4H0HB

Crystal structure of mimicry-recognizing 2d10 scfv with peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
251
structure length
241
Chain Sequence
MEIQLQQSGPELVKPGASVKISCKASGYSFTDYIMLWVKQSHGKSLEWIGNINPYYGSTSYNLKFKGKATLTVDKSSSTAYMQLNSLTSEDSAVYYCARKNYYGSSLDYWGQGTTLTVSSAKTTGGGGSDVVMTQTPFSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2D10 scFv
publication title Structural evaluation of a mimicry-recognizing paratope: plasticity in antigen-antibody interactions manifests in molecular mimicry.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 58
structure length 241
sequence length 251
ec nomenclature
pdb deposition date 2012-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h0hB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h0hB02
5ACLA 5E08L 3BKYL 1FFRA 3HI5H 1VFBA 3P9MA 2P8LB 2P24B 3BISA 3JUZA 5AWNH 2LV4A 3QZWG 5ESVA 3FQWB 3LRSB 3EYVA 3WL9A 1X7QB 5I1AA 5K9OB 4GRMB 5JHLH 1UEYA 4UI2A 1NGZB 3KYAA 5I9QB 1HWHB 4OQ1A 5FV2A 4H1LB 5DJCB 1MJ8L 3FQNA 5ID0B 3DX9A 1S7XA 2JK5A 1DFBL 4Y5VC 3SDYL 5JW5A 3WIHH 3HAEB 4LPVA 1JNNL 3DUSA 5DF0A 4YWGH 1S9YA 4F33A 4NKIL 2HLFC 4OI9A 2ZUVA 3TT1H 4PGEA 5CWSA 5JW4Q 1KCSL 2BSRB 3FB8B 4YDLB 3P30L 1UKSA 4LCYA 5C0FB 1PY9A 2PXYC 4I3RL 3VXSE 4J3SA 4OUOA 3IFLH 4TVPH 4MAYD 1AI1L 2C1OA 4ZQKA 5I2IA 3JV6A 1JPGB 3CFBA 2R2BA 1EZVX 5DSCA 1JIBA 2MMXA 2FWOB 4MAYC 1QBLH 5D2NC 5EOQL 2PYFB 4NQTA 1UKQA 4YIQA 3NFPB 1XCTA 4X4XB 2P8PA 1QKZL 1HCFX 2BOBB 4FQ1H 1G84A 1HSBA 4X6EB 3L95B 2CKNA 5D71H 4YHKL 2F19L 3VFOB 3KPSB 1H5BA 1NANH 3TJEH 1W0YT 1CZ8L 1R3HA 1WLHA 2CDEB 3QQ4B 1AFVH 2VZUA 1NCUA 2GJZB 4OZHF 1XMWA 2PYEA 4LCWA 4MNHB 3V4VH 2BC4A 1KJ2H 1PLGL 4L4TE 1I85C 3QZWB 5IV2A 4ZOEA 4WTXA 3UTTE 1SJVA 2HTKC 3FRUA 4LNRA 2HG5B 4P4KD 3EFFB 4UQ3B 5DQDL 5DD3H 1KLUB 3ZHDA 4XMPL 4CVXB 1FVDA 4OGXH 1SY6H 1LO5A 3K8MA 5I1GL 2C4XA 3DNKA 2NY4C 2BVOB 5TF1L 3RQ3A 4P4KC 1FG2B 4LFHD 4ONFL 5E5UB 3ZT7A 1R5WA 1MUJA 3ULUL 5BOPA 2FD6L 2P8MB 1MRCH 2OL3A 5DHVH 3X13A 4JFDA 1EVUA 2X4PB 2A2QT 3VXME 4B7IA 1T83A 3GJFH 2JJWA 1U8HB 3LEYH 4KJYA 4NN5C 1TVHA 3WLWD 4XPBH 5KSBB 1A14L 4PLKC 1T2QH 1JNLH 3QDHA 4DN3L 4NN7B 1EHNA 1D5ZA 1RFDL 2Q86A 2PYED 4GKOA 4LCWD 2LVCA 5DS8A 1U92A 5IVXF 3NPSB 3S8WA 4FNLL 4HKJB 1HI6B 2AVGA 3NABL 4ZSOE 4KJPD 1KC5H 4NQEA 1RUPH 5GRJH 1RULL 3REWA 1BZ7B 3OB0H 1C7TA 2NZ9C 2QTEA 3EYQC 1HHKB 3V5KA 5F9WB 3S3PA 1JUFB 1LEGA 4BYHA 4P46B 3FHQA 2E7CA 5ADPH 5DLMH 1U93A 1J1OL 1ZT4A 2CIKA 3G04A 3A67H 4KFZC 1NAKL 4JFDD 2P5EE 5JPNB 5I19H 1KLGB 4P5TA 4U6TA 3R8BB 4F80A 3BRFA 3Q6GH 1MWAA 3QIUB 4OFKA 1MRFH 4M7LH 4ZFGH 3P4NB 4JRYA 3ARGB 1P9MC 1A22B 1WSST 3MLVH 3SKNB 1U95A 1YY9C 4PJ5A 4X0KB 2UZIL 1MCBA 4BQBA 3GZKA 5EZIH 1P4BH 2C3HA 2NY6D 3EHBD 2EDRA 3O4LE 5L9DL 1OSPL 3FB5A 5C0RL 1KEMH 3IF1A 4NQED 4L8SB 4NC0B 5C2BL 1CGYA 4CNIB 4X5XA 2X1PA 5J12B 4GXVH 4NNYA 1IM9A 5JOEA 5HYJB 1UJTA 5A43C 3QP3A 2P45B 1NGXB 3HC4H 1G7IA 5D7JA 1KENL 1MHEB 1G7QB 4P5TD 4NQDA 2R29H 3MA7A 1DN0B 2WBKA 4BQ8A 3G6DL 2ADIB 4ODVH 4JRYD 4ZG1A 3HNVL 3MLUL 3AS0A 4XTRD 4Z8FH 1FLRL 4JFFA 3U79A 4C56E 4PJ5D 4P5TC 3T0EC 3QO1A 5EIIB 4JM4H 1T4KB 5EU6E 5GGVH 5E5MB 4YHYB 4XVUD 2Z35B 2CJUH 3X14A 4MX7B 1C5BL 4KHXH 1RJZA 4NN6B 3UZQA 4N0FB 2H26A 4KPHH 1JWMA 1OAZL 4XVUC 4WTWA 1UH2A 4NOFA 1XF4A 1RU9H 5H35A 2PKDA 3FONA 1IM9D 2NW3B 2VDOH 3CCHA 3GI8H 1A2YA 5D7IB 1QBBA 4QRTA 3SDDA 3EJZD 5CZXC 1NCAL 3QUXD 2E7MA 5HI5C 3QDMA 1M05B 4WFGD 5DZOA 1T21B 2D7QA 4H26B 1INEL 4NQDD 1TMCB 4YFDB 4PJCA 3C08L 5E7FA 3EJZC 5KSBF 4E9LA 4MCZB 3QUXC 5KJRL 3LMJH 4PR5A 1UC6A 5F7WC 4JFFD 5C7XH 3C9NA 4LSTH 3HI5L 3KPNA 4I2XE 1V8HA 2XQYG 3PL6D 1A9BB 1MIMH 3CSBA 3K74B 3PWVA 4UIMB 1KIPB 4JRXE 3ZKXC 4O2FB 5HHNB 4JFPB 4PBXA 4JO2H 2VDMH 1QNZL 3C6SA 1I8LC 2NY1B 2AP2A 3ZL4H 4DN4H 3MOBL 3RIAF 3PL6C 5HPMB 1EXUA 3QIWB 5JHLL 2P5WB 3PHOA 4ZUSA 2BCKB 4DCQA 4OB5H 3DPBA 4Z7UA 1UT9A 1MFNA 2W60A 4JPKL 4O2EA 4NPYB 1FGVH 3T3ME 3SDDD 1EX0A 4Q2ZB 1UJ3B 5LCVL 3WIHL 8FABA 5T3ZH 1OF2A 2B5IC 4EDXB 2XTJC 3QDMD 1KG0A 3RJDA 5JDJA 1CFSA 3D18B 3VFSB 4V2BA 1XF3A 5ALBL 5FYJU 4TVPL 2H2SD 2YRZA 2VN4A 5DR5H 4NO3B 4GRLA 5HVHC 2R0ZH 3WJLA 3H9SA 4DGYH 4JZNA 3V4PL 3JWDH 4UNUA 4QTHB 1T5XA 2EE9A 2ESVE 4IOSD 2XZCL 3QEQE 4EQ2A 4M7LT 1G7LB 1WZ1H 4FQ1L 4P2OD 5BQ7A 2CLVA 1HHJA 1W0VB 3MV8B 4LLQB 5D71L 1F8TL 3NAAH 5I18L 3TIDA 4ETQA 1WFNA 3U9PL 1I7TA 1AIFA 5H94B 1AFVL 4MA3A 3ZO0A 5ICYA 4P2OC 2FJHA 4JQXA 4PJXE 4ZTPH 1XIWB 4PGZA 4CMMB 1EMTH 3IFOA 2OMNA 3V0VB 1VEMA 3DUHA 1WVZA 3V4VL 5EZLB 2CO6B 2MSPA 5MHSD 1WBXA 1W2KT 5F3HB 1TFHA 4TYUA 3MRDA 4GG6E 1Z9OA 3BXNA 2VQTA 5E2VH 1FFQA 1L7TL 3QIBB 4OGXL 3C6LB 1A1OB 1FL3B 5J11B 4GRLD 3GRWA 4J4PC 3DWTA 5IFJA 1GZQB 4P3DA 1WITA 1MFAL 3MRPB 3F6LA 4HUXA 1MCWM 3H9SD 3QDGE 2G9HB 3PWUB 3QPQC 4XP6H 2X42A 2X4NA 4I9WD 3FB6A 4IOFD 2EKSA 1KJ3H 3VXPB 1UZ6F 4WWKB 3MRKB 5KTEH 1MF2H 1CF8H 3VFMA 1MHPH 3F7YA 5F1IA 1JBJA 1PYWB 4OFYA 4LSQH 5DQJA 2PF6A 4CBPA 1RHHA 1T2QL 1JNLL 2HJFA 4H25A 4OLYL 4XCNB 1LK2B 5EIVA 4CU6A 2VWEE 4UDTA 3S5LG 2IJ0C 3RIFF 4KGLA 4L4TB 4NWTH 4XNUH 3EOAB 5FF6B 1AGBB 4S1SH 3W0WE 3PQYE 1H0DB 3VD4A 1KC5L 3ULVH 1RUPL 4N0UE 3OPZH 5F44A 3GMNA 5IB2B 4GAJH 1NJ9A 