4H13D

Crystal structure of the cytochrome b6f complex from mastigocladus laminosus with tds
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
168
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 32
structure length 168
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h13D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h13D02
4H13C 4I7ZC 2NUKA 4NBDD 2DE5D 2E74C 2D2CD 1JM1A 2NUMA 1SQPE 1L0NE 4H0LD 3H1LE 2QJKC 2GBWA 4NBCD 2NWFA 2XSHA 1FQTA 1ULIA 5CXMA 1SQBE 2HMNA 1KB9E 2I7FA 2NVEA 4OGQC 1NTKE 2YMKA 3D89A 4PV1C 3GCEA 1NTME 3VMID 1PP9E 1O7WA 3L71E 1SJGA 3EQQA 3H1KE 1ULJA 4NBFD 2HMMA 4NBAD 4P1CH 5HL4A 1VM9A 3TGUE 4QDFA 5KLIC 4H44C 4NBHD 1WQLA 2E76C 2E4QA 3L74E 1O7MA 1O7NA 2NVGA 3GL0A 2QJYC 4HM4A 2CKFA 2HMOA 1VF5C 4QURA 3VCPA 1NU1E 5KLVE 4HM3A 3C0DA 4HM7A 4PD4E 2YVJB 4EMJB 1O7HA 4HM8A 4NBED 1SQQE 2XR8A 2YFJA 1ZRTE 2ZT9D 4U3FE 4P1BH 2BCCE 3GB4A 2YFIA 4QDDA 3L73E 3CX5E 4HKVA 4AIVA 5KKZC 2JZAA 2GBXA 4NB8D 3GZXA 4HM0A 2DE7D 2D2CC 3L70E 3AZCA 4H0LC 1KYOE 5BOKA 2FYUE 4OGQD 4NBBD 4HJLA 2A06E 2E75D 2YIUC 3VMHD 4QCKA 2HMKA 1BCCE 1RFSA 4NB9D 2FYNC 2XSOA 2BMOA 3GKEA 1SQVE 1EG9A 1O7PA 1G8KB 2NVFA 2ZT9C 2QPZA 2HMLA 5AEUA 3DQYA 4H44D 2IBZE 3L72E 4HM6A 4H13D 2E76D 3VCAA 1G8JB 2BMRA 2E74D 3BCCE 3H1HE 1BE3E 3H1IE 2E4PA 4QUQA 3H1JE 3FOUA 3CXHE 4AAYB 4NBGD 1VF5D 2Q3WA 2XRXA 3GZYA 3GL2A 4HM2A 4QDCA 2BMQA 3GOBA 4QDFB 2B1XA 3GTSA 3L75E 3EN1A 4PV1D 2E75C 1VCKA 2HMJA 2YFLA 3CWBE 2JO6A 4QUPA 2B24A 1SQXE 3VMGD 1P84E 1UUWA 1NDOA 1NYKA 5AEWA 1L0LE 1NTZE 1Q90C 1UUVA 1RIEA 3GTEA 1EZVE 2DE6D 4HM1A 4HM5A 1PPJE 2ZYLA 2QJPC 3N0QA 1O7GA
chains in the Genus database with same CATH superfamily
3CXHI 4NPDA 1L2PA 1HF9A 2V7QJ 1GDTA 1HBWA 5C39A 1L4AB 2R32A 1AFOA 1P84I 1OW8A 3VMID 3CLQA 4GODA 1SJGA 1EXIA 5HL4A 4C7NB 1LGHB 1URQB 3ABVC 2OYHB 3LIDA 4H44C 4NPEA 2KK7A 3SSUA 1IFMA 2ZYGA 4GKGA 1BGYG 1SLQA 2A06D 4M3LA 2KUBA 3TGUG 2HLOA 2YVJB 3GW6A 1OZHA 3A0BE 1H0TA 3CX5D 2A06G 2A45G 2QJYB 1Q2NA 1ZMEC 1N86A 3B5ND 2A06E 1E5WA 3CWBD 3NFQA 5M1BA 1RFSA 3HE5B 4AQRD 5AEUA 5KLIB 1GK6A 2IFMA 3L74J 1A02J 2GM4A 3H1LD 3CWBG 1LTJA 3GZYA 2FFDB 3V4WA 1S3JA 1Y9BA 2YKOA 1SQQJ 4WY4B 4Y99B 3A0BH 3CWBE 1JY3P 1LTBC 1G2CB 4KT0J 1NTZK 2I1JA 1L4AC 1QX8A 5DJUB 1EDKA 1E79H 1O7GA 4H13C 1AV1A 1URQC 2DE5D 1N7LA 3BASA 3I56P 1RF0A 3H1LE 3A7OA 5CCGC 4NBCD 3U1CA 1NTZJ 1OVVA 4AYCA 1NAFA 1NKZB 3L72J 3H1HJ 1SVFA 2HMMA 1L0NJ 4I7ZB 1OW7A 1S72P 4QDFA 1OMIA 2Z4EA 2ZVNB 1R5SA 2YKQA 2QJYC 2CKFA 1N7SD 1QLED 1DEEG 1VQLP 3VCPA 4HYTB 3C0DA 2GA1A 1GL2A 3VN0A 3Q5PA 3M0DA 3BRVB 2RH0A 2W27A 3O8ZA 1K73Q 1VQ8P 4HM0A 3L70E 5KLVJ 1AVOA 1YJNP 1FZGA 1DIPA 3QH9A 3QWOC 2FFDC 4MN4C 1JMMA 1LP1A 5AVVB 1WRGA 4WY4C 4Y99C 4Y28J 3RL0D 1EZVD 3RL0g 4DOJA 1PL5A 2O1JA 3HE4A 3GOBA 2QRXA 5BU8B 2C0WA 1RF1A 1Q90C 4C7RA 1EZVE 4HM1A 1OXZA 3TYYA 2Q6QA 4I7ZC 1XTGB 4UB8E 2W6BA 1H0TB 1RHZB 1AJYA 4Z1MH 2WTYA 4U3FD 3H1KD 3RK3B 4NBFD 2P1JA 4WVZA 1EQ7A 2P2UA 3P32A 2K37A 1KILD 2YO2A 1S5LX 3CCQP 4U3FG 1YQ3C 1SQXJ 3L71J 3H1KG 3RK2D 3KXDA 4HM7A 2Q7CA 2B88A 4U3FE 4UB8H 2Q9IA 2NPSA 3FX0A 5AVWB 1KTMA 1M1KQ 1DD4A 2CPBA 1N73A 3CXHD 4NB8D 2WQYC 3I55P 1KILE 2QA4P 1KC8Q 3V5BA 3L73G 3MTUE 1P84D 2XV5A 3WUUA 4C46A 1G8KB 2ZT9C 2JWAA 1ZR2A 2QIWA 4BXLA 1OIPA 2J58A 2E74D 4QUQA 3CL3D 4BRYA 3CXHE 2KZIA 1YTZT 2HFED 2PFXA 4QDFB 3ZDMA 3FXDA 5AW3B 2JWDA 1P84E 1OFCX 5KKZB 3TNUA 1LT1A 1SQPK 1S2EA 3N0QA 3FXEA 5KTBA 3E7KA 1GL2B 2IDBA 2QJKC 4XA4A 3S9OA 1SQBK 1FZFA 1BCCJ 2BEZF 2KI7B 3V4QA 3D6ZA 3BCCJ 1SQPG 3CXHH 1QEXA 5CMZA 1LP1B 1SQBG 1JB0J 1O7MA 4JQ0D 3PLNA 4N3YB 1P84H 1KFNA 5K5GB 3B4SA 1NU1E 