5EHXA 3KWJA 5AOAA 4FHZA 1QLWA 1SFRA 2XUFA 1C4XA 5E4JA 4N8EA 2VF2A 1ORVA 1H2XA 3PICA 2Z8XA 2PSHA 3FOBA 2WIDA 2H7YA 3HSSA 1SOMA 5AIAA 5FXMA 2WU3A 4U2BA 3Q0TA 1K63A 3WMRA 1QOZA 2XMSA 4K6GA 3S2ZA 4N5HX 2OCKA 4AZ0A 1YSCA 3M82A 5BWCA 3H1BA 3TRDA 4BE9A 5FPPA 5IVDA 1AX9A 3VJKA 4UHHA 1DWQA 1EH5A 2QT9A 5ALEA 3FYUC 4LXGA 3IUJA 5FUMA 1YA4A 2RHTA 4DMHA 4G9GA 3ZV7A 3JYHA 1ACJA 5IH7A 3FVTA 3HJUA 4NVRA 1EINA 1YAHA 1PJAA 3DL4A 1JFRA 1MO2A 1ZJ5A 4RGYA 1XZFA 5ALZA 4DNOA 3V48A 1BEZA 1FFCA 4M0FA 1L7QA 1OCEA 3WZMA 2WJ6A 4OPMA 3LS2A 2AJDA 2PSEA 2PSFA 4Y2PA 4FKBA 4UBKA 1ODCA 2JIDA 1JMKC 1AUOA 2QZPA 3I6YA 3STWA 1XZAA 4CI9A 4MQLA 4Y2VA 3WK4A 1UK7A 1XQXA 4RNCA 4J0GA 2XMZA 4ZV7A 2XQJA 1U8EA 4AXBA 1BU8A 3WKEA 1ISPA 3DJYA 3UUFA 3E3AA 4HZGA 5I8PA 1A7UA 4TPKA 3LIPA 5K5EA 3JW8A 1VJ5A 3I6MA 4U2GA 4Y7DA 1E8DA 1L7AA 2QMQA 2VATA 4NMWA 3UUEA 1YB7A 3AINA 4H0CA 3KWFA 5ALPA 4BYMA 5K3BA 3EBLA 1EA5A 2JGKA 1YASA 3VDXA 1LBTA 4HS9A 1LBSA 2BJHA 2XI4A 1XQWA 4E11A 4G4IA 2OAGA 1R9NA 2GYWA 2BUAA 2FUKA 4U2DA 1QONA 4X6XA 4ETWA 3HEAA 2C7BA 2WU4A 1JU3A 5CXXA 2JBWA 1ZD3A 4AZ3A 1J06A 2VSQA 4GECA 1CUJA 4BP9A 2ZJ6A 3ED1A 4GBGA 1F6WA 1MN6A 5ALSA 4HXEB 4DMFA 4QZVA 2WG2A 2FJ0A 3WKDA 2AJ8A 4Y2UA 5KBYA 5FRDA 1FFBA 4YPVA 1TAHA 1EK2A 2ROQA 2XMCA 1XQVA 2HA7A 4S0XA 4DSAA 1XRLA 4CFSA 2WFMA 4B0OA 5EHNA 1IVYA 3WA6A 5I9IA 2JGFA 5CBKA 1BEEA 2JGLA 2WG0A 1HPLA 1ODTC 3STTA 3WK8A 2DFPA 4C89A 5AI8A 1DX6A 3W9BA 1L7RA 3KXPA 3SWWA 1CFJA 1N1MA 2OGZA 1TIBA 1X2BA 4CCYA 3ESDA 1TCCA 3ICVA 5CH8A 5A2GA 3W06A 1K6EA 1YB6A 3DNMA 1U2EA 4AN0A 2PSJA 3WYDA 2HRQA 2XUHA 5JAOA 3STVA 4V2IA 5D6OA 1UK9A 4J03A 1H23A 2VA9A 5ALFA 4W1PA 5JD6A 2WLSA 3H2KA 1QIKA 2C4HA 1LZKA 3R3WA 1JJIA 4EA6A 2GBGA 3OTQA 2WHQA 4KE7A 3G0GA 3QM1A 1TK3A 5JZBA 2HL6A 3I2FA 2WFZA 1HKHA 2AJCA 1MT3A 5KREA 3H2JA 3F67A 3Q8WA 5AKXA 4NZZA 2XUQA 1E8NA 2WIGA 1GT6A 1W1IA 3D3NA 1JT2A 4WDRA 1TKRA 1YS2X 3O9VA 5K3CA 2QOEA 4E14A 1F8UA 5T4BA 2JGIA 4YK7A 4X97A 6YASA 2HA3A 2IIVA 3A70A 2O2GA 2QJRA 2GYVA 4Y2TA 4BVLA 2ZVDA 3HRHA 2Y2VA 5ALIA 3VVMA 3FCYA 3UMJA 3OURA 4WY8A 4OD0A 5ALWA 4IH9A 1E8MA 1C7IA 4I4CA 3T4UA 3HZOA 2PU7A 4MJ3A 1LNSA 3G7NA 3OM8A 4Q1VA 3QVMA 5HF6A 2C5FA 3IULA 2W6CX 2J4CA 5HZGA 1MX5A 2XUAA 4QDUA 3LCRA 3W2TA 1QIFA 3RKSA 4X85A 1B6GA 3IVMA 1G4HA 2G63A 1IZ7A 1KU6A 3WL7A 3VJLA 2OLEA 4UPDA 2GBFA 3DQZA 1MTZA 2WJ3A 4MEBA 4OYYA 2BGRA 2HADA 5AOCA 4X6UA 4DTCA 4W1RA 3LP5A 4H7DA 5AK4A 3KD2A 2QUBA 4GHWA 3AIMA 3WKBA 1UOOA 1LZLA 3G8YA 3AZOA 3B5EA 4H7HA 4UHEA 4H7FA 3JWEA 2ONCA 3B12A 4EY4A 1TCAA 4CG3A 1GGVA 2OG1A 4Q05A 5JZSA 5JIBA 1EK1A 2VT6A 4H77A 3U1TA 3C5WP 4QLAA 4C01A 1WOMA 1FFEA 2BCEA 5AIBA 1XFDA 2JGMA 2RGUA 3FLAA 1MAHA 5AO9A 3NUZA 5CW2A 1EDBA 3H2IA 4LYEA 1FFDA 1GPLA 3GUUA 1THTA 3F98A 3WL6A 4MEAA 2XMRA 3BF7A 1IMJA 4X3CA 5CH5A 4XX1A 5JANA 4X93A 4H18A 3PUIA 4BRSA 4UHCA 3A6ZA 2XUIA 4IHAA 3MUOA 2FJPA 2OAEA 2HU8A 2RHWA 1Q83A 1MNQA 2ES4A 4UBMA 2Y1KA 3IA2A 3WWOA 1LPPA 5DYYA 4B82A 4B7ZA 1DT3A 1YR2A 2XUPA 4FLFA 1CVLA 5SYNA 3D4LA 4NS4A 3G02A 4DNFA 4TVKA 3WL8A 3D59A 3WJ1A 2XQFA 1AKNA 3ZLVA 1G5FA 4GXNA 1WB6A 4AMZA 4B9EA 5C8ZA 5DNUA 4G4GA 1ZGBA 1D07A 4G9EA 5ISMA 2QRUA 4BVKA 3H2GA 5KWJA 3ANSA 5LZ8A 3VISA 4KE6A 5JAHA 3TGLA 1RWQA 4H7KA 5JASA 3QH4A 4J0HA 1KU0A 1TRHA 4B81A 1A88A 1GKKA 3BIXA 1UKBA 3VKFA 5LP1A 4M0EA 3PE6A 3CCCA 1JU4A 1NX9A 3ESAA 3ICWA 4LXIA 4QWMA 3R0VA 3STUA 4K6KA 4DIUA 1XROA 1UT6A 3WA7A 4X7BA 5HQ3A 1H2YA 3AJAA 3X3HA 5LZ5A 4ZV9A 4F60A 3V1MA 3WZLA 2BAGA 3DOIA 3C8HA 5ALDA 3PF9A 2WHPA 3KOOA 4KRYA 4OYLA 5LZ4A 4WFJA 1CRLA 3G9TA 4BC0A 2QJWA 4N5IX 5D3ZA 3HI4A 2DHEA 2GYUA 5ALXA 3FCXA 5BWBA 1DTEA 3GROA 3TJMA 1FJ2A 4Z49A 2JEYA 2V98A 1F0PA 1XZLA 4HTAA 4UUQA 1CPYA 4XIIA 4GLBA 1XQYA 5CT9A 5EIAA 4H7EA 3G9UA 3SX4A 1YA8A 5CH3A 2I3ZA 1CUVA 2J3DA 4HXGA 2HA5A 5AKLA 5AM5A 5LLSA 1RP1A 5AM2A 1UOQA 2AXEA 2RAUA 3D0KA 4A16A 3U0VA 5LYYA 1P0IA 1UOPA 2JEZA 1BN6A 5CRIA 4KAJA 2WFLB 5LKAA 4KR0A 3NWOA 2R11A 5A62A 1FSSA 1K5PA 5A7FA 3AUKA 4KAFA 3G0CA 5ALYA 2HA2A 5HFNA 3OOSA 4ARBA 4BTVA 1JJBA 3MVEA 4J0JA 4Q3OA 5EHZA 4X95A 2WHRA 2RONA 2WIKA 3NOXA 1VZ2A 3WK9A 4K2AA 1Q0RA 3C8DA 4BCBA 5J3JA 5JAUA 1OXMA 1XZHA 5FOQA 2WTNA 1EB8A 4PW0A 3V9AA 4BAZA 2XUOA 5DLPA 1GQRA 1R88A 5EFZA 5AM3A 2PVSA 1CEXA 3VXKA 5JARA 4B83A 4H35A 3IUNA 4DMKA 3R41A 4Q34A 4UFNA 4G1FA 4OCZA 4X71A 1ETHA 4J0IA 1GZ7A 1UWCA 4ROTA 2VAVA 4FWBA 1XZMA 4CCWA 1ZI9A 2OPHA 3DYIA 1QO9A 1WHSA 3OG9A 1CUSA 3C6XA 3LIIA 4HVTA 1P0QA 1J2EA 2DR0A 4KJXA 5AK5A 5F4ZA 1K8QA 3F96A 5LKRA 5AJHA 4QDZA 3FSGD 3WWEA 4G8CA 5IVKA 2XLBA 5FLKA 4KRXA 4K5QA 5HK9A 3DL7A 2WKWA 5ALUA 3AILA 5FV4A 4ZREA 1H2ZA 4X00A 4DYHA 4E15A 4AN1A 3WYNA 5AICA 1XZEA 3V1KA 4AO7A 3QBJA 1CQWA 4UHBA 1DQYA 4AX4A 2X5XA 4Q3LA 1HBJA 2CJPA 3R3UA 4BB0A 1NU6A 4BZZA 4P92A 1XZBA 2GZSA 4PSDA 3BE8A 5AK3A 2WJ4A 4G8BA 1QFSA 2B9VA 1X70A 1QIEA 4EZIA 5T4HA 3D2AA 2LIPA 4OB7A 4JYPA 1QO7A 1XLWA 2HM7A 1CLEA 3PDCA 3FWHA 3D5EA 2XQIA 5AKJA 5IVHA 1MAAA 2X8BA 1N5MA 1DX4A 5A7HA 4LHEA 1CUBA 2QUAA 1QGED 2Z3WA 4C87A 2J4FA 2Y6UA 