5E00A 5IMOA 4YFEA 4ZO7A 4LLMB 1DQLH 2BVEA 5ADPL 2GK0A 5IFAH 5DMKB 5HGDB 4MJ6A 3A67L 2ERJC 4LGSB 2FDBP 3FB7A 4D0CB 2NY7H 2NY0B 5C0DB 1EUTA 3GMQB 4U0QB 1QQDB 4YHIA 5I19L 5E6IC 3H2WA 4G8EA 1MY5A 2WWMD 3Q6GL 5F88B 3VXMB 1BX2B 5KG9A 3INUH 4ZFGL 5IMMB 2MOVA 1WISA 2CGRH 3RUGF 2QQNH 4OFYD 2A0LC 5F70A 5T3XL 3MLVL 4MNGA 4ZD3H 3M17A 1JYWA 3HI6H 3QXAA 2WWMC 1TIUA 4WNQA 1FL6B 4WHCA 3SDCA 1Z0NA 2HKHH 4KVNH 5ETUB 2XG4A 3QUYB 5CD3B 1EPFA 2VSCA 1FORH 1JWUA 3VRJB 5AD0B 4LBEA 1M7DB 3HZMA 2MQ3A 2WLYA 2Q3AA 1MCHA 2WAHA 1CFBA 4CDGC 4ZSOB 4GJTB 4GXVL 1A7PH 1NGWB 1Q94B 1KTRL 1WBYA 3C5ZB 2FSEA 1FVEA 1U41A 1X5FA 4OCMC 4UU9A 4LGPB 4F3FA 5CP7B 3T4YB 3S5LB 3L3OB 3ZMRA 4Y7MA 3HC4L 4CL7A 5I1LA 4TSCL 3SBWA 2P5EB 4PYHA 3GM0A 4P5KB 2I9TB 4HJJL 1MFBH 4FQIL 2D9CA 1UB5B 4TQEH 4R0LA 1IC4H 2ED7A 4YQXH 1IGYB 5C09A 1T6WA 3W5MA 5GGUA 3TPUB 2NQCA 4K2UH 4JM4L 2YR3A 4IDLA 2ZSWA 4PJ8A 1YJDH 5DHYB 3SE9L 1A9EB 3VWKA 2VLRA 3FRPA 1J0IA 4KROB 3RWIB 5IJVB 1X5IA 1J18A 3DXAE 3VMPA 2RFXB 3O4LB 4EVNB 4TN9A 2HVJA 3EAKA 4BSWA 5L8KB 1BVKB 1RU9L 1GJIA 5FDYA 4CUCA 2VDOL 3OJDA 5GS1C 5T1KB 2PTTA 4KI5C 2BVYA 4IJ3C 1NGQH 3D2UA 4XI5D 5EN2A 1KBGH 5SV4A 4ZO6A 2E6QA 1BFTA 4LCCA 4OF5A 43C9A 3HC0B 1P84K 3VI4E 4HJGA 3V4UH 1I8MB 5HVWA 1TITA 3TYFA 4XHJC 1PKQE 5EU5A 1T5WB 3LMJL 1V7MH 2E9WA 4LSTL 1KB5B 3U1SL 3VH8A 2I24N 1OPGH 1DBMH 1MIML 4KJQC 5EU6B 4JFYA 3RWEB 3KAAA 4KRPB 4U4BA 2SEBA 1WBZA 1CDBA 2VLRD 5J7CC 1OARL 2VDML 5GSRB 4O9HH 4P99A 4DN4L 3ZL4L 3BZEB 4N0CD 2V2WB 2CUMA 4WFEE 3MSPA 2HT2D 4JHBA 4MWFB 4AT6B 2UWEA 4NKOA 2VAAB 2BERA 4LRNH 4OB5L 1HKLH 3IXTB 1LDSA 2HFGL 4PY8J 5DFVD 2XY1A 2ZG2A 3D2UD 43CAB 4PJGE 4PRPE 1JTTA 4M7JH 4PJHA 4Y4HA 5CMAA 2FJGA 4WFFD 2OTPA 4XX1E 1NGYB 3DX8A 3DLQR 3TZVA 4EXKA 1BQHB 4LCCC 5DR5L 1XR8B 4UMGA 3AM8C 5EBLA 3TVMC 1K5NB 3RKDC 2RHEA 3PGCA 5H2BA 4I3GA 4YH6A 2VZ1A 3PXJA 3L3IA 4YHZL 2CPCA 4RZCB 3ULUD 5IEHB 1BIIB 2N1KA 3T0DA 1WZ1L 4OKDA 3IJSA 1AQKL 5F9OH 4LKCB 3SE3A 4KTDH 1ZHBA 5IEKB 3T8XB 3NAAL 4NKDA 2DIBA 1J86A 4P23C 4Z0XA 5FYKH 3ULUC 2YKLH 2Z8RA 2YBRA 4ZTPL 1AC0A 1EMTL 5IF0A 3H42H 4S1QH 4YDKH 4J2XA 3UJIH 2GSIB 4NRYA 3GMMA 5F93C 3RP1A 1GPOH 3LD8B 4Y4HD 5C0BA 1JHLL 1Q9KB 4NKMA 5KN5A 2WBJA 2D0GA 4YBHA 1CL7L 4YBQD 3TZVD 1VGKB 3QO0A 2FGWH 2W9DL 3ARYA 4V1DA 5CSBA 1T7ZA 3MC0A 3DRTB 4Y4HC 1P7KA 4BQ6A 4D9RE 3U6RB 2N4IA 1F3DJ 2ZUYA 1GZPA 3I6LD 4YBQC 5HYSB 3TZVC 1TJIH 4FQXA 3BH8A 2VDRH 3CMOH 5HYFA 3SCMD 2ESVB 1JRHI 1NDGA 3QEQB 1MH5B 1FV1B 3K1DA 1IAKA 3B2VL 5CKGA 5KTEL 1CF8L 4ODWB 4K7FA 3L1OL 3UTQA 2VAJA 3SCMC 3HZKA 1P7QB 5F96H 2O61B 4X4YA 4LVNB 3PDDA 3KPLB 2CIIA 1UKTA 3RWJB 4NWTL 1I3RA 2V7NB 4XNUL 2Z93A 1D6VL 3JUYA 4Z7WE 5E8DL 2V5MA 2WBJD 3QDJA 2QQKH 4GAJL 4OF6A 4V1DD 1NSNH 3MCLL 4ELKA 1DQLL 1RK0A 3RIFK 1MLCA 5IFAL 1F90H 5DD6A 4AM0A 4FQXD 3QDGB 4Y5YA 1XH3B 3MGOB 2EDFA 2IH1A 2DLFL 4UQ2A 3NA9L 4K94C 4ORGA 1RIUH 2VLLA 4D0DA 3INUL 3SGEH 1NBVH 1Z9LA 2CGRL 4FQXC 2QQNL 4P59H 3DVGB 5D6DA 3ARDA 5DO2D 1VFAB 5C0JB 4N8CH 3KJ4C 4WHTA 2AJYH 4PG2A 4QYOA 4HV8B 3GB7B 5C92A 4RGNC 3MLYH 3QUMH 2HKHL 3KPTA 4RGMB 1JYNA 1OT2A 1FNEB 5DO2C 4ZYKB 1I8IB 1FORL 4C57C 4ONOA 3G6JF 1JI2A 3BP5A 3LKPB 3MUJA 3PHQB 1TCRB 1B0RB 3D6GA 4JJHA 3W0WB 3PQYB 4KK5D 4JFHE 2E7LA 1CT8B 4N0UB 3EYUL 4JB9L 4PRHE 4U1JA 1A7PL 3MRCA 4XPAH 3MRNB 3TWCL 5IB1A 2GSGA 3AAZA 3D25B 4RFEB 4YXLL 5IM7A 2W59A 3C8HA 4Z76A 4AH2A 3RWFB 4WV1A 3VI3E 4OLZH 5IW6A 2F5BH 5BRZE 1HSAA 4MDIB 3NIFE 1QACA 1A6WH 3EGSA 1KCRL 3WIHA 4WIQA 2XWTA 5I73C 3A6CH 3A6OA 4OZ4A 1RIHH 4OF0A 4XCEA 1RZFH 4PJBA 2Z9TA 1JZ4A 3ARDD 5FA3A 5SX5K 4K2UL 4FTVE 3O3EA 5ENWB 3VA2C 1G7JB 3OXRA 3PJSB 4LPWA 1YJDL 5FM5O 4JPVH 3T3MF 3TIEA 3ARDC 3GUTB 2Y25A 1T89A 4GKZB 2V2XB 3C09B 3HUJF 3O0RH 1DDHA 1HINH 4PJEB 3S88H 3QEUB 3F6IA 5JORA 3O3DA 1KACB 5B21A 1JWSA 3QAZC 4JRWA 1YC8A 4XBGB 4M7ZB 3MLRL 3I2CH 5BZWA 3ZT5A 2GY7B 4I48A 3F7VA 1WQVT 3S4SG 5CGMA 1N2RA 2C4FT 3VJ6A 4GH7B 5TDOB 5EO9B 4DZ8B 1FIGH 3CAFA 2EYRA 3ILPB 4WV1C 3CMGA 3KLAA 5DJZA 1A1MA 1V7ML 3OBAA 4NHUB 5HHOA 5DRWB 3MRFA 4TVPD 1NEZB 5F9AC 3TJHD 1OPGL 1R3KB 1DBML 5JO5B 2ZCLL 4PJXF 4B5EA 2YUWA 5DK0B 5TPWH 2JE8A 4URTB 2C5DC 2GFBB 4IMLA 1OGAD 2VLMD 3ULSB 4RIRA 4LLUA 3K7UA 5DHVA 3DXAB 1ZHNA 2EDBA 3H0TB 3KPPB 4GG6F 2D7PA 4XX1G 3RNQB 3C2AH 4NM8H 3GJFA 2IPKB 1HKLL 4N9GB 2HLAA 3GSQB 5TDNA 3GMRA 4OGYH 3ALXA 3RGVC 3N1GC 3LSOA 2EE6A 2XKUA 1CGTA 4PB9H 4ZUVB 4ZFOB 3HNSL 1NDMA 4MXQD 1S8DA 2W07A 4FFZH 4L3AA 3BH9B 5ELIA 5T1DH 1B2WL 1RIVH 3MOAL 1ITCA 1F58H 4JM2C 5J1SC 5B38A 5IG7B 3RWCB 1K4DA 1IGTB 3O8XC 4MXQC 1WICA 5HHOD 1MREL 3VFVB 4H8WH 1TJHH 4QRQA 1F4XH 4PJDE 3U46B 3LKNB 3OKDB 4WU7B 2Y1VA 4WUUA 4NYLA 3EYOB 1GOFA 1J1XL 4R3SA 4MD0B 3I9GH 5IKCB 3ZHKA 4G6AC 3SPVA 3IFPB 4GKNB 3CK0H 4GQ9L 1F3RB 5IW3A 2NCMA 5DUMH 4ZS7L 4D9LH 4G43B 2YZ8A 4HZLB 2YKLL 4G9DB 2Q8AH 2VLJE 4Q6IA 1QVOA 3CJJA 3WN5A 3S36X 5DWUL 4ONHA 4PJ9D 4PJGB 4YDKL 1CDHA 4PRPB 3UJIL 1T7VA 4PYGA 3V0AC 2XWBB 5B8CB 3DI3B 3LEVH 2VL5A 2WIIB 4IDJL 4QCIA 2HFEB 5FO9B 5D6CB 1YMHA 3MUGA 3L5WA 4NQCB 1QHPA 4PJ9C 1I7UB 1MJJA 4PGCB 2C3VA 2LU7A 3RI5F 5IHLB 1T0MB 1QPPA 3BIKB 5JDSA 5AZEL 4X7SH 2JJTA 2X10A 5F97E 3V52H 1X5YA 2OI9B 5IESH 3CMOL 2E7HA 3BOVA 