4H0FA

Mutant structure of laminin-binding adhesin (lmb) from streptococcus agalactiae
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
264
structure length
264
Chain Sequence
GMSVVTSFYPMYAMTKEVSGDLNDVRMIQSGAGIHSFEPSVNDVAAIYDADLFVYHSHTLEAWARDLDPNLKKSKVNVFEASKPLTLDRVKPGATVYDPHTWTDPVLAGEEAVNIAKELGHLDPKHKDSYTKKAKAFKKEAEQLTEEYTQKFKKVRSKTFVTQHTAFSYLAKRFGLKQLGISGISPEQEPSPRQLKEIQDFVKEYNVKTIFAEDNVNPKIAHAIAKSTGAKVKTLSPLEAAPSGNKTYLENLRANLEVLYQQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal binding is critical for the folding and function of laminin binding protein, Lmb of Streptococcus agalactiae.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Cell adhesion
molecule keywords Laminin-binding surface protein
total genus 87
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4h0fA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4h0fA02
2XDQA 4HMPA 2M6LA 3UJPA 3PSAA 5BVHB 4FNAA 1N2ZA 5HDQA 3AEQB 2AFIB 5CX1B 3ZK8A 4TKVA 4WESA 3BE5A 3HJTA 2PRSA 3MD9A 4MO9A 5CR9A 1QH1B 2AFHA 4FKMA 1G21A 1TOAA 4H59A 4WZBA 4XPIA 4FI3F 4ND8A 3AEUB 3MWFA 3AEKA 5M29A 4MX8A 4B8YA 1KAHA 3ZK9A 4MLZA 3U7QB 1KARA 4FILA 5KOHB 2XUZA 5JOQA 2WI8A 1MIOA 4WNAB 1FP4A 3MINA 2YNMC 4WN9B 1QGUA 3ZKAA 2ETVA 4H0FA 5JG7A 4WZAA 2OV3A 4IRMA 3HH8A 3AERB 3ZK7A 1PSZA 2QI9F 5KOJB 5M3BA 3BE6A 2PS0A 4MDYA 1M1YA 1QH8B 3AESB 3R5SA 3K1AA 4GICA 4INPA 3TEFA 5GGYA 2MINA 1N2CA 4INOA 1PQ4A 2OV1A 5M34A 3PDIA 4LJSA 4CL2A 3CX3A 1M34B 4OVKA 4HN9A 1M1NB 5BVGA 1G20B 1H1LB 4OXRA 3AETA 1L5HB 4TKUA 4UDNA 2XDQB 2X4LA 2WHYA 3ZTTA 5HX7A 3EIXA 4DBLE 1ESZA 5BVHA 4K3VA 1K2VN 3AEQA 1N4DA 2OGWA 3TNYA 2AFIA 5CX1A 2PHZA 4TKVB 2R79A 4WESB 2M6KA 4OXQA 1K7SN 1EFDN 1QH1A 2AFHB 1G21B 2PS3A 4WZBB 4XPIB 5GGXA 4ND8B 4NNOA 3AEUA 3AEKB 2O1EA 4M7OA 5I4KA 4PM4A 4PAGA 3PSHA 1K0FA 2RG7A 3R5TA 4NNPA 3U7QA 5M2QA 3G9QA 5KOHA 2XH8A 3TLKA 1K75A 3EIWA 1MIOB 3MFQA 5JPDA 4WNAA 1FP4B 3MINB 4WN9A 2R7AA 1QGUB 5FLYA 5JJ5A 3LI2A 4WZAB 3AERA 2Q8PA 3LHSA 5KOJA 3MWGA 2XY4A 1N4AA 2OSVA 1M1YB 3GI1A 1QH8A 2XV1A 1KAEA 5AFSA 3AESA 4HMOA 3K1AB 4BBPA 2MINB 1N2CB 2XQVA 5KHLB 3NU1A 4UTPA 3PDIB 5B58T 1M34A 2Q8QA 4G07A 1M1NA 5BVGB 2YNMD 1G20A 1H1LA 4LS3A 4N01A 4UTOA 3HXPA 3AETB 4G09A 4TKUB 1L5HA 4HMQA 2PS9A 4UDOA 1XVLA
chains in the Genus database with same CATH superfamily
1SUSA 3KQUA 2DBVO 3O94A 1XZEA 2BEWA 4B3FX 1Z34A 1KOFA 1KQOA 3UMMA 4IBOA 5JH7A 2V4MA 4F2GA 1H05A 3T3PB 4LF8B 4F04A 2DCMA 2GHQA 2ZRAA 5KTNA 3V34A 3VSCA 1UC8A 3GCZA 2DKNA 2QW1A 2MU1A 2WD7A 3GRUA 4MPJA 4TS1A 1RAGA 3K6JA 4UEOA 2A9JA 2XMRA 3RSFA 4BB9A 4B8YA 4BZZA 1M2OA 4LJ9A 4E51A 4TTRA 5CRIA 2H54A 2XTZA 3CH7A 4YP5A 2GILA 2AF3C 4IICA 2I4IA 4IRXA 1JXOA 1ZA2A 1Y6JA 3MGKA 4BE9A 2BHSA 4RPCA 3WLAA 5HQ3B 3KEOA 2ZRLA 4BGEA 1G66A 1GTVA 4K6FA 5AOVA 2V3CC 3LQYA 1NJFA 3EGXA 1PYGA 2QOEA 3I04M 2W6JA 5CA1B 4EDHA 1ST3A 2J0UB 5J2TB 3IMEA 1EHCA 2QN8A 3JS5A 3KWMA 3NS7A 2FEPA 1H2HA 4MWDA 1GSIA 2OZLB 3UANA 4Y1RB 3R5SA 4O4LB 3ZDRA 2IOHA 2X8JA 1P61B 3V1UA 4F1JA 4XDHA 5I5EA 3IT2A 5LP6A 2VN8A 1UODA 1NJ2A 1O4WA 1PR9A 2CNLA 4HDAA 4CLEA 3HUEA 3GMDA 2OMEA 2BKXA 3PQ2A 2O9JA 3UH1A 3ODPA 1ZKMA 5EZYA 5JRZA 1EVQA 4Z99A 4LWOA 4R8VA 3BS4A 1J8DA 1ECPA 1X0XA 1YZHA 3IQGX 4BLQA 1V8PA 2WE7A 3H7AA 1YTLA 4NCJA 5JMOA 4ZCTA 2O4UX 3EEFA 3MJEA 2QZZA 2Y92A 4X20A 4XTCS 4HBGA 3C7KA 4OXYA 4BB5A 3CJRA 5ER9A 3L04A 3PC8A 3G8AA 3IP6A 4HHEA 1V8ZA 5CA0B 2RIRA 1JEDA 5I8ZA 4P6VF 1TVMA 4G63A 2XMPA 3JQQA 3LSTA 5TC4A 5IBPA 2VCEA 1T1IA 1NQXA 2WAXA 1E7QA 2H92A 2W90A 4HQ6A 4NBTA 4BXOA 4DY6A 2XZPA 3IERA 4JLUA 3ICCA 4MP6A 2GFIA 3OCYA 4K6MA 1VTKA 5DRYA 5MDHA 3DE0X 3L4EA 2J08A 2A9PA 1V16A 3GJ3A 4JT4A 3HTXA 1WKVA 2HSZA 5JS1A 3ASZA 3Q1KA 2ZVQX 4H1TA 2QVGA 1A5BB 2QDKA 4QGBA 1JIUA 2EERA 2BBOA 1ZESA 2ZAIA 3B6MA 5HRAA 4FYWA 1IC6A 2H31A 4EJSC 1QIKA 3JQGB 2XOEA 3MGCA 5FYQA 2I8CA 4DCPA 1XJWA 1XTVA 1Z8FA 2C2MA 3R6DA 4CKWA 2UXBB 3DEFA 1OHHD 2ONYA 3JVUA 1IPFA 4NVRA 4NV1A 3VVMA 4D57A 2A4MA 2WAOA 4M3NA 2BJHA 2RK4A 3SSAA 5JCOA 1QAQA 1GGMA 4ALKA 5CB4B 2BGRA 3OFVA 3QLVA 5JXHA 5DBGA 3N6VA 3L7JA 3KWJA 3L8CA 1LDNA 3B52X 3D8BA 3QIVA 1CFZA 3S6JA 3TK1A 2P4QA 3EUFA 2AI1A 5FL3A 1FB5A 1JDPA 4BL5A 4BEBA 2XUPA 2C8KA 4GG1A 2MYUA 4G97A 4BWGA 4OQNA 4LQCA 2P3LA 1T3GA 1TM4E 4HF7A 4QXQA 3GEIA 4B0PA 3E2PA 1KJ9A 2PUTA 2R85A 4B4OA 2BGNA 5IWAB 2NOAA 1C29B 1W25A 1HRDA 3K09A 3OOYA 4HZGA 4ND8A 3OEED 4NG5A 5C7LO 4XIJA 3GLGE 3PR3A 1F48A 2O2XA 1CJBA 5IAEA 1IEVA 1I2MA 1EWRA 5ELMA 2A0UA 1NLUA 2FMKA 2NXJA 2QYTA 2MCFA 4TMKA 2XRMA 2ZTSA 3MUNA 1DJPA 1G8SA 2AOWA 4QXMA 2UVPA 1JDSA 5C2JB 4P4GA 3Q3EA 3VYTB 1XCBA 4G0NA 1S96A 3D3NA 3JATB 2GS9A 4NDNE 2UYOA 3CUVA 4G85A 2PKCA 3OSZA 4ZT6A 3TX6A 4Q4CA 1CRQA 3WHPA 1KO1A 1O54A 4V0LA 3KYDB 5D3MB 5AK5A 5AUPB 4MJ3A 5A0VA 2R1UA 3IHLA 1YZQA 1CY6A 1FJHA 4MWSA 3P4UA 4NU8X 2P1RA 3LBAA 1MQ9A 1DADA 1BA2A 3O8BA 3KPUA 2IHUA 5T4EA 4H08A 3EVGA 4C2BA 2VVTA 4LHEA 5JAUA 1UMBB 1G20B 3DT8A 3VKUA 2F4NA 2AJTA 1R15A 2ZJ0A 3ICWA 5JS7A 2W6ZA 2QEQA 4UTNA 2VPQA 3V4LA 3A7DA 1EHYA 2BAGA 1YZUA 4I14A 1KY4A 2JI4A 2ZR9A 4RMNA 4YREA 3TUIC 2PSSA 1TNDA 3GK3A 1E9BA 1WXEA 3PEEA 2J4CA 1XWIA 2OGSA 4HGNA 5EZYF 3E22B 2C96A 4DUGD 