4PSUA 4QLOA 3WK6A 3BWXA 1IUNA 2P8SA 3RM3A 3C87A 2YYSA 1QIIA 1YAJA 3A2LA 3BJMA 4KYVA 2WG1A 4QE3A 4B85A 1W76A 2XQKA 3SK0A 1CUYA 3WI7A 4DSZA 4J7AA 1R9MA 2H7CA 1MNAA 1VLQA 1M33A 4OSEA 3C43A 3BF8A 4L3WA 3DEAA 4FDMA 1P0PA 1SCQA 2H7XA 1ZD5A 3VJMA 3F9CA 2D0DA 4C4ZA 3DDUA 2V97A 4FNGA 2HU7A 5DYWA 2WM2A 3ESCA 3FYUA 1BCSA 1NU8A 2B61A 4H7IA 3O4HA 1QTIA 2CEKA 3L1IA 5CXUA 2WUGA 1XZIA 2OXEA 1R1DA 1HLGA 4HAIA 1MJ5A 2CZQA 5CT5A 4FBLA 4FLMA 3CN9A 5EIHA 5LZ9A 2FX5A 1HL7A 1ZD2P 1A8QA 2NW6A 1SCKA 1E89A 1ZGCA 3EQ8A 3AIKA 5ALGA 3AZQA 4BDTA 5ALJA 1W4LA 2D5LA 3R3VA 2HDWA 2XDWA 3PFCA 4ZRDA 2OGSA 1UK6A 1XLVA 2GBCA 1LPSA 1XRMA 4QA9A 4GW3A 3WIBA 4A5SA 5LZ7A 4P9NA 1PFQA 2HA6A 1JKMA 2QXTA 4FBMA 1LPNA 1FFAA 3PI6A 1QIDA 2JGEA 4FMPA 3GELA 1LPMA 4U2EA 5IVIA 3I1YA 3G0IA 3G0BA 3FLEA 1IUPA 5YASA 5FPQA 1BCRA 5DWDA 2QM0A 1TQHA 2C5GA 4CIBA 1UKAA 5AKYA 1XRNA 3WK7A 5D7BA 2ZYSA 1OILA 2C0QA 2CUTA 4Y2QA 1ZIXA 3I28A 4MWTA 3L1HA 2BUBA 4MQMA 4C88A 3DOHA 2HRRA 4AMYA 1UKCA 1WPXA 1IUOA 1QTRA 4B0PA 3DLTA 3KSRA 1G66A 5K3AA 4ZWNA 1WPRA 3IDAA 4G8DA 3H2HA 4RE6A 3K2IA 1X2EA 4FFVA 5AKKA 1WB5A 4M0MA 4ZGBA 2VEOA 1XZGA 3IB3A 3RARA 3H04A 4WDQA 4I19A 4Y2RA 1BN7A 5DNVA 1UFOA 3S8YA 3ANTA 4QWWA 3BXPA 4IH4A 2ZYIA 1EDDA 3ZLTA 4PSCA 1ZIYA 3HLKA 5C8XA 2I3DA 1EI9A 1VKHA 2IITA 5ALNA 1DQZA 1MU0A 2DSNA 2JGJA 1ODSA 3P2MA 1GKLA 3R3XA 4IO0A 1GPNA 4BTLA 5AI4A 4BVJA 3ESBA 2V96A 1VE7A 4J0CA 2EDAA 1U65A 2OCLA 1CR6A 2PX6A 5A7GA 1VXOA 3H1AA 4X91A 2ACEA 3C5VA 4X92A 4B84A 5K3EA 3I2HA 3HYSA 4L0CA 3MUNA 5E4TA 3D2BA 4WY5A 2XB6A 5ALHA 2ZYHA 3CN7A 4KEAA 1BS9A 1QZ3A 2ECFA 5JATA 1I6WA 4UHDA 1VA5A 2PSDA 1XZJA 3BDIA 1S8OA 1C7JA 3WQHA 4WJLA 2XUJA 4AB1A 2XUDA 1CUFA 5HF5A 1Q0ZA 5JAPA 3PF8A 3N2ZB 1HDEA 2VQ6A 1GQSA 4UBLA 2AJLI 5EIEA 1W6RA 2PBLA 3EQ7A 2Z5GA 1W52X 3EIOA 4KACA 3DYVA 3WK5A 5JALA 4DLNA 3A2NA 1BE0A 4PO3X 4PQEA 4AO8A 2HIHA 3AZPA 1QIJA 4WCVA 1J1IA 3R3ZA 1Z68A 1AGYA 3DD5A 3RK4A 2VAXA 3HABA 3AFIA 5HF9A 1RYYA 4FOLA 5AHXA 1ZI6A 5AI5A 4W1QA 1CIJA 1P0MA 3GFFA 4E46A 1CUHA 3WKAA 4BE4A 1DU4A 4XVCA 4KE9A 3WWCA 1AURA 1LGYA 5LIPA 4RPCA 2XT0A 4UBNA 4BATA 3FSGA 2DHDA 2GBIA 5AI6A 2PM8A 1J07A 4ZI5A 2BGNA 5AM0A 4CCYB 4BZWA 4WFKA 4GWLA 2RI6A 1ZI8A 5AOBA 1WHTA 1CUUA 1JJFA 1Y37A 1SC9A 4LXHA 1YCDA 3K9BA 2ZJ7A 4L72A 3KDAA 5DNWA 4HRYA 5C7YA 1N8SA 1HQDA 5AKIA 5FKJA 3FAKA 4C6HA 1VXRA 1VA4A 2ZYRA 3G9XA 4C4YA 3T52A 4FNMA 2WIFA 4X6YA 4INZA 1EXWA 2HFJA 2WIJA 3WLAA 2BKLA 4GEGA 1R4ZA 4B9AA 3QITA 2XUKA 5CT8A 1T2NA 4BAGA 4A23A 3C6YA 4ITVA 2PKYX 2H9YA 2WILA 4AO6A 4Y9SA 2QS9A 3O0DA 2QKYA 1E5TA 2PUHA 3SC2A 4PV7A 5ALKA 2DHCA 4MWSA 5K3DA 4F21A 2HA4A 1QJ4A 3N0TA 2B20A 3NGMA 1T4MA 3A2MA 2C0PA 2G5PA 3ZI7A 3EF3A 2DQZA 4EB0A 5AKHA 5HKAA 4IQ4A 5CT6A 4W9RA 4CG2A 1ACLA 5DTIA 4JEIA 1XKTA 5HQ3B 3R40A 1CUCA 2RIPA 2OGTA 3D2CA 1QIMA 3ZLUA 3LLCA 5JADA 5AI9A 5HK8A 4C4XA 3O9MA 1WCYA 3M3DA 3ZPXA 5E2IA 4KE8A 4UBJA 1CUEA 2HU5A 2XMBA 5AKZA 3L1JA 1SCIA 1XZDA 2G5TA 3GA7A 3O95A 4EHBA 3OPMA 3E4DA 5DYTA 4UBOA 2CB9A 2XMDA 4AQDA 4BBZA 4JUIA 4MYSA 2Y2UA 2C58A 4YASA 1EHYA 2VJBA 3YASA 1E66A 4OB6A 2AJBA 3BL8A 2HHAA 4EY8A 1UZAA 2G4LA 5CTAA 4OUKX 4Y2JA 1JMYA 5ALVA 1CUDA 1BRTA 2I78A 5LZ2A 3O4GA 5AK6A 2XUGA 4MXDA 1ZJ4A 2ZJFA 2BFNA 2PPLA 4KAAA 5A71A 1XLUA 2QVBA 5CURA 3V1LA 5AP9A 4XJVA 1XRPA 5ALTA 4BCCA 4X94A 2OCGA 5EI5A 5FDFA 3M83A 5HFAA 4P08A 1CUAA 4K6HA 2UZ0A 2WQZA 3HXKA 3IIIA 1A8SA 5T4FA 3IUQA 2Q0XA 5CT4A 4MYDA 3QMWA 4CIAA 4L9AA 5HCUA 2PL5A 3AIOA 1QFMA 4CG1A 5ALOA 1CUWA 1WM1A 2JF0A 3I1IA 3I2JA 1GPKA 5AI0A 5DJ5A 2E3JA 2IX9A 1K4YA 4Y2XA 1VZ3A 3H17A 3BJRA 4W63A 4EY7A 4JH0A 5EHQA 4DNQA 5BV7A 2DCMA 3V1NA 1R3DA 1VE6A 3G9ZA 4DM7A 2J3QA 2ORYA 3TEJA 1E3QA 3BDVA 2EDCA 5JZ9A 4EY6A 3PUHA 2Y6VA 4OB8A 2VJCA 4P93A 4PNZA 1IZ8A 3C6ZA 2CBGA 3EQ9A 1KEZA 5AM1A 2VJDA 1AZWA 5ALMA 3GZJA 5H3HA 1H22A 1XKLA 1DINA 3O4JA 1CUZA 3WWPA 3B3QA 1MPXA 1Q84A 2VTVA 5T4EA 4N8SA 3WKCA 1EVQA 4ARAA 3WJ2A 5IKXA 5AH0A 1LPOA 3BIWA 4OU5A 2PU5A 4UFOA 3IUMA 3FLBA 1AQLA 3HACA 1QIHA 2OQVA 4DMCA 3W9UA 3C70A 4HXFB 4UBIA 4BC1A 2O2HA 1YS1X 1A8UA 4Q3KA 3H0CA 3IURA 3HC7A 3F8SA 3MGAA 1DT5A 1R50A 1U4NA 1F0NA 4UFPA 1UXOA 1BROA 2XMQA 3E1GA 1CUIA 1G42A 2VJAA 4UHFA 2QR5A 3D7RA 3I2IA 1CUXA 1EDEA 4G5XA 4O08A 3DKRA 5ALQA 5JD4A 4IH1A 2DQYA 3I2KA 5C81A 4FFWA 4BAUA 3CCBA 4GDMA 4HRXA 5AKEA 2YASA 2WHPB 2W22A 5E4YA 3DCNA 2WFLA 1DWPA 3WWDA 1XZKA 1JI3A 1WB4A 1THGA 2ZSHA 1CV2A 1ZOIA 3FYUB 3F97A 3PFBA 5AKGA 5K3FB 3CXUA 2XQGA 4QNNA 2WUEA 4FLEA 7YASA 2HA0A 3O4IA 3W04A 2EEPA 3H19A 4LKOA 2WTMA 4W1SA 2H1IA 5C8VA 4U2CA 3GBSA 2CMFA 3WIOA 3FVRA 5HKBA 4TGLA 3WL5A 4EY5A 3ZWQA 1DWOA 2OCIA 2VT7A 5SYMA 1UK8A 1H2WA 4X90A 1LPAB 1AMNA 1VOTA 5BOVA 2QXUA 5ALRA 3DS8A 3K6KA 4D9JA 2I03A 2O2IA 1MX1A 2ZSIA 5ESRA 4YX9A 3QMMA 4LIPD 3STXA 3FNBA 4ZXFA 3QPAA 3QYJA 3QZUA 5HF8A 2BUCA 1B41A 3R3YA 4FTWA 4J3JA 1LPBB 3IBTA 5KWIA 4JNCA 1ZICA 4Y2YA 4BCDA 1QE3A 3QPCA 3VVLA 4B6GA 2PUJA 1ORWA 4QDTA 2B4KA 4XWGA 5FP0A 1AC5A 4B80A 2X76A 3FBWA 4BRZA 4LYDA 1PV1A 1CUGA 2WUDA 4DNPA 4EUSA 2O7RA 5CMLA 4OU4A 4EBBA 2K2QB 4QEKA 1TCBA 2XE4A 1EVEA 3DKKA 2WUFA 2CKMA 1GXSA 2GZRA 4G4JA 1QIGA 3OC0A 5K3FA 1EB9A 1Y7IA 4WFIA 5I7UA 2V9ZA 5D3KA 5DTJA 1Y7HA 3QMVA 1USWA
