4H0HB

Crystal structure of mimicry-recognizing 2d10 scfv with peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
251
structure length
241
Chain Sequence
MEIQLQQSGPELVKPGASVKISCKASGYSFTDYIMLWVKQSHGKSLEWIGNINPYYGSTSYNLKFKGKATLTVDKSSSTAYMQLNSLTSEDSAVYYCARKNYYGSSLDYWGQGTTLTVSSAKTTGGGGSDVVMTQTPFSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPYTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2D10 scFv
publication title Structural evaluation of a mimicry-recognizing paratope: plasticity in antigen-antibody interactions manifests in molecular mimicry.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 58
structure length 241
sequence length 251
ec nomenclature
pdb deposition date 2012-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h0hB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h0hB02
2NY4D 1CICC 3M17B 3WNLA 3SPVA 1DL7L 3DV6A 3GUTB 4WFHD 2XYCA 4KMTH 2AQ1A 1U0QA 4X6BB 1W72L 1IM3A 3ALPA 5IOPB 4KZEH 5HJ3B 3ZE2F 1U91A 3N1GC 1MVUA 2BNQE 1ZHKB 4UUJA 4R4BA 3KPNB 4DOHE 4POUB 3TNMA 3A67L 1CDHA 4YXLH 7CGTA 4JLRA 1FSKC 4M48H 2H32B 2XRAL 1MWAH 3HE7D 2Q3ZA 2VR4A 4FQ2H 5F7KC 5SWZE 4D8PB 3C8HA 4MXQC 3QR2A 3U7WH 3RBGA 4N0CC 1RJLA 1UG9A 5GGUB 3VXRD 3OV6A 3G6AB 2OL3H 2ZPKH 1WBXB 2HT3C 2YA1A 2NCMA 4O2CB 3GGWA 3WHXA 1IFHH 2XXMB 4TSBL 4YGVB 1F90H 1CXIA 5IBUG 3UBXI 5HDBF 4PD4K 5I74B 1D9KC 1IGCH 4JO3L 4MNQE 3MUHL 3V5KB 4XCYB 3HPJB 1DEEB 3RGVB 3U2SA 1KTDB 5CBAA 3CVHB 3VFPA 2ZUTA 5C0RH 1JFQH 1T0PB 2GTWA 3BQUC 3Q6GL 4LKCB 4LSRH 3V8CA 3T1WA 5L6YL 3RVUC 4NQSB 2EH7H 3DUUB 5DDHB 4PJEE 4PJXE 3L3DB 4DEPC 4PJHB 4MB5A 4K2UH 3VXNB 1QSZA 1CLYL 4PJ8B 4GKOA 4WI5A 4FRWA 5DO2C 1KJ2L 3IJYA 3RWCB 4MNGA 3HZKB 3TJHC 2YMXL 2XPGB 4HX1B 2DWDA 4Q9CA 2XA8H 4J4PA 4JZJB 4X6FB 3S98A 5HVHC 1XGRB 4RFNC 3KPTA 4XT1C 1BVKA 4R4FL 3LKRA 2A83A 1IC7H 3SQOH 5C6WH 1N0XL 4EBQL 1RZ8B 4BH7A 4FS0A 2HLAB 5HYIA 2PW2A 4KHTH 5E03A 1KB5A 1OPGL 1S7XA 2HH0H 4PD4J 1T7ZA 3SO3B 1AGBB 5DRZB 4XPBL 4YEEA 4U3HA 1VFBB 2R0WL 3R1GL 1Z9MA 1RSFA 1K6QH 5I15L 4ONHA 3CPLB 3IGAB 1XMWA 4R7DB 2DD8L 1MPAL 4CDHA 5DC9B 4F3FB 1MY7A 4L3EA 1P2CB 3P2TA 4WI9A 5CZKA 3QP3A 3VWKD 5ESQB 2R69H 2JTDA 5F6IC 1DBAH 4D3CH 5IB4B 2C4FU 1U8KA 3LKSB 2NY6C 3LS4H 4UDTA 3ZKMC 1TFHA 2P24A 5DTFA 1DJSA 3ZHLA 3DVGB 4XP6H 2BP3A 4TSCH 5FYJD 4XXCC 5GJSL 2E9IA 2H8PB 3M8OH 4N0YH 4NRYA 3MNVA 4G3YH 5HDQH 4PGEA 4MLIA 5DHVB 4OKVA 1FN4A 1LP9E 1BOGA 2IQ9L 4HKXA 2ZSWB 1PG7X 2VZVA 2EIEA 4S1QL 4FN0A 5D72H 1XGYL 4J4PD 4ODWB 5D93B 5EU7C 3QUMA 4PJ7B 1SYSA 4JRYB 4S1SH 1TNMA 1T7VA 4YUEH 1BWWA 3P9MA 3U48A 4HC1H 4MD4B 5CP7A 3GIZH 3NTCL 4O58L 4LLQA 1Z5LB 4HFWB 1VGEH 5JUEH 4JN2A 1KIUA 5E4EB 2JE8A 2OR9L 1OWRM 1G9NL 4GW4B 1FPTL 3UBXB 4EJ1C 2UWEA 5GSVA 3BP4A 1I9EA 3SQBA 1G7HB 3V6ZA 1XGQB 1O7SA 3CK0H 4L3ED 4LPUA 5HDLA 2F53E 4XBPA 1VENA 1WITA 5JHLL 1LILA 5HYSA 4HLJA 3CH8A 3U9PH 1RUQL 4X6DA 5HGHA 3IT8D 3FN0L 3E2HC 1ES0B 1ZLWH 1FL3A 3P73B 2EYTB 2WUCH 1HQ4A 5K9QG 3JV6B 4WW1B 2FJFB 2QL1A 3TJEL 5L0QC 1MJ8L 3P11L 4ZS7H 5C2UB 1RZJL 4MDJA 5FA4B 1ZVSB 2HVKB 4JHAL 4FFWD 3NZ8B 4QXUH 2PO6B 7FABL 1N3NB 4EKXA 1NFDF 1NEUA 2VITB 2G5BA 5GGVL 4D9QD 4Z7NE 5IEHB 1IC5L 5A16A 3I3EA 3IFOB 3BRGC 3GSUA 1G7QA 3BAEL 3R0MA 1WAAF 4P5TA 1EV2E 4Y16B 4O9HL 4KK6D 4YC2C 3UXFA 1JI1A 1ZEAL 4ZFGL 2YD8A 3VXSB 5FOBB 1OF2A 2VLKE 3DRQB 3IVKA 1PGRB 1UEMA 3BD4A 5BW7C 1A1OA 3UTZA 1YEHL 1NBZB 3EYVA 1WIUA 3O3BB 4M3KB 1VKXA 4ALAH 5E5MB 2V2WB 4R0LC 1S78D 4V1DE 4M43L 1EX0A 5FEBA 1U36A 4QHNB 5FKAA 4DKFH 3UYRL 1R3HA 1VSCA 3WO3B 5D7JB 3RL1B 5GQBA 4QTIL 4FTVE 5HDOA 5EZIH 3GMMA 3T4AA 1I1CA 3ZKQD 4FXKA 4EI5B 1J1OH 4JANA 4KVCL 3VH8G 5D2LA 4YK4B 1WTLA 5EOQL 2DTSA 4JZOA 4L8SB 3VFMA 2F8VA 3GRWL 3WDIA 4U3XA 2VLKA 3BN9C 4JQVC 4OCYL 5JW4R 4CMHB 2I9LB 1X5FA 4WHTA 3HN3A 1NMBH 3DYPA 4NYLA 3LSOB 3NIFE 4X0KB 5SWSD 1LO3L 3DBXB 4O2FB 4RFOL 4V1DA 2LU7A 1GZPA 5TPWL 3JTTB 5HVGB 3F7RA 2IPKB 3BH9B 1DBBL 3IDJB 1IM9A 1ORQB 5J11C 4OZFA 4PJBF 1I8KA 1YMMB 1CE1L 1WZKA 2F54D 2HWZL 4LSSL 4XWGH 4G6JH 1FYTE 1I7ZA 3JV4A 2DKMA 1INQB 4QGYA 1EH9A 3E3QE 2WBWB 3W11C 4YDKH 1NUFA 5ECJE 3S4SG 2AI0H 4YBQC 1CE6B 1SY6L 1R5IA 2ATPA 5HYEA 3WS3B 4Y2DB 1QSED 5F7DB 2X09A 4EZMA 3I50H 4YX2H 2P5WB 1ZGLM 4YNYA 3BXNB 4N90E 3GM8A 5HYFA 1UJTA 5D7IA 5TE4L 5EO9A 4NNXA 2F19H 3BPNB 3Q6FA 4EN3C 1CR9L 3HPLA 4ZYKA 1MFEH 4JM2C 2V7NA 4L9LA 3VGEA 4L8CA 2FHBA 3U9UB 4NQVB 2ZUQC 5JHDD 4UU9A 1MCQA 3G5ZA 4KKLD 4DGVH 2JLLA 2XQYG 3E6HB 2YUZA 5C71A 4PP2A 3QEHB 1ED3A 5D2NC 1P7KB 3PHOB 4JRXD 3CUPB 1SY6A 2BFVH 5HPMA 2CKBH 3SE4A 4NKOA 1K4CB 2GSGA 5CIPA 1FC1A 2OR7A 4JFED 3ARSA 4I0PC 5DVKA 1UXWB 3FO1A 1CGVA 3BUTA 3K4DA 5GRXG 3QEQD 1U8OB 2B8OT 1IM9D 3QFJE 5HY9A 3DYOA 1H3XA 1GGYA 5CGMA 1PVHA 1J8HE 1KG0B 3ZE1F 3LIZH 4DGIL 4Y4HD 3LKQA 3QXAB 2VKXA 1MCEA 3B83A 3OAYH 1XGTA 5LAXB 4JFOB 4Y4FA 1U2HA 2EZ0D 3BEVB 4D0CA 3G6DH 1WCBA 3BIKB 5EN2A 1ZS8B 3UJTL 1AR1C 3T2PA 2VB5A 3NCYS 1QLEL 2OXHA 5TFSH 4BFIB 5D5MF 1XGPA 1ZTXL 5I74C 4NO2A 2VWEE 2EKJA 5MEPB 1IGJA 5SX4H 1JUFA 2VDLL 1T1WA 5J57B 1EHLH 1CDBA 1I7UA 1RUMH 4W6WB 4YHIB 4FZ8H 1FORL 1UM5H 1LO5A 4NWUL 1A6TA 1JK8B 4HUMB 2D2OA 2KBGA 3DTXA 3FRUB 4FQ1H 4D0DB 3DOSA 4YHPB 3C5ZA 