3KPOA 5J1AB 3MFGB 3ZDXE 1YEHH 5MENE 3GI9H 1UM6H 4NRZA 5EO0A 3B9KB 5D70H 3LVEA 1KSRA 3L3KA 3EYSH 4F9PA 2QL1A 3G08B 3K8LA 1TJGH 1JGDA 2X4TA 1DP0A 5FKAA 2DKUA 3L5JA 4NCDA 4XPTL 2DJUA 3JTSA 1CLZL 2CDFB 3OKLB 3TNNA 1HZHL 1NL0L 1NMAL 4S2SB 1Q1JL 4Y4FA 2BOCB 1CDYA 1X4ZA 3EFDL 1FPTL 5IIEA 1JMZA 4LPXA 2VZVA 1S7UA 3BX7C 2QQKL 1TVBA 1QZ1A 5IVOA 2W91A 3HC3H 4JPIB 4U0RB 3I3BA 1NSNL 2IFFH 3M1BA 3L5XH 3RZCB 2D2OA 3MREA 1N6QH 4BUHA 1YEKH 2GAZA 5BCAA 4P49A 1JPFB 4HIHA 1N7ML 1EBAA 3HB3D 3WMSA 1RIUL 3MUHL 4MD5B 1C08B 1IGIH 5ESAA 5I15H 4P59L 1MCQA 2R0LH 2MCG1 4NNPH 4QEGA 3QG7H 5BJTB 4PV9A 3OHXA 3MLYL 4G8GA 3QUML 5HGAA 1EA9C 4JY5L 4NBXB 3RDTC 4F9PC 5EZJB 5DZNA 3HHRB 5D7KE 2J4WH 1GHFH 5LQBH 1IM3A 3CLEL 4LIQL 3VI4F 2GCYA 5A3IC 3GSOA 1DE4A 4HIEB 3FFCE 2UY7A 4Z7WB 3LKQA 1U8QB 1XF1A 5GS2H 4XPAL 1IBGL 4OM1H 1ERNA 3MBXL 5DJDA 5F6IC 2JCCF 4NQXB 1MFCL 1WWBX 5EC1B 5HJ3B 4M9OA 2QSCH 2F5BL 4HX1B 3ARPA 1A6WL 2OTWA 4DFHA 1NUFA 2QSQA 1DUZA 2Y06L 3BEWA 5BO1H 1MI5A 3A6CL 4JFXB 5KSVB 3OTTA 3QI9C 1O5DT 1KF9B 5HDQH 1JHTB 4JKKA 4PGDA 3KS0H 2J1KA 4K71B 2DI8A 1BZ9A 4APQA 3O9WC 4G8GD 4FQPA 4JPVL 4QHLB 5LWYH 2G60H 4PJGF 4UOW1 2RBLA 4GS7C 3MV01 3FT3B 1X5ZA 5TH2B 2EDJA 1ZT7B 4O00A 5AAWA 1G9ML 5A2KH 5M7QA 4WW2C 3C8DA 1D5MA 4G9FA 1HILB 3NMEA 4XPHH 1HINL 1I3VA 5DJXA 2GTWB 4M5YH 1FYTA 4MA7L 1IKNA 1KB9K 3HE6B 4GKSB 2WWKO 2I60H 3S88L 3L3HA 5DD5H 1N64H 4PJCE 5K59E 5HHQA 4PRHB 1OAUH 1T0PB 3X3FH 3CFEA 2V5SA 5IGXL 3ETBF 3GNMH 1R0AH 4CVUA 4R2GB 4YXHL 4YHMH 2DQCH 3BWAB 5BRZB 2AKRA 3LPWA 4CMHB 5FYJH 4Y16C 1RZJC 1FIGL 2Y23A 4W4NA 1MI5D 3FQXA 4HUVA 1OY3B 2EO1A 1QA9A 3WS6A 4LOUD 2ORBL 1QSFD 1U91B 2CDGA 2H3NA 3R06A 4R7NB 4LSVL 4YJZL 5GGTH 4Q6YA 1TVDA 4MD4A 3ROLB 3UBXB 1D9KB 1NLBL 1WZMA 4N1EA 3MGTB 3VDBA 4FTVB 4WEBH 4APQD 3K0WA 4Z7UE 1RZ7L 2WUCL 4HT1L 5TPWL 2VXTH 4LFHG 4KQ4H 3GJEA 1JCKA 3MRGA 4QF1A 3SO5A 5ESQA 3MJGX 5DURD 4G9FD 1I7ZA 3P0VL 4LHUD 1BQSA 1FYTD 2XI9A 4JFZL 3K80A 4X99A 5KOMC 4O51B 4NM8L 3RBGA 1CI5A 3TH2T 1MJ7H 3JWDC 4PJAA 5FOBA 3MRIB 5DUBA 2Y6SD 1OTUD 1IKNC 3LN5A 2GUOB 4PB9L 1QEWB 4IRJB 2BRRH 2NPLX 3DO3A 4RAUA 3H3PH 4WU5B 2X44D 1CTNA 4HHAB 4M6OH 2JB5L 4ORZC 3RWHB 4FXLA 1S9VA 4HD9A 3FAXA 5FV1L 5GS0H 5FM5M 3LN4A 4CN4A 3DBXB 2CMRH 3GGWB 1CLCA 2HWZH 3L7FA 1TJHL 2VDPH 3IKCB 4LLYB 3WXWL 2FIKB 1J10A 1E28A 2ATPB 1A0QH 4UNVA 3RNKB 2V9QA 1ZT1A 1KPVB 1YMME 3NFSH 5C0CE 4AK1A 5I1JL 5I1EH 5DGQA 5AEAA 3QFJD 4PJIE 4RNRA 5CHNB 5DUML 4FQ2L 3I02A 4D9LL 4PRBB 3ECBA 1YY8A 2AXJA 2IH3A 3DUUB 4MCYA 4GG8A 3VXRA 5LXGH 3HPLA 2VZTA 1J05B 2R69L 3RTQA 4P2RA 4JN1H 3LEVL 3Q5TA 4MB5A 4HULB 1QFHA 1A7RL 1K6QH 1F11B 2HRPH 3LEXB 3KS0J 4J1UB 2VDQH 2G75B 2FHBA 2OJEB 5D1XA 2P1YA 3BI9X 5JW3L 1RZIA 5CIPA 4X7SL 5DVLA 3V52L 3S98A 5FCUH 3UTZB 5A40E 2MPAH 4PJDB 2YPLA 4HC1H 1XGTB 3ULVC 3DGGA 2V5YA 3IAQA 1U9KA 3I84A 1ZA3B 1EEYA 4ISVA 1YEHL 1NFDF 3TA3B 4QHNB 3GI9L 5D70L 3MR9B 3RI5K 3EYSL 4U7MA 3J7HA 4U1LB 5ICZA 4Y2OA 3F5WA 1TJGL 2ZP0T 3WFBH 1CICB 4OF8A 5L2JA 3VI3F 3VXRD 2VLJB 2NY2B 1D5XA 4LSUL 1S7QB 3RTQD 4P2RD 2E6PA 1FBIH 3MCKA 3U83A 1YUHA 2IBZX 3ISWA 4I1NB 1OGTB 5BS0A 3KXFE 2WUBH 1QHOA 4KDTA 3RTQC 4PJ7E 5D1XD 2Z0BA 1YEFL 4MNGE 3CDGA 4HH9B 5IK3A 3CFCL 5DFWH 3MV7E 2QHLA 1JZ3A 5C08E 1N4XH 2YPLD 4OIBA 1JF1B 4X8JB 3DGCR 1MCNA 1T20B 2VE6A 4UV7L 4I5BA 5IVZA 4M8QB 1R5IB 1IGIL 3EOYG 5HHXH 5MENB 5DUPL 4PTTA 4RFNC 1CGXA 4XH2B 2RJMA 1U3ZA 2R0LL 1Q0XH 4OJFH 4Z7VE 4EI5A 4YUEH 5IQ7H 4NCC1 4RMQA 1JNHB 3TBWB 1YEJH 2J8UE 3MLXH 4JE4B 3BMWA 1UWEL 2DQJH 3WNNA 5LQBL 2XRAH 4ZAKB 2AS5M 3KHQA 5T1LD 1G0DA 3GSWB 5GQBA 2AJSH 3HG1D 1KN4L 5BS0D 2DLHA 4DGIH 1IEAB 4HWEH 1AJ7H 1YJDC 1PEWA 5DTFB 4OM1L 4P4RA 5I71C 2ZG3A 2H9GA 4KKLD 3IVKB 1CTOA 1FO0A 3KYMA 2X4OB 4JZJA 1CE6A 4KUCF 1H3WM 3RWGA 2VKXA 3MA9H 1AHWC 4TTGA 5ITBH 3VFPA 3BO8A 2FZ3B 7CGTA 4IRSB 4OI8A 3MJ6A 5GSVB 1EHXA 2OR9L 3IGAB 4WI3A 5IFHH 4EIZC 2Z31D 4LCUA 3EYFB 3CFIC 4WY7H 5D7LA 4A6YH 5FUOH 2NTFA 3UX9B 4W70A 1G1CA 5GGSB 4M7KH 3P4LA 1G7MB 3F62A 4EI5D 2G60L 3BQUC 4U1HB 2Z31C 1KIQB 4Y4KB 4MLIA 2DBJA 4GMSL 1QBML 3OAZH 5KW9H 1KYOJ 4F57L 4K8RH 5DJ8B 2GK2A 1U3HB 3BPCA 1DQDH 3QHTC 1FHGA 3KPMB 1AKJD 2KZWA 4E41E 3FFCB 5DD5L 3LPFA 4BELD 1N64L 5FHBL 4FZEH 1OAUL 3X3FL 2PNDA 1R0AL 1KV3A 4YGVA 5FKPB 2DKSA 2DQCL 4NQUA 2OJZH 1YYLL 1W72A 3S36H 4X7DC 2AJUH 3OR6B 2L4OA 3NIDE 4OZIE 1EHAA 3FO1A 4L8CB 5I66B 4JCLA 4S0TD 5DQ9A 5ISZD 4P2QE 4LHJB 5GGTL 1ES0B 1KNOA 4MJIA 3MROA 3KG5A 4I77H 5KVFH 4WEBL 3SE4A 3L3DA 4XBEH 4ZXBA 3WUWB 2MKWA 2GITA 5E4EC 3VMNA 5ADOH 2VXTL 3HCVB 3B4NA 4KRLB 4R96B 4AEEA 2DMBA 4OBSA 1U2CA 5J9PB 3TEUA 3CFJA 3WUZA 4OF7A 5IVXA 1IFHH 4M9PA 5J13B 1BAFH 2A6IA 4AG4L 3FN0H 1DBAH 4FP8L 1XR9A 3O41B 4G3YL 3VFNA 3LS4H 2EH7L 4OCYH 4JKWA 2BRRL 4UTAH 3H3PL 3W39B 3F12B 2P8LA 3ZDXF 4OM0L 2P24A 4Q97A 4K3JH 4YBLC 1QLRB 2CRMA 1DSFL 3WDJA 3TM6A 4WVRA 3FQWA 2W9EH 3LRSA 4HGWB 3W9DB 1X7QA 2ZUXA 4MJID 5K9OA 1NGZA 2BFVL 4P9MH 5F7NC 4ZXBD 4HFWA 4XPFH 3SHSA 5DJCA 1AGCB 5ID0A 4OZGE 4S1DC 4RDQG 1RZ8B 1A0QL 3S6CA 5DHXB 1A6UH 3T0BA 3HAEA 4RA3A 2NYYD 3NFSL 4KHTH 3V5DB 5KVMC 3ARFA 1CFQB 5C0BE 3FB8A 1F02I 4TPRH 3C60B 3CVHH 5C0FA 2F8XC 4JQIH 2QSVA 1NKOA 4TNWF 3CSYB 