4ZCIA 4M0LA 4WCVA 4DLYA 1EWQA 3AGQA 1P18A 4FVTA 3HDYA 1BMTA 1U9CA 3KV3O 4D74A 4XR4A 3VUFA 2PQMA 3M0EA 1A7AA 3DOJA 5TF4A 5KNDA 5KYUA 1GVNB 4R5MA 2GUGA 1ENPA 2VJCA 5B6PA 3HXLA 4PV7A 3JAWA 2C9BA 1LJ8A 2JLSA 3DMDA 3WBKA 4Y6OA 2YUTA 1QFXA 3TL3A 5EPUA 5ISMA 1FFYA 1NXWA 4W5JA 3SIRA 4D0RA 4LJ7A 4MVWA 4KGZA 3JSXA 2OGZA 3LW8A 4HH3C 4XGRA 1EWYA 5JMTA 4OMCA 1Z7BA 1G0OA 1RR6A 3H5AA 4GNRA 4CLOA 1Y7HA 2E82A 4Q6WA 1IAVA 5AESA 4EI9A 2JAQA 2J7KA 3WYGA 4LRSB 4RJJA 1YA6A 1I30A 5AUNB 2AUMA 4I46A 1F0KA 2E89A 4FE4A 1S8FA 5DHUA 3OZCA 2W4QA 1TZKA 1X1RA 4XLLA 1UKBA 1M67A 1UBUS 3LUJA 3WQBA 4B3CA 2QQFA 1P19A 1E63A 5DMHA 1CTQA 1P7YA 3EXIA 5FH9A 1J8MF 2QTFA 2PD4A 2ZRCA 3A9TA 4BPBA 1U31A 3EFOA 3CWCA 1TW2A 3F8WA 4QLOA 4N7MA 4U2DA 4D0SA 1RPTA 3KR1A 3EIFA 3W9BA 3IB3A 4LS3A 2GFHA 4RDCA 3ORRA 3R75A 4UXIA 3RANA 3WA6A 3BE4A 4BLVA 3E8MA 5ERGB 4DCOA 3L7CA 1JKIA 2B2NA 2FZKA 3WMWA 3K35A 4P54A 3VA7A 2AEMA 3D6TB 3PI7A 1GQQA 1WPGA 4K9LA 2ZYTX 3E8SA 3RRMA 3OO0A 1KGDA 5FFFA 1NOIA 5HF9A 1P2FA 3LP6A 1OH7A 4MYUA 2D2IA 4YLEA 5ICCA 3FDJA 1M2KA 4WESA 1WQ1R 4KR9A 2D0IA 2WWWA 2ZI4A 4OFBA 5K0FA 4FIDA 4PWZA 3DDOA 4TL6A 2C7BA 2EFDB 3PS9A 4FTWA 1V3TA 5BV7A 4F1WA 2NSLA 2AR9A 1TJ4A 4GC9A 4UE3S 1RWOA 4X61A 1TDJA 4GMKA 3ROKA 1T15A 4CM4B 1WEKA 1DX6A 1OGYA 4DCVA 1DQRA 1LDGA 1DAGA 2B21A 3FF1A 2QRHA 1RYDA 2VDKB 3CIOA 4XIIA 4RZQA 1UBMS 3B9QA 4FILA 4K1XA 1FX0B 1ZOOA 3GUYA 3SYRA 2C5BA 5K45A 4B7AA 1QG6A 3CNEA 1Z4OA 3WQQA 4BFYA 1Y6GA 3DMFA 2RGWA 3F71A 2D6FA 1X94A 3G9UA 1KMNA 3SR0A 3D0RA 3DZHA 1E1QA 1PR0A 2F43B 3A6FA 3NEYA 3ZX5A 3GFTA 1IQPA 3DE5X 3VR4H 1VI6A 3IA7A 4GGMX 2XBLA 4G5FA 1S9DA 5T3YA 3JQ8A 1OFVA 2ID7A 1HUQA 3DAOA 1QCCA 3EG5A 4J1NA 5DSTA 4KGDA 2GTHA 1KU0A 2Q5JA 2WSMA 1YZLA 5F7OA 4P4NA 1T26A 4C5AA 1CZOA 1QNLA 2ACKA 2JH8A 3QE3A 1DBVO 1H2BA 2Z3VA 3R8XA 3WRVA 2FMUA 4EUEA 1TTQB 4LY9A 5DPMA 1IBRA 2CKMA 2Y4OA 4WXHA 4D3XA 1ZGCA 4RWEA 4NBWA 4US1R 4JJFA 4M7RA 1KBOA 1RAEA 2DUUA 3BSFA 4LRWA 5K4AA 4BWFB 3F74A 2RGDA 3CX6A 1ODIA 2Z1NA 4H6XA 4HS9A 5IBRA 2FDCA 1L1EA 2A6PA 3NUGA 1H5QA 2P2ZA 4F11A 3BCRA 2WK1A 5IC6A 3SWWA 2FX2A 4WLEA 3I9LA 4QOGA 4V0NA 6REQB 4PN3A 4HAWA 2WIJA 2QIPA 1MU0A 4B80A 4POOA 4ARCA 1IN1A 1ZKDA 2J09A 3N0VA 4P7GA 3L5OA 3ZVRA 4BJHB 5DI9A 1PJ3A 2YFQA 4RKRA 4HL6A 2Z2IA 2OZPA 3PYLA 3VHXA 3BA1A 2PLRA 2ZSEA 1RJDA 2IGTA 2IK8A 3QF4B 4WN9A 4N5DA 3HJGA 2Y0PA 1UJ6A 3VKVA 1FE8A 3MEQA 4Q9KA 3LOQA 2H57A 3TQHA 3VC7A 1L8OA 1SO8A 4HUQA 2I8LA 5AVKA 4AIRA 3L82B 8ATCA 1FRFS 2QQ0A 1AUXA 4EHIA 5IANA 3A11A 1W35A 1SU4A 3UWKA 3Q8XB 1CR1A 1EM8B 1X70A 2J0EA 3F7MA 4MB2A 3BXHA 3IUNA 4RFSB 3OLXA 5FI0B 1KQNA 4I50B 4PYRA 1JBKA 3I1IA 3DC2A 1YQGA 1QTNA 3NM4A 3PEUA 3RSLA 2FWMX 3GYBA 4MVYA 4U39A 1U0NA 2ZI6A 3AP2A 3DDNA 1O9GA 2QLNA 4O4IA 4ZT7A 4EYQA 2JVKA 4S3MA 3AHEA 3WYNA 2I1QA 2JL1A 2MR5A 3L49A 1VJTA 3FDXA 4JZYA 2AXPA 3NWPA 1BWPA 2P9FA 2WB2A 5CX1B 3HR8A 3D4NA 3KT6A 1IATA 1BQ3A 4F72A 3AR3A 1J1ZA 1Z5UA 3PNMA 5K09A 2OAEA 4OQXA 4K7JA 4XDGA 3PENA 4P7KA 4ZWNA 4CEHA 1T35A 5F2OA 5K8TA 3ZGYA 1ADGA 4DWVA 4ITRC 5GM1A 1FTSA 1JG1A 3UT6A 3NT5A 4QGHA 4A6EA 2VH1A 1C1DB 1SK9A 3MPOA 1RYNA 1EJBA 1UK6A 3MJ4A 4HEJA 1U2QA 2YQZA 2I29A 3THSA 2RGRA 4TSRA 3K4HA 4KBYA 1J9ZA 4G4GA 1WCWA 3GGPA 4L4SA 4AYWA 3WLIA 5C9ZA 1OIWA 1GOTA 1MJFA 3PL1A 5BOVA 1ZEMA 3JWHA 4CV0A 2AOTA 5AKZA 1MVNA 4B47A 4L4UA 2QTVA 1GNPA 4PSAA 4U7TB 1P0CA 3V7WA 2CXPA 2FPSA 3PNPA 1NWCA 3LGAA 4DIFA 5ALRA 2FPXA 4LY3A 4OJTA 1WPXA 4DC9A 4NWIA 1JQJC 1OXBB 5JAMA 5BT8A 3ZV6A 2WSSD 4YACA 3UKJA 2JI8A 3VTZA 2VSFA 4LPKA 4RC9A 5DLPA 4EH1A 5ESXA 3VR2D 3WRXA 2ZR0A 1G21E 1X3LA 3QMVA 4XARA 3OE7A 1TUIA 4QUJA 4TTJA 2VRNA 4GOND 5ALNA 2GEVA 1DI0A 3FGZA 1Q22A 1TM3E 2WIKA 4QUIA 4WLOA 4CF7A 3L0CA 4FX5A 4QNRA 5MGBA 2VUSA 1ZD8A 3TNYA 3WKCA 3G6KA 1ZK2A 2NAFA 2OL4A 3B20A 3EGVA 5IABA 2DR3A 4FBLA 5TPWA 2QJWA 2YC2C 4MQFB 2B34A 3TRDA 4F0JA 1GU1A 3GPBA 1Q3TA 1RXCA 4MRMA 2BGMA 3BRCA 1SHTX 1OXSC 2FFBA 2GEJA 4M9UA 2JJ1A 4E7PA 3G0IA 1KJNA 3EHEA 4BV9A 3R5JA 5DH9A 1XRSB 4JLJA 2O7QA 1U7ZA 4GI2A 2JGFA 1R8YA 4Q19A 5K2MA 3IL2A 1BX0A 3U3XA 1XCPA 3RABA 1YCHA 1W36B 1BHO1 2PWZA 1KK1A 4J49A 1M1XB 2NUBA 3NM6B 4ZU6X 4B4VA 1JU9A 3NTRA 4QYMA 5JY1A 4HOYA 1HH4A 1T3ZA 1U2SA 3BGWA 3K2IA 2RGBA 4NICA 5DGCA 4TV8F 3L40A 3C8HA 1OLSA 1JAIA 1H0HA 3T4UA 3INGA 4EI8A 1O8CA 2QPOA 3DTVD 1RWKA 2HT6A 4JYMA 4YUXA 2NT4A 2X5OA 2ZJ8A 2VHYA 3V8EA 4DHEA 3FNFA 3SQNA 1O8BA 4HPJB 1DXHA 2EKBA 1P0IA 2EGHA 1XQXA 3A4MA 3R3SA 1G55A 3W4JA 2AS0A 2MINB 4BMPB 4I8IA 5DWQA 2CXXA 5LA6A 4E33A 3TLEA 3O7MA 2HR1A 1X87A 4HYQA 4TZKA 2ZXFA 2IE0A 1B73A 1X19A 2BUAA 3EGEA 3H1BA 5AI0A 4IDPA 4C22A 2AUNA 2XZOA 3DE1X 4XVCA 4AL4A 3UB4A 2IH2A 5LUBA 1R4ZA 2R1ZA 4W7SA 3LQ4A 2OCLA 4MUGA 2M6LA 1Z0IA 2OXEA 1KDVA 1N5OX 3NFRA 1DX4A 5JBNA 2NM0A 2GWHA 1RXIA 2ICAA 3F49S 5EP3A 5JAHA 4JI2B 4LRYA 1JHVA 4LAFA 4CMHA 1YZNA 3VH4A 1LSUA 4RY0A 3L8MA 2O2CA 1SR8A 1KE1A 3ZCSA 3FJYA 4HNRA 1EA5A 3JVEA 1KYVA 3MJHA 1G1AA 5JNTA 4YO7A 3F3MA 4IXDA 4RVUA 3UK6A 1P0FA 4ZFNA 2P0EA 1JUDA 3O38A 3FHCB 5KNDH 2FMHA 4DNQA 2QWXA 3LF2A 2FUKA 3LPMA 5CDFA 5U1PA 1CQWA 3UY4A 4BMOB 2GJ8A 3DG9A 1OLUB 4CWAA 3S8MA 1F60A 3HBLA 3ZDZB 3AIIA 5KQLA 3KD2A 5JG7A 2NYAA 2C0CA 2EWWA 