2Q8AL 4RFEA 3D18B 3TCLA 3D25B 4KJPD 4NRZA 5JR1L 3TN0C 4PJ8C 2DMKA 5C6TL 4JGUA 2X42A 4HZAA 4ZXBB 2X4PA 4MS8D 1WIOA 1NLBL 1HHGA 4JB9L 3CVHH 1DANU 1ZVHA 4KKAD 2EICA 3FB8A 5E5RB 1FL5A 3U30B 4C57C 4EDXB 1G9EA 4M6OH 4HW6A 4Y4FD 3HZVA 1AP2A 1N5YL 1T3FA 1KLFA 4H26B 3SO3C 3I3BA 3FFCE 4PJDF 1EEZB 1X6NA 2YA0A 2E7MA 1GL4B 4MAYC 5GJTL 1JWSA 4M6AA 1TQBC 2F58H 3V6FB 5DJ8B 5B39G 1KTLB 4LLWA 3WFBH 4Z7UB 2ZCLH 5B4MC 3VWJA 1CN4A 3H0TB 4UQ2B 4OM0H 3L5XL 4WHDA 2ARJA 2IALB 2X89A 2O93L 4B7LA 1NGYB 4M7ZB 2R2CA 4XVJH 1ZHBB 4LEOA 2NX5E 3VXQA 4GBXC 5IVXA 3QQ3A 3OGCB 1N6QL 4IJ3B 5MHSD 2IG2H 2OMNA 4EQ3A 4FXGA 5DMGD 2DB8A 3GBNH 4PUBL 4U1HA 2M26A 2YKLL 2E6JA 2DLHA 4HPOL 3K8LA 1JGUL 1OARH 3OXRB 5D93C 5CEXA 4KMLB 1BQHB 3WUWA 3INUH 3QHZL 5FYKE 5DLMH 3VGDA 1LDPL 4UT9L 3EOAA 5FYKL 1GGBL 2FATL 4LMQI 2VN7A 3O8XC 3PWNB 4HGMA 4IMKC 3HUJF 4W4OC 1X5ZA 3MRCB 1AXTH 5IQ9A 2X4TA 4KK9C 3AXLB 1OGAE 3VI4E 1YPZF 2A74B 4Y5YB 3MLTB 5IT2H 5IG7A 4JREB 2WP3O 4ACPA 3IDNA 5GGRA 3KLAA 4M7LH 1C16A 3OGOE 3SCMD 4WV1A 5EU6B 5C09E 4XC3L 3AS3A 4MB3A 3G6JB 4PRPE 3HS0A 1FO0B 3DUHA 3C6SA 3C2AH 2H1PL 3OB0H 4MWFB 4GUPB 4PRIE 1AIFB 5HVWA 3EYFB 3VG0H 1MRCH 2GJZB 1NDGA 1JBJA 1QEWA 1MJ7H 3TT1L 3DMMC 2AABL 3FB6A 4I1NB 2X2YA 4PY8I 4NHUA 3NGBC 4AEEA 3TLRA 4K3HA 1LO0H 1A1MA 1OGAA 4Z7WE 1LD9A 3B3IB 5FCUH 5KTEL 3DX9A 1A6PA 1XGUA 2J8UA 2F8XC 4N5ED 1W0WB 2NY7H 2IANE 3MJ9L 3VI3E 1MCCA 3VFRB 3MR9B 1T1YB 5C09A 1NLDH 1NKOA 4NQTA 3VGBA 2V2XA 5IHZA 4NT6A 2KUTA 2P5EB 1ZLWK 5EC1B 1YNLH 3RNKA 2DLFH 2W60A 1LMKA 3FONA 5IF0A 4LEXL 5F7FA 4MNHA 3DWTA 3HLAA 5JA8B 3WV0A 1PKQE 3AMLA 2IMMA 1YY9D 4P5MA 1VFAA 2ITDB 4BFBD 1YEEL 3QUZA 5F7HA 3MA9L 2EIZA 1E4KA 3EYQC 5AAMA 5GIRB 1KB9K 4P2OB 2VUOA 3LEVL 5DQ9B 1SJHB 5E7FA 2DQEH 4CMHC 2AJXL 2BVPA 3RHWF 2VABA 1G6RH 4CGTA 4MX7A 3GSRA 5JPNA 2FIRT 5ABDE 4X5WB 2CLRB 2DQDL 4TNVF 5CUSH 1UJ3A 2OBGA 4MDIA 1S7SA 4QF1B 2B2XH 3BPOB 3ILQC 2QV2A 4PJIB 4UBDC 4DVBA 4JPVH 4NM4H 3QJHA 4YQXH 5E2TL 3IFPB 5F9JA 2L7UA 2NY4B 4MMXC 3KYMB 1VACA 1Z9LA 3LZFH 2CIIB 3IB4A 5DD5H 1L0QA 3MREB 1N2RA 4ZS6C 4NKIL 2R2EB 3X17A 2R56H 3B2UC 4GRWE 4J1UB 2YWZA 5M7QA 5ENWA 3FB7A 4DWHA 3VXTA 1CL7I 3FQRA 1GPOL 1EK3A 5INDA 2APWA 4IRSA 1RURL 3CMOL 5DUPH 1KB9J 3D85A 1MREL 1AD9A 2YR3A 4WI6A 3LKOA 4JY5L 3MLXH 1OTTC 4BUHA 4Y1AE 1TZGL 3U0TA 1G7IB 4FQHA 2HLFC 3MLYL 4NWTL 3OXSB 3QIUA 3KPRA 4LFHG 4YFDB 3G5VB 2AJUL 1T7XA 3VXRB 4JDTL 3K1KC 5INCA 5C0CA 4X6CE 1FBIH 2FZ3A 4X83A 2Y7QA 5C0EA 5F3BB 3BZEB 4K9EL 4TULH 2X6MA 5CSGA 3VMNA 1T6VN 1KXVC 4M61A 2I60H 3OKYA 4U6XB 4G6AD 2BSRA 4NDMA 4MCZB 4Y19A 3D3VE 2X4QA 1NCUA 4OKDA 1KEGL 3B8SA 3QSKB 1T04B 3DV6B 2P8PB 4JR9H 1A5FL 1M71A 1FFRA 1CLZL 3ZKXC 4WFGE 5FGCB 4JO2H 1F3DH 1CK0H 2BJMH 3RWIB 2DL9A 2V7HB 2OZ4A 4UT6L 4XPFH 2ZOKA 4GS7B 4I18A 1IGYA 2VDRH 5D1ZB 1SEQL 3KPSD 4BZYA 1IAIL 4EUPH 3WFEL 3P4MA 4IRSD 5EU5A 3TH3T 3NIGF 4UUJB 4P23A 2XQBH 4YEFA 3O81A 2VE6B 4JFHD 1XR9B 1L6XA 1RV6X 4FABL 4ZG1A 3T0EC 2C3WA 3RTQA 5FECB 5JOPD 2VH5H 1X5AA 3HC3L 2L0DA 1YYMH 1S7RA 3L5WA 3NCBB 3PIQB 5FUZL 3KPRD 3I9GL 3H3BC 3VXME 4R7NB 1DVFC 3CAFA 1JYWA 3STZB 3V5HA 5IB5B 1LK3H 4X7EC 3OAYK 4GG8B 4HS3B 5C0CD 2HKFH 3W82A 3U83A 3CJJA 2DQFA 4ZUSB 4CJ0A 1A7QL 1JI2A 3IDMA 4F37K 1CVRA 3U2SB 4WY7H 4Y19D 4HJ0D 1FVCA 4O00A 5CBAB 5HYQA 3VWKB 2C26A 1OAYL 3MRBB 2P45B 2BSED 3VFPB 4YHMH 2WM0A 2ADGA 3O3UN 2GTWB 4ZO7A 5LGHL 3QQ4B 1YJDC 3AAZA 2YHGA 2FIKA 4Z0BL 3MLSL 2ZOLB 3KYKH 4G8GE 3NABL 4U1NA 1N7MH 5EO0B 1PFCA 2D7PA 3N1FC 4D2NA 3GMQA 3VXMA 3HRZB 3O11A 5D1QB 4ZUUA 5C9JA 4P23D 4G6FD 2M1KA 4IRZL 3IJYB 4X9BA 3KPOA 1JZ8A 3TV3H 4LCWE 4WO4D 1NAMH 1WUNT 2DWDB 5DJDA 3H9SB 3KG5A 3I02A 3PWLA 5LQBL 1YJDH 3KDMB 2FX9L 4PJFE 5DUBA 4PLKD 5T33H 2MNUA 4LAQL 4UQ3A 5F9AC 5BRZE 4DUXA 5FYLH 1SJVA 3S3PA 3T3PF 2Q6WA 5E2WH 4DN3H 3P77B 3U1SH 2GUOB 4ENEC 5EOCJ 1B2WL 5SV4A 1KCSL 1QR1A 3O4LE 1F3JA 2V5MA 3CC5B 3KPPA 4WFED 4HCRL 2X9WA 1S7VA 3BT2L 4LSDA 4UT7H 5KSAC 3QDGB 4XVTH 1PG7L 1WEJL 2HMIC 4R3SB 3HR5A 4U0RB 1U93A 5GS0C 3L3KB 1FFQA 4P3DA 1UA6H 5FA3B 5TDPB 3B9EA 3FAXA 1RIUL 4KRPD 2OTWB 3W81A 3O3EB 1B6UA 2UYLB 1SM3L 3MYJB 4NN5C 1U3YA 2E7LA 3MNVB 1XF2A 5IMMA 4JPKL 4XI5C 1CZ8L 4LHUG 3QQ9D 1BOGB 2WP3T 5IVZB 1BQLH 2BDNH 3W39B 4NZTL 1DQMH 2D7NA 5FFLA 4L4VA 2ZWLT 2DLIA 3B6SA 3TA3B 5LGJB 5D2NE 3QUMB 1UM6L 1TQCC 4MQ7A 4M7LT 4FOMA 5CJXC 1BMGA 1A7RH 5C86A 3UYPA 1KIQB 4HGWB 4L8BA 2BVTA 4HWZA 4FFYL 5CP7B 1OW0A 4PJCB 4R9HA 3MRQA 4NFCA 4XPHL 4I8DA 3S7GA 4BA8A 4K8RC 1QVOA 1FNSL 1H0DB 5HHPB 5TDOA 3W9EA 2Z4QA 2OTUB 1OLLA 3VXPB 4MJIA 4FQCH 3BP4B 4OIIL 4HEME 4LSUH 2FX8L 1QFWH 4H1LG 5FO9A 1TJHH 1FO0H 3MX0A 5HGHB 1H3GA 3WE6A 5EB9A 2HRLA 3PHQB 3OMZA 4HMEA 4JFXA 3AS1A 3SJVB 3PL6D 2PTTA 1JZ5A 1HZHL 2NTFB 4LGPB 4Z78B 1VPOL 3OB0K 4QWWC 4X7TA 5C0AE 3BYYA 3ELAT 2X5PA 4X8JB 5SWSB 5JZ7C 3C5JB 1ZA3B 4P9HC 1OB1B 5E00A 2XOTA 2DLEA 1HH9B 1DFBH 5A16B 3BP6B 4J8RB 1EO8L 2JELL 3PWVB 4HK0A 5EUOE 1OAKH 3VXUD 2PCPB 5FUOH 1KT2A 2F54B 2OQJB 3IVKB 4RMQA 1NSNH 2FSEA 2E7CA 1Z0MA 2AEQL 3ARGB 4N8CH 5CGTA 1J1XL 2DQTH 4LLUB 4LLVA 5FGBA 5I1GH 4K94L 1JJUA 1DQDH 4J3WA 5DJCB 1QSEB 4P9HH 5I1LA 4YHLH 2Y1VA 4MJID 3R8BB 2PYEE 1NBQA 4DN4H 4M1DL 1D3CA 3GMMB 5E99L 5C9KA 