chains in the Genus database with same CATH superfamily
1E64A 2O1EA 4TV9A 3WP0A 2YFQA 2PXXA 3MJDA 3UTDA 3WGKA 2OD2A 3MZ0A 4J1NA 5EJ2A 2AW5A 2A57A 1XEFA 3WIDA 1LCIA 3H18A 5FR1A 1J1ZA 5CDGA 1ZPDA 4K9MA 4URZR 1YMQA 3D4BA 3OT1A 2Q5LA 4YTEA 3ILYA 4QNMA 1C1DA 4P36A 4GU5A 3H87A 4HEA1 4FBGA 3A1WA 3NWPA 1PJQA 3VZSA 1NQTA 1XZCA 1DADA 1OBOA 1DJMA 3CSDA 2YZKA 1GGFA 2DT8A 4W6QA 3W5SA 4Z3KA 1EQ2A 1QYRA 2HX1A 5TC4A 5THKA 2E5WA 1RYNA 4HDMA 1IL0A 4QYSA 5LLDA 2ZROA 1V8PA 1VBFA 2FX2A 4RJLA 1W4BA 2ZREA 3VKWA 3PJRA 2OVBA 1FUKA 1Z36A 2B2CA 2HTEA 4IDEA 1AOXA 3VR1A 3UA4A 4H7JA 1E0SA 3COSA 1S7CA 3R0XA 1WUJS 4FILA 1S02A 4QX6A 2XLCA 5TEWA 1KTIA 5IXYA 3NFRA 1G0OA 1RJGA 4Y9DA 4W7HA 1B6TA 3IE0A 1ZVJA 2JEOA 1AK9A 4TKUA 3H1EA 4BDSA 1XRQA 4DDMA 2JKZA 1YACA 1POWA 2AMFA 4ODIA 4ZHQF 3KQQA 4B45A 3VHRA 4MR9B 3EGCA 1CEQA 3Q2OA 5ER9A 2IELA 2VPWA 3HCAA 4J0DA 4E5NA 3P19A 1PJ3A 1XRRA 1BE8A 4GMFA 1KXZA 1A5BB 3DDOA 4QYWA 4Q7JB 1G3UA 3STYA 1UKZA 1QAQA 2R6GA 2VPZA 3O4VA 3O8OB 1PKEA 1SCUA 3E18A 2ZYUX 4WNIA 3T1NA 2O7VA 4I3FA 4PIVA 3IS3A 2IHKA 5HIAA 3WYAA 4LDQA 1CQZA 2I34A 3TLEA 1E1YA 4RFSA 3OKFA 4FZRA 4DGQA 8ATCA 5C53B 3PGJA 1EX9A 4CKCA 2NO6A 3NYIA 3KTAB 1ZOOA 4QRHA 4ND4A 5F3WB 2QRHA 3ET4A 3I83A 3KWJA 2RGYA 4MS3A 1I24A 1C3EA 2R2GA 2D0OB 3BGVA 4QREA 4YJ2F 1OX4B 4FHZA 4A2CA 5LB4A 1C4XA 4C2BA 1V9SA 5CLIA 3D6VA 4KLZA 3WL3A 4N8EA 4D1YA 2QZSA 4NBLA 4FD2A 4ZEXA 1A9QA 1PJ4A 4QM7A 1H2XA 4HGPA 1E94E 1UXKA 4WEQA 4CUZA 1TYEB 4Q7EA 4B6OA 2IYTA 4IHJF 3FOBA 3Q15C 3S2EA 5ICSA 2ZZMA 3A27A 2ZIZA 4GOJA 2AMVA 5FA5A 4JLNA 1SOMA 2I2XB 3FHJA 2XV1A 1N9GA 5ESWA 3WTCA 2MIIA 5CTJA 3WMRA 1D2RA 1WZIA 3GMTA 3M6MD 5KVCA 1G1AA 5LQRA 3L5KA 1K8YB 2NADA 3RC9A 1P5JA 3LBYA 1RI5A 1B8OA 3UAXA 3RW9A 2E18A 2W2QA 4RDIA 5B2EA 4CTMA 3ISVA 4QVIA 2UZ1B 4HNVA 4WACA 3QYPA 1UJ6A 4OQLA 2M6RA 3ROMA 5EN4A 3HG7A 4U6SA 2HLHA 2HZ7A 4ID3A 1FTSA 1WQ1R 5KNDD 4LRWA 4IJ5A 3QBTA 3MTGA 3H1BA 1SUBA 4WHMA 2DZDA 1MC8A 4KQKA 1K7XB 4BE9A 4BQRA 4FI3C 3Q6IA 1FJHA 5JAIA 3CSUA 1C30B 2JFPA 1X42A 5IVDA 2P91A 1EFDN 4DV4B 5HRUA 1E1CA 1J2RA 5D1NA 5E95A 1D2MA 4JXKA 3GVPA 1M34B 2FA9A 3C6MA 1GHTA 2JD0A 2VR1A 5H3CA 4BASA 1FQKA 4DBLE 1MOQA 1FNSA 5EHIA 3N86A 5E2BA 3E9RA 1SRRA 3KZVA 5KHLB 3R6GA 5IK2A 2Q7DA 3BSYA 3C8MA 1USGA 5DLEA 5IH7A 4OHXA 3FVTA 3PTLA 2GN2A 1EINA 1J0BA 3D7SA 3IDOA 1QPZA 4KNWA 1JJVA 2JFQA 4QJIA 4KI0A 4MWOA 4Z7NB 1YB4A 4RGYA 5KPJA 1N3IA 4ERNA 2OD7A 4Q1EA 4F6LA 4CTNA 1AKQA 1XZFA 4LRUA 4DNOA 3QP9A 2B34A 1PJ8A 1D1TA 2H11A 4KMRA 1NVXQ 1ZA1A 2RJOA 4MMZB 1IPEA 1L7QA 2WJ6A 1E79D 2EFDB 4ZQFA 5K6AC 3LS2A 3WGVA 2OK8A 4Q66C 5J1TB 1FS4A 2IGBA 2PSEA 2ZSFA 1IY1A 4Y2PA 5K2MA 4IWNA 1ODCA 1BG6A 2IXBA 2JFZA 4RNDB 1I94B 2JIDA 4J2OA 3ZU5A 4D92A 1AUOA 2QMUA 2I4OA 3N9IA 2NUAB 1AGXA 2BEWB 4IFTA 3M4ZA 1DBIA 4PZAA 5BVGB 3QKSA 3FMIA 4P54A 2XGOA 3LLVA 5KVQA 4CI9A 2BHRA 1U0HC 4EK9A 4MQLA 1Z2DA 2P5UA 2B1IA 1HTBA 1M2OA 3L6CA 1HYBA 4XGIA 3U5ZB 1JEYA 3BAFA 2UYGA 3HCFA 1YBFA 1P8AA 1FRNA 3SBDA 2QIPA 2XQJA 1U8EA 3CB4A 4D0LB 4UE6A 3KK0A 4OI0A 1U8YA 4CF4A 3QOWA 4QVGA 1XN1A 4HAXA 2Q4EA 1ZCFA 3GRPA 3LQ2A 4W7SA 4QGSA 1FA9A 2QN8A 5GV8A 4DMMA 4EJ0A 4JD5A 3VC2A 4H6WA 3SOZA 2B4AA 1JA0A 4KXNA 5CCDA 1QYXA 2LXNA 2OORA 2RHHA 4I6EA 5K4GA 3R23A 3LBHA 4BP1A 1Y8QA 3EFOB 3B1WA 2E89A 5EKUA 1I1OA 1ZEMA 2CYBA 4IZ6A 5IKEA 3I6MA 1E6EA 1DKUA 2DWCA 4XYEA 1Y9ZA 4DILA 4LWPA 1X8JA 4YP7A 2VJLA 4LOIA 2HMWA 1M2OB 2CJXA 2AI3A 221PA 2NTJA 3AUSA 4NOMA 4Y18A 4CHTA 5G4KB 1LU9A 3NT5A 5M29A 2FPIA 2J3KA 5DYGA 3AU9A 3JSXA 1NC3A 3UUEA 1BXGB 1YB7A 3AINA 4K03A 2I3BA 3MTBA 4O5AA 5BT9A 1D2GA 3K1YA 5JPIA 4BYMA 3EMVA 3LUPA 5CB8A 4PHTA 1RZRD 2X1VA 2OQ2A 4IQFA 1RC8A 3DLBA 1D7OA 2B0JA 3G2KA 3L5OA 5HBGA 3PIDA 4LW8A 2O8FB 3VDXA 1CC1S 1T4BA 2BMJA 2IXGA 4HD8A 4TLEA 5G0SA 4FYIA 3WNZA 3W8NA 1LBSA 4NJMB 4QPZA 4UM9B 3ZHZA 4CIWA 3UKDA 2Z1NA 5JDIC 5K0FA 4LGCA 1XD9A 1J24A 3KM0A 3NWJA 4RXMA 4XWOA 1CF9A 3PK0A 1Y5RA 1BXRB 3C8ZA 1H6BA 2YNMD 2CD7A 2EL7A 3CMCO 2ZUSA 4UUAA 4TV8B 1CY6A 1CKEA 3VHXA 5I8WA 2VPXA 3MWKA 3ICCA 4U2DA 3TTWA 4ETWA 5AW5A 4LQ4A 3TTXA 4Y98A 2WNHA 4GFDA 4MW7A 1ZVMA 3CLTD 1GNVA 2JBWA 5HTKA 1ZD3A 1J06A 2Z6VA 1AKVA 4GECA 4CLRA 3SEQA 1XLTC 4JI2B 4YCAA 2DETA 1PFVA 1P2GA 2G04A 3DZJA 2OENG 4HWSA 4WLEA 1F6WA 5D1HA 1HFKA 1NATA 1U0FA 4UE3S 4HHEA 4DRXB 2FJ0A 5FNVF 4TXLA 1GAWA 3P9YA 1PWEA 3I3SR 3GA0A 4Y2UA 6REQB 3B6MA 3I0ZA 5BYAA 1N2EA 2MSLA 5CB4A 1RPTA 1PNQA 2PUFA 1RMTA 1W5SA 1G5QA 3LHFA 4OXIA 1TPZA 3AEYA 2ROQA 3L77A 5LU8A 4LPSA 4RTMA 3IUSA 1MLDA 2F1HA 1NVMB 5H4GA 2WWWA 3ZNPA 3H5OA 1LNQA 2VBIA 4JVLA 2JH9A 3MINB 1NI4A 4CFSA 2BYTA 4MO9A 3GEBA 2GPBA 3VU1A 3P4UA 3HLYA 3SFVA 1YONA 3QUSA 1YZFA 3L8ZA 4FGKA 1E2NA 5JRJA 4QDJA 2QAIA 2PY6A 1U8FO 1U02A 1UBMS 1UFVA 1PVDA 3QF4B 5BV1A 1VE9A 4X54A 4TKVA 4BKOA 5CBKA 1BEEA 1J22A 4WKGA 1HPLA 2OD9A 3F5DA 1L5WA 3H86A 1MT0A 4MWBA 3DBHA 