1ZVJA 1VB5A 1GL3A 1GCOA 1DKRA 3A1WA 3BMNA 3LVFO 1U02A 3NQ41 2W2NA 3KOXA 5E1DA 4ZAVA 5B3JA 1I9GA 3W1VA 5KWEA 3ETGA 2IZ7A 3PFIA 3D59A 4M21A 1DAMA 1K7YA 1K9SA 1JX6A 1SUDA 3KB2A 4ARZA 4FR0A 4FYXA 4F2HA 3HCCA 4F96A 1Y80A 5J2TF 1ZUWA 1KYTA 3ABIA 1AGXA 4G5QA 4NQZA 2B9EA 4OQLA 4YAWA 4IYRA 1T5OA 4J8PA 1L9KA 1MNAA 2OAP1 3WWCA 4MV7A 3ZQ6A 1YQEA 2E4YA 3IEUA 1N92A 1P8AA 1WAMA 3AFMA 3ANNA 3EZGA 4G5HA 4X8LA 4KE9A 3VYSB 3W6UA 2GLTA 3O0TA 3VPSA 4Q4HA 4RVFA 1UANA 1JDZA 1VJDA 4COOA 2ZUWA 3U2QA 2X4LA 3FGOA 2V1XA 3H5TA 4P4SA 3DEYX 4HLDA 4JI5B 2FLWA 4HX5A 4EVIA 1E64A 5H68A 4Y2QA 4J4TA 1Y3FE 5AKHA 4R54A 4UE2A 3O9MA 4LK2A 1EAYA 3BWMA 3D4IA 4MKRA 5TJHA 5D01A 1AA6A 1OLXB 2X0IA 2VWQA 4IDDA 1V7QA 4OJQA 5GGXA 4E7OA 3EX7C 1SCNE 4R41A 3TB4A 2WMYA 1YBHA 3O8LA 3REQB 2C4TA 2FRVA 4K2AA 2YMQA 3BXGA 5AKXA 5AOCA 2ZM5A 2AHRA 2CWWA 1L7XA 2JH3A 2RC6A 1ZH6A 3L0SA 1T24A 4UOQA 5CCBA 3R9XA 2CJFA 2CBXA 2IBMA 1P39A 4UHBA 4F85A 3RM3A 4Z9YA 2XWJI 5GJBA 1P2DA 2XTMA 2G76A 3O4IA 2JIOA 4FFDA 1LKZA 3U9SA 1X1EA 3HV0A 3KLOA 4D2IA 1RT9A 4BKMA 4FEEA 4EJSB 5IF9A 4KR6A 4G3XA 4HNVA 3O90A 1XZLA 3T7EA 1J9GA 3LYHA 4NAVA 3LVBA 2PKQO 2I71A 3KKQA 1UIRA 1DKUA 2RDMA 1KFEB 2G7ZA 4FCTA 2ACVA 4BO1A 3TLMA 2XUIA 4L7VA 2Q07A 2ZBEA 5CXSA 4PW0A 3KUUA 1JEOA 1LRKA 1WA5A 2OZLA 3C3YA 3EQ7A 3QWAA 2IH5A 3L8GA 1ADFA 16PKA 1IJEA 1G5TA 3KJNA 5H81A 5CJ2A 1YFJA 2LDXA 4JC8A 3F6SA 3OEWA 3N8GA 1YJCA 1YDWA 2V7BA 3GMTA 3ND9A 4Z0PA 3PRJA 3TINA 3KOZA 1QR6A 1HDYA 2HLPA 1W9MA 2V6GA 2HJSA 2ZJFA 4Y6GB 3T1HB 4NMMA 5KAMA 2ZM6B 2H1VA 5AKEA 3R3YA 4CV2A 5JALA 3U7FB 3U3RA 1ZG3A 2P8JA 3HI4A 4FMDB 3EA4A 3C3XA 3U9TA 3UWPA 5BN1A 4Z86A 2V7PA 3A32A 4IILA 4C7KA 2BFPA 3L8ZA 4Q01A 3W4IA 4W8OA 3AJ9A 4TKVA 3NHAA 1E66A 4RVSA 3GROA 4Q9HA 4CM8B 1RJEA 1H9AA 3FPGA 2PSDA 2AR7A 3HYCA 1CQZA 4NARA 4U7WA 2BMJA 4NBNA 2ESRA 1Z73A 1BFUA 1L5FA 3L7KA 4OP3A 1DUIA 4LC9A 3GEPA 4H3KB 4HPXB 2GK6A 3EDOA 4NK4A 1DTEA 5AXCA 2QQEA 3H9BA 3RC1A 3TOVA 5FLKA 3C5CA 1JJIA 2ZJ3A 2FPWA 4PAWA 2C20A 4KB5A 3Q1LA 4V1CA 4NRDA 1RVDA 4CJXA 5HZMA 1F7UA 1WDMA 1LRJA 1T4BA 4RA6A 2WW8A 2Z8ZA 5JLJA 1XD9A 4NV3A 4AXBA 1OH8A 1JALA 5BNFA 3K70B 3L8HA 2D5IA 2NV0A 1KPGA 1HFWA 2GARA 3ZHRA 4YPVA 2G07A 2VHWA 3MS4A 3G2HA 2AMFA 1S1MA 1DX9A 2IEYA 3OBIA 4LWPA 4Z49A 1QLJA 4QQKA 5B4VA 2DP4E 4L3OA 5FOTA 3F6RA 2XA9A 1R00A 1SD2A 1L4GA 1WKBA 2CNWA 3N75A 4LCJA 3ZWDA 2BELA 1GPLA 1FUKA 2C4WA 3H5RA 2JD1A 4GPIB 1RKUA 1PR3A 2WWRA 3PA6A 1ESCA 5DSZA 5BPFA 3J7TA 4KXQA 1XMOB 4L4RA 2RJNA 3AOEA 1XTSA 2Q3JA 4HNAA 1QOZA 2AJBA 3BIOA 4BRWA 4ZD6A 4NZNA 4DCTA 3V8PA 2FTKE 2ATCA 5DNDA 3RC7A 4LOJA 5I47A 2Q6OA 5JQWA 3TCXB 5K20A 1V71A 1F6BA 1NVDA 3H42B 5IK2A 1M8GA 4RD2A 2I2BA 3AUTA 1ECLA 1SUBA 1OILA 3BMOB 1JZTA 1KFKB 3CSUA 1L5OA 3KFXA 4L72A 4WZ6A 5C8ZA 3MSCA 5FUWA 5JMPA 1GARA 2CVPA 3U13A 4GIBA 4YA6A 5HE9A 5A4AA 1YKSA 1UWKA 3G9XA 4XRRA 5CVEA 4CZ2A 1Z4QA 1JAYA 1TEZA 4YRZA 1UK8A 2Y0DA 1E59A 4OK5A 2AQHA 4UHKA 4EUNA 4J6EA 4QTYA 4B2PA 4GOJA 5JFGA 1E3IA 1QGUB 1COWA 3DMTA 5A7HA 3PRHA 2R84A 3RTDA 1UCFA 1QFYA 3EWIA 1DAFA 4ZODA 7GPBA 4XB2A 3QOXA 2ZCJA 2QD5A 3OPNA 2B4QA 1UJ2A 5B3KA 1XNRB 4KFRA 4OXXA 3TZBA 1N4AA 1ZK4A 3OQJA 1GKLA 1PL6A 1CUGA 4RVNA 1GSHA 2EIXA 1NKVA 2IDZA 3MYRA 1G9XA 1G9SA 2QZPA 3CEAA 2HBRA 3HE3A 2VAWA 2VJYA 2R8RA 4QOSA 1QGAA 5DKFA 2X1HA 4PQRA 1I94B 2FP4A 5B58T 2B1QA 3DQPA 3SSOA 2C5GA 3VKGA 3QPDA 2HSDA 2PZMA 2BFNA 4LVCA 3KDAA 1A9XA 4OXNA 4IJVA 4RJTA 3AETB 4AZ0B 1SVNA 3TZQA 1UT5A 3SJZA 5I48A 3ZNNA 2X6QA 4HMPA 1ZJJA 1OAKA 2NGRA 1KIAA 3TLJA 4TMWA 4RKQA 4BV2A 2I7XA 3KT0A 3NOXA 4G01B 1KY2A 4P2BA 4FJ0A 4HAZA 1OIVA 3HB5X 1ZMBA 1VFNA 4J0HA 1SBNE 4X8OA 1YOBA 5MFPA 2CGEA 3UMVA 5G53C 2EOAA 3DEAA 5J2UB 2DQYA 1NBME 4B4UA 2J9XB 5EUCA 5AP9A 4X8MA 1VJCA 2DHDA 2GPSA 4FJ2A 2FJUA 3D8HA 3IE2A 3MBOA 4LTMA 1II8B 8MHTA 1BXGA 1DIRA 1GPDG 4GWLA 5WRFA 4HVCA 5JHHB 3IP3A 1R8JA 2RHDA 4KLCA 5IT4A 4GPAA 3FOBA 1ZJ6A 2ZK7A 2NV2B 2ECPA 1IL0A 2FK8A 3KFLA 1MB4A 1VXOA 4PFJA 5CTAA 4RX1A 3TTUA 3F7OA 5GY7A 2O52A 3BRWA 4J3NA 1SAYA 1HNWB 2WU8A 2O8BB 5KPJA 2V3VA 1LNZA 3DWGA 2YW9A 1NXXA 3G59A 3PXUA 3IESA 4OLAA 3M70A 1AKEA 5B6IA 4FN5A 3EXIB 5EXSA 4KXWA 1YWGO 2BP7A 3MLAA 4N5NA 4NKRA 2H07A 2Q6VA 4NU6A 5D6NA 3PDUA 1RYMA 4GKJB 3V46A 4M0PA 1L7BA 3FPCA 4BEVA 4FNGA 1Y37A 2WT4A 3IDZA 3DVQX 3B3QA 4PZPA 1MR3F 2D1RA 1HQCA 2P9YA 4O63O 4BOYA 3JVIA 3UV6A 3ONEA 2QMHA 4KWIA 3EIXA 4LZLA 2IOFA 3M4XA 3PDCA 4QULA 3BXOA 4BZWA 2Q1UA 5JASA 5JWRA 1X1CA 1AHHA 2DCUA 3C1UA 2WTUA 2WLTA 4P5DA 1LC0A 1J97A 4U1RA 4XX0B 1XBTA 4G26A 4Q34A 2NZVG 3V1KA 3W8EA 2YN4A 4II3A 5IDWA 3OM9A 4ZQBA 4B33A 3D7NA 4E1VA 1UDWA 2YQ5A 1WHSB 4ZGBA 4G4JA 1MLDA 4BCDA 5E0OA 1S0UA 3BVPA 4G0YA 2Q2QA 2G3YA 3ZH9B 1SU7A 5FFNA 4UOEA 3K0AB 2GO7A 3QH4A 5FWNA 4EM6A 2XRZA 5I6DA 4OU5A 1JIXA 2LGJA 4GSLA 1COZA 2X0DA 5JPDA 3Q3HA 2JZNA 1CXZA 1ISMA 2E1RA 2AXEA 3OFND 4HGZA 4GXQA 4QUBA 2VHQA 4AY5A 1J8QA 1Z3IX 3EWSA 3DD1A 4XDZA 2ERXA 5AM2A 4L50A 5BQ3A 3KQOA 2C92A 5HOQA 1TAHA 3W78A 4BKRA 2NO5A 1OH5A 4CT5A 3ZYZA 4CI9A 2QF7A 3FNQA 3DP9A 4ZQHA 1MC8A 2R1TB 3HBNA 3ZE1B 1PJ2A 4JLBA 4M9RA 2VTKA 4KO4S 3ZZ0A 2I62A 3ZCTA 3CPEA 1YHNA 3QU2A 4J4HA 1GZ6A 5KJ6A 1ZIYA 4D6PA 5LXTB 1IN7A 2ODBA 1QPBA 