1A4JB 3EO0B 4JDTH 1L7IH 4LVEA 2A9NL 1JPGA 4KJWC 1CGVA 3QUMA 5EH1A 4ODTH 4JN1L 3SQBA 2X9XA 3DV6B 2FWOA 5CAYB 2HRPL 5B4MC 2L7JA 3WDHA 2PYFA 3NFPA 2D7OA 4X4XA 3BYTA 3H9YA 5DK2B 1TENA 2BOBA 2I9LB 4JREB 3O6FD 2Q8BH 4UTBL 2ED8A 4X6EA 3L95A 5DT1H 3SY0B 3VFOA 2XZQH 2Z8SA 4PRIE 2I25N 5FCUL 1FSKB 2CDEA 3QQ4A 3WNLA 2MPAL 4NO0B 5INCB 1FQ9C 3O6FC 4KUZH 1ZMYA 2HKFH 4MNHA 4JVPA 4LVHC 1YMMB 5C0CB 3ARFD 2A9MH 4NNXB 1IQDB 3QZWA 5T1MB 4PLNC 4P9HL 5JQ6H 4PJIB 5IROA 1FZKB 3QDJE 4ZOCA 4UQ3A 4FQCH 1KLUA 4CVXA 3WFBL 1KB5L 1MAML 3ARFC 2UUDK 2Y5TB 4R4FH 2BVOA 1JFQL 5H37G 3P0GB 5JLZB 1FG2A 3GEWB 4M48H 4EN3B 2P8MA 4IIQC 2A6JB 2WUBL 3C87A 1ONQB 2X4PA 4HKZB 3BDXA 1U8HA 1UXWB 3IU4H 5T33H 5D5ME 2X70B 1LHZA 5KSBA 2QHRH 2UYLA 2NLJB 4JG0H 1YEGH 3D0VA 4EUPB 3ARED 1N4XL 3KLDA 2VXSL 5BV7B 1BM3H 4JANB 2PUQT 3U0WH 3BRDA 4HKJA 4HLJA 3AREC 5C6PB 4TSBL 1HI6A 4PJCF 2IANE 4OJFL 2Q3ZA 1CGSH 1BZ7A 2ZWLT 2APFA 3P11L 1UQSB 4NZRL 5BW7C 1YEJL 3K4ZA 4OZFB 4ODSL 1JUFA 4P46A 4W68A 4YDVB 1I7RB 5IR1B 3GBML 2XRAL 3FRPG 4RWHA 5CEXB 1J8HE 3LIZH 4EJ1C 4F2MB 2AJSL 5FDWB 4YDIL 4DGIL 3MUY1 5JPNA 3KXFB 1HXMB 1KLGA 4X9IA 5E9DD 1RAMA 4HWEL 3T2OA 1NEUA 1WV7T 1AD9B 3OKEB 5DVKA 3P4NA 4PJ7B 4ELME 3ARGA 3BEVB 1Z0MA 5DA4A 4L8BA 5EBMB 5ANME 3LQAH 2MCPL 3SKNA 3TBTB 4Z7UF 4HF5H 4Z6AT 5LGJB 3O4OC 3U7YL 3MV7B 4X0KA 4Q9BA 2A73B 5C08B 4XAWL 1XF2A 3VRIB 1YNKL 1BFOB 1IC7L 5CJXA 5IFHL 1IGCL 3ZYIA 2DKMA 3UDWC 4GW4B 4HUKB 2OLDA 3RY5A 1EO7A 4A6YL 4L8SA 4N0YL 3CX5J 4CNIA 5E2JA 4Z7VB 1FNSH 2R1XB 4X7TB 3VH8G 5C8JB 1DVFB 5HYJA 5KW9L 3QPXH 1BF2A 2J8UB 4HIIB 4ZOBA 1GRWA 3C5JB 4RQQB 3QXUA 3JV5A 1NGXA 3S35H 4HCRH 1MHEA 1G7QA 5HYIA 1DN0A 3GSNB 2ADIA 3ARGD 1LDPL 1WK0A 5EIIA 1T4KA 1NC2D 3NGBB 5E5MA 3S36L 2Z35A 4UV4H 1CL7I 4EEEA 2AJUL 4NKQB 3LB6D 5DJ2B 1CU4H 4MX7A 3G6AB 3NZ8B 5IB4B 5C3LD 3IDIB 4N0FA 1XCQA 4NSKB 3OKYA 3E3QC 4OKVB 3VGDA 3V0WH 5C9JB 1VCAA 2LAAA 3LB6C 5CJXC 4KY1H 3I75B 1UZ8B 1A7NL 2MQCA 2NW3A 1ZANL 4R26H 5HYJD 4KV5F 4RDQF 3RA7H 1PJ9A 4OUUB 4UT6H 5DRZB 5MEQA 5FGRA 2DM3A 1NUGA 3RVVC 1M05A 5F7KC 5JIPA 1OAQH 1T21A 1IFHL 3DIFB 4H26A 5DDHB 1BAFL 4H8WC 5EDXA 4E41B 2R9HD 2DQGH 2DICA 1DBAL 3QQ9D 5IMKB 4DVRL 5J3HD 3BIBX 4MCZA 3LS4L 4Q7DA 1HE7A 2PETA 4W4OC 4OCYL 4HAGA 4HXBH 4QXWA 4YK4B 2EC8A 4HQQL 4OCLC 4UTAL 5IB5B 4OD3L 5ALCL 4NZUL 1OB1B 2LTQB 3QQ9C 5GJSL 1A9BA 2XA8L 4UIMA 1OAYH 1PDKA 4K3JL 1KIPA 4QHUB 4WUUE 1CIDA 4O2FA 4KDVA 4JFPA 5HHNA 4L29B 1J11A 4OZIB 1ROWA 5HPMA 3HTLX 2W9EL 4P2QB 4MHHI 4PV8B 5EU7E 4ERSH 3MJ9H 3OR7B 3QIWA 1FFOB 5C07A 1DQJB 1T7XA 2BCKA 3NN8B 4G5ZH 4XPFL 1OL0A 4NN6C 1V05A 3ARVA 1ZA6B 4JVUA 3MO1B 4NPYA 2XTLA 4HIJB 3ARSA 4Q2ZA 1A6UL 1UJ3A 2B4CC 2BJMH 3GSUB 4EDXA 3NTCH 3ZT6A 4LSPH 1J87A 2IMMA 1WT5A 1KCVH 2YSSB 2EXYD 4RMVA 3VXQB 1QSED 4Q0XH 1ZXQA 3D48R 3A6BH 3D18A 3VFSA 4F37K 3BRGC 4LDLB 3EDFA 3ARTA 1L7IL 4G6FD 2B0SL 3T04D 3DETC 5HXMA 2O5YH 4NO3A 3RL2B 4XBPA 3UJJH 5TGBB 2WINA 5I8CB 2JJSC 4QTHA 1G0XA 2UUDH 3CSGA 2V9TA 2NY1D 4TNWK 2OM5A 1G7LA 3CC5B 2Q8BL 3IKKA 2P49B 1X9QA 1TQBC 4LLQA 3MV8A 1G1YA 3QIWD 5I75C 5C07D 2W9LA 4Z7VF 2GTZB 2G5BA 2XZQL 4L9DA 4XP9H 2VSDA 1M71B 1XGYH 4UILH 2DI7A 4M62H 5H94A 3T0VA 2J8UF 1CLYL 3U48A 4M61A 1SJHB 4OZGB 4CMMA 3V0VA 3L3JB 4OCWH 5EZLA 2H8PB 5DC9B 1QRNE 1UYWH 2A9ML 5F3HA 3MRJB 5IJKC 4K7PX 1OAKH 3AVEA 2YEZB 3BD5A 4LP5A 1QO3B 1SBSL 3DRQB 4JDVB 1JPST 2CH8A 2X89A 3QIBA 1C5DA 1CGWA 3C6LA 3LDBB 3T77B 1A1OA 2IAMC 2ZUQC 1FL3A 4R6UA 4R4FL 1GZQA 3TF7C 1QSZA 3MRPA 4M48L 5KSAB 4OLVH 2G9HA 3FQTA 3UTPE 2VDKH 2A6DB 3ARZA 1PX3A 5FGBA 2QQQA 1UA6H 2V7HB 4WWKA 3MRKA 2RAMA 3IU4L 1DANT 1VB9A 4CJ1A 3ZKSD 5D9SB 1PYWA 1PVHA 2QHRL 5D2NE 5GS2D 4JG0L 1ND0B 2BMKB 4M6MH 3RVXD 4PRIB 1IC5L 1DL7L 3AXLB 4XCNA 3CLFL 4ZFOL 1LK2A 4F7CB 1BM3L 4WO4B 1TCMA 4Y2DB 3VFGL 2B39A 4JQVC 4OD2B 1Q9OB 3L9RB 3RVXC 2M1KA 5IBUB 3U0WL 3DHJA 3ZDZF 4Z7QE 4L4TA 1MPAH 2F8VA 3EOAA 5FF6A 1AGBA 2X9WA 3KNBB 3LHPH 1H0DA 3W9EB 1GC1H 3OGCB 4OLXH 3UTTA 2VO5A 3VXSD 3QIBD 3DYPA 4MA1C 5IB2A 5GGTA 3SKOB 3C6LD 5DVMA 4O5LL 3JBG7 4LLMA 1S78D 4QTIL 3DX6A 4WEMB 1FRGH 5DMKA 1JGEB 4D0CA 5CJOL 2YXFA 3NIDF 5C0DA 4XGZB 4I0PB 1QQDA 1AXTH 1BFVL 2FCBA 3DROB 4WWKD 1S78C 5F88A 8CGTA 2Z8WC 3VXMA 1BX2A 1NCWH 2NMSA 4QLRA 5IMMA 4AIZB 2UWEF 4GUPB 5D5MB 2AXGB 4R8WH 4HF5L 5FGBC 3RVWD 3QFDB 4YR6B 1FL6A 1AD0B 4JGJA 2VDLH 3RJQB 3MLPA 1HOCB 5ETUA 5F3BB 3QUYA 5CD3A 4X80L 3VRJA 5AD0A 3RVWC 1M7DA 5AYUL 4L4TD 1Y6MR 3DMMC 4LLDB 4XVSL 3UTTD 4ZSOA 2IANB 1SJEB 3TFKD 3KPRE 1YA5A 1O0VA 1NGWA 1Q94A 4U6YA 1QR1B 4DGVH 3C5ZA 2NZIA 3UTOA 4JY6B 1WF5A 1ZLSH 5CP7A 3TFKC 3T4YA 4XCFH 3S5LA 3L3OA 1J8HB 1I75A 2NY0D 4HCRL 3EO9H 1TQCB 1EIBA 1OCWH 1I9IL 2XACC 2P5EA 4NUGH 3VXMD 4P5KA 5AAMA 4CDHA 2FRGP 2VXUH 2X1QA 3THMH 2I9TA 5D72H 1I4FB 1CG9B 1UB5A 3LH2H 5GGRY 3BN9C 4ELMB 2J3SA 3IDUA 5D1ZB 3VRLE 3U4BL 3WFEH 5ANMB 2ENSA 1HKFA 1PGRB 3VXOB 4NO2B 1FNLA 4G6ML 5DHYA 1A9EA 4UV4L 2NY3B 2EXWD 4WGVB 2KPNA 2Y7QB 4X5WB 1CU4L 3QUYD 1MCDA 5IJVA 5E2UL 2Z4QB 2I5YH 2RFXA 5T5FH 3O4LA 3MODH 3QCTH 4EVNA 1IAOB 4HGMA 4LEOB 2EXWC 5GS0D 4PG9B 3MZTA 1BVKA 4HJ0C 1NAMB 1JRHH 2Z91B 4DOHE 5M95B 3VG0H 1OVZA 1S7TB 3C5ZD 5DRNA 5T1KA 3HMWH 5HDBF 1NCTA 