4L75A 4U7JA 4EMJB 2R3CA 4HM8A 3HE4B 2CK3H 4QMAA 1S1CX 4B86A 2R5BA 3H1ID 3PH0A 1RF1B 4XE5B 3M9BA 4HH2A 1WMKA 1S9KD 5BOKA 1CZQA 1OWAA 1PP9J 3VMHD 4QCKA 3H1IG 2BMOA 1FDMA 2N9YB 4H44D 2BEQD 3B8EB 3H1IE 1BE3D 2AXCA 4NPFX 1EXJA 4WWIA 1GK4A 3L36A 4UB6E 2W90A 1GL2C 3M0DC 5APVA 1NTKD 1IFIA 3VMYA 1JTHA 1Q86Q 5CCGA 2XDJA 1BE3G 1NDOA 1UIIA 5AEWA 3H1JJ 2WSEJ 3EWKA 2O01N 5APQA 2NPSB 1NTKE 1N73B 1PPJG 1KQFB 2L91A 1USEA 1PGOA 4P1CH 1KD1Q 4UB6H 3R2PA 1J1EB 2HODA 3L37A 2WSCJ 4HJGH 3GL0A 1RF1C 1BDDA 3NXSA 2ITAA 1JNMA 2HPCA 2W8ZA 4HM3A 1L4AD 1YI2P 2WT7A 1AVYA 3KPEA 2FFDA 1LTSC 2E42A 1URQD 5TJHA 1JCDA 3SWFA 1NHLA 1LWUA 3TNUB 1LTIC 1USDA 3RBZA 1VQ4P 2R3SA 3GKEA 2QE7H 2JKVA 2D2CB 3CCJP 1ZOYC 4AAYB 4ZKUA 1BDCA 1OVRA 4RESB 4KJMA 2B1XA 2NPSC 2YFLA 4QUPA 1JMBA 2OGUA 1N73C 1A02F 3CC2P 1RIEA 1BSNA 4HM5A 4EOTA 4DT0A 2NUMA 1J1EC 2GBWA 5KAFE 2O1KA 3W68A 1D7MA 4WY4D 1SQVJ 3GCEA 1ZRTD 1K04A 1PGPA 3AE5C 4NBAD 1FOSF 1Y47A 5AW6B 3TDKA 1HVVA 4D6TD 4LC1A 3JSVC 2JJLA 1JCCA 3SWYA 2QVAA 1Q90D 4D6TG 2XR8A 1FZCA 1ZRTE 3LW5J 2KYVA 5BVZA 2WPRA 4H13B 2E76B 5KAFH 2H88C 4AUWA 4D6TE 1JTHB 3AEAC 2I1KA 2D2CC 1M56D 3L75D 1IZNB 1BGYJ 2WPVB 4JF7A 2HMKA 4XFJA 1YBKA 3TGUJ 4YTPC 4K3AA 1FJPA 3CMEP 1KN7A 3IAOA 3L75G 4ASWA 4H0LB 4K35A 2W6JH 1LTAC 2KXPB 3L75E 1NTMK 1DD3A 1PGJA 3IFMA 2HODB 1NTMD 2HMJA 4DJGA 1GD2E 2K1AA 4WBAA 3CC4P 4KHXA 1JY2N 2FY8A 1HUCA 2HPCB 1MZ9A 1VPCA 4PJ0E 2WPSA 3L74D 2WT7B 1NTMG 3CWBJ 3N7NA 2YMYA 1NGMB 1KMIZ 5APWA 2PGDA 5GTHE 2ZXEB 1NTME 1SQQD 3L74G 2Y9ZA 3H1LG 1LWUB 1ZP0C 2YNYA 1IK9A 2E76C 3L74E 2QG4A 2K3RA 2CPSA 3B71A 1FE6A 4PV1B 1NKNA 4PJ0H 1SQQE 1QVGO 2YXQB 3NMDA 4P1BH 3RK3D 3L72D 4QDDA 3H1HD 4O9BA 4GIFA 2WWWA 2XKMA 2E5YA 3L70D 5GTHH 4H0LC 1FOSE 2Z5HA 2FKWB 1RQUA 4GOEA 2FXOA 4NB9D 1RY3A 4JYCA 1O7PA 1M7LA 3L70G 1FC2C 1WT6A 3RK3E 3L72E 2MKVA 3H1HE 1KYOI 2IZ1A 1QGKB 4HM2A 4QDCA 1VQOP 2GUVA 3KQGA 1SFCC 2JO6A 3C8VA 1FZBA 1Y8AA 2QSIA 2IBZI 1S5LE 3AEFC 1FZEA 1LWUC 2K88A 1IO4A 2JDIH 1VQ9P 1FZCB 3B5NB 2AEJA 1JY3O 1ULIA 1ZR4A 1EZVG 3G4SP 1X79B 4PV1C 3A3YB 3UIAA 4LGDE 2ZT9B 2BCCD 1YYCA 3P8CD 3KHUA 5CJ0A 2N1TC 1HH0A 3MIWA 1GW3A 1GL2D 1IFDA 3OAKA 1BSHA 5APSA 1NO4A 4OGQB 4ZNCA 4W80A 2BCCG 3H25A 1S5LH 3ITKA 5CJ4A 2WSFJ 3K5BA 1YTZI 3HTKA 1DH3A 1AA0A 2OYIA 2BCCE 4JPZB 3P8CE 3VOPA 1AQ5A 3BVHA 1GU4A 2K9JA 2QJKB 4DCKA 1TU3F 3GMAA 2ZVOB 4NBBD 4PD4I 2E75D 4U3FJ 2FBWC 1L0LK 3H1KJ 1SQXD 2K9YA 3MP7B 1L0LD 3TSIA 3PP5A 2JEEA 1EG9A 3G6EP 1G1JA 2QM7A 1T6AA 3D6YA 2ZYAA 3HD7A 2XRXA 1L0LG 1FZCC 3WMM0 3B5NC 1VCKA 1SQXE 3L73J 3JC22 1L0LE 2J59M 3GTEA 2FYZA 1GZLA 3CCLP 1EDJA 3VMXA 2RN0A 1Q7YQ 1T2KC 2I7FA 4OGQC 4IL6X 5L8RJ 2YO3A 2KLUA 3M9QA 1VQMP 1ULJA 1M1JC 1ZLLA 3P8MC 1FAVA 5AW5B 1HGVA 1KB9I 1NU1K 2NPSD 2QM8A 1NU1D 1BCCD 2BASA 4HB1A 2Y0EA 1W5CE 4L76A 2ZFCA 1SQPJ 3BCCD 3CC7P 1SQBJ 1NU1G 1BCCG 2I8DA 3CPWO 2IX7C 2A45I 3GHGC 3EFGA 2KSJA 1IK7A 1BCCE 1JM0A 1U7MA 3BCCG 5AW9B 3AE7C 4DZOA 3WU2E 3CX5I 3DQYA 4JYBA 1R5LA 3CI9A 3BCCE 2E4PA 1JY2P 5H2FE 1JOCA 2YIUB 3II6A 3C1LA 2Z5IA 5GTIE 3JCUE 3R4YA 1T3JA 5EFWB 1PP9D 3M9HA 3H1IJ 3RGUA 3RL0C 2DE6D 2UWJE 3VTPC 2KIKA 2ZYLA 2Y0DA 4NBHD 2P58A 3AE6C 2D2CD 3G71P 1DX7A 2LR2A 3HTKB 1PP9G 1Q81Q 2OYIB 1NTKK 3WU2H 2VRSA 2K9JB 2YMKA 2C9NY 1M57D 5TISE 2L5GB 2OTKE 1PP9E 3V2PA 1O7WA 2AEMA 1BE3J 5KJ7A 1FDOA 4RKUJ 5H2FH 1RE4A 2WSSH 5GTIH 3JCUH 1SS1A 1NTKG 2NVGA 1KYOD 5AVRB 2FYUD 4HM4A 2B9BA 2XNXA 3V6IA 3PJSK 5APUA 5KAIE 1NOHA 4RJTA 2AEFA 4W7ZA 1FJKA 3HD7B 1MFTA 3CCMP 1IJDB 2IBZD 2FYUG 3VP8A 5AVXB 5B5EE 1W2EA 3GZXA 1Q82Q 1X9VA 5TISH 1KILC 1KYOE 2FYUE 1ZW0A 3AE2C 2YIUC 2IBZG 3RK2C 1QVFO 1FDIA 4I2LC 