4Y1EA 2ZI3A 3K0KA 4IEFB 3WL4A 3AVTA 1SVOA 3RS3A 3WMFA 2OCPA 4TMXA 2FR8C 1QUEA 3QHPA 3GUCA 2RMKA 2OBFA 2YYYA 2X9QA 4OBEA 2HF2A 3OCZA 1L5VA 1XI2A 1KERA 4QD3A 3O9ZA 5HJEA 3KTAB 5JAPA 4PG7A 4BATA 4YI3A 3HB9A 4A16A 1DUSA 1JHQA 4KQ9A 3OHSX 4KFSA 2FPPB 1MRZA 4GE3A 2ZE6A 5KJEA 1AD2A 4OQDA 1K89A 1HLDA 1N6NA 1NVAA 3B1VA 3UJAA 1E6MA 1P0QA 1JFFB 1XA3A 3TNDA 3WI7A 5C51B 4DV3B 1N5KA 3CUUA 2C77A 3H2SA 2BMDA 3Q7EA 4YR9A 4W1PA 2ZULA 3QQPA 3DPIA 3PVZA 1C3OB 1T3TA 4C29A 2QX6A 4OD0A 1L4MA 1QLWA 2QN2A 4RK4A 3UAOA 3ZIAA 1E9EA 3HG7A 5ADUS 1H69A 5KYXB 2JJYA 3A4YA 3UFXA 1TAQA 1IWOA 1FRZA 5FBQB 3UJ7A 2AYXA 5C8YA 3PEFA 1A82A 3DSRA 1TMKA 4FOSA 3OU6A 2BBWA 2HIAA 4GW3A 4R8RA 5KI6A 5HKKA 2NU6A 3AYZB 1D1SA 5IN5A 4MV1A 2EAUA 2C03A 3VPHA 3P2IA 1M5UA 4MH0R 1H4TA 2UZIR 1I14A 2X76A 1LV7A 3FIUA 3NBKA 4GMFA 2HJHA 4K9RA 5G1OA 2X3UA 3GXOA 5C4IA 2Q4RA 4TV9F 4FHGA 3ROZA 4IIJF 4XM1A 5A7FA 4G9GA 1GD1O 1EFVA 1GRCA 1XNHA 1YQ9A 1HNZB 2RHMA 4OI2A 4JI0B 3AI2A 1XXHE 3BTOA 2W9XA 2XUFA 1LI5A 1XQ9A 3DE4X 3FWYA 3GLKA 3HXTA 3HWX1 3X1WA 4PBSA 4YRIA 1OREA 2MTBA 3PUZA 4HRVA 3TE7A 4YHHB 2E18A 4IZOA 3TQTA 1Q7CA 2PY6A 2OM2A 5EJ5A 5JH7B 4WBNA 5FBKA 2V7QA 2E7ZA 1VDZA 4UHDA 2DJIA 1UBOS 2R8OA 4DLSA 1X1AA 3TAHA 3RTBA 3SC6A 4YP1A 3ZI4A 1X7XA 3ENVA 4I81A 4PC2A 3AONB 1JA0A 3LO8A 4RAQA 3AEUA 3SJBA 4YP0A 1NLFA 2O1EA 1G5RA 5EIFA 2VTBA 1E0JA 1NRIA 2K4MA 5IJWA 3TFOA 4HXGA 3W04A 1E4VA 3LL4A 3CZRA 4F56A 3TR6A 4PSDA 2PGNA 3M6XA 1RRVA 2G71A 1F2TA 2EV9A 2W6PA 4R3WA 4QYTA 4ND6A 3UAZA 2ZYWX 3H0KA 2DUWA 3A1FA 1J09A 1QGZA 3LI2A 4WZAB 2ZIWB 4TMYA 3ACBA 2Z09A 2AOTB 3QWIA 4ACAA 2Y4NA 4ND4A 4XCVA 3NT2A 2VJPA 2J0UA 3LVQE 4EB0A 5KDOA 3RSQA 1WPQA 3KE9A 2Y1GA 3E9NA 4U2FA 4CQMB 2W8BA 1EG7A 4FS8A 2G5GX 3G5LA 1H9CA 1JLHA 2B83A 4R1MA 3AVUA 1URPA 4XM0A 4XD7D 4RL4A 1FTQA 3DLCA 1UWLA 3SZLA 1J1IA 3D8UA 3M1YA 1L1FA 1T3LA 4XE5A 3IIEA 1W2GA 2HNAA 5IVDA 5FX2A 1HLGA 2RARA 3ONNA 3FCSB 2GRUA 2IXAA 3QNWA 4J16C 1ISFA 3IDAA 3PNQA 2P9EA 1HYBA 1N0IA 3N2ZB 3OZEA 4IOJA 4X3CA 1Y63A 2FSUA 3IHKA 4RKYA 3PSAA 4CT4B 5TQ0B 2GXSA 2M9MA 4IGEA 5AO9A 4UFNA 1JSCA 4H4CA 1B14A 1N25A 1C4XA 1NN1A 4DCSA 2I67A 3CTMA 3NTXA 4MQFA 3CNNA 4GWKA 3MD9A 2OUIA 2XXAB 4J90A 2IV7A 2NUAB 2Y6VA 4LJYA 4JUAA 3P7MA 4JL6A 1GFZA 5KSWB 4B9AA 1GDHA 2FGKA 2IKSA 1BDBA 3RT9A 2C5HA 4MK4A 3SEAA 5AXDA 4L6CA 1VYTA 2X3YA 4LZNA 3SHFA 4BLPA 4YQFA 5IKXA 1E1MA 3LUFA 2HLHA 3QEAZ 1EDZA 1NW3A 2YV4A 2G5CA 2WM8A 4HUJA 2VWHA 2XD4A 3B6EA 4LYJA 2VNHA 1AKTA 1BEUB 4FBGA 3ZKAA 4B6JA 1M54A 4Z1MD 1PZFA 2IELA 1CEYA 1J0CA 3R3VA 1L5QA 4Y2VA 4ZMBA 2A8YA 4QBGB 1NMYA 4MMXB 4Q3OA 3BFPA 1S02A 4UNQA 1Y4SA 4P2GA 3TR5A 3HSYA 3FRHA 2XVZA 3CCCA 4AZVA 3FE2A 2YJTD 1O95A 4X1KA 1KHHA 2ZU0C 3JTEA 4HXYA 3ITKA 3FTPA 1TF2A 3I4LA 4Q4DA 4ZVSA 2NTVA 5LCXA 1J39A 1TW3A 4HN9A 4S1WA 3WGQA 4YCMA 3CVXA 2IHNA 1P31A 2FUG6 1H6AA 3RGGA 2QVLA 3BD8A 3NT4A 1LDEA 4NK5A 1Y8QA 3OTIA 1CEXA 1NM5C 4IIJA 4BQNA 5D87A 5BVHA 2JLXA 2JEZA 2ZB3A 3G2PA 2OOSA 4GYYA 2YOFA 3GEDA 2QRNA 4B46A 2GJAA 4E88A 1CDDA 4QYXA 4I5EA 3M3DA 1U8EA 1B15A 4E31A 5JXIA 3C3WA 4YCAA 3X44A 4YJ3F 4IDNA 4L02A 5F2EA 5TPZA 1MO6A 2GA9A 3FF4A 1CY7A 4KX5A 3D3WA 3D6VA 3J81A 3RAFC 4I1RA 3AWIA 4Y1FA 4AF7A 5JC8A 1CUCA 1BNCA 2P67A 1HDEA 2FMTA 1XPOA 3C3EA 2XE8A 1QHFA 3H16A 1OR8A 3NBUA 1JZSA 2ZJAA 4DTCA 1Y8CA 3EUWA 4RSGA 5JNLA 3OX1A 2GRJA 4QOFA 4ND7A 4YPFA 1YH3A 2G40A 3A1VA 1W5SA 4EIWA 3B3GA 5K6AC 4K05A 5HR5A 3MWDA 4TS4A 1KYWA 2BZGA 1IEXA 3DTYA 4O59O 2PE5A 5CK5A 4UTVA 2DB3A 4II2A 2YVKA 3D6FA 4P82A 1I3MA 4K26A 1E6WA 2PFKA 4A2WA 3IODA 3O83A 5TB5A 4AJIA 1DWQA 1C30A 2YRXA 1R0YA 3TRKA 3UICA 5FF9A 2CLEB 2ECFA 2GHRA 4D0LB 4B3BA 2G9NA 3M2TA 3DDUA 3HKBA 5LYJB 1HNXB 3LKDA 2DEUA 1UMBA 3MN1A 3DDSA 1E62A 3M3HA 1WQ4A 2QRLA 4BFTA 4PPGA 3HCBA 3AB7A 4FYYA 2XVYA 2C61A 1OA1A 2VUTA 2A5YB 3W1EA 1PGNA 2QAIA 1W87A 3DYBA 3PX2A 1YVDA 3Q3GE 3S28A 3UW1A 4KUHA 1C1HA 1CZKA 3WWYA 3FKSD 5E2AA 3C2QA 3O75A 3R9WA 1OXTA 4IDEA 1E9CA 1IVNA 5CGZA 3SQDA 4NFSA 3NIDB 5AKGA 3EDCA 4ZCMA 1F06A 3DF9A 4MUXA 3DOIA 3QLVC 5G41A 3O21A 4C0HA 5HZGA 4DGSA 1BIFA 2QZSA 1W59A 2GNPA 2BKUA 2O2YA 3EGOA 4OSEA 4TLDA 4C01A 3LPDA 3ZK9A 1EVEA 3H1TA 3LGSA 1NHGA 3PPIA 4GP7A 1NP6A 4JJ4A 1IMOA 1R9NA 3PKJA 1SKAA 2AFVA 5EP4A 5F78A 3VVBA 4S04A 3T7TA 3GJTA 3U0BA 4MNTA 1LDMA 4Y9TA 5K3FA 1WW2A 4EJSA 3F6CA 5DLEA 1P9NA 5I7SA 4B7XA 3WWDA 4IRMA 1M2NA 2LXNA 4TL9A 6Q21A 3DTVB 4R2KA 1SQ6A 5TT0A 1QQAA 2NUPB 5DN6D 1SUPA 1E4OA 3BDVA 3R3XA 2WU3A 4IO1A 3HJHA 3TLZA 1YZGA 2ZTMA 3OOWA 4HWRA 4P80A 4Y0AA 4ERNA 1YB6A 3B3FA 3WL5A 3CLSD 5CBPA 3BICA 3ACCA 2FSPA 4Y2TA 3KKZA 2I2WA 2JIQA 2FPKA 3I9MA 2XZDA 1PG0A 5CJJA 4M9ZA 3H2KA 4YV0A 3LCMA 3NNDA 1M7GA 2FSFA 4QBTA 1ZMXA 4XRGA 4BFVA 4FXOA 4YMIA 1M6NA 4C9BA 1W6UA 2EHJA 5ECGC 4GI1A 1U5CA 1NZJA 2CJYA 2NV6A 1KI6A 3DL7A 3L7NA 4IVPA 2ZIEA 1F6DA 2G28A 2LCFA 1UPAA 2V74B 4LTNA 1UM8A 2RGYA 4WKPA 4IMJB 4U8GA 1J7KA 3I2KA 4QUAA 5A62A 2K87A 4DDKA 2Q1XA 4C07A 3PG5A 4RIHA 5KDLA 4PG8A 2XI4A 3UJ6A 1K6XA 2F9FA 3R0VA 3PC8C 4EUKA 3WWPA 1VE1A 3ENKA 3IIJA 2WUVA 5SY9A 3B51X 3RSGA 4RK6A 4RHXA 3U7QA 5A2GA 4LFCB 3BSYA 2PZJA 2P9ZA 4DMCA 1TCBA 4QUEA 1U5BB 2FN4A 1WHTA 5LP6C 2JC3A 2ZE5A 1VL2A 3HKDA 1R8QA 