4S0ZA 1T2EA 4FC6A 1QR2A 4NCKA 2BPOA 4HMOA 2BFBB 4CIVA 1Y6ZA 3AH8A 5DGCA 1SZJG 1II8A 1U81A 2NOAA 4WNYA 2PRKA 3QBDA 5U4QA 1D1PA 4MW9A 3W9BA 4CF6A 3ZGOA 3HKDB 1L7RA 4ZO9A 2QTHA 4E1VA 1O94A 2YWRA 4C30A 2EX0A 5LN1A 1QSGA 1R4AA 1G8PA 4XLTA 4JOCA 4LY3A 4P5PA 3L0BA 1Y3IA 1TF5A 3A0RB 4LJSA 3VMMA 3J81k 5KYWA 5EKXA 4CCYA 1R8YA 4B4DA 1DKNA 1TCCA 3CGWA 4WBXC 3WGJA 1PW7A 4U8GA 4E0BA 4L8GA 5AI5A 1XEWY 2GAFA 2YR0A 1H65A 3Q40A 1LSUA 2JFOA 4COOA 1LS1A 3RNOA 2DWPA 5I7WA 4ZVNA 2HJHA 1Y7LA 1P1RA 4REQA 3PGMA 1Z15A 2JIOA 4TZ0A 4MJXA 1CRQA 3E27A 2QD5A 1T6NA 1CJBA 4L78A 2B8JA 3QQ5A 1B8UA 4YYZA 2BFDA 1RHKA 2M6SA 3A1UA 3RIHA 4D2IA 2W6IA 2FUG1 4YCJA 1N9ZA 3FJYA 4MYUA 1UK9A 3BJIC 3T0FA 2BMAA 3CXRA 1X1BA 2I2AA 3V97A 3Q9UA 4M1ZA 4DM3A 4D0SA 2JA1A 5ALFA 1L4LA 4P35A 4IDPA 4RHTA 3H2KA 3NATA 1I3CA 1QIKA 4X5OA 1YJCA 1RCTE 5I9BA 1J99A 3SZLA 1Y1SA 2JFUA 4RVFA 2XX3A 4F2PA 1EXDA 3WHIA 1J7KA 1SCBA 2WHQA 1K3FA 4BVBA 1UIMA 3SFTA 4M0DA 4OLFA 4YMIA 1TK3A 1JSLA 3A6GA 3I2FA 4AJ4A 2APJA 3EY4A 3PNKA 3ADOA 1V16A 1HKHA 3VR5A 3PFGA 3ROPA 1YJ8A 2BZ1A 2RH5A 3OA2A 3Q3CA 2ZATA 4RYLA 4AULA 3AOEC 1ZK4A 3VSDA 3ZQKA 1MT3A 3KSBC 1RM5A 1U9YA 2VJOA 2C1EA 2HF8A 2H52A 1KVUA 2A9FA 5DHSA 1QQTA 3NHKA 4RJJA 2LVBA 3SC4A 4GOXA 4ZVPA 3RU9A 2OP0A 1GT6A 1UDCA 4KLRA 2B37A 3KALA 3JS5A 3ZTTA 5JQGA 1M5TA 2RI1A 3QIVA 5HE8A 1RKBA 2BKXA 3GNLA 4J49A 1JT2A 5IRCD 4WDRA 5FTLA 4O4IB 5IAGA 1AT1A 1PDOA 5JI3E 1QQ5A 1YS2X 2HWWA 3DYBA 3O9VA 4JZYA 4RD0A 3L7OA 1ECBA 2XY4A 3I12A 1SXJE 2ZVPX 2BKUA 3IAS1 3PXEA 1JX6A 1ZGAA 4R8MA 2I6UA 5JH7A 3S99A 2G08A 3II6X 1OX4A 3WBKA 4OXQA 1W5FA 3DLCA 4TVOA 3QFTA 3PQ7A 4X1YB 5FHRA 4R9RA 3NETA 1CQIA 3EY9A 3CVJA 2ZS7A 1ENZA 3L84A 3PVSA 1W581 3TAUA 1G5IA 3CLRD 4UD6A 1YRBA 3P2EA 1MD9A 4D96A 1LTQA 4YK7A 2IOFA 1SBHA 4BVHA 6YASA 4CHGA 1GEEA 2W43A 1UXJA 3GOQA 4IIVA 1R8XA 3A70A 2QJRA 4NBTA 4Y2TA 3D64A 2WE8A 2K4MA 1EXMA 3LYAA 4M98A 4NEHB 4IUYA 4TRMA 3ETEA 3K5IA 1US8B 2QX4A 1KVRA 1U4SA 4IWYA 4EYEA 1QMPA 4DA7A 2W8BA 3OURA 1SCAA 3DEZA 3OUTA 3FHTA 1C9YA 1LSSA 3FDFA 4I4CA 3Q98A 1AU9A 3HZOA 3QKRB 2VP3A 2VNSA 2WMDA 2Y1WA 5LL6P 4MKZA 1AV6A 1G21A 2JRLA 3BPSA 3L6BA 2J4CA 4UU1A 3FCAA 4B4UA 2PUTA 4FE7A 3I5UA 3AHGA 6Q21A 2B21A 2ZIXA 2GZDA 3CSSA 3MRSA 3PFHA 1SG6A 5IYZA 4X85A 5C1BA 1AF4A 1G41A 1UBTS 1ZH4A 4WI1A 2ZS8A 3I3OA 2DF8A 2AN9A 1OHHD 4MYTA 4R9NA 4BNLA 1L5VA 1KU6A 3TTVA 2V7TA 3GUCA 2H4XA 3P2JA 1FU8A 1V16B 1RCFA 2OLEA 3NDBB 3F2IA 1SD5A 3CYFA 3G5AA 4JLBA 1P17A 5K0CA 1GT91 3S5UA 4IX9A 3DQZA 1X7HA 1WP9A 3FM9A 4RULA 4MEBA 3AKZA 4PG8A 2G9ZA 3DEKA 3HKBB 4OYYA 1U2GC 5EYPA 2BGRA 4BXOB 2HADA 3I58A 2Z6QA 5JG7A 3ONEA 4MWCA 3TOVA 4DTCA 1IG0A 1CJMA 3W79A 4NXNB 1QHYA 1RAEA 4HDMB 4DWOA 1UT8A 2E82A 3K31A 2XB2A 1AQNA 4M21A 4C0AC 2VG8A 3WKBA 1S7GA 4NH0A 1XTQA 3KE9A 4UHEA 2AC2A 3JWEA 3CRVA 2NO4A 1TM2A 1N8NA 3ZIAD 2UYHA 1QQ6A 1JSCA 1UCFA 4GKAA 3T5MA 1OLUB 4CU2A 2FN8A 2PLRA 3BHIA 3CKMA 3B12A 3KEQA 4UULA 4Y0NA 4B3MB 1OAOA 1JAYA 1TCAA 2FCAA 2WJVA 2E7ZA 2PKQO 1WA5A 3OJCA 4TMYA 3GLHB 4AF8A 4AFNA 4CG3A 4ER5A 1JI0A 2X4DA 3O8QB 1J39A 1R6AA 1USUA 1YS7A 3COWA 4N7RA 5A3VA 4AROA 1AZTA 3N8GA 1F7UA 2YJGA 2P4HX 2XW6A 3KV3O 4R1OA 4QG3A 4Q05A 4BNXA 1DP4A 3GEHA 3HCCA 3QFHA 1JHYA 2BW0A 4WUVA 1Q1EA 1F1BA 4R16A 3P71T 1BJTA 1EK1A 5D3MA 5JIBA 1M2WA 3S1AB 3DEIA 3JASA 1Y1KE 3DCIA 1T9ZA 3P4YA 1XP5A 1ANKA 2QVZX 3C5WP 3LPLA 4H77A 3AETB 4XYGA 5CNKA 5JSZB 5LQSA 4DA6A 1KR5A 5AUNB 5AIBA 1L1QA 2JGMA 2P2NA 4Y9UA 1BJKA 4S35A 1Z7WA 1D0VA 1BSVA 2Q3LA 1K7SN 2QTRA 3UOGA 5AO9A 3FNHA 1X1DA 5CW2A 1FFXB 1V6CA 2XJ9A 1MF7A 3FSJX 3L0YA 4YRGA 4EGAA 721PA 1TUEA 3F6PA 5FOUA 3FOAA 5C7LO 3IMCA 2XYRA 1OC2A 3REGA 3KYCB 4FJ1A 3DQQA 1ISFA 2ADFA 1MEJA 4LJYA 4X3CA 4I50F 5ARCA 5JO0A 3WL6A 3ZWCA 3A4NA 2VC2B 1ND6A 4H18A 4U5QA 2BELA 2GR9A 4GPBA 1KKLA 3QLEA 2P2ZA 4Q4AA 3A6ZA 3U61B 1OGJA 4KQMA 3F8TA 4HMQA 4WVLA 4K7JA 4X65B 2CFCA 3DO6A 3GGCA 1P1CA 3MUOA 3K9HA 2OY0A 2XMPA 3C6KA 5BSMA 5C5EA 1XNHA 3DFUA 3K0EA 3TFWA 5H9VA 3T9AA 2OAEA 2HU8A 4MINA 1NSFA 4M1SA 5KNBA 3FPCA 1XL1A 2E6UX 1MNQA 3LBNA 5B58C 1RQNA 2QW1A 5BQFA 4ND8B 2CLMB 3PT5A 2NYRA 3CG0A 2GK6A 4GPIB 1P2DA 1S3SA 1XMSA 3ETJA 4QL3A 1QBGA 4N76A 2V65A 4RHUA 3SX0A 3DE4X 4KR2A 5CFOA 3KKQA 4EL0A 1UZUA 3X44A 4DBZA 5HRAA 4WZAE 1U0SY 3R5JA 5E8RA 1OLSA 4NONA 4BKRA 1TOAA 1Z26A 3F3MA 4ETIA 5CB4B 1JJAA 2CLKB 4FLFA 2QRPA 3KDPA 1LSJA 1Y5NA 2WE7A 2ZRKA 4NS4A 3T3HA 4BV3A 4Z4CA 4XUDA 5H70A 2FE1A 3E7FA 1OIWA 3E3OA 3WL8A 4AZVA 2K6GA 3AQ4A 3N8KA 2XQFA 4GUDA 1HR0B 1O0CA 3IJ5A 2W2OA 3P9KA 3PNVA 5HP4A 3K16A 1UDBA 2VP0A 2ZTUA 4UM7A 4CDNA 3OTGA 2V4ZA 1W19A 1BS2A 3ANLA 4NQZA 4B8ZA 2OO3A 3UM9A 1EJ6A 2NU9A 3UJCA 3KL2A 3ONNA 4G1EB 4KQGA 4EABA 2FZKA 1BD4A 1VFNA 2VSOA 4TMZA 4C2TA 2D7JA 3QWHA 4N5NA 3JQDA 1ZGBA 2AB0A 2QEQA 4D0RA 4BOYA 5LLTA 1AJEA 2CLHB 3OZAA 4X20B 3OC6A 3ABSB 4UU0A 3RC2A 2EKDA 1HNWB 1SVLA 4X66B 3GO4A 2O7SA 1U9IC 2HMTA 3AF0A 2ODNA 1BGXT 1DARA 1XTJA 4BVKA 4KQIA 1XNJA 4CMAA 5LZ8A 4RO0A 1YZUA 4MRPA 2J9ZB 3MMZA 5IUNC 4KE6A 5JAHA 2I4LA 2HGSA 3ND7A 