4H0EA

Crystal structure of mutant orr3 in complex with ntd of arar
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
70
structure length
70
Chain Sequence
EFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spacing between core recognition motifs determines relative orientation of AraR monomers on bipartite operators.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
molecule keywords Arabinose metabolism transcriptional repressor
total genus 20
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4h0eA00
2VBYA 4EMSA 1XDUA 4D0PA 4ZZDA 4BNCA 2KJCA 4Q48A 4EJTA 1SD6A 2M5WA 4GCVA 1O3RA 1YS6A 4EM1A 1FLIA 4HZFA 3HOSA 4O5VA 1FP1D 4LG0A 5E1ZB 4HYEA 3M7GA 4ASNA 2DQLA 3O6BB 5HLGA 5JVTA 3ERED 1DDNA 3SZTA 2WTEA 1LNWA 1ZRCA 1T38A 5K5RA 4GYGA 2PN6A 2ACJA 3KZZA 4HF2A 5A2QK 3KP7A 1SD5A 3ZMSA 5BPDA 1X3UA 1HQCA 2XRNA 2Q8KA 5F1RA 1A04A 1ON1A 3G3ZA 5ILVA 4RAZA 2UXXA 3PFIA 1C0WA 5LRSA 5FLXK 1IRFA 1MJAA 3GWZA 2FA5A 1T6SA 4WX9A 4KT5C 2JT1A 2FBIA 4M72A 1HW5A 5TRDA 3V7RA 5HDKA 2Y48A 4E70A 2EV5A 3F3XA 4AIJA 2XAHA 1FBQA 1F9NA 4I02A 3Q5FA 2LF7A 3DPLC 3R0JA 1SD4A 2L4AA 3GFLA 3E6BA 2ZKZA 2NAZA 2Q2EA 1ZG3A 2Z33A 1TW2A 4N9HA 3JTGA 1J0RA 4ESFA 2A6EF 3MCZA 2L54A 3GEZA 1GXPA 4RGUA 5D4SA 3VODA 2W85A 3IC7A 1UHWA 2VXZA 1SAXA 1FYKA 1G3WA 1HKTA 2EV6A 3ZMVA 1I6XA 2V9VA 2RKHA 4WXHA 2DW4A 1H9GA 4FX0A 1J59A 4WF2A 4CHUA 1FP2A 1U3EM 2DAOA 4K2EA 4JQFA 4HDVA 1TBXA 3BWGA 5JR3A 2VBWA 4PZJA 1EH7A 4A6EA 2V6CA 3TGNA 4KN4X 2DTRA 1R5GA 2GA2A 4RB2C 2H09A 1ZLKA 3FMSA 2P6TA 2WC2A 3BJAA 2A3SA 5H6RA 2F5FA 1U5TC 3IKVA 1Y0UA 2FNAA 2O03A 4EM0B 5LRRA 1XN7A 3WTZA 3J81K 4A0XA 5HS8A 3ZQ7A 1HSTA 1O7LA 2FBHA 3LA2A 1TNTA 2V1UA 1JHFA 3BJOA 2BGCA 2CWEA 1S3JA 2PG4A 2A69F 1BC8C 2HYFA 3ZMTA 2QQAA 1FY7A 4P96A 4MHGA 1GVJA 3BPVA 1Z05A 3HRMA 4EQQA 3KZYA 2NRAC 4AVPA 2CFXA 3LSTA 3I71A 1UFMA 4LK0F 1R1UA 4GGGA 2KRFA 3WE3A 1R58A 1EV7A 2FMYA 2Q0OA 3QU3A 1S6LA 1UB9A 4BXUA 1HSJA 3MZYA 4AIKA 3H3ZA 4U0YA 1WKMA 4UV8A 5FFXA 5K1YA 3KLOA 3L9FA 3M8FA 5HLIA 4U0WA 2H6BA 2UWMA 2H6CA 5FLXZ 2W24A 4ZZLA 4M71A 1D3YA 4XSXF 3I54A 1BBYA 5HDGA 5AONA 4LFUA 3M8EA 5J8CA 2OQRA 2KKOA 1EH6A 1G3TA 3MZHA 1KA8A 1W7PD 3T5XA 2MLKA 4I2OA 2EK5A 4LB6B 1ON2A 1J5YA 1WRJA 4CXFA 4P9FA 4NQWA 1Q1HA 1I5ZA 1SMYF 5BQTA 1Z7UA 2MC3A 3RYPA 3DKWA 3F6OA 4HAMA 4S04A 4CDGA 3C1DA 2WWYA 1PP7U 2KIUA 5FGMA 2BYVE 4G9YA 4WXDA 4L0YB 2VONA 4ENKA 1FOKA 2JRTA 3HRTA 4KNYA 2QUFA 5EEHA 2IT0A 4ENJA 1XDSA 3L7WA 1S8NA 2P7CB 2EA2A 2W57A 1ZGAA 3LA7A 2L3DA 3RPQA 1KGSA 4I0AA 2XIGA 5F64A 1MJBA 1BIAA 1BOAA 3GFIA 1B9NA 3AAFA 5L3FA 5D6EA 2RDPA 1U78A 4CZZA 4L0ZB 3ISPA 1TTYA 3EDPA 3ULQB 1BI1A 1J75A 4P55A 1IXSB 3H92A 4HX7A 1OMIA 1IN6A 2STTA 1UHMA 1QNTA 2IPQX 2FE3A 2HYGD 3GVAA 2EFPA 1KU3A 5ICGA 5LBQA 2DLLA 4ETSA 1XSVA 4O3MA 3FZVA 4OU0A 2FXAA 2COMA 2H27A 1KU2A 5ILUA 3M1EA 4LG0B 2QQ9A 2Z99A 3P9KA 3WU0A 1ULYA 3RJPA 5LHHA 3HSFA 1ZHFA 3I53A 5L3EA 2XAJA 4G7HF 2YPRA 3F72A 3N4MA 2GWRA 3WGIA 4MEXF 2YU3A 1FBUA 2R3SA 2D1VA 2OBPA 3KEOA 1K78A 3ECOA 5H20A 3V7CA 1CF7A 3KP3A 1R7JA 3WTWC 2P4WA 2MBFA 3REOA 3WGGA 2VODA 3QPTA 3RDIA 1ODDA 3E6MA 2MH9A 5CVJA 3KP6A 3CUQA 4A0YA 4OMZA 3QP6A 4HF0A 2ETHA 1ZYRF 4MGRA 3CUQB 5HDNA 1YW8A 5K5QA 5E17F 2R7DA 2P5VA 2FF4A 3DQVC 1G4DA 4UUVA 1YO5C 2P5LC 2Y0MA 1K78B 2GA1A 2R7FA 4M9SA 1P6RA 3ECHA 3IWFA 2NNYA 3I59B 3WU1B 4UHTA 4Y15A 2QENA 2HEOA 1HW1A 2HTSA 2RGVA 4KN7X 2NYXA 2ZCWA 4JK1X 5D5VB 4YFXF 5D6FA 5E8GA 4PGGA 2PEXA 4LLGF 3DEUA 3GZ5A 1B9MA 4Z2YA 1D5VA 1OYIA 2IRFG 4RGXA 1CF7B 3TOBA 2QM3A 3F8CA 3LWFA 1FPQA 3TQNA 2Z5UA 4LK1F 2VC1A 4HLYA 2DPDA 1G3SA 2JPBA 3WODF 4EJWA 3RKXA 1LEAA 4BH9A 4EJOA 3JW4A 1ZH5A 3PQJA 4ZYDA 4RB3C 1IUYA 1L3LA 1HBXG 1BN5A 4B8XA 2QZ8A 3KEQA 1V3FA 2D45A 3JAMK 3HTSB 2EA4A 3CTAA 1DP7P 4RGRA 1FT9A 5DCMB 1WWXA 4IVNA 3RKYA 5ED4A 3RIRA 4RAYA 4BHCA 4M9XA 2D1HA 5BMZA 2GIVA 4HDUA 4P5OA 1XMKA 4DNCA 2VT2A 4N0BA 3ZN1A 1T0FA 4OINF 4CGZA 5ICFA 4LMYA 4MTEA 5DCFA 4CO8A 1O3SA 1REPC 2V1DA 1KQ8A 3HYIA 4KA4A 1B4AA 2K27A 5CVVA 3MEXA 5DV5A 2XKPA 1U5TA 1KQ9A 1ZLJA 1TW3A 2P5KA 2DK5A 1FX7A 1BC7C 1RZ4A 3ML6A 1IN7A 4PDKA 5IT9K 2AS5F 5ILSA 4NB5A 1K79A 2AXLA 3TO9A 5ICEA 3GYHX 4G6QA 4HLXA 1S7AA 2ESNA 1ZREA 2M8EA 1Z1DA 3LAPA 2VOPA 2KIMA 4EJUA 3BPXA 1AOYA 5E18F 3JSPA 3RYRA 3K0LA 1Z9CA 2E7WA 2LKPA 3L2CA 2Y75A 1I1GA 1XGOA 3QU6A 4HV6A 4M74A 3DXJF 4U88A 2NNNA 1K6OA 3PQKA 3R4KA 3F8MA 1W7PB 3CLOA 4IXAA 3WTXC 2IVMA 5CYVA 4QLCU 2A07F 1HKSA 3TOAA 2CO5A 2QBYB 2QQBA 2PLYA 1R5HA 2HR3A 1JGSA 4KYWA 1SFXA 6PAXA 1XCVA 2ZXJA 1JHHA 2QBYA 3NEUA 3JAMZ 1LEBA 3B73A 5DUIA 2IA1A 3GZ6A 2JSCA 3KLNA 3GFMA 4KICA 2QYOA 2J5OA 4LD5A 3KCCA 2A68F 3F22A 1BM9A 4S05A 5IT9Z 2JZYA 4KUMA 1T39A 2VE8A 5HS7A 4ESBA 2HKOA 3BP8A 2OU2A 2HWVA 4O6JA 2PJPA 4QWQA 3L00A 2V1XA 4XRFA 4A5NA 1ZG1A 3KP4A 3MFKA 4HX4A 3GLXA 2CGPA 3V8JA 2PBIA 4HX8A 1MD0A 3RPUA 1H0MA 5D5XB 3F8FA 2OD5A 2A5YB 2RVCA 2VE9A 2G7UA 4CICA 3T0YA 5TJJA 5DEQA 4GYIA 1YW7A 1I27A 1RUOA 1S7OA 1O3TA 1V4RA 5E20A 2IA2A 3DFGA 2W25A 3FHZA 2KIFA 1RIOH 2QVOA 4UVCA 3V7SA 4HF1A 2PI0A 5DD4A 4ESJA 3J81Z 2OZ6A 4I98B 5BPIA 2XAQA 2O6GE 2D2WA 2FMLA 1J9IA 1KYZA 1KU9A 3FXUA 2FU4A 1RI7A 2EFQA 2K02A 1W7PA 3CO7C 4M6YA 1WQ2A 3SHFA 4LB5A 4G94A 4EM2A 4NHJA 4U0VA 2ZFWA 4RB1A 2O8XA 2DFIA 4KMUX 1XSDA 1IN5A 2ZBKA 3FX3A 3S2WA 1JXSA 4UVAA 4AD9A 4WWCA 1RNLA 4FHTA 4UNOA 3BROA 3HHGA 5J8FA 3KETA 2LNBA 2HOEA 1VTNC 5EEGA 1BI3A 2GZWA 4IHTA 4LGWA 4MQ9F 3KE2A 1PUEE 5FB2A 3U2RA 3U9GA 2LF8A 2HQNA 2PMHA 3VEPA 4YFNF 3IRRA 1K7AA 1Z91A 4UXNA 1FSEA 2KJBA 3WTTC 3V4GA 1SD7A 3F23A 4ZYGA 1KU7A 5AIQA 4ENNA 1J2XA 5FO5A 4A12A 4OOIA 2IW5A 1ZARA 1YIOA 1GXQA 1W5TA 2YX7A 1YLFA 1ONVA 3HSRA 4LJZF 2K86A 4OIPF 3I4PA 3HOTA 3Q9VA 5D4RA 4B09A 4UVBA 5DCMA 3K2ZA 2LSOA 4IHSA 5K5OA 4R79A 1YYVA 2FQ3A 3BY6A 5KK1A 2BEOA 1LJ9A 3LAJA 2ELHA 2XAFA 1U6GA 4L5IA 2IA0A 3IL2A 2ZMEB 5LHIA 1EH8A 1Z6RA 1MDMB 3FF5A 3C18A 2JPCA 3FM5A 3VFZA 3HSEA 5FFZA 3K1MA 4I09A 4FT8A 2LDUA 2OQGA 3E6DA 4YG2F 4M73A 3K9TA 4L9TA 4DQ2A 3I5UA 1D8KA 3GFJA 3FXQA 4Y13A 4ZYHA 2IJLA 4UV9A 1FSHA 2DK8A 2ISYA 4AWXB 2FNPA 4GXOA 3TDZC 2J5PA 4H0EA 3RTRA 1FNNA 1OYYA 4Y17A 2HDCA 5LGTA 3CJNA 4IPAA 1ZN2A 2EFWA 5IT3A 5HS9A 4A0ZA 1HXDA 3SZPA 5HLHA 2CG4A 3IKTA 3E5QA 2OAZA 4Q47A 3GUDA 5H6QA 1P4AA 2FEZA 1S29A 4IRHA 2DU9A 4L9VA 2XKOA 2RNJA 4HV5A 4BQAA 4N9IA 2Z3YA 1MJ9A 1W5SA 2DT5A 1WI9A 2YSRA 4BHBA 2PQ8A 4KIGA 3O3KA 3G73A 3F8NA 3CUQC 2F5EA 1MGTA 2CQKA 3O2PE 1HKQA 3BJ6A 4R1HA 1BI2A 3V8KA 3J80Z 1LVAA 3ROUA 2F2EA 1CGPA 2XV4S 3ZMDA 3BDDA 1ZGJA 5KVRA 3GX4X 1F4KA 1AWCA 4OIOF 5J6XA 5L3DA 2M30A 1TQIA 4P9UA 3EYYA 2E1NA 1XSXA 5LEJA 1LB2A 4XLPF 3QPHA 4IF4A 3OOPA 3WE2A 3JSOA 1IRGA 3M9AA 5F6FA 2XUBA 2H94A 5L3CA 3DV8A 2P6SA 4RGSA 5FD6A 3IWZA 1P4WA 4R8HA 1B1BA 4EV0A 4RS8A 1QZZA 3CO6C 1LDKB 4MQVA 2C6YA 2GXGA 3ABTA 4KMFA 1B59A 2ESHA 3CUOA 1R22A 1HW2A 3ZPLA 3HIFA 2P8TA 3P9CA 3D0SA 1GHCA 2W84A 2DPUA 4MEYF 5CLSA 2FOKA 1U2WA 5D8LB 4WCGA 3QP5A 1QGPA 1YTYA 3TO6A 2STWA 4AIHA 1R36A 5E1WA 3W6KB 3J7AO 3WGHA 2O3FA 3I59A 1FC3A 2DBBA 2E1CA 4U7BA 4L5JA 1SMTA 1DPUA 1YFHA 5CVUA 4GO1A 1IZ1A 2BBYA 2ZMEA 2NS0A 3ZN0A 2K4JA 4ENMA 4LLLA 1QBJA 4G6DA 2OZUA 1XGMA 1Z6TA 3LQQA 1XMAA 1XCBA 3KP5A 2MD5A 1RUNA 4XLNF 3FXRA 2PFBA 3DP7A 3MQ0A 1P4XA 2M45A 3VOEA 3B02A 5HVQC 2HS5A 4BHPA 4ON0A 2WV0A 2VT3A 1QO0D 4YFKF 1IXRC 2CW0F 4ZH4F 1T2KA 3I0TA 3FM3A 1OYWA 4FX4A 2RV8A 2B0LA 2HTJA 3E3VA 3GXOA 2A61A 4I01A 3V8LA 4G8XA 2ISZA 4PGHA 1ZRFA 1BIBA 5LEKA 1U8RA 3SQNA 4WXCA 1H9TA 3WTVC 2HGCA 4PCQA 2XHKA 1OR7A 2VN2A 1SFUA 2HFHA 3GO5A 3T1BA 1MDMA 4WK8F 2K4BA 2X4HA 2L01A 1QQIA 5JHUA 3COAC 4IRGA 4KIBA 1IN8A 5L3BA 2M1BA 3GF2A 3HHHA 2EB7A 4M6XA 3F6VA 3T8RA 3ZMUA 4U7DA 1ZRDA 2VBZA 1USSA 3U1DA 2O0YA 3H3UA 3WTYC 3C3WA 1ZAOA 1O7FA 3SXYA 3Q9SA 4EJVA 1IF1A 2XGXA 1JE8A 1U5TB 1FZPB 1OPCA 1F5TA 2VBXA 4OMYA 2MA3A 5LGNA 2QLZA 5BOXA 1XB4A 1SFEA 5DD8A 2ZNZA 2UZKA 2XAGA 4L9NA 2DQRA 5LHGA 2GQQA 3FWEA 3E6CC 2P7VB 1FBSA 3ABUA 5D8KB 2IP2A 1I1SA 3BOQA 4HOBA 3RKWA 3KFWX 3R61A 2EFNA 3EQLF 3QOPA 4ZYEA 4MTDA 1BJAA 2RN7A 3MWMA 1QPMA 3D5LA 1QZYA 1LQ1A 2RC4A 5ICCA 2L02A 3DPTA 2PMUA 5ERIA 3FMRA 3ZP5A 1OKRA 1KQ0A 1USTA 1E2XA 2ZO4A 3WG9A 3HUGA 4HQMA 2HKXA 5CJ9A 2XASA 1IW7F 2YX4A 3ELKA 2YR2A 3HRUA 1FYMA 2ADUA 2GAUA 3J80K 2XVCA 1NHAA 5DYMA 3DF8A 1MZBA 3T8TA 2X0LA 1STZA 3EYIA 2CSOA 2MLGA 2F5DA 5CVRA 1XD7A 4KDPA 1FWZA 1PP8F 3JTHA 1YW9A 5DUKA 1BI0A 2UXNA 1IXCA 2TDXA 4KIFA 1F1ZA 1R23A 2JTVA 3IHUA 1B6AA 4EVIA 5HOOA 4MNUA 2FBKA 4BAYA 2G7HA 1W4MA 3L09A 2G9WA 2BE5F 2RQPA 4A5MA 2VOOA 1L0OC 1KYWA 1TQMA 2EJRA 4BYYA 2QWWA 4G7OF 4CYDA 3NQOA 4IRIA 2MH2A 3P7NA 1TLHB 5A2QZ 1D8JA 2HQRA 3HRSA 4L18B 4EGYA 5DDGA 2VC0A 2E7XA 4HBLA 2V79A 1IN4A 3E5UA 3HTUA 3I58A 3RI4A 4HA8A 2EV0A 3IRQA 5LLQA 2F5CA 1PDNC 2DI3A 1T98A 3E5XA 4Q4ZF 5L3GA 3MAJA 4Q5SF 4A6DA 3C7JA 1P92A 5JFRA 3TKYA 5FD5A 2O61A 2FRHA 5JI6A 2EWNA 4EGZA 1XGSA 2EFOA 1DPRA 3SFZA 2ZJ2A 4L9JA 4A2UA 2Z9OA 5BS6A 3WTSC 1O3QA 4XBFA 4I7HA 3ZMZA 1WSUA 1G3YA 2L4MA 4LLNA 2DO7A 1R1TA 4OIRF 3R60A 5E1XA 1LDDA 1P2FA 3GW2A 3E97A 2HZTA 5LGUA 1O57A 3LQRA 3QAHA 1E17A 3I64A 1G6NA 3OV8A 2K7LA 4F7ZA 3P9IA 4XSZF 3WTUC 1R00A 4I0BA 4HQEA 4IJAA 2BV6A 2CYYA 4M9ZA 3LA3A 3F21A 1YG2A 2ZNYA 3F8BA 3TDUC 3BZ6A 4YIIA 3K69A 3KP2A 4KFCA 2XROA 1MKMA 2FSWA 1YQAA 1TNSA 3NRVA 3W6JB 2OA4A 3QRFF 1ZG5A 2GXBA 3TO7A 3R6SA 1R1VA 1IAWA 3R0AA 5AIPA 4HW0A 3LFKA 5D5WB 1XGNA 4YIFA 3EUHA 3K1NA 1UCRA 4OIQF 5CVIA 3N97A 2M87A 4G7ZF 3CDHA 1YS7A 1FYLA 3K1PA 1TQPA 3EETA 1J7KA 4TV7A 3FMQA 3VB2A 5D5UB 1DUXC 4JBAA 1LDJA 4RB0A 2A6HF 5E8IA
chains in the Genus database with same CATH superfamily
2ECBA 2BHYA 2VBYA 4EMSA 1XDUA 1LE8B 2E35A 4MFEA 5E79C 3J7YJ 2P81A 4D0PA 4ZZDA 2OC6A 4IKFA 4BNCA 1ETQA 2DMNA 1UELB 2EQRA 2KJCA 3EUHC 4Q48A 4BEHB 3HM5A 2CQXA 1D1CA 2LVSA 3MKWB 1V54H 4EJTA 1SD6A 1Y8QB 2M5WA 4GCVA 1O3RA 4GRIA 1YS6A 4EM1A 1FLIA 4HZFA 2IGOA 3DTEA 1Z0XA 3HOSA 4O5VA 4BXFA 1FP1D 2QGUA 4LG0A 4AC0A 5E1ZB 4HYEA 3M7GA 3GCMA 4ASNA 3PO3J 2DQLA 3J7ZI 3FK7A 2A05A 3O6BB 2BVMA 4CYCB 1AKHB 3TP0A 5HLGA 3OMYA 5JVTA 3ERED 1H8AC 4FTHA 1QHGA 1I3AA 1DDNA 3SZTA 1X3ZB 2WTEA 1LNWA 1ZRCA 5EEAA 1OCOH 1T38A 5K5RA 1VQKI 4GYGA 1Y39A 3DTIA 2PN6A 2X1EA 3KZZA 2ACJA 2L9VA 2MABA 4HF2A 4EEFG 4YELA 3ASNH 5A2QK 3KP7A 3G6EI 5M5WJ 4X6AJ 1ERDA 4MO7A 1SD5A 3ZMSA 2DOFA 4A3CJ 5BPDA 3S14J 1X3UA 2KP6A 1HQCA 2XRNA 2Q8KA 2QEXI 1RR8C 1I6HJ 1X1BA 3G71I 4C9YA 2COBA 1A04A 5F1RA 1ON1A 3Q0UA 3G3ZA 5ILVA 4RAZA 3ZR8X 2HOSA 2UXXA 3PFIA 4IQJA 4C3IJ 1C0WA 1HCRA 5LRSA 1K4TA 5FLXK 1IRFA 3LSRA 3VYUB 1MJAA 1OCZH 3I4MJ 3GWZA 2VKHA 2FA5A 1EKEA 1T6SA 1VQ5I 2K9LA 4WX9A 4KT5C 2QA4I 2DA7A 2JT1A 4B3AA 1X19A 4F3QA 2FBIA 4BEHA 4A3IJ 1A6QA 2NOGA 1MMDA 4M72A 2IBDA 1HW5A 2QCOA 3G1OA 5TRDA 1WJCA 3V7RA 5KNLA 4FETA 4ZDPA 1RKTA 2WB1A 1NG7A 3OS1A 5HDKA 2MFZA 2Y48A 3JRFA 4E70A 2NS8A 1IRXA 2EV5A 2NVTJ 3F3XA 4AIJA 2XAHA 1FBQA 3RZOJ 2DODA 1F9NA 2DMTA 4ITVA 3OYIA 4I02A 3Q5FA 4PJJA 2LF7A 3ABLH 3DPLC 1Z3YA 3R0JA 2JJ7A 1MH4A 1SD4A 4NQWB 2L4AA 1IV6A 3GFLA 3TBIA 3E6BA 2ZKZA 4D5FA 2NAZA 1YIJI 2HNHA 2W48A 2GXAA 1SC7A 2HOTA 2Q2EA 2CFOA 2H1LA 2O5RA 2WY7Q 1ZG3A 3GLLA 2Z33A 1TW2A 4N9HA 2DMPA 1V55H 3JTGA 1J0RA 2XF5A 4ESFA 1OR7C 2A6EF 3MZ8A 4HRIA 4A3BJ 2KRHA 3GEZA 2L54A 2TRTA 3MCZA 1GXPA 2JA7J 3CMMA 2XGEA 3K4JA 2QKMB 4II3A 4RGUA 5D4SA 1SEUA 3VODA 2VL8A 4RDUA 4PUSA 2W85A 3IC7A 1X2NA 2DYSH 2R7OA 1UHWA 2VXZA 4AYBN 1SAXA 1FYKA 1G3WA 1FEXA 1HKTA 2EV6A 3ZMVA 1I6XA 2V9VA 2RKHA 4WXHA 2DW4A 1H9GA 3W2AA 4FX0A 1JUSA 1J59A 4D5CA 4WF2A 3BTIA 2LMDA 2HDDA 3UR3C 4CHUA 2L9SA 1D1BA 1WJ5A 1FP2A 5IOYA 3DPUA 1U3EM 1FTZA 2DAOA 4K2EA 2H8RA 4JQFA 4HDVA 1TBXA 4N4OB 5FRNA 3BWGA 5JR3A 2VBWA 4PZJA 1LFBA 1EH7A 4A6EA 2V6CA 3TGNA 2MG4A 3SEZA 3BR0A 2TCTA 4KN4X 4LOCA 2XB0X 2BHZA 1RR7A 2DTRA 1R5GA 2GA2A 