4F38A 4DR1B 2CNOA 1JZQA 4XSGA 1OMOA 4OB6A 4Y3UA 1LNQA 4YDHB 1A27A 1K8ZB 2HHAA 1N1EA 1P73A 4GX5A 4QBHA 2NU8B 1R6AA 1XTPA 3C3DA 3JQ8B 2FZCA 4B32A 1M1YB 5JR3A 1QH8A 2ZXEA 3QA3E 4MQBA 7YASA 2VC2B 3KUDA 2ZRPA 1BX1A 5AKYA 3JRNA 4MUJA 2OO3A 1L7EA 1N36B 1SCUA 3NHLA 3VZCA 1PS9A 4AI6A 3X1MA 2IS4A 2O0MA 3QEMA 3V4PB 4DVJA 1W88A 3HVJA 3GPLA 2AH5A 4YMTA 2CUNA 4Y2YA 1DG3A 3RASA 1Z0DA 2G4CA 1XF9A 3BXEA 4DADA 2DLDA 2YWHA 3HJNA 2I0FA 2A5GA 4I5FA 5C35A 4AYTA 2XNHA 4BECA 1ID8A 1EK5A 3PC7A 1JU4A 1OFGA 4V1CI 2FWIA 1TKAA 1XNJA 3WNZA 3COJA 4O2BB 2D1YA 2PX5A 5EYPA 3EIEA 4NBLA 2W0SA 2Y67A 3M9WA 1VHWA 4LVOA 1NF3A 4X85A 2ODQA 5DTMA 5EJAA 4PO1A 1CIJA 2DFVA 1NUUA 3FYSA 3I0NA 1VB3A 2QMOA 2FEKA 2AMYA 4LHZA 1T0BA 5ILQA 5KYTA 4B7UA 4W5QA 4U9IS 1G4HA 2IF2A 3W2TA 3FUWA 4OBXA 4XYBA 1SCJA 1XF1A 4KXVA 3SOZA 1NDHA 1PJTA 1QGUA 2JAHA 3DHWC 3MPUA 1EFRA 2P9QA 2VQFB 4BJ6A 3TPFA 3HKEB 5ECDA 4P3NA 4J43A 5F1OA 1KKLA 3COSA 3R7AA 3FY4A 1C4WA 4EVSA 1VJ0A 4F3KA 2BMFA 1J99A 1YF3A 4ZCSA 3DDWA 2W6CX 5DBOA 4YCJA 1GWNA 2QLTA 1NVXQ 1OUMA 1U0GA 1XCLA 3LCCA 5KBYA 5K6RA 3BSWA 5D2CA 2ZIAA 2JRLA 1KFJB 1DQZA 1QSGA 2J8ZA 1LI4A 2W6NA 2WU4A 4JDUA 4RZUA 4X0EA 4B75A 1EBUA 2QT1A 3OQNA 3DFZA 3CX7A 2WIAA 3PITA 4M0UA 3TSYA 3L0OA 2C78A 3T7CA 1TO1E 2FA9A 4D82A 1H23A 1A5ZA 3ZS8A 3QBDA 5FUYA 4HCJA 5H9VA 3ZI7A 9LDTA 4LZZA 4AWXA 4R2XA 3SYLA 2P30A 2M6KA 4EY6A 1NF9A 3F6PA 3A1UA 4XM2A 3E9DA 3JWEA 3MIZA 4HDNB 5A9SB 4DA4A 1AK2A 2YZNA 1T4MA 4QRDA 3K5IA 1GYQA 2HJRA 4U9HS 1KMHA 2QD2A 4Y2SA 4YRTA 4YXWA 3V3TA 4B2YA 2IW3A 3X2EA 3KQVA 3KU4A 4GYJA 2GASA 5EUBA 4CTJA 3ZWVA 1TCUA 4ZV9A 2ZRHA 2J1LA 3O5AA 4WOKA 2XITA 5ERYA 3UG6A 4AB1A 5TEVA 3IS3A 3UXMA 2NQ8A 2FZGA 3B89A 5HW0A 4J1SA 4E5PA 4XWAA 3F6YA 2O0HA 3B2QA 4K6GA 1WXDA 2YY5A 3UMGA 1VRWA 2QTVB 4GRIA 4KLAA 4DDWA 1M2VA 3KVYA 5AJHA 3JWPA 2ID4A 4DRZA 1KEKA 1QE5A 1ML3A 1WCV1 1IB6A 3AH8A 1VHTA 2QR3A 4XWTA 3UTCA 5BNTA 3GNSA 3H75A 3MOGA 2V96A 4DC0A 4HK4A 2VQ6A 1KEUA 5F3DA 2HMYB 3D4OA 2GJ4A 1MABB 2AEFA 4GUDA 8LDHA 2W58A 1NQAO 3FN4A 3OURA 4P38A 4Z7OB 3ZN2A 3WFIA 3I62A 4DYDA 3EPPA 1JHXA 1KVTA 4WE3A 3W4KA 1PFQA 1E79A 1NVWQ 3FNGA 4G0UA 4WH0A 2PWPA 3FTDA 3HA3A 2XWPA 3GLVA 4QRIA 5FIUA 3TG2A 3NBMA 2H1IA 4ZQEA 1H8HA 1BMQA 1TJYA 4YQEA 3UBMA 3GVPA 4R1QA 4JB8A 4PLGA 3UOAB 1D6MA 5JUWA 4DT1B 3HJTA 3H6HA 1FSGA 521PA 3VR5H 4TRRA 2RI6A 2WJAA 3GCWA 3TN7A 4KXYA 3UMRA 3DWIA 5ICMA 1AV7A 4KGXA 3VR3D 4GM1A 5JVDF 1ODTC 2R6JA 4LV6A 4U7HA 1X74A 2YWDA 5AVWA 4RCVA 5KU1A 3CU5A 4L0MA 4DCUA 3NTQA 2J3LA 1ONPA 2IQIA 2EW1A 2GR9A 2OBNA 1NVKA 3GCXA 4MR8A 2VSYA 3VOTA 2ZBGA 3EGWA 3KQPA 3EYAA 1GCGA 1UXJA 2FFJA 1F9AA 4FMCB 3W7VA 1IY0A 3MJVA 4B74A 4MJ7A 2WOJA 2P2LA 4CFYA 2J5RA 1TTPB 3EPKA 5E4FA 5ALSA 5KOIA 1WV0A 3GRCA 2Q27A 1N8KA 2JPDA 2V55B 3I30X 3NEAA 3BJEA 4XA8A 3EODA 2HWUA 3N87A 1ZSYA 3P9YA 3JARA 1EFPA 5ES4B 5THXA 3L7LA 5DXAA 3VDMA 1T5HX 1QQ6A 4L4YA 1Z75A 3K8YA 4M6WA 4D9BA 3M6VA 3CX3A 4EG1A 3ZBTA 1Q12A 2ADFA 2SCUB 1L4YA 1NAHA 1NZDA 1Z7EA 3L6DA 3MJSA 5A5DA 1Y4AE 2YVAA 3D6JA 1DKQA 1UOEA 1PJLA 3LNCA 2H4HA 4U00A 5EZSA 2XGOA 3LLSA 4DKXA 1R0RE 4DM4A 2YW2A 5HX7A 4JYZA 3JASA 2C07A 3OC6A 2TMDA 2EZ9A 3SHTA 1JQBA 1U7UA 2ERYA 2GZHA 4F8JA 1U6JA 4AROA 4L3WA 4KVAA 3OQHA 3I39X 1SA0A 2BI7A 4ZHSA 2EBHX 3NC4A 4W1SA 3X1ZA 2X40A 4AWAA 4QUGA 3VDQA 1SU8A 2I7TA 3PDHA 4Z54A 1TC1A 1US8A 3IUSA 5SZIA 2Y6UA 1KP2A 3KC2A 2IPAB 1U28A 1NNI1 2D74A 2NZYA 1DARA 1JF8A 3HUDA 3KAPA 5H1YA 3Q5GA 2P65A 1DTWB 3MWLA 5HKAA 1XDBA 3I32A 1DMRA 5CFPA 3OZGA 4OAPA 1SVMA 3QVTA 4UCFA 4QQNA 3TZKA 4YMGA 3KR2A 5DT2A 5TQVA 3PJGA 1R27A 1TZCA 2FOXA 3E27A 4FCWA 5L8VA 1H0SA 3L3BA 3Q88A 4FINA 1FRNA 2W2TA 3DR5A 4L5AA 1QX3A 2PL3A 1Y3AA 1YZVA 1XZBA 3TJMA 4A23A 1WDWB 3UWOA 2YYZA 4ARZB 1FUEA 2VLIA 4BNDA 5KCMA 4JEMA 1X15A 1G3MA 3LZCA 3EVNA 3ELBA 3TOSA 2WT9A 5LD2B 3ZDQA 3I5MA 1P4JA 1KY3A 3GA0A 1P4SA 2GCEA 2ISQA 1NIPA 2V45A 5DFAA 1M33A 1KQPA 3D0QA 3PQ3A 1EUCB 4JU8A 4X7RA 3ZTWA 4NE9A 2DWCA 1QM5A 1BXRB 4PZEA 3KJXA 3N5CA 2FPIB 1IONA 4YDRA 3QPCA 3KO8A 1B8NA 2PBRA 2EXXA 3MBIA 3FZEA 1XU9A 2H29A 5F23A 4TTPA 4LOAA 1SURA 1PFVA 4RIGA 1OPXA 3FNIA 4CG2A 1B6RA 3HKCA 4KUEA 2QN3A 4TSFD 3MCAA 4UAJA 5AOAA 4JVSB 4HDCA 3AR5A 4R40A 2GK3A 3E0XA 1P9LA 3VU0A 2PN1A 3NYIA 3P0RA 3HU1A 5EJ2A 2PKEA 1BD4A 4HXFB 4CV3A 1QHEA 1VBNA 2XW6A 5I8PA 3LJKA 4MUEA 2NPIA 5FADA 3SHVA 1CZLA 3KAKA 3TLGB 1V4NA 2FK7A 2ODEA 4LRTB 3Q85A 4MPPA 2ZEJA 2FJPA 1ISPA 3L7BA 1I10A 4Q47A 3VSBA 2OXRA 5JZMA 4Z3OA 4ZOLA 4JVMA 5L51A 4MUBA 5BR8B 3NHZA 2BLNA 2VWPA 2XT6A 2BFCB 1U7HA 4YRAA 2D3WA 2EBWA 1PX2A 2I4TA 3NEJA 2ZSJA 4NI5A 3AUAA 1PT5A 1JEQA 1KZGB 2Q29A 1Z7WA 4CETA 3UB3A 2PS0A 1F1JA 3E1GA 3NC0C 4J7AA 3V48A 5HIAA 4G8CA 4DM3A 2Q4TA 2W2QA 4D8VA 3G1UA 2C2YA 3OZ7A 1QRRA 1Z5WA 3TD2A 3W06A 5CLFA 3KEGA 4QRHA 1SCAA 3MTAA 4QKQA 5LB4A 3S1AA 3O8OB 3HO8A 2F8TA 3KLMX 5L6MB 3MWKA 3LLUA 1UMDA 5IS2A 2XDQB 1N9ZA 5FAXA 1L4FA 4BB6A 1ZMOA 3PWZA 3N9IA 4K6CA 3AV0B 1RQXA 2QZJA 2BMEA 3TVYA 3GJ7A 3QXCA 1YB2A 3OD1A 4FGLA 2HW8A 4G5YA 1CJVC 3LT4A 1I5OA 1V47A 2C57A 4YP7A 3W5CA 1T2EA 5BUZA 1GKUB 4RMJA 3AU8A 4GBGA 2AFHB 5SY4A 2E4VA 3CZ5A 3G5TA 3IAM6 3P96A 3WNQA 3TF5A 1GY8A 4YJ3B 1ABEA 5KINB 1TE2A 5KKNB 3YASA 