3FHCB 1RWQA 2EC5A 4H7KA 4RSGA 4UEJA 5E6SB 5FQNA 2O2SA 3ZDFA 1Y5LA 4XCQA 4YJDA 5JASA 2EFHB 2H7VA 3MQ2A 4TUYF 4B6FA 5BPFA 3FIUA 4RA6A 4JJEA 5ADHA 2JCBA 5KU1A 4US0R 4PHHA 3S4YA 2DX7A 4LOJA 5C8ZA 3VKFA 1DV2A 5F2OA 5HIMA 1BGWA 2JIZD 5JMTA 2W6QA 4ALMA 2ZB2A 3TZLA 4BMXA 1M75A 4G37A 1APBA 1R16A 5KJFA 3L05A 3PXAA 2P9TA 3QK7A 1Z0ZA 2Z6UA 4OUDB 2O8CB 3JQFA 4EHNA 1R8SA 1YL6A 3LCVB 2FPLA 2WAOA 4KR9A 4C3UA 3OIFA 4G5SA 2CCKA 4XFKA 4JUDX 5CXSA 1XTKA 3VV2A 3R6TA 1B74A 4X7BA 4L5BA 2AN1A 1OGYA 4FCVA 2H18A 4P58A 1GN8A 4DEXA 1A9PA 3D6UA 2ZR7A 2KWIA 1BQEA 4ZV9A 2EWMA 1JB1A 5CPBA 2VYFA 3DOIA 3GEPA 1ZL2A 3OE5A 4MEJA 4RD2A 1LVHA 1A1SA 3C8HA 4TX1A 2YNMC 2WHPA 3PF9A 1Q3HA 2ZJAA 1KVQA 2XGSA 4JUBA 1WHTB 2P2GA 2C29D 2C9OA 3TZHA 2WA1A 1LI7A 5EAIA 2QJWA 5D3ZA 4DVGA 5LYJA 3Q0EA 5JZVA 1UJ2A 3EVZA 2R65A 5ALXA 3ZE9A 5IJ0A 1DTEA 3GROA 1VM6A 2GOYA 3I5AA 2CUKA 5H7XA 2A5YB 4LCBA 3TJMA 5JS1A 4AP5A 4MCAA 4TKLA 5K0SA 2V98A 3SEZA 2Z9DA 1U9ZA 1X19A 5REQB 4AY2A 3WAJA 2C7PA 1TTHA 2A7QA 1KJ9A 3JWJA 1DX9A 2A1TR 5TMEA 3ZBPA 1L4BA 1PV2A 2HEIA 3WWYA 1P7YA 1TLFA 1UPUA 2A5LA 3LPNA 1W73A 3MRVA 3R5SA 4H7EA 4NZMA 4QJBA 4QPDA 3SX4A 1WXEA 1YA8A 5CH3A 4MULA 3QW4B 5CBPA 3UB2A 2G5GX 1U1GA 1CUVA 3G85A 1JQ3A 5DBOA 4DCUA 1U2QA 2J3DA 4HXGA 4XIJA 1KI3A 3IAXA 2QX9A 4Z4HA 1ZGJA 3ELWA 4JLMA 2GI4A 2O06A 5LLSA 1KAHA 1WMAA 3PGA1 2C5HA 5F21A 5TR9A 3W5IA 4U2KA 5B1EA 4ZT2A 4HNTA 5FWXA 2FSIA 3CW2A 3THWB 2AXEA 1IK6A 3RIMA 1TZKA 4L3OA 4O1HA 1OXVA 3EZ6A 4CZ2A 4GI3A 2F00A 2YXEA 5EJGA 4G5YA 3UA3A 1BVUA 3HCDA 2P4EA 3K9QO 2PLAA 4MX8A 3HA2A 3ITNA 4MICA 3WNVA 5HMLA 1L4MA 3F71A 2GUGA 1LLDA 1NDUA 3GPIA 4XJSA 5FLYA 3AR3A 1UOPA 3WV5A 4CN8A 2DE0X 4D80A 1BN6A 3G8AA 5ERGB 3B1ZA 3B1JA 3V46A 2IS6A 3K1ZA 4KLCA 3W8FA 1DSSG 4GKBA 5K3SA 3HKCB 4IXNA 1PZMA 4KVGA 1KR2A 4KR0A 2ZDGA 3EXFB 1Z5NA 3D5TA 4WKCA 2FZ4A 5ER6A 1TVKB 2VDUE 5A7FA 2C3MA 4L27A 3DWFA 1UPBA 3QF7A 2QAGA 5D3QA 2P69A 4EEXA 3HB1A 5KYYA 3TG2A 2X5JO 2QLFA 4LY0A 1ZN8A 2EXXA 1ZITA 1E58A 2JC3A 1DAPA 3CW9A 5GAJA 1XNRB 1G5TA 3DEYX 4ARBA 4MOWA 3E7DA 3PWKA 4BTVA 3DDWA 1EP3B 4J6EA 4LQLA 4QUJA 3O3OB 1C3JA 5ICCA 3AUUA 4J0JA 3AUXA 3T12A 1G20A 4WOKA 4LJ9A 1WF6A 5KJCA 2ZI6A 3K9CA 3GJZA 1XHEA 4P32A 2KE5A 3BCUA 2EGUA 2PKWA 5CJ2A 4EHKA 5KDDA 4JWTA 4ROSA 4X95A 3U1VA 3I9FA 1CB0A 5IYZF 3JXEA 2ZYAA 3RCBA 4C5CA 1VZ2A 3WK9A 3QU2A 3BGSA 4WOBA 1Q15A 2Q1WA 1GL7A 3KR2A 4BCBA 1GP2A 1GTZA 1VPEA 2E48A 2Q9BA 1OXMA 1RI3A 1KNXA 4PAOA 4JJ6A 5AJXA 1KDYA 2PUDA 1DUSA 1XZHA 3DUFB 4IRMA 4MDEA 2FEPA 3FHLA 1U1CA 2E4XA 1UAYA 1MZPA 1U0GA 2WTNA 4Z1MD 5L3ZA 2B1GA 4NH4A 1L5KA 5B7PA 2WWIA 4V3CA 1SVUA 2C2ZA 1M2HA 4B6RA 1Q21A 4L2IB 1ETUA 3JD3A 2OO7A 3AF6A 3DMPA 3RV3A 2CMGA 2J0UB 3U80A 4ANFA 4JC0A 3PNMA 3G8BA 1EWVA 5BN3A 1WCWA 2GN9A 2ZWPA 2PRSA 1S2NA 1ENYA 2CL7X 2FI1A 2W11A 1NONA 3KHKA 5HMMA 3QX3A 4YMHA 1W0KD 1SEPA 3B3FA 4OSPA 3VXKA 3S2GA 4RQUA 3SYLA 1Y80A 4JSTA 2AW3A 1A7JA 2VH2A 4H35A 3IUNA 3DMTC 1LWOA 4C0LA 1F48A 1OX5A 1MTOA 4UFNA 5GVSA 2R7NA 4RABA 4Q18A 4DIFA 1RMQA 2PYZA 4P22A 4A8TA 4OCZA 3CKYA 4NDNE 4LS3A 3PRJA 1ETHA 5L45A 3R7BA 1GZ7A 3E4CA 5AXCA 4GQBA 1JDZA 4J7CA 2F64A 3MJRA 5JQGB 1UWCA 2EW8A 1IXKA 5JNVA 3HJNA 4ROTA 4EFLA 2P6NA 1DG9A 5EEHA 3F6YA 4QELA 2I1QA 4G63A 3S2YA 2VAVA 1PJBA 4XQ0A 3T1HB 1V5FA 4WLOA 3ZCQA 1KMNA 3DHNA 1KBQA 4EKGA 2J59A 2QM8A 1NYQA 5CCEA 2IHVA 4FWBA 4HNAA 3ZCUA 1NHWA 4Q9NA 3GOHA 2IUYA 2X86A 4CCWA 1OAOC 2M32A 4KWCA 2P2YA 4OL0A 3ZI0A 4F96A 4Z5XA 2MCFA 5BR8B 2QT1A 3PGLA 2XYVA 2YTZA 1U3FA 4E2WA 1WHSA 2ZOSA 1Z5WA 3D1JA 3OG9A 4QPCA 1FCJA 5KMGB 3C6XA 4EARA 4ACBA 4GSYA 2QD2A 4K2HA 1JHQA 3B36A 1TAUA 4F2HA 1VCNA 1KPIA 1K8QA 3EDYA 1VHJA 2ZIXB 1C9KA 2B0CA 3KXDA 3NHMA 2PD4A 4WW0A 1EX6A 1V1JA 3Q41A 5GJCA 3MTAA 3WX0A 4KN9S 2H0QA 3IMFA 4JLPA 4BKMA 1TYCA 4M1TA 3RIXA 4KRXA 4FYXA 5AXAA 4YJFB 1DC4A 3R9XA 3D6MA 4E5KA 1TT5B 3RSHA 3N8HA 1QB8A 3ZH9B 1WW8A 3V8EA 2PVPA 1JYSA 3DFMA 3KVRA 4ZREA 1H2ZA 1ZNWA 4KQEA 2F43A 3UWDA 4DG8A 4QM6A 3R44A 3SBEA 2GN8A 1DPGA 1ENPA 5CYOA 3SR4A 1J9GA 2AL7A 2JGDB 2IUSA 5AJYA 2F1IA 5L9AA 3WYNA 1VP3A 3V1KA 2I29A 1Z6AA 4KPYA 3FD8A 5FTNA 1KSJA 2BSQA 3CZQA 1X1RA 5ITVA 1CQWA 3LH5A 1V3TA 1UPXA 1OASA 4B2PA 2DTXA 5EZYB 4GX0A 1DI0A 4NABA 3IOYA 2Z95A 3CR7A 1Y3HA 2H59A 3MAJA 4AG5A 5JPCA 5H81A 1ZZEA 4TWZA 1OFUX 2ZWAA 1SCUB 1NF2A 4PGFA 1JIKA 4AD8A 4BB0A 2Y0CA 3PU6A 4YA6A 4IG4A 2VUTA 2Q7XA 5IJ0B 4HT3B 3HU5A 3C0KA 1SGWA 4NU6A 1A4XA 2RAVA 4IL5A 4C21A 3ZN2A 2DTEA 1YR7A 2HO4A 3L1KA 3MCUA 2O59A 2P6UA 4C7OA 3BXFA 4PQYA 5DI3B 3UBTA 4RXTA 1FSPA 2HJVA 2X40A 2QUIA 1QFSA 4LVNA 1NMZA 4B3HA 1TQ4A 3TNDA 1F60A 4DS3A 5EMHA 1H0RA 2EKPA 1FJXA 1E4EB 2JAHA 2J0QA 1KI6A 4EATA 1USIA 1JSRA 2FSVC 5EE0A 2H2HA 3TIIA 2NP6A 1N5OX 1I0ZA 4I5GA 3D2AA 4OB7A 4PAGA 4P0QB 1T2AA 4LJ8A 1O89A 1P74A 2Z30A 5DBFA 3TR6A 3UQZA 1BDHA 1XLWA 2CY0A 2YHSA 4IXTA 1JAHA 1JKJA 1VL2A 2GPNA 4OEHA 3SIRA 3NNNA 3IDZA 2QUJA 4LNUA 1YR1A 4IGEA 4FFDA 3KKOA 3VKUA 2YV4A 3E23A 2XWQA 4FGJA 1FBTA 3SGLA 5LQNA 3OD1A 1UC9A 5H1YA 1WZEA 4CKXA 3D02A 4L9RA 3DQPA 