4H13D

Crystal structure of the cytochrome b6f complex from mastigocladus laminosus with tds
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
168
Chain Sequence
b'DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 32
structure length 168
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h13D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h13D02
2HMNA 3AZCA 3H1HE 4NBFD 2E74C 2HMMA 1VM9A 2E74D 2QPZA 3GZXA 1SQXE 2ZT9C 4QDCA 2ZT9D 2HMJA 1Q90C 2E76C 4HM4A 2E76D 1O7MA 1G8KB 2YFJA 5KKZC 2I7FA 2XSOA 1UUWA 4NBHD 2BCCE 4H44C 2QJYC 3H1JE 2NWFA 4H44D 3VCPA 2ZYLA 3FOUA 4NBAD 2BMOA 2JZAA 3VCAA 3H1IE 3VMHD 1NDOA 2YVJB 3GKEA 3L72E 4HKVA 2HMKA 5AEWA 4HM8A 2FYUE 2NVFA 4HM0A 1RIEA 3GL0A 2HMLA 5HL4A 2E4QA 1BE3E 2NUKA 4QCKA 2E75C 1WQLA 3CXHE 2E75D 2YIUC 2QJKC 4QUPA 1O7PA 2YFLA 4NBDD 4I7ZC 3D89A 4NB8D 4NB9D 1PP9E 1L0LE 4QUQA 2NVGA 4AIVA 2B1XA 2BMRA 3TGUE 2BMQA 4HM2A 4NBED 2IBZE 3C0DA 1NTME 2GBWA 2B24A 1UUVA 4U3FE 5AEUA 2QJPC 3EQQA 3L75E 1RFSA 4OGQC 2Q3WA 1O7GA 4OGQD 2CKFA 3H1KE 2XR8A 3BCCE 1NYKA 4P1CH 2FYNC 4EMJB 3GZYA 3CX5E 4HM6A 4QDFB 3L70E 1BCCE 3GL2A 1O7WA 3H1LE 1ULJA 5KLIC 1ZRTE 1JM1A 1PPJE 2DE5D 3EN1A 4H13C 5KLVE 4H13D 1SQVE 2GBXA 3L74E 4HM3A 4QDDA 3GCEA 1SJGA 2E4PA 2HMOA 1ULIA 4HM5A 1KYOE 1L0NE 2D2CC 1SQQE 3VMGD 2D2CD 1EZVE 1SQBE 3GB4A 4NBGD 2DE6D 4HM7A 1G8JB 4HM1A 3GTEA 1VCKA 1EG9A 4NBBD 4H0LC 2YMKA 4H0LD 4PD4E 2JO6A 1NTKE 1NU1E 1O7HA 4P1BH 2NUMA 2XRXA 2YFIA 1VF5C 3GTSA 1VF5D 3GOBA 2XSHA 3DQYA 2DE7D 4HJLA 4NBCD 1NTZE 3VMID 3CWBE 1P84E 3N0QA 4AAYB 4QURA 2A06E 1SQPE 5CXMA 1KB9E 1O7NA 2NVEA 1FQTA 4QDFA 5BOKA 4PV1C 3L71E 4PV1D 3L73E
chains in the Genus database with same CATH superfamily
5DJUB 3KZIH 3QH9A 3KXDA 2QJKB 2NRGA 3D6YA 3II6A 1HJ0A 5AW1B 3AEEC 1N86A 3Q3DA 1NWQA 2NZ2A 1K8AQ 3VCPA 3BASA 1NU1J 1T2KC 1BCCD 3L72E 2HFED 4I6MC 1N73B 3HTKA 2Q1KA 3EFGA 5AW7B 1YJNP 3CXHE 1QEXA 1WT6A 1KYOD 2JWDA 1EZVD 1IFNA 1S2EA 1ZP0C 2G3AA 1S3JA 3TGUE 1X9VA 4NPDA 4QMAA 3C0DA 3BCCD 3P8MC 4KJMA 1PFIA 1UUVA 2OGUA 5M1BA 2RMZA 2JWAA 2K1AA 2CPSA 2FYNC 2KS1B 4EMJB 3GZYA 3CX5E 5TISH 3PJSK 1L2PA 3GL2A 2J58A 1VQ7P 1KV4A 2QE7H 2OYHA 3H25A 1L4AD 3GB4A 1NH4A 2AEMA 2JP3A 2QM8A 3Q5RA 3T97A 3AEBC 3A0BE 3G9RA 1U57A 2OYIC 2GM4A 1JY3N 1NAFA 2W6BA 3CWBE 1O7NA 2NVEA 2C0XA 2O1KA 3HUSA 1J2JB 1H8AA 2KK7A 4I7ZB 2JDIH 5B66E 1DEEG 1O7MA 4RO0A 2NPSC 2FYUK 1RF1A 1GL2A 3CCSP 4NBHD 1QL2A 2BMOA 2R5BA 3V2NA 5AW6B 1USDA 1G2CB 1RQUA 3E1RA 1L0LK 4RESB 2N9BA 4HM0A 1RIEA 3MD0A 2WSEJ 1BE3E 2E75D 4EYYQ 1TU3F 1VQMP 1OWAA 4HM2A 1M1JB 2P7JA 1LWUB 2W83C 3SWKA 4TT3H 3CCLP 1NOHA 5APQA 3HE5A 3H1KE 3TYYA 3H1JJ 1ZN5A 1EXIA 4WY4B 2RN0A 1Q81Q 1PPJE 1HWTC 3USSA 1MV8A 2FYUJ 2K9JA 1BGYE 2Q3EA 3U1AA 1KC8Q 1HTLC 5BVZA 5AVYB 3R4YA 1T8ZA 1AA0A 4DZOA 1M7LA 2E76B 2YMYA 1L0LJ 5CJ4A 4NBBD 4PD4E 1IK9A 2WSFJ 1PIXA 3E1IA 2XSHA 1RE4C 4HJLA 3AE9C 1LP1B 1JB0J 3FXEA 1IK7A 1M56D 1ZW0A 2WSCH 2XV5A 1HGVA 4R4LA 1NTKG 1KILC 3I55P 5KLVJ 2J5UA 1JCDA 2AEFA 2IBZD 2FYZA 1H0TA 3RL0D 4UB8H 2YKQA 3G4SP 1KB9H 2E42A 2I7FA 2IDBA 1YITP 2HG5D 5APVA 4IOIH 5AEWA 1RH5B 5KLVD 1ZMEC 2NUKA 1NTMD 1URQA 5AW2B 4NBDD 2OYOA 3GHGC 3IAOA 4LC1A 1Y47A 4D6TJ 3RK3D 3ABVC 3M91A 3PP5A 4HB1A 3KYQA 1HGZA 5CJ0A 1KQGB 2Q3WA 2IZ1A 2CKFA 2C9LY 3BRTB 3E7KA 1LTJB 4D6TD 3L71J 3CCVP 3KPEA 4H13C 1VQ9P 4JF7A 1CI6A 3HE4A 1GW4A 1G8JB 3L70G 2FKWB 5APWA 1YYCA 1KQLA 1LGHB 2HR3A 4U3FJ 3L74G 3CC7P 2QJYB 3L75J 3L71D 4ZKUA 1N7LA 1YI2P 1L0NG 2QG4A 3AEAC 3CC2P 1R5SA 4PV1D 1VPCA 2QPZA 1OW7A 1SQVJ 1GL2D 5H2FE 3FGAD 4U3FD 3L75D 1N7SB 1T3JA 4OWFA 1SQQG 1LT9A 1SQBG 4GKGA 3CD6P 3H1IE 1SQXG 4AQRD 4HM8A 1FZCA 1FE6A 3M06A 5HL4A 1SQVD 5KLIB 4WWIA 2M5AB 1K73Q 2HYNA 1SQPJ 1P84H 1W5CE 4ZNCA 1BDCA 1NTKK 1VQPP 1LTIC 1E5WA 1UIXA 4P1CH 2N1TB 1SQPD 1RE3C 3VMXA 3R2PA 2J59M 2QA4P 2N1TA 1M8OB 1L4AC 2WVRA 1PGQA 2KP8A 4HM7A 4XA4A 3CXHH 4M3LA 1LTGC 3O6QB 3H1LG 1NTKE 1CW5A 1N2DC 2KB7P 4C46A 3TF5A 2KOGA 3CCEP 3IFMA 2HLOA 3L73D 2WSCJ 2FFDC 3V6IA 2QSIA 1KB9E 3L37A 4QDFA 5BOKA 4HM6A 3CL3D 1JNMA 2E74D 1S9KD 