4RB2C 2H09A 1WJFA 4I6ZA 1ZLKA 3FMSA 2ICWG 2P6TA 5KAFC 2WC2A 3CCSI 3CC2I 4F52A 3BJAA 4IX7A 2A3SA 5H6RA 2F5FA 2R0QC 1U5TC 3IKVA 1Y0UA 2FNAA 2O03A 1G59A 4EM0B 5LRRA 2R7QA 1XN7A 3V42A 3BTCA 3WTZA 5HLTA 4MIMA 1JT0A 3OYLA 3J81K 4W97A 5E3MA 4U87A 4XL9A 4A0XA 5HS8A 3ZQ7A 1HSTA 1O7LA 2FBHA 1Q1VA 3LA2A 1TNTA 1YX3A 2DT7B 2VQHA 2V1UA 1BOBA 2M8GX 1JHFA 4PFPA 3ZXSA 3BJOA 4B48A 5FKKA 1GLNA 3TW6A 2BGCA 2DA4A 2CWEA 3ZGKA 1S3JA 2PG4A 1X58A 3CCUI 2Y69H 2A69F 2KL4A 3DBHB 2HZDA 1BC8C 1APLC 3FXJA 2JQ7A 2HYFA 3ZMTA 2QQAA 3CC4I 3JRCA 1FY7A 3HPGA 5CQEA 1ZQ3P 3K4BA 1WJEA 3ERMA 4P96A 4MHGA 1GVJA 1A31A 3BPVA 5GTIC 2Z1DA 3VSLA 3H0DA 1Z05A 3HRMA 4EQQA 3KZYA 2NRAC 4AVPA 3L2UA 2CFXA 3LSTA 1V5GA 3I71A 1UFMA 5EF6A 3EUAA 3G4SI 3S32A 1QA6A 4LK0F 1M1EB 1R1UA 4GGGA 3SFIA 2KRFA 3WE3A 3U1KA 4DJAA 4OAZA 3HXLA 3GTMJ 2IAIA 1R58A 4CCJA 2M34A 2BY3A 1EV7A 2FMYA 1MSEC 1VQOI 3HOZJ 2Q0OA 3BTJA 3KIOA 2QF7A 4Y3OA 3QU3A 1S6LA 1UB9A 4BXUA 3OYEA 1HSJA 2CS3A 3MZYA 4AIKA 2LBFA 3BC8A 3H3ZA 5IYCJ 2VKVA 2DFFA 4U0YA 1WKMA 4UV8A 5FFXA 3KYLA 5K1YA 1YITI 3KLOA 3E7LA 4V2FA 3L9FA 3WHBA 3M07A 3M8FA 5HLIA 1HLVA 1JJ8C 4U0WA 5M5XJ 2H6BA 3OYMA 1MW7A 1ETWA 2IS1A 2H6CA 2UWMA 3CDLA 4B44A 5FLXZ 1Z3XA 4XRMA 2W24A 4ZZLA 4M71A 1D3YA 4XSXF 3RCOA 3OR2C 1LUJB 5IP7J 3I54A 3M3YJ 3DEEA 2DA1A 1BBYA 5HDGA 4KITB 5IPAA 2HVSA 5AONA 4LFUA 3M8EA 5J8CA 2OQRA 4LIUA 2QSHX 2KKOA 2Y31A 3ONQA 1EH6A 4NC8A 2LOOA 2L0KA 1MBEA 1X4OA 1G3TA 3IH2A 3MZHA 3OS2A 1KA8A 1W7PD 3LL7A 4AYBA 3T5XA 2MLKA 1DQUA 4ZYAA 2BW3B 4I2OA 2EK5A 2R7VA 3GBGA 1IO2A 1YI2I 4LB6B 1ON2A 2ID6A 1J5YA 1WRJA 4CXFA 3FBIB 4P9FA 4NQWA 3M1CA 3CCJI 1Q1HA 4XICA 1HF0A 1DGRM 1BJZA 3X2QH 1I5ZA 2MW8A 4M3GA 2NVQJ 1SMYF 5BQTA 2OUMA 4ZTFA 1Z7UA 2VPLA 1FIAA 2MC3A 4E6KG 3RYPA 3DKWA 1JKQC 3N05A 3LSGA 2L7KA 3F6OA 4HAMA 4S04A 4CDGA 3C1DA 1YHQI 1UMQA 2VPRA 2WWYA 2X85A 1PP7U 4M3FA 2KIUA 2CV1A 2KFDA 1POGA 5FGMA 1QHHD 2BYVE 4G9YA 4J01A 3AKZA 4WXDA 4L0YB 2VONA 4ENKA 3HRTA 2JN6A 2JRTA 2IXSA 1FOKA 2HXIA 4KNYA 2QUFA 5EEHA 1GV5A 2VXDA 3CCMI 2IT0A 1HDDC 1D1AA 4ENJA 1XDSA 1QRYA 3L7WA 1S8NA 1WFXA 2P7CB 2EA2A 2W57A 2DJIA 3M8JA 1ZGAA 3LA7A 2L3DA 3RPQA 3CMYA 3S2HJ 1KGSA 4I0AA 2XIGA 4NC7A 5F64A 3JRGA 1MJBA 2BW3A 1BIAA 1BOAA 3DEWA 5IP6A 1PYVA 3K4NA 3GFIA 1B9NA 1TL8A 3AAFA 1VQNI 5L3FA 4AIDA 5D6EA 2RDPA 3G2BA 1U78A 4CZZA 4L0ZB 5CQGA 3ISPA 1TTYA 3EDPA 1ZR2A 3ULQB 1BI1A 1D0XA 1J75A 4P55A 1IXSB 3H92A 4HX7A 1OMIA 5J1RA 1IN6A 2STTA 1UHMA 2V7FA 1QNTA 2IPQX 1T95A 2FE3A 2HYGD 3MVPA 3GVAA 1KU3A 2EFPA 2VIXA 3OR1C 5ICGA 5LBQA 2HDWA 3HKZA 3IP4B 2DLLA 4ETSA 5F08A 1XSVA 3H5RA 3CCVI 2XSDC 4O3MA 3FZVA 2M9HA 1YJWI 4OU0A 3RSNA 2FXAA 2COMA 5H2FC 2IEKA 2DOEA 3AL0B 2H27A 1KU2A 2VKEA 1WJAA 5ILUA 2R4GA 3M1EA 4LG0B 2QQ9A 2Z99A 4ZDOA 2LLKA 3P9KA 2BY1A 3WU0A 1VQPI 1ULYA 3RJPA 5LHHA 3HSFA 1ZHFA 3I53A 2DMUA 5L3EA 2XAJA 2DA6A 4G7HF 2YPRA 2CUEA 1BA5A 3F72A 3N4MA 2GWRA 2WBMA 3I9V2 2VKDA 3WGIA 2JA5J 4MEXF 2YU3A 1T08B 2EZHA 1UHSA 5DS9A 1FBUA 3DWLE 2E36A 2R3SA 4H4KC 3TMOA 2D1VA 2OBPA 3OYKA 1MNEA 1JKRC 3KEOA 2X1CA 1K78A 3ECOA 3WG7H 1TWAJ 3GTGJ 2E71A 1WVRA 5H20A 3V7CA 3WU2C 2F6CA 1TP4A 1CF7A 1SANA 3O8HA 2NVUB 3KP3A 1R7JA 2KZVA 3WTWC 2P4WA 2MGQA 2MBFA 3REOA 1Y6IA 3WGGA 2VODA 3QPTA 1WJDA 3RDIA 1ODDA 3AG1H 3E6MA 5JLWA 3PIPF 1BW5A 2MH9A 5CVJA 3KP6A 4I99C 3CUQA 4A0YA 5IOZA 3JCUC 4OMZA 3Q3SA 1NTCA 3QP6A 1K83J 4BKXA 2JK3A 2LFBA 4HF0A 1PVEA 2ETHA 2L7FP 1ZYRF 4MGRA 3D1NI 4ZTJA 3CQZJ 2DDAA 2V9KA 3CUQB 5HDNA 1K61A 1YW8A 1ETXA 1WZ2A 2XSJC 2WADA 5K5QA 5E17F 3S15J 2R7DA 2P5VA 2FF4A 2E2IJ 3DQVC 5GADJ 1G4DA 1BR1A 3ABMH 2Y0SA 4UUVA 1YO5C 2KIQA 1JT6A 2P5LC 4RM3A 2CQNA 1JTYA 1OCCH 1OCPA 2Y0MA 3AFHA 1K78B 1K4SA 2GA1A 2R7FA 4M9SA 4IHYA 1P6RA 3ECHA 2XF7A 3IWFA 2NNYA 3I59B 3EUKL 3Q0WA 4QPQA 3WU1B 4UHTA 3W6VA 3GTKJ 4Y15A 2QENA 1ENHA 2GOMA 2HEOA 1HC8A 1HW1A 2HTSA 1U9NA 2JA2A 2RGVA 3PM1A 4IHVA 1G8XA 3ZRGA 2OCCH 4KN7X 2NYXA 2ZCWA 4JK1X 5D5VB 4YFXF 1F43A 5D6FA 5E8GA 4PGGA 2PEXA 4JYKA 4LLGF 3DBRB 1FMWA 3DEUA 2VJJA 3EPZA 1B9MA 3GZ5A 4Z2YA 1D5VA 1OYIA 2IRFG 5EG0A 4RGXA 1CF7B 2V1NA 4BQOA 3W3CA 3TOBA 4BS9A 2QM3A 2HVQA 4BE2A 4EATA 3PNTA 4XRSA 2EZKA 3F8CA 2NVYJ 1D0YA 3LWFA 1XTAA 1BR2A 5B1BH 1FPQA 4E7SA 3OYBA 2DTZA 1JKPC 3TQNA 2Z5UA 4LK1F 2WA0A 3HOXJ 3FXOA 2VC1A 3BT9A 4HLYA 2DPDA 2HPMA 1G3SA 2DCEA 2JPBA 3WODF 4EJWA 1QZEA 3GMEA 3RKXA 1QU3A 4RBOA 1LEAA 3BG5A 4CCOA 4BH9A 2R7XA 2JA8J 3JRDA 5C4JJ 4EJOA 2DJNA 2M7BA 3S8PA 3JW4A 1ZH5A 4JX5A 4BUPA 3PQJA 4ZYDA 4RB3C 4XKWA 3RZDJ 5M3FJ 2VLAA 1IUYA 1L3LA 1HBXG 1VQ7I 3K4CA 1BN5A 4B8XA 2M4GA 2QZ8A 3KEQA 4FE7A 2R5ZA 1V3FA 3ZQIA 2D45A 3JAMK 3HTSB 2EA4A 3CTAA 1NH3A 1DP7P 4RGRA 3CMAI 1TZLA 1FT9A 5DCMB 1WPKA 2GOXB 2QQ8A 3QPSA 1WWXA 3CP8A 4IVNA 5F04A 3RKYA 5ED4A 4XNFA 3RIRA 1R9TJ 4RAYA 4BHCA 4M9XA 2D1HA 3DCFA 5BMZA 2FQ4A 2GIVA 4HDUA 2NXNB 2HYJA 3OYNA 1KZHA 2CRGA 4P5OA 4X1EA 2H8WA 1XC5A 1XMKA 1UAAA 4DNCA 2LP0A 2VT2A 1ACIA 4N0BA 2RREA 3ZN1A 1T0FA 4OINF 4CGZA 5ICFA 4LMYA 4MTEA 4YRVA 3HDDA 5DCFA 3OS0A 4CO8A 1O3SA 3BG3A 1I39A 1REPC 1I50J 2V1DA 1KQ8A 3HYIA 4KA4A 2EIMH 1B4AA 3HOWJ 1B8IB 1R4MB 2K27A 2M3AA 5CVVA 2CW8A 3BZKA 3MEXA 5DV5A 2VASA 2XKPA 3KYCB 1JGGA 3I3LA 3S1MJ 2OJED 1U5TA 2RNGA 3QYBA 3QYEA 3IH3A 4XKBA 1KQ9A 5F0HA 1TWCJ 1ZLJA 1J09A 1TW3A 2FUG2 2A6TA 2P5KA 2DK5A 1FX7A 1BC7C 1RKWA 1RZ4A 3ML6A 1EA3A 1IN7A 4PDKA 4A69C 5IT9K 3HC7A 2AS5F 5ILSA 3F9KA 4NB5A 1K79A 2WAQA 2AXLA 2CV2A 3TO9A 5KAIC 5ICEA 3GYHX 1MMSA 4G6QA 4HLXA 1T8IA 1SFKA 5J3LA 1S7AA 2ESNA 4D7MA 2M8EA 4PJ0C 1ZREA 4KISA 1Z1DA 2W7NA 2MC4A 3LAPA 1QPIA 2VOPA 4RMNA 1X1AA 1MBGA 1QVUA 1Y1VJ 2KIMA 4GFBA 4EJUA 3BPXA 1AOYA 5E18F 3JSPA 4XLFA 3RYRA 4A93J 2ZSHB 2NVXJ 3K0LA 1Z9CA 2B9SA 3PUBA 2ZSIB 2E7WA 2LKPA 1V5EA 3L2CA 2IS6A 5CPRB 1B72B 4A3KJ 2Y75A 1I1GA 1XGOA 2E1OA 3QU6A 4HV6A 4M74A 3FDYA 3DXJF 4I76A 4U88A 3OYAA 2NNNA 2WAEA 1WH7A 1ITYA 3FISA 2V4JC 1K6OA 3PQKA 3R4KA 3F8MA 1W7PB 3A03A 3CLOA 2LY9A 2X48A 4IXAA 3WTXC 2IVMA 5CYVA 1EJ9A 4QLCU 3GTPJ 3OL3A 2A07F 1HKSA 3TOAA 2CO5A 5HODA 1G2HA 3GZNB 2QBYB 1VQMI 3HGYA 3BQYA 2QQBA 2PLYA 4M3BA 1R5HA 2HR3A 1JGSA 4A3LJ 4KYWA 1SFXA 6PAXA 4CH7A 1XCVA 2ZXJA 4JP0A 1JHHA 3VDXA 4Y52J 4BBSJ 4HEA2 2LKSA 3L2QA 3HUGB 2LK2A 3QWLA 5K7FA 2QBYA 1Z21A 3NEUA 5KHDA 2XPVA 2B63J 4DYQA 3JAMZ 4QTRA 1LEBA 2X6XA 2YUSA 3HOVJ 1T56A 4BACA 1YJNI 3B73A 4DBQA 2LBFB 5DUIA 5LFAA 2IA1A 3GZ6A 2JSCA 2FJ1A 4RLQA 3KLNA 4L5EA 3GFMA 4KICA 5J1YA 2QYOA 2J5OA 3VWBA 4F91B 4LD5A 3CZ6A 2Y9YA 3KCCA 3VPRA 3LSPA 4UB6C 2A68F 2K5CA 3F22A 2JRMA 1BM9A 4S05A 2R7ZJ 2JZYA 5IT9Z 1OJLA 4KUMA 1T39A 2VE8A 2W4SA 3OOUA 5EGOB 5HS7A 2VI6A 4ESBA 2HKOA 3BP8A 2OU2A 2E34A 2R7WA 3QOEA 4F93B 4E7ZA 3W2VA 4CCLA 1ZR4A 4Z6YA 2HWVA 4O6JA 2PJPA 4QWQA 1KONA 2CH0A 3L00A 2V1XA 4HSTA 1IV8A 4XRFA 4A5NA 1NG6A 2M0CA 4B3XA 4BJ6C 1ZG1A 3KP4A 3MFKA 1XMXA 4FE4A 4HX4A 3GLXA 3DLAA 2CGPA 3ABKH 1JJ6C 2XAUA 3V8JA 2PBIA 4HX8A 1MD0A 1F36A 4KT6A 3RPUA 1H0MA 1DU0A 2MD0A 1FOYA 5D5XB 3F8FA 2OD5A 5JHFA 2A5YB 3A01A 3H9JA 1SFOJ 2RVCA 3HOYJ 2VE9A 3S3OA 5FKNA 4FASD 3C2GA 4CCMA 3JRIA 2G7UA 4CICA 5IYDJ 3T0YA 5FJ8J 1MMAA 2EBIA 2PMZA 1SVOA 5TJJA 5DEQA 1RESA 1VZ0A 4BY7J 4GYIA 1YW7A 1I27A 1RUOA 1S7OA 1O3TA 5EDNA 1V4RA 2R5YA 1SAUA 4XORA 5J4YA 5E20A 1ZELA 2IA2A 3DFGA 3K2AA 4UUSB 1OCRH 2W25A 2KMUA 2KIFA 3HB9A 3FHZA 2DXIA 4NNJA 1A6IA 1RIOH 2QVOA 5GP9A 4UVCA 3V7SA 2VB6A 4HF1A 2PI0A 1LE8A 4D1QA 5DD4A 4ESJA 3J81Z 4BQNA 3HZJA 4LIVA 2OZ6A 4I98B 5BPIA 2GLOA 2XAQA 1MBKA 4ANJA 2O6GE 2D2WA 5DTDA 2FMLA 1U8BA 5IP9J 1J9IA 1KYZA 1XG1A 1KU9A 3FXUA 3IH4A 1X3WB 1RI7A 2F4MB 2FU4A 4UB8C 2EFQA 2K02A 1W7PA 3L2VA 4M3DA 3CO7C 3AL0C 4A3JJ 2W1OA 4M6YA 1WQ2A 3SHFA 3NARA 1BL0A 2AO9A 2XPWA 1SVMA 1X1DA 4LB5A 2L7MP 4DZJA 4G94A 4EM2A 3LFUA 3DBLB 4NHJA 2PMZN 4BDYA 4U0VA 2ZFWA 2X9DA 4RB1A 1XS9A 3HL2A 4NUBA 2O8XA 5EZHA 4NDLA 4BL0B 5C3EJ 2Y9ZA 5B3SH 2DFIA 4KMUX 3CCYA 1XSDA 2HU9A 1IN5A 5FLVA 2ZBKA 4CZCA 3FX3A 3S2WA 1JXSA 4RLFA 4UVAA 3BR3A 2Y30A 4XN0A 4AD9A 4WWCA 1RNLA 4FHTA 2X1DA 4UNOA 3BROA 3HHGA 5J8FA 3PUFA 4CCKA 3KETA 3ASOH 2LNBA 2XRLA 2HOEA 4HNVA 1IUFA 1VTNC 5EEGA 1BI3A 2GZWA 2XDVA 4XOTA 2NS7A 4XK4A 4IHTA 4LGWA 1R6RA 2IGKA 3KE2A 4MQ9F 3U2RA 4XRSG 3U9GA 5FB2A 1PUEE 4IHWA 2LF8A 2HQNA 3CD6I 1LVKA 2PMHA 3SYTA 3VEPA 4YFNF 3IRRA 1K7AA 1Z91A 3H0GJ 2ZJRF 1R4NB 4UXNA 4J00A 1FSEA 2KJBA 3WTTC 3V4GA 1MBJA 1SD7A 2Z16A 3F23A 4ZYGA 1KU7A 3OSFA 4B47A 5AIQA 2HPIA 4ENNA 1J2XA 4X0GA 5FO5A 3HEFA 4A12A 1ZTRA 4OOIA 2N8GA 2IW5A 1ZARA 1YIOA 1GXQA 1W5TA 2YX7A 4HG2A 4DYRA 1YLFA 1ONVA 3HSRA 4LJZF 2K86A 4OIPF 2PX9A 3FXKA 3I4PA 3HOTA 3LMMA 2ZB9A 2G0EA 3Q9VA 3UNGC 4IOAF 2LKXA 4PSXA 2F5VA 5D4RA 3H9GA 2DYRH 4B09A 2X6WA 4UVBA 2FD5A 5DCMA 5EGOA 3K2ZA 3OIPA 2JWTA 2LSOA 2O7OA 4IHSA 1N75A 5K5OA 4R79A 1YYVA 2FQ3A 3BY6A 5KK1A 2EILH 3PSIA 2CMPA 4RA2A 1S72I 2BEOA 3B6AA 1LJ9A 1Y1WJ 3LAJA 2KHMA 2ZXWH 4LITA 2ELHA 2Q2EB 2XAFA 1U6GA 2EIJH 4L5IA 5J40A 3IV5A 2PJRB 2IA0A 3IL2A 3BR6A 3MMYB 5IYBJ 2ZMEB 5LHIA 2OPTA 3VYSB 4PJNA 1O4XA 2F4IA 1EH8A 4ZDLA 3C2BA 4ABZA 1Z6RA 2LREA 3FF5A 1MDMB 3C18A 2JPCA 3FM5A 3VFZA 1RRJA 2DA3A 3CJQB 3HSEA 2IGNA 5FFZA 3K1MA 4I09A 1P9QC 4FT8A 2LDUA 2OQGA 3FXMA 3E6DA 3GTQJ 3S2DJ 4YG2F 1SVLA 4M73A 2CV0A 3K9TA 2LG4A 1U9OA 4E7LA 3JRBA 4L9TA 4DQ2A 1V5FA 4B43A 4E4HA 1YX5A 3I5UA 1D8KA 3GFJA 3FXQA 1IDZA 1T33A 3BR2A 4Y13A 5GAHJ 1W36D 3H1CA 4ZYHA 3IUOA 2EPFA 2IJLA 4UUSA 4UV9A 2LY2A 3CC7I 1FSHA 2DK8A 3S16J 2ISYA 4AWXB 4RM2A 1Y0NA 2FNPA 4GXOA 3TDZC 4XKCA 2CJJA 2J5PA 3O8GA 5E8IA 4H0EA 3RTRA 2PJRA 3PO2J 3OYJA 1FNNA 1OYYA 5GAGJ 4E7IA 2K85A 2Y0SN 4Y17A 2HDCA 1QVTA 5LGTA 1W36C 2HVRA 2ZMEC 3CJNA 4IPAA 1ZN2A 2EFWA 5IT3A 5HS9A 3SZGA 4A0ZA 4A3FJ 3GTLJ 1HXDA 2AHQA 2OCEA 3SZPA 1MIJA 1AA7A 5HLHA 2CG4A 1E0EA 2LD5A 3IKTA 2X6OA 3E5QA 2OAZA 4Q47A 4DGWB 3GUDA 5H6QA 5FRMA 1P4AA 2FEZA 2L5QA 1S29A 4IRHA 2DU9A 4FQGA 3D5RC 2GIZA 4L9VA 1NK3P 3AG3H 3H3VK 2XKOA 2RNJA 4HV5A 4BQAA 4N9IA 4W1UA 2ME0A 2Z3YA 1MJ9A 4PSWA 1W5SA 2FX0A 2ZC2A 2DT5A 1WI3A 4BY1J 2K9QA 3J7AY 4PJMA 1WI9A 2YSRA 3NAUA 1VI0A 1P7JA 3K4KA 3BQZA 1W0UA 4BHBA 2PQ8A 1JTXA 4KIGA 1N77A 2AQEA 3O3KA 3G73A 4II2A 3F8NA 3CUQC 1HDPA 2EZLA 3FKJA 2F5EA 2WV1A 1X1CA 1MGTA 2CQKA 3O2PE 4MLOA 3TEDA 1B8IA 1HKQA 5B1AH 3BJ6A 4R1HA 1BI2A 3V8KA 3J80Z 2OTJI 1VF9A 1LVAA 4DOZA 2K40A 3KZIC 3ROUA 1GUUA 4LG3A 2F2EA 3FIWA 1CGPA 3OYFA 2XV4S 2O9LA 5KVRA 3BDDA 1ZGJA 4IEJA 3ZMDA 3GX4X 5DM6F 1F4KA 4XIDA 1AWCA 4OIOF 4JX6A 5J6XA 1RPWA 1GV2A 5L3DA 2M30A 1TQIA 4P9UA 4J19A 3BG6A 2JSPA 3EYYA 2RQQA 2E1NA 4C30A 2IGMA 1XSXA 1A36A 5LEJA 1LB2A 9ANTA 3QQAA 2XGDA 2FOWA 4XLPF 3QPHA 4IF4A 3OOPA 4RAFA 2QSGX 3WE2A 1YOVB 3VYTB 1TC3C 3JSOA 1IRGA 3M9AA 2LTPA 5F6FA 2XUBA 1E3HA 5JLXA 2H94A 5DM7F 5L3CA 3DV8A 2P6SA 5JVGF 2GBYA 1JUMA 2VJ5A 4RGSA 1VFCA 5FD6A 3IWZA 5F0FA 3HG9A 2MYSA 1B72A 1P4WA 4E7KA 4XOPA 2VJIA 4R8HA 1HOMA 4C3HJ 1B1BA 4EV0A 4RS8A 4G12A 4DYCA 5E3LA 2W82A 1QZZA 3CO6C 4UY8I 3SDBA 2O8KA 2GM4A 1LDKB 2JVHA 3ZQFA 2X6YA 3BR5A 2XF6A 4MQVA 3PNVA 1OISA 2C6YA 5E3OA 2GXGA 3ABTA 4KMFA 1B59A 2K9SA 2WB1N 4PFOA 2ESHA 2JUGA 1W5CC 3CUOA 4XLAA 2XPUA 1P7IA 4V2GA 2A5WA 1R22A 1HW2A 3LSJA 2H1KA 3ZPLA 2R7TA 3HIFA 4AUXA 2P8TA 3IAS2 3P9CA 5BNGA 1AKHA 2K9MA 4CYCA 3CLQA 3D0SA 1VQLI 1GHCA 3L2WA 1MMGA 3I4NJ 2W84A 1I3QJ 2ELKA 3BLYA 4PJLA 2DPUA 1LFUP 4BBRJ 4MEYF 2V6EA 5CLSA 1JUPA 2FOKA 1U2WA 3RPUD 3U21A 4D9JA 5D8LB 2JMWA 4WCGA 3QP5A 1QGPA 1XX5A 5C44J 2F4OB 1YTYA 5FKOA 5TISC 1R5ID 4XN3A 3E0JB 3TO6A 4AIHA 1YRNB 2STWA 2IS2A 2ZJPF 1R36A 5E1WA 3W6KB 3PIOF 3CF2A 3LSIA 3J7AO 3KPHA 4C3JJ 4XONA 3WGHA 2O3FA 3I59A 4IZZA 1UJ8A 1FC3A 2DBBA 3CCEI 3DLLF 1VNDA 4HSRA 3W2WA 4BE1A 2E1CA 4U7BA 3A4CA 1ETOA 4L5JA 1SMTA 3PJRA 1DPUA 1A5JA 2LRDA 5C4XJ 1YFHA 2KLOA 5CVUA 1BR4A 3ZQLA 3NWTA 4GO1A 1IZ1A 4F92B 2BBYA 4HNUA 3S1NJ 2AQFA 3RKQA 2KDOA 2ZMEA 5F1JA 