5ILGA 3JARB 1UBOS 1YBAA 4LFBB 1DX4A 2PMCA 3GYBA 2ZRAA 2DUJA 3ENZA 2FXVA 3I0MA 2H92A 4YAGA 3GLIB 3RAPR 1X15A 3NVKI 2QUAA 4PYMA 1QGED 2CXQA 3NHJA 1KY2A 2Z3WA 2PGXA 3DTNA 4C87A 3DO5A 2XB4A 5IZ4A 2W4IA 1YZHA 3ACBA 3KL4A 3KJGA 3OPQA 5CLJA 5EHGA 1P81A 1NPYA 2AG8A 4EG4A 4B6EA 4Y0VA 3FGPA 3LI2A 1Z45A 2HBZA 4KXXA 3NHSA 3BXGA 3L7IA 3S55A 3GF4A 3GNSA 1FFHA 4CNBA 1ZUNB 3BWXA 3ELBA 1TI7A 2AF4C 4H1UA 4RLSA 3THWA 3C87A 3OLQA 1KMCA 2YYSA 4L0QA 2MSDB 3UCXA 2C07A 1D6NA 1QIIA 1YAJA 3WHPA 2BHTA 5BRAA 2YWJA 3U49A 1HA3A 5FWDA 3RG8A 3FX2A 3H5TA 1JAZA 4KYVA 4PYRA 2G0NA 1GUAA 1W76A 4P7BA 2SBTA 4JI3B 3FOEC 1R6VA 3LC1O 1CBUA 4A10A 5EIFA 4OQ4A 1NDHA 1R0KA 4KN5A 4JFRA 4KR6A 4MYCA 1E18A 4DSZA 3B6ZA 2IKQA 4QBGB 4MV1A 2ZR8A 2VTEA 4L8FA 4ZAXA 3RS8A 4J7AA 1II8B 4I99A 1E4OA 2F7SA 1VYTA 4IS3A 5CHEA 5L7WA 1MNAA 1VLQA 1YR8A 4CL3A 3QEBZ 4C7BA 4PVDA 3FHOA 3RRZA 1C8KA 1WDLA 1WV1A 1C7FA 2H1RA 3IDFA 1XWFA 4OFBA 1OLSB 1PJLA 1W6UA 4FHCA 4E4TA 3LUCA 4RTQA 1XCLA 1K6IA 2WVHA 4RU1A 3BFVA 3UAWA 3F9CA 3TLMA 1N57A 2ZE6A 3K5WA 4YVFA 1T5HX 2XAAA 2D0DA 1D04A 2BZ0A 2G7ZA 3IIKA 1V35A 1J8YF 3DKPA 4FZVA 2P65A 1TA0A 1J0EA 2YVKA 4H7PA 4R1UA 5DOVA 5JS6A 1V3VA 2P41A 3H5AA 3JYLA 4XVHA 1O08A 1Y9JA 2C7GA 4OJYA 3IAM1 4KIFA 3FZYA 1BCSA 1NU8A 2O5RA 3FYUA 2EHDA 4WRRA 4HDKB 4C22A 3H3JA 4DHWA 1C1XA 1AB5A 1VI6A 5KWEA 3O4HA 3U7JA 1M66A 3G0OA 1YBMA 4NU8X 2O14A 1PK7A 2BHSA 1C2TA 1SZDA 1T5OA 4LNHA 4W6ZA 1XDZA 1LW6E 2VNHA 2DWQA 2WUGA 2HLDD 2G80A 4KXMA 4UVIA 5HQTA 4JP5A 3MOGA 5LBIA 2I2WA 1GCIA 3CPHA 5COQA 1R1DA 2YWFA 3AJDA 3LUAA 4KAXA 4LI3X 3BE4A 3NBQA 2DY1A 1AO0A 2D5IA 2CZQA 5CT5A 3EOAI 3KP1A 2V7VA 1V47A 4YWJA 2O2YA 4K1LA 4FBLA 3S2FA 5JY1A 3L7AA 1UC8A 2Q0HA 4ND5A 5JH7B 4M9QA 5F77A 3CN9A 3FGOA 5EIHA 3Q5DA 1N2GA 1GDHA 4G5GA 3QVLA 1ZD2P 5LMUB 1MC4A 2XTZA 2V5VA 1Z56C 4OQPA 3TUIC 3VUEA 3FB1A 3HGQA 3B6KA 1X14A 3I9KA 4FHDA 1L4YA 1LNZA 4LZJA 1N3BA 1IM2A 3L7MA 3AIKA 1CNMA 5ALGA 1ZR4A 4F2DA 1L6RA 3LRTA 1M8GA 4LF6B 2HJGA 4L0MA 4N0MA 4BX9A 4DT1B 3HH8A 4YDHB 2FPGB 2BP7B 3SJCA 2JGAA 3E9EA 1X9GA 3FKJA 5BMOA 3IKTA 1EHCA 1UK6A 1MO3A 2CBXA 3MJFA 4Q4JA 4R01A 5FWYA 1Q11A 1IBCA 1QGZA 1T43A 1XLVA 2GBCA 2I1LA 2JJQA 2J85A 2QSJA 2VYND 1PL6A 4DB2A 2ZRLA 4PHGA 3SC2B 1L5QA 4A91A 3WIBA 1LLUA 2MTBA 4NE2A 4R2WA 4WECA 3ZHOA 2PYDA 3C5HA 1FRQA 3PHGA 3NT4A 2P2SA 3RS4A 3FPSA 4JI0B 1FFAA 4QGHA 3EH2A 5CB6A 2B3DA 3OPYA 3RAGA 4TYMA 4RZIA 2QENA 3B78A 3OJXA 3RWOA 1Q6YA 4UMVA 1LPMA 3I1YA 2H0RA 2HCRA 1HV8A 2A2ZA 1A7KA 3Q9SA 1PNVA 3R6DA 3VO8A 4D9EA 5IASA 1NM5A 1RABA 4PZPA 4KYIB 4RY0A 1KS2A 1Y6QA 3IHKA 3WTBA 1N8TA 1U8UA 4LBYA 4CIBA 3L01A 1TE2A 1OVMA 4B8WA 2GEFA 3R7WB 3EVFA 4MS1B 3LD9A 4EG7A 3S70A 1C1XB 3IV7A 4G1BA 3WK7A 2ZIFA 3CO5A 3LCUA 2GN6A 1GO2A 1KS9A 3ZVNA 3Q7PA 2CUTA 4IMJB 1ZIXA 4YRQA 2OOSA 2YVQA 3QUAA 1HK7A 4D9GA 3GLSA 1EFCA 1XF1A 4R8VA 4QGFA 2VDLB 2VUHB 4N3AA 5KS2A 1P29A 2BUBA 2ZIAA 4MQMA 1N77A 1KSHA 2EX1A 4EO4A 5DCWA 1IN7A 2NTNA 3FUWA 3SM9A 3IR5A 3OJFA 1OKKD 5HEKA 1XVTA 1AUVA 1H6CA 2W2PA 3O8BA 4PO8A 1DXOA 5FOXA 2JLAA 1REQB 2YOFA 4KG7A 5JT1A 2J33A 2G67A 3A9SA 1T4CA 3OD5A 3DLTA 1CDEA 5GMOA 3V55A 4BU0A 3ZD6A 2V6GA 2C9YA 2OHIA 1P0FA 3KZKA 1HRKA 3OWXA 1OFHA 1XVLA 2E2WA 2QVGA 2X6QA 3AI7A 4ZANA 3CEMA 2H3HA 3GJSA 3U9LA 2C7QA 1JMVA 1X2EA 3I53A 1Z0DA 1P61B 2PZ8A 5AKKA 3WRVA 2IX3A 5JEEA 1BMQA 1P33A 2HXGA 1WB5A 4M0MA 4J4HA 4WBSA 1IM5A 3EUAA 3ILHA 3KSZO 1QDEA 2JCYA 1H4VB 3P9IA 4ZGBA 5BV2P 3N53A 3RRMA 2O5EA 1XZGA 3IB3A 1LC3A 4QJ4A 4GM4A 1ZM7A 2BZGA 3OIUA 3RARA 4N41A 4O1MA 4S05A 4BLSA 5EIOA 4J0FA 5CYFA 2F48A 4JR2A 4Y2RA 3S8YA 1UFOA 1FZTA 1CZLA 4H1HA 1FX0B 2RGBA 4I81A 2ZTHA 1RYHA 3BXPA 1KFJB 4ML3A 4URHA 2JIZA 2ZYIA 5B3LA 1M6HA 3O7WA 4MIEA 4EOGA 2R68A 4PSCA 5B2FA 2R79A 2VS1A 4DANA 4E6EA 3MJ4A 1BA2A 2GNOA 1KAQA 2NUTB 4XVQA 1UBEA 1NR5A 3AHJA 4IGAA 4D9BA 2WLTA 2IXDA 4IXMA 5CA1A 1EI9A 3G59A 3ROXA 3GJYA 4GPTA 3VR6D 5ALNA 1IXSB 1CP3A 3I04A 1HE3A 2ZRNA 2EIXA 1CD5A 2COEA 2WT4A 1I01A 4FWIB 4RVOA 5DRTA 4ESVA 1PT5A 4ZHSA 1SN7A 2X7XA 3C3WA 4R05A 1SULA 3SNKA 1OBFO 3IQGX 3VTKA 4BMSA 3C98A 3GLFB 3ND6A 3QEAZ 1CTQA 1J2UA 1FNCA 1A5AB 2YBDA 2BEUA 3CNHA 4B7UA 5KQRA 2F17A 2V96A 1VE7A 1UKEA 4LRXA 5IDVA 4Q6BA 4BX2A 3ZDDA 1IWBB 1JAXA 4NP6A 1YE3A 1FJGB 3RC8A 3Q3GE 3KAKA 4PS0A 3EVCA 3EK2A 5KTSA 1CVRA 3GYGA 2XDYA 1ES9A 3V1UA 1L2TA 2IDZA 5JMOA 2IK8A 4OBEA 3VI4B 2O8EB 3TQTA 1J2YA 2NZVG 2WZQA 3HVJA 4IJQA 3ZWBA 2CDAA 1VXOA 2ZE7A 4WX2B 5I4CA 2PBFA 2B8WA 1H4TA 5F2KA 3F5SA 4DQ0A 2A3NA 4KXFB 3P94A 1VHLA 3HP4A 3FPGA 4X92A 1K6JA 1LQ2A 2ZZKA 4R84A 3VR4H 3I9LA 4WLNA 5JO9A 5K3EA 2W90A 3FMGA 1ESEA 2VHEA 2CF5A 3RABA 1JR3D 4IV5A 1GAJA 1K8XB 3ZU4A 1WQ4A 4RTLA 5DCUA 2WQ7A 4P7GA 4C0WA 4A8JB 3RTBA 1DL5A 3ILXA 4LVUA 3NV9A 2R8EA 1BX3A 1FBNA 1ATIA 2NVWA 2L82A 3K4HA 3ACDA 3MJHA 3NAMA 4JJZA 4KPUB 2JI4A 5TQJA 3T5DA 4AJKA 3T61A 1KWKA 3OX1A 4UARA 2GK3A 4I4LA 3RH0A 5BY2A 4PM4A 1RVDA 3T52A 4KEAA 2HWXA 3A06A 4GMKA 4D9HA 5HVNA 1BS9A 4GM1A 4FYJA 2FUNB 3WLMA 3D6AA 2R25B 4DV2B 2FK7A 1Q57A 2IH4A 3WHKA 2EWVA 