4BXLA 1DEBA 1AV1A 5AW0B 3B5NA 1KILE 1E79H 2BCCE 3RK2B 2P10A 4OGQB 3CCRP 3F5HA 1Y8AA 4IFMA 1URQD 3A0BH 2HPCB 1VQOP 2K88A 3M9HA 2E75C 4NPFX 1WQLA 1NKZB 1OVUA 4QUPA 2KLUA 4RKUJ 1IFMA 4CPGA 2PFXA 4NB8D 2WT7B 2K37A 1PV3A 2BMRA 2D2CB 3VMAA 1JY2P 2R3CA 4IFDK 1SFCB 4ASVA 2JJLA 1JY2O 1P84I 5AW3B 1NYKA 1QVGO 1NTZJ 3VOPA 2A45I 2B9BA 3L70E 1SQQK 1SQBK 1SQXK 3L74E 3MZWB 3AE3C 2E4PA 4GT1A 1K04A 1Q82Q 2KSEA 1MFZA 1L0NE 4HH2A 1VQNP 1BSHA 4N6JA 1J1DB 1BE3G 2WPQA 1YHQP 1NTZD 2WTYA 2CK3H 2KNCB 2A06D 5AVVB 5AW5B 5APSA 3WUUA 3CXHI 1IFJA 1OW6A 5AW4B 2E43A 2FXOA 2WPSA 1M1KQ 3VMZA 3AZCA 1IFIA 3AE2C 5CCGA 1SQXE 1JO5A 3AE7C 2R3SA 3UIAA 1NYHA 4N3YB 3RL0C 1SQQJ 1ZOYC 1BGYG 1SQBJ 3V4QA 1QL1A 3G3ZA 2H88C 1N7SD 3H1HG 4PD4H 3GF7A 2E5YA 1EC5A 1PP9D 2UWJE 3EFFK 2YIUC 5CCHA 1PGPA 3D89A 3RK3C 5AVTB 2K9YA 1WMKA 2RKLA 1RF0A 1CZQA 4H0LB 3L35A 3BCCE 2MJZA 1K05A 2LXCB 2OYHC 3H1LE 1FZAA 2N1TD 1A02J 3L72J 2JO1A 1JTHB 2WITA 1SJGA 1N73A 3V5BA 3MUDA 1NU1D 2Q7CA 4YXDC 3L36A 2XZRA 1OMIA 1SLQA 3TGUJ 1RY3A 5E79E 2IYOA 3L72D 4B86A 4NBCD 3D71A 3TNUB 3VN0A 1RQVA 4BRYB 3HUSC 5AVWB 3V2RA 2Y9YA 1FAVA 2KS1A 4PV1C 4L75A 1GU4A 1VL2A 2FXMA 4NBFD 3B5ND 1JY3P 2B87B 2KI7B 3H32B 3TGUD 1RF1C 1GL2C 2ZT9D 3KDPB 2H7HA 1JY3O 2HODB 2XNXA 3HD7B 1Q7YQ 5KKZC 4L76A 1NKNA 4H44D 3CX5D 1Q86Q 2O3JA 2FYNB 4MN4C 1FZBA 3CWBJ 4IFFA 4K3AA 5DJTB 1O7PA 4WB4A 4NB9D 4PD4I 3I56P 2BEZF 4L73A 1GMJA 3U1CA 1RFSA 2V7QH 1O7GA 1KORA 1ZRTD 5H2FH 2AEJA 3CWBD 3IN6A 2ZAEB 1PGJA 2OYIB 3CCJP 1IC2A 1J1EC 3A7OA 3PTZA 2DE5D 1MZ9A 4HM3A 1G2CA 3H1IG 2QEXP 3V2PA 1OW8A 4N78D 3AE1C 3P7KA 1EG9A 2NPSB 1O7HA 1M1JA 1LWUA 1VF5D 2ZVNB 3H1KJ 3A2AA 2YKPA 5CCGD 4WY4A 3AEGC 3P8CD 4A7PA 3H1HE 2E74C 2KUBA 3MHVA 4QDCA 3SFDC 3H1JD 4XFJA 4HM4A 1YQ4C 1PZQA 2FYUD 1IFDA 3H1KD 1EDLA 3VTPC 5APUA 4DOJA 1T3UA 1URQC 1Y9BA 5CCHD 1T6AA 2PAJA 4JBZA 1L0LD 1LP1A 2O01H 2Z5HA 3SWYA 4BWNA 1HJBA 1AQ5A 4EIJA 1GK6A 2QM7A 2B1XA 1ZR4A 1SVFA 1NTME 1VQ8P 4C7RA 2LR2A 2WPVB 3RK3E 2H8PD 2WSSH 3AE5C 1VDFA 2P1JA 1Q2NA 2IX7C 2XR8A 1PL5A 3VP9A 4GDOA 2BCCG 1XTCC 2Q3IA 2GUVA 2KIKA 1FBMA 1KILB 1S5LX 1DIPA 3JCUH 5B5EE 1PGOA 3ITKA 1VQKP 3WUVA 2JKVA 4Z1MH 2QIWA 3GTSA 5AVUB 1HF9A 2YKOA 3L71E 3NFQA 1LJ2A 2WWWA 1LTJA 4UB6E 2HMMA 1GW3A 3GHGB 1NO4A 3KHUA 2AXTH 1LT9C 1G8KB 1FJKA 3PLNA 1DD3A 5AVRB 3HD7D 2IFNA 1FZCC 1N7SC 2Y0CA 2ZYLA 1YQ3C 4NBAD 3GKEA 1JOCA 3P32A 2E4QA 1GK4A 2WQYC 3CLQA 4H13B 1JM0A 2JEEA 4DCKA 1QGKB 1QLED 2ZYDA 3RBZA 4Y99C 1SP4A 5KAFE 3OJAB 5GTIH 1OX3A 1N7SA 2Y0EA 1W2BO 1KB9I 1PP9G 2C0WA 2N1TC 2W8ZA 1ULIA 2M5AA 3VMGD 2M3BA 2W6AA 1S5LH 1BCCG 3N4XA 4U7JA 2PP6A 2H89C 2DE7D 1KYOH 4RJTA 4WY4D 5CMZA 1EZVG 4C7NB 3WMM0 4AUWA 4ZKPA 4HM5A 3L73E 1S1CX 3BCCG 3B5NC 2ZT9C 2E76D 5BU5A 1S9KE 2XSOA 2YXQB 2QVAA 4H44C 3O6QA 1NTKJ 1YTZT 4GIFA 3CC4P 2O01J 3GL0A 2P2UA 5E79H 4R4MA 3NXSA 3NMDA 3CCMP 3B71A 3A5TA 1L4AB 4QUQA 3W67A 2FXPA 1NTKD 2M8RA 2QJPC 3EQQA 3W68A 2XKMA 2BASA 3C1LA 3JCUE 1L0NK 1KB9D 2FFDB 1ULJA 5KJ7A 1WRGA 3FX0A 3M0DA 2PGDA 3FWLA 1GU5A 4XE5B 2HPCA 1FZEA 2DE6D 2Q9IA 2WT7A 2JO6A 3I5CA 5BU8B 2R5DA 1VF5C 1SFCA 4DT0A 2AXTE 1NTZE 4EDFA 2A06E 5CCGC 3RGUA 3L70J 2YVJB 2L5GB 2E75B 1VM9A 3L74J 4GOFA 1KYOI 4IL6E 1Q90D 2WSEH 1L0NJ 5EFWB 3M9QA 5AVZB 2Q6QA 2ZXEB 2NWFA 3M9BA 3FOUA 2DW3A 1OFCX 3VMHD 3L70D 2KNCA 2SPZA 5CCHC 1XTGB 1LT1A 3Q1MA 4ASWA 1YJ9P 5GTIE 1JEKA 1NGMB 2QJKC 3GMAA 1RF0C 2G8YA 1EDJA 2FY8A 1PP9E 1AVYA 3SSUA 1SQXJ 2FYUG 3ZDMA 3S4RA 3C8VA 1GTWA 4LLHA 3AEDC 5KAIE 2YO2A 5APXA 1L0LG 1N73C 1BCCE 1O7WA 3MUDC 1UIIA 1S5LE 2OQQA 1SQQD 2IBZG 5AW9B 1SQBD 1FZFA 1OVRA 3AECC 4TLFA 1SQXD 2R44A 2HMOA 1FDIA 1KYOE 1EZVE 3JSVC 1BSNA 4K35A 4GODA 3RL0B 2PRRA 2YMKA 3MTUE 3B8EB 3CCQP 1NU1E 1P84D 5KLVG 2KLVA 4W7YA 3HTKB 1NTMG 5KTBA 1IO4A 3GW6A 3BCCJ 3N0QA 4JQ0D 1AQTA 1AJYA 1FQTA 3CI9A 3H1LJ 2HMNA 5APYA 2YIUB 2POHA 1JTHA 1X79B 2I1KA 5AVXB 3RK3B 3EWKA 2WMMA 1QX8A 3HD7C 3GLMA 1DD4A 4D6TG 5B5EH 3VCAA 1H89A 3IF4A 3KQGA 3CXHD 2O1JA 3H1LD 4HKVA 2HMKA 2NVFA 2HMLA 2OYHB 3TNUA 5AVSB 4BRYA 3Q2YA 1KD1Q 2YO3A 4I7ZC 1X8YA 3A0HE 2W6JH 