4A3GJ 2NS0A 1ZK8A 2R5ZB 3HJEA 3S3MA 3ZN0A 2K4JA 1UZCA 4ENMA 3DTKA 4LLLA 1QBJA 4G6DA 4FISA 2OZUA 1XGMA 1ZGWA 1Z6TA 3P5JA 3LQQA 3L1PA 1H89C 1XMAA 3KEYA 2CUFA 1MNDA 4JX4A 1IJWC 1XCBA 3HKZN 4D7NA 3KP5A 2M7AA 2MD5A 1TWHJ 3GTOJ 1RUNA 5E3NA 1X2MA 4XLNF 1LFPA 3FXRA 4QPOA 3DP7A 2PFBA 4AU7A 2L2OA 3MQ0A 2OF7A 4PK4A 4BDZA 5IY5H 5J1UA 3A1YA 1P4XA 5HNHA 2XGCA 2M45A 3VOEA 3B02A 3H5AA 2HS5A 5HVQC 5M5YJ 4BHPA 4XLCA 4ON0A 1PUFA 4C2MJ 2WV0A 4RAGA 3PL8A 2VT3A 5F27A 1QO0D 3BG7A 2CW7A 4YFKF 1YJ9I 1IXRC 3K70D 1TWFJ 4XMYA 2CW0F 4Y7NJ 2OV7A 4ZH4F 1N78A 1T2KA 2MSYA 3I0TA 3FM3A 2EZIA 3GTJJ 3JR9A 1OYWA 4M3EA 1H88C 4OWRB 4FX4A 2RV8A 2B0LA 2HTJA 3E3VA 3GXOA 4IO9F 4QIWN 2A61A 4AVZA 1MBFA 4I01A 2KPMA 3V8LA 4G8XA 4PGHA 2ISZA 1ZRFA 1BIBA 5LEKA 1ORKA 1TT0A 1U8RA 1D5YA 3SQNA 4WXCA 4A3EJ 3C2HA 1H9TA 5LD2C 4DBRA 2I5UA 4N4NB 3QPLA 1LPQA 3PFYA 3PNYA 4IHXA 1R71A 3WTVC 2EIKH 3OIQA 2VUMJ 2HGCA 2XB5A 4PCQA 2XHKA 1OR7A 2HQ5A 4IQ4A 1Z77A 3ZOBA 2VN2A 3LNQA 2EINH 1SFUA 2VQLA 5HNFA 2HFHA 5J4VA 3S17J 3GO5A 1WCMJ 5FKLA 3T1BA 3OIOA 4HNTA 3S93A 1MDMA 3HPHA 3QYFA 4WK8F 2K4BA 2E1MB 2X4HA 4CUGA 2YS9A 2L01A 3K70C 1QQIA 5JHUA 3COAC 4IRGA 2BXYA 4KIBA 1IN8A 2DFHA 5L3BA 2M1BA 1VQ8I 3GF2A 3MKZA 5GTHC 3OSGA 1GDTA 3FBNB 3HHHA 2EB7A 4M6XA 3F6VA 5EZGA 4NC6A 1S7EA 2L9NA 1NK2P 3T8RA 4XQFA 3ZMUA 4U7DA 2IS4A 2DFEA 2BOLA 2AXTC 3K4LA 1ZRDA 2YU9J 2VBZA 1N25A 1USSA 3KX2A 1JKOC 3U1DA 4Y33A 3FKIJ 4A3MJ 2O0YA 4M6VA 1IDYA 3H3UA 3WTYC 3C3WA 1ZAOA 1VQ6I 1W1WE 1MBHA 1O7FA 3SXYA 3MD2A 3M4OJ 3Q9SA 3TW7A 4EJVA 4BE0A 1IF1A 2XGXA 1JE8A 1U5TB 1FZPB 3F0CA 1E3OC 1OPCA 4CA0A 4DIQA 3AG2H 3H5NA 2E60A 1F5TA 2ZXIA 1FIPA 2R7UA 2VBXA 2UV1A 2D5VA 4OMYA 2L7ZA 2MA3A 4GDFA 3ZQHA 5LGNA 1WGXA 3FHNA 4E7HA 4A3DJ 2QLZA 5BOXA 1XB4A 1SFEA 5DD8A 2ZNZA 3VSKA 2WAQN 4ZJZA 2UZKA 4YIRX 2XAGA 4L9NA 2HXOA 2DQRA 2E5ZA 5LHGA 1ETVA 2GQQA 3FWEA 3OY9A 3RQ4A 1RETA 3E6CC 3HOUJ 2VJ4A 2P7VB 1FBSA 5FROA 4BJTA 3ABUA 5D8KB 2IP2A 1I1SA 2DT6A 2DA2A 4DZPA 1S9HA 3HGGA 2E19A 2RAEA 3BCBA 4MFDA 3MKYB 3BOQA 2LYCA 4BXXJ 4NBQA 4HOBA 3RKWA 2ME6A 3KFWX 3R61A 2EFNA 3EQLF 2Z2SB 3CMEI 3QOPA 2ID3A 1Z67A 4ZYEA 5EJCA 4MTDA 3OYGA 1BJAA 2JUCA 2RN7A 2CQ7A 3MWMA 1QPMA 3D5LA 1QZYA 1D0ZA 3ZCOA 1LQ1A 2RC4A 1R49A 5ICCA 2L02A 3E1SA 3MKLA 3DPTA 2PMUA 1AHDP 2ECCA 2ZJQF 3JRHA 3NWSA 4KJZA 2DOAA 4B1RA 3CJRB 5ERIA 3FMRA 2V26A 3ZP5A 3ZQCA 3CF5F 1IG7A 1IC8A 1OKRA 1KQ0A 1USTA 1WH5A 1E2XA 2ZO4A 3WG9A 3HUGA 4HQMA 1FTTA 2DDBA 2HKXA 1E3PA 2LH9A 5CJ9A 3DKXA 1UG2A 3K6GA 4DW6A 2XASA 3IAM2 1X4PA 3RQIA 1WHUA 1IW7F 2YX4A 3ELKA 2YR2A 4IL6C 4S0HB 1FOXA 3TP3A 2DN0A 3HRUA 1FYMA 2KT0A 1GVDA 2LC2A 5EG0B 3OYHA 2QKLB 2R5YB 2ADUA 1T0FC 2GAUA 3J80K 1XPXA 1MSFC 3CJTB 5EYRA 4BJ5C 2XVCA 4P1WA 1IRZA 2JVGA 1NHAA 5DYMA 3DF8A 3PSFA 1MZBA 3A01B 2ELJA 3BR1A 1FMVA 3T8TA 2X0LA 1STZA 3EYIA 2CSOA 2MLGA 2DMQA 2F5DA 4C2UA 5CVRA 1XD7A 4KDPA 1FWZA 2K3FA 1PP8F 1AU7A 3JTHA 3G1MA 1MNMC 1YW9A 1Y8RB 5DUKA 3CCQI 3DU6A 2M2EA 3ZQGA 2HQAA 1BI0A 2UXNA 1IXCA 2TDXA 4CCNA 3JREA 4KIFA 1F1ZA 1R23A 2JTVA 3IHUA 1B6AA 4EVIA 5HOOA 3A02A 3KYDB 4MNUA 2R92J 3BCAA 2FBKA 4BAYA 2G7HA 1W4MA 5FLMJ 3L09A 2BE5F 2G9WA 2RQPA 1TWGJ 3DKYA 4A5MA 4ZC3A 2VOOA 1LKXA 1L0OC 1KYWA 3K4MA 1TQMA 1EF4A 2EJRA 4BYYA 2QWWA 1UG0A 4G7OF 5GPCA 2R93J 1DP3A 3S3NA 4CYDA 3NQOA 4IRIA 3H35A 2MH2A 3P7NA 1TLHB 3CCLI 1YRNA 5A2QZ 1D8JA 2UUZA 4C2TA 2HQRA 2CUZA 3SEQA 3UKGA 2B7EA 4HPQA 2I10A 3HRSA 3FK6A 4L18B 1Z7LA 2M4KA 4EGYA 1CQTA 1K6YA 3A0HC 5K7HA 4B4CA 5DDGA 2VC0A 3LOCA 2VQCA 3ESWB 2E7XA 2E2JJ 1ETYA 4HBLA 2V79A 2F48A 3K7AJ 1IN4A 3LSHA 3VYRB 2V9PA 4XLHA 3E5UA 3HTUA 3I58A 3BG9A 3RI4A 4HA8A 1PUFB 2WAFA 2EV0A 3IRQA 5LLQA 2F5CA 1PDNC 2DI3A 1T98A 1FOWA 5CKTA 2LR8A 3WHCA 1VQ9I 1VQ4I 3E5XA 4Q4ZF 5L3GA 3MAJA 4G6TB 4Q5SF 3L2RA 4A6DA 3C7JA 2CQQA 1GT0C 1P92A 5JFRA 3TKYA 2BY0A 4BU2A 4OAYA 2K9NA 4XM3A 5FD5A 2O61A 2FRHA 4CSWA 2EWNA 5JI6A 4EGZA 1RC9A 1XGSA 1YE9A 2EFOA 3LSKA 1DPRA 2BZTA 2NOJB 3B6CA 3SFZA 1FJLA 5GAEJ 4BQQA 2ZJ2A 4V19K 4QSHA 4F55A 1WJBA 4L9JA 4A2UA 3BZCA 2Z9OA 2BXZA 5BS6A 3WTSC 1O3QA 1ETKA 2BVLA 5F0CA 5K7ZA 4XBFA 3MN2A 2WY8Q 4I7HA 4BGDA 2BY2A 5TGTA 3ZMZA 1WSUA 1W0TA 1G3YA 3CDIA 2Q1ZB 2L4MA 4LLNA 2DO7A 1R1TA 1DU6A 4XR6A 2CUJA 2ZFUA 4OIRF 3Q0VA 2LY1A 2KRCA 3A0BC 3R60A 5E1XA 4Y4RA 1LDDA 1P2FA 5J47A 2Y2ZA 5GPAA 3GW2A 1IGNA 1A35A 2HI3A 3E97A 1OQYA 2HZTA 2QSFX 1O57A 3LQRA 3QAHA 5LGUA 3SJMA 1E17A 5FKMA 3I64A 1G6NA 5B5EC 3OV8A 1OFCX 1TT5B 1OLTA 2JA6J 3H36A 2K7LA 4AM3A 4JOMA 4F7ZA 3P9IA 4XSZF 1HA8A 3WTUC 2KQRA 1R00A 4I0BA 4HQEA 4IJAA 3BTLA 1JI8A 2BV6A 1U0JA 2CYYA 2K3PA 4M9ZA 3ZQQA 3S1RJ 3CESA 3LA3A 2E5NA 2E2HJ 5B66C 3A2KA 3F21A 1YG2A 3HBLA 2ZXHA 3SDGA 3D5SC 4E7JA 2ZNYA 3F8BA 4XLEA 3TDUC 3CCRI 3BZ6A 4YIIA 2M0MA 3K69A 3KP2A 1MH3A 3AG4H 3OL4A 2VQGA 2R7RA 3QODA 4KFCA 2XROA 3K10A 2CU7A 1MKMA 2FSWA 2W00A 5KCMA 5M3MJ 1YQAA 1TNSA 3NRVA 3CP2A 1BW6A 4YEJA 3W6JB 2I8DA 2OA4A 3QRFF 1ZG5A 2EH3A 3G1LA 3TO7A 2GXBA 4IOCF 3DU5A 2R7SA 1S5LC 4FCYA 1Y56A 3R6SA 1R1VA 1IAWA 3FXLA 3R0AA 1MMNA 3TL4X 2L9RA 1X1PA 5AIPA 4HW0A 2E1MC 3LFKA 5D5WB 3I56I 2OTLI 1XGNA 3S1QJ 4YIFA 3EUHA 3LSMA 3K1NA 1UCRA 4OIQF 5CVIA 3N97A 1ZKGA 2M87A 2HOAA 4G7ZF 3CDHA 2DA5A 3JRAA 1YS7A 3OYDA 3I55I 2X51A 2KZGA 3OWTA 3OYCA 2XC7A 1FYLA 3K1PA 1TQPA 3EETA 1J7KA 4TV7A 3FMQA 2P0WA 3VB2A 5D5UB 1DUXC 1PJRA 2KISA 4JBAA 4XKVA 1LDJA 4UUTA 2KDZA 4RB0A 2A6HF 3H9QA 1OCTC 1DGWY
chains in the Genus database with same CATH topology
2VBYA 4EMSA 1XDUA 4D0PA 4ZZDA 4BNCA 2KJCA 4Q48A 4EJTA 1SD6A 2M5WA 4GCVA 1O3RA 1YS6A 4EM1A 1FLIA 4HZFA 3HOSA 4O5VA 1FP1D 4LG0A 5E1ZB 4HYEA 3M7GA 4ASNA 2DQLA 3O6BB 5HLGA 5JVTA 3ERED 1DDNA 3SZTA 2WTEA 1LNWA 1ZRCA 1T38A 5K5RA 4GYGA 2PN6A 2ACJA 3KZZA 4HF2A 5A2QK 3KP7A 1SD5A 3ZMSA 5BPDA 1X3UA 1HQCA 2XRNA 2Q8KA 5F1RA 1A04A 1ON1A 3G3ZA 5ILVA 4RAZA 2UXXA 3PFIA 1C0WA 5LRSA 5FLXK 1IRFA 1MJAA 3GWZA 2FA5A 1T6SA 4WX9A 4KT5C 2JT1A 2FBIA 4M72A 1HW5A 5TRDA 3V7RA 5HDKA 2Y48A 4E70A 2EV5A 3F3XA 4AIJA 2XAHA 1FBQA 1F9NA 4I02A 3Q5FA 2LF7A 3DPLC 3R0JA 1SD4A 2L4AA 3GFLA 3E6BA 2ZKZA 2NAZA 2Q2EA 1ZG3A 2Z33A 1TW2A 4N9HA 3JTGA 1J0RA 4ESFA 2A6EF 3MCZA 2L54A 3GEZA 1GXPA 4RGUA 5D4SA 3VODA 2W85A 3IC7A 1UHWA 2VXZA 1SAXA 1FYKA 1G3WA 1HKTA 2EV6A 3ZMVA 1I6XA 2V9VA 2RKHA 4WXHA 2DW4A 1H9GA 4FX0A 1J59A 4WF2A 4CHUA 1FP2A 1U3EM 2DAOA 4K2EA 4JQFA 4HDVA 1TBXA 3BWGA 5JR3A 2VBWA 4PZJA 1EH7A 4A6EA 2V6CA 3TGNA 4KN4X 2DTRA 1R5GA 2GA2A 4RB2C 2H09A 1ZLKA 3FMSA 2P6TA 2WC2A 3BJAA 2A3SA 5H6RA 2F5FA 1U5TC 3IKVA 1Y0UA 2FNAA 2O03A 4EM0B 5LRRA 1XN7A 3WTZA 3J81K 4A0XA 5HS8A 3ZQ7A 1HSTA 1O7LA 2FBHA 3LA2A 1TNTA 2V1UA 1JHFA 3BJOA 2BGCA 2CWEA 1S3JA 2PG4A 2A69F 1BC8C 2HYFA 3ZMTA 2QQAA 1FY7A 4P96A 4MHGA 1GVJA 3BPVA 1Z05A 3HRMA 4EQQA 3KZYA 2NRAC 4AVPA 2CFXA 3LSTA 3I71A 1UFMA 4LK0F 1R1UA 4GGGA 2KRFA 3WE3A 1R58A 1EV7A 2FMYA 2Q0OA 3QU3A 1S6LA 1UB9A 4BXUA 1HSJA 3MZYA 4AIKA 3H3ZA 4U0YA 1WKMA 4UV8A 5FFXA 5K1YA 3KLOA 3L9FA 3M8FA 5HLIA 4U0WA 2H6BA 2UWMA 2H6CA 5FLXZ 2W24A 4ZZLA 4M71A 1D3YA 4XSXF 3I54A 1BBYA 5HDGA 5AONA 4LFUA 3M8EA 5J8CA 2OQRA 2KKOA 1EH6A 1G3TA 3MZHA 1KA8A 1W7PD 3T5XA 2MLKA 4I2OA 2EK5A 4LB6B 1ON2A 1J5YA 1WRJA 4CXFA 4P9FA 4NQWA 1Q1HA 1I5ZA 1SMYF 5BQTA 1Z7UA 2MC3A 3RYPA 3DKWA 3F6OA 4HAMA 4S04A 4CDGA 3C1DA 2WWYA 1PP7U 2KIUA 5FGMA 2BYVE 4G9YA 4WXDA 4L0YB 2VONA 4ENKA 1FOKA 2JRTA 3HRTA 4KNYA 2QUFA 5EEHA 2IT0A 4ENJA 1XDSA 3L7WA 1S8NA 2P7CB 2EA2A 2W57A 1ZGAA 3LA7A 2L3DA 3RPQA 1KGSA 4I0AA 2XIGA 5F64A 1MJBA 1BIAA 1BOAA 3GFIA 1B9NA 3AAFA 5L3FA 5D6EA 2RDPA 1U78A 4CZZA 4L0ZB 3ISPA 1TTYA 3EDPA 3ULQB 1BI1A 1J75A 4P55A 1IXSB 3H92A 4HX7A 1OMIA 1IN6A 2STTA 1UHMA 1QNTA 2IPQX 2FE3A 2HYGD 3GVAA 2EFPA 1KU3A 5ICGA 5LBQA 2DLLA 4ETSA 1XSVA 4O3MA 3FZVA 4OU0A 2FXAA 2COMA 2H27A 1KU2A 5ILUA 3M1EA 4LG0B 2QQ9A 2Z99A 3P9KA 3WU0A 1ULYA 3RJPA 5LHHA 3HSFA 1ZHFA 3I53A 5L3EA 2XAJA 4G7HF 2YPRA 3F72A 3N4MA 2GWRA 3WGIA 4MEXF 2YU3A 1FBUA 2R3SA 2D1VA 2OBPA 3KEOA 1K78A 3ECOA 5H20A 3V7CA 1CF7A 3KP3A 1R7JA 3WTWC 2P4WA 2MBFA 3REOA 3WGGA 2VODA 3QPTA 3RDIA 1ODDA 3E6MA 2MH9A 5CVJA 3KP6A 3CUQA 4A0YA 4OMZA 3QP6A 4HF0A 2ETHA 1ZYRF 4MGRA 3CUQB 5HDNA 1YW8A 5K5QA 5E17F 2R7DA 2P5VA 2FF4A 3DQVC 1G4DA 4UUVA 1YO5C 2P5LC 2Y0MA 1K78B 2GA1A 2R7FA 4M9SA 1P6RA 3ECHA 3IWFA 2NNYA 3I59B 3WU1B 4UHTA 4Y15A 2QENA 2HEOA 1HW1A 2HTSA 2RGVA 4KN7X 2NYXA 2ZCWA 4JK1X 5D5VB 4YFXF 5D6FA 5E8GA 4PGGA 2PEXA 4LLGF 3DEUA 3GZ5A 1B9MA 4Z2YA 1D5VA 1OYIA 2IRFG 4RGXA 1CF7B 3TOBA 2QM3A 3F8CA 3LWFA 1FPQA 3TQNA 2Z5UA 4LK1F 2VC1A 4HLYA 2DPDA 1G3SA 2JPBA 3WODF 4EJWA 3RKXA 1LEAA 4BH9A 4EJOA 3JW4A 1ZH5A 3PQJA 4ZYDA 4RB3C 1IUYA 1L3LA 1HBXG 1BN5A 4B8XA 2QZ8A 3KEQA 1V3FA 2D45A 3JAMK 3HTSB 2EA4A 3CTAA 1DP7P 4RGRA 1FT9A 5DCMB 1WWXA 4IVNA 3RKYA 5ED4A 3RIRA 4RAYA 4BHCA 4M9XA 2D1HA 5BMZA 2GIVA 4HDUA 4P5OA 1XMKA 4DNCA 2VT2A 4N0BA 3ZN1A 1T0FA 4OINF 4CGZA 5ICFA 4LMYA 4MTEA 5DCFA 4CO8A 1O3SA 1REPC 2V1DA 1KQ8A 3HYIA 4KA4A 1B4AA 2K27A 5CVVA 3MEXA 5DV5A 2XKPA 1U5TA 1KQ9A 1ZLJA 1TW3A 2P5KA 2DK5A 1FX7A 1BC7C 1RZ4A 3ML6A 1IN7A 4PDKA 5IT9K 2AS5F 5ILSA 4NB5A 1K79A 2AXLA 3TO9A 5ICEA 3GYHX 4G6QA 4HLXA 1S7AA 2ESNA 1ZREA 2M8EA 1Z1DA 3LAPA 2VOPA 2KIMA 4EJUA 3BPXA 1AOYA 5E18F 3JSPA 3RYRA 3K0LA 1Z9CA 2E7WA 2LKPA 3L2CA 2Y75A 1I1GA 1XGOA 3QU6A 4HV6A 4M74A 3DXJF 4U88A 2NNNA 1K6OA 3PQKA 3R4KA 3F8MA 1W7PB 3CLOA 4IXAA 3WTXC 2IVMA 5CYVA 4QLCU 2A07F 1HKSA 3TOAA 2CO5A 2QBYB 2QQBA 2PLYA 1R5HA 2HR3A 1JGSA 4KYWA 1SFXA 6PAXA 1XCVA 2ZXJA 1JHHA 2QBYA 3NEUA 3JAMZ 1LEBA 3B73A 5DUIA 2IA1A 3GZ6A 2JSCA 3KLNA 3GFMA 4KICA 2QYOA 2J5OA 4LD5A 3KCCA 2A68F 3F22A 1BM9A 4S05A 5IT9Z 2JZYA 4KUMA 1T39A 2VE8A 5HS7A 4ESBA 2HKOA 3BP8A 2OU2A 2HWVA 4O6JA 2PJPA 4QWQA 3L00A 2V1XA 4XRFA 4A5NA 1ZG1A 3KP4A 3MFKA 4HX4A 3GLXA 2CGPA 3V8JA 2PBIA 4HX8A 1MD0A 3RPUA 1H0MA 5D5XB 3F8FA 2OD5A 2A5YB 2RVCA 2VE9A 2G7UA 4CICA 3T0YA 5TJJA 5DEQA 4GYIA 1YW7A 1I27A 1RUOA 1S7OA 1O3TA 1V4RA 5E20A 2IA2A 3DFGA 2W25A 3FHZA 2KIFA 1RIOH 2QVOA 4UVCA 3V7SA 4HF1A 2PI0A 5DD4A 4ESJA 3J81Z 2OZ6A 4I98B 5BPIA 2XAQA 2O6GE 2D2WA 2FMLA 1J9IA 1KYZA 1KU9A 3FXUA 2FU4A 1RI7A 2EFQA 2K02A 1W7PA 3CO7C 4M6YA 1WQ2A 3SHFA 4LB5A 4G94A 4EM2A 4NHJA 4U0VA 2ZFWA 4RB1A 2O8XA 2DFIA 4KMUX 1XSDA 1IN5A 2ZBKA 3FX3A 3S2WA 1JXSA 4UVAA 4AD9A 4WWCA 1RNLA 4FHTA 4UNOA 3BROA 3HHGA 5J8FA 3KETA 2LNBA 2HOEA 1VTNC 5EEGA 1BI3A 2GZWA 4IHTA 4LGWA 4MQ9F 3KE2A 1PUEE 5FB2A 3U2RA 3U9GA 2LF8A 2HQNA 2PMHA 3VEPA 4YFNF 3IRRA 1K7AA 1Z91A 4UXNA 1FSEA 2KJBA 3WTTC 3V4GA 1SD7A 3F23A 4ZYGA 1KU7A 5AIQA 4ENNA 1J2XA 5FO5A 4A12A 4OOIA 2IW5A 1ZARA 1YIOA 1GXQA 1W5TA 2YX7A 1YLFA 1ONVA 3HSRA 4LJZF 2K86A 4OIPF 3I4PA 3HOTA 3Q9VA 5D4RA 4B09A 4UVBA 5DCMA 3K2ZA 2LSOA 4IHSA 5K5OA 4R79A 1YYVA 2FQ3A 3BY6A 5KK1A 2BEOA 1LJ9A 3LAJA 2ELHA 2XAFA 1U6GA 4L5IA 2IA0A 3IL2A 2ZMEB 5LHIA 1EH8A 1Z6RA 1MDMB 3FF5A 3C18A 2JPCA 3FM5A 3VFZA 3HSEA 5FFZA 3K1MA 4I09A 4FT8A 2LDUA 2OQGA 3E6DA 4YG2F 4M73A 3K9TA 4L9TA 4DQ2A 3I5UA 1D8KA 3GFJA 3FXQA 4Y13A 4ZYHA 2IJLA 4UV9A 1FSHA 2DK8A 2ISYA 4AWXB 2FNPA 4GXOA 3TDZC 2J5PA 4H0EA 3RTRA 1FNNA 1OYYA 4Y17A 2HDCA 5LGTA 3CJNA 4IPAA 1ZN2A 2EFWA 5IT3A 5HS9A 4A0ZA 1HXDA 3SZPA 5HLHA 2CG4A 3IKTA 3E5QA 2OAZA 4Q47A 3GUDA 5H6QA 1P4AA 2FEZA 1S29A 4IRHA 2DU9A 4L9VA 2XKOA 2RNJA 4HV5A 4BQAA 4N9IA 2Z3YA 1MJ9A 1W5SA 2DT5A 1WI9A 2YSRA 4BHBA 2PQ8A 4KIGA 3O3KA 3G73A 3F8NA 3CUQC 2F5EA 1MGTA 2CQKA 3O2PE 1HKQA 3BJ6A 4R1HA 1BI2A 3V8KA 3J80Z 1LVAA 3ROUA 2F2EA 1CGPA 2XV4S 3ZMDA 3BDDA 1ZGJA 5KVRA 3GX4X 1F4KA 1AWCA 4OIOF 5J6XA 5L3DA 2M30A 1TQIA 4P9UA 3EYYA 2E1NA 1XSXA 5LEJA 1LB2A 4XLPF 3QPHA 4IF4A 3OOPA 3WE2A 3JSOA 1IRGA 3M9AA 5F6FA 2XUBA 2H94A 5L3CA 3DV8A 2P6SA 4RGSA 5FD6A 3IWZA 1P4WA 4R8HA 1B1BA 4EV0A 4RS8A 1QZZA 3CO6C 1LDKB 4MQVA 2C6YA 2GXGA 3ABTA 4KMFA 1B59A 2ESHA 3CUOA 1R22A 1HW2A 3ZPLA 3HIFA 2P8TA 3P9CA 3D0SA 