5JATA 4UHDA 3AEQA 1JR2A 4KK4A 1TFUA 4YREA 3R76A 2G3YA 4Y9RA 4DY4A 3WQHA 4MW5A 2XUJA 4MV5A 3TE7A 1DC8A 1EGQA 4TT8A 4AB1A 2WR8A 2A5DA 1WVGA 2QQGA 2QTVA 3E15A 4ZYWA 3GEDA 1IB6A 2Q8PA 2VA8A 4MVCA 4HBZA 5GINE 1SIOA 4MKIA 3OO0A 2WOJA 3ZKWA 4G25A 2BRUA 1JN0A 1HNNA 1OBCA 3KQPA 1P4JA 1SU6A 1O0SA 3ZEAA 4RSHA 4EPWA 4IOLA 5I5EA 3DXYA 2O3JA 1M6NA 3WXMA 1RIIA 5GZ1A 2RKOA 4E31A 1N25A 4U7WA 5EIEA 2FR8A 3G17A 2X5KO 4H08A 4H3KB 1S2OA 3V32A 2IT1A 3PLNA 5C2JB 3B38A 5DCLA 3OO1A 1P1IA 1P3Y1 1W52X 1YTLA 1SXJD 4TRNA 5M04A 1GZSA 3EIOA 5BV8A 1ZINA 3TSOA 3VR3D 2J6CA 2HMUA 4O3MA 2KLBA 2Q1UA 2F8MA 1CQJA 3V80A 4ZYYA 3UUWA 1X80A 3OLXA 4FEGA 5JALA 3H4TA 4D56A 5KEIA 3UT0A 1J4AA 4KKXB 4MVJF 2QTMA 3RK1A 1ADYA 1TJ3A 4DLNA 1VECA 3A2NA 3AI1A 3AERA 1QFJA 1TLLA 3JTMA 1H8ED 5EJ5A 3DMFA 2MYNA 4R5MA 3HMKA 1KDTA 2ZM5A 1BDBA 4MR8B 4AY6A 1S96A 4Z4EA 2IZ0A 5EG5A 1XDGA 4QHSA 1E1RD 1PD0A 1PCXA 3KSMA 4C3OB 3VO1A 3EUFA 1J6UA 2O1WA 2N1MA 2CYCA 3AY6A 3DD5A 3HV0A 3V33A 4Z4IA 2FN4A 3NWBA 2V3CC 1FRZA 2NU6A 4QT4A 4BL5A 4LF8B 1S2DA 3HM9A 5A04A 1FYFA 3IEXA 3IBCA 4CV1A 3ASYA 2IQ5A 2MSNA 3IT3A 1E2LA 3HXMA 4J29A 4LZNA 3LL7A 3KJEA 4FT4A 5AHXA 3ADKA 5D86A 3RG2A 3SM3A 1NXVA 1ABFA 3ZWKA 1CY4A 1SCJA 4HEA6 4ZHQA 2CXSA 4WBNF 1CUHA 4WGFA 3WKAA 3K6SB 1CQPA 2OO5A 1PYGA 1FC0A 1DU4A 1LKZA 3RJTA 1MDBA 4G0WA 4PQRA 2DY0A 1GM5A 3NIFB 2A84A 3FDXA 4OXNA 5KCMA 1JG2A 4QTZA 2AOXA 1K8ZB 2W9XA 4NJMA 1T1SA 5IP5A 4CLEA 1MOSA 3IIEA 4NYIR 4CBVA 2J45A 2C82A 4JU8A 4PQFA 5BV0A 3SZGA 1C80A 4O2AB 5AVYA 2CKDA 2KX7A 1AK2A 3WLHA 4A0RA 2DFKB 2EFJA 1QCYA 2PM8A 3TVDA 4MCIA 3DOCA 4X0EA 2A86A 4L85A 3OM0A 4XX0A 4YGXB 3K1AB 3KELA 1JEEA 3TLKA 5MHTA 1PTJC 4BZWA 5ITSA 1KI7A 3D8BA 2XZLA 3RGWS 1PHRA 5ECGC 5HIIA 4XUCA 3JYNA 3LGSA 5K01A 2AWNA 1WWKA 4GBMA 3TE6A 3A9WA 1WHTA 2OE2A 3GBPA 5JFGA 1SC9A 3DBLA 4LXHA 2OXTA 1YCDA 3Q3IA 3ZDCA 3RD5A 1BIFA 4B32A 2O23A 4FQ7A 1RLUA 1NF3A 4A0QA 2J08A 5LNK6 3KPVA 5C7YA 3LDAA 1DEOA 1N34B 1NVAA 3L6DA 1K97A 1L5LA 4A0SA 3OUZA 5FKJA 4JUAA 1R66A 3WJ7A 1U7TA 5CM2Z 4YMWA 4TRRA 3AVVA 2J5BA 2FKAA 1AUQA 3QWIA 1QG4A 4LXUA 4FNMA 3NNDA 2WIFA 2GJ4A 2IZ5A 3I05A 4NV1A 4TLMB 4X6YA 4ECEA 3B1VA 5BQOA 3ZCPA 4XB1A 1MB3A 3QUCA 4M7WA 3V2HA 3EF0A 4ZVKA 1R4ZA 4B9AA 2ADMA 4MR8A 3PT9A 3EIQA 4XUGB 2ZB3A 4HWRA 3I2YX 2MSKA 3M7IA 1T2NA 1JE1A 3C6YA 1EVIA 1HOTA 4MROA 4KI7A 4IKOA 1PL8A 2XJ4A 4WXRA 4Q24A 4XOUA 2NUAA 3SAJA 3ZBQA 3CLSD 5JWRA 3OU6A 4DV1B 2HSJA 1RWMA 1WVIA 3TLXA 1SCNE 2IYQA 4J94A 4Y9SA 2PCLA 4UAVA 4W7IA 3VX4A 4QO8A 1Z4QA 5K0ZA 2PUHA 3A3YA 3DWIA 3SC2A 3ZK8A 4B73A 1VPWA 4G5HA 1LDBA 2AZXA 1Z6GA 2LWIA 2QR3A 1GYPA 1JHOA 4IV0A 1TGYA 2FP4A 4TS1A 3HLTA 1KGDA 1EG2A 2D0IA 2DBYA 3PNOA 4TV8A 3RTDA 4F21A 2B1RA 2NV6A 4PNEA 3L4JA 2AOTA 3BMQB 1H3NA 5FH9A 5MFPA 1W7AA 4G9BA 2AA3A 4EFDA 1QJ4A 3OFSA 2B20A 4GWGA 3W7VA 1Z29A 4UM8B 3OWOA 4DDWA 4RD3A 5JXWA 3A2MA 1N32B 4UASA 4H4CA 3UC5A 2Q5CA 3STHA 1EFLA 1L9KA 3GJTA 1OFTA 4I5EA 2WMOB 4RCYA 2DQZA 2NT4A 3RUEA 3ZI7A 4F72A 1F8YA 3RQSA 3PNPA 2YDXA 4BMVA 3Q7IA 4WINA 4YT2A 2DFNA 3GDGA 3U9SA 1QS0B 4OQDA 2ZCVA 5LOVB 4CG2A 4W9RA 4RV5A 2WYIA 4ZDKA 4AUNA 3EPJA 3OQPA 4JEIA 3EPKA 3KKLA 5JSQA 5K2OA 5H68A 1IIBA 3F6EX 2Z5VA 3U9TA 3CRQA 3ZXUB 1IEVA 2WAAA 3OH8A 5HE9A 3MG9A 2MYUA 2RIPA 3ORQA 4AJOA 5I9TA 5B4TA 1VLVA 2DEUA 1M2KA 1GV1A 3DM5A 4XXHA 4QSHA 2HC9A 4M36A 2WJWA 5EUBA 4QU5A 5GOTA 3ELUA 3EXIA 4LSWA 2ZT8A 3DG9A 2GKSA 3ETGA 3UHJA 2A35A 4EWLA 1T9DA 4ND6A 2OBXA 1VRCA 1AG9A 4ZDWA 2NTYC 4YIHA 3SQWA 4V1CI 2NQ2C 4LOLA 5E2IA 5H0IA 1PGOA 3L18A 4UBJA 1PU2A 4I36A 3HDQA 5ITZA 4WY2A 1WDMA 3IA7A 3MS7A 3KAQA 3DL2A 4OIFA 4ZGWA 1YHNA 4R68A 3SEFA 1RYZA 4F97A 4YUXA 2VZ8A 1F38A 5EJAA 5T3YA 4JKYA 4LZAA 1JQLB 1QXSA 1HT2E 1X74A 2VCYA 2ZUUA 1MP0A 3LUGA 4ARIA 1PIWA 1S3GA 5DNEA 2FDCA 4OTZA 3NC0C 2IEAA 3PGKA 5AJTA 1EFRA 2VPPA 3D1LA 1ONOA 4JJKA 3CX4A 4R31A 2CHFA 4XX0B 3TI9A 5IKMA 5LJLA 2FMFA 2YIMA 1JQJC 1QHFA 3U60B 3KU1A 2WB4A 4ZO4A 5BVGA 4PPQA 4LN1A 3KJFA 3EGIA 2F8TA 3QVTA 4UD2A 1EWTA 3LYUA 4LDZA 3JQEA 3GGGA 4AQDA 4OX9Y 1OXSC 3KNZA 1MIOA 4LECA 4E5MA 1SVWA 4HDNA 4F3KA 3OEHA 4BNNA 1L5FA 4NYJR 3H5IA 5EE9A 3VOAA 1ZWLA 1KKUA 2JLBA 2Y2UA 5J2TF 1Y1RA 5K0LA 5KX5B 1SD2A 3RR2A 3ITEA 4ZOLB 4AKIA 4ZCPA 2BJVA 2A0YA 1E3TA 3T4PA 3YASA 1JR4A 1B8PA 2PHZA 1SURA 4A36A 3VR2D 2AJBA 1IJFA 2IIBA 1KPHA 5FADA 2QROA 5IFKA 2OZLB 5CFRA 4ZVTA 3E9YA 3EVTA 5I9MA 1AN9A 4DIMA 1EZZA 5IT4A 4LMAA 3M89A 3O8QA 3OZVA 5DNDA 1U7DA 1Q3TA 4Y2JA 1TIKA 4R41A 4EEZA 1MORA 1CUDA 3LBIA 4P4TA 1R0YA 2DWUA 4B40A 2Q46A 4NAUA 2PQ6A 1HT1E 2ATCA 1FQOA 4POOA 4RQBA 3P9PA 4QOHA 5CP8A 4W9MC 2ZG6A 5BYBA 5AK6A 2BCJQ 3M6WA 1YL7A 2QE6A 3T95A 3ZHYA 1TJ4A 1ULTA 2VTKA 3AB8A 3BERA 3ZGZA 3FKQA 4UCWA 4JVMA 3BJEA 2B82A 1ZJ4A 4CR8A 1PQ4A 4ZYXA 3R5KA 4TTQA 3TX6A 4YJGB 4RTPA 4TZ6A 2CNWA 1HKUA 1N4DA 1XXHA 3IQXA 4I2VA 2OQRA 2XOKA 4AKSA 2Y0PA 4X63A 3UH0A 4C0BA 1FUEA 1BWRA 5A71A 4RVNA 2KBEA 1V8DA 3HN2A 4YQEA 3CEAA 3PEEA 4AUEA 5L3RA 5G3YA 2I9PA 3DEJA 2I55A 3C1TA 1YB5A 3QU9A 1E5VA 4ZYLA 2QK4A 5A4DA 1HC7A 3WOHA 