3T97B 2B87A 3H32A 3L71G 4UB6H 3A3YB 2HODA 3BRVB 3HD7A 3RBXA 3RK2D 4OGQD 5KJ7D 2KXPB 1M57D 1ZRTE 2IYPA 1JM1A 3HUSB 2ITAA 3EN1A 1YBKA 3TDKA 4U3FG 3GCEA 5L8RJ 4PV1B 1JUNA 3L75G 3JC22 4W80A 2D2CD 4NBGD 1RF1B 1GL2B 2BEQD 1M1JC 1LWUC 3GTEA 2IBZI 1VQ6P 1SFCD 2YXRB 2ZJSE 5KKZB 1SQVG 4N78E 1FZGA 4EOTA 2AXCA 4WY4C 5KAFH 2MKVA 4AAYB 2KYVA 1BE3J 2RH0A 2OYIA 1KQSO 3H6PA 3RL0g 2Y9ZA 1FOSF 3MGNA 3GZXA 2KZIA 1GD2E 3B4SA 3WU2E 1JCCA 1LTSC 2E76C 1OXZA 1KQFB 1LTTC 3P8CE 3HE5B 1USEA 1SQPG 1UUWA 1MKMA 1BDDA 3SWFA 3H1JE 3D6ZA 1BE3D 3F89A 2NPSA 1NDOA 1U7MA 3CPWO 1HBWA 2K9JB 5KLVK 2FYUE 4AYCA 5K5GB 1BGYJ 1J1EB 1NTMK 4YTPC 4QCKA 2WZ7A 2ZVOB 4PJ0E 3U59A 4JYBA 1L0LE 3H1HJ 2NVGA 3M0AA 4IL6X 4NBED 2XNDH 2IBZE 3GG2A 3L73G 2GBWA 5AEUA 3AE4C 1VQ5P 2YNYA 1PPJD 3Q5PA 1BGYD 2M3EA 3KZIE 1AVOA 2OTKE 1K9MQ 5KLVE 3H1HD 4QDDA 3CCUP 1H0TB 4PD4D 2E74B 4YPCA 2JR8A 1LTBC 1YIJP 4HM1A 4H0LD 2IZ0A 3PRJA 1NTMJ 1R5LA 1IZNB 1NJIQ 1KFMA 3FWNA 3DQYA 3LIEA 2OTLP 5AW8B 1LTJC 3G71P 1URQB 5CXMA 4NPEA 1RE4A 4D6TE 1QVFO 1RHZB 3OW2O 4WBAA 2ZXXA 1Q90C 1KILA 5TISE 1IFPA 2Z5IA 3Q5SA 2QJYC 1T2KD 2XU6A 3IR9A 1X0TA 1SQVK 4OVNF 1CI6B 3AEFC 3HE4B 5CBNA 3HRNA 1NTZG 1S4XA 3CMEP 2A06G 3G6EP 4U3FE 3GHGA 2LKMA 3L75E 4IL6H 1VQ4P 1G1JA 4YXWH 1HH0A 1SQPK 4WVZA 3LW5H 5KLIC 3VYIA 4LGDE 1ZLLA 1SQVE 1Z56A 2W90A 4I2LC 3V2QA 2GBXA 5GTHH 4HKZH 1JMMA 2V7QJ 2IFMA 1EDKA 2OTJP 1VCKA 1YTZI 1LT9B 1KN7A 2GUSA 4KHXA 1FDOA 1FDMA 4P1BH 2XRXA 5APTA 2YFIA 2K3RA 3H1IJ 1FZCB 3L4FA 3C9IA 2R32A 3OA7A 4W7ZA 4ZMDA 1KZUB 3VMID 3TSIA 3EQ2A 3BATA 1SQPE 1IJDB 2I1JA 1GDTA 5KAIH 3MP7B 2HMJA 4JYCA 1GZLA 1AFOA 3VMYA 1FJPA 1A02F 3H1ID 1OVVA 1FOSE 2A45H 2NPSD 4Y99B 2IPPA 2A45G 4OH8B 1S72P 4O9BA 3CMAP 2ZYGA 1NU1G 2FBWC 1OZHA 3VP8A 4C7NA 3L73J 2BMQA 1R8EA 3PHLA 2V4HA 3L72G 2O01N 2M0BA 2LXBA 1DX7A 1HVVA 3RK2C 4OGQC 3SFEC 5KJ7C 5C39A 4KT0J 3PH0A 3M0DC 3BVHA 1ZV8A 2E5TA 4QDFB 1H88A 3NTNA 3TGUG 4UB8E 1RE3A 1ZXGA 3B5NB 3D70A 1NAYA 2D2CC 2ZT9B 1KMIZ 3CX5H 1SFCC 1NTZK 1L4AA 1FS0E 3A0HH 5AVQB 2BCCJ 3OAKA 1HUCA 3O8ZA 4H44B 2H43A 3GOBA 1U7JA 5CHXA 1X22A 1KTMA 2CPBA 3QWOC 3GF3A 2XDJA 3AE8C 1N8RQ 2FFDA 5TJHA 1KILD 4JPZB 1MUUA 2QRXA 3AE6C 1VQLP 1J1DC 2BCCD 3TK1A 4GOEA 4L74A 2VRSA 3CWBG 2KSJA 4HYTB 2YFJA 1W2EA 4DJGA 1DH3A 2N9YB 2QJPB 2I8DA 2JZAA 2C9NY 2ZFCA 5B66H 1EQ7A 1OIPA 3FXDA 1JY2N 2WPRA 1EZVI 4Y28J 2GA1A 2YFLA 2Y0DA 1FU1A 4AIVA 2OARA 1LTAC 1G1IA 1ZR2A 3S9OA 4HJGH 3V4WA 2B24A 1SS1A 2P67A 3WU2H 5GTHE 4EI2A 3LW5J 1VF5B 3L74D 1EXJA 2ZYAA 1NVOA 1L0ND 1CSBA 1NHLA 3H1JG 2B89A 4H13D 2W27A 3LIDA 3WUTA 1M90Q 3MIWA 1NU1K 3S1KA 1SQQE 3H1KG 1MFTA 1SQBE 2KZJA 5CBOA 3K5BA 1PP9J 2P58A 1FC2C 2L91A 4H0LC 4PJ0H 1YJWP 1PPJG 4I1LA 1EDIA 2NUMA 2Q5UA 1KFNA 2WSFH 2Z4EA 3CX5I 1D7MA 1P84E 2B88A 4QURA 1JMBA 1LNQA 3N7NA 1BCCJ
chains in the Genus database with same CATH topology
3RL0g 2HMMA 2E74D 3GZXA 3D6YA 1HJ0A 2E76C 1KQFB 1G8KB 3AEEC 1KILE 1DD3A 3Q3DA 1UUWA 1MKMA 2NZ2A 2BCCE 3VCPA 3H1JE 2ZYLA 2P10A 1YQ3C 4OGQB 3D6ZA 4NBAD 1NDOA 3GKEA 3L72E 2FYUE 2E4QA 2WQYC 4YTPC 4QCKA 2E75C 1WQLA 3CXHE 4H13B 4QUPA 4RKUJ 1ZP0C 2G3AA 4NB8D 1L0LE 2NVGA 1PV3A 2BMRA 2D2CB 3TGUE 4IL6X 4NBED 2IBZE 3C0DA 2GBWA 1UUVA 5AEUA 3AE4C 5M1BA 3Q5PA 1NYKA 2FYNC 4EMJB 3GZYA 3CX5E 3L70E 3GL2A 5KLVE 4QDDA 3L74E 3AE3C 2E4PA 1K04A 3H25A 1ULIA 2E74B 1L0NE 3VMGD 3GB4A 4HM1A 4H0LD 2JP3A 4U7JA 3Q5RA 3AEBC 3G9RA 1U57A 2H89C 3DQYA 2DE7D 3CWBE 5CXMA 1OW6A 1O7NA 2NVEA 4HM5A 3L73E 1S1CX 3AZCA 3AE2C 1SQXE 2ZT9C 4I7ZB 1Q90C 3AE7C 1NYHA 2E76D 1O7MA 1ZOYC 2XSOA 2H88C 4NBHD 3Q5SA 2QJYC 4H44C 3O6QA 2BMOA 2O01J 1RQUA 3GF7A 4HM0A 1RIEA 3GL0A 3AEFC 2WSEJ 1BE3E 4R4MA 2E75D 2YIUC 3D89A 3B71A 4QUQA 1TU3F 4HM2A 2K9YA 1WMKA 2FXPA 4U3FE 2QJPC 4H0LB 3EQQA 4TT3H 3L75E 3H1KE 3BCCE 1K05A 1EXIA 3H1LE 1ULJA 5KLIC 1PPJE 2JO1A 1SQVE 2GBXA 1SJGA 2V7QJ 3R4YA 2DE6D 4YXDC 2E76B 1VCKA 1OMIA 4NBBD 4PD4E 2JO6A 1FDOA 4P1BH 2XRXA 2WSFJ 1PIXA 2YFIA 1VF5C 2XSHA 4NBCD 4HJLA 3D71A 3AE9C 1JB0J 1NTZE 3VMID 1RQVA 1IK7A 2A06E 1SQPE 2YVJB 4PV1C 4R4LA 1VL2A 2E75B 4NBFD 