1GHCA 2W84A 2DPUA 4MEYF 5CLSA 2FOKA 1U2WA 5D8LB 4WCGA 3QP5A 1QGPA 1YTYA 3TO6A 2STWA 4AIHA 1R36A 5E1WA 3W6KB 3J7AO 3WGHA 2O3FA 3I59A 1FC3A 2DBBA 2E1CA 4U7BA 4L5JA 1SMTA 1DPUA 1YFHA 5CVUA 4GO1A 1IZ1A 2BBYA 2ZMEA 2NS0A 3ZN0A 2K4JA 4ENMA 4LLLA 1QBJA 4G6DA 2OZUA 1XGMA 1Z6TA 3LQQA 1XMAA 1XCBA 3KP5A 2MD5A 1RUNA 4XLNF 3FXRA 2PFBA 3DP7A 3MQ0A 1P4XA 2M45A 3VOEA 3B02A 5HVQC 2HS5A 4BHPA 4ON0A 2WV0A 2VT3A 1QO0D 4YFKF 1IXRC 2CW0F 4ZH4F 1T2KA 3I0TA 3FM3A 1OYWA 4FX4A 2RV8A 2B0LA 2HTJA 3E3VA 3GXOA 2A61A 4I01A 3V8LA 4G8XA 2ISZA 4PGHA 1ZRFA 1BIBA 5LEKA 1U8RA 3SQNA 4WXCA 1H9TA 3WTVC 2HGCA 4PCQA 2XHKA 1OR7A 2VN2A 1SFUA 2HFHA 3GO5A 3T1BA 1MDMA 4WK8F 2K4BA 2X4HA 2L01A 1QQIA 5JHUA 3COAC 4IRGA 4KIBA 1IN8A 5L3BA 2M1BA 3GF2A 3HHHA 2EB7A 4M6XA 3F6VA 3T8RA 3ZMUA 4U7DA 1ZRDA 2VBZA 1USSA 3U1DA 2O0YA 3H3UA 3WTYC 3C3WA 1ZAOA 1O7FA 3SXYA 3Q9SA 4EJVA 1IF1A 2XGXA 1JE8A 1U5TB 1FZPB 1OPCA 1F5TA 2VBXA 4OMYA 2MA3A 5LGNA 2QLZA 5BOXA 1XB4A 1SFEA 5DD8A 2ZNZA 2UZKA 2XAGA 4L9NA 2DQRA 5LHGA 2GQQA 3FWEA 3E6CC 2P7VB 1FBSA 3ABUA 5D8KB 2IP2A 1I1SA 3BOQA 4HOBA 3RKWA 3KFWX 3R61A 2EFNA 3EQLF 3QOPA 4ZYEA 4MTDA 1BJAA 2RN7A 3MWMA 1QPMA 3D5LA 1QZYA 1LQ1A 2RC4A 5ICCA 2L02A 3DPTA 2PMUA 5ERIA 3FMRA 3ZP5A 1OKRA 1KQ0A 1USTA 1E2XA 2ZO4A 3WG9A 3HUGA 4HQMA 2HKXA 5CJ9A 2XASA 1IW7F 2YX4A 3ELKA 2YR2A 3HRUA 1FYMA 2ADUA 2GAUA 3J80K 2XVCA 1NHAA 5DYMA 3DF8A 1MZBA 3T8TA 2X0LA 1STZA 3EYIA 2CSOA 2MLGA 2F5DA 5CVRA 1XD7A 4KDPA 1FWZA 1PP8F 3JTHA 1YW9A 5DUKA 1BI0A 2UXNA 1IXCA 2TDXA 4KIFA 1F1ZA 1R23A 2JTVA 3IHUA 1B6AA 4EVIA 5HOOA 4MNUA 2FBKA 4BAYA 2G7HA 1W4MA 3L09A 2G9WA 2BE5F 2RQPA 4A5MA 2VOOA 1L0OC 1KYWA 1TQMA 2EJRA 4BYYA 2QWWA 4G7OF 4CYDA 3NQOA 4IRIA 2MH2A 3P7NA 1TLHB 5A2QZ 1D8JA 2HQRA 3HRSA 4L18B 4EGYA 5DDGA 2VC0A 2E7XA 4HBLA 2V79A 1IN4A 3E5UA 3HTUA 3I58A 3RI4A 4HA8A 2EV0A 3IRQA 5LLQA 2F5CA 1PDNC 2DI3A 1T98A 3E5XA 4Q4ZF 5L3GA 3MAJA 4Q5SF 4A6DA 3C7JA 1P92A 5JFRA 3TKYA 5FD5A 2O61A 2FRHA 5JI6A 2EWNA 4EGZA 1XGSA 2EFOA 1DPRA 3SFZA 2ZJ2A 4L9JA 4A2UA 2Z9OA 5BS6A 3WTSC 1O3QA 4XBFA 4I7HA 3ZMZA 1WSUA 1G3YA 2L4MA 4LLNA 2DO7A 1R1TA 4OIRF 3R60A 5E1XA 1LDDA 1P2FA 3GW2A 3E97A 2HZTA 5LGUA 1O57A 3LQRA 3QAHA 1E17A 3I64A 1G6NA 3OV8A 2K7LA 4F7ZA 3P9IA 4XSZF 3WTUC 1R00A 4I0BA 4HQEA 4IJAA 2BV6A 2CYYA 4M9ZA 3LA3A 3F21A 1YG2A 2ZNYA 3F8BA 3TDUC 3BZ6A 4YIIA 3K69A 3KP2A 4KFCA 2XROA 1MKMA 2FSWA 1YQAA 1TNSA 3NRVA 3W6JB 2OA4A 3QRFF 1ZG5A 2GXBA 3TO7A 3R6SA 1R1VA 1IAWA 3R0AA 5AIPA 4HW0A 3LFKA 5D5WB 1XGNA 4YIFA 3EUHA 3K1NA 1UCRA 4OIQF 5CVIA 3N97A 2M87A 4G7ZF 3CDHA 1YS7A 1FYLA 3K1PA 1TQPA 3EETA 1J7KA 4TV7A 3FMQA 3VB2A 5D5UB 1DUXC 4JBAA 1LDJA 4RB0A 2A6HF 5E8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBY A;  4EMS A;  1XDU A;  4D0P A;  4ZZD A;  4BNC A;  2KJC A;  4Q48 A;  4EJT A;  1SD6 A;  2M5W A;  4GCV A;  1O3R A;  1YS6 A;  4EM1 A;  1FLI A;  4HZF A;  3HOS A;  4O5V A;  1FP1 D;  4LG0 A;  5E1Z B;  4HYE A;  3M7G A;  4ASN A;  2DQL A;  3O6B B;  5HLG A;  5JVT A;  3ERE D;  1DDN A;  3SZT A;  2WTE A;  1LNW A;  1ZRC A;  1T38 A;  5K5R A;  4GYG A;  2PN6 A;  2ACJ A;  3KZZ A;  4HF2 A;  5A2Q K;  3KP7 A;  1SD5 A;  3ZMS A;  5BPD A;  1X3U A;  1HQC A;  2XRN A;  2Q8K A;  5F1R A;  1A04 A;  1ON1 A;  3G3Z A;  5ILV A;  4RAZ A;  2UXX A;  3PFI A;  1C0W A;  5LRS A;  5FLX K;  1IRF A;  1MJA A;  3GWZ A;  2FA5 A;  1T6S A;  4WX9 A;  4KT5 C;  2JT1 A;  2FBI A;  4M72 A;  1HW5 A;  5TRD A;  3V7R A;  5HDK A;  2Y48 A;  4E70 A;  2EV5 A;  3F3X A;  4AIJ A;  2XAH A;  1FBQ A;  1F9N A;  4I02 A;  3Q5F A;  2LF7 A;  3DPL C;  3R0J A;  1SD4 A;  2L4A A;  3GFL A;  3E6B A;  2ZKZ A;  2NAZ A;  2Q2E A;  1ZG3 A;  2Z33 A;  1TW2 A;  4N9H A;  3JTG A;  1J0R A;  4ESF A;  2A6E F;  3MCZ A;  2L54 A;  3GEZ A;  1GXP A;  4RGU A;  5D4S A;  3VOD A;  2W85 A;  3IC7 A;  1UHW A;  2VXZ A;  1SAX A;  1FYK A;  1G3W A;  1HKT A;  2EV6 A;  3ZMV A;  1I6X A;  2V9V A;  2RKH A;  4WXH A;  2DW4 A;  1H9G A;  4FX0 A;  1J59 A;  4WF2 A;  4CHU A;  1FP2 A;  1U3E M;  2DAO A;  4K2E A;  4JQF A;  4HDV A;  1TBX A;  3BWG A;  5JR3 A;  2VBW A;  4PZJ A;  1EH7 A;  4A6E A;  2V6C A;  3TGN A;  4KN4 X;  2DTR A;  1R5G A;  2GA2 A;  4RB2 C;  2H09 A;  1ZLK A;  3FMS A;  2P6T A;  2WC2 A;  3BJA A;  2A3S A;  5H6R A;  2F5F A;  1U5T C;  3IKV A;  1Y0U A;  2FNA A;  2O03 A;  4EM0 B;  5LRR A;  1XN7 A;  3WTZ A;  3J81 K;  4A0X A;  5HS8 A;  3ZQ7 A;  1HST A;  1O7L A;  2FBH A;  3LA2 A;  1TNT A;  2V1U A;  1JHF A;  3BJO A;  2BGC A;  2CWE A;  1S3J A;  2PG4 A;  2A69 F;  1BC8 C;  2HYF A;  3ZMT A;  2QQA A;  1FY7 A;  4P96 A;  4MHG A;  1GVJ A;  3BPV A;  1Z05 A;  3HRM A;  4EQQ A;  3KZY A;  2NRA C;  4AVP A;  2CFX A;  3LST A;  3I71 A;  1UFM A;  4LK0 F;  1R1U A;  4GGG A;  2KRF A;  3WE3 A;  1R58 A;  1EV7 A;  2FMY A;  2Q0O A;  3QU3 A;  1S6L A;  1UB9 A;  4BXU A;  1HSJ A;  3MZY A;  4AIK A;  3H3Z A;  4U0Y A;  1WKM A;  4UV8 A;  5FFX A;  5K1Y A;  3KLO A;  3L9F A;  3M8F A;  5HLI A;  4U0W A;  2H6B A;  2UWM A;  2H6C A;  5FLX Z;  2W24 A;  4ZZL A;  4M71 A;  1D3Y A;  4XSX F;  3I54 A;  1BBY A;  5HDG A;  5AON A;  4LFU A;  3M8E A;  5J8C A;  2OQR A;  2KKO A;  1EH6 A;  1G3T A;  3MZH A;  1KA8 A;  1W7P D;  3T5X A;  2MLK A;  4I2O A;  2EK5 A;  4LB6 B;  1ON2 A;  1J5Y A;  1WRJ A;  4CXF A;  4P9F A;  4NQW A;  1Q1H A;  1I5Z A;  1SMY F;  5BQT A;  1Z7U A;  2MC3 A;  3RYP A;  3DKW A;  3F6O A;  4HAM A;  4S04 A;  4CDG A;  3C1D A;  2WWY A;  1PP7 U;  2KIU A;  5FGM A;  2BYV E;  4G9Y A;  4WXD A;  4L0Y B;  2VON A;  4ENK A;  1FOK A;  2JRT A;  3HRT A;  4KNY A;  2QUF A;  5EEH A;  2IT0 A;  4ENJ A;  1XDS A;  3L7W A;  1S8N A;  2P7C B;  2EA2 A;  2W57 A;  1ZGA A;  3LA7 A;  2L3D A;  3RPQ A;  1KGS A;  4I0A A;  2XIG A;  5F64 A;  1MJB A;  1BIA A;  1BOA A;  3GFI A;  1B9N A;  3AAF A;  5L3F A;  5D6E A;  2RDP A;  1U78 A;  4CZZ A;  4L0Z B;  3ISP A;  1TTY A;  3EDP A;  3ULQ B;  1BI1 A;  1J75 A;  4P55 A;  1IXS B;  3H92 A;  4HX7 A;  1OMI A;  1IN6 A;  2STT A;  1UHM A;  1QNT A;  2IPQ X;  2FE3 A;  2HYG D;  3GVA A;  2EFP A;  1KU3 A;  5ICG A;  5LBQ A;  2DLL A;  4ETS A;  1XSV A;  4O3M A;  3FZV A;  4OU0 A;  2FXA A;  2COM A;  2H27 A;  1KU2 A;  5ILU A;  3M1E A;  4LG0 B;  2QQ9 A;  2Z99 A;  3P9K A;  3WU0 A;  1ULY A;  3RJP A;  5LHH A;  3HSF A;  1ZHF A;  3I53 A;  5L3E A;  2XAJ A;  4G7H F;  2YPR A;  3F72 A;  3N4M A;  2GWR A;  3WGI A;  4MEX F;  2YU3 A;  1FBU A;  2R3S A;  2D1V A;  2OBP A;  3KEO A;  1K78 A;  3ECO A;  5H20 A;  3V7C A;  1CF7 A;  3KP3 A;  1R7J A;  3WTW C;  2P4W A;  2MBF A;  3REO A;  3WGG A;  2VOD A;  3QPT A;  3RDI A;  1ODD A;  3E6M A;  2MH9 A;  5CVJ A;  3KP6 A;  3CUQ A;  4A0Y A;  4OMZ A;  3QP6 A;  4HF0 A;  2ETH A;  1ZYR F;  4MGR A;  3CUQ B;  5HDN A;  1YW8 A;  5K5Q A;  5E17 F;  2R7D A;  2P5V A;  2FF4 A;  3DQV C;  1G4D A;  4UUV A;  1YO5 C;  2P5L C;  2Y0M A;  1K78 B;  2GA1 A;  2R7F A;  4M9S A;  1P6R A;  3ECH A;  3IWF A;  2NNY A;  3I59 B;  3WU1 B;  4UHT A;  4Y15 A;  2QEN A;  2HEO A;  1HW1 A;  2HTS A;  2RGV A;  4KN7 X;  2NYX A;  2ZCW A;  4JK1 X;  5D5V B;  4YFX F;  5D6F A;  5E8G A;  4PGG A;  2PEX A;  4LLG F;  3DEU A;  3GZ5 A;  1B9M A;  4Z2Y A;  1D5V A;  1OYI A;  2IRF G;  4RGX A;  1CF7 B;  3TOB A;  2QM3 A;  3F8C A;  3LWF A;  1FPQ A;  3TQN A;  2Z5U A;  4LK1 F;  2VC1 A;  4HLY A;  2DPD A;  1G3S A;  2JPB A;  3WOD F;  4EJW A;  3RKX A;  1LEA A;  4BH9 A;  4EJO A;  3JW4 A;  1ZH5 A;  3PQJ A;  4ZYD A;  4RB3 C;  1IUY A;  1L3L A;  1HBX G;  1BN5 A;  4B8X A;  2QZ8 A;  3KEQ A;  1V3F A;  2D45 A;  3JAM K;  3HTS B;  2EA4 A;  3CTA A;  1DP7 P;  4RGR A;  1FT9 A;  5DCM B;  1WWX A;  4IVN A;  3RKY A;  5ED4 A;  3RIR A;  4RAY A;  4BHC A;  4M9X A;  2D1H A;  5BMZ A;  2GIV A;  4HDU A;  4P5O A;  1XMK A;  4DNC A;  2VT2 A;  4N0B A;  3ZN1 A;  1T0F A;  4OIN F;  4CGZ A;  5ICF A;  4LMY A;  4MTE A;  5DCF A;  4CO8 A;  1O3S A;  1REP C;  2V1D A;  1KQ8 A;  3HYI A;  4KA4 A;  1B4A A;  2K27 A;  5CVV A;  3MEX A;  5DV5 A;  2XKP A;  1U5T A;  1KQ9 A;  1ZLJ A;  1TW3 A;  2P5K A;  2DK5 A;  1FX7 A;  1BC7 C;  1RZ4 A;  3ML6 A;  1IN7 A;  4PDK A;  5IT9 K;  2AS5 F;  5ILS A;  4NB5 A;  1K79 A;  2AXL A;  3TO9 A;  5ICE A;  3GYH X;  4G6Q A;  4HLX A;  1S7A A;  2ESN A;  1ZRE A;  2M8E A;  1Z1D A;  3LAP A;  2VOP A;  2KIM A;  4EJU A;  3BPX A;  1AOY A;  5E18 F;  3JSP A;  3RYR A;  3K0L A;  1Z9C A;  2E7W A;  2LKP A;  3L2C A;  2Y75 A;  1I1G A;  1XGO A;  3QU6 A;  4HV6 A;  4M74 A;  3DXJ F;  4U88 A;  2NNN A;  1K6O A;  3PQK A;  3R4K A;  3F8M A;  1W7P B;  3CLO A;  4IXA A;  3WTX C;  2IVM A;  5CYV A;  4QLC U;  2A07 F;  1HKS A;  3TOA A;  2CO5 A;  2QBY B;  2QQB A;  2PLY A;  1R5H A;  2HR3 A;  1JGS A;  4KYW A;  1SFX A;  6PAX A;  1XCV A;  2ZXJ A;  1JHH A;  2QBY A;  3NEU A;  3JAM Z;  1LEB A;  3B73 A;  5DUI A;  2IA1 A;  3GZ6 A;  2JSC A;  3KLN A;  3GFM A;  4KIC A;  2QYO A;  2J5O A;  4LD5 A;  3KCC A;  2A68 F;  3F22 A;  1BM9 A;  4S05 A;  5IT9 Z;  2JZY A;  4KUM A;  1T39 A;  2VE8 A;  5HS7 A;  4ESB A;  2HKO A;  3BP8 A;  2OU2 A;  2HWV A;  4O6J A;  2PJP A;  4QWQ A;  3L00 A;  2V1X A;  4XRF A;  4A5N A;  1ZG1 A;  3KP4 A;  3MFK A;  4HX4 A;  3GLX A;  2CGP A;  3V8J A;  2PBI A;  4HX8 A;  1MD0 A;  3RPU A;  1H0M A;  5D5X B;  3F8F A;  2OD5 A;  2A5Y B;  2RVC A;  2VE9 A;  2G7U A;  4CIC A;  3T0Y A;  5TJJ A;  5DEQ A;  4GYI A;  1YW7 A;  1I27 A;  1RUO A;  1S7O A;  1O3T A;  1V4R A;  5E20 A;  2IA2 A;  3DFG A;  2W25 A;  3FHZ A;  2KIF A;  1RIO H;  2QVO A;  4UVC A;  3V7S A;  4HF1 A;  2PI0 A;  5DD4 A;  4ESJ A;  3J81 Z;  2OZ6 A;  4I98 B;  5BPI A;  2XAQ A;  2O6G E;  2D2W A;  2FML A;  1J9I A;  1KYZ A;  1KU9 A;  3FXU A;  2FU4 A;  1RI7 A;  2EFQ A;  2K02 A;  1W7P A;  3CO7 C;  4M6Y A;  1WQ2 A;  3SHF A;  4LB5 A;  4G94 A;  4EM2 A;  4NHJ A;  4U0V A;  2ZFW A;  4RB1 A;  2O8X A;  2DFI A;  4KMU X;  1XSD A;  1IN5 A;  2ZBK A;  3FX3 A;  3S2W A;  1JXS A;  4UVA A;  4AD9 A;  4WWC A;  1RNL A;  4FHT A;  4UNO A;  3BRO A;  3HHG A;  5J8F A;  3KET A;  2LNB A;  2HOE A;  1VTN C;  5EEG A;  1BI3 A;  2GZW A;  4IHT A;  4LGW A;  4MQ9 F;  3KE2 A;  1PUE E;  5FB2 A;  3U2R A;  3U9G A;  2LF8 A;  2HQN A;  2PMH A;  3VEP A;  4YFN F;  3IRR A;  1K7A A;  1Z91 A;  4UXN A;  1FSE A;  2KJB A;  3WTT C;  3V4G A;  1SD7 A;  3F23 A;  4ZYG A;  1KU7 A;  5AIQ A;  4ENN A;  1J2X A;  5FO5 A;  4A12 A;  4OOI A;  2IW5 A;  1ZAR A;  1YIO A;  1GXQ A;  1W5T A;  2YX7 A;  1YLF A;  1ONV A;  3HSR A;  4LJZ F;  2K86 A;  4OIP F;  3I4P A;  3HOT A;  3Q9V A;  5D4R A;  4B09 A;  4UVB A;  5DCM A;  3K2Z A;  2LSO A;  4IHS A;  5K5O A;  4R79 A;  1YYV A;  2FQ3 A;  3BY6 A;  5KK1 A;  2BEO A;  1LJ9 A;  3LAJ A;  2ELH A;  2XAF A;  1U6G A;  4L5I A;  2IA0 A;  3IL2 A;  2ZME B;  5LHI A;  1EH8 A;  1Z6R A;  1MDM B;  3FF5 A;  3C18 A;  2JPC A;  3FM5 A;  3VFZ A;  3HSE A;  5FFZ A;  3K1M A;  4I09 A;  4FT8 A;  2LDU A;  2OQG A;  3E6D A;  4YG2 F;  4M73 A;  3K9T A;  4L9T A;  4DQ2 A;  3I5U A;  1D8K A;  3GFJ A;  3FXQ A;  4Y13 A;  4ZYH A;  2IJL A;  4UV9 A;  1FSH A;  2DK8 A;  2ISY A;  4AWX B;  2FNP A;  4GXO A;  3TDZ C;  2J5P A;  4H0E A;  3RTR A;  1FNN A;  1OYY A;  4Y17 A;  2HDC A;  5LGT A;  3CJN A;  4IPA A;  1ZN2 A;  2EFW A;  5IT3 A;  5HS9 A;  4A0Z A;  1HXD A;  3SZP A;  5HLH A;  2CG4 A;  3IKT A;  3E5Q A;  2OAZ A;  4Q47 A;  3GUD A;  5H6Q A;  1P4A A;  2FEZ A;  1S29 A;  4IRH A;  2DU9 A;  4L9V A;  2XKO A;  2RNJ A;  4HV5 A;  4BQA A;  4N9I A;  2Z3Y A;  1MJ9 A;  1W5S A;  2DT5 A;  1WI9 A;  2YSR A;  4BHB A;  2PQ8 A;  4KIG A;  3O3K A;  3G73 A;  3F8N A;  3CUQ C;  2F5E A;  1MGT A;  2CQK A;  3O2P E;  1HKQ A;  3BJ6 A;  4R1H A;  1BI2 A;  3V8K A;  3J80 Z;  1LVA A;  3ROU A;  2F2E A;  1CGP A;  2XV4 S;  3ZMD A;  3BDD A;  1ZGJ A;  5KVR A;  3GX4 X;  1F4K A;  1AWC A;  4OIO F;  5J6X A;  5L3D A;  2M30 A;  1TQI A;  4P9U A;  3EYY A;  