2RKLA 1PV3A 2IBZE 1SFCA 2E76D 3C9IA 4H13D 3FOUA 5CCGD 5KAIH 1NVOA 4I6MC 2B87A 5AVYB 2OYIC 2MJZA 4A7PA 2YKPA 5B5EH 4ZKPA 1VQ5P 1KZUB 5B66E 1MFZA 3TK1A 1KYOH 2E74C 3IN6A 4ZMDA 4H0LD 4IFFA 5CCHA 1U7JA 4OVNF 3AE1C 5AVZB 2N1TA 4PD4D 3P7KA 3GLMA 5AW1B 1M8OB 2JP3A 3HD7C 2PRRA 1VM9A 1CW5A 2WZ7A 2IYOA 2AXTE 3AEBC 1MKMA 1FS0E 3U1AA 2HMOA 2Q5UA 1DEBA 4OH8B 1RE3A 4PD4E 5APXA 5B66H 4I1LA 3AEGC 3S1KA 5AW2B 1IFJA 5AW4B 3MHVA 1HWTC 2JZAA 3M91A 2FXPA 1VF5B 3G9RA 5AVUB 1LT9A 4EYYQ 3A0HE 1CI6A 2XU6A 1HJBA 1XTCC 4CPGA 3MGNA 1SQVE 2AXTH 4D6TJ 3B5NA 3Q3DA 2O01H 4HM6A 3N4XA 1G8JB 2BMRA 5E79E 1EDLA 2H89C 4NBGD 4PD4H 1KQSO 2M3EA 1VQNP 2P7JA 3AEEC 1KB9D 3FGAD 1BGYD 3LIEA 1KQGB 3I5CA 1QL1A 2R44A 3TGUD 1PZQA 2LXCB 3BATA 1J2JB 4N78D 3A0HH 1ZN5A 3E1IA 3L75J 1M1JA 3T97A 3V2RA 3CCSP 1VQ6P 2XSHA 3CCEP 3Q1MA 2M5AB 1YHQP 1KB9E 4YXDC 3OJAB 1VDFA 1BGYE 5E79H 3WUTA 4EI2A 1MUUA 3TGUE 1FBMA 2KS1B 4N78E 1KORA 4WB4A 1O7NA 1FZAA 2HR3A 1VF5C 1NTMJ 2V7QH 4OWFA 2OTLP 1SFCB 3CCRP 1SQQK 1O7HA 3LW5H 3KDPB 2ZT9D 1N7SA 3H32A 2B87B 3GHGA 3H1LJ 3CX5E 1ZXGA 1KB9H 2IPPA 3EFFK 2KNCB 2DE7D 1T2KD 4OGQD 1SQQG 5KJ7C 2Q1KA 1RE4C 3V2QA 2FXMA 1T3UA 2ZYDA 1NTZD 4IFMA 3HUSA 2QPZA 1K05A 3D70A 1L0NK 3SFEC 3VCAA 2N1TB 2OYHC 1L0ND 2A45H 2Y9YA 5APYA 1LTGC 2BMQA 1NTZG 3CCUP 2C0XA 2FYNB 3L72G 3CX5H 3H1HG 3VMGD 1L0NG 1NTZE 3GF7A 1GU5A 1MV8A 3L70J 4NBDD 1L0NE 3E1RA 4YXWH 1RQVA 1HTLC 5KLVK 1VQKP 4HKZH 3MD0A 2JR8A 5KLVD 3D89A 5CBOA 1LT9B 4GDOA 1N2DC 2QJPB 3EQQA 1PIXA 1CI6B 5KLIC 3NTNA 3M0AA 1H8AA 5KLVG 4EDFA 1JO5A 3Q2YA 3MUDA 4JBZA 3AE8C 1IFPA 5KLVE 1YIJP 3CCVP 1KILA 2YFJA 5CCHC 3IR9A 1S4XA 5AVTB 4YPCA 2XNDH 3VMAA 2BCCJ 5BU5A 2WPQA 4GOFA 1HGZA 2FYNC 1M1JB 3T97B 2NVFA 3HRNA 2POHA 4IL6E 4R4LA 1RE3C 3VMZA 1KQLA 3GL2A 4GT1A 3MZWB 1U57A 2HYNA 3IF4A 3GTSA 3GF3A 1SQXK 3PRJA 2DW3A 3L71D 1JEKA 4EIJA 3V2NA 3CD6P 1W2BO 5CBNA 1LT9C 1N8RQ 2ZJSE 2QJPC 3AEDC 3U59A 2NUKA 4TLFA 2M8RA 2W6AA 2NWFA 3TF5A 3AE4C 1N7SB 1YITP 1SQXG 3L71G 2KP8A 3H32B 3GHGB 5CXMA 1LNQA 1L0LJ 1PFIA 4IL6H 2E43A 1LTJB 3L71E 1OW6A 5AW8B 3H1KE 3L73D 2XZRA 2G3AA 3A5TA 1EDIA 5AW0B 3SWKA 3A2AA 3HUSB 2WSFH 1Z56A 2H7HA 3PTZA 2C9LY 1EC5A 3RL0B 4R4MA 2OQQA 4IFDK 3GB4A 4IOIH 3L73E 4AIVA 3OA7A 1YQ4C 4N6JA 1GTWA 1OX3A 4ASVA 3HD7D 1GW4A 3RBXA 3SFDC 2XSOA 3RK3C 1ZV8A 1SQPD 2SPZA 2LKMA 2LXBA 1T8ZA 1IC2A 2V4HA 1G1IA 1NU1J 1X22A 1SQBD 1PGQA 1N7SC 1UUWA 2B89A 1RH5B 1LTJC 3FWLA 1IFNA 1VQ7P 3AECC 1VL2A 2GUSA 4W7YA 1SQPE 5APTA 1KILB 1JY3N 1FQTA 2ZXXA 3CMAP 1NWQA 1CSBA 1SQBE 2E75B 2HMNA 3PHLA 3F5HA 3HUSC 1YJ9P 2NVEA 3RK2B 2H43A 3GG2A 2P10A 1FU1A 1RF0C 2Q3EA 1KV4A 2Y0CA 3O6QA 1H88A 2RMZA 2O3JA 1WQLA 2E4QA 3USSA 4QURA 2IYPA 3EQ2A 3WUVA 3VP9A 3D71A 4L73A 4NBED 1JUNA 1X8YA 1NH4A 2E74B 1NAYA 2M0BA 5KKZC 4BWNA 4HKVA 1L4AA 3H1JD 2GBXA 2NRGA 3OW2O 2FYUK 1R8EA 3AZCA 1NTKJ 1S9KE 2WITA 4C7NA 2IZ0A 1URQA 2OYHA 2WVRA 3L4FA 5AVSB 1K8AQ 3H1JG 2KZJA 1PPJD 2HMLA 1KFMA 3MUDC 1VQPP 2M5AA 1GMJA 1X0TA 1BE3E 4LLHA 2FYUJ 3H1JE 1VF5D 1M90Q 2P67A 2ZAEB 2E75C 2KS1A 1LTTC 1HJ0A 2PP6A 3VYIA 2M3BA 2KSEA 3AE9C 2HG5D 1PPJE 1JY2O 3F89A 1AQTA 2G8YA 1JM1A 3HE5A 2QEXP 3Q5SA 2OARA 2YXRB 3KZIE 1J1DB 5KJ7D 5DJTB 4BRYB 1SP4A 2KLVA 1EZVI 2KNCA 4L74A 2WSEH 3AE3C 2W83C 1LJ2A 4WY4A 1G2CA 1K9MQ 2PAJA 2R5DA 2H8PD 3FWNA 3H6PA 3M06A 2Q3IA 2E5TA 2YFIA 1H89A 4H44B 2J5UA 3KZIH 1QL2A 2O01J 2KB7P 2OTJP 2WSCH 2IFNA 1NJIQ 1UIXA 5CHXA 2JO1A 3L35A 2NZ2A 3Q5RA 4HJLA 1NYHA 1SFCD 1YJWP 3S4RA 3W67A 1SQVK 1SQVD 4TT3H 5AVQB 2Q3WA 2OYOA 5AW7B 2N9BA 1SQVG 1J1DC 3O6QB 2WMMA 4RO0A 3EN1A 4PV1D 2KOGA 3BRTB 3G3ZA 2B24A 3KYQA 5CCHD 1NYKA 1OVUA 1UUVA 2N1TD