1VM9A 2J5UA 2ZT9D 2HMJA 1Q90D 5KKZC 2I7FA 2IDBA 2NWFA 4H44D 3FOUA 3VMHD 5AEWA 3Q1MA 1ZMEC 2FBWC 2NUKA 1NGMB 2QJKC 1O7PA 3GMAA 2G8YA 4NBDD 3IAOA 4NB9D 1PP9E 2BMQA 2BEZF 1R8EA 3ABVC 1GMJA 1KQGB 1RFSA 4OGQC 3SFEC 1O7GA 2Q3WA 1KORA 2CKFA 3C8VA 4KT0J 3IN6A 3AEDC 4QDFB 1BCCE 1O7WA 2OQQA 2DE5D 4H13C 4HM3A 3AECC 2HMOA 1FDIA 1KYOE 3D70A 2D2CC 1EZVE 2ZT9B 1KMIZ 1OW8A 1G8JB 3AE1C 1EG9A 2YMKA 1NU1E 1O7HA 1VF5D 4H44B 3GOBA 1KTMA 3GF3A 3N0QA 3AEAC 1AJYA 3AE8C 1FQTA 4PV1D 3AEGC 2HMNA 3H1HE 2E74C 2QPZA 1OW7A 3AE6C 4QDCA 3SFDC 3EWKA 4XFJA 4HM4A 3FGAD 2YFJA 1YQ4C 3GLMA 1DD4A 2JZAA 3VCAA 3H1IE 4HKVA 2HMKA 1Y9BA 4HM8A 2NVFA 2HMLA 5HL4A 3Q2YA 4Y28J 2YFLA 4I7ZC 4AIVA 2B1XA 3S9OA 3T97B 1NTME 2B24A 2WPVB 3RK3E 4OGQD 3AE5C 3LW5J 1UIXA 2XR8A 4P1CH 1VF5B 1EXJA 1PL5A 1ZRTE 1JM1A 4GDOA 3EN1A 4H13D 3GCEA 5L8RJ 4PV1B 1S5LX 1DIPA 1SQQE 2D2CD 1SQBE 4NBGD 2BEQD 4HM7A 3GTEA 4H0LC 1NTKE 2NUMA 4Z1MH 2QIWA 3GTSA 2WSCJ 1P84E 2MKVA 4AAYB 4QURA 2QSIA 1HF9A 1KB9E 4QDFA 5BOKA 3L71E 4HM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMN A;  3AZC A;  3H1H E;  4NBF D;  2E74 C;  2HMM A;  1VM9 A;  2E74 D;  2QPZ A;  3GZX A;  1SQX E;  2ZT9 C;  4QDC A;  2ZT9 D;  2HMJ A;  1Q90 C;  2E76 C;  4HM4 A;  2E76 D;  1O7M A;  1G8K B;  2YFJ A;  5KKZ C;  2I7F A;  2XSO A;  1UUW A;  4NBH D;  2BCC E;  4H44 C;  2QJY C;  3H1J E;  2NWF A;  4H44 D;  3VCP A;  2ZYL A;  3FOU A;  4NBA D;  2BMO A;  2JZA A;  3VCA A;  3H1I E;  3VMH D;  1NDO A;  2YVJ B;  3GKE A;  3L72 E;  4HKV A;  2HMK A;  5AEW A;  4HM8 A;  2FYU E;  2NVF A;  4HM0 A;  1RIE A;  3GL0 A;  2HML A;  5HL4 A;  2E4Q A;  1BE3 E;  2NUK A;  4QCK A;  2E75 C;  1WQL A;  3CXH E;  2E75 D;  2YIU C;  2QJK C;  4QUP A;  1O7P A;  2YFL A;  4NBD D;  4I7Z C;  3D89 A;  4NB8 D;  4NB9 D;  1PP9 E;  1L0L E;  4QUQ A;  2NVG A;  4AIV A;  2B1X A;  2BMR A;  3TGU E;  2BMQ A;  4HM2 A;  4NBE D;  2IBZ E;  3C0D A;  1NTM E;  2GBW A;  2B24 A;  1UUV A;  4U3F E;  5AEU A;  2QJP C;  3EQQ A;  3L75 E;  1RFS A;  4OGQ C;  2Q3W A;  1O7G A;  4OGQ D;  2CKF A;  3H1K E;  2XR8 A;  3BCC E;  1NYK A;  4P1C H;  2FYN C;  4EMJ B;  3GZY A;  3CX5 E;  4HM6 A;  4QDF B;  3L70 E;  1BCC E;  3GL2 A;  1O7W A;  3H1L E;  1ULJ A;  5KLI C;  1ZRT E;  1JM1 A;  1PPJ E;  2DE5 D;  3EN1 A;  4H13 C;  5KLV E;  4H13 D;  1SQV E;  2GBX A;  3L74 E;  4HM3 A;  4QDD A;  3GCE A;  1SJG A;  2E4P A;  2HMO A;  1ULI A;  4HM5 A;  1KYO E;  1L0N E;  2D2C C;  1SQQ E;  3VMG D;  2D2C D;  1EZV E;  1SQB E;  3GB4 A;  4NBG D;  2DE6 D;  4HM7 A;  1G8J B;  4HM1 A;  3GTE A;  1VCK A;  1EG9 A;  4NBB D;  4H0L C;  2YMK A;  4H0L D;  4PD4 E;  2JO6 A;  1NTK E;  1NU1 E;  1O7H A;  4P1B H;  2NUM A;  2XRX A;  2YFI A;  1VF5 C;  3GTS A;  1VF5 D;  3GOB A;  2XSH A;  3DQY A;  2DE7 D;  4HJL A;  4NBC D;  1NTZ E;  3VMI D;  3CWB E;  1P84 E;  3N0Q A;  4AAY B;  4QUR A;  2A06 E;  1SQP E;  5CXM A;  1KB9 E;  1O7N A;  2NVE A;  1FQT A;  4QDF A;  5BOK A;  4PV1 C;  3L71 E;  4PV1 D;  3L73 E; 
#chains in the Genus database with same CATH topology
 5DJU B;  3KZI H;  3QH9 A;  3KXD A;  2QJK B;  2NRG A;  3D6Y A;  3II6 A;  1HJ0 A;  5AW1 B;  3AEE C;  1N86 A;  3Q3D A;  1NWQ A;  2NZ2 A;  1K8A Q;  3VCP A;  3BAS A;  1NU1 J;  1T2K C;  1BCC D;  3L72 E;  2HFE D;  4I6M C;  1N73 B;  3HTK A;  2Q1K A;  3EFG A;  5AW7 B;  1YJN P;  3CXH E;  1QEX A;  1WT6 A;  1KYO D;  2JWD A;  1EZV D;  1IFN A;  1S2E A;  1ZP0 C;  2G3A A;  1S3J A;  3TGU E;  1X9V A;  4NPD A;  4QMA A;  3C0D A;  3BCC D;  3P8M C;  4KJM A;  1PFI A;  1UUV A;  2OGU A;  5M1B A;  2RMZ A;  2JWA A;  2K1A A;  2CPS A;  2FYN C;  2KS1 B;  4EMJ B;  3GZY A;  3CX5 E;  5TIS H;  3PJS K;  1L2P A;  3GL2 A;  2J58 A;  1VQ7 P;  1KV4 A;  2QE7 H;  2OYH A;  3H25 A;  1L4A D;  3GB4 A;  1NH4 A;  2AEM A;  2JP3 A;  2QM8 A;  3Q5R A;  3T97 A;  3AEB C;  3A0B E;  3G9R A;  1U57 A;  2OYI C;  2GM4 A;  1JY3 N;  1NAF A;  2W6B A;  3CWB E;  1O7N A;  2NVE A;  2C0X A;  2O1K A;  3HUS A;  1J2J B;  1H8A A;  2KK7 A;  4I7Z B;  2JDI H;  5B66 E;  1DEE G;  1O7M A;  4RO0 A;  2NPS C;  2FYU