2E1N A;  1XSX A;  5LEJ A;  1LB2 A;  4XLP F;  3QPH A;  4IF4 A;  3OOP A;  3WE2 A;  3JSO A;  1IRG A;  3M9A A;  5F6F A;  2XUB A;  2H94 A;  5L3C A;  3DV8 A;  2P6S A;  4RGS A;  5FD6 A;  3IWZ A;  1P4W A;  4R8H A;  1B1B A;  4EV0 A;  4RS8 A;  1QZZ A;  3CO6 C;  1LDK B;  4MQV A;  2C6Y A;  2GXG A;  3ABT A;  4KMF A;  1B59 A;  2ESH A;  3CUO A;  1R22 A;  1HW2 A;  3ZPL A;  3HIF A;  2P8T A;  3P9C A;  3D0S A;  1GHC A;  2W84 A;  2DPU A;  4MEY F;  5CLS A;  2FOK A;  1U2W A;  5D8L B;  4WCG A;  3QP5 A;  1QGP A;  1YTY A;  3TO6 A;  2STW A;  4AIH A;  1R36 A;  5E1W A;  3W6K B;  3J7A O;  3WGH A;  2O3F A;  3I59 A;  1FC3 A;  2DBB A;  2E1C A;  4U7B A;  4L5J A;  1SMT A;  1DPU A;  1YFH A;  5CVU A;  4GO1 A;  1IZ1 A;  2BBY A;  2ZME A;  2NS0 A;  3ZN0 A;  2K4J A;  4ENM A;  4LLL A;  1QBJ A;  4G6D A;  2OZU A;  1XGM A;  1Z6T A;  3LQQ A;  1XMA A;  1XCB A;  3KP5 A;  2MD5 A;  1RUN A;  4XLN F;  3FXR A;  2PFB A;  3DP7 A;  3MQ0 A;  1P4X A;  2M45 A;  3VOE A;  3B02 A;  5HVQ C;  2HS5 A;  4BHP A;  4ON0 A;  2WV0 A;  2VT3 A;  1QO0 D;  4YFK F;  1IXR C;  2CW0 F;  4ZH4 F;  1T2K A;  3I0T A;  3FM3 A;  1OYW A;  4FX4 A;  2RV8 A;  2B0L A;  2HTJ A;  3E3V A;  3GXO A;  2A61 A;  4I01 A;  3V8L A;  4G8X A;  2ISZ A;  4PGH A;  1ZRF A;  1BIB A;  5LEK A;  1U8R A;  3SQN A;  4WXC A;  1H9T A;  3WTV C;  2HGC A;  4PCQ A;  2XHK A;  1OR7 A;  2VN2 A;  1SFU A;  2HFH A;  3GO5 A;  3T1B A;  1MDM A;  4WK8 F;  2K4B A;  2X4H A;  2L01 A;  1QQI A;  5JHU A;  3COA C;  4IRG A;  4KIB A;  1IN8 A;  5L3B A;  2M1B A;  3GF2 A;  3HHH A;  2EB7 A;  4M6X A;  3F6V A;  3T8R A;  3ZMU A;  4U7D A;  1ZRD A;  2VBZ A;  1USS A;  3U1D A;  2O0Y A;  3H3U A;  3WTY C;  3C3W A;  1ZAO A;  1O7F A;  3SXY A;  3Q9S A;  4EJV A;  1IF1 A;  2XGX A;  1JE8 A;  1U5T B;  1FZP B;  1OPC A;  1F5T A;  2VBX A;  4OMY A;  2MA3 A;  5LGN A;  2QLZ A;  5BOX A;  1XB4 A;  1SFE A;  5DD8 A;  2ZNZ A;  2UZK A;  2XAG A;  4L9N A;  2DQR A;  5LHG A;  2GQQ A;  3FWE A;  3E6C C;  2P7V B;  1FBS A;  3ABU A;  5D8K B;  2IP2 A;  1I1S A;  3BOQ A;  4HOB A;  3RKW A;  3KFW X;  3R61 A;  2EFN A;  3EQL F;  3QOP A;  4ZYE A;  4MTD A;  1BJA A;  2RN7 A;  3MWM A;  1QPM A;  3D5L A;  1QZY A;  1LQ1 A;  2RC4 A;  5ICC A;  2L02 A;  3DPT A;  2PMU A;  5ERI A;  3FMR A;  3ZP5 A;  1OKR A;  1KQ0 A;  1UST A;  1E2X A;  2ZO4 A;  3WG9 A;  3HUG A;  4HQM A;  2HKX A;  5CJ9 A;  2XAS A;  1IW7 F;  2YX4 A;  3ELK A;  2YR2 A;  3HRU A;  1FYM A;  2ADU A;  2GAU A;  3J80 K;  2XVC A;  1NHA A;  5DYM A;  3DF8 A;  1MZB A;  3T8T A;  2X0L A;  1STZ A;  3EYI A;  2CSO A;  2MLG A;  2F5D A;  5CVR A;  1XD7 A;  4KDP A;  1FWZ A;  1PP8 F;  3JTH A;  1YW9 A;  5DUK A;  1BI0 A;  2UXN A;  1IXC A;  2TDX A;  4KIF A;  1F1Z A;  1R23 A;  2JTV A;  3IHU A;  1B6A A;  4EVI A;  5HOO A;  4MNU A;  2FBK A;  4BAY A;  2G7H A;  1W4M A;  3L09 A;  2G9W A;  2BE5 F;  2RQP A;  4A5M A;  2VOO A;  1L0O C;  1KYW A;  1TQM A;  2EJR A;  4BYY A;  2QWW A;  4G7O F;  4CYD A;  3NQO A;  4IRI A;  2MH2 A;  3P7N A;  1TLH B;  5A2Q Z;  1D8J A;  2HQR A;  3HRS A;  4L18 B;  4EGY A;  5DDG A;  2VC0 A;  2E7X A;  4HBL A;  2V79 A;  1IN4 A;  3E5U A;  3HTU A;  3I58 A;  3RI4 A;  4HA8 A;  2EV0 A;  3IRQ A;  5LLQ A;  2F5C A;  1PDN C;  2DI3 A;  1T98 A;  3E5X A;  4Q4Z F;  5L3G A;  3MAJ A;  4Q5S F;  4A6D A;  3C7J A;  1P92 A;  5JFR A;  3TKY A;  5FD5 A;  2O61 A;  2FRH A;  5JI6 A;  2EWN A;  4EGZ A;  1XGS A;  2EFO A;  1DPR A;  3SFZ A;  2ZJ2 A;  4L9J A;  4A2U A;  2Z9O A;  5BS6 A;  3WTS C;  1O3Q A;  4XBF A;  4I7H A;  3ZMZ A;  1WSU A;  1G3Y A;  2L4M A;  4LLN A;  2DO7 A;  1R1T A;  4OIR F;  3R60 A;  5E1X A;  1LDD A;  1P2F A;  3GW2 A;  3E97 A;  2HZT A;  5LGU A;  1O57 A;  3LQR A;  3QAH A;  1E17 A;  3I64 A;  1G6N A;  3OV8 A;  2K7L A;  4F7Z A;  3P9I A;  4XSZ F;  3WTU C;  1R00 A;  4I0B A;  4HQE A;  4IJA A;  2BV6 A;  2CYY A;  4M9Z A;  3LA3 A;  3F21 A;  1YG2 A;  2ZNY A;  3F8B A;  3TDU C;  3BZ6 A;  4YII A;  3K69 A;  3KP2 A;  4KFC A;  2XRO A;  1MKM A;  2FSW A;  1YQA A;  1TNS A;  3NRV A;  3W6J B;  2OA4 A;  3QRF F;  1ZG5 A;  2GXB A;  3TO7 A;  3R6S A;  1R1V A;  1IAW A;  3R0A A;  5AIP A;  4HW0 A;  3LFK A;  5D5W B;  1XGN A;  4YIF A;  3EUH A;  3K1N A;  1UCR A;  4OIQ F;  5CVI A;  3N97 A;  2M87 A;  4G7Z F;  3CDH A;  1YS7 A;  1FYL A;  3K1P A;  1TQP A;  3EET A;  1J7K A;  4TV7 A;  3FMQ A;  3VB2 A;  5D5U B;  1DUX C;  4JBA A;  1LDJ A;  4RB0 A;  2A6H F;  5E8I A; 
#chains in the Genus database with same CATH topology
 2ECB A;  2BHY A;  2VBY A;  4EMS A;  1XDU A;  1LE8 B;  2E35 A;  4MFE A;  5E79 C;  3J7Y J;  2P81 A;  4D0P A;  4ZZD A;  2OC6 A;  4IKF A;  4BNC A;  1ETQ A;  2DMN A;  1UEL B;  2EQR A;  2KJC A;  3EUH C;  4Q48 A;  4BEH B;  3HM5 A;  2CQX A;  1D1C A;  2LVS A;  3MKW B;  1V54 H;  4EJT A;  1SD6 A;  1Y8Q B;  2M5W A;  4GCV A;  1O3R A;  4GRI A;  1YS6 A;  4EM1 A;  1FLI A;  4HZF A;  2IGO A;  3DTE A;  1Z0X A;  3HOS A;  4O5V A;  4BXF A;  1FP1 D;  2QGU A;  4LG0 A;  4AC0 A;  5E1Z B;  4HYE A;  3M7G A;  3GCM A;  4ASN A;  3PO3 J;  2DQL A;  3J7Z I;  3FK7 A;  2A05 A;  3O6B B;  2BVM A;  4CYC B;  1AKH B;  3TP0 A;  5HLG A;  3OMY A;  5JVT A;  3ERE D;  1H8A C;  4FTH A;  1QHG A;  1I3A A;  1DDN A;  3SZT A;  1X3Z B;  2WTE A;  1LNW A;  1ZRC A;  5EEA A;  1OCO H;  1T38 A;  5K5R A;  1VQK I;  4GYG A;  1Y39 A;  3DTI A;  2PN6 A;  2X1E A;  3KZZ A;  2ACJ A;  2L9V A;  2MAB A;  4HF2 A;  4EEF G;  4YEL A;  3ASN H;  5A2Q K;  3KP7 A;  3G6E I;  5M5W J;  4X6A J;  1ERD A;  4MO7 A;  1SD5 A;  3ZMS A;  2DOF A;  4A3C J;  5BPD A;  3S14 J;  1X3U A;  2KP6 A;  1HQC A;  2XRN A;  2Q8K A;  2QEX I;  1RR8 C;  1I6H J;  1X1B A;  3G71 I;  4C9Y A;  2COB A;  1A04 A;  5F1R A;  1ON1 A;  3Q0U A;  3G3Z A;  5ILV A;  4RAZ A;  3ZR8 X;  2HOS A;  2UXX A;  3PFI A;  4IQJ A;  4C3I J;  1C0W A;  1HCR A;  5LRS A;  1K4T A;  5FLX K;  1IRF A;  3LSR A;  3VYU B;  1MJA A;  1OCZ H;  3I4M J;  3GWZ A;  2VKH A;  2FA5 A;  1EKE A;  1T6S A;  1VQ5 I;  2K9L A;  4WX9 A;  4KT5 C;  2QA4 I;  2DA7 A;  2JT1 A;  4B3A A;  1X19 A;  4F3Q A;  2FBI A;  4BEH A;  4A3I J;  1A6Q A;  2NOG A;  1MMD A;  4M72 A;  2IBD A;  1HW5 A;  2QCO A;  3G1O A;  5TRD A;  1WJC A;  3V7R A;  5KNL A;  4FET A;  4ZDP A;  1RKT A;  2WB1 A;  1NG7 A;  3OS1 A;  5HDK A;  2MFZ A;  2Y48 A;  3JRF A;  4E70 A;  2NS8 A;  1IRX A;  2EV5 A;  2NVT J;  3F3X A;  4AIJ A;  2XAH A;  1FBQ A;  3RZO J;  2DOD A;  1F9N A;  2DMT A;  4ITV A;  3OYI A;  4I02 A;  3Q5F A;  4PJJ A;  2LF7 A;  3ABL H;  3DPL C;  1Z3Y A;  3R0J A;  2JJ7 A;  1MH4 A;  1SD4 A;  4NQW B;  2L4A A;  1IV6 A;  3GFL A;  3TBI A;  3E6B A;  2ZKZ A;  4D5F A;  2NAZ A;  1YIJ I;  2HNH A;  2W48 A;  2GXA A;  1SC7 A;  2HOT A;  2Q2E A;  2CFO A;  2H1L A;  2O5R A;  2WY7 Q;  1ZG3 A;  3GLL A;  2Z33 A;  1TW2 A;  4N9H A;  2DMP A;  1V55 H;  3JTG A;  1J0R A;  2XF5 A;  4ESF A;  1OR7 C;  2A6E F;  3MZ8 A;  4HRI A;  4A3B J;  2KRH A;  3GEZ A;  2L54 A;  2TRT A;  3MCZ A;  1GXP A;  2JA7 J;  3CMM A;  2XGE A;  3K4J A;  2QKM B;  4II3 A;  4RGU A;  5D4S A;  1SEU A;  3VOD A;  2VL8 A;  4RDU A;  4PUS A;  2W85 A;  3IC7 A;  1X2N A;  2DYS H;  2R7O A;  1UHW A;  2VXZ A;  4AYB N;  1SAX A;  1FYK A;  1G3W A;  1FEX A;  1HKT A;  2EV6 A;  3ZMV A;  1I6X A;  2V9V A;  2RKH A;  4WXH A;  2DW4 A;  1H9G A;  3W2A A;  4FX0 A;  1JUS A;  1J59 A;  4D5C A;  4WF2 A;  3BTI A;  2LMD A;  2HDD A;  3UR3 C;  4CHU A;  2L9S A;  1D1B A;  1WJ5 A;  1FP2 A;  5IOY A;  3DPU A;  1U3E M;  1FTZ A;  2DAO A;  4K2E A;  2H8R A;  4JQF A;  4HDV A;  1TBX A;  4N4O B;  5FRN A;  3BWG A;  5JR3 A;  2VBW A;  4PZJ A;  1LFB A;  1EH7 A;  4A6E A;  2V6C A;  3TGN A;  2MG4 A;  3SEZ A;  3BR0 A;  2TCT A;  4KN4 X;  4LOC A;  2XB0 X;  2BHZ A;  1RR7 A;  2DTR A;  1R5G A;  2GA2 A;  4RB2 C;  2H09 A;  1WJF A;  4I6Z A;  1ZLK A;  3FMS A;  2ICW G;  2P6T A;  5KAF C;  2WC2 A;  3CCS I;  3CC2 I;  4F52 A;  3BJA A;  4IX7 A;  2A3S A;  5H6R A;  2F5F A;  2R0Q C;  1U5T C;  3IKV A;  1Y0U A;  2FNA A;  2O03 A;  1G59 A;  4EM0 B;  5LRR A;  2R7Q A;  1XN7 A;  3V42 A;  3BTC A;  3WTZ A;  5HLT A;  4MIM A;  1JT0 A;  3OYL A;  3J81 K;  4W97 A;  5E3M A;  4U87 A;  4XL9 A;  4A0X A;  5HS8 A;  3ZQ7 A;  1HST A;  1O7L A;  2FBH A;  1Q1V A;  3LA2 A;  1TNT A;  1YX3 A;  2DT7 B;  2VQH A;  2V1U A;  1BOB A;  2M8G X;  1JHF A;  4PFP A;  3ZXS A;  3BJO A;  4B48 A;  5FKK A;  1GLN A;  3TW6 A;  2BGC A;  2DA4 A;  2CWE A;  3ZGK A;  1S3J A;  2PG4 A;  1X58 A;  3CCU I;  2Y69 H;  2A69 F;  2KL4 A;  3DBH B;  2HZD A;  1BC8 C;  1APL C;  3FXJ A;  2JQ7 A;  2HYF A;  3ZMT A;  2QQA A;  3CC4 I;  3JRC A;  1FY7 A;  3HPG A;  5CQE A;  1ZQ3 P;  3K4B A;  1WJE A;  3ERM A;  4P96 A;  4MHG A;  1GVJ A;  1A31 A;  3BPV A;  5GTI C;  2Z1D A;  3VSL A;  3H0D A;  1Z05 A;  3HRM A;  4EQQ A;  3KZY A;  2NRA C;  4AVP A;  3L2U A;  2CFX A;  3LST A;  1V5G A;  3I71 A;  1UFM A;  5EF6 A;  3EUA A;  3G4S I;  3S32 A;  1QA6 A;  4LK0 F;  1M1E B;  1R1U A;  4GGG A;  3SFI A;  2KRF A;  3WE3 A;  3U1K A;  4DJA A;  4OAZ A;  3HXL A;  3GTM J;  2IAI A;  1R58 A;  4CCJ A;  2M34 A;  2BY3 A;  1EV7 A;  2FMY A;  1MSE C;  1VQO I;  3HOZ J;  2Q0O A;  3BTJ A;  3KIO A;  2QF7 A;  4Y3O A;  3QU3 A;  1S6L A;  1UB9 A;  4BXU A;  3OYE A;  1HSJ A;  2CS3 A;  3MZY A;  4AIK A;  2LBF A;  3BC8 A;  3H3Z A;  5IYC J;  2VKV A;  2DFF A;  4U0Y A;  1WKM A;  4UV8 A;  5FFX A;  3KYL A;  5K1Y A;  1YIT I;  3KLO A;  3E7L A;  4V2F A;  3L9F A;  3WHB A;  3M07 A;  3M8F A;  5HLI A;  1HLV A;  1JJ8 C;  4U0W A;  5M5X J;  2H6B A;  3OYM A;  1MW7 A;  1ETW A;  2IS1 A;  2H6C A;  2UWM A;  3CDL A;  4B44 A;  5FLX Z;  1Z3X A;  4XRM A;  2W24 A;  4ZZL A;  4M71 A;  1D3Y A;  4XSX F;  3RCO A;  3OR2 C;  1LUJ B;  5IP7 J;  3I54 A;  3M3Y J;  3DEE A;  2DA1 A;  1BBY A;  5HDG A;  4KIT B;  5IPA A;  2HVS A;  5AON A;  4LFU A;  3M8E A;  5J8C A;  2OQR A;  4LIU A;  2QSH X;  2KKO A;  2Y31 A;  3ONQ A;  1EH6 A;  4NC8 A;  2LOO A;  2L0K A;  1MBE A;  1X4O A;  1G3T A;  3IH2 A;  3MZH A;  3OS2 A;  1KA8 A;  1W7P D;  3LL7 A;  4AYB A;  3T5X A;  2MLK A;  1DQU A;  4ZYA A;  2BW3 B;  4I2O A;  2EK5 A;  2R7V A;  3GBG A;  1IO2 A;  1YI2 I;  4LB6 B;  1ON2 A;  2ID6 A;  1J5Y A;  1WRJ A;  4CXF A;  3FBI B;  4P9F A;  4NQW A;  3M1C A;  3CCJ I;  1Q1H A;  4XIC A;  1HF0 A;  1DGR M;  1BJZ A;  3X2Q H;  1I5Z A;  2MW8 A;  4M3G A;  2NVQ J;  1SMY F;  5BQT A;  2OUM A;  4ZTF A;  1Z7U A;  2VPL A;  1FIA A;  2MC3 A;  4E6K G;  3RYP A;  3DKW A;  1JKQ C;  3N05 A;  3LSG A;  2L7K A;  3F6O A;  4HAM A;  4S04 A;  4CDG A;  3C1D A;  1YHQ I;  1UMQ A;  2VPR A;  2WWY A;  2X85 A;  1PP7 U;  4M3F A;  2KIU A;  2CV1 A;  2KFD A;  1POG A;  5FGM A;  1QHH D;  2BYV E;  4G9Y A;  4J01 A;  3AKZ A;  4WXD A;  4L0Y B;  2VON A;  4ENK A;  3HRT A;  2JN6 A;  2JRT A;  2IXS A;  1FOK A;  2HXI A;  4KNY A;  2QUF A;  5EEH A;  1GV5 A;  2VXD A;  3CCM I;  2IT0 A;  1HDD C;  1D1A A;  4ENJ A;  1XDS A;  1QRY A;  3L7W A;  1S8N A;  1WFX A;  2P7C B;  2EA2 A;  2W57 A;  2DJI A;  3M8J A;  1ZGA A;  3LA7 A;  2L3D A;  3RPQ A;  3CMY A;  3S2H J;  1KGS A;  4I0A A;  2XIG A;  4NC7 A;  5F64 A;  3JRG A;  1MJB A;  2BW3 A;  1BIA A;  1BOA A;  3DEW A;  5IP6 A;  1PYV A;  3K4N A;  3GFI A;  1B9N A;  1TL8 A;  3AAF A;  1VQN I;  5L3F A;  4AID A;  5D6E A;  2RDP A;  3G2B A;  1U78 A;  4CZZ A;  4L0Z B;  5CQG A;  3ISP A;  1TTY A;  3EDP A;  1ZR2 A;  3ULQ B;  1BI1 A;  1D0X A;  1J75 A;  4P55 A;  1IXS B;  3H92 A;  4HX7 A;  1OMI A;  5J1R A;  1IN6 A;  2STT A;  1UHM A;  2V7F A;  1QNT A;  2IPQ X;  1T95 A;  2FE3 A;  2HYG D;  3MVP A;  3GVA A;  1KU3 A;  2EFP A;  2VIX A;  3OR1 C;  5ICG A;  5LBQ A;  2HDW A;  3HKZ A;  3IP4 B;  2DLL A;  4ETS A;  5F08 A;  1XSV A;  3H5R A;  3CCV I;  2XSD C;  4O3M A;  3FZV A;  2M9H A;  1YJW I;  4OU0 A;  3RSN A;  2FXA A;  2COM A;  5H2F C;  2IEK A;  2DOE