3A27A 3BL6A 2DQSA 3RVOA 2K7FA 3JYOA 1XPRA 3SMVA 2YHIB 4HEA1 4PZYA 1HA3A 1NZFA 2Q46A 2C7RA 3DV2A 3IUQA 2VATA 5CDTA 5HQ3A 3FOZA 1UF9A 4ZQFA 5K8VA 4OP2A 2OCXA 1PJRA 2Q7DA 1KKMA 1QH0A 2YN0A 2FPOA 4TT3D 4DV5B 2WWFA 1ICEA 2QV7A 4JJGA 4R2LA 3OEHD 4HDSA 4KN5A 5BXQC 1DP4A 1JRLA 3AUXA 3WXBA 3ZQKA 2Z5VA 3D5EA 1EWTA 5EJFA 1KGSA 2FN8A 2BVNA 3FHOA 1G8MA 4JX9A 2WNHA 3AM3A 4YAFA 1M8JA 3AESA 3TE6A 3STWA 3P5SA 1TQ2A 1VIAA 3SKXA 1PL8A 3QQ5A 5HQTA 2KHZA 4E2YA 1KI2A 5K3OA 3U4QA 1FNSA 4FU0A 3ED1A 3O73A 4G07A 3QMMA 2GSDA 1SUEA 3EQZA 4HAYA 3V8MA 4PQFA 4BQOA 1CR6A 2XAUA 3GAAA 4UDOA 4R1NA 5CBKA 5IJ9A 1E9AA 2XJ4A 1KC1A 2HF7A 4UU1A 2OEPA 2FG7C 1ZWLA 2GN1A 2OXTA 3FPLA 4RORA 3D5TA 3WGZA 3DZKA 2E49A 5FOWA 2I6UA 1SG9A 1SVSA 1VM6A 3ZKWA 4F3YA 2ZJZA 3DNMA 4KVZA 3RO7A 1BCRA 1POWA 5BR4A 5KOYA 3LXRA 1UKVY 5J23A 2BTQB 3KOWA 4WNIA 4IMRA 4DJ5X 1FVOA 2O05A 4FDVA 3DOCA 3RH0A 1YGPA 1YRHA 3UA3A 3C15C 2XYPA 2QD1A 4ZMRA 5A6VA 2HMWA 2BI4A 1N8SA 3EGIA 3VZSA 1YZTA 1Z18A 1Q7BA 4DIUA 4EFMA 5HMMA 3Q8MA 1A9YA 1PWEA 4JLNA 3N2NA 5EEHA 1Z37A 2J3JA 4A0SA 2QUJA 4MVJF 3T38A 1A9RA 5EWLB 4BBJA 2JFNA 5DTRA 1A8UA 1XFDA 1O0CA 3BUSA 3IEVA 1TAUA 1TPZA 1KQ3A 4H7HA 3ESXA 3HXQA 1LWNA 1NSTA 5I9TA 3HM2A 3QOYA 4KTTE 5A5GA 1T5DX 1IOVA 4IS2A 5E9AA 4G0OA 4P7FA 4WOCA 3VYWA 4A1FA 2LVBA 2L19A 1W96A 3H8SA 2VS1A 1NVFA 1GV1A 3AVPA 5DM4A 3TI9A 1RHQA 5ULLA 4N3AA 5L3QA 2WJ6A 4HB0A 4KBFA 1GZSA 2FZLA 4IKPA 4LOIA 2G77B 2QDXA 3T0IA 2EHDA 3F1KA 3E5NA 4NH4A 1FK8A 1W0JA 4IWYA 4LV5B 2WF8A 1SY7A 2ATEA 4TQUS 1V5IA 4TWAA 1L5KA 4BTLA 4M0EA 2C1XA 4CT0A 1ZI8A 2H1CA 2N1BA 2ZRJA 3R76A 3E9ZA 1JTEA 1TM5E 3IOYA 3U4CA 1NUHA 2Q4EA 1ZQ9A 3MS7A 4WFKA 1XFAA 4AC9A 1MKYA 2W83A 3IMFA 3QFTA 1IDOA 1ZM9A 4K6KA 4UVEA 4ZGWA 4KQWA 4MRAA 4GH5A 1I8TA 1M66A 3EMKA 3LUPA 1ZA1A 1HMYA 4K8RB 4Z51A 4JI4B 1IZ9A 1P4GA 3I3SR 1DTSA 5BW4A 3CNOA 1X7ZA 1HURA 2J3IA 2VQSA 2XAAA 1NQOA 4RV4A 3RUCA 4QICA 1VJ1A 4MIEA 2GAIA 5BR7A 1OTHA 1H2ZA 4M46A 4RCZA 1E9RA 4L73A 4X3PA 3ZJ5A 4D3FA 1K75A 1WP9A 1T1GA 2C2KA 2XOKD 1FP4B 1HE1C 3IUMA 3OHPA 3PEYA 1ZU4A 2Y99A 2UVPB 3KP1A 4UAVA 5HF8A 3ZH2A 5BSFA 3W5JA 2BFAA 2ZP1A 1Z4MA 2FXVA 5KTPA 1XVUA 5MFZA 4YRKA 3A1EA 4UQPA 5E4TA 1C80A 1TJNA 3EPHA 1AK1A 1QYIA 1Z7YA 2BBTA 3LC7O 2Z6UA 2IEAA 5AJZA 1TMOA 5DM70 5L45A 2F3UA 4GOOD 3KZXA 1Z5PA 1J2TA 1FFBA 4ZO4A 1JIJA 1I0IA 1MH9A 4TV9B 1IZ8A 3AI1A 3OBBA 1L5LA 2ZS8A 1OHHA 4DS3A 2HO5A 3C0KA 5EGNA 2QZ4A 5DLDA 3T1VA 1G20A 2I9KA 3VGPA 1IEWA 2ZRMA 3A6JA 3VR5D 1YB7A 1CZRA 5A06A 3RBVA 3NZEA 1Z4LA 1DXYA 1TK2A 3LKVA 1RM3A 2XR1A 3OIGA 3P20A 3F47A 4NPHA 1S3IA 4GGPA 1KI6B 1M5TA 3LGXA 3FUVA 4XTRA 1W34A 2FF7A 5I9MA 1EP2B 4MVJI 3AVYA 4R9RA 1OXKB 1XOIA 3MJTA 4XCXA 3LPCA 3LYLA 2VYVA 5H3HA 3DL4A 2NYUA 2VG8A 5C7OO 1UM9B 5AQ1A 1QCYA 3IEMA 2Z6QA 2SBTA 2VJDA 2BHNA 3MOSA 4KE8A 2FRXA 1CEQA 1MFZA 2EF1A 1T2VA 4B6GA 4DA7A 3U44A 1IK6A 3H2GA 3EZFA 4V3CA 1JSLA 1ADJA 5HBRA 5J5AA 4RGYA 4E3ZA 2A94A 4CCYA 3AIKA 5A5EA 2APJA 4UTZA 3GLUA 4BVEA 2PT9A 1I1HA 3PQ4A 4DLVA 1XB2A 1N34B 2P35A 1FYVA 1JQEA 2A58A 3R8FA 3VR4A 1K6MA 1CUDA 2BE9A 1GKIA 1WMDA 2OECA 1Z0FA 2J33A 3KX2A 4ALIA 3OPXA 3ZHXA 3EZXA 2HI0A 4FKZA 2QG6A 3CX8A 1ESNA 1BYUA 3GLRA 4PRKA 4AMVA 2PV7A 1NNSA 4HFRA 1Y81A 2GYUA 4TN5A 2JCXA 1UKCA 2JH9A 4R1LA 5DM0A 2ZGVA 1CDOA 2C9ZA 3HYTA 3EXFA 5CCEA 3ZXIA 1ISRA 3IV6A 1KJYA 1N2GA 1YBVA 5AM0A 4IWXA 2GTPA 1JEJA 4HDRA 4BKQA 4CKYA 1XK6A 3KYCB 2FVXA 4QDKA 1U3TA 2AB0A 3K0FA 4A6XA 1W88B 3AVQA 3WDSA 1C0IA 4C0JA 1GLNA 1RAHA 1QHHA 1S6YA 4OQZA 1LXCA 3BD7A 1MB0A 1JPNA 1N3IA 1AKQA 4MQ4A 1ULUA 1GFSA 3A3PA 5LMZA 2GJ9A 4L2IB 2JCYA 4MYRA 1JKXA 1NR1A 1OPRA 5GMOA 4BNTA 4WCFB 1XJCA 2AVNA 1RAFA 2R65A 1PGQA 4JOBA 1EFDN 2H4XA 2I2DA 4ER7A 5C46F 4I4TB 5PGMA 4W4TA 1JLMA 4TM8A 3JXEA 1GKYA 5IJZA 1AGPA 2FSVC 4EQ6A 2OLEA 1TGYA 2W6ID 1GHTA 3IPAA 3KLNA 2C4MA 5G4KA 5CEFA 1DCFA 1XZAA 2ZSFA 2ZVDA 2HM7A 4L9AA 4EG3A 2EARA 3RRXA 4IGFA 3WK4A 4OA8A 4MULA 4MQMA 1KNQA 1SG6A 3EEIA 3TZLA 1RTKA 2V97A 4LOHA 1NBAA 3KLPX 3PHJA 2I3ZA 4OQYA 3W2EA 1B41A 1IY1A 3FCXA 3V1MA 4G5XA 1VMKA 2IY9A 4B1FA 1JHRA 3AERA 3TLBA 2O7VA 4B6EA 2JLCA 3CH5A 2UYQA 3VM6A 1M83A 3V80A 2CK3D 1GR1A 1YL5A 2Q1WA 1GNRA 4TXLA 2O5CA 1E7YA 2BHLA 1DWPA 1RYBA 3K1AB 3QJGA 4HY3A 5THQA 3E82A 3O2NA 2JI6A 2I3BA 3EBOA 1TIPA 2O8EA 1QHSA 3NHYA 3AW8A 4BDSA 3HPQA 3OQBA 3CF2A 4YWJA 5JQGB 3AVXA 3SE7A 2FUCA 3RCBA 5BVGB 3C39A 2X14A 1EFVB 2PWAA 3BWEA 2RB4A 1J2YA 3EVTA 1FC0A 4FWBA 4I4TF 1KIFA 4RETA 2NXEA 2YJ5A 4JZKA 1CRLA 1RPAA 2PS9A 3GRRA 3LPLA 5AIBA 1KOLA 1AXEA 2GAAA 1P2VA 1TZMA 3AKYA 4RF5A 5LXTF 3S55A 4AS2A 7ADHA 3C6KA 1A2OA 1X6VA 1DL5A 5C31A 2OCAA 4DIOA 3QE9Y 5FA5A 4MV5A 5JSKA 3MYYA 4EO9A 3F5MA 3STVA 1LLQA 1ULBA 1EHIA 3L7AA 3ZXYA 4L08A 4JR1A 1C3JA 1NQ5A 3GA7A 3OVMA 4FI3F 3UPTA 1I32A 5C37A 4J0FA 5DU2A 3FYUC 3QXXA 4GUAA 2O0KA 4AUMA 4WXEA 5KWSA 3DONA 1AS0A 3I42A 5F21A 3A6LA 4ZAYA 1Z2DA 3UKOA 3IHWA 2AC2A 2H08A 2YJ6A 3G5MA 2A57A 3GRYA 3KKKA 1LBTA 4YBZA 3F96A 5TNXA 2WICA 4WZAA 3BTSA 2V7UA 2VWGA 4LFBB 1F38A 2IP1A 2YY7A 3M5CA 4UE6A 4RTMA 1LRLA 4PIMA 2PA0A 3RDPA 3E7PA 2BF4A 2ZCUA 3A31A 1EVKA 3F4LA 4ICIA 1ENOA 4RE6A 3RSCA 5C32A 1MEOA 2XDYA 1PR4A 2ZUSA 2MIIA 3B1ZA 1CIPA 421PA 4EA8A 