K;  1RF1 A;  1GL2 A;  3CCS P;  4NBH D;  1QL2 A;  2BMO A;  2R5B A;  3V2N A;  5AW6 B;  1USD A;  1G2C B;  1RQU A;  3E1R A;  1L0L K;  4RES B;  2N9B A;  4HM0 A;  1RIE A;  3MD0 A;  2WSE J;  1BE3 E;  2E75 D;  4EYY Q;  1TU3 F;  1VQM P;  1OWA A;  4HM2 A;  1M1J B;  2P7J A;  1LWU B;  2W83 C;  3SWK A;  4TT3 H;  3CCL P;  1NOH A;  5APQ A;  3HE5 A;  3H1K E;  3TYY A;  3H1J J;  1ZN5 A;  1EXI A;  4WY4 B;  2RN0 A;  1Q81 Q;  1PPJ E;  1HWT C;  3USS A;  1MV8 A;  2FYU J;  2K9J A;  1BGY E;  2Q3E A;  3U1A A;  1KC8 Q;  1HTL C;  5BVZ A;  5AVY B;  3R4Y A;  1T8Z A;  1AA0 A;  4DZO A;  1M7L A;  2E76 B;  2YMY A;  1L0L J;  5CJ4 A;  4NBB D;  4PD4 E;  1IK9 A;  2WSF J;  1PIX A;  3E1I A;  2XSH A;  1RE4 C;  4HJL A;  3AE9 C;  1LP1 B;  1JB0 J;  3FXE A;  1IK7 A;  1M56 D;  1ZW0 A;  2WSC H;  2XV5 A;  1HGV A;  4R4L A;  1NTK G;  1KIL C;  3I55 P;  5KLV J;  2J5U A;  1JCD A;  2AEF A;  2IBZ D;  2FYZ A;  1H0T A;  3RL0 D;  4UB8 H;  2YKQ A;  3G4S P;  1KB9 H;  2E42 A;  2I7F A;  2IDB A;  1YIT P;  2HG5 D;  5APV A;  4IOI H;  5AEW A;  1RH5 B;  5KLV D;  1ZME C;  2NUK A;  1NTM D;  1URQ A;  5AW2 B;  4NBD D;  2OYO A;  3GHG C;  3IAO A;  4LC1 A;  1Y47 A;  4D6T J;  3RK3 D;  3ABV C;  3M91 A;  3PP5 A;  4HB1 A;  3KYQ A;  1HGZ A;  5CJ0 A;  1KQG B;  2Q3W A;  2IZ1 A;  2CKF A;  2C9L Y;  3BRT B;  3E7K A;  1LTJ B;  4D6T D;  3L71 J;  3CCV P;  3KPE A;  4H13 C;  1VQ9 P;  4JF7 A;  1CI6 A;  3HE4 A;  1GW4 A;  1G8J B;  3L70 G;  2FKW B;  5APW A;  1YYC A;  1KQL A;  1LGH B;  2HR3 A;  4U3F J;  3L74 G;  3CC7 P;  2QJY B;  3L75 J;  3L71 D;  4ZKU A;  1N7L A;  1YI2 P;  1L0N G;  2QG4 A;  3AEA C;  3CC2 P;  1R5S A;  4PV1 D;  1VPC A;  2QPZ A;  1OW7 A;  1SQV J;  1GL2 D;  5H2F E;  3FGA D;  4U3F D;  3L75 D;  1N7S B;  1T3J A;  4OWF A;  1SQQ G;  1LT9 A;  1SQB G;  4GKG A;  3CD6 P;  3H1I E;  1SQX G;  4AQR D;  4HM8 A;  1FZC A;  1FE6 A;  3M06 A;  5HL4 A;  1SQV D;  5KLI B;  4WWI A;  2M5A B;  1K73 Q;  2HYN A;  1SQP J;  1P84 H;  1W5C E;  4ZNC A;  1BDC A;  1NTK K;  1VQP P;  1LTI C;  1E5W A;  1UIX A;  4P1C H;  2N1T B;  1SQP D;  1RE3 C;  3VMX A;  3R2P A;  2J59 M;  2QA4 P;  2N1T A;  1M8O B;  1L4A C;  2WVR A;  1PGQ A;  2KP8 A;  4HM7 A;  4XA4 A;  3CXH H;  4M3L A;  1LTG C;  3O6Q B;  3H1L G;  1NTK E;  1CW5 A;  1N2D C;  2KB7 P;  4C46 A;  3TF5 A;  2KOG A;  3CCE P;  3IFM A;  2HLO A;  3L73 D;  2WSC J;  2FFD C;  3V6I A;  2QSI A;  1KB9 E;  3L37 A;  4QDF A;  5BOK A;  4HM6 A;  3CL3 D;  1JNM A;  2E74 D;  1S9K D;  4BXL A;  1DEB A;  1AV1 A;  5AW0 B;  3B5N A;  1KIL E;  1E79 H;  2BCC E;  3RK2 B;  2P10 A;  4OGQ B;  3CCR P;  3F5H A;  1Y8A A;  4IFM A;  1URQ D;  3A0B H;  2HPC B;  1VQO P;  2K88 A;  3M9H A;  2E75 C;  4NPF X;  1WQL A;  1NKZ B;  1OVU A;  4QUP A;  2KLU A;  4RKU J;  1IFM A;  4CPG A;  2PFX A;  4NB8 D;  2WT7 B;  2K37 A;  1PV3 A;  2BMR A;  2D2C B;  3VMA A;  1JY2 P;  2R3C A;  4IFD K;  1SFC B;  4ASV A;  2JJL A;  1JY2 O;  1P84 I;  5AW3 B;  1NYK A;  1QVG O;  1NTZ J;  3VOP A;  2A45 I;  2B9B A;  3L70 E;  1SQQ K;  1SQB K;  1SQX K;  3L74 E;  3MZW B;  3AE3 C;  2E4P A;  4GT1 A;  1K04 A;  1Q82 Q;  2KSE A;  1MFZ A;  1L0N E;  4HH2 A;  1VQN P;  1BSH A;  4N6J A;  1J1D B;  1BE3 G;  2WPQ A;  1YHQ P;  1NTZ D;  2WTY A;  2CK3 H;  2KNC B;  2A06 D;  5AVV B;  5AW5 B;  5APS A;  3WUU A;  3CXH I;  1IFJ A;  1OW6 A;  5AW4 B;  2E43 A;  2FXO A;  2WPS A;  1M1K Q;  3VMZ A;  3AZC A;  1IFI A;  3AE2 C;  5CCG A;  1SQX E;  1JO5 A;  3AE7 C;  2R3S A;  3UIA A;  1NYH A;  4N3Y B;  3RL0 C;  1SQQ J;  1ZOY C;  1BGY G;  1SQB J;  3V4Q A;  1QL1 A;  3G3Z A;  2H88 C;  1N7S D;  3H1H G;  4PD4 H;  3GF7 A;  2E5Y A;  1EC5 A;  1PP9 D;  2UWJ E;  3EFF K;  2YIU C;  5CCH A;  1PGP A;  3D89 A;  3RK3 C;  5AVT B;  2K9Y A;  1WMK A;  2RKL A;  1RF0 A;  1CZQ A;  4H0L B;  3L35 A;  3BCC E;  2MJZ A;  1K05 A;  2LXC B;  2OYH C;  3H1L E;  1FZA A;  2N1T D;  1A02 J;  3L72 J;  2JO1 A;  1JTH B;  2WIT A;  1SJG A;  1N73 A;  3V5B A;  3MUD A;  1NU1 D;  2Q7C A;  4YXD C;  3L36 A;  2XZR A;  1OMI A;  1SLQ A;  3TGU J;  1RY3 A;  5E79 E;  2IYO