chains in the Genus database with same CATH topology
4NBDD 3EWKA 1L0NE 1HF9A 1RQVA 2V7QJ 2I7FA 4OGQC 4IL6X 5L8RJ 1NTKE 3D89A 1OW8A 1KQFB 3VMID 4GDOA 1SJGA 1EXIA 3EQQA 1ULJA 4P1CH 5HL4A 1PIXA 3ABVC 5KLIC 4H44C 2WSCJ 3GL0A 3Q2YA 3AE8C 5KLVE 4HM3A 2YVJB 2YFJA 1ZMEC 2A06E 1IK7A 5M1BA 1BCCE 1RFSA 2FYNC 3T97B 3AE7C 3GKEA 2NVFA 5AEUA 3DQYA 3BCCE 2D2CB 4R4LA 2E4PA 1ZOYC 4AAYB 3GZYA 3GL2A 1U57A 1Y9BA 2B1XA 3GTSA 3GF3A 3R4YA 3CWBE 2YFLA 4KT0J 4QUPA 1RIEA 2DE6D 4HM5A 2ZYLA 2QJPC 3AEDC 4NBHD 1O7GA 4H13C 2NUKA 3AE6C 2D2CD 2DE5D 2NUMA 3H1LE 2GBWA 4NBCD 2NWFA 3AE4C 5CXMA 2YMKA 3GCEA 1PP9E 1O7WA 3L71E 1K04A 1OW6A 3H1KE 3AE5C 2HMMA 1FDOA 4NBAD 4I7ZB 1OW7A 4RKUJ 4QDFA 2G3AA 1OMIA 2NVGA 2QJYC 4HM4A 2CKFA 3VCPA 3C0DA 1Q90D 3Q5PA 2XR8A 4R4MA 1ZRTE 2OQQA 3LW5J 3GB4A 4H13B 2E76B 3L73E 4AIVA 2H88C 3AEAC 3GZXA 4HM0A 1YQ4C 2D2CC 3L70E 1KYOE 3AE2C 2FYUE 1DIPA 2WPVB 2YIUC 2HMKA 4XFJA 4YTPC 4Y28J 2XSOA 3SFDC 1FDIA 1PV3A 2IBZE 4H13D 2E76D 3RL0g 3IAOA 4H0LB 3FOUA 1PL5A 3GOBA 3L75E 1DD3A 2HMJA 1UUWA 1Q90C 1EZVE 4HM1A 3AECC 1VL2A 4I7ZC 2E74C 3IN6A 1SQPE 4H0LD 1FQTA 3AE1C 1NGMB 1KMIZ 2E75B 1SQBE 2HMNA 2NVEA 1AJYA 1NTME 4Z1MH 2P10A 3GLMA 2JP3A 4NBFD 1VM9A 1ZP0C 3O6QA 1WQLA 2E76C 2E4QA 3L74E 3AEBC 1MKMA 2HMOA 1S5LX 4QURA 1YQ3C 3B71A 4PV1B 3D71A 4HM7A 4PD4E 3AEGC 4NBED 1SQQE 4U3FE 4P1BH 4QDDA 1KTMA 2E74B 1DD4A 5KKZC 4HKVA 2JZAA 2GBXA 4NB8D 2WQYC 2FXPA 1VF5B 3G9RA 1R8EA 3AZCA 1KILE 4H0LC 1RQUA 4NB9D 1SQVE 1O7PA 1G8KB 2ZT9C 3Q3DA 2HMLA 2QIWA 3RK3E 3L72E 4HM6A 1G8JB 2BMRA 2MKVA 2E74D 1GMJA 3H1HE 1BE3E 4QUQA 3H1JE 3CXHE 2H89C 4NBGD 1VF5D 4HM2A 4QDCA 3AEEC 4QDFB 3FGAD 2E75C 2JO6A 3C8VA 1HJ0A 1KQGB 1P84E 2QSIA 3AE9C 3AEFC 1PPJE 3N0QA 2G8YA 1JM1A 3Q5SA 2IDBA 2QJKC 3S9OA 2XSHA 3Q1MA 1ULIA 2BEZF 1KB9E 4YXDC 4PV1C 3D6ZA 2ZT9B 3TGUE 3AE3C 1KORA 1JB0J 1O7MA 1O7NA 1VF5C 4OGQB 3H25A 1NU1E 4U7JA 2WSFJ 4EMJB 1O7HA 4HM8A 2ZT9D 2BCCE 2YFIA 4H44B 2J5UA 1S1CX 2O01J 3CX5E 1UIXA 2JO1A 2DE7D 1TU3F 1WMKA 3GMAA 2NZ2A 5BOKA 4OGQD 3Q5RA 4NBBD 4HJLA 1NYHA 2E75D 2FBWC 3VMHD 4QCKA 2K9YA 2BMOA 1EG9A 2QPZA 4H44D 1K05A 3D70A 3SFEC 3VCAA 2BEQD 1EXJA 3H1IE 4TT3H 3D6YA 2Q3WA 2XRXA 2BMQA 3EN1A 4PV1D 1VCKA 2B24A 1SQXE 3VMGD 1NDOA 1NYKA 5AEWA 1L0LE 1NTZE 3GF7A 1UUVA 3GTEA 2WSEJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H13 C;  4I7Z C;  2NUK A;  4NBD D;  2DE5 D;  2E74 C;  2D2C D;  1JM1 A;  2NUM A;  1SQP E;  1L0N E;  4H0L D;  3H1L E;  2QJK C;  2GBW A;  4NBC D;  2NWF A;  2XSH A;  1FQT A;  1ULI A;  5CXM A;  1SQB E;  2HMN A;  1KB9 E;  2I7F A;  2NVE A;  4OGQ C;  1NTK E;  2YMK A;  3D89 A;  4PV1 C;  3GCE A;  1NTM E;  3VMI D;  1PP9 E;  1O7W A;  3L71 E;  1SJG A;  3EQQ A;  3H1K E;  1ULJ A;  4NBF D;  2HMM A;  4NBA D;  4P1C H;  5HL4 A;  1VM9 A;  3TGU E;  4QDF A;  5KLI C;  4H44 C;  4NBH D;  1WQL A;  2E76 C;  2E4Q A;  3L74 E;  1O7M A;  1O7N A;  2NVG A;  3GL0 A;  2QJY C;  4HM4 A;  2CKF A;  2HMO A;  1VF5 C;  4QUR A;  3VCP A;  1NU1 E;  5KLV E;  4HM3 A;  3C0D A;  4HM7 A;  4PD4 E;  2YVJ B;  4EMJ B;  1O7H A;  4HM8 A;  4NBE D;  1SQQ E;  2XR8 A;  2YFJ A;  1ZRT E;  2ZT9 D;  4U3F E;  4P1B H;  2BCC E;  3GB4 A;  2YFI A;  4QDD A;  3L73 E;  3CX5 E;  4HKV A;  4AIV A;  5KKZ C;  2JZA A;  2GBX A;  4NB8 D;  3GZX A;  4HM0 A;  2DE7 D;  2D2C C;  3L70 E;  3AZC A;  4H0L C;  1KYO E;  5BOK A;  2FYU E;  4OGQ D;  4NBB D;  4HJL A;  2A06 E;  2E75 D;  2YIU C;  3VMH D;  4QCK A;  2HMK A;  1BCC E;  1RFS A;  4NB9 D;  2FYN C;  2XSO A;  2BMO A;  3GKE A;  1SQV E;  1EG9 A;  1O7P A;  1G8K B;  2NVF A;  2ZT9 C;  2QPZ A;  2HML A;  5AEU A;  3DQY A;  4H44 D;  2IBZ E;  