3LKOB 1CFNB 1FNGB 1CDUA 1Q8MA 4LVOC 4TTDC 5GS0C 3OXSB 2CKBB 4OBRA 3ELAT 4KZEH 3HC0A 5EFIB 4R9HA 1MRDH 1OAQL 2KH2B 2P5ED 1I8MA 1VESA 2DQGL 2VR4A 1U42A 3GHBH 4GXUM 3D85B 1T1YB 1T5WA 4POZD 3ZSSA 3DI2B 1E6OL 2Y07L 3EJYC 4JO1L 5D96B 4KVCH 1CVRA 1KB5A 2AK4E 4C56A 1FNHA 2KDGA 1KJMB 5EU6A 1ULVA 3RWEA 5A2IH 2IQAB 2R2CA 3MRMB 1HCVA 3N9GL 5GSRA 3T0EE 3CNKA 3H3BC 3BZEA 2V2WA 3PXHA 3BZ4B 3O4LD 3V6OC 5I8EB 4TUOB 4ERSL 3MJ9L 1FH5H 4MWFA 2HH0L 4AT6A 5I17B 3RPIB 1YNTB 1N5AB 2VAAA 2EDXA 2FATH 3NCMA 3IXTA 2BSTB 2QQLH 4FQJH 5GIRB 4MQXD 43CAA 1HQ4B 4OCNC 3OF6A 4O2CB 2BJML 3GBNH 4YXKL 2ZSVB 2BP3A 3VFTB 5EU3B 1RV6X 2R56H 2VYRE 4Q0XL 3S3JA 3GSRB 5HTSA 4E0RB 3WO4C 1NGYA 3BW9B 1SEBB 4K9EH 2O5YL 2CUIA 1XR8A 4CKVX 1FLTX 1C1EH 2IC2A 4PLJD 4C56D 4QXTB 1K5NA 3UJJL 2OTUB 3WXVH 4LRIC 5EU6D 4KRPD 4WWID 4GLRI 5LGHL 2AJXH 3AS3A 4JHWL 3PV6B 5DEFB 3MQIA 3PGDB 1BIIA 1GAFH 5KVEH 2EDTA 4LKCA 3PP3H 1IGMH 3IFNH 5IEKA 4TNVK 2J88L 3T8XA 4NHCH 5CUSH 3QEHB 3GIVA 3DYOA 4JHAH 2WSKA 2F74B 3DVNB 1J0YA 1R6VA 5I74C 3RY6A 3OF6D 1X5AA 3CFDB 4OCWL 4HUWB 2CO7B 3WIIH 1ORQB 2R1YB 2GSIA 1NQBA 1OAKL 2LABA 3OZ9H 1Q9KA 1ADQH 4G8FB 4PJBF 1VGKA 4N68A 4ELMF 2XTJE 4YNYB 3G5VB 1V3LA 4BZYA 4PFEA 1OTSD 1PKOA 5GRVK 2EDQA 3DRTA 3U6RA 2YK1H 4WJ5A 1TXKA 5SWQB 1MCOL 4UNTA 3PP4H 1JK8B 1RZGB 4JRXD 1OTSC 4ODUB 5MP6H 2ESVA 5IQ9A 5JW4M 3QEQA 1UA6L 2DI9A 1MH5A 1FV1A 5TF0A 1V3MA 3BKMH 4ODWA 1MFDL 3RHWK 2FB4H 2X4UB 3UAJD 4KAQH 4KQ3L 5BZDA 2VC2H 1UB6B 2VXVH 2ZPKH 1P7QA 2O61A 4ODXB 4EDWH 4DUWA 3ARRA 4QXUH 3VXUE 4N90D 5E8OB 4PJXA 5CEYB 3KPLA 1ZK9A 3RWJA 4NGHL 3IU3B 2V7NA 5E2WH 5EUOE 3LHPL 1GC1L 1I1YB 3TNMB 4GG6A 4Y5VB 3EIFA 3SQOH 5CD5D 2GW5A 2R4RH 4NIKB 2Y36H 4HGKC 4X4ME 2DWDB 1VADB 4NZDA 4X9HA 2PXYB 1YDPB 3GIZH 3QDGA 3MGOA 5CD5C 5MHSE 5C3TA 2ESVD 5L88L 3QEQD 1P69B 3I3DA 4NM4H 5F7EH 3WHXB 4FZ8H 4UINL 4P3CH 3DVGA 1NMBH 3TCLB 5C0JA 1VFAA 1EERB 4R8WL 2FYYB 5D2NB 4K8RC 2MKLC 3D0LA 5F7MC 5L6YH 3H9HB 3GB7A 3P9LB 5F72S 1FNEA 3UJTH 1QFPA 1T1ZB 1I8IA 4M5ZL 1KN2L 1UVQB 2NY5H 3LKPA 3PHQA 1TCRA 3AU1B 1B0RA 3W0WA 1MCIA 3PQYA 3BZDA 1CT8A 4N0UA 5D93C 1AO7E 2EE3A 3MRNA 3FQRB 4JKLA 5D2LE 4DGVL 3D25A 4MXVF 3VXTB 4I8DA 3D69B 1S7XB 4U6HB 1ACYL 3RWFA 3F7PC 1ZLSL 4N1HB 3GO1H 5SWSD 3DO7B 1FYHB 4MDIA 2BVPB 3LQZB 3QDGD 5J89A 1V3JA 3BSZH 1S9YB 3TV3H 4HLZG 2NY4B 4NUGL 4P4KB 4Y8AA 2HMIC 2VXUL 4PREB 3U30C 5D72L 4HBQA 3T08A 2GIYA 1I1CA 1I9RL 3JVGC 5ENWA 3PJSA 3NCYS 2BNQE 1A21A 4NN5B 5C6WH 4AEFA 3AMLA 1F45A 3GUTA 4Y89A 4GKZA 2V2XA 2Q1EA 1BVLB 3H6JA 3LS5H 3QCTL 2EDNA 1BGXL 3W0WD 4PJEA 3PQYD 4RGMC 1ZOXA 3O3AA 2PO6A 3QEUA 4XXCC 1JZ5A 1JRHL 1R3HB 3VG0L 5CSGA 4XC1H 1NLDL 4QRPE 4XBGA 3HMWL 4FQLL 3WNKA 5BV7H 2XZAL 3P2TA 1WIPA 5FO7B 3SO3C 3NCBB 4MHHG 4O02L 4RRPG 5J6GB 4U1SB 5JUEH 2BY3A 4MSWB 4EIGB 1MRDL 5TDOA 5EO9A 4DZ8A 5IP4A 3ZKND 3P9WB 3ILPA 1YEEH 4ZUTB 1OP9A 5C0ND 3HMXL 4K7PH 2HVKB 5DRWA 4E5XB 1NEZA 3T1WA 1R3KA 3MRHB 5JO5A 1DEDA 5CZKA 5HYEA 3V6FB 4Y5XC 1MUJB 5DK0A 5I76B 4LSRH 1H8NA 2EDOA 3E1F1 4LKXB 1DN2A 5EB9A 3F7RA 3ULSA 3DXAA 4LEXH 2QKIB 3H0TA 3KPPA 4P57B 2PO6D 4KC3B 4HDIB 3WSQH 3DVIA 3TCXA 2IPKA 1KTDB 4N9GA 4DOHB 3GSQA 3C09C 2QQLL 4GBXC 5H37H 1RUMH 4POYA 4ZUVA 3GBNL 3M8OL 2PO6C 3BKYH 2DQDL 4ZFOA 4PRDB 5E5RB 3AB0C 2X7LB 2JLLA 4KI5E 4DWHA 5HHVL 4NC1C 3BH9A 1E4XI 4FN0A 4LIQE 4OGAD 4ZNCD 1MELA 5IG7A 1NBQA 3RWCA 1IGTA 3WKMH 1CXIA 3L5IA 3TN0D 3UO1H 4JY4B 1C1EL 2E7BA 1ED3B 3KPSE 2DTMH 3VFVA 2AK4B 2IMNA 3WXVL 1RURL 3O2VH 1AR1D 3PGFL 2OK0H 3U46A 3LKNA 2DMKA 4IM8A 3OKDA 1V3KA 2VTFA 2AJXL 3G04B 4RFOL 4WU7A 2C1PB 3TN0C 4L8DB 3EYOA 1DFBH 1DBKL 4P5TB 1GAFL 2OMBA 4Z7QF 3SDYH 3T0EB 4AMKH 5KVEL 3DXAD 4MD0A 1MWAB 3IS1X 3LQMA 5IKCA 3SGKA 2UZXB 4WI8A 2OS7A 3IFPA 4DVBB 3CGTA 4GKNA 4NHCL 3P30H 4G43A 1SBBA 4JHAL 2BHZA 2WP3T 4HZLA 2BNRE 4G9DA 1AI1H 3P4OB 4DW2L 2ZCKL 1MLBB 4WDIB 2W92A 4PJGA 3VFUB 4PRPA 4Y8DC 3WIIL 3IYLW 2XWBA 1BD2E 4W6YB 5B8CA 3O11B 5CGYD 3SDAB 2X1XR 2WIIA 3MLSH 2LFGA 5D6CA 1ADQL 2R0KH 4XB8A 3FOLB 3ESVF 2ITCB 3IJYB 2OP4L 1I7UA 4PGCA 5L8LB 1QKZH 3AY4A 3OV6A 5E1AB 1TLKA 1YQ2A 5CGYC 3BIKA 2YK1L 4YHKH 2VUYA 1MCKA 3PP4L 3FZUC 3QUXB 5J1AA 1G7IB 1ZTXL 4BK5A 5CJ8A 4WFHE 4PD4K 4NQDB 3BKML 3C2SA 1NKRA 3B9KA 4WFED 1PLGH 2FB4L 4HCRA 1MCRA 3WV0A 1INQB 2VC2L 5CILH 5M94B 3I85A 1I1AC 5C70A 3G08A 2VXVL 2K9UA 1D5IL 5DQDH 4EDWL 4G6JL 4QXUL 3PL6B 1BWWA 1C5CH 2CDFA 3DTXB 3OKLA 2LE9A 1ZLUK 1T1WB 1OQOA 1PBYA 2YPKB 4Y0GA 1T2XA 4S2SA 5TF1H 4R4BB 5CKAA 3NFNB 2BOCA 3FHAA 4PRAB 2FD6H 1PY4A 4OGZA 3LQAC 3SJVE 4UOJA 1OLLA 2FJFB 3SQOL 2B5IB 2XTJB 2R4RL 3MV11 4JPIA 3SKMB 3VCLB 5B8CC 3MGAA 4J23A 3RZCA 3U0TB 1AE6L 3GIZL 4J3TA 3FCTB 2I26N 4DN3H 4M3KB 1JPFA 4X9FA 4PS4L 3AY4C 1JI1A 4C58B 2QR0B 5HVHB 4NM4L 5F7EL 3B9KD 4MD5A 1C08A 4FZ8L 5EU4B 4P3CL 2XQBH 1EEQA 1Q72H 1TTGA 3NABH 1T66D 2XZZA 4YPGB 4PGBB 4PJAF 5ICXA 1S7WB 5BJTA 2MFNA 3ARBD 3M07A 4KKBC 1WFOA 3VXUB 2XNAB 4O58L 3BP4B 3UJTL 5EZJA 1T66C 3C6SB 5JR1L 2NY5L 3ARBC 3P77B 4P2OB 1P4IL 1G7HB 5EUOB 3PNWB 3OMZA 3SGDI 4HIEA 1HQRB 1MVUB 4V2CB 4Z7WA 1U8QA 1YPZE 5A2JH 3BP6B 4NQXA 3NA4A 4O2EB 4D9RD 32C2B 5EC1A 3RZCD 5HJ3A 1UADC 4NJAL 5HHME 3BSZL 4HX1A 1ZLWK 2UZIH 2B2XH 