1J0ZA 1DTUA 3O6LL 2YSSA 3LMJL 3UTSD 3BPOC 4NQXA 3HG1E 5A40E 5D2LB 1K2DA 1ACZA 3SKMB 5BV7B 5E8DH 2QTEA 3C5SA 5JORB 1NL0H 2I07A 3I6LD 2VDOH 5IW1A 5JPMB 1B0WA 1F4YL 5JHDB 1JRHI 4QHMB 4M3JA 2NW2A 4N9OB 4GAGH 4LLAA 3MV8E 1LE9A 4OCRH 2VUYA 5C0BE 1UM4L 4JRXB 4HLZG 4GJTB 4LU5H 4M7JH 2FD6L 4WEBL 1UKTA 5EZLB 3FOMA 4JFEB 3GJEB 3FFDB 1D5IL 2FL5B 3T0DA 1OSZB 2BY0A 3QEQB 4NNYB 1BPVA 1IQWH 3MRRB 3V4PL 4CW1A 4HS6B 2FO4A 3AREA 4OUUA 3SDCA 2BRRH 1C5DB 4Y4HB 1UCTA 2A6KA 1MI5D 4JFQB 3L95B 2VZ1A 3UPCA 1U6AH 2ATPB 3WFZA 1LEIB 2X4SB 4L3AA 1R3IH 3FQNA 5IP4A 4Z7UF 3GMOA 1NC4A 1L7TL 4JAMB 5DK3A 3TM6A 5I1AA 2R9HD 1EUUA 4RGNC 3PGDA 3MJGX 2NY2D 4P2QB 1J5OL 4XPAH 4L9LB 1I8LC 4OQTA 2VZUA 1EIBA 1U8NB 4D9LH 3H9HA 5D1ZC 5HPMB 2VNCA 3RWJA 1NGZA 4PLJD 1AKJA 1HKLL 1MAML 4X4ZA 2VL5B 3QQNA 3RVTC 4GAJH 2XICA 5E56A 4LSQL 5C1MB 3UPAA 3FO1B 3I6GA 3X14A 5DS8B 4K7FA 4WDIA 4XMLH 4B50A 3BH8A 5HY9B 2R4RL 4LVOB 4G9FA 3ARED 1D5MA 4U2ZA 4ZPVB 3SDCD 1C12B 1S9YB 3TWCH 5I66A 1KV3A 1C5BH 5F44A 4ZTPL 4PG2C 1NBYA 2CIKB 32C2A 1RJZA 2JJUA 1G7JB 1FL6A 4XC1L 3DO7B 5HVFB 5E2UL 3SDXA 2QEJA 4RGMB 3RUGE 3SDAA 2R8SH 4S0TD 1WCBB 3BHBA 5ANMB 1RIHH 5IQ7H 2DWEB 1JF6A 1NC4D 2W0LA 1W0YT 1WZ1H 2DIJA 12E8H 1FAIL 4F9PC 2PUQT 1T0MA 5MENE 3BPLC 3ES6B 4X5XA 2OMBA 4G6MH 2EO1A 6CGTA 5J6GB 4HIIA 3U4BH 3WFDH 4N8VG 5HHNA 4GLRI 4F7TB 5ESVA 3EOYG 1KFAH 4KV5F 4Z7QE 1KLGA 5ILTL 1JPFA 4XVSH 1XR8A 1OTSC 3QHFL 6FABL 5C2BH 2Y06L 3DTXB 5I30H 5DC4B 3GNML 5EUKA 4PB9H 1A14L 4OCLC 3HC4H 4HKJA 3VG9C 4RFEB 2E5EA 3BKML 4PTTB 4PFEA 1GCFA 3B9KC 3L1OL 4EXKA 2VYRE 2WV3A 4I3SL 1I9RL 2QSCH 2ICEB 2DM2A 2NYYD 1MIML 3NCCB 3PABA 4URTB 4G9FD 5D6CA 3ZDZF 3UPRA 3UTTA 3DXAD 2AERT 5DJ6A 4NO5A 1S5IL 3MCG1 1A6AB 3PQYE 5IM7A 1KJVA 5IBTL 3SDAD 1F3DJ 3HZVB 5DMJB 1CL7H 1G9ML 4WU5A 5T1KD 4AEIH 5ADOL 3BDXA 5IMOA 2AEPL 3HNSH 3T2NH 3C6LA 1CXFA 4OTXL 3QEUB 3TFKD 5CWSB 1NAKH 1AQDA 1PSKL 1IKFH 3N50A 4N8VA 1T2QL 3ISWA 5CJOH 5H2BB 2NXYB 3TT3L 3B43A 2A6IA 1I1AA 5FUCC 2CJUL 4JQIH 3SCMB 4DTGL 4LLWB 3ULVD 5HHME 3K7UA 2O5ZH 5ICYB 4ELKA 4DKEH 5DK2A 3QIWA 2HFEA 3JZ7A 4K3JH 4LVHB 5ID1B 1EVTC 3S35X 4NQCA 3GKWH 5TH2A 1WV7T 3LN5A 4OCWH 4E41E 3PQYA 2XZQH 3I85A 1FDLH 1I8IA 4M5ZL 4ZTOL 5JTWA 1TNNA 1TXKA 3U7AA 3QDME 4U1HB 2Z31C 2Y6SC 4OFIA 3WUZA 2JJVA 4N1CA 5KJRL 2Z91A 3UTTD 3TPUA 3MROB 3TA3C 4EUPG 1F5WA 2JCCB 1AGEA 1AJ7H 3GSNA 3BZFA 1ZHNB 3EOAB 4YFLI 4YGAB 3G9AB 4GRLA 3X12A 4G8IA 4NO0B 5FV2A 2E3VA 3MO1A 5JMRA 4DQOH 4R26L 1IARB 3CLEL 2EYSA 1FE8L 4ODVH 3GDBA 4E41A 5C0ND 1C5CH 4IOFD 5GGRB 5BO1H 3KLAB 2R0LH 1C16B 1I1AD 2DM3A 1SBSH 1JNLH 1QUNA 3HKFA 1OAXH 3LQZA 4G5ZL 3LPFA 5FOJA 2CDGA 3TEUA 1I4FA 1HINH 1JN6A 2ATKA 3VW3H 3QIWD 1H8OA 3K81A 3MUY1 1HXMA 3C6SB 2EEBA 3SGJA 1KC5H 2DTMH 3ARBC 3CFDA 4NQCD 1CFSB 1NC2A 1NDGB 3C60D 3SDDC 4P4KA 3MBXH 1SJEA 1X5YA 3TO4A 3QI9B 4PP1C 5KSBA 1CDGA 3K80A 1DBMH 4LAJH 3UEZA 4Q9QL 3FAWA 1F8TH 5KSVA 1B88A 1ZWIA 1A1MB 4F7CA 4DFHA 4QT5B 2J8UB 3IU3B 1A6ZA 1KPVA 3QXWA 4OLWL 3T09A 4HFUL 4NKMB 4X8XA 2XTJE 5F72S 4GRLD 1XAUA 3ARGC 1U92A 5DQJB 2NY0D 3ILPB 5F7MC 3ARWA 3AU1A 5KOMC 1B4RA 3GK8H 2DBJA 1XZ0B 4OGYH 4LF3A 4ERSH 3PDOA 2P7TB 3MNWA 2WANA 3RPKA 5ERWA 1MCBA 3LKPA 2E9WA 4OLYH 3BX7C 4XNYL 1C1EH 1U8HA 2Y23A 4LARL 1E4XI 5DYOB 5E6IC 5I1CL 4HUUA 1A7OH 4YFEA 2JJSA 4ZFOA 3NCJL 2O61B 4XBGA 4UIKH 2Y25A 2FJGB 3T65A 2JIXD 3GJFA 4ONGH 2VMFA 5B3JE 2DJ4A 2Z8VC 3D87B 3VRLF 2QQQA 3F62A 1GGCL 2AJ3A 1K85A 3QUKA 3IDXH 3NFSH 1NJ9A 3T4YA 3WS6A 5C07E 3B9DA 4RZCA 1Q9OB 1TVDA 3TYFB 3EGSA 5I17A 3HA0A 4MQTB 4OZGB 4L5FL 4ZFFB 3SE9L 3WFHB 4BFEA 5BV7H 4BZ2H 5BJTA 1S7SB 5T1DH 5EULV 1M4KA 3BW9A 3BZ4A 4LRIC 4K07A 1R24B 1RULL 3ARZA 1GJIA 5BXFA 5F9JB 1IGML 1BJ1J 4PG9A 5FHBH 5FYKU 1MCSA 5DJ0A 5JOEA 3MOAH 3KJ6L 5TQ2L 2E7BA 5KAQF 3ZE2E 3MRKB 5HGAB 4LVNB 3EJYC 2ZSVA 4XCEB 3KPSB 5ID0A 5C07A 5I1HL 3LH2L 5GS0L 3M07A 1A4KB 1N4XH 1G7MB 5DEFB 5HHOB 4LIQE 4JKPH 4XPGL 5SWQA 5J13B 43C9A 2G60L 2XV6B 1BD2A 1JNHA 2Z35A 4LIQL 3QO0B 4L4TB 1H5BA 3MV01 2O5XL 4OBRA 5EC2A 4Z8FH 3IAQA 4PJGB 1ZAGA 5DT1H 3DSFH 2IAMA 1V3LA 1NQBA 5GISH 3BP5B 1OCWL 1EAJA 4YIQA 1JV5A 4Q6IB 3QUYB 1L9NA 5HDBE 2Z93A 1UADC 5FKPA 3ROLB 2DM7A 3HI6H 2J4WL 5GHWL 1YC8A 4JPIB 4P46A 4R90H 4M61B 5HGDB 2DQUL 5TQ0L 1QG3A 2IH1A 3FMGH 5JQ6L 2XKNB 4YPGB 4CL7A 3L7FA 2VIRA 1BWMA 4K8RL 1EEYB 2PTVA 1Q94B 4NQEE 3S88L 4FQXC 2BNRB 3BMWA 5HI4D 3D69A 2WWKO 3U0WH 4TQEL 4PRDA 5LCVH 5TJWK 4QLRA 4FMKA 2A73B 4MZ2A 3C9NA 3RWGB 1N59B 4LOUC 2ENYA 4FMFA 3JWOC 1IGFH 4AL8H 4O4YH 3P4MB 2MKWA 4M6NH 1I9IL 2ED9A 2E7HA 3QG7L 2NTSP 1BD2D 1MY5A 1SMOA 4WO4B 5L9DL 4PJCF 2ZZUT 4LNVA 1ADQH 5DZNA 2DS4A 1S7RB 2JK5B 1S7QA 2NZ9C 3MV9A 2IAMD 3OKDB 1ZV5A 1QQDA 4JN1H 3GMPA 1FZOB 5FF6B 1H3PH 2UWEF 1MCDA 1FYTD 3JWOH 4OB5H 5JW3H 2B39A 3X3FH 4NQEA 3D39E 4G42A 2UUDH 3PGFL 1A9BB 3MNZA 4JFFE 4X6DF 3RWDA 4PS4L 4PB0L 3U0PA 3HAEB 3LS5L 4H8WL 1F4AA 1DN0B 4IOSD 4P46D 5T3ZH 4HS8L 5T5FL 4KZDL 2OYPA 4X4ME 3F7VA 5AYUL 1RUAH 1K8DB 4QRTB 1U8IA 1ZA6A 3MBEA 1BZ7A 1JRHH 1OAZH 2G2RA 3DGCR 1OP3H 3EDJA 1N8ZA 4NZRH 4UB0L 3S3JA 2XZCL 1BLNA 5E7BA 2YWYA 3ZL4H 4N9GA 3MRPB 4PYGA 5B8CC 5JQHC 1JHTA 1Q0XL 4PY8J 3MXVH 3WLWC 5MP6L 3UJIH 1QLFB 4LCYA 