3L72 E;  4HM6 A;  4H13 D;  2E76 D;  3VCA A;  1G8J B;  2BMR A;  2E74 D;  3BCC E;  3H1H E;  1BE3 E;  3H1I E;  2E4P A;  4QUQ A;  3H1J E;  3FOU A;  3CXH E;  4AAY B;  4NBG D;  1VF5 D;  2Q3W A;  2XRX A;  3GZY A;  3GL2 A;  4HM2 A;  4QDC A;  2BMQ A;  3GOB A;  4QDF B;  2B1X A;  3GTS A;  3L75 E;  3EN1 A;  4PV1 D;  2E75 C;  1VCK A;  2HMJ A;  2YFL A;  3CWB E;  2JO6 A;  4QUP A;  2B24 A;  1SQX E;  3VMG D;  1P84 E;  1UUW A;  1NDO A;  1NYK A;  5AEW A;  1L0L E;  1NTZ E;  1Q90 C;  1UUV A;  1RIE A;  3GTE A;  1EZV E;  2DE6 D;  4HM1 A;  4HM5 A;  1PPJ E;  2ZYL A;  2QJP C;  3N0Q A;  1O7G A; 
#chains in the Genus database with same CATH topology
 3CXH I;  4NPD A;  1L2P A;  1HF9 A;  2V7Q J;  1GDT A;  1HBW A;  5C39 A;  1L4A B;  2R32 A;  1AFO A;  1P84 I;  1OW8 A;  3VMI D;  3CLQ A;  4GOD A;  1SJG A;  1EXI A;  5HL4 A;  4C7N B;  1LGH B;  1URQ B;  3ABV C;  2OYH B;  3LID A;  4H44 C;  4NPE A;  2KK7 A;  3SSU A;  1IFM A;  2ZYG A;  4GKG A;  1BGY G;  1SLQ A;  2A06 D;  4M3L A;  2KUB A;  3TGU G;  2HLO A;  2YVJ B;  3GW6 A;  1OZH A;  3A0B E;  1H0T A;  3CX5 D;  2A06 G;  2A45 G;  2QJY B;  1Q2N A;  1ZME C;  1N86 A;  3B5N D;  2A06 E;  1E5W A;  3CWB D;  3NFQ A;  5M1B A;  1RFS A;  3HE5 B;  4AQR D;  5AEU A;  5KLI B;  1GK6 A;  2IFM A;  3L74 J;  1A02 J;  2GM4 A;  3H1L D;  3CWB G;  1LTJ A;  3GZY A;  2FFD B;  3V4W A;  1S3J A;  1Y9B A;  2YKO A;  1SQQ J;  4WY4 B;  4Y99 B;  3A0B H;  3CWB E;  1JY3 P;  1LTB C;  1G2C B;  4KT0 J;  1NTZ K;  2I1J A;  1L4A C;  1QX8 A;  5DJU B;  1EDK A;  1E79 H;  1O7G A;  4H13 C;  1AV1 A;  1URQ C;  2DE5 D;  1N7L A;  3BAS A;  3I56 P;  1RF0 A;  3H1L E;  3A7O A;  5CCG C;  4NBC D;  3U1C A;  1NTZ J;  1OVV A;  4AYC A;  1NAF A;  1NKZ B;  3L72 J;  3H1H J;  1SVF A;  2HMM A;  1L0N J;  4I7Z B;  1OW7 A;  1S72 P;  4QDF A;  1OMI A;  2Z4E A;  2ZVN B;  1R5S A;  2YKQ A;  2QJY C;  2CKF A;  1N7S D;  1QLE D;  1DEE G;  1VQL P;  3VCP A;  4HYT B;  3C0D A;  2GA1 A;  1GL2 A;  3VN0 A;  3Q5P A;  3M0D A;  3BRV B;  2RH0 A;  2W27 A;  3O8Z A;  1K73 Q;  1VQ8 P;  4HM0 A;  3L70 E;  5KLV J;  1AVO A;  1YJN P;  1FZG A;  1DIP A;  3QH9 A;  3QWO C;  2FFD C;  4MN4 C;  1JMM A;  1LP1 A;  5AVV B;  1WRG A;  4WY4 C;  4Y99 C;  4Y28 J;  3RL0 D;  1EZV D;  3RL0 g;  4DOJ A;  1PL5 A;  2O1J A;  3HE4 A;  3GOB A;  2QRX A;  5BU8 B;  2C0W A;  1RF1 A;  1Q90 C;  4C7R A;  1EZV E;  4HM1 A;  1OXZ A;  3TYY A;  2Q6Q A;  4I7Z C;  1XTG B;  4UB8 E;  2W6B A;  1H0T B;  1RHZ B;  1AJY A;  4Z1M H;  2WTY A;  4U3F D;  3H1K D;  3RK3 B;  4NBF D;  2P1J A;  4WVZ A;  1EQ7 A;  2P2U A;  3P32 A;  2K37 A;  1KIL D;  2YO2 A;  1S5L X;  3CCQ P;  4U3F G;  1YQ3 C;  1SQX J;  3L71 J;  3H1K G;  3RK2 D;  3KXD A;  4HM7 A;  2Q7C A;  2B88 A;  4U3F E;  4UB8 H;  2Q9I A;  2NPS A;  3FX0 A;  5AVW B;  1KTM A;  1M1K Q;  1DD4 A;  2CPB A;  1N73 A;  3CXH D;  4NB8 D;  2WQY C;  3I55 P;  1KIL E;  2QA4 P;  1KC8 Q;  3V5B A;  3L73 G;  3MTU E;  1P84 D;  2XV5 A;  3WUU A;  4C46 A;  1G8K B;  2ZT9 C;  2JWA A;  1ZR2 A;  2QIW A;  4BXL A;  1OIP A;  2J58 A;  2E74 D;  4QUQ A;  3CL3 D;  4BRY A;  3CXH E;  2KZI A;  1YTZ T;  2HFE D;  2PFX A;  4QDF B;  3ZDM A;  3FXD A;  5AW3 B;  2JWD A;  1P84 E;  1OFC X;  5KKZ B;  3TNU A;  1LT1 A;  1SQP K;  1S2E A;  3N0Q A;  3FXE A;  5KTB A;  3E7K A;  1GL2 B;  2IDB A;  2QJK C;  4XA4 A;  3S9O A;  1SQB K;  1FZF A;  1BCC J;  2BEZ F;  2KI7 B;  3V4Q A;  3D6Z A;  3BCC J;  1SQP G;  3CXH H;  1QEX A;  5CMZ A;  1LP1 B;  1SQB G;  1JB0 J;  1O7M A;  4JQ0 D;  3PLN A;  4N3Y B;  1P84 H;  1KFN A;  5K5G B;  3B4S A;  1NU1 E;  4L75 A;  4U7J A;  4EMJ B;  2R3C A;  4HM8 A;  3HE4 B;  2CK3 