4NQSB 2R2EB 3TV3L 4RSVA 4HZAA 3L3GB 4JFXA 5KSVA 3CFKB 4F15C 3VFWB 3D1MC 1JHTA 4LU5H 1XF3B 5L9DH 2IWGA 5DD1H 2J2ZA 4MZ2A 5LKNA 3NH7L 5C2BH 1LO2H 5HGBB 5EPMB 2BXZA 2CRIA 4QHLA 2WMPA 5D7IE 2YXMA 3FT3A 4Z7NF 1C12B 5TH2A 1ZT7A 2VQ1B 4RGNE 1HILA 1LO0H 2KBGA 1G6RB 1U8OB 2GTWA 2CLVB 1HHJB 2LU4A 3VD5A 2ARWA 3HE6A 4GKSA 2V9RA 4PRHA 1AO7B 5DMJB 3G6DH 5D2LB 5ICYB 2DB8A 3HNVH 3BKJL 3MLUH 5BV7L 5JOPE 5GPRA 1HIMH 4H1LG 5JUEL 3BWAA 2WK2A 5JXEA 1GGCL 5BRZA 5FYLE 5IHUH 1BJ1J 5E4IA 3STZB 2OCFD 2BY1A 5KBNC 3HAEG 4J3WA 1Y6KR 1S9WA 1U91A 4K3DH 3WE6B 1UGNA 1HN1A 4K7PL 4R7NA 4PIRF 3ROLA 3UBXA 2JKXA 5E6IB 1D9KA 3IB4A 5AZ2L 4P3DB 3MGTA 2P5WE 4FTVA 4C83B 5CEZE 2BNQB 3V5HB 1MOEA 1NUNB 1HHIB 1ZVYA 4LSRL 3VWJD 2WQRA 2Y72A 4I4WB 4XXDA 4K71C 2ZUWA 1GYAA 3HZYA 3HLAB 3HE6D 3OKKB 4O51A 1INEH 3B9EA 4JFHD 3VWJC 4XCYA 4PRHD 3C08H 3MRIA 4NO5B 1XGQB 2KQMA 4C4KT 3GHEH 1H15B 5HY9B 1RUML 2GUOA 1QEWA 4IRJA 1EDQA 4PBWD 3CH8A 5JA8B 5DJ0B 5JXED 5BRZD 4WU5A 2EICA 3N1PC 4AENB 4P3WA 4HHAA 3MV9E 2GEEA 1SMAA 1LEIB 3RWHA 5I1HH 4LPYA 1QNZH 4K23H 3H8NA 5JXEC 3R1GH 1NJ9B 5E00B 2DLGA 3WKML 3WKNA 5JOFB 3DBXA 3MOBH 3MV8E 5JIHA 3UO1L 1CBVL 3GGWA 2ZJSL 2IPTH 3UMTA 1D9KD 2DTML 4FTVD 3O2VL 3IKCA 4LLYA 2OK0L 4DKAA 2FIKA 1TZHB 5GRVL 2D4FA 1QFUL 4JPKH 4BSVB 2FO1A 2ATPA 4KKAD 1OM3L 1D9KC 5LCVH 4AMKL 3RNKA 4AEIL 5EUOF 2R0WL 1KPVA 2JELL 1F6LL 1H3PH 2VZ3A 3VD3A 1K3IA 1WFUA 4PRBA 5CP3A 3MYZA 5ALBH 3DUUA 1CD1B 1A3RL 3HZVB 4XNXH 1VFOA 1OGAE 4IRJD 1J05A 2DD8H 5GRYA 2DJ4A 3ARWA 4RMTA 5MI0C 3V4PH 5GS1B 1F11A 3MLSL 1MQKH 4IJ3B 2R0KL 3LEXA 2XZCH 1PW3A 3PWNB 1QLEH 3F7QA 4G80B 2G75A 2FHFA 2DLEA 3JTTB 5EC2B 5B3JF 3MACH 1EJOH 4U3XA 5FCSH 4JPWL 3BJLA 1F8TH 3S9DB 3S3SA 5I18H 1T7YA 4UU9B 1Z9MA 3U9PH 3UTZA 2D31B 4KUCD 4PJDA 1XGTA 1A6TA 3V8CA 1ZA3A 1P53A 3EDEA 3IS0X 3TA3A 4QHNA 3MR9A 1QYGL 3X11B 5CILL 1A3LH 4FFWD 4U1LA 4IBLT 1OP3K 1MCLA 4ALAL 4Z77B 2AABL 5D2LF 2NNAB 1CDCA 3SKUD 3CXDH 1L7TH 3IXAB 1C5CL 1CICA 2BNRB 5CJQH 1VFMA 3IDYC 2VLJA 1T1XB 2F53E 1S7QA 3WJJA 1MFAH 3UZVB 4XCCH 4OLUH 1BD2B 4KU1A 3BUYB 5LBSL 3RVUD 2W0LA 2CSPA 4H88L 4HH9A 4X7CC 5FAAA 3D2UB 1IAIM 2EDHA 4F58H 3RVUC 4OLYH 4QT5B 4X8JA 1JF1A 2HT3D 1T20A 3WLWC 3TVMB 3TA3D 4TULH 2XOTA 1R5IA 1H5BC 5MENA 2A83A 1CR9L 2XQBL 4Q74A 4XH2A 1Q72L 5I1KH 2HT3C 2RIKA 1P4LB 1FC2D 2XWJA 4WRLA 3K2MC 3HMXA 4X7EC 1CICD 2NXZD 3QXDB 4YO0B 2VLJD 4Z0BL 1BPVA 5TQ0L 1JNHA 3TBWA 2NY2D 4KJPC 1JF5A 4P23B 3LKSB 3BUTA 4ZAKA 4TUKH 1RJYB 3FTGB 2NXZC 3GSWA 3WFDL 3SJVB 4N8VB 1IEAA 2NY2C 4PY8I 4L1DA 1LP9E 5DTFA 1K3ZA 3MNWB 3OGOE 4XAKE 5T3XH 3IVKA 2X4OA 2NX5E 4O4YH 5EORH 1QBAA 5F89B 4KKCD 2B2XL 5HBBA 1T83C 2FZ3A 1FVCB 3L7EB 4IRSA 3IAGC 4Y4HB 3IT8D 5GSVA 4W6WB 4LU5L 3UTSE 5MEND 1ZWIB 2X4RB 3LAFA 3EYFA 3PWJB 5DD1L 5EBWB 4HWUA 1A4KB 1H3UA 1LO2L 5GGSA 1O7VA 1G7MA 5GZOD 1NCCH 5F6HJ 2NY6C 4U1HA 3EHBC 1KIQA 3EDJA 1GCFA 3T2QA 1S9XB 3SCMB 4D0BB 2Q7YB 1LEKB 5DJ8A 4U31A 5AG8A 4KI5F 1LO0L 3CXHK 1GGYA 1U3HA 1EAPB 3KPMA 1FDLL 4TSCH 3FFCA 4IS6B 5CINH 4XVJL 2E5EA 1YPZB 2D03L 3I50H 4Z0XB 4HJJH 4FQIH 4MVBD 1ZS8B 2AJ3A 1TDQA 1HIML 2DMCA 2OBGA 5FKPA 4QHKJ 4M3JA 5IHUL 5HHMB 4NCC2 1EFXA 4N9OB 3Q6FA 1KIRB 3KYKL 3SE9H 1OAXH 1X5HA 2WANA 4FRWA 4XTRC 4MVBC 3OR6A 4WW1B 4K3DL 4L8CA 5I66A 4KMTL 4PP1D 4MQSB 5JTWA 1ADQA 4U33A 1ES0A 5JHDE 1DBJH 2V5TA 3EJJX 3WUWA 3V79C 4D3CH 3KJ4B 3FKUS 4R96A 1AQDB 2MHAB 5J9PA 5D7KD 1E27B 3ZYJA 4RGNB 4K9EC 1U3HD 4QRSB 2KKQA 2F15A 5D7JD 3RU8L 2YN3A 3E0GA 3FFCD 4ZDHB 4DEPC 4HIXH 1FN4B 2QADD 1N59B 2HYMA 4R7DB 3O41A 4A2MA 1U3HC 3GHEL 5D7JC 1A1NB 2X4SB 3OB8A 5E2TL 1NMCC 1TNNA 3U1SH 3W39A 2AAVA 2E9IA 1EFXD 1QG3A 4OF3A 4MLSA 3FT4B 2QADC 2XFXB 1OARH 5I1HL 4K23L 1G7PB 3IRZA 3R1GL 2XICA 3SOBL 4HGWA 3W9DA 2IPTL 5I73B 1RK0B 1L9NA 4UBDD 2D0HA 5KOVC 4RMWA 4AM0B 4OSUH 3VFRB 1ODAA 1AGCA 2HFGH 5T3ZE 1YN6B 5HYQA 1RZ8A 3MTRA 4FQQB 1J12A 4UBDC 1QSFE 5ACMA 1PX4A 5A2FA 1CFQA 1VDGA 1H3PL 1N3NB 2WIMA 3VGFA 3C60A 4RAVB 3SDDC 1KUMA 1QD0A 3OQ3B 3CSYA 1A4JA 3EO0A 4XNXL 1MCCA 1H8OA 1OP3H 5HGHB 4DUVA 1TETH 2DD8L 3D39E 1U6AH 3QAZB 1JL8A 1YN7B 3DV6A 4S0SD 2H2SC 3MV9B 1WC7B 1MQKL 1E4KA 4YHZH 1QLEL 1K4CB 3MACL 1EJOL 5DK2A 3KR3H 5BVJB 2I9LA 1AQKH 3ARXA 5EO1B 3QWOB 5JIKA 1LO3H 3SY0A 1KT2B 1RMFL 5I1IH 3MRRB 4OV6F 4NO0A 5KZCD 5INCA 4OQTH 2IADB 4LGRB 2QV2A 1YMMA 5C0CA 5JIIA 1A3LL 4NNXA 1IQDA 5T1MA 3UROR 4PJIA 3C60D 1JHLH 1YEIH 4YX2L 1CL7H 5CLTA 3Q0HA 3CXDL 2W9DH 2LU3A 5D1QA 5CJQL 5KANI 4K07A 3U4EB 3BESR 1N0XL 2NXYB 1OGAB 2Y5TA 1U8LB 5JLZA 5JPMB 5C0EB 4XCCL 4EN3A 4OLUL 4HLZH 1YZZA 3RGVB 3KYOB 1J0HA 2A6JA 1ONQA 4GRLC 2BX5A 1R3LB 2CXGA 3B2VH 3CX2A 1UXWA 3QA3B 3WJLC 1Q9LB 4NJ9H 3L1OH 4QKXB 2X70A 1EHLH 4OFVA 3QCUH 4G42B 2NLJA 5BZWB 4ZFZB 4IOFC 4JM2B 4F58L 5D7IF 2NY5C 4NO0D 4EUPA 2VL4A 3O8XB 5IHZB 1Q0YH 4KK9D 1R3JB 1KOAA 4MQTB 4TULL 1KJ2B 3BT2L 2P47B 1YMMD 5C0CD 4JANA 3QR2A 4AJ0A 4JFQB 5I1KL 3ULVE 3S7GA 5E6YA 1D6VH 4L3EE 5E8DH 4JQXC 1C7SA 1IE5A 3VG9C 1RPQA 1U58B 5D1QD 3MCLH 2YOCA 4QOKE 4OZFA 2F53B 1JP5A 2X09A 1AGDB 2XXCB 3M45A 4YDVA 1I7RA 1J5OL 5IR1A 4RMSA 4YZFE 4TUKL 2QBWA 4KKNA 5CEXA 5D1QC 4F2MA 1AY1L 1WCBB 5FDWA 5ERWB 3CZFB 3P0YL 5F9DC 2DLFH 3KXFA 3NA9H 