A;  3L72 D;  4B86 A;  4NBC D;  3D71 A;  3TNU B;  3VN0 A;  1RQV A;  4BRY B;  3HUS C;  5AVW B;  3V2R A;  2Y9Y A;  1FAV A;  2KS1 A;  4PV1 C;  4L75 A;  1GU4 A;  1VL2 A;  2FXM A;  4NBF D;  3B5N D;  1JY3 P;  2B87 B;  2KI7 B;  3H32 B;  3TGU D;  1RF1 C;  1GL2 C;  2ZT9 D;  3KDP B;  2H7H A;  1JY3 O;  2HOD B;  2XNX A;  3HD7 B;  1Q7Y Q;  5KKZ C;  4L76 A;  1NKN A;  4H44 D;  3CX5 D;  1Q86 Q;  2O3J A;  2FYN B;  4MN4 C;  1FZB A;  3CWB J;  4IFF A;  4K3A A;  5DJT B;  1O7P A;  4WB4 A;  4NB9 D;  4PD4 I;  3I56 P;  2BEZ F;  4L73 A;  1GMJ A;  3U1C A;  1RFS A;  2V7Q H;  1O7G A;  1KOR A;  1ZRT D;  5H2F H;  2AEJ A;  3CWB D;  3IN6 A;  2ZAE B;  1PGJ A;  2OYI B;  3CCJ P;  1IC2 A;  1J1E C;  3A7O A;  3PTZ A;  2DE5 D;  1MZ9 A;  4HM3 A;  1G2C A;  3H1I G;  2QEX P;  3V2P A;  1OW8 A;  4N78 D;  3AE1 C;  3P7K A;  1EG9 A;  2NPS B;  1O7H A;  1M1J A;  1LWU A;  1VF5 D;  2ZVN B;  3H1K J;  3A2A A;  2YKP A;  5CCG D;  4WY4 A;  3AEG C;  3P8C D;  4A7P A;  3H1H E;  2E74 C;  2KUB A;  3MHV A;  4QDC A;  3SFD C;  3H1J D;  4XFJ A;  4HM4 A;  1YQ4 C;  1PZQ A;  2FYU D;  1IFD A;  3H1K D;  1EDL A;  3VTP C;  5APU A;  4DOJ A;  1T3U A;  1URQ C;  1Y9B A;  5CCH D;  1T6A A;  2PAJ A;  4JBZ A;  1L0L D;  1LP1 A;  2O01 H;  2Z5H A;  3SWY A;  4BWN A;  1HJB A;  1AQ5 A;  4EIJ A;  1GK6 A;  2QM7 A;  2B1X A;  1ZR4 A;  1SVF A;  1NTM E;  1VQ8 P;  4C7R A;  2LR2 A;  2WPV B;  3RK3 E;  2H8P D;  2WSS H;  3AE5 C;  1VDF A;  2P1J A;  1Q2N A;  2IX7 C;  2XR8 A;  1PL5 A;  3VP9 A;  4GDO A;  2BCC G;  1XTC C;  2Q3I A;  2GUV A;  2KIK A;  1FBM A;  1KIL B;  1S5L X;  1DIP A;  3JCU H;  5B5E E;  1PGO A;  3ITK A;  1VQK P;  3WUV A;  2JKV A;  4Z1M H;  2QIW A;  3GTS A;  5AVU B;  1HF9 A;  2YKO A;  3L71 E;  3NFQ A;  1LJ2 A;  2WWW A;  1LTJ A;  4UB6 E;  2HMM A;  1GW3 A;  3GHG B;  1NO4 A;  3KHU A;  2AXT H;  1LT9 C;  1G8K B;  1FJK A;  3PLN A;  1DD3 A;  5AVR B;  3HD7 D;  2IFN A;  1FZC C;  1N7S C;  2Y0C A;  2ZYL A;  1YQ3 C;  4NBA D;  3GKE A;  1JOC A;  3P32 A;  2E4Q A;  1GK4 A;  2WQY C;  3CLQ A;  4H13 B;  1JM0 A;  2JEE A;  4DCK A;  1QGK B;  1QLE D;  2ZYD A;  3RBZ A;  4Y99 C;  1SP4 A;  5KAF E;  3OJA B;  5GTI H;  1OX3 A;  1N7S A;  2Y0E A;  1W2B O;  1KB9 I;  1PP9 G;  2C0W A;  2N1T C;  2W8Z A;  1ULI A;  2M5A A;  3VMG D;  2M3B A;  2W6A A;  1S5L H;  1BCC G;  3N4X A;  4U7J A;  2PP6 A;  2H89 C;  2DE7 D;  1KYO H;  4RJT A;  4WY4 D;  5CMZ A;  1EZV G;  4C7N B;  3WMM 0;  4AUW A;  4ZKP A;  4HM5 A;  3L73 E;  1S1C X;  3BCC G;  3B5N C;  2ZT9 C;  2E76 D;  5BU5 A;  1S9K E;  2XSO A;  2YXQ B;  2QVA A;  4H44 C;  3O6Q A;  1NTK J;  1YTZ T;  4GIF A;  3CC4 P;  2O01 J;  3GL0 A;  2P2U A;  5E79 H;  4R4M A;  3NXS A;  3NMD A;  3CCM P;  3B71 A;  3A5T A;  1L4A B;  4QUQ A;  3W67 A;  2FXP A;  1NTK D;  2M8R A;  2QJP C;  3EQQ A;  3W68 A;  2XKM A;  2BAS A;  3C1L A;  3JCU E;  1L0N K;  1KB9 D;  2FFD B;  1ULJ A;  5KJ7 A;  1WRG A;  3FX0 A;  3M0D A;  2PGD A;  3FWL A;  1GU5 A;  4XE5 B;  2HPC A;  1FZE A;  2DE6 D;  2Q9I A;  2WT7 A;  2JO6 A;  3I5C A;  5BU8 B;  2R5D A;  1VF5 C;  1SFC A;  4DT0 A;  2AXT E;  1NTZ E;  4EDF A;  2A06 E;  5CCG C;  3RGU A;  3L70 J;  2YVJ B;  2L5G B;  2E75 B;  1VM9 A;  3L74 J;  4GOF A;  1KYO I;  4IL6 E;  1Q90 D;  2WSE H;  1L0N J;  5EFW B;  3M9Q A;  5AVZ B;  2Q6Q A;  2ZXE B;  2NWF A;  3M9B A;  3FOU A;  2DW3 A;  1OFC X;  3VMH D;  3L70 D;  2KNC A;  2SPZ A;  5CCH C;  1XTG B;  1LT1 A;  3Q1M A;  4ASW A;  1YJ9 P;  5GTI E;  1JEK A;  1NGM B;  2QJK C;  3GMA A;  1RF0 C;  2G8Y A;  1EDJ A;  2FY8 A;  1PP9 E;  1AVY A;  3SSU A;  1SQX J;  2FYU G;  3ZDM A;  3S4R A;  3C8V A;  1GTW A;  4LLH A;  3AED C;  5KAI E;  2YO2 A;  5APX A;  1L0L G;  1N73 C;  1BCC E;  1O7W A;  3MUD C;  1UII A;  1S5L E;  2OQQ A;  1SQQ D;  2IBZ G;  5AW9 B;  1SQB D;  1FZF A;  1OVR A;  3AEC C;  4TLF A;  1SQX D;  2R44 A;  2HMO A;  1FDI A;  1KYO E;  1EZV E;  3JSV C;  1BSN A;  4K35 A;  4GOD A;  3RL0 B;  2PRR A;  2YMK A;  3MTU E;  3B8E B;  3CCQ P;  1NU1 E;  1P84 D;  5KLV G;  2KLV A;  4W7Y A;  3HTK B;  1NTM G;  5KTB A;  1IO4 