H;  4QMA A;  1S1C X;  4B86 A;  2R5B A;  3H1I D;  3PH0 A;  1RF1 B;  4XE5 B;  3M9B A;  4HH2 A;  1WMK A;  1S9K D;  5BOK A;  1CZQ A;  1OWA A;  1PP9 J;  3VMH D;  4QCK A;  3H1I G;  2BMO A;  1FDM A;  2N9Y B;  4H44 D;  2BEQ D;  3B8E B;  3H1I E;  1BE3 D;  2AXC A;  4NPF X;  1EXJ A;  4WWI A;  1GK4 A;  3L36 A;  4UB6 E;  2W90 A;  1GL2 C;  3M0D C;  5APV A;  1NTK D;  1IFI A;  3VMY A;  1JTH A;  1Q86 Q;  5CCG A;  2XDJ A;  1BE3 G;  1NDO A;  1UII A;  5AEW A;  3H1J J;  2WSE J;  3EWK A;  2O01 N;  5APQ A;  2NPS B;  1NTK E;  1N73 B;  1PPJ G;  1KQF B;  2L91 A;  1USE A;  1PGO A;  4P1C H;  1KD1 Q;  4UB6 H;  3R2P A;  1J1E B;  2HOD A;  3L37 A;  2WSC J;  4HJG H;  3GL0 A;  1RF1 C;  1BDD A;  3NXS A;  2ITA A;  1JNM A;  2HPC A;  2W8Z A;  4HM3 A;  1L4A D;  1YI2 P;  2WT7 A;  1AVY A;  3KPE A;  2FFD A;  1LTS C;  2E42 A;  1URQ D;  5TJH A;  1JCD A;  3SWF A;  1NHL A;  1LWU A;  3TNU B;  1LTI C;  1USD A;  3RBZ A;  1VQ4 P;  2R3S A;  3GKE A;  2QE7 H;  2JKV A;  2D2C B;  3CCJ P;  1ZOY C;  4AAY B;  4ZKU A;  1BDC A;  1OVR A;  4RES B;  4KJM A;  2B1X A;  2NPS C;  2YFL A;  4QUP A;  1JMB A;  2OGU A;  1N73 C;  1A02 F;  3CC2 P;  1RIE A;  1BSN A;  4HM5 A;  4EOT A;  4DT0 A;  2NUM A;  1J1E C;  2GBW A;  5KAF E;  2O1K A;  3W68 A;  1D7M A;  4WY4 D;  1SQV J;  3GCE A;  1ZRT D;  1K04 A;  1PGP A;  3AE5 C;  4NBA D;  1FOS F;  1Y47 A;  5AW6 B;  3TDK A;  1HVV A;  4D6T D;  4LC1 A;  3JSV C;  2JJL A;  1JCC A;  3SWY A;  2QVA A;  1Q90 D;  4D6T G;  2XR8 A;  1FZC A;  1ZRT E;  3LW5 J;  2KYV A;  5BVZ A;  2WPR A;  4H13 B;  2E76 B;  5KAF H;  2H88 C;  4AUW A;  4D6T E;  1JTH B;  3AEA C;  2I1K A;  2D2C C;  1M56 D;  3L75 D;  1IZN B;  1BGY J;  2WPV B;  4JF7 A;  2HMK A;  4XFJ A;  1YBK A;  3TGU J;  4YTP C;  4K3A A;  1FJP A;  3CME P;  1KN7 A;  3IAO A;  3L75 G;  4ASW A;  4H0L B;  4K35 A;  2W6J H;  1LTA C;  2KXP B;  3L75 E;  1NTM K;  1DD3 A;  1PGJ A;  3IFM A;  2HOD B;  1NTM D;  2HMJ A;  4DJG A;  1GD2 E;  2K1A A;  4WBA A;  3CC4 P;  4KHX A;  1JY2 N;  2FY8 A;  1HUC A;  2HPC B;  1MZ9 A;  1VPC A;  4PJ0 E;  2WPS A;  3L74 D;  2WT7 B;  1NTM G;  3CWB J;  3N7N A;  2YMY A;  1NGM B;  1KMI Z;  5APW A;  2PGD A;  5GTH E;  2ZXE B;  1NTM E;  1SQQ D;  3L74 G;  2Y9Z A;  3H1L G;  1LWU B;  1ZP0 C;  2YNY A;  1IK9 A;  2E76 C;  3L74 E;  2QG4 A;  2K3R A;  2CPS A;  3B71 A;  1FE6 A;  4PV1 B;  1NKN A;  4PJ0 H;  1SQQ E;  1QVG O;  2YXQ B;  3NMD A;  4P1B H;  3RK3 D;  3L72 D;  4QDD A;  3H1H D;  4O9B A;  4GIF A;  2WWW A;  2XKM A;  2E5Y A;  3L70 D;  5GTH H;  4H0L C;  1FOS E;  2Z5H A;  2FKW B;  1RQU A;  4GOE A;  2FXO A;  4NB9 D;  1RY3 A;  4JYC A;  1O7P A;  1M7L A;  3L70 G;  1FC2 C;  1WT6 A;  3RK3 E;  3L72 E;  2MKV A;  3H1H E;  1KYO I;  2IZ1 A;  1QGK B;  4HM2 A;  4QDC A;  1VQO P;  2GUV A;  3KQG A;  1SFC C;  2JO6 A;  3C8V A;  1FZB A;  1Y8A A;  2QSI A;  2IBZ I;  1S5L E;  3AEF C;  1FZE A;  1LWU C;  2K88 A;  1IO4 A;  2JDI H;  1VQ9 P;  1FZC B;  3B5N B;  2AEJ A;  1JY3 O;  1ULI A;  1ZR4 A;  1EZV G;  3G4S P;  1X79 B;  4PV1 C;  3A3Y B;  3UIA A;  4LGD E;  2ZT9 B;  2BCC D;  1YYC A;  3P8C D;  3KHU A;  5CJ0 A;  2N1T C;  1HH0 A;  3MIW A;  1GW3 A;  1GL2 D;  1IFD A;  3OAK A;  1BSH A;  5APS A;  1NO4 A;  4OGQ B;  4ZNC A;  4W80 A;  2BCC G;  3H25 A;  1S5L H;  3ITK A;  5CJ4 A;  2WSF J;  3K5B A;  1YTZ I;  3HTK A;  1DH3 A;  1AA0 A;  2OYI A;  2BCC E;  4JPZ B;  3P8C E;  3VOP A;  1AQ5 A;  3BVH A;  1GU4 A;  2K9J A;  2QJK B;  4DCK A;  1TU3 F;  3GMA A;  2ZVO B;  4NBB D;  4PD4 I;  2E75 D;  4U3F J;  2FBW C;  1L0L K;  3H1K J;  1SQX D;  2K9Y A;  3MP7 B;  1L0L D;  3TSI A;  3PP5 A;  2JEE A;  1EG9 A;  