1HXMA 4ZNEE 2APWA 1FIEA 1AD9A 4BUGA 2O5ZL 3OKEA 4PJ7A 3BEVA 3HPJB 5EBMA 3LSOB 4MXWL 4O4YL 3NACL 3TBTA 5LGJA 4PJ9B 5EORL 4HPYL 3ZKMD 3MV7A 2YUXA 4CU8A 3FT2B 5C08A 3BGMA 3VRIA 1BFOA 3HRZB 4PP2B 4GW4A 1K4DB 3QT2A 1CVSC 1XFPA 3SGJA 4PJEE 4M00A 3GSVB 3ZDYF 3EYUH 4JB9H 4JZOB 5CIPH 2CRZA 1NCCL 4AQOA 4Z7VA 2R1XA 3TWCH 3E2HB 1U8PA 1QFWI 2APXA 4X7TA 4HG4K 5C8JA 2D4DA 5FM8A 4YXLH 1DVFA 1KEGH 2J8UA 4HIIA 2HN7B 1OWRM 3WYRA 4JN2B 5F71A 3C5JA 4RQQA 4ACPA 4HAFA 4HMDA 4EZMA 1KCRH 3KXFD 4HS3B 1MHHB 5CINL 4TRPL 1IVLA 3I50L 1LP9B 2DDQL 2K3TA 2NX5B 3FFDB 3ABZA 3MV7D 3MBEB 1BIHA 5C08D 3SDCD 1OAXL 2H6PB 3CH1B 3HG1E 3UBXI 5DJ2A 3OAUL 3G6AA 3NZ8A 5E94B 5IB4A 3UTSB 3IDIA 4NSKA 3SDCC 4OKVA 1B0GB 2EEAA 3RFZC 5C9JA 1DBJL 1BQHG 1OD7A 3UZEA 1IGFH 1CS6A 3I75A 5L2KE 1UZ8A 1LQSR 4D3CL 1DVFD 3MLRH 1ZHKB 3RAJL 4OUUA 5DRZA 5J8OA 4NRZB 3RDTB 4QHMB 3DIFA 5DDHA 4HIXL 1DVFC 4E41A 5C0AE 4HEME 3KVQA 1DUYB 4XI5C 1N6UA 1L9MA 4MS8D 5C09D 4YEFA 1CD9B 3VGAC 1JMXA 2F9BT 3QB7C 4CN6A 2AEPH 3SBWC 5IB5A 1OB1A 5C9KA 4PJ8D 2ZCLH 5KSUB 5F6IB 3VWKD 1H9VA 4R0LC 4QHUA 4HPOL 2NR6D 1LE5B 4L29A 3MNZB 4OZIA 3V6ZB 2XKSA 4U6VL 4PJ8C 4PV8A 4P2QA 1U8NB 3VWKC 3OR7A 1FFOA 3QI9B 5JHDB 2NR6C 1FO0H 1DQJA 4OSUL 3NN8A 1VACA 4N0CC 2BVQB 4IRZL 1ZA6A 2HT2C 3QISA 4YC2C 3MO1A 2JB6B 5HYSG 4HIJA 1FGNH 3KWWB 1JE6A 3GSUA 3O9WB 3HNTH 3HNSH 5E8NB 1ITBB 1S3KL 4GS7B 1BREA 4GSDL 2YSSA 4E41D 1VGEH 3VXQA 5DFVC 3NPZB 4G8IB 1M6OB 4NQCE 1B2WH 3MOAH 4WW2B 4RWYL 2FX7L 3OHXB 1T03H 2E9BA 3RL2A 3D9AH 4U1MB 1CWVA 3B8YA 1TETL 5DEZA 1K8DB 1MREH 1U6AL 4OZHE 5TGBA 4LAQH 5I8CA 4FMFA 1JHKH 1B9ZA 2J5LC 1J1XH 2CXKA 3CC5A 3KR3L 4P2QD 4NWUH 4NT6B 1X44A 4Y16B 4OV5B 1K9TA 1LO3L 4GQ9H 5I1IL 5FYKE 4ZS7H 2GTZA 5HPOA 1EO5A 1M71A 1IAIL 1EK3A 1OW0A 2EDKA 4UT7L 1J88A 3ORJA 1W72H 1SJHA 3BEWB 3CPLB 4OQTL 4OZGA 5DWUH 2COQA 3L3JA 2H8PA 2AK1L 1XZ0B 1LWRA 3N85H 4F7EB 1QSFB 4MNQE 3MRJA 1YEIL 3B9DA 4IDJH 1GGIH 1ETZB 1QO3A 1TPXC 1FFNA 3DRQA 4JDVA 1M7IB 4TSAL 3G9AB 4WHYG 3T77A 4BKLB 1C16B 1Z5LA 5AZEH 2EYTA 5IBTH 3FMGH 5KSAA 3D39B 2X4QB 2P7TB 2VISB 1WIOA 3RKPA 1U0QA 4LHUB 2A6DA 1MJUL 3IDMB 3SDXE 2PW1B 2VXQH 4YEEA 1FNAA 2V7HA 2X1OA 3MUZ1 3QCVL 3KLSA 4NJ9L 2CR6A 1F4YH 5D9SA 1EHLL 3QCUL 1ND0A 4PRIA 3AXLA 2DQTL 3MJ8B 2EYSB 1Q0YL 4XPTH 1CLZH 3G9VA 4F7CA 4WO4A 1MCWW 1A6PA 4Y2DA 3SE3C 1HZHH 1NL0H 4OD2A 3JV4B 1NMAH 3L9RA 1Q1JH 2YWYA 3QEGH 5C0BD 3EFDH 3MNVB 1FPTH 3KNBA 2IBGA 3W9EA 3OGCA 1HH9A 4ZODA 3B5TA 3O6LL 1J0JA 2WW8A 1SYSA 3PE9A 3SKOA 4XNZB 4H1LH 3K1KC 2F54E 2WBJC 3X3GH 2YZ1A 3HAEH 1JGEA 2L0DA 1N7MH 4XGZA 3QFJB 2RB8A 4KH2A 3DROA 3TBVB 2AQ1A 1RQ5A 5F7LB 1EEUA 3U2SA 1UEMA 2YD6A 5FOBB 4LCIH 4AIZA 1HYSD 2YRPA 4LLWA 4GUPA 5D5MA 5MEPB 2AXGA 5DI8B 4CJ0A 1S7VB 3QFDA 5EOCL 4YR6A 3QQ3B 4C59B 1AD0A 4WO4D 4S11A 3BPLC 4JY5H 3VA6A 1HOCA 3S96B 4KXZI 5F3BA 4P5MA 5FHAH 3CLEH 1CFVH 2AXFB 4H0HB 4LIQH 5SWZE 3DV4B 4LLDA 4L3EB 4GLRH 4K3EH 2IANA 3FAWA 1SJEA 3QDJD 2HJLB 3L7FB 1LNUB 1IBGH 1QR1A 3MBXH 1NEZG 4LDOB 4HFUH 2V2TB 4U6XB 4LHQB 1KEGL 4QOKB 1UCTA 4U1KB 3RWDB 4JY6A 1MFCH 4XWOD 4KK5C 5CFHA 1YEDB 1CK0L 4XHQA 4I0CC 1J8HA 3UPAA 2Y06H 3I02B 3EO1B 3RX5A 5MEOB 1YNLH 5ILTH 4Q9RH 2ZOLB 2IH3B 1CG9A 4Y5YC 4ELMA 5D1ZA 5B22A 5F7HA 3O2DH 5ANMA 3TH4T 5J06A 3IDNB 2OR7A 3VXOA 4NO2A 3AUVA 1WAAA 3RTQB 3ZHLA 5I6XC 4RGOH 2R2HB 5D6DC 5FO8B 3GBLA 2Y7QA 3MRQA 4X5WA 5EUKB 3OKOB 5E9DE 1G9MH 5K9KB 3LKRA 4KRNA 4XT1C 1L6ZA 3QNZB 4PG2C 3N1QC 2Z4QA 4PUBL 5HDOA 1IAOA 4MA7H 4LEOA 2IAND 4PG9A 1SVCP 2VR5A 3VGGA 1IGFL 3NCCB 1MQ8A 2Z91A 2XN9E 1S7TA 1NBYB 1F00I 4U7SA 1KGCE 1CD0A 5IGXH 2E27H 3LKOA 1CFNA 1FNGA 3B83A 2QLVB 4YXHH 3OXSA 2E7LC 5J4MA 1J8HD 5EFIA 4LMQE 5L0QC 4BH7B 3GMLB 5TE7H 1U3YA 35C8L 1P7HL 3LRHA 3DYMA 2ORBH 2IF7A 4OAWB 4BZ2H 1UM5H 1T1YA 4OI7A 2BSSB 2Y9RT 1B6DA 5D1ZD 4LSVH 3GKWL 2AEPL 1OTTD 1NLBH 1DQTA 1WCQA 1KJMA 2EH8L 3MCKB 5I71B 1RZ7H 2NY3D 1YUHB 4XMLH 1QSVA 2WUCH 4HT1H 5T1LB 3MRMA 3HG1B 1GGBL 2B7DT 1AHWB 5J6HB 3TJHC 3BZ4A 1CXLA 2A6KB 3P0VH 5C71A 5I8EA 4JFZH 4TUOA 3V9FA 3KLHD 2ATKB 1EFQA 3RPIA 1HHHB 1FO0L 1YNTA 1N5AA 1EO8L 1T89C 1JPTH 3MMEB 4DFIA 3BKCL 5L2KB 2BSTA 3PHSA 5B39B 1VHPA 2PW2B 1E0OB 1HQ4A 1FGNL 3KLHC 3BP7B 4O2CA 1GXEA 3HNTL 4XRCB 4J3VA 2N56A 3BQUB 2ZSVA 2Z31B 3VFTA 4WENB 5EU3A 1VGEL 5GRWA 5K9JH 2JB5H 3H3KA 4XZUB 3VW3L 3MFFB 3KPQB 3GSRA 5C0AB 4E0RA 4RISH 4HMCA 4JFEE 4UAOC 5E70A 1T03L 2C4FU 1SEBA 1BZQK 4GAYB 3D9AL 3U36B 1NPUA 3LPGA 4QXTA 2OTUA 4LAQL 3WXWH 5FB8B 5BMFL 2OXHA 4BJLA 1FZJB 1XGPB 2AEWA 3PV6A 4UB0L 5DEFA 1JHKL 1G6RL 3PGDA 1AKJB 3DURB 4OD1L 5D96C 1LE9B 3IDXL 2DQHH 5HVGB 4NWUL 5I1JH 3SKJL 5LAXB 4NBZB 2YC1B 3K4AA 4FQ2H 2IG2H 3RWGB 4LARL 3QEHA 2ICEB 5L7XH 2F74A 3DVNA 4HMEA 1W72L 3O45B 4YZFF 3CFDA 4R90H 4XWGL 4HUWA 4HK0B 1CQYA 3N85L 2R69H 4XP1H 1ORQA 3IJHB 1L6XA 2O5XL 2R1YA 2Z8VC 3HI1B 3V95A 5ISZB 1A7RH 5DRXA 4XPGH 5I16B 2W1NA 4FG6D 1GGIL 2K1MA 1P84J 5GHWH 4YNYA 2A1WL 1JF6A 5FFLA 3G5VA 1P2CB 4YHNB 3UPRB 3SN6N 3I6KB 5JW3H 1DBBH 4L4VE 5IBTL 5SWQA 2AJZB 3FMGL 5EBGA 1NC4B 4OZHB 1R5VB 2FHCA 1JK8A 1LO4H 4HKBB 4WUUD 1FL5B 2VXQL 2X41A 1QSEE 3LN9A 3B3IB 1ZSDB 4PJEF 4X5LA 4BM7A 1OD9A 2X4UA 4EXPX 1F4YL 3E6HB 4YBLB 1UB6A 4EQ3A 