4KRPB 2EKSB 2HJKA 1EJOL 1JPTH 2MPAL 3O6FB 1UQSB 3GMQB 4QYOA 3DNKA 5IR1A 1YY8A 1CXLA 3U4EA 2BK8A 3HMWL 2YZ1A 2MHAA 3UO1L 3TP4A 2A77H 1Y18A 2Y36L 2C5DC 4WFFD 4KK5C 2BOCA 4XBEL 3MV9D 1QBAA 4PJ5D 1U58A 1CLOL 5AWNH 4H5SA 3S5LG 1J8HD 1AH1A 2C3HA 3MUGA 2Q6WB 3T0XA 1OTUD 3CSYA 3QZWG 3I2CH 4K7PY 3U7YH 5I19H 2KZ1B 5F7UA 5D2LF 4KRLB 4U0QB 1M6OB 3TVMC 5CD5C 2YPKA 3HE6A 2YZ8A 3KAAA 3MBED 3T0AA 1T5WB 3MRNB 1A3LH 4GXVL 2PXYA 3DGGA 1F2XK 1QHOA 4U05A 4B5EA 5T5NF 2VDQH 1BZQK 2EDEA 2VLMD 3PL6B 1AE6L 3UTQA 3KNBB 4GSDL 1MCWM 2GJ6A 5I75C 1MF2H 3KVQA 4NGHH 1CXEA 1NFDE 4OAWA 4U1KB 4B41A 5IIEA 3RIAK 3DVNB 5KZCD 1A2YA 2HJFB 4LPYA 1ROWA 1LO4H 2CRZA 4M9PA 1Q1JL 4X7CC 1WAAE 4UV4H 1Y6MR 4WI3A 2ICCA 4I2XB 4N0UB 4AMKL 2HTKD 1BZ9A 4BKLB 2AV7B 4X6EA 4NJ9H 43CAB 4AT6A 3BSZH 5M95B 3ZTJH 3OAZH 3QNYA 5CILH 1TETH 2W38A 4YO0B 3VXUB 4ZSOA 4L8BB 5CBEB 5IGXH 1I8MA 4U6YB 3CFEA 3PWPE 3RDTD 3H7LA 4HK3N 3GSOB 3MLVL 2NY3B 1QO3A 1VFMA 2UZYB 5D7IF 5F9WC 5JXEC 1OSPL 4FG6D 4OLEA 2EE3A 3QI9C 4RCAA 1UYWH 3O6ML 5FM5M 3TIEA 5IEKA 1TCMA 4GLRH 4I3GA 3B9VA 3CXHK 3GMNA 5DD3L 4X7SH 4JO4L 3H3PH 4KQ4L 4HK3J 3UTSB 3IJHA 1VGKB 5DI8A 5J06A 4NJAL 2QADD 3K3QA 3QNZA 1WAAA 2A9NL 3HMXH 4Z77A 5F8QC 5DK0B 4I77L 5DRWA 2VDNH 1J05B 2CO7B 1MWAA 3TGXA 4JFXB 3BJ91 2B20A 2V9TA 1OAUL 4J3SA 2BSSB 3L5JA 2GJ6D 4M8VA 1A6VL 2OL3A 2F8OA 5EDXA 3LDBB 2OI9B 1IAKB 4ZD3H 1WLHA 1QR4A 5EIIB 3SY0B 2FLBT 3VFSB 4L3CA 4U6TA 3V7MA 1EMTL 1U3HB 2RCSH 4PJBE 4HHAA 4OZIA 4WUUE 4HK0B 3L6FA 1H8NA 1GIGH 3FCTB 2X4NA 3D2UD 3MV7A 5DD0H 4CU6A 4PGCB 1MI5B 2HH0L 4AEFA 2YBRB 4JG0L 4PBWD 3RWHA 1ND0B 4OD3L 4M62H 3O2WL 4PV8B 4XP4H 3CX2A 1HOCA 3HRPA 3QDJA 1D9KA 3OKEB 2X1OA 3BGFC 2J3SA 2HVJB 4NN6C 4BH8B 2ERJB 4F2MA 2ESVA 4K7PH 2ED8A 1R3JB 4EOWH 4HH8A 1CBVH 1JWMB 2YSSB 1ZKAA 2R69L 4OV6F 1RUPL 4D3CL 5E9DA 3C5SB 2NY2B 5I2IA 1BEYL 4HH9B 4YHKL 1DDHB 5IVNA 3UAJC 3E0GA 2BNUB 4PRPD 4WUUA 5IJVA 1T0NA 3JWDL 4TNWK 2EE2A 1KYOJ 4GQ9H 2XKSA 2NW2B 1LE5B 1C08A 3S34L 4TSAL 2VR9A 4LVNC 5D9SA 1ZT1A 4Z95H 2DI9A 2GTZB 4RNRB 4F7EA 5CGYC 4HAGA 5L7XL 1EHXA 5BMFL 1MRDH 2J6EH 4WHYG 2D03L 5MEQB 5CINH 1TVHA 3U79A 3ZE1E 4JFDE 3I6KB 4A2MA 1EA9C 2P8MA 4NUJB 4N0CD 3SDCB 3TBVA 3C8KA 3DURB 1CDYA 3L7EB 5EA0L 3MV7D 3OX8A 1ZLUH 2HT3D 5JIIA 5F8RC 1RZ7L 4DVRH 1JF1A 2AK4A 3SDYH 2VC2L 4XCCH 1IEAB 3O3DB 3GMLA 3QDJD 1D9KD 3KWWB 1YEKH 5D5ME 5EU4B 1KCUL 2ESVD 4CKVX 1HWHB 2WWMC 2CDEB 3VFUB 5DEZA 1KPRB 1HN1A 4MD0A 1EAPB 5AZ2H 5BZDA 3QUXC 5E9DD 2AXFB 3BQUD 5F93C 3MJ7B 3IJSA 4FQLH 1UVQA 2I26N 5IVXF 5L88L 1A64A 5KVDH 5KVMC 1HEZA 4QTHB 1U8LA 4XXCA 4HC1A 5HYJE 2D31B 1KEML 2HFFA 4EXPX 2NXZC 2WWKT 5DO2D 2QHLA 2PYFA 2W92A 2AW2A 3TJHD 2MTPA 3ZKSD 3O2DH 3VMPA 1HHKA 4HDIB 1NGXB 3H42H 3I6GB 3MLRL 1TJGH 4JJ5B 5J3HC 2OSLB 3HTLX 2VLRD 4O5LH 3RKDC 3DI3B 3I75B 5EZOL 1MJJA 4OGAD 2HJLA 1FZKA 3DXAB 5GS1A 4A6YB 5I66B 1F13A 1FZMB 5IK3A 1LNUA 4NZUL 4M5YL 3O4OB 3MGAA 3S37X 4UDUB 4BSVB 4XAWL 3MRJA 4ETYA 3GBMH 5T1KB 4PJDE 1GXEA 3EO1A 3BIBX 4B53A 2WUBH 1E4XH 4I0CC 2HA1A 4BQ8A 1E6OL 3C08L 3RU8H 3VDBA 4X5XB 4PTUA 4OCXL 4U33A 2BNQB 3U6RA 5JMOC 4TUOB 1VFUA 2MSPA 2FJHB 4Z5RB 5J6HB 1D5BA 2B0SH 5I73B 4TUJB 2VDPH 1TTGA 3KYNB 1GGIH 2R0ZL 4DOHB 4MJ5A 1KLGB 3NN8B 3HB3D 3LRGA 2B5IC 2H2SC 5EORH 4ZUTA 3L3HA 1MCRA 1EGJH 1CT8A 5FO8A 4YHOH 4MA1B 4LPXA 1NCCL 3MYZA 1DE4B 3SKJL 4WNQA 3OJDA 3HAEH 3Q5TA 4XMPH 3O6FC 2J8UF 3OZ9H 3VRJA 4AIZA 4WW2A 5KVGL 4DCQA 4BUGA 4BK4A 3Q1SL 3OJ2C 1MQKH 2X4OA 4I9WE 1FJ1A 1D6EA 1G0DA 4CVXA 3ULSB 1R0AH 5CEZE 2N1KA 3QG6B 5D6CB 1RJCA 5CEZL 1MHEB 1YQ2A 1UZ8B 1JPGA 2DQCL 4Q7DA 4NO5B 2VDKH 5BW7A 3KLSA 1GC1H 2BOBB 1TITA 4RWYL 2P44B 3UZQA 3WCYA 5DVNA 1CCZA 4MD5B 1Y0LB 1TPXB 3HUJE 4R0LA 4JFPB 1J12A 2BVQA 1TZIA 2DM4A 3CU1A 3S6CA 5GGTL 3EO0B 2CMRH 5IBUB 2A38A 1GAFL 1YPZE 1TJIH 3S35L 1PYWB 3VE0B 5GRVL 4E0RA 5E94A 2ZCHH 4PJEB 3EFFA 1MIEL 3MLUL 4PJXB 4P48A 1I1AB 2GFBB 5ADPH 4QY8A 2DOCA 3N1PC 5C0DA 3RX8A 4GW1B 1FNAA 5K9QI 5GGSB 4DW2H 4JQVA 2HFEB 3W0WE 1HI6A 4JDVA 3OQ3B 3TBWB 3C60B 4J3OC 3HUJA 4OCMC 4L29A 5ALBL 1M05B 1T66C 3OKNA 5ICXA 2QHRH 3CXDH 5BZWB 5CMAB 1JWUA 2GSIB 5D8JL 4YFLF 1YEJL 1NCNA 3H6JA 3O45B 4XNMA 2ICWI 2ADIB 3O2VL 4R8WL 2VXUL 3EYUH 1AGEB 2WBJB 4LCCB 3KXFE 3WL9A 4NZJA 4F15B 1OAQL 3U82B 1WC7A 2CUHA 2APFA 4GRLB 4AQOA 2NLJA 1I1FA 2FCBA 4OZHA 3G6DL 1KLUA 2NY0B 3MGTA 5EOCL 3O9WB 3QPQC 3W0WA 5IB1B 1B0RA 3V6OC 2EYSB 4HKZA 2CKBA 3W9DA 2BXZA 4PLOB 5I6XB 4Y8DC 4F57L 2I9TA 4OLZH 3A6OA 1W0VB 1RZGA 3ARFC 1EO5A 1BM3H 3QH3A 3F7YA 5T1MA 3M17A 4U7MA 3GUTA 4LNRB 4ZDHB 5CKGA 4MHHG 4EVNB 2W9DH 3BN9D 1MFCL 4KROB 2KDGA 1NCWH 1MJUH 4H0IA 2JIXB 4X6BA 3OAZK 5IOPA 5HJ3A 2CRIA 2YK1L 1ZHKA 4XNQB 3QEGL 5KSBB 1I3GH 2XZAH 2BVOB 4J3VA 4MAUL 3KPNA 4HXBL 1T21A 5KSVB 1ZWIB 4OBSA 3THMH 1P53A 3OAUH 2E27L 3ULUC 1OT1A 3CLFH 1U8JB 2H32A 1AGDB 4D8PA 2O5YL 2F53B 2OP4H 4D0BB 3WN5B 1QD0A 2HAZA 2AQ2A 3G6AA 3U46A 3NAAL 5JW4Q 4X80H 3GI8H 4YGVA 4Y7MA 4C56E 1AI1L 4YHZH 5IWLA 3GI9L 3PF2A 4HEPG 3V5KA 2F58L 4XCYA 1DEEA 3RGVA 3ULUH 1K4DB 1DQLH 1MEXH 4JM2D 3IYLW 3OG4B 1BVLB 3CVHA 4JO1L 1JL8A 1T03H 2QSTA 4LKCA 3KPLB 4NQSA 3DUUA 5DDHA 1SHMA 2NY1B 3L3DA 2H9GB 1Z0NA 1RU9L 4PJHA 3UC0H 1CFNB 4I0PD 