3G6E P;  1G1J A;  2QM7 A;  1T6A A;  3D6Y A;  2ZYA A;  3HD7 A;  2XRX A;  1L0L G;  1FZC C;  3WMM 0;  3B5N C;  1VCK A;  1SQX E;  3L73 J;  3JC2 2;  1L0L E;  2J59 M;  3GTE A;  2FYZ A;  1GZL A;  3CCL P;  1EDJ A;  3VMX A;  2RN0 A;  1Q7Y Q;  1T2K C;  2I7F A;  4OGQ C;  4IL6 X;  5L8R J;  2YO3 A;  2KLU A;  3M9Q A;  1VQM P;  1ULJ A;  1M1J C;  1ZLL A;  3P8M C;  1FAV A;  5AW5 B;  1HGV A;  1KB9 I;  1NU1 K;  2NPS D;  2QM8 A;  1NU1 D;  1BCC D;  2BAS A;  4HB1 A;  2Y0E A;  1W5C E;  4L76 A;  2ZFC A;  1SQP J;  3BCC D;  3CC7 P;  1SQB J;  1NU1 G;  1BCC G;  2I8D A;  3CPW O;  2IX7 C;  2A45 I;  3GHG C;  3EFG A;  2KSJ A;  1IK7 A;  1BCC E;  1JM0 A;  1U7M A;  3BCC G;  5AW9 B;  3AE7 C;  4DZO A;  3WU2 E;  3CX5 I;  3DQY A;  4JYB A;  1R5L A;  3CI9 A;  3BCC E;  2E4P A;  1JY2 P;  5H2F E;  1JOC A;  2YIU B;  3II6 A;  3C1L A;  2Z5I A;  5GTI E;  3JCU E;  3R4Y A;  1T3J A;  5EFW B;  1PP9 D;  3M9H A;  3H1I J;  3RGU A;  3RL0 C;  2DE6 D;  2UWJ E;  3VTP C;  2KIK A;  2ZYL A;  2Y0D A;  4NBH D;  2P58 A;  3AE6 C;  2D2C D;  3G71 P;  1DX7 A;  2LR2 A;  3HTK B;  1PP9 G;  1Q81 Q;  2OYI B;  1NTK K;  3WU2 H;  2VRS A;  2K9J B;  2YMK A;  2C9N Y;  1M57 D;  5TIS E;  2L5G B;  2OTK E;  1PP9 E;  3V2P A;  1O7W A;  2AEM A;  1BE3 J;  5KJ7 A;  1FDO A;  4RKU J;  5H2F H;  1RE4 A;  2WSS H;  5GTI H;  3JCU H;  1SS1 A;  1NTK G;  2NVG A;  1KYO D;  5AVR B;  2FYU D;  4HM4 A;  2B9B A;  2XNX A;  3V6I A;  3PJS K;  5APU A;  5KAI E;  1NOH A;  4RJT A;  2AEF A;  4W7Z A;  1FJK A;  3HD7 B;  1MFT A;  3CCM P;  1IJD B;  2IBZ D;  2FYU G;  3VP8 A;  5AVX B;  5B5E E;  1W2E A;  3GZX A;  1Q82 Q;  1X9V A;  5TIS H;  1KIL C;  1KYO E;  2FYU E;  1ZW0 A;  3AE2 C;  2YIU C;  2IBZ G;  3RK2 C;  1QVF O;  1FDI A;  4I2L C;  2RKL A;  1PV3 A;  2IBZ E;  1SFC A;  2E76 D;  3C9I A;  4H13 D;  3FOU A;  5CCG D;  5KAI H;  1NVO A;  4I6M C;  2B87 A;  5AVY B;  2OYI C;  2MJZ A;  4A7P A;  2YKP A;  5B5E H;  4ZKP A;  1VQ5 P;  1KZU B;  5B66 E;  1MFZ A;  3TK1 A;  1KYO H;  2E74 C;  3IN6 A;  4ZMD A;  4H0L D;  4IFF A;  5CCH A;  1U7J A;  4OVN F;  3AE1 C;  5AVZ B;  2N1T A;  4PD4 D;  3P7K A;  3GLM A;  5AW1 B;  1M8O B;  2JP3 A;  3HD7 C;  2PRR A;  1VM9 A;  1CW5 A;  2WZ7 A;  2IYO A;  2AXT E;  3AEB C;  1MKM A;  1FS0 E;  3U1A A;  2HMO A;  2Q5U A;  1DEB A;  4OH8 B;  1RE3 A;  4PD4 E;  5APX A;  5B66 H;  4I1L A;  3AEG C;  3S1K A;  5AW2 B;  1IFJ A;  5AW4 B;  3MHV A;  1HWT C;  2JZA A;  3M91 A;  2FXP A;  1VF5 B;  3G9R A;  5AVU B;  1LT9 A;  4EYY Q;  3A0H E;  1CI6 A;  2XU6 A;  1HJB A;  1XTC C;  4CPG A;  3MGN A;  1SQV E;  2AXT H;  4D6T J;  3B5N A;  3Q3D A;  2O01 H;  4HM6 A;  3N4X A;  1G8J B;  2BMR A;  5E79 E;  1EDL A;  2H89 C;  4NBG D;  4PD4 H;  1KQS O;  2M3E A;  1VQN P;  2P7J A;  3AEE C;  1KB9 D;  3FGA D;  1BGY D;  3LIE A;  1KQG B;  3I5C A;  1QL1 A;  2R44 A;  3TGU D;  1PZQ A;  2LXC B;  3BAT A;  1J2J B;  4N78 D;  3A0H H;  1ZN5 A;  3E1I A;  3L75 J;  1M1J A;  3T97 A;  3V2R A;  3CCS P;  1VQ6 P;  2XSH A;  3CCE P;  3Q1M A;  2M5A B;  1YHQ P;  1KB9 E;  4YXD C;  3OJA B;  1VDF A;  1BGY E;  5E79 H;  3WUT A;  4EI2 A;  1MUU A;  3TGU E;  1FBM A;  2KS1 B;  4N78 E;  1KOR A;  4WB4 A;  1O7N A;  1FZA A;  2HR3 A;  1VF5 C;  1NTM J;  2V7Q H;  4OWF A;  2OTL P;  1SFC B;  3CCR P;  1SQQ K;  1O7H A;  3LW5 H;  3KDP B;  2ZT9 D;  1N7S A;  3H32 A;  2B87 B;  3GHG A;  3H1L J;  3CX5 E;  1ZXG A;  1KB9 H;  2IPP A;  3EFF K;  2KNC B;  2DE7 D;  1T2K D;  4OGQ D;  1SQQ G;  5KJ7 C;  2Q1K A;  1RE4 C;  3V2Q A;  2FXM A;  1T3U A;  2ZYD A;  1NTZ D;  4IFM A;  3HUS A;  2QPZ A;  1K05 A;  3D70 A;  1L0N K;  3SFE C;  3VCA A;  2N1T B;  2OYH C;  