A;  3GW6 A;  3BCC J;  3N0Q A;  4JQ0 D;  1AQT A;  1AJY A;  1FQT A;  3CI9 A;  3H1L J;  2HMN A;  5APY A;  2YIU B;  2POH A;  1JTH A;  1X79 B;  2I1K A;  5AVX B;  3RK3 B;  3EWK A;  2WMM A;  1QX8 A;  3HD7 C;  3GLM A;  1DD4 A;  4D6T G;  5B5E H;  3VCA A;  1H89 A;  3IF4 A;  3KQG A;  3CXH D;  2O1J A;  3H1L D;  4HKV A;  2HMK A;  2NVF A;  2HML A;  2OYH B;  3TNU A;  5AVS B;  4BRY A;  3Q2Y A;  1KD1 Q;  2YO3 A;  4I7Z C;  1X8Y A;  3A0H E;  2W6J H;  3T97 B;  2B87 A;  3H32 A;  3L71 G;  4UB6 H;  3A3Y B;  2HOD A;  3BRV B;  3HD7 A;  3RBX A;  3RK2 D;  4OGQ D;  5KJ7 D;  2KXP B;  1M57 D;  1ZRT E;  2IYP A;  1JM1 A;  3HUS B;  2ITA A;  3EN1 A;  1YBK A;  3TDK A;  4U3F G;  3GCE A;  5L8R J;  4PV1 B;  1JUN A;  3L75 G;  3JC2 2;  4W80 A;  2D2C D;  4NBG D;  1RF1 B;  1GL2 B;  2BEQ D;  1M1J C;  1LWU C;  3GTE A;  2IBZ I;  1VQ6 P;  1SFC D;  2YXR B;  2ZJS E;  5KKZ B;  1SQV G;  4N78 E;  1FZG A;  4EOT A;  2AXC A;  4WY4 C;  5KAF H;  2MKV A;  4AAY B;  2KYV A;  1BE3 J;  2RH0 A;  2OYI A;  1KQS O;  3H6P A;  3RL0 g;  2Y9Z A;  1FOS F;  3MGN A;  3GZX A;  2KZI A;  1GD2 E;  3B4S A;  3WU2 E;  1JCC A;  1LTS C;  2E76 C;  1OXZ A;  1KQF B;  1LTT C;  3P8C E;  3HE5 B;  1USE A;  1SQP G;  1UUW A;  1MKM A;  1BDD A;  3SWF A;  3H1J E;  3D6Z A;  1BE3 D;  3F89 A;  2NPS A;  1NDO A;  1U7M A;  3CPW O;  1HBW A;  2K9J B;  5KLV K;  2FYU E;  4AYC A;  5K5G B;  1BGY J;  1J1E B;  1NTM K;  4YTP C;  4QCK A;  2WZ7 A;  2ZVO B;  4PJ0 E;  3U59 A;  4JYB A;  1L0L E;  3H1H J;  2NVG A;  3M0A A;  4IL6 X;  4NBE D;  2XND H;  2IBZ E;  3GG2 A;  3L73 G;  2GBW A;  5AEU A;  3AE4 C;  1VQ5 P;  2YNY A;  1PPJ D;  3Q5P A;  1BGY D;  2M3E A;  3KZI E;  1AVO A;  2OTK E;  1K9M Q;  5KLV E;  3H1H D;  4QDD A;  3CCU P;  1H0T B;  4PD4 D;  2E74 B;  4YPC A;  2JR8 A;  1LTB C;  1YIJ P;  4HM1 A;  4H0L D;  2IZ0 A;  3PRJ A;  1NTM J;  1R5L A;  1IZN B;  1NJI Q;  1KFM A;  3FWN A;  3DQY A;  3LIE A;  2OTL P;  5AW8 B;  1LTJ C;  3G71 P;  1URQ B;  5CXM A;  4NPE A;  1RE4 A;  4D6T E;  1QVF O;  1RHZ B;  3OW2 O;  4WBA A;  2ZXX A;  1Q90 C;  1KIL A;  5TIS E;  1IFP A;  2Z5I A;  3Q5S A;  2QJY C;  1T2K D;  2XU6 A;  3IR9 A;  1X0T A;  1SQV K;  4OVN F;  1CI6 B;  3AEF C;  3HE4 B;  5CBN A;  3HRN A;  1NTZ G;  1S4X A;  3CME P;  2A06 G;  3G6E P;  4U3F E;  3GHG A;  2LKM A;  3L75 E;  4IL6 H;  1VQ4 P;  1G1J A;  4YXW H;  1HH0 A;  1SQP K;  4WVZ A;  3LW5 H;  5KLI C;  3VYI A;  4LGD E;  1ZLL A;  1SQV E;  1Z56 A;  2W90 A;  4I2L C;  3V2Q A;  2GBX A;  5GTH H;  4HKZ H;  1JMM A;  2V7Q J;  2IFM A;  1EDK A;  2OTJ P;  1VCK A;  1YTZ I;  1LT9 B;  1KN7 A;  2GUS A;  4KHX A;  1FDO A;  1FDM A;  4P1B H;  2XRX A;  5APT A;  2YFI A;  2K3R A;  3H1I J;  1FZC B;  3L4F A;  3C9I A;  2R32 A;  3OA7 A;  4W7Z A;  4ZMD A;  1KZU B;  3VMI D;  3TSI A;  3EQ2 A;  3BAT A;  1SQP E;  1IJD B;  2I1J A;  1GDT A;  5KAI H;  3MP7 B;  2HMJ A;  4JYC A;  1GZL A;  1AFO A;  3VMY A;  1FJP A;  1A02 F;  3H1I D;  1OVV A;  1FOS E;  2A45 H;  2NPS D;  4Y99 B;  2IPP A;  2A45 G;  4OH8 B;  1S72 P;  4O9B A;  3CMA P;  2ZYG A;  1NU1 G;  2FBW C;  1OZH A;  3VP8 A;  4C7N A;  3L73 J;  2BMQ A;  1R8E A;  3PHL A;  2V4H A;  3L72 G;  2O01 N;  2M0B A;  2LXB A;  1DX7 A;  1HVV A;  3RK2 C;  4OGQ C;  3SFE C;  5KJ7 C;  5C39 A;  4KT0 J;  3PH0 A;  3M0D C;  3BVH A;  1ZV8 A;  2E5T A;  4QDF B;  1H88 A;  3NTN A;  3TGU G;  4UB8 E;  1RE3 A;  1ZXG A;  3B5N B;  3D70 A;  1NAY A;  2D2C C;  2ZT9 B;  1KMI Z;  3CX5 H;  1SFC C;  1NTZ K;  1L4A A;  1FS0 E;  3A0H H;  5AVQ B;  2BCC J;  3OAK A;  1HUC A;  3O8Z A;  4H44 B;  2H43 A;  3GOB A;  1U7J A;  5CHX A;  1X22 A;  1KTM A;  2CPB A;  3QWO C;  3GF3 A;  2XDJ A;  3AE8 C;  1N8R Q;  2FFD A;  5TJH A;  1KIL D;  4JPZ B;  1MUU A;  2QRX A;  3AE6 C;  1VQL P;  1J1D C;  2BCC D;  3TK1 A;  4GOE A;  4L74 A;  2VRS A;  3CWB G;  2KSJ A;  4HYT B;  2YFJ A;  1W2E A;  4DJG A;  1DH3 A;  2N9Y B;  2QJP B;  2I8D A;  2JZA A;  2C9N Y;  2ZFC A;  5B66 H;  1EQ7 A;  1OIP A;  3FXD A;  1JY2 N;  2WPR A;  1EZV I;  4Y28 J;  2GA1 A;  2YFL A;  2Y0D A;  1FU1 A;  4AIV A;  2OAR A;  1LTA C;  1G1I A;  1ZR2 A;  3S9O A;  4HJG H;  3V4W A;  2B24 A;  1SS1 A;  2P67 A;  3WU2 H;  5GTH E;  4EI2 A;  3LW5 J;  1VF5 B;  3L74 D;  1EXJ A;  2ZYA A;  1NVO A;  1L0N D;  1CSB A;  1NHL A;  3H1J G;  2B89 A;  4H13 D;  2W27 A;  3LID A;  3WUT A;  1M90 Q;  3MIW A;  1NU1 K;  3S1K A;  1SQQ E;  3H1K G;  1MFT A;  1SQB E;  2KZJ A;  5CBO A;  3K5B A;  1PP9 J;  2P58 A;  1FC2 C;  2L91 A;  4H0L C;  4PJ0 H;  1YJW P;  1PPJ G;  4I1L A;  1EDI A;  2NUM A;  2Q5U A;  1KFN A;  2WSF H;  2Z4E A;  3CX5 I;  1D7M A;  1P84 E;  2B88 A;  4QUR A;  1JMB A;  1LNQ A;  3N7N A;  1BCC J; 