3GHEH 4NM8H 4PJ8A 1F6AB 1UACL 5KVFH 3K46A 4KI5C 3RWCA 2O26U 5D96C 5I17B 3HZKA 4QRUB 5HHVH 2XPGA 1I7TB 1P7QD 4JZJA 2ICWB 3EKCA 4F58H 5BJTB 1YMHB 3FN9A 1SVCP 3HNTH 4ODTL 3BZ4B 5D7SL 4FTVB 1RZ8A 3BDYH 2HLAA 4HXAL 1XF1A 3V2AR 1YEFH 5DD6B 5KW9H 1AR1D 4HPYL 5DRZA 4LASL 4Z7OF 1OQOA 8FABA 3C2SA 1VFBA 2C1OB 4Y0GA 4YXKH 5IESH 1UH3A 1IC1A 4QRQB 1IRAY 4TUKH 3IGAA 3BE1H 4R7DA 5T1LD 1AHWC 3VH8B 3NIGE 3RGVD 5IJKC 4F3FA 4OJFL 5E95B 1K8IB 2HKHH 1P2CA 4BM7A 2QQNH 5ESQA 4XRCA 43C9B 3UCRA 1UENA 3BD5A 5IB4A 3LKSA 1UXSA 3BZDA 4KPHL 2HRPH 4OCSL 5JDSB 3C2AL 3KR3H 5EC2B 3WO4C 3DVGA 5ALCH 1KENL 1JNNH 3LQAC 3MLWL 4KTYA 5EIQA 2IAMB 5DRNB 2H8PA 5F3HB 2XN9E 5BS0D 3TN0D 3CGTA 3VDAA 4PJ8D 1BQSA 1FYTB 3N85L 1ZLUK 2N7AA 2WAHA 1UZ6F 4UZGA 3AB0C 5I9QC 2ZSWA 4KXZI 3TYGL 5GGSY 5FCUL 2ZUXA 4LHJB 1NMCC 1F4XL 4ODWA 4AJ0A 1RZKC 1FVEB 4PJ7A 4P46B 1X5HA 2RHEA 2F5AL 4JRYA 4QGTA 1AQKH 1MLCA 3WKMH 2C3GA 4OFDA 2E8YA 3S4SB 3MRGB 2IH1B 3LQAH 1RHHA 3L7FB 2V5YA 4MD4A 1KELL 3OL2A 1OM3H 2FNBA 4W4OA 3O4OC 4HWBL 1Z5LA 4HFWA 2VTFA 1YNLL 3D69B 4GW4A 4UTBH 4MAYD 5EWIH 1CFVH 4AM0B 3NA9H 5F71A 3UBXA 1KGCE 4WWID 3C9NB 2FHCA 2W1NA 3WD5L 1Q9LA 1RZKH 4FNLL 1S9KC 2R0KH 1G7HA 3WIFA 1XGQA 3MV8D 4OFKA 5DJ2B 4MB4A 3UTOA 2UV3A 4A6YH 1ES0A 2NY5C 3LHPL 3P73A 4CJ1A 5F1NB 2EYTA 5EBMB 3JV6A 4WW1A 5DMKA 1DL7H 2FJFA 3CZFB 3V0WL 3QFJB 2QR0B 1J0YA 4GBXD 3T3PE 5DJYB 4NKQB 4UV7L 4PJ5B 5FA4A 1ZVSA 4RA3A 1BREA 1Z3GL 3NZ8A 1J8HB 1W72H 4XZUB 5L2KA 1PX4A 4FP8L 1N3NA 1T80A 4KJQC 4Q0XL 5IFJB 3KLDA 4HLZH 5T3XE 2EDWA 5IEHA 1T6WA 1EHAA 1RZFL 5T3XL 3IFOA 3U0PB 2DIAA 3LRHA 2Q8BL 3A67H 4Y16A 4JRYD 1QBLL 4ZNEE 5B22A 3VXSA 5IMLA 1U8IB 3DRQA 4QRRD 2DI8A 1RIVL 1PEZA 4POZD 2XRAH 4R96B 1PDKA 5TDNB 3O3BA 1DUZB 1UC6A 4JDZB 4KK9D 2V2WA 5DFVC 5E5MA 4QHNA 4UAOC 2YUVA 2ZKHL 4UIMB 5D7JA 3RL1A 4TSBH 3R06B 4WI8A 3P0YL 2DL2A 5IR1B 4M4PA 3U4EB 4EI5A 2BVEA 5DGRA 1VDGA 2D4DA 3GSVB 1D5XB 5KZCB 4JO3H 2VISB 3QNXB 1FG2A 3V9FA 3TBYB 1CIUA 1KIRB 1TDQA 1ZT7B 4OLXL 2HT4D 5F6HI 3Q6GH 1QSVA 2P5WE 5L6YH 2I9LA 3BI9X 4H5SB 4M1CC 3DMMD 4NQDE 5L2KD 3IDIB 4IM8A 3LSOA 3EDEA 4PJ9B 4X0KA 3RDTB 2XG4A 1RD6A 3QAZB 4HF5L 5GGVY 3TCXA 3DBXA 4O2FA 1CLYH 3WNMA 1S7WB 3JTTA 3CFKB 2LTQB 1WK0A 1KJ2H 3BH9A 2RGSA 4LSPL 3IDJA 4Y16D 3FFCB 4G8FB 4QRSB 3VXSD 2YMXH 1YMMA 4ISVB 3STBA 3Q3GB 5IMKA 4KRNA 1INQA 4JHBA 5D7KE 2ORBL 4LCCC 4KK6C 5GRYA 5HHXL 5DZLA 1N0XH 1ODAA 1KIPA 4EBQH 1CE6A 4OSUL 3WS3A 1YEGL 4Y2DA 4YHYB 4IIQB 3LEXA 2J7LA 5F7DA 1CGSL 1OPGH 2WLZA 2P5WA 4XPBH 3O9WC 5GPRA 4G7YH 3UJJL 2R0WH 3BXNA 3UTPE 3R1GH 1S78C 3OJVC 4EI5D 5KS9B 5I15H 1A47A 2MWCA 1YN7B 2NX5B 3H7BB 5CKAA 2DD8H 1MPAH 4XGZB 1R3KB 3OSKA 1ORSB 3U9UA 4NQVA 4X6EB 2H2PC 4CADB 1R5VB 4KROC 1NFKA 3E6HA 1NEZG 4BFGA 5AZEL 3BKJL 3HZMB 3QEHA 1P7KA 3PHOA 1I8MB 3D2UB 3MMEB 1K4CA 5GJSH 1WIPA 3CFJA 1P6AB 4KI1A 1MFAL 1UXWA 5C08E 3RPIB 1U8OA 2IQ9H 1G9NC 4JVPA 4S1QH 1YMMD 15C8L 3EOTL 1XGYH 3MODL 4OF0A 1KG0A 1FIEA 1DBKL 1CICB 2ADJB 1X3DA 4AH2B 3QXAA 4P5TC 3IJHB 5DI8B 5LAXA 4KGLA 4YHML 4JFOA 3DHMA 4ZS6D 3B2UD 5DRWB 3BEVA 4ORGB 1MWAB 3F6LA 1P4LA 5EBGA 3NTCH 4PRPB 3T77A 4O58H 2R2HB 1ZS8A 5FO7A 4GQPH 1FNFA 2H45A 2OR8A 3HC0B 2WQ8A 4V2BA 5CZVL 2OR9H 1G9NH 2C4XA 2OL3B 4PRIB 1FPTH 2IEPA 2X40A 4BFIA 5BOZG 1NGPL 1RZJC 4K23L 4I4WA 5MEPA 1MCLA 3K1DA 1GSMA 1SJXA 4D9RE 5JHLH 3T0EA 4TTDC 4YHIA 4IMLA 1FSKB 1RUQH 4HGKC 1JK8A 3FN0H 3SDXF 3SGKC 1DEDA 3G9VA 4Z7WB 3FRUA 3ZT6A 4D0DA 4YAQB 4PR5B 4YHPA 2J88L 3TJEH 3D18A 3MV7B 1MJ8H 2ZUYA 2R1YB 3P11H 3VFGL 4BSWB 1M7DB 1RZJH 2C3VB 3G04A 4JHAH 1U42A 5J12C 3CDFA 4Z7UE 4ZXBA 4WU7B 7FABH 2R39A 4P2RE 4F33B 2C7UB 2V9QA 3ULVF 1D9KB 5I1KL 2AJZB 1IQDB 5GGVH 3WXWL 5JIPA 2ESVB 2WMPA 4XAKD 1IC5H 1JGVL 1IAII 1U9KA 3EFDL 3TO2B 3BAEH 4M00A 4O9HH 5HD8C 1ZEAH 4EDXA 4ZFGH 3DYMA 5E9DB 3BQUB 1LK2B 1PKQB 2A1WL 4CUCA 1DBJL 1VCAA 2XKUA 1QBML 4W70A 2DDQL 3AS2A 1J18A 4H26A 1YEHH 3JXAA 2VLJE 3S3SA 2L4OA 1EEZA 4M43H 4XNZC 5CHNB 2EZ0C 3ZDXF 3UYRH 1J0JA 5IHUH 4TVPE 3V6FA 5DJ8A 4QTIH 1KTLA 4F7EB 4AIXA 4U4BA 3T0ED 1A21A 4G43B 1F97A 1MSPA 5HVHB 3H0TA 2LE9A 4RISH 3MJ8A 2DYPA 4RFNB 4UQ2A 4KVCH 1BF2A 1YDPB 2E6QA 4CAGA 1RMFL 2VLRB 5EOQH 2IALA 4KUZL 3F7PC 1DVFD 1NGYA 1WFUA 2W9EL 1ZHBA 3C8KB 3GRWH 4LKXB 5DFTA 1F58H 4OCYH 3OGCA 4FHBD 5EU6E 2GCYA 4ZXBD 1FFOB 2ZNXA 1H9VA 1PQZA 1LO3H 3E3QC 5EBLA 4RFOH 3GO1L 4KJPC 5TPWH 1LGVA 2F5BL 3OXRA 4NNPL 2VL4A 1X6LA 3RJDA 1BQHA 5I8CB 3ZT7A 1DBBH 2ITCA 5F6IB 3DECA 1FYHB 2NY6B 3ZSSA 4KV5E 1WICA 2D3VA 1QOKA 1CE1H 2IPTL 1YEDB 1MCWW 2HWZH 4LSSH 3V6OE 1UVQB 2GAZB 3PWNA 2YPLD 1MH5B 3MRCA 1CDIA 5FYLD 1HHIB 3ARPA 1G7PB 3AXLA 1SY6H 3QCVL 2A74A 4P59L 3L3GB 4Y4FC 4Y5YA 3SKNB 3S37L 1L0XA 5CD3B 2P47B 5I18L 4Y1AB 3EOBB 2BC4B 3JVGA 2OS7A 4HIEB 3ZTNL 4P4RA 2DQJL 1MRFL 2AJSL 2VRAA 1RFDL 1DLHA 5TE4H 4NN7C 4X7FC 3NFPA 2FGZA 3G6JA 2DYPD 4E42A 5IB2B 3ZDZE 4X6CB 1CR9H 1FO0A 5DF0A 3TIDB 4GUPA 5E8OB 4F7PB 4PGJA 1AIFA 2P43B 3EYFA 1V7ML 4PIRF 3LEYH 4S0SD 5IUSA 3D3VB 1L7IL 1F2QA 3OKOB 3V52L 5AD0B 3C5ZC 3AROA 5KSAD 3B3IA 1B6DA 1JVKA 3A6CL 1HSAB 1W0WA 2CGRL 3E2HB 5K9OB 3IS1X 3VFRA 3MR9A 1T1YA 1FV1B 5AG9A 4Y4KC 4DGIH 5GS3A 1HHHB 2P5EA 5KSBF 2Q7NA 5EC1A 4LRNH 3QCUL 4KTDL 