1TI7A 4G4SP 4B6OA 3EZ6A 4NNJA 3UJDA 4KIUA 4EOGA 1QFJA 1E2EA 4HP8A 1PGOA 1JKJA 4LQ4A 4DSUA 3PHHA 1M34B 5SYAA 2B7BA 1DLIA 1N75A 4NESA 5AI9A 3UWDA 4W7HA 2QTMA 2GEDA 5JYEA 5LLSA 3UB2A 3FWPA 4P1ZA 3F78A 1N2EA 2GN9A 2IHJA 4A8PA 2RH5A 3PWTA 1IBKB 3FX2A 3KQWA 1K2VN 3KJZA 4GFDA 4WEOA 5EUQB 3VKWA 2H2WA 3VNRA 4B4DA 5HKOA 4R1UA 3W9UA 1TJPB 4EW1A 1Q6ZA 1F7VA 5C52B 1L5YA 1W5BA 1XVAA 4MINA 1L7DA 3I83A 1K3TA 5JS6A 4WY8A 4F9GA 5HE8A 1IXZA 3SC2B 3N07A 3QI2A 1B0UA 4EPTA 5HMLA 3L1KA 2VTDA 3F5DA 1KOGA 1GQ2A 1XDUA 2BF7A 1E58A 2OP1A 4H6VA 4XJSA 4M7OA 1K3FA 1X1SA 1MXHA 3D2BA 5K05A 4CUJA 4JLSA 5HP4A 2Q0HA 3RE1A 3GH1A 3TSAA 1RP1A 3RSZA 1C0EA 2QLFA 4PSCA 4ZCPA 4EZIA 3QYFA 1X9HA 3MFQA 3STYA 2D1FA 1ZN2A 2BSQA 4MR8B 2G63A 1QKKA 4ZREA 2B2XA 2VKTA 4YAOA 3RJTA 3WRWA 4L8LA 1NRXA 4O4HB 4JASB 4OLBA 2Q6IA 1I3CA 1ZD3A 4L8YA 4BN4A 3QEOA 3LFTA 1AQNA 3A0RB 1CQPA 3Q9LA 3DUFB 3V6MA 1DRUA 1E92A 3IXLA 3JQCA 4MVXA 5H70A 3VC2A 3KQYA 1KP3A 3NDJA 4BLWA 3P26A 1EZ1A 4QAJA 1Q0UA 1S8NA 1I1NA 5TE9A 4BLOA 4HPWA 8OHMA 1KA9H 5F4BA 3H2ZA 1XMIA 3FOWA 1R2QA 4KQEA 1TC2A 4L5CA 5EZYB 4CIAA 3BXFA 4G09A 1YR3A 3ZJYA 1O77A 1H2YA 1FVFA 2FU5C 4DARA 4E46A 3OFKA 3KQHA 3L0BA 1M6YA 2R8YA 5BRJA 1Q0RA 5AWFC 3S2GA 4M7WA 4PZZA 2FI1A 4O2AA 3RUPA 4LF5B 1UWVA 3RSSA 2PAAA 3UJHA 4WZAE 4X20B 1UFVA 2CNBA 5EQTA 3RS7A 5L3SB 4RULA 1MOZA 2WUGA 1LUAA 4WKCA 1UBHS 3FUCA 4DMLA 1VKHA 2WKRA 3HI6A 3VSDA 1HGXA 2SKDA 3HB1A 4UHCA 3U3DA 4XQ9A 2P4EA 4L5BA 1I7QB 1GLVA 5DF1A 4A15A 4I08A 2G8LA 4O4JB 2EQ5A 3AFGA 3GW8A 3UWMA 1IXRC 1C7IA 1LX6A 1NVGA 2BR3A 5E3HA 2YXLA 4G1FA 1KVUA 2ZJ5A 3K8OE 1QANA 2EX0A 4OJNA 1G2IA 1PT6A 2IYVA 5D8DA 5FL7A 3DLHA 4L8FA 1GRNA 1V35A 5BV2P 3N8HA 4DDMA 5ITWA 1SKUA 2HRZA 3MWJA 4GR4A 1YU6A 2QT9A 3P2YA 4RV9A 4RH3A 4HGQA 5JPCA 3L6OO 2P6OA 1W4BA 1ZD5A 4P3XA 1N5LA 2BKVA 3JU3A 1R8SA 1JQLB 5DHPA 5F9HA 1Q16A 2BSXA 4MOWA 3H5OA 4N40A 4OREX 4ZDJA 4UUOA 1R0CA 2BJWA 4YAIA 2PFGA 5KREA 5JATA 1KAGA 2QIOA 4INPA 4AP5A 3NBAA 3SEZA 1UZLA 4L1KA 1LA2A 2C84A 3GUUA 1DQPA 1T5LA 3WZLA 4MLDA 4RVDA 4EAQA 4KR3A 1RRFA 4UAUA 5HPYB 1UPUA 5JDIC 1Y8RB 2HK8A 4QJ5A 1K08A 2PDAA 1AMOA 4S1VA 2BT4A 4ZIRA 4ASUA 2J7PD 4ZZ0A 1C8BA 4TN1A 1WS6A 3AIOA 3FCOA 5A4IS 4N39A 4DN6A 1JGTA 1J06A 2O2SA 3RU3A 2JLZA 1NBIA 1QP4A 5CIWA 4FQ5A 3LD9A 2HCBA 3KQMA 4HVAA 5HM6A 2CJPA 3BJZA 1SH7A 3K30A 1LPPA 3N8DA 4Y6LA 3VTAA 2R79A 2CV0A 3E8XA 5CDGA 3ER6A 1Z7GA 1VG0B 4QOEA 3GDWA 4IHKA 5AHOA 3T9DA 3W05A 4QYIB 2R4TA 3JD0A 1D8TA 1OU4A 1SFRA 1ZIDA 2PMBA 3A4TA 3BMCA 3GGJA 1K7EB 3EVAA 4P34A 4ZICA 4X93A 3NBXX 1KO5A 4WD3A 1AF7A 1C14A 5ALHA 1H4VB 1PHPA 3F4BA 5BN4A 3B36A 2B98A 4TL8A 5BV0A 4MSUA 2QMQA 5FUQA 2A78A 5IH7A 1F2VA 4J0GA 1V6SA 1II0A 2BEJA 3EIWA 3H9CA 4PX5A 4EITA 4U2CA 4XWGA 4HV4A 2Z8XA 4FZVA 4KFTA 4F8YA 4D6YA 2FRDA 3DTVA 1FPQA 2VH5R 1I6KA 2I33A 2XKAA 3KELA 3RFFA 3W90A 1VSVA 5E1BA 4W1QA 1QO0A 3CZPA 2V7XA 4O25A 3QVMA 4Z9FA 4I4LA 3CRVA 4RGQA 4WVFA 5E6SA 1D2EA 1O87A 3DHVA 1UC5B 1WL8A 1Z68A 2WWHA 2DBZA 3JTMA 4GQBA 3TTXA 3VH1A 5KHOC 3QE0A 3L84A 3LUCA 3PLAE 1E1RD 4KGVA 2JAPA 3MOIA 4PZLA 5F2KA 3THYB 1W1UA 2JVJA 3RV4A 1G2PA 3PQ5A 4XKJA 3R0JA 1Z62A 2IL1A 4LGMA 4MW5A 2OY0A 3WRYC 2A1IA 2PUDA 2PM8A 4QBFA 2IJGX 1EYZA 1BS1A 3D7MA 1RYFA 2ZAYA 3FUUA 4NEHB 2WPDD 1MG5A 1QUFA 1WBDA 1VMDA 1EXWA 2QLJA 1RI4A 4GS5A 4C6RA 4R8LA 1U0EA 1XLTA 5ALJA 4ZXFA 3UHJA 2ZAGA 5C1PA 1NRJB 3IAEA 4BP8A 1ZGGA 2PZLA 1BDMA 4ATNA 4NHEA 2UKDA 2FZWA 3UGKA 3RVPA 5GOTA 1EXVA 4CU2A 3LC1O 4ZV4A 2DR0A 4F12A 1I4WA 1PVOA 1XUOA 4UUNA 2WYVA 4WK4B 5SICE 1YR9A 1SIBE 3O6VA 4PGMA 5EE9A 4BXOB 1XELA 4MPRA 3THXB 1N6KA 2GK7A 2VR1A 4ZVLA 2ZB7A 1EI9A 1H22A 1Y48E 3PFBA 4JJ8A 2CFOA 4PG5A 1BKYA 4X1YB 2OK7A 3RJ9A 1NGSA 3GY0A 3JY6A 4ZVNA 1ZWKA 3LPNA 4PHCA 4YT2A 4KXUA 1R8XA 4NTZA 4EO4A 2VRBA 3FPSA 3HL0A 5DWDA 3AINA 1QFZA 2PRIA 1DAPA 3E58A 5D1HA 3HLYA 3TD9A 1EFCA 2Z0MA 4PPQA 4B45A 4RAOA 2GPNA 5REQB 1IM5A 1E3LA 3T3HA 1BE1A 2CBZA 4NLLA 2J41A 3DC7A 4OEHA 1M1YA 4X1OA 5DP2A 3RS0A 3VH2A 3UENA 2Q7XA 3AESB 2DLNA 1IRXA 3UM9A 3W5UA 3BF8A 1YK1A 4INOA 4DWWA 3L6EA 5GADl 1TA9A 3FPHA 2PNFA 3HBMA 3GZJA 3FB1A 1XO1A 3H86A 3M6FA 3U4QB 1VSTA 2F1KA 4PEVA 1V9LA 2A9KA 4CMIA 2UZ0A 4ZCQA 1JNYA 1GPBA 3AT1A 2EKDA 4F3NA 1DG9A 1RCTE 2OR3A 2W6OA 2XCOA 3A6DA 4HWPA 4C0XA 1NRWA 1A8SA 3TR0A 5CB4A 5EIEA 4KIFA 3U16A 2JHFA 3AP1A 3JQBC 1UDAA 4MS4A 3MGGA 4R8MA 5FLXA 2H85A 4K9DA 3SZUA 5C5IA 1Z5OA 1NY5A 2HRBA 3FHJA 3SFVA 4ZEVA 2LUOA 4P4LA 3C8ZA 2GZ1A 4HG2A 3R3HA 4LC1A 4QAQA 4IIXA 4F6RA 1AKYA 5EIBD 1VFPA 2NXNA 1ZPDA 3I12A 4OMFG 1XYVA 5J4VA 5J2UF 3V4OA 3A1DA 1TQ4A 1QYXA 4XEHA 1EQ2A 3DVRX 1O97D 2A0WA 3DXZA 2V5VA 1ZY2A 3N5KA 3LUKA 4CM4A 2P2NA 4EFNA 1TYCA 1I80A 1HDGO 5GZ1A 1P9RA 1WR8A 4YVFA 3MT8A 2C1ZA 1YUNA 2DPXA 3HCEA 4ZI7F 4LMAA 4WV3A 1WUJS 5J4YA 3ZDEA 2DE0X 3E03A 1E3MA 2L42A 1B0PA 4NC9A 5EPEA 4LK3A 2OAQ1 3M4NA 1IVSA 3B3AA 1GILA 3K2QA 4YWHA 1TYDE 2O48X 5BN5B 2HFKA 4FR5A 1AH2A 2HZBA 1GVHA 5IDXA 3K6KA 1AE1A 3OZVA 5FPHA 1G16A 3STTA 3KYDA 4DKJA 3OLZA 1JTVA 4I1OA 3FSRA 2ZRKA 2A5FA 3I2FA 4WKOA 5K8IA 3AG5A 5LZ8A 1ZXXA 2H2GA 2QRJA 4WJZA 1ODCA 1YIAA 2BY4A 2F6RA 1R0XA 3JQAD 3UK7A 4K0KB 3PI6A 3CX4A 4WK6A 2DFDA 4WJKB 2J6IA 4EL5A 3RGWS 