A;  3AL0 B;  2H27 A;  1KU2 A;  2VKE A;  1WJA A;  5ILU A;  2R4G A;  3M1E A;  4LG0 B;  2QQ9 A;  2Z99 A;  4ZDO A;  2LLK A;  3P9K A;  2BY1 A;  3WU0 A;  1VQP I;  1ULY A;  3RJP A;  5LHH A;  3HSF A;  1ZHF A;  3I53 A;  2DMU A;  5L3E A;  2XAJ A;  2DA6 A;  4G7H F;  2YPR A;  2CUE A;  1BA5 A;  3F72 A;  3N4M A;  2GWR A;  2WBM A;  3I9V 2;  2VKD A;  3WGI A;  2JA5 J;  4MEX F;  2YU3 A;  1T08 B;  2EZH A;  1UHS A;  5DS9 A;  1FBU A;  3DWL E;  2E36 A;  2R3S A;  4H4K C;  3TMO A;  2D1V A;  2OBP A;  3OYK A;  1MNE A;  1JKR C;  3KEO A;  2X1C A;  1K78 A;  3ECO A;  3WG7 H;  1TWA J;  3GTG J;  2E71 A;  1WVR A;  5H20 A;  3V7C A;  3WU2 C;  2F6C A;  1TP4 A;  1CF7 A;  1SAN A;  3O8H A;  2NVU B;  3KP3 A;  1R7J A;  2KZV A;  3WTW C;  2P4W A;  2MGQ A;  2MBF A;  3REO A;  1Y6I A;  3WGG A;  2VOD A;  3QPT A;  1WJD A;  3RDI A;  1ODD A;  3AG1 H;  3E6M A;  5JLW A;  3PIP F;  1BW5 A;  2MH9 A;  5CVJ A;  3KP6 A;  4I99 C;  3CUQ A;  4A0Y A;  5IOZ A;  3JCU C;  4OMZ A;  3Q3S A;  1NTC A;  3QP6 A;  1K83 J;  4BKX A;  2JK3 A;  2LFB A;  4HF0 A;  1PVE A;  2ETH A;  2L7F P;  1ZYR F;  4MGR A;  3D1N I;  4ZTJ A;  3CQZ J;  2DDA A;  2V9K A;  3CUQ B;  5HDN A;  1K61 A;  1YW8 A;  1ETX A;  1WZ2 A;  2XSJ C;  2WAD A;  5K5Q A;  5E17 F;  3S15 J;  2R7D A;  2P5V A;  2FF4 A;  2E2I J;  3DQV C;  5GAD J;  1G4D A;  1BR1 A;  3ABM H;  2Y0S A;  4UUV A;  1YO5 C;  2KIQ A;  1JT6 A;  2P5L C;  4RM3 A;  2CQN A;  1JTY A;  1OCC H;  1OCP A;  2Y0M A;  3AFH A;  1K78 B;  1K4S A;  2GA1 A;  2R7F A;  4M9S A;  4IHY A;  1P6R A;  3ECH A;  2XF7 A;  3IWF A;  2NNY A;  3I59 B;  3EUK L;  3Q0W A;  4QPQ A;  3WU1 B;  4UHT A;  3W6V A;  3GTK J;  4Y15 A;  2QEN A;  1ENH A;  2GOM A;  2HEO A;  1HC8 A;  1HW1 A;  2HTS A;  1U9N A;  2JA2 A;  2RGV A;  3PM1 A;  4IHV A;  1G8X A;  3ZRG A;  2OCC H;  4KN7 X;  2NYX A;  2ZCW A;  4JK1 X;  5D5V B;  4YFX F;  1F43 A;  5D6F A;  5E8G A;  4PGG A;  2PEX A;  4JYK A;  4LLG F;  3DBR B;  1FMW A;  3DEU A;  2VJJ A;  3EPZ A;  1B9M A;  3GZ5 A;  4Z2Y A;  1D5V A;  1OYI A;  2IRF G;  5EG0 A;  4RGX A;  1CF7 B;  2V1N A;  4BQO A;  3W3C A;  3TOB A;  4BS9 A;  2QM3 A;  2HVQ A;  4BE2 A;  4EAT A;  3PNT A;  4XRS A;  2EZK A;  3F8C A;  2NVY J;  1D0Y A;  3LWF A;  1XTA A;  1BR2 A;  5B1B H;  1FPQ A;  4E7S A;  3OYB A;  2DTZ A;  1JKP C;  3TQN A;  2Z5U A;  4LK1 F;  2WA0 A;  3HOX J;  3FXO A;  2VC1 A;  3BT9 A;  4HLY A;  2DPD A;  2HPM A;  1G3S A;  2DCE A;  2JPB A;  3WOD F;  4EJW A;  1QZE A;  3GME A;  3RKX A;  1QU3 A;  4RBO A;  1LEA A;  3BG5 A;  4CCO A;  4BH9 A;  2R7X A;  2JA8 J;  3JRD A;  5C4J J;  4EJO A;  2DJN A;  2M7B A;  3S8P A;  3JW4 A;  1ZH5 A;  4JX5 A;  4BUP A;  3PQJ A;  4ZYD A;  4RB3 C;  4XKW A;  3RZD J;  5M3F J;  2VLA A;  1IUY A;  1L3L A;  1HBX G;  1VQ7 I;  3K4C A;  1BN5 A;  4B8X A;  2M4G A;  2QZ8 A;  3KEQ A;  4FE7 A;  2R5Z A;  1V3F A;  3ZQI A;  2D45 A;  3JAM K;  3HTS B;  2EA4 A;  3CTA A;  1NH3 A;  1DP7 P;  4RGR A;  3CMA I;  1TZL A;  1FT9 A;  5DCM B;  1WPK A;  2GOX B;  2QQ8 A;  3QPS A;  1WWX A;  3CP8 A;  4IVN A;  5F04 A;  3RKY A;  5ED4 A;  4XNF A;  3RIR A;  1R9T J;  4RAY A;  4BHC A;  4M9X A;  2D1H A;  3DCF A;  5BMZ A;  2FQ4 A;  2GIV A;  4HDU A;  2NXN B;  2HYJ A;  3OYN A;  1KZH A;  2CRG A;  4P5O A;  4X1E A;  2H8W A;  1XC5 A;  1XMK A;  1UAA A;  4DNC A;  2LP0 A;  2VT2 A;  1ACI A;  4N0B A;  2RRE A;  3ZN1 A;  1T0F A;  4OIN F;  4CGZ A;  5ICF A;  4LMY A;  4MTE A;  4YRV A;  3HDD A;  5DCF A;  3OS0 A;  4CO8 A;  1O3S A;  3BG3 A;  1I39 A;  1REP C;  1I50 J;  2V1D A;  1KQ8 A;  3HYI A;  4KA4 A;  2EIM H;  1B4A A;  3HOW J;  1B8I B;  1R4M B;  2K27 A;  2M3A A;  5CVV A;  2CW8 A;  3BZK A;  3MEX A;  5DV5 A;  2VAS A;  2XKP A;  3KYC B;  1JGG A;  3I3L A;  3S1M J;  2OJE D;  1U5T A;  2RNG A;  3QYB A;  3QYE A;  3IH3 A;  4XKB A;  1KQ9 A;  5F0H A;  1TWC J;  1ZLJ A;  1J09 A;  1TW3 A;  2FUG 2;  2A6T A;  2P5K A;  2DK5 A;  1FX7 A;  1BC7 C;  1RKW A;  1RZ4 A;  3ML6 A;  1EA3 A;  1IN7 A;  4PDK A;  4A69 C;  5IT9 K;  3HC7 A;  2AS5 F;  5ILS A;  3F9K A;  4NB5 A;  1K79 A;  2WAQ A;  2AXL A;  2CV2 A;  3TO9 A;  5KAI C;  5ICE A;  3GYH X;  1MMS A;  4G6Q A;  4HLX A;  1T8I A;  1SFK A;  5J3L A;  1S7A A;  2ESN A;  4D7M A;  2M8E A;  4PJ0 C;  1ZRE A;  4KIS A;  1Z1D A;  2W7N A;  2MC4 A;  3LAP A;  1QPI A;  2VOP A;  4RMN A;  1X1A A;  1MBG A;  1QVU A;  1Y1V J;  2KIM A;  4GFB A;  4EJU A;  3BPX A;  1AOY A;  5E18 F;  3JSP A;  4XLF A;  3RYR A;  4A93 J;  2ZSH B;  2NVX J;  3K0L A;  1Z9C A;  2B9S A;  3PUB A;  2ZSI B;  2E7W A;  2LKP A;  1V5E A;  3L2C A;  2IS6 A;  5CPR B;  1B72 B;  4A3K J;  2Y75 A;  1I1G A;  1XGO A;  2E1O A;  3QU6 A;  4HV6 A;  4M74 A;  3FDY A;  3DXJ F;  4I76 A;  4U88 A;  3OYA A;  2NNN A;  2WAE A;  1WH7 A;  1ITY A;  3FIS A;  2V4J C;  1K6O A;  3PQK A;  3R4K A;  3F8M A;  1W7P B;  3A03 A;  3CLO A;  2LY9 A;  2X48 A;  4IXA A;  3WTX C;  2IVM A;  5CYV A;  1EJ9 A;  4QLC U;  3GTP J;  3OL3 A;  2A07 F;  1HKS A;  3TOA A;  2CO5 A;  5HOD A;  1G2H A;  3GZN B;  2QBY B;  1VQM I;  3HGY A;  3BQY A;  2QQB A;  2PLY A;  4M3B A;  1R5H A;  2HR3 A;  1JGS A;  4A3L J;  4KYW A;  1SFX A;  6PAX A;  4CH7 A;  1XCV A;  2ZXJ A;  4JP0 A;  1JHH A;  3VDX A;  4Y52 J;  4BBS J;  4HEA 2;  2LKS A;  3L2Q A;  3HUG B;  2LK2 A;  3QWL A;  5K7F A;  2QBY A;  1Z21 A;  3NEU A;  5KHD A;  2XPV A;  2B63 J;  4DYQ A;  3JAM Z;  4QTR A;  1LEB A;  2X6X A;  2YUS A;  3HOV J;  1T56 A;  4BAC A;  1YJN I;  3B73 A;  4DBQ A;  2LBF B;  5DUI A;  5LFA A;  2IA1 A;  3GZ6 A;  2JSC A;  2FJ1 A;  4RLQ A;  3KLN A;  4L5E A;  3GFM A;  4KIC A;  5J1Y A;  2QYO A;  2J5O A;  3VWB A;  4F91 B;  4LD5 A;  3CZ6 A;  2Y9Y A;  3KCC A;  3VPR A;  3LSP A;  4UB6 C;  2A68 F;  2K5C A;  3F22 A;  2JRM A;  1BM9 A;  4S05 A;  2R7Z J;  2JZY A;  5IT9 Z;  1OJL A;  4KUM A;  1T39 A;  2VE8 A;  2W4S A;  3OOU A;  5EGO B;  5HS7 A;  2VI6 A;  4ESB A;  2HKO A;  3BP8 A;  2OU2 A;  2E34 A;  2R7W A;  3QOE A;  4F93 B;  4E7Z A;  3W2V A;  4CCL A;  1ZR4 A;  4Z6Y A;  2HWV A;  4O6J A;  2PJP A;  4QWQ A;  1KON A;  2CH0 A;  3L00 A;  2V1X A;  4HST A;  1IV8 A;  4XRF A;  4A5N A;  1NG6 A;  2M0C A;  4B3X A;  4BJ6 C;  1ZG1 A;  3KP4 A;  3MFK A;  1XMX A;  4FE4 A;  4HX4 A;  3GLX A;  3DLA A;  2CGP A;  3ABK H;  1JJ6 C;  2XAU A;  3V8J A;  2PBI A;  4HX8 A;  1MD0 A;  1F36 A;  4KT6 A;  3RPU A;  1H0M A;  1DU0 A;  2MD0 A;  1FOY A;  5D5X B;  3F8F A;  2OD5 A;  5JHF A;  2A5Y B;  3A01 A;  3H9J A;  1SFO J;  2RVC A;  3HOY J;  2VE9 A;  3S3O A;  5FKN A;  4FAS D;  3C2G A;  4CCM A;  3JRI A;  2G7U A;  4CIC A;  5IYD J;  3T0Y A;  5FJ8 J;  1MMA A;  2EBI A;  2PMZ A;  1SVO A;  5TJJ A;  5DEQ A;  1RES A;  1VZ0 A;  4BY7 J;  4GYI A;  1YW7 A;  1I27 A;  1RUO A;  1S7O A;  1O3T A;  5EDN A;  1V4R A;  2R5Y A;  1SAU A;  4XOR A;  5J4Y A;  5E20 A;  1ZEL A;  2IA2 A;  3DFG A;  3K2A A;  4UUS B;  1OCR H;  2W25 A;  2KMU A;  2KIF A;  3HB9 A;  3FHZ A;  2DXI A;  4NNJ A;  1A6I A;  1RIO H;  2QVO A;  5GP9 A;  4UVC A;  3V7S A;  2VB6 A;  4HF1 A;  2PI0 A;  1LE8 A;  4D1Q A;  5DD4 A;  4ESJ A;  3J81 Z;  4BQN A;  3HZJ A;  4LIV A;  2OZ6 A;  4I98 B;  5BPI A;  2GLO A;  2XAQ A;  1MBK A;  4ANJ A;  2O6G E;  2D2W A;  5DTD A;  2FML A;  1U8B A;  5IP9 J;  1J9I A;  1KYZ A;  1XG1 A;  1KU9 A;  3FXU A;  3IH4 A;  1X3W B;  1RI7 A;  2F4M B;  2FU4 A;  4UB8 C;  2EFQ A;  2K02 A;  1W7P A;  3L2V A;  4M3D A;  3CO7 C;  3AL0 C;  4A3J J;  2W1O A;  4M6Y A;  1WQ2 A;  3SHF A;  3NAR A;  1BL0 A;  2AO9 A;  2XPW A;  1SVM A;  1X1D A;  4LB5 A;  2L7M P;  4DZJ A;  4G94 A;  4EM2 A;  3LFU A;  3DBL B;  4NHJ A;  2PMZ N;  4BDY A;  4U0V A;  2ZFW A;  2X9D A;  4RB1 A;  1XS9 A;  3HL2 A;  4NUB A;  2O8X A;  5EZH A;  4NDL A;  4BL0 B;  5C3E J;  2Y9Z A;  5B3S H;  2DFI A;  4KMU X;  3CCY A;  1XSD A;  2HU9 A;  1IN5 A;  5FLV A;  2ZBK A;  4CZC A;  3FX3 A;  3S2W A;  1JXS A;  4RLF A;  4UVA A;  3BR3 A;  2Y30 A;  4XN0 A;  4AD9 A;  4WWC A;  1RNL A;  4FHT A;  2X1D A;  4UNO A;  3BRO A;  3HHG A;  5J8F A;  3PUF A;  4CCK A;  3KET A;  3ASO H;  2LNB A;  2XRL A;  2HOE A;  4HNV A;  1IUF A;  1VTN C;  5EEG A;  1BI3 A;  2GZW A;  2XDV A;  4XOT A;  2NS7 A;  4XK4 A;  4IHT A;  4LGW A;  1R6R A;  2IGK A;  3KE2 A;  4MQ9 F;  3U2R A;  4XRS G;  3U9G A;  5FB2 A;  1PUE E;  4IHW A;  2LF8 A;  2HQN A;  3CD6 I;  1LVK A;  2PMH A;  3SYT A;  3VEP A;  4YFN F;  3IRR A;  1K7A A;  1Z91 A;  3H0G J;  2ZJR F;  1R4N B;  4UXN A;  4J00 A;  1FSE A;  2KJB A;  3WTT C;  3V4G A;  1MBJ A;  1SD7 A;  2Z16 A;  3F23 A;  4ZYG A;  1KU7 A;  3OSF A;  4B47 A;  5AIQ A;  2HPI A;  4ENN A;  1J2X A;  4X0G A;  5FO5 A;  3HEF A;  4A12 A;  1ZTR A;  4OOI A;  2N8G A;  2IW5 A;  1ZAR A;  1YIO A;  1GXQ A;  1W5T A;  2YX7 A;  4HG2 A;  4DYR A;  1YLF A;  1ONV A;  3HSR A;  4LJZ F;  2K86 A;  4OIP F;  2PX9 A;  3FXK A;  3I4P A;  3HOT A;  3LMM A;  2ZB9 A;  2G0E A;  3Q9V A;  3UNG C;  4IOA F;  2LKX A;  4PSX A;  2F5V A;  5D4R A;  3H9G A;  2DYR H;  4B09 A;  2X6W A;  4UVB A;  2FD5 A;  5DCM A;  5EGO A;  3K2Z A;  3OIP A;  2JWT A;  2LSO A;  2O7O A;  4IHS A;  1N75 A;  5K5O A;  4R79 A;  1YYV A;  2FQ3 A;  3BY6 A;  5KK1 A;  2EIL H;  3PSI A;  2CMP A;  4RA2 A;  1S72 I;  2BEO A;  3B6A A;  1LJ9 A;  1Y1W J;  3LAJ A;  2KHM A;  2ZXW H;  4LIT A;  2ELH A;  2Q2E B;  2XAF A;  1U6G A;  2EIJ H;  4L5I A;  5J40 A;  3IV5 A;  2PJR B;  2IA0 A;  3IL2 A;  3BR6 A;  3MMY B;  5IYB J;  2ZME B;  5LHI A;  2OPT A;  3VYS B;  4PJN A;  1O4X A;  2F4I A;  1EH8 A;  4ZDL A;  3C2B A;  4ABZ A;  1Z6R A;  2LRE A;  3FF5 A;  1MDM B;  3C18 A;  2JPC A;  3FM5 A;  3VFZ A;  1RRJ A;  2DA3 A;  3CJQ B;  3HSE A;  2IGN A;  5FFZ A;  3K1M A;  4I09 A;  1P9Q C;  4FT8 A;  2LDU A;  2OQG A;  3FXM A;  3E6D A;  3GTQ J;  3S2D J;  4YG2 F;  1SVL A;  4M73 A;  2CV0 A;  3K9T A;  2LG4 A;  1U9O A;  4E7L A;  3JRB A;  4L9T A;  4DQ2 A;  1V5F A;  4B43 A;  4E4H A;  1YX5 A;  3I5U A;  1D8K A;  3GFJ A;  3FXQ A;  1IDZ A;  1T33 A;  3BR2 A;  4Y13 A;  5GAH J;  1W36 D;  3H1C A;  4ZYH A;  3IUO A;  2EPF A;  2IJL A;  4UUS A;  4UV9 A;  2LY2 A;  3CC7 I;  1FSH A;  2DK8 A;  3S16 J;  2ISY A;  4AWX B;  4RM2 A;  1Y0N A;  2FNP A;  4GXO A;  3TDZ C;  4XKC A;  2CJJ A;  2J5P A;  3O8G A;  5E8I A;  4H0E A;  3RTR A;  2PJR A;  3PO2 J;  3OYJ A;  1FNN A;  1OYY A;  5GAG J;  4E7I A;  2K85 A;  2Y0S N;  4Y17 A;  2HDC A;  1QVT A;  5LGT A;  1W36 C;  2HVR A;  2ZME C;  3CJN A;  4IPA A;  1ZN2 A;  2EFW A;  5IT3 A;  5HS9 A;  3SZG A;  4A0Z A;  4A3F J;  3GTL J;  1HXD A;  2AHQ A;  2OCE A;  3SZP A;  1MIJ A;  1AA7 A;  5HLH A;  2CG4 A;  1E0E A;  2LD5 A;  3IKT A;  2X6O A;  3E5Q A;  2OAZ A;  4Q47 A;  4DGW B;  3GUD A;  5H6Q A;  5FRM A;  1P4A A;  2FEZ A;  2L5Q A;  1S29 A;  4IRH A;  2DU9 A;  4FQG A;  3D5R C;  2GIZ A;  4L9V A;  1NK3 P;  3AG3 H;  3H3V K;  2XKO A;  2RNJ A;  4HV5 A;  4BQA A;  4N9I A;  4W1U A;  2ME0 A;  2Z3Y A;  1MJ9 A;  4PSW A;  1W5S A;  2FX0 A;  2ZC2 A;  2DT5 A;  1WI3 A;  4BY1 J;  2K9Q A;  3J7A Y;  4PJM A;  1WI9 A;  2YSR A;  3NAU A;  1VI0 A;  1P7J A;  3K4K A;  3BQZ A;  1W0U A;  4BHB A;  2PQ8 A;  1JTX A;  4KIG A;  1N77 A;  2AQE A;  3O3K A;  3G73 A;  4II2 A;  3F8N A;  3CUQ C;  1HDP A;  2EZL A;  3FKJ A;  2F5E A;  2WV1 A;  1X1C A;  1MGT A;  2CQK A;  3O2P E;  4MLO A;  3TED A;  1B8I A;  1HKQ A;  5B1A H;  3BJ6 A;  4R1H A;  1BI2 A;  3V8K A;  3J80 Z;  2OTJ I;  1VF9 A;  1LVA A;  4DOZ A;  2K40 A;  3KZI C;  3ROU A;  1GUU A;  4LG3 A;  2F2E A;  3FIW A;  1CGP A;  3OYF A;  2XV4 S;  2O9L A;  5KVR A;  3BDD A;  1ZGJ A;  4IEJ A;  3ZMD A;  3GX4 X;  5DM6 F;  1F4K A;  4XID A;  1AWC A;  4OIO F;  4JX6 A;  5J6X A;  1RPW A;  1GV2 A;  5L3D A;  2M30 A;  1TQI A;  4P9U A;  4J19 A;  3BG6 A;  2JSP A;  3EYY A;  2RQQ A;  2E1N A;  4C30 A;  2IGM A;  1XSX A;  1A36 A;  5LEJ A;  1LB2 A;  9ANT A;  3QQA A;  2XGD A;  2FOW