1DUYB 3UJTH 2EDFA 1WVZA 2EH8L 1AO7A 2WZPD 5AUMB 3A6BL 3VA2C 1QLEH 4ODHL 4X9GA 5DXWA 2M8XA 2ITDA 1ZTXH 3BISA 1VESA 1NFIA 1S7UB 4WFHE 4YC2B 2LVCA 2VERN 2VDLH 1HDMB 1TCRB 3GIVA 5GIRA 5AYQA 1FORH 4P2OA 3VWJC 1N6UA 4U1SB 4NWUH 5DQ9A 2EEAA 1SJHA 2ZCKL 4R0LB 1TZIB 3U36A 3LN9A 2Q8AH 5K9KB 1ZLSL 1QKZL 1ETZB 5EZJA 5DVOA 3VGAB 4X5WA 5JR1H 1JZ3A 2CLRA 1NGWB 4OLUH 5C6TH 4WTWA 5FM5O 3WEXB 4G8GB 3EFFB 4QF1A 1BHGA 5E08H 1NLBH 4JB9H 4PJIA 1K3IA 1UWGL 3DARA 4QY8B 3IFPA 4XPAL 1D6VL 4OIAA 1EZVX 4ZUVB 4N5EC 3ZE0F 3VXRE 2P5ED 2CIIA 5IBLC 2AXJA 3FO2B 3MREA 4LCWB 3STLB 2R2EA 4YHYC 5HYSG 1N5YH 2IMNA 4PJFB 4LQFL 3QIBB 5JZ7D 1AO7D 4NBYB 1IL1B 5BRZB 2K7PA 1BFVH 2ZP0T 1KCKA 4NHCH 1PAMA 1UGNA 5GJTH 1DP0A 3P4LA 1JWUB 3NVQA 5J11B 2MQ0A 1J7VR 1JF5A 4WV1C 5FGCE 3O4LB 3TWCL 4P2OD 3H9YA 5DSCA 5ETUA 2CLVB 3ALXA 5DMIL 2WK2A 3L5XH 1G7IA 1R3LB 3OXSA 4F80A 3WL9B 1P6FA 1CGUA 3NFNA 2CK0L 4JM4L 4X4YB 4HG4K 3G5VA 4AENB 1J10A 3VXRA 2FYYB 1QA9B 4H0GA 4OZHB 2V6HA 3BZEA 5F3BA 1N6QH 1II4E 3VD3A 3JTSB 5CFHA 4EN3B 4NPYB 3IAGC 4RRPA 4ZUWA 4U6XA 2YKLH 4MCZA 4HPOH 4E5XB 1D7FA 1JGEB 1JGUH 4JM2B 1I8LA 3EJZD 1WWAX 1G1YA 3T3MF 1T04A 1W2KT 3QHZH 2P8PA 3ZZ1A 2ZUQB 1KJ3L 4XMKL 3VRLE 3EDKA 3ABZA 1LDPH 4UT9H 5FYKH 3RWIA 1GGBH 2FATH 2V7HA 4GMSL 5D2NB 4MXWL 3HC4L 1IKNA 4LHUB 1IBGL 2VO5A 5D1ZA 3WJJA 5DURD 5CJBA 4P99A 4I0PB 5LXGL 1HSBB 5F7NC 2NY5L 5DD1H 3OPZL 5KVEL 1T21B 2VE6A 1XR9A 3ARRA 4B7IA 5EH1A 5FECA 1SBBA 1P7QB 1DLFL 4XC3H 1CGXA 4GAYB 5KAQG 1IC4L 2AJYL 4X4XA 1P4IL 3QUZC 3PIQA 5FYJE 2H1PH 2V5RA 3MPCA 1BGXL 1E4KC 5LKNA 4R7NA 5FYJL 3CFBB 3STZA 4L1DA 3QWRA 5IB5A 3RVWC 3U46B 4GG8A 4HS3A 5IFHL 3CVIH 4MNGE 3CDYA 3FQTB 3TT1H 2AABH 4ZUSA 1KACB 4RGND 5T1LB 5GSRB 3AFLA 5KTEH 3RVVC 5C0AB 5I8EB 1RZIB 4NOBA 1QFOA 3VWKA 2G75B 1UJ3C 3MJ9H 1WT5A 3MRBA 1RY7B 4XXDB 3QQ4A 4KK8C 2WW8A 1KB5L 1X9QA 2ZOLA 5EO0A 5D1ZD 4R97C 5EUOB 3SHSA 3IFNL 5BS0B 3TN0B 3CH1B 3HRZA 3RVTD 5D1QA 2B1HL 4ZO8A 4L3EE 1BP3B 2EYRB 2GT9B 5HGBB 3I3DA 3PWPD 4LEXH 5GXBB 3LD8B 3VGGA 2EDHA 4HUVB 1S8DB 4YR6B 2EXWD 3O3AB 5I71C 4IRSC 3H9SA 3ARDC 4OUOA 1MOEA 3KDMA 3MZGB 1YEEH 1XF5A 2ZJSL 3MA9H 2FEDD 3S96A 4JY4B 5E0QA 3SE3A 4RGOL 3LEVH 3QWRD 5GS2H 3P77A 2R1WB 2AS5M 3HG1B 1F42A 2GUOA 4X99B 2AJXH 8FABB 4D9QE 3FT3B 3QIUC 3MCLL 4M93C 3BDBA 5DEGB 3IDYC 4MAYB 4TPRH 3CC5A 5IW6B 1XF3A 1TQBB 1KN2L 5I1IL 3J7HA 3QUML 3QDGA 1HE7A 1P84K 2DQDH 3MV8B 3KPMB 3KPQA 1A7NL 1A1NB 4J6RL 4QOKA 4R3SA 2B1AL 4XRCB 1OTSD 4Y88A 3L3KA 4WEMB 1UXSB 4J7RA 3DX6B 5E2TH 2DJSA 5FA3A 4HJ0C 5TDPA 1YQVL 4IDJL 3PXHA 2C9AA 2OTWA 1WWBX 2UWEE 3MQIA 3O3EA 4GBXB 1PZ5B 2UYLA 3B9KD 3UZVB 3MYJA 4NKIH 4LCIL 1MCPL 5D1QD 1ZLVH 5IFAL 2LV4A 1FFPB 4I18C 4GRWH 4X6DE 4OD2B 5IVZA 4OFYA 1GPOH 3W39A 3ZMRA 1DN2A 1RURH 3CMOH 3H9SD 3TA3A 5KSUB 5LGJA 1VEMA 2K7QA 4K9EC 4OV5B 4P23C 3TZVB 1FHGA 1QPPA 1MLCB 1MREH 1KIQA 4JY5H 3RTQC 4HGWA 4QRRB 4ZOCA 1RHHB 3O8XB 4PJCA 1CS6A 3MLYH 4NWTH 4PLKC 5AEAA 5KS9F 2IWGA 4P5KB 1WZLA 1H0DA 5HHPA 2AJUH 4JDTH 2OTUA 3VXPA 1Q9LB 2ICWJ 4K9EH 3WIFB 3QDGD 4QOKD 1MFNA 5DRXB 2MCG1 3DHJA 1TZHB 2MQCA 3PHQA 35C8L 1KEGH 3PGCB 3SJVA 5DMKB 1VFOA 1A5FH 5I1JL 2NTFA 1ZE3C 1CLZH 4JFDD 3SDDA 4Z78A 2EDKA 4KY1L 3DMMB 5F1IB 5L2KB 4UT6H 4W4NA 4X8JA 5SWSA 3NGBB 5D6DA 1SEQH 2Z9TA 3C5JA 1IAIH 2Z31D 1ZA3A 2Y6SD 4OFYD 5D2LE 5TE7L 2CLZA 3WFEH 3QT2A 1OB1A 3RUGB 4BQ9A 3ZHDA 1HH9A 3TA3D 5BV7L 2NW3B 4QHUB 2J1KA 3BP6A 5T5NG 5GRUL 4J8RA 3IFLL 3OKKB 3PWVA 4CNIB 4FABH 5IMLB 2PCPA 5MENB 4Z9KB 2F54A 2OQJA 4IRJB 3HC3H 1KULA 3ARGA 2XQYK 1ONQB 4JRXE 4LLUA 3N06B 5FUZH 4OZFG 4E9LA 3V4UL 4JFEE 4XNXL 4NUGL 1PLGL 5DJCA 1QSEA 1CVSC 4KJYB 3OJMB 4CMMB 3V5DB 3VGAC 4CVZB 2IFFL 1XH3B 1G6RB 1YNKL 5J8OA 4HULB 4OZIF 1A4JB 2VXTL 4XCFL 3SKMA 1N64L 4OM1L 5JORA 1FG2B 4AY0A 2IADB 1QFHA 5JPMA 3PP4L 4JGMA 3SJVD 1U8PB 3VD5A 1OAYH 4YDJB 1PEWA 3NACL 4QHMA 5JHDA 3SDDD 4PP1D 4Z0BH 3MLSH 1T2JA 3NABH 1FRGL 5D7IE 4JRXA 4BQ6A 3QIBC 5DJAB 2X1XR 4WJ5B 3PHSA 5EZLA 1LEKA 4JFEA 3GJEA 5I8OL 3FFDA 2E7LC 2DMBA 1UFUA 2FL5A 1X7QB 1OSZA 4IRZH 3QEQA 4NNYA 3MRRA 4LLMB 4HS6A 3DX7B 1C5DA 2LU3A 3W2DL 5LQBH 4Y4HA 3ARGD 5IMKB 2FX9H 1G7LB 1I85A 4JFQA 3KLHC 3L95A 3T2QA 4LAQH 2J5LB 1KIPB 3HNVL 1LEIA 1YECL 2X4SA 3LEXB 3U0WL 3NOIA 1T20B 4ONFL 4WTZA 4JAMA 3V0AC 5MI0C 1B2WH 4Q2ZA 1KCSH 1TENA 2KL6A 3B2VL 4AEHL 5HPOA 3FTGB 3MLZL 4X5LA 2YXFA 5E6ID 1ZANL 4DK6A 4HCRH 1Q38A 3B5TA 3BT2H 2F74B 1A7PL 1NCTA 3EO9L 4P2QA 1PG7H 1WEJH 3UZEA 2PR4L 1QYGL 3EYSL 3QDMB 5D7LD 3KGRA 5CZXC 2GEEA 1GVIA 1U8NA 1BIHA 4YHNB 2I27N 1JGLH 2AJVL 3EBAA 1RIUH 3RI5K 3FB5B 1SM3H 5LBSL 3CFJB 2VL5A 4JQXA 2YRZA 4DZ8B 5HI3C 2LQRA 2Q87A 4JPKH 5DS8A 1CZ8H 4EUPB 4HQQL 4KKBC 25C8L 3LCYA 2AGJL 2EXYC 5JLZA 3H9ZA 4NZTH 4ZPVA 1C12A 1S9YA 1F11B 1T5XB 1F02I 1UM6H 2CIKA 1UT9A 3DO7A 1G7JA 2NZIA 4PREB 4PY7B 1ADQA 4FQXA 3ZKXB 4KRMB 2Z92B 3EW3B 3ZHKA 2X7LA 1U2CA 4Y89A 3ZYIA 4FFYH 1WWCA 4Q9BA 1P4LB 5I1DB 3T77B 1IEBB 5ANMA 2DWEA 5FO7B 3MRDB 4XPHH 4C54A 4W6XB 5FGBC 3ES6A 1FNSH 2P4AB 4G7VL 3RP1A 4I4WB 4OIIH 5J6GA 1GHFL 4P2QD 2FX8H 3T0EB 4Q9RL 3VU2A 4F7TA 3VFVB 4IMLB 4HT1L 2R9HC 3L5HA 1AC0A 1PJ9A 3FJTA 1QFWI 2IQAB 1H3UA 3QWOA 4ONOA 4OD1L 5JO5B 1QRND 1DVFB 4JZNB 