1YVEI 1Q50A 1ADBA 1K6IA 1ZGZA 2PFSA 2QJRA 2HU8A 4FJ1A 3NYQA 2QY9A 3E22A 4OK3A 3H5WA 3S2SA 5IASA 3U09A 2BEUB 2H9AA 2HMTA 1JJ7A 2QX4A 2BFBB 4KDRA 3SZMA 4YX9A 4L8WB 4BVHA 5A4JA 3EDYA 4XWKA 4H2DA 1QBGA 5ALYA 1PKXA 1SQ0A 4P33A 5IT0A 5KYUB 4W5TA 1MEJA 5EHGA 2HD4A 1QCZA 4DLTA 4BMNA 1KMCA 1Z45A 5F33A 3LP8A 5ENZA 4V2IA 2WJVA 4NL4H 3B12A 4LWQA 4K81B 2D7DA 1TADA 3KUXA 2P6PA 2YH2A 3HDVA 3SHOA 1PUIA 3GLFB 1SQFA 5AW1A 5FBVB 5A3RA 2H2HA 2X42A 3OUTA 4J29A 1K5PA 1SVIA 1JEAA 3CRMA 4X64B 2RD2A 2XNCA 3M6UA 1EXDA 2VYFA 4WQMA 1X80A 2J9FB 1I2ZA 1S3GA 2VAVA 1RXYA 1R9JA 2DH6A 2A7XA 2Q9CA 2J32A 3R7DA 3U1BA 1JEYB 2IWHA 4H7DA 2NPOA 3TAUA 2VJMB 3U7RA 5ICGA 2DPYA 2HK6A 3C8DA 4O2LA 4U2KA 4ZN6A 4FW8A 1JQDA 4A0HA 2CNWD 2REOA 1AKVA 3KSRA 1U65A 4NMXB 2GYYA 5K7SA 1SC3A 5KOJA 2G9UA 2I1LA 3KG2A 1OF1A 1PWYE 2NTYC 5JEEA 1MB3A 2LBPA 3D2CA 3EXG2 5EY5B 2NSDA 4UZEA 2Z5LA 2X1VA 2YJ4A 3KPWA 3KR0A 4XQGA 3UC9A 1OQAA 3FSGA 2XBMA 3WGHA 3HN6A 4NFYA 5IH3A 1VL0A 4YRBA 4GVLA 1BJTA 2C2ZA 2QUKA 3D54D 3R5FA 1GZ4A 1XKQA 3N0XA 5EQFA 3DP7A 2R9VA 1JV2B 2NMVA 3EGCA 2EU8A 3KAQA 3EEBA 3VGJA 1RPNA 3S2ZA 3B6IA 1LVGA 4KLNA 1LCIA 2JD2A 1KETA 3IDOA 4QFBA 3GLTA 1TKCA 2AUTA 2XUQA 4JSTA 4RHCA 3KLBA 5E6RB 5EP1A 2UUBB 1FU7A 2V7VA 1OA0A 4Q9JA 4ZI5A 3RVNA 3MMSA 2QAGC 1FX1A 1PO7A 5LVAA 1K0FA 3FYTA 1YRQA 3SXPA 2JAUA 1HRKA 5DULA 1Y7LA 3QVGB 5I9NA 3TZHA 1RJWA 2GBPA 1QG2A 4PQYA 1DAKA 3RYTC 3U4AA 4Z3DA 3CWQA 2ZJ7A 2GM4A 4OPMA 2QK4A 2F43A 1MRSA 2Q8PA 3HXOA 1JE1A 1VCHA 2C83A 2J4DA 3IIKA 4QQFA 3DEZA 2P4SA 3M9LA 1PNTA 3M5PA 1X7YA 2VDPB 4E4YA 3IBSA 5AVVA 3N7UA 2BP7B 5KYYA 1TYAE 1E96A 1ZOPA 3EXFB 4XIGS 2JLRA 3GJ5A 3T1OA 5JZOA 1UPXA 2GYWA 1OWOA 4YUVA 4DQDA 4PCAA 4S05A 2BZSA 4NS1A 1P2TA 1Z8HA 1M0WA 2WMNB 4L9SA 4ZJZA 1DOHA 3PQ8A 1Z2OX 2Y1EA 2P78A 4C1NA 3WL3A 2I99A 2PUCA 4BC1A 1RZUA 1MZVA 1MDFA 2UUPA 1XWWA 4HMQA 3ZVMA 4K46A 4XIFA 3WBBA 4UXHA 3PXDA 3VU8A 2E5WA 4UMDA 3RVMA 1FU4A 2QPTA 4S1PA 2A9OA 4BMCA 4ZRNA 4QM7A 3OZWA 4QQ8A 4GXTA 4Q39A 3SYNA 4EMSA 5BV8A 5K5EA 3O1LA 5ALUA 2C42A 4RSRA 3HWWA 3P9KA 4JLVA 2XYRA 4WCFA 4WZZA 4M1MA 3SIXA 1XJ5A 4TTAA 1RIFA 4PHHA 2JCSA 2KBFA 5K0CA 2WHXA 2M6SA 1L3IA 3L8EA 4BO6A 3FSEA 4PNEA 4UM8B 4QU5A 4YYEA 1Z0AA 2FSHA 2QLBA 3B70A 3PCXA 3WIUA 4EKDA 5JZSA 5G4KB 3TTTA 1VLVA 3L4BA 4JXKA 2OILA 4KKXB 5IU6A 3FPAA 3O8RA 4MV4A 3CG4A 1PF7E 3O4RA 2G06A 1F9EA 3SE0A 1K0UA 3SX0A 3IMGA 4P31A 4C2AA 5TJ9A 3JVDA 1V0JA 1OLSB 1WJGA 4YRNA 1T9HA 3H4VA 3M1IA 4GX1A 1NFRA 4F3RA 1PJSA 1D2GA 3H2BA 3NATA 5CFQA 1R37A 5J5CA 1LDYA 3AJAA 3HYRA 4PYOA 3K1AA 2FZVA 2GCIA 5AIAA 3U31A 4F86A 4ZO7A 2GPJA 4PX9A 1NATA 3PDIA 4IEEA 1ZNZA 3HK2A 1IY8A 3T99A 1M1NB 2I3DA 2LWIA 3OZBA 3PNYA 4X92A 3CPSA 3M33A 3IUJA 3A28A 1XRMA 5D3QA 2B99A 3NW9A 4B09A 3QVUA 2VZ9A 5DLYA 1RS0A 4RV5A 4MWEA 5ALIA 2DTDA 1OV4A 2BR5A 4HADA 3HL4A 3HUUA 4NOMA 3RYIA 5KVCA 3RC9A 3TGWA 4YK7A 5CX1A 3CVJA 2DY1A 1QZZA 3BHMA 3P1JA 4TLLB 1WUYA 3ZQJA 4QLAA 5K2OA 2ZYDA 4O8ZA 3U7HB 5KNCD 1QH1A 2VF5X 3IT0A 3EJWA 3QY0A 3SEFA 1SVKA 2GA8A 4DOMA 2JFPA 1W4LA 3T94A 4RDHA 3CG0A 1PL0A 4RHUA 2DT5A 4RMHA 1E1CB 2QTWB 4ECEA 3WAGA 1C3OA 2CMGA 4N7JA 1GPUA 2FFRA 4MB6A 1BEZA 2ZWOA 4GWGA 4YEDA 3V7YA 1ENYA 1T9GS 1YDHA 1F8XA 2QP9X 3NJ8A 3ORHA 3LIPA 1CQXA 4E11A 2ODNA 3S0JA 5DBFA 2O3JA 5KAPA 4EB8A 1P3DA 2CSUA 2H2FA 2UVQA 5J63A 4A8JB 4CCAA 3ESQA 1Y1KE 2OV6A 1G38A 4BRZA 2IYNA 2OHXA 3GUHA 1SXJA 1UEJA 1ISHA 4PAMA 2AD5A 4B6SA 1UXIA 4QOIA 5MN6A 5GPBA 4MMYB 2R0QC 2B8WA 5BN3B 2BGWA 4BQPA 1E2HA 1SELA 1NMZA 1NY6A 2XUOA 3T8YA 2W22A 1E3TA 4R2JA 1FXWA 5TGZA 4B83A 4CQNA 2DUNA 3F7NA 3KK0A 3MILA 3QE4A 4RDXA 3W34A 4GOXA 3CUWA 3L8FA 1PYDA 3I9V6 4TXHA 4YCDA 4DC1A 1CULC 1GLGA 3LQKA 3PFGA 5ALTA 4ZOLF 3ZOZA 3AR7A 1G98A 4I1VA 2TYSB 3HO1A 3A2LA 1N33B 3HRIA 3SLGA 3QVLA 4FZJA 2NSHA 5BSHA 4R8SA 1KJZA 3DO5A 4IAOA 2TS1A 2ZT7A 4EG0A 1QYWA 4AK9A 3CFYA 3ZK8A 2Q7OE 4WXYB 3LBYA 3NBZC 2FUEA 5G1NA 4R1PA 1P77A 2H3EA 3FJ1A 5EXPA 5CR9A 5IVPA 2WNIA 2ZAOA 3IP5A 1W5FA 4FZRA 4IIEA 1BZYA 2CFCA 4UMVA 2CMDA 2P1ZA 3H2HA 3IR6A 4MX8A 4XAQA 4B76A 4UEWA 2ATVA 2NWQA 1EEHA 4OHXA 4Z9AA 1ACJA 1VC2A 3TKYA 2CL0X 4CN9A 5FQOA 1O08A 3WZMA 3R8CA 2A30A 2P75A 3RTGA 1OV6A 1XDDA 3ZCUA 4FGSA 2WOOA 4ZVKA 2O7NA 1SKYB 3U3ZA 3UW3A 5AVZA 2JZCA 4I8DA 2XUAA 4K3UA 1M0EA 1GKKA 1NVTA 1U9IC 3HEMA 4H18A 4H1UA 5HKKD 2LIPA 4BO0A 1WXGA 4YPOA 4UTRA 1N3BA 5KQGA 2IV3A 2P2DA 4YGYA 1ZL2A 1VHLA 2C95A 2L17A 4CNBA 1JYFA 3PNVA 3BIWA 4HWKA 5JCJA 1W93A 2N0SA 2HMUA 4ER6A 5A3QA 3PA8A 1YUMA 4MDFA 1ZR4A 1XC7A 4CKWB 3ETNA 1M6VA 2OV1A 1UBTS 5B1HA 4DQXA 1G8AA 3ADCA 1IOWA 5HYVA 4GLBA 1LV8A 4I6GA 1ISGA 3I1YA 1GQFA 1VE5A 1FMLA 4JELA 3MTQA 1Q2UA 4K86A 5DNAA 4GO1A 1LDBA 4R1OA 1FQKA 3IDQA 4M8SA 4RSMA 4XZ3A 5E7JA 1F0NA 1Q1AA 4EW6A 1FJXA 2FWAA 1GTG1 1VLHA 2R8XA 2GN4A 4G4SO 3A6HA 5J3JA 2BCJQ 2PSFA 2PUBA 4CEJB 5EOVA 5FO1A 5DJ5A 1YCFA 1PVDA 2ODAA 4G86A 1QIGA 1UDCA 3A9RA 1Q21A 2H7VA 2PIDA 3EA0A 3URKA 4HDKB 3OY2A 4NYJQ 5L3SA 1ILWA 2XCIA 2BDTA 2DPGA 3L07A 3LT2A 3QIAA 2XRFA 4NYIQ 2FETA 4NMWA 5CMLA 4HEQA 1VG8A 3QX7A 5JSYA 1NBHA 4G25A 4Q1CA 3RHFA 3RVKA 3RYHA 1RJFA 3ZIUA 4AKSA 4AZTA 2YWCA 2JRCA 3E4DA 5FNVB 1C2TA 2ISCA 1L4NA 5EI5A 1HT1E 4HTFA 4WDQA 1E3DA