A;  4XLP F;  3QPH A;  4IF4 A;  3OOP A;  4RAF A;  2QSG X;  3WE2 A;  1YOV B;  3VYT B;  1TC3 C;  3JSO A;  1IRG A;  3M9A A;  2LTP A;  5F6F A;  2XUB A;  1E3H A;  5JLX A;  2H94 A;  5DM7 F;  5L3C A;  3DV8 A;  2P6S A;  5JVG F;  2GBY A;  1JUM A;  2VJ5 A;  4RGS A;  1VFC A;  5FD6 A;  3IWZ A;  5F0F A;  3HG9 A;  2MYS A;  1B72 A;  1P4W A;  4E7K A;  4XOP A;  2VJI A;  4R8H A;  1HOM A;  4C3H J;  1B1B A;  4EV0 A;  4RS8 A;  4G12 A;  4DYC A;  5E3L A;  2W82 A;  1QZZ A;  3CO6 C;  4UY8 I;  3SDB A;  2O8K A;  2GM4 A;  1LDK B;  2JVH A;  3ZQF A;  2X6Y A;  3BR5 A;  2XF6 A;  4MQV A;  3PNV A;  1OIS A;  2C6Y A;  5E3O A;  2GXG A;  3ABT A;  4KMF A;  1B59 A;  2K9S A;  2WB1 N;  4PFO A;  2ESH A;  2JUG A;  1W5C C;  3CUO A;  4XLA A;  2XPU A;  1P7I A;  4V2G A;  2A5W A;  1R22 A;  1HW2 A;  3LSJ A;  2H1K A;  3ZPL A;  2R7T A;  3HIF A;  4AUX A;  2P8T A;  3IAS 2;  3P9C A;  5BNG A;  1AKH A;  2K9M A;  4CYC A;  3CLQ A;  3D0S A;  1VQL I;  1GHC A;  3L2W A;  1MMG A;  3I4N J;  2W84 A;  1I3Q J;  2ELK A;  3BLY A;  4PJL A;  2DPU A;  1LFU P;  4BBR J;  4MEY F;  2V6E A;  5CLS A;  1JUP A;  2FOK A;  1U2W A;  3RPU D;  3U21 A;  4D9J A;  5D8L B;  2JMW A;  4WCG A;  3QP5 A;  1QGP A;  1XX5 A;  5C44 J;  2F4O B;  1YTY A;  5FKO A;  5TIS C;  1R5I D;  4XN3 A;  3E0J B;  3TO6 A;  4AIH A;  1YRN B;  2STW A;  2IS2 A;  2ZJP F;  1R36 A;  5E1W A;  3W6K B;  3PIO F;  3CF2 A;  3LSI A;  3J7A O;  3KPH A;  4C3J J;  4XON A;  3WGH A;  2O3F A;  3I59 A;  4IZZ A;  1UJ8 A;  1FC3 A;  2DBB A;  3CCE I;  3DLL F;  1VND A;  4HSR A;  3W2W A;  4BE1 A;  2E1C A;  4U7B A;  3A4C A;  1ETO A;  4L5J A;  1SMT A;  3PJR A;  1DPU A;  1A5J A;  2LRD A;  5C4X J;  1YFH A;  2KLO A;  5CVU A;  1BR4 A;  3ZQL A;  3NWT A;  4GO1 A;  1IZ1 A;  4F92 B;  2BBY A;  4HNU A;  3S1N J;  2AQF A;  3RKQ A;  2KDO A;  2ZME A;  5F1J A;  4A3G J;  2NS0 A;  1ZK8 A;  2R5Z B;  3HJE A;  3S3M A;  3ZN0 A;  2K4J A;  1UZC A;  4ENM A;  3DTK A;  4LLL A;  1QBJ A;  4G6D A;  4FIS A;  2OZU A;  1XGM A;  1ZGW A;  1Z6T A;  3P5J A;  3LQQ A;  3L1P A;  1H89 C;  1XMA A;  3KEY A;  2CUF A;  1MND A;  4JX4 A;  1IJW C;  1XCB A;  3HKZ N;  4D7N A;  3KP5 A;  2M7A A;  2MD5 A;  1TWH J;  3GTO J;  1RUN A;  5E3N A;  1X2M A;  4XLN F;  1LFP A;  3FXR A;  4QPO A;  3DP7 A;  2PFB A;  4AU7 A;  2L2O A;  3MQ0 A;  2OF7 A;  4PK4 A;  4BDZ A;  5IY5 H;  5J1U A;  3A1Y A;  1P4X A;  5HNH A;  2XGC A;  2M45 A;  3VOE A;  3B02 A;  3H5A A;  2HS5 A;  5HVQ C;  5M5Y J;  4BHP A;  4XLC A;  4ON0 A;  1PUF A;  4C2M J;  2WV0 A;  4RAG A;  3PL8 A;  2VT3 A;  5F27 A;  1QO0 D;  3BG7 A;  2CW7 A;  4YFK F;  1YJ9 I;  1IXR C;  3K70 D;  1TWF J;  4XMY A;  2CW0 F;  4Y7N J;  2OV7 A;  4ZH4 F;  1N78 A;  1T2K A;  2MSY A;  3I0T A;  3FM3 A;  2EZI A;  3GTJ J;  3JR9 A;  1OYW A;  4M3E A;  1H88 C;  4OWR B;  4FX4 A;  2RV8 A;  2B0L A;  2HTJ A;  3E3V A;  3GXO A;  4IO9 F;  4QIW N;  2A61 A;  4AVZ A;  1MBF A;  4I01 A;  2KPM A;  3V8L A;  4G8X A;  4PGH A;  2ISZ A;  1ZRF A;  1BIB A;  5LEK A;  1ORK A;  1TT0 A;  1U8R A;  1D5Y A;  3SQN A;  4WXC A;  4A3E J;  3C2H A;  1H9T A;  5LD2 C;  4DBR A;  2I5U A;  4N4N B;  3QPL A;  1LPQ A;  3PFY A;  3PNY A;  4IHX A;  1R71 A;  3WTV C;  2EIK H;  3OIQ A;  2VUM J;  2HGC A;  2XB5 A;  4PCQ A;  2XHK A;  1OR7 A;  2HQ5 A;  4IQ4 A;  1Z77 A;  3ZOB A;  2VN2 A;  3LNQ A;  2EIN H;  1SFU A;  2VQL A;  5HNF A;  2HFH A;  5J4V A;  3S17 J;  3GO5 A;  1WCM J;  5FKL A;  3T1B A;  3OIO A;  4HNT A;  3S93 A;  1MDM A;  3HPH A;  3QYF A;  4WK8 F;  2K4B A;  2E1M B;  2X4H A;  4CUG A;  2YS9 A;  2L01 A;  3K70 C;  1QQI A;  5JHU A;  3COA C;  4IRG A;  2BXY A;  4KIB A;  1IN8 A;  2DFH A;  5L3B A;  2M1B A;  1VQ8 I;  3GF2 A;  3MKZ A;  5GTH C;  3OSG A;  1GDT A;  3FBN B;  3HHH A;  2EB7 A;  4M6X A;  3F6V A;  5EZG A;  4NC6 A;  1S7E A;  2L9N A;  1NK2 P;  3T8R A;  4XQF A;  3ZMU A;  4U7D A;  2IS4 A;  2DFE A;  2BOL A;  2AXT C;  3K4L A;  1ZRD A;  2YU9 J;  2VBZ A;  1N25 A;  1USS A;  3KX2 A;  1JKO C;  3U1D A;  4Y33 A;  3FKI J;  4A3M J;  2O0Y A;  4M6V A;  1IDY A;  3H3U A;  3WTY C;  3C3W A;  1ZAO A;  1VQ6 I;  1W1W E;  1MBH A;  1O7F A;  3SXY A;  3MD2 A;  3M4O J;  3Q9S A;  3TW7 A;  4EJV A;  4BE0 A;  1IF1 A;  2XGX A;  1JE8 A;  1U5T B;  1FZP B;  3F0C A;  1E3O C;  1OPC A;  4CA0 A;  4DIQ A;  3AG2 H;  3H5N A;  2E60 A;  1F5T A;  2ZXI A;  1FIP A;  2R7U A;  2VBX A;  2UV1 A;  2D5V A;  4OMY A;  2L7Z A;  2MA3 A;  4GDF A;  3ZQH A;  5LGN A;  1WGX A;  3FHN A;  4E7H A;  4A3D J;  2QLZ A;  5BOX A;  1XB4 A;  1SFE A;  5DD8 A;  2ZNZ A;  3VSK A;  2WAQ N;  4ZJZ A;  2UZK A;  4YIR X;  2XAG A;  4L9N A;  2HXO A;  2DQR A;  2E5Z A;  5LHG A;  1ETV A;  2GQQ A;  3FWE A;  3OY9 A;  3RQ4 A;  1RET A;  3E6C C;  3HOU J;  2VJ4 A;  2P7V B;  1FBS A;  5FRO A;  4BJT A;  3ABU A;  5D8K B;  2IP2 A;  1I1S A;  2DT6 A;  2DA2 A;  4DZP A;  1S9H A;  3HGG A;  2E19 A;  2RAE A;  3BCB A;  4MFD A;  3MKY B;  3BOQ A;  2LYC A;  4BXX J;  4NBQ A;  4HOB A;  3RKW A;  2ME6 A;  3KFW X;  3R61 A;  2EFN A;  3EQL F;  2Z2S B;  3CME I;  3QOP A;  2ID3 A;  1Z67 A;  4ZYE A;  5EJC A;  4MTD A;  3OYG A;  1BJA A;  2JUC A;  2RN7 A;  2CQ7 A;  3MWM A;  1QPM A;  3D5L A;  1QZY A;  1D0Z A;  3ZCO A;  1LQ1 A;  2RC4 A;  1R49 A;  5ICC A;  2L02 A;  3E1S A;  3MKL A;  3DPT A;  2PMU A;  1AHD P;  2ECC A;  2ZJQ F;  3JRH A;  3NWS A;  4KJZ A;  2DOA A;  4B1R A;  3CJR B;  5ERI A;  3FMR A;  2V26 A;  3ZP5 A;  3ZQC A;  3CF5 F;  1IG7 A;  1IC8 A;  1OKR A;  1KQ0 A;  1UST A;  1WH5 A;  1E2X A;  2ZO4 A;  3WG9 A;  3HUG A;  4HQM A;  1FTT A;  2DDB A;  2HKX A;  1E3P A;  2LH9 A;  5CJ9 A;  3DKX A;  1UG2 A;  3K6G A;  4DW6 A;  2XAS A;  3IAM 2;  1X4P A;  3RQI A;  1WHU A;  1IW7 F;  2YX4 A;  3ELK A;  2YR2 A;  4IL6 C;  4S0H B;  1FOX A;  3TP3 A;  2DN0 A;  3HRU A;  1FYM A;  2KT0 A;  1GVD A;  2LC2 A;  5EG0 B;  3OYH A;  2QKL B;  2R5Y B;  2ADU A;  1T0F C;  2GAU A;  3J80 K;  1XPX A;  1MSF C;  3CJT B;  5EYR A;  4BJ5 C;  2XVC A;  4P1W A;  1IRZ A;  2JVG A;  1NHA A;  5DYM A;  3DF8 A;  3PSF A;  1MZB A;  3A01 B;  2ELJ A;  3BR1 A;  1FMV A;  3T8T A;  2X0L A;  1STZ A;  3EYI A;  2CSO A;  2MLG A;  2DMQ A;  2F5D A;  4C2U A;  5CVR A;  1XD7 A;  4KDP A;  1FWZ A;  2K3F A;  1PP8 F;  1AU7 A;  3JTH A;  3G1M A;  1MNM C;  1YW9 A;  1Y8R B;  5DUK A;  3CCQ I;  3DU6 A;  2M2E A;  3ZQG A;  2HQA A;  1BI0 A;  2UXN A;  1IXC A;  2TDX A;  4CCN A;  3JRE A;  4KIF A;  1F1Z A;  1R23 A;  2JTV A;  3IHU A;  1B6A A;  4EVI A;  5HOO A;  3A02 A;  3KYD B;  4MNU A;  2R92 J;  3BCA A;  2FBK A;  4BAY A;  2G7H A;  1W4M A;  5FLM J;  3L09 A;  2BE5 F;  2G9W A;  2RQP A;  1TWG J;  3DKY A;  4A5M A;  4ZC3 A;  2VOO A;  1LKX A;  1L0O C;  1KYW A;  3K4M A;  1TQM A;  1EF4 A;  2EJR A;  4BYY A;  2QWW A;  1UG0 A;  4G7O F;  5GPC A;  2R93 J;  1DP3 A;  3S3N A;  4CYD A;  3NQO A;  4IRI A;  3H35 A;  2MH2 A;  3P7N A;  1TLH B;  3CCL I;  1YRN A;  5A2Q Z;  1D8J A;  2UUZ A;  4C2T A;  2HQR A;  2CUZ A;  3SEQ A;  3UKG A;  2B7E A;  4HPQ A;  2I10 A;  3HRS A;  3FK6 A;  4L18 B;  1Z7L A;  2M4K A;  4EGY A;  1CQT A;  1K6Y A;  3A0H C;  5K7H A;  4B4C A;  5DDG A;  2VC0 A;  3LOC A;  2VQC A;  3ESW B;  2E7X A;  2E2J J;  1ETY A;  4HBL A;  2V79 A;  2F48 A;  3K7A J;  1IN4 A;  3LSH A;  3VYR B;  2V9P A;  4XLH A;  3E5U A;  3HTU A;  3I58 A;  3BG9 A;  3RI4 A;  4HA8 A;  1PUF B;  2WAF A;  2EV0 A;  3IRQ A;  5LLQ A;  2F5C A;  1PDN C;  2DI3 A;  1T98 A;  1FOW A;  5CKT A;  2LR8 A;  3WHC A;  1VQ9 I;  1VQ4 I;  3E5X A;  4Q4Z F;  5L3G A;  3MAJ A;  4G6T B;  4Q5S F;  3L2R A;  4A6D A;  3C7J A;  2CQQ A;  1GT0 C;  1P92 A;  5JFR A;  3TKY A;  2BY0 A;  4BU2 A;  4OAY A;  2K9N A;  4XM3 A;  5FD5 A;  2O61 A;  2FRH A;  4CSW A;  2EWN A;  5JI6 A;  4EGZ A;  1RC9 A;  1XGS A;  1YE9 A;  2EFO A;  3LSK A;  1DPR A;  2BZT A;  2NOJ B;  3B6C A;  3SFZ A;  1FJL A;  5GAE J;  4BQQ A;  2ZJ2 A;  4V19 K;  4QSH A;  4F55 A;  1WJB A;  4L9J A;  4A2U A;  3BZC A;  2Z9O A;  2BXZ A;  5BS6 A;  3WTS C;  1O3Q A;  1ETK A;  2BVL A;  5F0C A;  5K7Z A;  4XBF A;  3MN2 A;  2WY8 Q;  4I7H A;  4BGD A;  2BY2 A;  5TGT A;  3ZMZ A;  1WSU A;  1W0T A;  1G3Y A;  3CDI A;  2Q1Z B;  2L4M A;  4LLN A;  2DO7 A;  1R1T A;  1DU6 A;  4XR6 A;  2CUJ A;  2ZFU A;  4OIR F;  3Q0V A;  2LY1 A;  2KRC A;  3A0B C;  3R60 A;  5E1X A;  4Y4R A;  1LDD A;  1P2F A;  5J47 A;  2Y2Z A;  5GPA A;  3GW2 A;  1IGN A;  1A35 A;  2HI3 A;  3E97 A;  1OQY A;  2HZT A;  2QSF X;  1O57 A;  3LQR A;  3QAH A;  5LGU A;  3SJM A;  1E17 A;  5FKM A;  3I64 A;  1G6N A;  5B5E C;  3OV8 A;  1OFC X;  1TT5 B;  1OLT A;  2JA6 J;  3H36 A;  2K7L A;  4AM3 A;  4JOM A;  4F7Z A;  3P9I A;  4XSZ F;  1HA8 A;  3WTU C;  2KQR A;  1R00 A;  4I0B A;  4HQE A;  4IJA A;  3BTL A;  1JI8 A;  2BV6 A;  1U0J A;  2CYY A;  2K3P A;  4M9Z A;  3ZQQ A;  3S1R J;  3CES A;  3LA3 A;  2E5N A;  2E2H J;  5B66 C;  3A2K A;  3F21 A;  1YG2 A;  3HBL A;  2ZXH A;  3SDG A;  3D5S C;  4E7J A;  2ZNY A;  3F8B A;  4XLE A;  3TDU C;  3CCR I;  3BZ6 A;  4YII A;  2M0M A;  3K69 A;  3KP2 A;  1MH3 A;  3AG4 H;  3OL4 A;  2VQG A;  2R7R A;  3QOD A;  4KFC A;  2XRO A;  3K10 A;  2CU7 A;  1MKM A;  2FSW A;  2W00 A;  5KCM A;  5M3M J;  1YQA A;  1TNS A;  3NRV A;  3CP2 A;  1BW6 A;  4YEJ A;  3W6J B;  2I8D A;  2OA4 A;  3QRF F;  1ZG5 A;  2EH3 A;  3G1L A;  3TO7 A;  2GXB A;  4IOC F;  3DU5 A;  2R7S A;  1S5L C;  4FCY A;  1Y56 A;  3R6S A;  1R1V A;  1IAW A;  3FXL A;  3R0A A;  1MMN A;  3TL4 X;  2L9R A;  1X1P A;  5AIP A;  4HW0 A;  2E1M C;  3LFK A;  5D5W B;  3I56 I;  2OTL I;  1XGN A;  3S1Q J;  4YIF A;  3EUH A;  3LSM A;  3K1N A;  1UCR A;  4OIQ F;  5CVI A;  3N97 A;  1ZKG A;  2M87 A;  2HOA A;  4G7Z F;  3CDH A;  2DA5 A;  3JRA A;  1YS7 A;  3OYD A;  3I55 I;  2X51 A;  2KZG A;  3OWT A;  3OYC A;  2XC7 A;  1FYL A;  3K1P A;  1TQP A;  3EET A;  1J7K A;  4TV7 A;  3FMQ A;  2P0W A;  3VB2 A;  5D5U B;  1DUX C;  1PJR A;  2KIS A;  4JBA A;  4XKV A;  1LDJ A;  4UUT A;  2KDZ A;  4RB0 A;  2A6H F;  3H9Q A;  1OCT C;  1DGW Y; 
#chains in the Genus database with same CATH homology
 2VBY A;  4EMS A;  1XDU A;  4D0P A;  4ZZD A;  4BNC A;  2KJC A;  4Q48 A;  4EJT A;  1SD6 A;  2M5W A;  4GCV A;  1O3R A;  1YS6 A;  4EM1 A;  1FLI A;  4HZF A;  3HOS A;  4O5V A;  1FP1 D;  4LG0 A;  5E1Z B;  4HYE A;  3M7G A;  4ASN A;  2DQL A;  3O6B B;  5HLG A;  5JVT A;  3ERE D;  1DDN A;  3SZT A;  2WTE A;  1LNW A;  1ZRC A;  1T38 A;  5K5R A;  4GYG A;  2PN6 A;  2ACJ A;  3KZZ A;  4HF2 A;  5A2Q K;  3KP7 A;  1SD5 A;  3ZMS A;  5BPD A;  1X3U A;  1HQC A;  2XRN A;  2Q8K A;  5F1R A;  1A04 A;  1ON1 A;  3G3Z A;  5ILV A;  4RAZ A;  2UXX A;  3PFI A;  1C0W A;  5LRS A;  5FLX K;  1IRF A;  1MJA A;  3GWZ A;  2FA5 A;  1T6S A;  4WX9 A;  4KT5 C;  2JT1 A;  2FBI A;  4M72 A;  1HW5 A;  5TRD A;  3V7R A;  5HDK A;  2Y48 A;  4E70 A;  2EV5 A;  3F3X A;  4AIJ A;  2XAH A;  1FBQ A;  1F9N A;  4I02 A;  3Q5F A;  2LF7 A;  3DPL C;  3R0J A;  1SD4 A;  2L4A A;  3GFL A;  3E6B A;  2ZKZ A;  2NAZ A;  2Q2E A;  1ZG3 A;  2Z33 A;  1TW2 A;  4N9H A;  3JTG A;  1J0R A;  4ESF A;  2A6E F;  3MCZ A;  2L54 A;  3GEZ A;  1GXP A;  4RGU A;  5D4S A;  3VOD A;  2W85 A;  3IC7 A;  1UHW A;  2VXZ A;  1SAX A;  1FYK A;  1G3W A;  1HKT A;  2EV6 A;  3ZMV A;  1I6X A;  2V9V A;  2RKH A;  4WXH A;  2DW4 A;  1H9G A;  4FX0 A;  1J59 A;  4WF2 A;  4CHU A;  1FP2 A;  1U3E M;  2DAO A;  4K2E A;  4JQF A;  4HDV A;  1TBX A;  3BWG A;  5JR3 A;  2VBW A;  4PZJ A;  1EH7 A;  4A6E A;  2V6C A;  3TGN A;  4KN4 X;  2DTR A;  1R5G A;  2GA2 A;  4RB2 C;  2H09 A;  1ZLK A;  3FMS A;  2P6T A;  2WC2 A;  3BJA A;  2A3S A;  5H6R A;  2F5F A;  1U5T C;  3IKV A;  1Y0U A;  2FNA A;  2O03 A;  4EM0 B;  5LRR A;  1XN7 A;  3WTZ A;  3J81 K;  4A0X A;  5HS8 A;  3ZQ7 A;  1HST A;  1O7L A;  2FBH A;  3LA2 A;  1TNT A;  2V1U A;  1JHF A;  3BJO A;  2BGC A;  2CWE A;  