1HZHH 4PTTA 4H1LH 4X7DC 1VPOH 3G04B 2VZSA 3LD8C 2ICEA 4K94C 4UINL 1T7YA 1MCIA 4PLJC 1U41A 4K71C 3RL2B 1EO8H 1A6AA 1NAMB 2JELH 3D1MC 3FQWA 3RAJL 4I48B 4FQXD 5IVXE 1FH5L 5HI5C 3AREC 2YOCA 4EDWL 4N0FB 3WUWG 2AEQH 3MRIB 2YPLB 4G6KL 1J1XH 1A6UL 5F7EL 4WW2F 1L0YA 4LOUD 1A3RL 3QEUA 5CWSA 5F21B 3FRPA 4K94H 1JHKL 3PWJB 4LCUB 5H2BA 4GW5B 1MNUL 3CDGA 4NCC2 4WI7A 3SCMA 3NIDF 5DMYA 2AXGB 5T3ZD 4M1DH 5E99H 5ICYA 4U6HB 1DSFL 3O6LH 3LMJH 3MJ8B 2DYPB 1YUHB 2NZ9D 1S9XB 3PNWB 5EO1B 5IHBA 1CGYA 5HSFA 5ID1A 1DR9A 1F4YH 4W81A 5C3LD 3O0RL 3OBAA 4DGYL 2GCYB 2EDOA 1UM4H 1PQZB 1O7VA 2GJJA 1IILE 2FD6H 4MJ6B 4N0RA 3Q0HA 5EBLB 4WEBH 3FT2A 4P0DA 4BYHA 5KSAB 2H6PB 3MROA 1D5IH 1EO7A 1CYGA 2JCCA 5F6HJ 2CDFB 2ITCB 3V4PH 3TZVC 1ZHNA 1T1XB 4Z7VB 5AG8A 1T89A 2BX5A 5DR5L 3WLWD 4WI4A 4NO0A 1HCFX 4ZQKB 3BO8B 4NN5B 3SOBL 3SDAC 3HFML 3BRDA 1WWWX 2J8UE 2NXYD 3UDWA 4HWUA 4LGRB 1L7TH 4OI8A 4P4RB 3O6KL 1ZLVK 1ZT4A 1CTOA 1DLHB 1J1PL 3T8XB 2JKXA 4U1LB 3NFPB 4E42B 4KK5D 1TQCB 3RZCB 2A6JB 1J5OH 3OR6B 2EC9U 4OZHF 2SEBB 3DROB 3RX5A 3LRSA 1CFSA 3HMXA 4XNUL 5TF1H 3QI9A 3V79C 2DIBA 4JPWL 4L1HA 4JM2F 3TVMD 5CD5D 2BHZA 1HKLH 1MAMH 1S3KL 4LSQH 5IKCB 4QT5A 4QNPF 1SYVB 2WQRA 3IU3A 5H37H 1TVBB 2R4RH 1KJMB 3OR7B 4NKMA 1X5KA 1BFSA 5FGRA 1X5XA 4IRJC 1AD0B 1Q9KB 5IROC 4GRMB 4ZTPH 5DQJA 1RVFL 2Y9RT 3ILPA 4NO0D 4XC1H 1IEHA 5E2UH 1XZ0A 4F37F 1PY4A 2P7TA 2HTLD 4TYUA 2GY5A 3D5OF 4OIBA 3C6LC 4Z95L 1AO7B 2VKWA 1FAIH 1CD8A 1KBGL 1SQ2N 4KTEL 5CJ5A 1T4KB 5DYOA 5IV2B 4MZ3A 2O61A 3IU4L 1FGNL 2FJGA 1NFIB 4GAFB 3D39B 2D4FA 2VZ3A 1NUDA 4JFFB 3GIVB 5J7CC 1TIUA 1EBPA 5ILTH 1MHPL 4GO6B 3QHFH 3WHE1 6FABH 2Y06H 3QIWC 5A1AA 3KPSE 4ZAKB 5JXED 2HG5B 2NNAB 3GNMH 3QULA 1CF8L 3QI9D 2ICES 4HUXB 1A14H 2CD0A 8CGTA 3U36B 2VXVL 1Q9OA 3BKMH 3TYFA 5EZJB 4OZGA 1G9MC 3L1OH 4ZFFA 4ORZC 4JFHE 4RAVB 3QA3B 3WFHA 1C7SA 1NGQH 4I3SH 4OT1L 1I9RH 5JOPE 4APQB 2J6EA 4U1GC 2YEZB 3DRTB 3IXTB 1MIMH 1R24A 3KPRE 4PJHF 4RMRA 3P4OA 1S5IH 2YN3A 2OJEB 3VCLB 2QQKL 1OD9A 3BPCB 5C0CE 2J5LC 2EDNA 5IBTH 2F15A 4MLSA 1G9MH 1EDQA 4C83B 4UNUA 3MRKA 5ADOH 5HGAA 5HHQB 1RK1A 2AEPH 1JYXA 5DHXB 4OTXH 4XCEA 5DURB 3KPSA 3ROOA 1PSKH 4PGBA 4YDVB 1T2QH 5E8PB 4Y19E 1EXUB 1A4KA 4PRNB 1G7MA 3BD3A 5DEFA 1IT9L 2YC1B 5HHOA 1MFDL 5M94B 4NO3B 4S10A 3TT3H 3QO1B 4RMWA 4U1JB 3CU7A 2CJUH 3QO0A 3MXWL 1T22B 4L4TA 1ULVA 4DTGH 5JA9A 5DWUL 3F65A 3G5XB 3S5LB 3CFCL 5DSCB 4PJGA 5ETUB 3QZWB 1KCLA 2OZ4L 3NFNB 2PKDA 3SGJC 4UOW1 3OWEA 4M8QB 3BP5A 3LN4B 5LWYL 3N9GL 3LY6A 4Q6IA 3QUYA 5IW3A 4P4KC 3TO4C 3ROLA 4M5ZH 4NKDB 4ZTOH 1JPSL 1BAFL 3GB7A 4JPIA 2GK0B 3O2DA 4RGNB 1CIDA 5LGKA 5GGQL 5HGDA 3QUXA 4ZUWB 5KJRH 5D1XB 2XKNA 4YPGA 1NFDB 4JVWA 4OFPA 1UWEL 4Y5XB 4V2CB 1ACYL 1EEYA 5FK9B 1Q94A 1UB5B 2BNRA 1CU4L 3DVFA 3PDDA 5D70L 2A73A 3RWGA 1NMAL 1YYLL 2YD9A 1N59A 4WFEE 3QRFM 1KTRL 4R26H 3FOLB 1I7RB 1QRKA 1YEIL 2EC8A 3CLEH 3ESUF 4PJ7F 1FE8H 3GMRB 5HHOD 3NPSC 3PWPB 2OK0L 4L4TD 2BCKB 1S5HA 4WO4A 5DGQA 4G5ZH 2I5YL 3K8MA 4CVWA 2BSTB 2JJSC 3DV4B 2JK5A 2UZIL 4X4XB 3OKDA 1GC1L 2V5TA 3RWEB 3WFCL 3WXVL 1E4WL 5FF6A 1FZOA 4RIRB 4S1RL 1F4WL 2FWOB 1PZUB 4Z7OE 4YE4L 3QUYD 1EGJA 5C0IB 2XTJC 1A9BA 3BPLB 1N5AB 3HAEA 2WWMD 4Q9QH 1DN0A 2CSPA 3QUXD 3TBSB 1K8DA 1KNOA 4QRTA 3PJSB 3AY4A 2V17L 4OI7A 1EBAA 3LOWA 1H15B 1INEL 1BFTA 4OLWH 2AVGA 4HFUH 2BNRD 3MRPA 4PGDB 1QBBA 4H20L 2FX7L 3GFUA 1MHCB 3BWAA 3MOBL 3CX5K 3VG9B 4PJBB 1KXTB 1QLFA 4KAQL 1P9MC 2EKSA 3NH7L 4YBLC 3O6FA 1UQSA 2I25N 3B9KB 2H26B 4RMVA 1UZ6E 3MUJA 4FZEL 5J3HD 4TOYL 4XNYH 3RKDD 4UNTA 4LARH 5I1CH 1XIWC 3NCJH 3FT4A 1XF5B 1JYNA 1BBDL 3S96B 2X44D 5C0GB 1XCTB 1H5BC 3NZHH 4FFVD 1GGCH 2W9LA 3C87A 4Y5VB 1T1ZB 4OGZA 5C7XL 1QFPA 1HKFA 2G9HA 4L4VE 3RKPA 4I2XE 4N0UE 2W65B 1NCAL 1A6WL 1M6OA 1XF3B 5F1SA 4MA8L 3GM0A 3V7AG 4L5FH 3D9AL 1QTYT 4HIHB 3SE9H 3VXUE 1ZMYA 3HI5L 1T5WA 3KPQB 3MRNA 4QOKB 2JB6B 1QFUL 3CX5J 2HN7B 2Y5TB 4RMTA 2ED7A 5E1HB 3V7AE 4QHLB 4ZOAA 1RULH 5JW4M 4PRAB 2AQ3A 3PL6A 3DETD 1IGMH 3RA7L 3KNBA 4JFDB 4MJIE 3KJ6H 3O6FD 1H3VA 4QRPA 5TQ2H 2N56A 4HIJB 4F9LA 4U1KA 1E28B 3DVNA 5EIVA 3UTSE 3M45A 2HJFA 4MXVF 2Z31B 4GKZB 5K33A 3JSSA 5I1HH 1U3ZA 3LH2H 5GS0H 3I6LE 1U8MB 4I2XA 4N0UA 4ZOBA 4XPGH 4BKLA 2AV7A 43CAA 3V0VB 2G60H 1KCVL 4KVNL 1FCCA 4LIQH 4N8PA 4YO0A 3VXUA 3RZCC 5D5MB 2VXSL 3FQXB 2O5XH 2PTUA 5CBEA 1GYAA 1A9EB 4U6YA 3VDCA 1BFOA 1REIA 3GSOA 1S7TB 3IRZA 1MCJA 5I16B 1OGTB 1OCWH 4FA8A 2KKQA 5HYJB 2BY2A 4TN9A 2B4CC 2J4WH 1M7XA 3SGDI 5GHWH 2HT2D 3IS0X 5A3IC 4ZO6A 3UTSA 1VGKA 3UMTA 4TVPD 2UY7A 1MI5E 2DQUH 5TQ0H 5DK0A 5JQ6H 3ARBB 1J05A 1MHHB 4XH2B 2FB4L 1MCNA 4K8RH 5E24E 5ITBL 3S88H 5T1MB 3SDDB 2BSSA 2R1XB 5JOFB 4QRPD 2IGFL 1U3JA 1VADB 4TQEH 1T66D 2WIIB 1IAKA 2APXA 3TC9A 1ZGLB 3NA4A 5EU3B 3SY0A 5EIIA 2HFTA 3GHBL 5ITFB 3JV5A 2CLZB 4ZOEA 2IBZX 3VFSA 1XT5A 1U3HA 1I9IH 4RAUB 4PJDB 2P1YA 3OKLB 3QG7H 3QXDA 2MCPL 3B4NA 3BP7B 4H8WC 5L9DH 3FCTA 1MELA 1YEFL 5F96L 4PGCA 1MI5A 2NY3D 2C1PA 2YBRA 3QPQD 4ZAKC 5A2IH 5ISZD 1ND0A 2CK2A 3ORJA 3GSXB 3WMSA 1MCOL 4PV8A 5DHYB 4N68A 3OKEA 2HVJA 3ARFD 5FGSA 4BH8A 3K2UL 3PGFH 1R3JA 4PS4H 4PB0H 3MRHB 1FGVL 4M7KL 3LS5H 4H8WH 1JWMA 2VQ1B 4K3EL 5E6IB 4HS8H 5T5FH 4G9DB 4APQC 4KZDH 