4YGVB 5DYOB 5KS9E 1IEBB 4K3GA 4U1GC 5T3XD 2EO9A 5AG9A 5E8OA 5EU7C 1H8SA 5C0IB 2YD3A 4LSUH 3X12B 3S34H 5EA0L 1QRNA 3IU3A 1BJMA 3QEGL 4MNQB 4WEUD 1JYVA 4Z95H 1C8PA 3HS0A 4Q6IC 1II4E 5FIEA 2N7BA 1I1YA 3TNMA 3WN5C 4F7PB 5GGRB 4Y5VA 4MJIB 1ZHLB 4HEPG 3BPNC 1XEDA 5IOPB 5F1OB 1NFIB 5CEZH 2DWDA 4WI7A 1YEFH 1VADA 2ARJB 5D4QA 1T6VN 2FX8L 2PXYA 4HUUB 4EBQH 3CFCH 3X3GL 1IRAY 1F3JB 2MTPA 3SDXB 4UV7H 2JJTC 3IETB 4BQCA 3WHXA 2EEDA 5DUPH 4LCIL 4RBPK 2BVUA 3TCLA 3Q1SL 4HS6A 2FX9H 2FYYA 5D2NA 1FZMB 1FZOB 2Z92B 3H9HA 3HB3C 2XPGA 1E4XH 2I27N 4ZUWA 3VD9A 3P9LA 3PWLB 5SX5H 5L8JB 1T1ZA 2DJSA 1EGJH 4XB7A 4GW5B 3PDGA 1UWEH 1QRND 4Y4FD 4FS0A 5FHAL 1CFVL 1UVQA 1MIEH 5KVGL 1UWXK 4HSQA 3O6FB 3UC0H 3AU1A 4K3EL 1KN4H 5TQ2H 3LV3B 1B6UA 5DGRA 4LVHB 1IAMA 2APBA 2HLFD 2IBBA 1SHMA 4NFBA 1QRKA 4FXGB 4HFWB 4Y4FC 3UBXG 1I85A 3FQRA 1BF8A 2AGJH 4QRRE 4HFUL 3VXTA 1WIUA 3D69A 2PXYD 3STLA 4U6HA 4JGUA 2HJKB 2F54B 4XP4L 3DO7A 2BVPA 3LQZA 2F5AH 3BDBA 2PTVA 3UTPD 4Y1AE 1NCBL 3ARFB 3TT3L 2W38A 1FFPB 1JN6B 1YNLL 4P4KA 5ILTL 4Q9RL 2MJWA 2OR9H 4PREA 5CJBA 5I0ZA 2UZYB 5DEGB 4NP4H 4JG1H 2HRLA 4IIQB 3O2DL 3W81A 5C0GB 4M93C 1JTPA 3QUMB 1X4XA 3FQUB 5TE4H 4RGOL 2O93L 3ZSTA 4GMSH 1RUKH 2FO4B 1B3JA 2PTUA 1QBMH 4QXGL 5JNYB 4F57H 1BVLA 2ADFH 2VRAA 5SWZB 3I3EA 4C55A 3KHOA 3MYJA 3H7BB 5FHBH 3PABB 3KPRA 4CADB 3W82A 2FECL 1P6AB 3AREB 2E27L 2GI7A 2HTKD 5CGTA 2YA1A 5I1DB 3P4MB 5I8OH 5FO7A 4DUXA 4QWWD 1KCKA 1YYLH 4U1SA 5FYJE 5J6GA 3OL2A 4MSWA 5DC4B 2DIAA 4NBYB 2ICES 4OQTA 3PV7A 5TE7L 2NY4D 5J0BA 1UM4L 5IMLB 2ZUSA 3QJHB 4ZUTA 5TDPB 4LP4A 1UM5L 3FO9B 4BZ2L 4QWWC 1VKXB 1CDGA 1AGFB 2HVKA 4AY0A 1VFUA 4E5XA 3T65B 4Y19E 4XP5L 3MRHA 4LOUC 4LPTA 4QNPE 3V6FA 4XMLL 5I76A 3ILQD 1P9MA 3EDDA 1RD6A 3ET9F 4LKXA 4PLKD 5E9DB 3O4OB 4X98B 4APQC 2QKIA 1HXYB 4P57A 3ILQC 4X6CE 2UYLB 4HDIA 3KPRD 4AG4H 3TGXA 1QLFB 1JPTL 4FP8H 3D0VB 1KTDA 2XN9B 3B6SB 4G3YH 1UFUA 1GOGA 2EH7H 1IILE 3FN3A 4KTYA 3GSXB 4P0DA 1XF5B 1DQQB 2NZ9D 5DJAB 4QY8A 4NDMB 3SDXF 4PRDA 3EYQD 2FLBT 3AROA 2X7LA 4OM0H 1R24B 5K9JL 2X40A 1YQVL 2Y6SC 1OTUC 1DSFH 1N8ZB 2VABB 2JJUA 4RISL 4MQ7B 3AGVA 1O7SA 3VXNB 4JY4A 4ENED 1ED3A 3KJ6H 1ZVSB 1PQZB 3SGDH 3WS6C 2AK4A 2BFVH 2ZZUT 4X6BA 3BYYA 3WNOA 4ONGH 3EBAA 4OCSH 4RRPA 1Y0LA 2C1PA 3ZE2E 4L8DA 1I1RA 1YY9D 4U1IB 4ENEC 1KCUL 3T0EA 3B5HA 2DQHL 5JXAH 2MWCA 1KPUB 4Z7WF 4NUJB 3HA0A 4DVBA 3S37X 4L8BB 4QRUB 1SYVB 2IG2L 4JDZB 4MA8H 4CU7A 4R97B 1CE1H 5L7XL 1A3QA 3V6OE 1NC2B 1IL1B 3P4OA 25C8L 1XF2B 2GJJA 1MLBA 2A9NH 4WDIA 4F8QA 4R90L 3VFUA 4XP1L 3O11A 3SDAA 4Z78B 4XPGL 1YECL 1A7QL 1RZKH 2I07B 3FOLA 2ITCA 5GHWL 3IJYA 4K94L 5EZOL 4AIOA 5EULV 2BK8A 4M1CD 4JFEB 1A6VH 1UENA 5E1AA 4UTBH 3HR5B 1DBBL 3BE1L 1LD9B 3JV0A 2AK4D 2FH6A 4HWZB 3QUXA 1LO4L 4M1CC 9CGTA 2AERT 3HE7A 3T0ED 4AL8L 2P42B 1INQA 3G5ZB 4KK8D 4P9HH 1I8LA 5CS7A 2B20A 1KB5H 2MQ0A 3F8UB 3PL6A 3WFCH 1MAMH 4RBPH 3DTXA 5FYLL 1ORSB 1T1WA 4KK8C 1T0NB 2YPKA 3NIFF 4DAGL 5C86A 3UXFA 1NGPH 1JFQH 4H5SA 4R4BA 3S34L 3DSFH 3NFNA 1N26A 2DOCA 3SDAD 2NW2B 1XCQB 4PRAA 4UDUB 1K8IB 5F7YC 4Z95L 1B4RA 1T04B 4JEGB 5CZXD 2FJFA 1I3UA 3B9VA 5HI5D 2C3GA 1D5BB 1UWXH 3SKMA 4OCRH 3VCLA 1RY7B 3SDAC 5CEZL 4EBQL 3U0TA 3TYGH 3O6MH 4L4VB 3CU1A 3FCTA 5MEQB 3U7WH 3REVB 4D94A 2VXSH 4LF3A 5D1XC 2QR0A 3G6JE 3HE7D 1QSEB 1CCZA 3BD3A 3UEZA 1JV5B 4UOW0 4KWUA 1A5FH 1E6JH 5EU4A 4G6FB 2CLRB 4TSBH 2FX9L 1P6FA 2X1WL 4YPGA 4PGBA 3HE7C 5KS9B 3BJ91 1S7WA 1GIGH 2P44B 1E4XL 4YHLH 3BMVA 1KTKE 1TQBB 3P11H 3TO2B 3VXUA 2XNAA 4NZRH 5I75B 3BP4A 5E8PB 1EGJL 4ODSH 2DBLH 5AWNL 5DD0H 3GBMH 1MIEL 3P77A 5F1NB 2N7AA 4P2OA 3UC0L 1INDH 1G7HA 5EUOA 3PNWA 3ALWA 1HQRA 1MVUA 4YDIH 3NZHH 5FK9B 5TQ2L 1RZJH 5C07B 3QWRA 3RUGB 2BZDA 4CVZB 2M26A 2XTJD 1J9CT 3VD7A 1J1PH 2AGJL 3BP6A 3W11D 4N90E 4X4MA 32C2A 3OJ2C 2MCPH 4HK3J 3WUWG 5C1MB 4JO4H 4I18B 4M4RA 1BOGB 2F5AL 3U7YH 2EC9U 2BSED 2XT1B 4YWGL 5HI3D 4KDTC 4NQSA 2J6EA 4N0RA 3U9UB 4F7MB 2IAMB 4Z5RB 3TT1L 2R2EA 1X5GA 2ZUQB 4XAWH 3W11C 5SV3A 4J4PA 1FJ1B 4KKLC 3HUJE 4PJFE 3L3GA 3CFKA 1YNKH 3VFWA 2DF3A 1IC7H 3OWEA 1IGCH 3IFLL 4NP4L 4JG1L 2DYPB 5HI3C 2DN7A 2A38A 1KJVB 4TUJB 4XBPB 4N0YH 3WFHB 4NFDA 5HGBA 5EPMA 3B8SA 5TE4L 3VXUD 2WINB 3ME0A 1QBLL 2Y4SA 1RUKL 3IDJB 1C12A 3E6FB 2VQ1A 3LY6A 2ADFL 1WTLA 3HN3A 1G6RA 4EI5C 1U8OA 4MYWB 3G5XB 4FABH 3RX7A 3QWRD 5F7DB 2G5BB 3TJEL 3QXWA 1AO7A 1HNFA 5IWLA 3K8KA 5D2LA 5INDB 4QRRB 4Y88A 1LDPH 4M61B 4PJDF 5I8OL 4HKXA 4MA1B 4JLRB 5BOZG 1KJ2L 1HH6B 2VIRB 4Y1AB 3STZA 4J4PD 3RY4A 4OLEA 4JZJC 5DD3L 3QPQD 3VXSB 1TZGH 1C5DB 3WE6A 1SY6L 1LGVA 4IOIB 4D8PB 2AQ3A 5D7LD 3ROOB 5E6IA 1F42A 5SWSE 4C83A 1AGEA 1X5LA 2BNQA 3FQTB 3V5HA 1HHIA 1A7NH 1MRCL 4OFDA 1ZANH 3CDFA 4I4WA 1MSPA 2FIRT 2VKWA 3UYRH 4BFBD 5HHPB 4U1NB 3LEYL 4FXKA 1T7WA 1W8NA 4X83A 4XPBL 3QBTB 3HLAA 3QUKB 3OKKA 1AXSB 3OSKA 4M8VA 1DLHB 2VZSA 1EH9A 2ICWJ 1M7XA 1AO7D 4WHYH 4DVRH 5GRXG 2PR4H 1UG9A 4NO5A 2FBJH 1XGQA 4QRPA 2V17H 3DMMB 1H15A 5HY9A 2BXYA 1HWGB 4HQQH 3AC0A 4POUB 5DJ0A 4OD3H 5ALCH 4NZUH 2AJVH 4AENA 4J8RB 5GJSH 2XKNB 2XA8H 5IWLC 3JWNC 1LEIA 4I0KA 3UTTB 1G6VK 5GRJL 4LK4A 2BNUB 1MY7A 5JOFA 1S7RB 4DKEH 5KS9F 1TTUA 3WLBB 3KJ6L 5E6ID 4GRMA 1MCPH 1RUQH