#chains in the Genus database with same CATH homology
 3RL0 g;  2HMM A;  2E74 D;  3GZX A;  3D6Y A;  1HJ0 A;  2E76 C;  1KQF B;  1G8K B;  3AEE C;  1KIL E;  1DD3 A;  3Q3D A;  1UUW A;  1MKM A;  2NZ2 A;  2BCC E;  3VCP A;  3H1J E;  2ZYL A;  2P10 A;  1YQ3 C;  4OGQ B;  3D6Z A;  4NBA D;  1NDO A;  3GKE A;  3L72 E;  2FYU E;  2E4Q A;  2WQY C;  4YTP C;  4QCK A;  2E75 C;  1WQL A;  3CXH E;  4H13 B;  4QUP A;  4RKU J;  1ZP0 C;  2G3A A;  4NB8 D;  1L0L E;  2NVG A;  1PV3 A;  2BMR A;  2D2C B;  3TGU E;  4IL6 X;  4NBE D;  2IBZ E;  3C0D A;  2GBW A;  1UUV A;  5AEU A;  3AE4 C;  5M1B A;  3Q5P A;  1NYK A;  2FYN C;  4EMJ B;  3GZY A;  3CX5 E;  3L70 E;  3GL2 A;  5KLV E;  4QDD A;  3L74 E;  3AE3 C;  2E4P A;  1K04 A;  3H25 A;  1ULI A;  2E74 B;  1L0N E;  3VMG D;  3GB4 A;  4HM1 A;  4H0L D;  2JP3 A;  4U7J A;  3Q5R A;  3AEB C;  3G9R A;  1U57 A;  2H89 C;  3DQY A;  2DE7 D;  3CWB E;  5CXM A;  1OW6 A;  1O7N A;  2NVE A;  4HM5 A;  3L73 E;  1S1C X;  3AZC A;  3AE2 C;  1SQX E;  2ZT9 C;  4I7Z B;  1Q90 C;  3AE7 C;  1NYH A;  2E76 D;  1O7M A;  1ZOY C;  2XSO A;  2H88 C;  4NBH D;  3Q5S A;  2QJY C;  4H44 C;  3O6Q A;  2BMO A;  2O01 J;  1RQU A;  3GF7 A;  4HM0 A;  1RIE A;  3GL0 A;  3AEF C;  2WSE J;  1BE3 E;  4R4M A;  2E75 D;  2YIU C;  3D89 A;  3B71 A;  4QUQ A;  1TU3 F;  4HM2 A;  2K9Y A;  1WMK A;  2FXP A;  4U3F E;  2QJP C;  4H0L B;  3EQQ A;  4TT3 H;  3L75 E;  3H1K E;  3BCC E;  1K05 A;  1EXI A;  3H1L E;  1ULJ A;  5KLI C;  1PPJ E;  2JO1 A;  1SQV E;  2GBX A;  1SJG A;  2V7Q J;  3R4Y A;  2DE6 D;  4YXD C;  2E76 B;  1VCK A;  1OMI A;  4NBB D;  4PD4 E;  2JO6 A;  1FDO A;  4P1B H;  2XRX A;  2WSF J;  1PIX A;  2YFI A;  1VF5 C;  2XSH A;  4NBC D;  4HJL A;  3D71 A;  3AE9 C;  1JB0 J;  1NTZ E;  3VMI D;  1RQV A;  1IK7 A;  2A06 E;  1SQP E;  2YVJ B;  4PV1 C;  4R4L A;  1VL2 A;  2E75 B;  4NBF D;  1VM9 A;  2J5U A;  2ZT9 D;  2HMJ A;  1Q90 D;  5KKZ C;  2I7F A;  2IDB A;  2NWF A;  4H44 D;  3FOU A;  3VMH D;  5AEW A;  3Q1M A;  1ZME C;  2FBW C;  2NUK A;  1NGM B;  2QJK C;  1O7P A;  3GMA A;  2G8Y A;  4NBD D;  3IAO A;  4NB9 D;  1PP9 E;  2BMQ A;  2BEZ F;  1R8E A;  3ABV C;  1GMJ A;  1KQG B;  1RFS A;  4OGQ C;  3SFE C;  1O7G A;  2Q3W A;  1KOR A;  2CKF A;  3C8V A;  4KT0 J;  3IN6 A;  3AED C;  4QDF B;  1BCC E;  1O7W A;  2OQQ A;  2DE5 D;  4H13 C;  4HM3 A;  3AEC C;  2HMO A;  1FDI A;  1KYO E;  3D70 A;  2D2C C;  1EZV E;  2ZT9 B;  1KMI Z;  1OW8 A;  1G8J B;  3AE1 C;  1EG9 A;  2YMK A;  1NU1 E;  1O7H A;  1VF5 D;  4H44 B;  3GOB A;  1KTM A;  3GF3 A;  3N0Q A;  3AEA C;  1AJY A;  3AE8 C;  1FQT A;  4PV1 D;  3AEG C;  2HMN A;  3H1H E;  2E74 C;  2QPZ A;  1OW7 A;  3AE6 C;  4QDC A;  3SFD C;  3EWK A;  4XFJ A;  4HM4 A;  3FGA D;  2YFJ A;  1YQ4 C;  3GLM A;  1DD4 A;  2JZA A;  3VCA A;  3H1I E;  4HKV A;  2HMK A;  1Y9B A;  4HM8 A;  2NVF A;  2HML A;  5HL4 A;  3Q2Y A;  4Y28 J;  2YFL A;  4I7Z C;  4AIV A;  2B1X A;  3S9O A;  3T97 B;  1NTM E;  2B24 A;  2WPV B;  3RK3 E;  4OGQ D;  3AE5 C;  3LW5 J;  1UIX A;  2XR8 A;  4P1C H;  1VF5 B;  1EXJ A;  1PL5 A;  1ZRT E;  1JM1 A;  4GDO A;  3EN1 A;  4H13 D;  3GCE A;  5L8R J;  4PV1 B;  1S5L X;  1DIP A;  1SQQ E;  2D2C D;  1SQB E;  4NBG D;  2BEQ D;  4HM7 A;  3GTE A;  4H0L C;  1NTK E;  2NUM A;  4Z1M H;  2QIW A;  3GTS A;  2WSC J;  1P84 E;  2MKV A;  4AAY B;  4QUR A;  2QSI A;  1HF9 A;  1KB9 E;  4QDF A;  5BOK A;  3L71 E;  4HM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...