3ARVA 2RIKA 3QRGL 4MHHI 4DZBA 3B9AA 5AYUH 4PRHA 4BZ1H 3HE6C 1QFWM 4HH9A 1DDHA 2BNUA 4GMTL 4UB0H 1WF5A 2FBJL 2XZCH 2R15A 3E8UL 4HUNB 2PXYC 5D7LB 2A9ML 1LE5A 1Q0XH 3PP3H 3DVIA 3N0PB 4WGVB 5MP6H 4YLQT 2QLVB 2R29L 2GTZA 1EJOH 4RNRA 2MPAH 4IS6B 3IETB 4QXGL 1LEKB 3EDDA 1U3HD 1WCQA 2QQLL 4UTAL 5MEQA 5D4QA 4H88L 1YPZB 3ULUD 3HMWH 5J1TC 5JNYB 3UO1H 3I6KA 4M1GL 4OF5A 4OQTL 2Y36H 5FB8B 4NUJA 1V5JA 5L2JB 5EG6C 3DURA 3L7EA 4FQIL 5DC0A 4U1IA 4XBEH 1FLRL 3MV11 5C8JB 4I3RL 1MFBL 1CLOH 5FHAL 2VXQL 1IEAA 3O3DA 3C09C 4H25B 1HIML 3BRFA 4LPWA 4WCYL 3KWWA 2W59A 1J0IA 4QCIB 4Q2ZB 5EU4A 2AV1B 5IJKA 3FO9A 4IEFB 4GG6B 4O02L 4G9FE 3DXAE 1H3WM 2CDEA 2D7TL 3VFUA 3MACL 4UILL 1KPRA 3Q5YA 1EAPA 4CN1A 4PRHD 2AXFA 5D1XC 5F70A 3MJ7A 3ECBB 2AK1L 2DBLL 4NQUA 3SDXE 1F00I 2NR6C 4Y5XC 1TTFA 4GXVH 4QTHA 2D31A 5H37G 3MRMB 1NCDL 1QRNB 4KI5D 4XWOC 1AE6H 2H3NB 3KXFB 4GSDH 5EOTB 4J3TA 3F58L 2R23B 1QSFA 4HDIA 3UP1A 4NP4L 5C70A 1NGXA 3ULVE 2Z8WC 4Z7VF 4JJ5A 3ULVL 2OSLA 5JLZB 3I75A 1YN6B 1J8KA 1Q1JH 2YD7A 3MFFB 1QLRB 3DXAA 4A6YA 1HXYB 1FZMA 4AMKH 3H3KA 2XZZA 2VAAB 2W07A 3Q48A 5ICZB 4FQXB 5K9JL 5H35B 1KSRA 4UDUA 2X7LB 4JKLA 4BSVA 1N6VA 5T1KA 3BFOA 1RI8A 3QXUA 2GITA 1HHJB 3MLVH 1W72A 4NSKB 1U8QB 1R6VA 2DMCA 1Z9OA 2EDTA 3ZDXE 5J89A 1OSPH 2CPCA 3G6JF 3O6MH 4MCYB 4O51B 3UTTE 2BHUA 5B38B 4YWGL 2Q86B 3J8F7 4CBPA 2BNQA 1V3JA 1SEBA 4TUOA 4Z5RA 2FJHA 5J6HA 3W5NA 5DD3H 3LV3B 4TUJA 3X13B 4JO4H 3KYNA 5KG9B 4KQ4H 3RQ3A 3NN8A 5J4MA 4NJAH 5E2VL 4X9FA 2A9NH 3QWOB 4I77H 2YXMA 4XP9L 1ZVYA 4Z18A 1DE4A 4NBZB 4OGXL 3QWQB 3G5YB 1JTOA 1OAUH 4HIXL 5SWZA 1E6JL 1A6VH 1QSFD 2XWBB 2EE9A 1TTUA 3EZJB 2CUIA 1EERB 4U31A 4GXUM 3ULSA 2EDJA 5I1EL 3QG6A 1P69B 2IH3B 1MHEA 1EMTH 4C56B 1UCBL 1UZ8A 4BJLA 4XTRC 4NQCE 4MNQA 1KN4L 2BOBA 4MA3A 3TBTB 4LDOB 3FQWB 4MD5A 1Y0LA 4JFPA 5B8CB 4OGAC 3EO0A 3GJFK 4JG1L 1PYWA 3VE0A 3BKYL 2ARJQ 4Y5VC 3IKCB 4JG0H 2VSCA 3CCHA 4G7YL 3L3OB 4OD3H 5GRJL 4JHWL 3O2WH 3JWDC 4PJEA 4PJXA 2OX5A 1I9JL 4KJWD 3VFNB 2BNQD 2GFBA 3CDGB 5FDWB 1KJ2A 2LFGA 3GSNL 4GW1A 1Q9WB 2DQGL 2X1QA 5LG1A 1CFTA 4MA7L 5GGSA 1RUPH 3HZYB 3BJLA 4NFDA 4GT7A 1BEYH 4YHKH 3DIFA 4P9ML 4M6ML 2OJZL 3TBWA 4KJQD 3HB3C 5SWZD 5JW4N 3C60A 3JWDH 4GKNB 3OKMB 2KQMA 2VLLB 1M05A 3S34H 4TSAH 4PJIF 4WENB 4P57B 5BZWA 5CMAA 4FFZL 5DZOA 2GSIA 2CQVA 5IHLB 3TVMB 5L7XH 3FT2B 5J56B 1ERNA 2PW1B 5BMFH 3H8NA 3O45A 1FG9C 4IHOB 2D03H 2ADIA 3EAKA 2WBJA 4MNQD 4YDLC 4LCCA 1FIGL 5D71L 5DFVD 5MERB 2DQHL 2X4UB 5GS1C 3WJLC 5KSBE 5EA0H 1JHLL 2Q1EA 2D0FA 4WHYH 4KDTA 5I8KL 5CCKL 4HWEL 1RZ7H 3O9WA 2GKIA 5IB1A 2LAGB 5I75B 3ARUA 3O41A 2VC2H 4AG4L 4ZMAT 1RQ5A 2VSDA 4KQ3L 1W0VA 2XN9B 1A22B 1OP5H 4OLVL 1KCUH 3S8WA 4R2GB 1ZT4B 3SE8L 2D0HA 2YD1A 4LNRA 1LP9A 4ZDHA 1UKSA 4EVNA 3DX8B 5JXAL 4HUWB 2JIXA 3KJ4C 4M1CD 5E8EB 5L88H 4ZO9A 2H41A 3LRSB 4WUKL 5F9WB 1KEMH 4XNQA 1AY1L 3VFWB 1FZJB 1U95B 1V7NL 2BVOA 2DQIL 3L3JB 1WFNA 2RFXB 4P2CG 4ZFOL 1W8NA 4WW2C 3MLRH 1MAJA 1Z9SA 1U8JA 2WBJD 4R6UA 1AGDA 1P5UA 3MCKB 5EZOH 2F53A 3ZE0E 5J1SC 4D0BA 3NPZB 4XVUD 3WN5A 4FQJL 4NZUH 4M5YH 3O9WD 4HKBB 4QXTB 4XAWH 4S2SB 3WNKA 3QCTL 4KHXL 4U6VL 5ESAB 4ZFZB 5IHUL 5CP3A 4WTXA 1K4DA 1E6OH 3C08H 1PG7W 3VD7A 1BVLA 2W0FB 3QPXL 4RISL 4OCXH 4LSVL 3SGKA 2H2PD 4NFBA 4KROD 5F89B 5DQDL 3KPLA 3L3IB 2R0ZH 1JGDB 2H9GA 4XP1L 5FM8A 1F58L 1CFNA 2R4SL 4NIKB 3QULB 1F6AA 1G0XA 1NCCH 2VR5A 3VJ6B 3SKJH 4S1DD 5MEOB 1MLBB 1UB6A 1V05A 4KDWA 2XNAB 4QRUA 3BGFB 1BD2E 2MKLC 4NN6B 1I7TA 5KVGH 2NMSA 1JZ2A 3LKNB 1QZ1A 2ICWA 3Q1SH 3REVB 2YD6A 1YMHA 1CXKA 3GSWB 1LO2L 1A0QL 4P5TD 3REWB 5F9OL 3T3ME 4FTVA 2Y07L 2F53D 5CEZH 5E4IA 3T1FB 3VFOB 4HBCL 2DQCH 1IGIL 3HI1B 3RVXC 3MGOB 3P4OB 3RY6A 1PW3A 4O2EA 5DD6A 4RWYH 1RUKL 2CXKA 1IAOB 4WGWB 3R8QA 1XCQA 3GRWA 3IDGB 2C1OA 4ODUB 3X11A 4QRQA 5GGTH 1GAFH 1RK1B 1Z2KA 3S35H 5DJXB 3VH8A 3S36L 4JFZL 1HCVA 1K8IA 3PP3K 4PGBB 4TTDD 3ROOB 4NQDB 2DKSA 1EFXB 4MMZC 1MIEH 3MLUH 3P30L 3FN3A 2HFGL 1SMAA 1FNEB 1P4BL 5JDSA 2NY1D 1EEQA 3L9RA 3NCMA 3RIAF 5DRNA 1I3RB 5F3HA 2VLKD 5C3TA 4J3UA 2DLTA 1J87A 3LEYL 4LSTL 3EJJX 3X3GL 1FYTA 4YXHL 4K3DL 4EQ2A 4J23A 3SGDH 1K5NB 5ALBH 4V1DD 3FKUS 5JIKA 5DUML 3AMKA 3P9WB 4PV9B 3GB7B 1FVEA 4PJAB 4WFFE 5HD8D 5D8JH 3MV9E 1YEJH 3QUXB 4FTVD 1T83A 3UYOD 3V4VL 3S4SA 3MRGA 3P4NB 2A6DB 4PJ5E 5FXCH 3O2VH 4R8WH 4DKAA 2FRGP 2VXUH 2Q7YB 5DJZB 2JB5L 4RMSA 3LVEA 1OAQH 4LRNL 5KOVC 2XXCB 2J8HA 2NXZB 4AM0A 5F1KC 3DJ9A 4K55A 3BKCL 2B4CL 1CDJA 1P1ZB 5EOCH 1I1RA 1JYVA 1QNZL 3CSGA 5TGBB 5BVPL 4RX4A 5DJ2A 1DQQB 5IWLC 4F57H 1I1YB 5BQ7B 2VDML 4HV8B 2Q76A 4R4NC 1Q72L 3RGVC 1S5HB 2NPLX 3MRLB 5F1NA 5C08B 2H32H 4XPTL 5EBMA 1NEZB 3BGAA 2P49B 3CZFA 3WIHL 2VLME 3QFJA 5C0JB 2QR0A 4DAGL 1NCBL 3P0VL 5DJYA 1MFCH 4XP5L 4PJ5A 1CFQA 4XZUA 1J8HA 1OVZA 2VAJA 4MQXC 1INDL 5IFJA 2FGWL 2YK1H 4P3CL 3WSQL 4GH7B 3QEGH 4OLUL 3EUUA 1CD1B 3CDCA 4MAUH 4HXBH 4JE4B 5E08L 3FO0L 1LEGA 1KNOB 4N90D 4HWNA 4KKNA 3FHAA 3PWUB 4GXUN 4Y4KA 3DUSB 1IZJA 4JZJC 2E27H 5TE6L 2B5IB 4R96A 5TDNA 2O5YH 2FECL 1DUZA 4JDZA 3WIHA 3LB6C 4KH2A 5CSZA 3WHE0 3BWAB 3BEWB 1LWRA 4UIMA 3FZUC 3RIFF 3NAAH 3R06A 1BFVL 1Y6KR 4RX4D 1AI1H 3GI9H 4OZ4B 3GSVA 4NHCL 1EPFA 4YH6A 1D5XA 1AFVL 1F45A 2VISA 3QNXA