1S3J A;  2PG4 A;  2A69 F;  1BC8 C;  2HYF A;  3ZMT A;  2QQA A;  1FY7 A;  4P96 A;  4MHG A;  1GVJ A;  3BPV A;  1Z05 A;  3HRM A;  4EQQ A;  3KZY A;  2NRA C;  4AVP A;  2CFX A;  3LST A;  3I71 A;  1UFM A;  4LK0 F;  1R1U A;  4GGG A;  2KRF A;  3WE3 A;  1R58 A;  1EV7 A;  2FMY A;  2Q0O A;  3QU3 A;  1S6L A;  1UB9 A;  4BXU A;  1HSJ A;  3MZY A;  4AIK A;  3H3Z A;  4U0Y A;  1WKM A;  4UV8 A;  5FFX A;  5K1Y A;  3KLO A;  3L9F A;  3M8F A;  5HLI A;  4U0W A;  2H6B A;  2UWM A;  2H6C A;  5FLX Z;  2W24 A;  4ZZL A;  4M71 A;  1D3Y A;  4XSX F;  3I54 A;  1BBY A;  5HDG A;  5AON A;  4LFU A;  3M8E A;  5J8C A;  2OQR A;  2KKO A;  1EH6 A;  1G3T A;  3MZH A;  1KA8 A;  1W7P D;  3T5X A;  2MLK A;  4I2O A;  2EK5 A;  4LB6 B;  1ON2 A;  1J5Y A;  1WRJ A;  4CXF A;  4P9F A;  4NQW A;  1Q1H A;  1I5Z A;  1SMY F;  5BQT A;  1Z7U A;  2MC3 A;  3RYP A;  3DKW A;  3F6O A;  4HAM A;  4S04 A;  4CDG A;  3C1D A;  2WWY A;  1PP7 U;  2KIU A;  5FGM A;  2BYV E;  4G9Y A;  4WXD A;  4L0Y B;  2VON A;  4ENK A;  1FOK A;  2JRT A;  3HRT A;  4KNY A;  2QUF A;  5EEH A;  2IT0 A;  4ENJ A;  1XDS A;  3L7W A;  1S8N A;  2P7C B;  2EA2 A;  2W57 A;  1ZGA A;  3LA7 A;  2L3D A;  3RPQ A;  1KGS A;  4I0A A;  2XIG A;  5F64 A;  1MJB A;  1BIA A;  1BOA A;  3GFI A;  1B9N A;  3AAF A;  5L3F A;  5D6E A;  2RDP A;  1U78 A;  4CZZ A;  4L0Z B;  3ISP A;  1TTY A;  3EDP A;  3ULQ B;  1BI1 A;  1J75 A;  4P55 A;  1IXS B;  3H92 A;  4HX7 A;  1OMI A;  1IN6 A;  2STT A;  1UHM A;  1QNT A;  2IPQ X;  2FE3 A;  2HYG D;  3GVA A;  2EFP A;  1KU3 A;  5ICG A;  5LBQ A;  2DLL A;  4ETS A;  1XSV A;  4O3M A;  3FZV A;  4OU0 A;  2FXA A;  2COM A;  2H27 A;  1KU2 A;  5ILU A;  3M1E A;  4LG0 B;  2QQ9 A;  2Z99 A;  3P9K A;  3WU0 A;  1ULY A;  3RJP A;  5LHH A;  3HSF A;  1ZHF A;  3I53 A;  5L3E A;  2XAJ A;  4G7H F;  2YPR A;  3F72 A;  3N4M A;  2GWR A;  3WGI A;  4MEX F;  2YU3 A;  1FBU A;  2R3S A;  2D1V A;  2OBP A;  3KEO A;  1K78 A;  3ECO A;  5H20 A;  3V7C A;  1CF7 A;  3KP3 A;  1R7J A;  3WTW C;  2P4W A;  2MBF A;  3REO A;  3WGG A;  2VOD A;  3QPT A;  3RDI A;  1ODD A;  3E6M A;  2MH9 A;  5CVJ A;  3KP6 A;  3CUQ A;  4A0Y A;  4OMZ A;  3QP6 A;  4HF0 A;  2ETH A;  1ZYR F;  4MGR A;  3CUQ B;  5HDN A;  1YW8 A;  5K5Q A;  5E17 F;  2R7D A;  2P5V A;  2FF4 A;  3DQV C;  1G4D A;  4UUV A;  1YO5 C;  2P5L C;  2Y0M A;  1K78 B;  2GA1 A;  2R7F A;  4M9S A;  1P6R A;  3ECH A;  3IWF A;  2NNY A;  3I59 B;  3WU1 B;  4UHT A;  4Y15 A;  2QEN A;  2HEO A;  1HW1 A;  2HTS A;  2RGV A;  4KN7 X;  2NYX A;  2ZCW A;  4JK1 X;  5D5V B;  4YFX F;  5D6F A;  5E8G A;  4PGG A;  2PEX A;  4LLG F;  3DEU A;  3GZ5 A;  1B9M A;  4Z2Y A;  1D5V A;  1OYI A;  2IRF G;  4RGX A;  1CF7 B;  3TOB A;  2QM3 A;  3F8C A;  3LWF A;  1FPQ A;  3TQN A;  2Z5U A;  4LK1 F;  2VC1 A;  4HLY A;  2DPD A;  1G3S A;  2JPB A;  3WOD F;  4EJW A;  3RKX A;  1LEA A;  4BH9 A;  4EJO A;  3JW4 A;  1ZH5 A;  3PQJ A;  4ZYD A;  4RB3 C;  1IUY A;  1L3L A;  1HBX G;  1BN5 A;  4B8X A;  2QZ8 A;  3KEQ A;  1V3F A;  2D45 A;  3JAM K;  3HTS B;  2EA4 A;  3CTA A;  1DP7 P;  4RGR A;  1FT9 A;  5DCM B;  1WWX A;  4IVN A;  3RKY A;  5ED4 A;  3RIR A;  4RAY A;  4BHC A;  4M9X A;  2D1H A;  5BMZ A;  2GIV A;  4HDU A;  4P5O A;  1XMK A;  4DNC A;  2VT2 A;  4N0B A;  3ZN1 A;  1T0F A;  4OIN F;  4CGZ A;  5ICF A;  4LMY A;  4MTE A;  5DCF A;  4CO8 A;  1O3S A;  1REP C;  2V1D A;  1KQ8 A;  3HYI A;  4KA4 A;  1B4A A;  2K27 A;  5CVV A;  3MEX A;  5DV5 A;  2XKP A;  1U5T A;  1KQ9 A;  1ZLJ A;  1TW3 A;  2P5K A;  2DK5 A;  1FX7 A;  1BC7 C;  1RZ4 A;  3ML6 A;  1IN7 A;  4PDK A;  5IT9 K;  2AS5 F;  5ILS A;  4NB5 A;  1K79 A;  2AXL A;  3TO9 A;  5ICE A;  3GYH X;  4G6Q A;  4HLX A;  1S7A A;  2ESN A;  1ZRE A;  2M8E A;  1Z1D A;  3LAP A;  2VOP A;  2KIM A;  4EJU A;  3BPX A;  1AOY A;  5E18 F;  3JSP A;  3RYR A;  3K0L A;  1Z9C A;  2E7W A;  2LKP A;  3L2C A;  2Y75 A;  1I1G A;  1XGO A;  3QU6 A;  4HV6 A;  4M74 A;  3DXJ F;  4U88 A;  2NNN A;  1K6O A;  3PQK A;  3R4K A;  3F8M A;  1W7P B;  3CLO A;  4IXA A;  3WTX C;  2IVM A;  5CYV A;  4QLC U;  2A07 F;  1HKS A;  3TOA A;  2CO5 A;  2QBY B;  2QQB A;  2PLY A;  1R5H A;  2HR3 A;  1JGS A;  4KYW A;  1SFX A;  6PAX A;  1XCV A;  2ZXJ A;  1JHH A;  2QBY A;  3NEU A;  3JAM Z;  1LEB A;  3B73 A;  5DUI A;  2IA1 A;  3GZ6 A;  2JSC A;  3KLN A;  3GFM A;  4KIC A;  2QYO A;  2J5O A;  4LD5 A;  3KCC A;  2A68 F;  3F22 A;  1BM9 A;  4S05 A;  5IT9 Z;  2JZY A;  4KUM A;  1T39 A;  2VE8 A;  5HS7 A;  4ESB A;  2HKO A;  3BP8 A;  2OU2 A;  2HWV A;  4O6J A;  2PJP A;  4QWQ A;  3L00 A;  2V1X A;  4XRF A;  4A5N A;  1ZG1 A;  3KP4 A;  3MFK A;  4HX4 A;  3GLX A;  2CGP A;  3V8J A;  2PBI A;  4HX8 A;  1MD0 A;  3RPU A;  1H0M A;  5D5X B;  3F8F A;  2OD5 A;  2A5Y B;  2RVC A;  2VE9 A;  2G7U A;  4CIC A;  3T0Y A;  5TJJ A;  5DEQ A;  4GYI A;  1YW7 A;  1I27 A;  1RUO A;  1S7O A;  1O3T A;  1V4R A;  5E20 A;  2IA2 A;  3DFG A;  2W25 A;  3FHZ A;  2KIF A;  1RIO H;  2QVO A;  4UVC A;  3V7S A;  4HF1 A;  2PI0 A;  5DD4 A;  4ESJ A;  3J81 Z;  2OZ6 A;  4I98 B;  5BPI A;  2XAQ A;  2O6G E;  2D2W A;  2FML A;  1J9I A;  1KYZ A;  1KU9 A;  3FXU A;  2FU4 A;  1RI7 A;  2EFQ A;  2K02 A;  1W7P A;  3CO7 C;  4M6Y A;  1WQ2 A;  3SHF A;  4LB5 A;  4G94 A;  4EM2 A;  4NHJ A;  4U0V A;  2ZFW A;  4RB1 A;  2O8X A;  2DFI A;  4KMU X;  1XSD A;  1IN5 A;  2ZBK A;  3FX3 A;  3S2W A;  1JXS A;  4UVA A;  4AD9 A;  4WWC A;  1RNL A;  4FHT A;  4UNO A;  3BRO A;  3HHG A;  5J8F A;  3KET A;  2LNB A;  2HOE A;  1VTN C;  5EEG A;  1BI3 A;  2GZW A;  4IHT A;  4LGW A;  4MQ9 F;  3KE2 A;  1PUE E;  5FB2 A;  3U2R A;  3U9G A;  2LF8 A;  2HQN A;  2PMH A;  3VEP A;  4YFN F;  3IRR A;  1K7A A;  1Z91 A;  4UXN A;  1FSE A;  2KJB A;  3WTT C;  3V4G A;  1SD7 A;  3F23 A;  4ZYG A;  1KU7 A;  5AIQ A;  4ENN A;  1J2X A;  5FO5 A;  4A12 A;  4OOI A;  2IW5 A;  1ZAR A;  1YIO A;  1GXQ A;  1W5T A;  2YX7 A;  1YLF A;  1ONV A;  3HSR A;  4LJZ F;  2K86 A;  4OIP F;  3I4P A;  3HOT A;  3Q9V A;  5D4R A;  4B09 A;  4UVB A;  5DCM A;  3K2Z A;  2LSO A;  4IHS A;  5K5O A;  4R79 A;  1YYV A;  2FQ3 A;  3BY6 A;  5KK1 A;  2BEO A;  1LJ9 A;  3LAJ A;  2ELH A;  2XAF A;  1U6G A;  4L5I A;  2IA0 A;  3IL2 A;  2ZME B;  5LHI A;  1EH8 A;  1Z6R A;  1MDM B;  3FF5 A;  3C18 A;  2JPC A;  3FM5 A;  3VFZ A;  3HSE A;  5FFZ A;  3K1M A;  4I09 A;  4FT8 A;  2LDU A;  2OQG A;  3E6D A;  4YG2 F;  4M73 A;  3K9T A;  4L9T A;  4DQ2 A;  3I5U A;  1D8K A;  3GFJ A;  3FXQ A;  4Y13 A;  4ZYH A;  2IJL A;  4UV9 A;  1FSH A;  2DK8 A;  2ISY A;  4AWX B;  2FNP A;  4GXO A;  3TDZ C;  2J5P A;  4H0E A;  3RTR A;  1FNN A;  1OYY A;  4Y17 A;  2HDC A;  5LGT A;  3CJN A;  4IPA A;  1ZN2 A;  2EFW A;  5IT3 A;  5HS9 A;  4A0Z A;  1HXD A;  3SZP A;  5HLH A;  2CG4 A;  3IKT A;  3E5Q A;  2OAZ A;  4Q47 A;  3GUD A;  5H6Q A;  1P4A A;  2FEZ A;  1S29 A;  4IRH A;  2DU9 A;  4L9V A;  2XKO A;  2RNJ A;  4HV5 A;  4BQA A;  4N9I A;  2Z3Y A;  1MJ9 A;  1W5S A;  2DT5 A;  1WI9 A;  2YSR A;  4BHB A;  2PQ8 A;  4KIG A;  3O3K A;  3G73 A;  3F8N A;  3CUQ C;  2F5E A;  1MGT A;  2CQK A;  3O2P E;  1HKQ A;  3BJ6 A;  4R1H A;  1BI2 A;  3V8K A;  3J80 Z;  1LVA A;  3ROU A;  2F2E A;  1CGP A;  2XV4 S;  3ZMD A;  3BDD A;  1ZGJ A;  5KVR A;  3GX4 X;  1F4K A;  1AWC A;  4OIO F;  5J6X A;  5L3D A;  2M30 A;  1TQI A;  4P9U A;  3EYY A;  2E1N A;  1XSX A;  5LEJ A;  1LB2 A;  4XLP F;  3QPH A;  4IF4 A;  3OOP A;  3WE2 A;  3JSO A;  1IRG A;  3M9A A;  5F6F A;  2XUB A;  2H94 A;  5L3C A;  3DV8 A;  2P6S A;  4RGS A;  5FD6 A;  3IWZ A;  1P4W A;  4R8H A;  1B1B A;  4EV0 A;  4RS8 A;  1QZZ A;  3CO6 C;  1LDK B;  4MQV A;  2C6Y A;  2GXG A;  3ABT A;  4KMF A;  1B59 A;  2ESH A;  3CUO A;  1R22 A;  1HW2 A;  3ZPL A;  3HIF A;  2P8T A;  3P9C A;  3D0S A;  1GHC A;  2W84 A;  2DPU A;  4MEY F;  5CLS A;  2FOK A;  1U2W A;  5D8L B;  4WCG A;  3QP5 A;  1QGP A;  1YTY A;  3TO6 A;  2STW A;  4AIH A;  1R36 A;  5E1W A;  3W6K B;  3J7A O;  3WGH A;  2O3F A;  3I59 A;  1FC3 A;  2DBB A;  2E1C A;  4U7B A;  4L5J A;  1SMT A;  1DPU A;  1YFH A;  5CVU A;  4GO1 A;  1IZ1 A;  2BBY A;  2ZME A;  2NS0 A;  3ZN0 A;  2K4J A;  4ENM A;  4LLL A;  1QBJ A;  4G6D A;  2OZU A;  1XGM A;  1Z6T A;  3LQQ A;  1XMA A;  1XCB A;  3KP5 A;  2MD5 A;  1RUN A;  4XLN F;  3FXR A;  2PFB A;  3DP7 A;  3MQ0 A;  1P4X A;  2M45 A;  3VOE A;  3B02 A;  5HVQ C;  2HS5 A;  4BHP A;  4ON0 A;  2WV0 A;  2VT3 A;  1QO0 D;  4YFK F;  1IXR C;  2CW0 F;  4ZH4 F;  1T2K A;  3I0T A;  3FM3 A;  1OYW A;  4FX4 A;  2RV8 A;  2B0L A;  2HTJ A;  3E3V A;  3GXO A;  2A61 A;  4I01 A;  3V8L A;  4G8X A;  2ISZ A;  4PGH A;  1ZRF A;  1BIB A;  5LEK A;  1U8R A;  3SQN A;  4WXC A;  1H9T A;  3WTV C;  2HGC A;  4PCQ A;  2XHK A;  1OR7 A;  2VN2 A;  1SFU A;  2HFH A;  3GO5 A;  3T1B A;  1MDM A;  4WK8 F;  2K4B A;  2X4H A;  2L01 A;  1QQI A;  5JHU A;  3COA C;  4IRG A;  4KIB A;  1IN8 A;  5L3B A;  2M1B A;  3GF2 A;  3HHH A;  2EB7 A;  4M6X A;  3F6V A;  3T8R A;  3ZMU A;  4U7D A;  1ZRD A;  2VBZ A;  1USS A;  3U1D A;  2O0Y A;  3H3U A;  3WTY C;  3C3W A;  1ZAO A;  1O7F A;  3SXY A;  3Q9S A;  4EJV A;  1IF1 A;  2XGX A;  1JE8 A;  1U5T B;  1FZP B;  1OPC A;  1F5T A;  2VBX A;  4OMY A;  2MA3 A;  5LGN A;  2QLZ A;  5BOX A;  1XB4 A;  1SFE A;  5DD8 A;  2ZNZ A;  2UZK A;  2XAG A;  4L9N A;  2DQR A;  5LHG A;  2GQQ A;  3FWE A;  3E6C C;  2P7V B;  1FBS A;  3ABU A;  5D8K B;  2IP2 A;  1I1S A;  3BOQ A;  4HOB A;  3RKW A;  3KFW X;  3R61 A;  2EFN A;  3EQL F;  3QOP A;  4ZYE A;  4MTD A;  1BJA A;  2RN7 A;  3MWM A;  1QPM A;  3D5L A;  1QZY A;  1LQ1 A;  2RC4 A;  5ICC A;  2L02 A;  3DPT A;  2PMU A;  5ERI A;  3FMR A;  3ZP5 A;  1OKR A;  1KQ0 A;  1UST A;  1E2X A;  2ZO4 A;  3WG9 A;  3HUG A;  4HQM A;  2HKX A;  5CJ9 A;  2XAS A;  1IW7 F;  2YX4 A;  3ELK A;  2YR2 A;  3HRU A;  1FYM A;  2ADU A;  2GAU A;  3J80 K;  2XVC A;  1NHA A;  5DYM A;  3DF8 A;  1MZB A;  3T8T A;  2X0L A;  1STZ A;  3EYI A;  2CSO A;  2MLG A;  2F5D A;  5CVR A;  1XD7 A;  4KDP A;  1FWZ A;  1PP8 F;  3JTH A;  1YW9 A;  5DUK A;  1BI0 A;  2UXN A;  1IXC A;  2TDX A;  4KIF A;  1F1Z A;  1R23 A;  2JTV A;  3IHU A;  1B6A A;  4EVI A;  5HOO A;  4MNU A;  2FBK A;  4BAY A;  2G7H A;  1W4M A;  3L09 A;  2G9W A;  2BE5 F;  2RQP A;  4A5M A;  2VOO A;  1L0O C;  1KYW A;  1TQM A;  2EJR A;  4BYY A;  2QWW A;  4G7O F;  4CYD A;  3NQO A;  4IRI A;  2MH2 A;  3P7N A;  1TLH B;  5A2Q Z;  1D8J A;  2HQR A;  3HRS A;  4L18 B;  4EGY A;  5DDG A;  2VC0 A;  2E7X A;  4HBL A;  2V79 A;  1IN4 A;  3E5U A;  3HTU A;  3I58 A;  3RI4 A;  4HA8 A;  2EV0 A;  3IRQ A;  5LLQ A;  2F5C A;  1PDN C;  2DI3 A;  1T98 A;  3E5X A;  4Q4Z F;  5L3G A;  3MAJ A;  4Q5S F;  4A6D A;  3C7J A;  1P92 A;  5JFR A;  3TKY A;  5FD5 A;  2O61 A;  2FRH A;  5JI6 A;  2EWN A;  4EGZ A;  1XGS A;  2EFO A;  1DPR A;  3SFZ A;  2ZJ2 A;  4L9J A;  4A2U A;  2Z9O A;  5BS6 A;  3WTS C;  1O3Q A;  4XBF A;  4I7H A;  3ZMZ A;  1WSU A;  1G3Y A;  2L4M A;  4LLN A;  2DO7 A;  1R1T A;  4OIR F;  3R60 A;  5E1X A;  1LDD A;  1P2F A;  3GW2 A;  3E97 A;  2HZT A;  5LGU A;  1O57 A;  3LQR A;  3QAH A;  1E17 A;  3I64 A;  1G6N A;  3OV8 A;  2K7L A;  4F7Z A;  3P9I A;  4XSZ F;  3WTU C;  1R00 A;  4I0B A;  4HQE A;  4IJA A;  2BV6 A;  2CYY A;  4M9Z A;  3LA3 A;  3F21 A;  1YG2 A;  2ZNY A;  3F8B A;  3TDU C;  3BZ6 A;  4YII A;  3K69 A;  3KP2 A;  4KFC A;  2XRO A;  1MKM A;  2FSW A;  1YQA A;  1TNS A;  3NRV A;  3W6J B;  2OA4 A;  3QRF F;  1ZG5 A;  2GXB A;  3TO7 A;  3R6S A;  1R1V A;  1IAW A;  3R0A A;  5AIP A;  4HW0 A;  3LFK A;  5D5W B;  1XGN A;  4YIF A;  3EUH A;  3K1N A;  1UCR A;  4OIQ F;  5CVI A;  3N97 A;  2M87 A;  4G7Z F;  3CDH A;  1YS7 A;  1FYL A;  3K1P A;  1TQP A;  3EET A;  1J7K A;  4TV7 A;  3FMQ A;  3VB2 A;  5D5U B;  1DUX C;  4JBA A;  1LDJ A;  4RB0 A;  2A6H F;  5E8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...