2PGOA 5EI5A 2KM1A 5A0FA 5FDFA 4C9BA 3EMKA 1K1EA 4YDSA 4Z3OA 2GBLA 1RLTA 1Y5MA 1DPFA 3FTFA 4DQVA 4G0NA 4Q16A 2X42A 3C7KA 1PZNA 1SUSA 1NW8A 3KXKA 4KXYA 1SXPA 4IIJB 5BSWA 3BXEA 4YLGA 5IBCA 4HAYA 5BQ5A 4N7JA 1HDZA 2EJWA 2QR2A 3BXOA 4X9XA 3T06B 5T4FA 4IXWA 1ZU4A 1R9JA 2V7QD 3E5MA 4HNQA 2Q5IA 3DVSX 1N2CB 4LDNA 4CIAA 1JFTA 3F2VA 2D1QA 3OWHA 2IZ7A 1YZKA 1AKWA 2PL5A 2X7JA 2GEJA 3B7PA 2JARA 5IM5A 3QIAA 3BB1A 1VL0A 4EDHA 2DOKA 1F51E 2OAQ1 2ZIGA 4WOJA 2BE9A 5TGTA 2VAPA 3LQRA 1N6NA 2QLLA 3FWKA 3O4FA 3PCTA 4P84A 4TM8A 3RWMB 4ILEA 3MT9A 3D3EA 3G2QA 2CUNA 5DJ5A 3ER8A 4A92A 1E2QA 3LDGA 4HTFA 1JECA 4MQ6A 3AONB 2Q45A 3ZV5A 3ZU3A 5CFNA 3COPA 2P11A 2B6NA 3HE3A 3O8OA 4MPTA 2XT9A 3U56A 4QFCA 3QTLA 3ECAA 3DUFA 4Y2XA 3B13B 5FUYA 5T3UA 1IQUA 2GAIA 3P4XA 1ULZA 1NP6A 2RHDA 4TQAA 5SY9A 3B1XA 5JXJA 1A8HA 3NNSA 5JAMA 4J4BA 3GDHA 4JH0A 4Z8YA 3FFBA 3O73A 4XEHA 1JHAA 5DLYA 5EHQA 4TROA 2IIQA 3EVNA 4JB8A 4KX3A 1R6BX 3AQIA 3CKKA 4YRDA 3PFKA 1I2ZA 4GP7A 2VPYA 1HRDA 1RWKA 4PQGA 5DCYA 4H0NA 4DPLA 4BLWA 2DM6A 4YUVA 3I5YA 1CJTC 2QUKA 3BCSA 1OI2A 4YACA 4I8XA 2I1VB 4A6EA 3B70A 4BFUA 5A4KA 1YVDA 1R3DA 4DM7A 3THXA 5FFMA 1T8PA 3TB4A 4DQUA 4JC8A 2J3QA 2AX4A 4KDEA 5EVCA 2UXCB 1LH0A 3B1FA 3AL2A 2BJWA 1X7ZB 4DCGA 1YNOA 3BDVA 4RAQA 5HR5A 3O93A 1RAAA 3PUHA 3PB3A 2ZFUA 4OB8A 4AZSA 2ZPUA 2Y68A 3GV0A 4CCSA 5TSDA 2WWFA 2MJLA 3L7KA 4P3KA 4RVUA 4U7HA 2GA9A 1XD2B 4QYIB 2F3PA 4OHVA 4RMHA 2DQ4A 3UMGA 5AVZA 1DELA 1OJ7A 1MX3A 1N2ZA 1PJZA 1T5DX 1Z8DA 3DMGA 3FKSA 5FR2A 5BYKA 1K3TA 3NRCA 1M10A 1UEXC 2I8CA 3B6IA 1KEZA 3V42A 4AP6A 1O96A 2DQKA 4KUHA 3QLTA 2XTMA 1AZWA 4OHRA 3IX7A 3K2EA 4ZI2A 1NOJA 4MV3A 2BFDB 5EMJA 1XTTA 1QHHB 2O8DA 2Z2JA 4FFOA 5H3HA 1Q12A 2YXDA 4LBWA 4DWVA 4D46A 4RSRA 4YROA 3P7MA 3R77A 3DAGA 4KSBA 1OH5A 1ZWKA 1YKGA 3H2ZA 3T0IA 2C99A 2KB0A 2Q2VA 2Q0QA 3M9WA 3PPIA 2PAAA 3HL0A 2J5QA 4YLYA 3MBIA 5I4KA 1DOZA 4ZK2A 4TSFA 1PTJA 2RGGA 5TNXA 5GJBA 4TYPA 1Q77A 2Y1DA 2J6IA 3D3KA 1ISHA 1FK8A 3WJ2A 1CJCA 4Z3DA 4AC9A 2G1PA 1D4OA 2WYWA 5T57A 2VEDA 1HNXB 1NVGA 4HP8A 3JQFC 2IYUA 1I1HA 3PLRA 2AMJA 1NGSA 2QN9A 3D3JA 3IUMA 1I36A 3FLBA 4I4NA 5JRZA 3QU4A 4DEYA 5EJIA 3I34X 1Y8ZA 1ZGZA 1MHTA 1TK9A 1N3LA 1SWWA 2YVLA 4XLZA 1B15A 2R00A 3A3OA 1QIHA 2H08A 3IPCA 4HWPA 1G9TA 2OQVA 3WJAA 1E7MA 1ZRHA 3PGXA 1Q1QA 3N2GA 3UJAA 3H9EO 3U44B 4NFSA 5C51B 4P4NA 2B5VA 2ATXA 1G3QA 1WCIB 2OORC 5TMDA 4YJ2A 3S1SA 1P4GA 2V7GA 4TTAA 2VHYA 1YTUA 3HC7A 1DIOB 3ZW8A 4P98A 1L3IA 4A0GA 4WADA 5FBHA 2IOFK 3CRRA 3ICOA 4HV4A 3DBHB 4AY3A 2V6MA 5IAJA 1UXOA 4PSAA 1DCKA 2XMQA 2YV3A 1CUIA 3DXZA 3GN2A 4JSRA 1SHUX 2EZUA 1C9EA 2VDPB 1KP9A 4UHFA 2C88A 1A2OA 2CVOA 1P72A 2LUOA 3EA0A 2I9KA 5DWQA 1NFRA 5D6NA 4QYTA 2MDTA 1G4AE 4U3JB 1EDEA 4QSMA 1LX6A 4A0FA 1ST2A 5HS4A 1RHQA 1ULUA 2P2LA 3KLPX 4JX9A 2Q4BA 3LT0A 4GPZA 2GB4A 4MVYA 1DFHA 2OYSA 2HYIC 1IOLA 3PDHA 4XASA 3WL4A 3F78A 5FUWA 3K2QA 4R2JA 4U0JA 2IYPA 3I2KA 5IJAA 1JR6A 4IKPA 1XZPA 1BYIA 1LLCA 1ODIA 3CZ4A 1NJ1A 4G01B 4GDMA 4HRXA 1KI9A 4RWZA 5FUXA 4WXMA 3EQ6A 5AVKA 2XHEA 1JH9A 2G70A 3DCNA 1L7PA 3IHWA 1JI3A 3ML1A 5H16A 1WB4A 3UK2A 1NVUQ 2RCNA 2QN3A 1CV2A 4K6FA 3SHOA 4MR7B 3REFA 5G0WA 1U94A 3ZUPA 1XDDA 4R1QA 4KFCA 3PEYA 1DFGA 3FI9A 3UHFA 3SHWA 1QQAA 5B3JC 4AXXA 4QOIA 4I08A 5F4BA 5AKGA 4FU0A 5K3FB 4IDBA 1TJNA 1KL7A 5U1PA 3WMGA 2WKRA 1FXWF 2RGEA 2ZXFA 4L22A 5HDQA 3FNGA 5HKKD 1NVFA 1FUYB 5IZCA 1V7QA 2WUEA 4ZC1A 4M8SA 5LDGA 1UMCB 2F3QA 4FLEA 3GJRA 4ZQEA 4PLYA 7YASA 2FFBA 2C2KA 1M0SA 3F3YA 2QJFA 1V5IA 1S2MA 2Q0SA 3IDQA 1MBZA 2PH1A 1S3FA 3LPCA 3G7SA 1V2HE 3H19A 5DYNA 3TKLA 3W04A 5LPNA 5KKCA 2IEDA 3B2EA 2SICE 1A98A 2PDAA 3EVAA 3GBSA 4HB2A 1RXIA 3TW0A 1B4DA 3DPUA 4ALKA 1THMA 4DZRA 3MW8A 4N5MA 3TSYA 1NWHA 4TGLA 4BIMA 3AO0B 3FKSD 2NU9B 3DP9A 5KNLA 1HGXA 1JLMA 3AY7A 4JBXA 4EQ6B 5TGZA 1HE8B 3HA3A 5SYMA 3DAOA 2QU7A 3FW1A 1Z37A 1MXHA 1T9BA 1KTVA 3NBZC 1UDRA 1M34E 4P8RA 6PFKA 2HW8A 2QV0A 4V3BA 4LHYA 4KCGA 1LPAB 1MUUA 2OHFA 4XYLA 4YO7A 3O3NB 5FOTA 5BOVA 3MN1A 1E6CA 4KO3S 3OIDA 4M9CA 4PXAA 3IO3A 1LUAA 1TLTA 5DXFA 1EUCB 1L4UA 1ZNZA 2IC5A 3E9DA 4FINA 3RVRA 3TN7A 4N03A 4UDNA 5TGDA 1ZHFA 2O2IA 1MX1A 1QM5A 3OM9A 4L15A 4FGLA 3PD0A 1K27A 1KRHA 2AH5A 4QUAA 3STXA 5IBPA 3FNBA 4W5RA 4F1WA 4MUGA 4CUJA 1GFIA 3FI0A 4PSKA 4XVRA 3HCBA 1SOVA 2MMCA 1XHFA 4ZCQA 4IIYA 4FTWA 3T94A 2IY8A 5KWIA 3A9CA 4Y2YA 3KLBA 2Z08A 4MVJA 1RYMA 3LF2A 3W6UA 1UXGA 3N3BC 1JEYB 2E49A 1RBYA 3LKZA 5HKOA 1O57A 2P30A 2VF8A 1RD4A 1ZUHA 1T6XA 3E9NA 3HN7A 4YRLA 5CX4A 2PUJA 3BK2A 3CWCA 3C24A 3KYBA 3TXYA 3I62A 2R87A 2EQAA 5DHUA 5JQWA 3D6NB 1FTYA 1YMVA 1AC5A 1DOAA 3JATA 4MS4A 3ZIAA 3HP7A 3ZHCA 3CLHA 3CX8A 3LE8A 3WIUA 2NU8B 1PV1A 1BFKA 4HNSA 4B3RB 5AW0A 4N4AA 1B6SA 1M1NB 4P53A 4YRKA 5CA1F 4NZNA 2FMTA 4M1OA 4D8XA 5MDHA 2GM5A 4XPIA 4XSHA 4R9VA 3GWZA 2FWNA 1J42A 2W2TA 1XCBA 5ITWA 3VKHA 1W4RA 3ESYA 4JJFA 5JSKA 3H1FA 4COKA 3DR5A 1HG0A 4OU4A 4W5WA 1RAFA 2BEUB 1I2CA 2WHXA 4MIOA 3CNNA 4NWIA 4QG7A 5JJIA 3B8EA 4OBWA 3UJHA 1MVOA 2DB3A 1O77A 5F1OA 1XCMA 3A6JA 4UTZA 2BMWA