1L0N D;  2A45 H;  2Y9Y A;  5APY A;  1LTG C;  2BMQ A;  1NTZ G;  3CCU P;  2C0X A;  2FYN B;  3L72 G;  3CX5 H;  3H1H G;  3VMG D;  1L0N G;  1NTZ E;  3GF7 A;  1GU5 A;  1MV8 A;  3L70 J;  4NBD D;  1L0N E;  3E1R A;  4YXW H;  1RQV A;  1HTL C;  5KLV K;  1VQK P;  4HKZ H;  3MD0 A;  2JR8 A;  5KLV D;  3D89 A;  5CBO A;  1LT9 B;  4GDO A;  1N2D C;  2QJP B;  3EQQ A;  1PIX A;  1CI6 B;  5KLI C;  3NTN A;  3M0A A;  1H8A A;  5KLV G;  4EDF A;  1JO5 A;  3Q2Y A;  3MUD A;  4JBZ A;  3AE8 C;  1IFP A;  5KLV E;  1YIJ P;  3CCV P;  1KIL A;  2YFJ A;  5CCH C;  3IR9 A;  1S4X A;  5AVT B;  4YPC A;  2XND H;  3VMA A;  2BCC J;  5BU5 A;  2WPQ A;  4GOF A;  1HGZ A;  2FYN C;  1M1J B;  3T97 B;  2NVF A;  3HRN A;  2POH A;  4IL6 E;  4R4L A;  1RE3 C;  3VMZ A;  1KQL A;  3GL2 A;  4GT1 A;  3MZW B;  1U57 A;  2HYN A;  3IF4 A;  3GTS A;  3GF3 A;  1SQX K;  3PRJ A;  2DW3 A;  3L71 D;  1JEK A;  4EIJ A;  3V2N A;  3CD6 P;  1W2B O;  5CBN A;  1LT9 C;  1N8R Q;  2ZJS E;  2QJP C;  3AED C;  3U59 A;  2NUK A;  4TLF A;  2M8R A;  2W6A A;  2NWF A;  3TF5 A;  3AE4 C;  1N7S B;  1YIT P;  1SQX G;  3L71 G;  2KP8 A;  3H32 B;  3GHG B;  5CXM A;  1LNQ A;  1L0L J;  1PFI A;  4IL6 H;  2E43 A;  1LTJ B;  3L71 E;  1OW6 A;  5AW8 B;  3H1K E;  3L73 D;  2XZR A;  2G3A A;  3A5T A;  1EDI A;  5AW0 B;  3SWK A;  3A2A A;  3HUS B;  2WSF H;  1Z56 A;  2H7H A;  3PTZ A;  2C9L Y;  1EC5 A;  3RL0 B;  4R4M A;  2OQQ A;  4IFD K;  3GB4 A;  4IOI H;  3L73 E;  4AIV A;  3OA7 A;  1YQ4 C;  4N6J A;  1GTW A;  1OX3 A;  4ASV A;  3HD7 D;  1GW4 A;  3RBX A;  3SFD C;  2XSO A;  3RK3 C;  1ZV8 A;  1SQP D;  2SPZ A;  2LKM A;  2LXB A;  1T8Z A;  1IC2 A;  2V4H A;  1G1I A;  1NU1 J;  1X22 A;  1SQB D;  1PGQ A;  1N7S C;  1UUW A;  2B89 A;  1RH5 B;  1LTJ C;  3FWL A;  1IFN A;  1VQ7 P;  3AEC C;  1VL2 A;  2GUS A;  4W7Y A;  1SQP E;  5APT A;  1KIL B;  1JY3 N;  1FQT A;  2ZXX A;  3CMA P;  1NWQ A;  1CSB A;  1SQB E;  2E75 B;  2HMN A;  3PHL A;  3F5H A;  3HUS C;  1YJ9 P;  2NVE A;  3RK2 B;  2H43 A;  3GG2 A;  2P10 A;  1FU1 A;  1RF0 C;  2Q3E A;  1KV4 A;  2Y0C A;  3O6Q A;  1H88 A;  2RMZ A;  2O3J A;  1WQL A;  2E4Q A;  3USS A;  4QUR A;  2IYP A;  3EQ2 A;  3WUV A;  3VP9 A;  3D71 A;  4L73 A;  4NBE D;  1JUN A;  1X8Y A;  1NH4 A;  2E74 B;  1NAY A;  2M0B A;  5KKZ C;  4BWN A;  4HKV A;  1L4A A;  3H1J D;  2GBX A;  2NRG A;  3OW2 O;  2FYU K;  1R8E A;  3AZC A;  1NTK J;  1S9K E;  2WIT A;  4C7N A;  2IZ0 A;  1URQ A;  2OYH A;  2WVR A;  3L4F A;  5AVS B;  1K8A Q;  3H1J G;  2KZJ A;  1PPJ D;  2HML A;  1KFM A;  3MUD C;  1VQP P;  2M5A A;  1GMJ A;  1X0T A;  1BE3 E;  4LLH A;  2FYU J;  3H1J E;  1VF5 D;  1M90 Q;  2P67 A;  2ZAE B;  2E75 C;  2KS1 A;  1LTT C;  1HJ0 A;  2PP6 A;  3VYI A;  2M3B A;  2KSE A;  3AE9 C;  2HG5 D;  1PPJ E;  1JY2 O;  3F89 A;  1AQT A;  2G8Y A;  1JM1 A;  3HE5 A;  2QEX P;  3Q5S A;  2OAR A;  2YXR B;  3KZI E;  1J1D B;  5KJ7 D;  5DJT B;  4BRY B;  1SP4 A;  2KLV A;  1EZV I;  2KNC A;  4L74 A;  2WSE H;  3AE3 C;  2W83 C;  1LJ2 A;  4WY4 A;  1G2C A;  1K9M Q;  2PAJ A;  2R5D A;  2H8P D;  3FWN A;  3H6P A;  3M06 A;  2Q3I A;  2E5T A;  2YFI A;  1H89 A;  4H44 B;  2J5U A;  3KZI H;  1QL2 A;  2O01 J;  2KB7 P;  2OTJ P;  2WSC H;  2IFN A;  1NJI Q;  1UIX A;  5CHX A;  2JO1 A;  3L35 A;  2NZ2 A;  3Q5R A;  4HJL A;  1NYH A;  1SFC D;  1YJW P;  3S4R A;  3W67 A;  1SQV K;  1SQV D;  4TT3 H;  5AVQ B;  2Q3W A;  2OYO A;  5AW7 B;  2N9B A;  1SQV G;  1J1D C;  3O6Q B;  2WMM A;  4RO0 A;  3EN1 A;  4PV1 D;  2KOG A;  3BRT B;  3G3Z A;  2B24 A;  3KYQ A;  5CCH D;  1NYK A;  1OVU A;  1UUV A;  2N1T D; 
#chains in the Genus database with same CATH homology
 4NBD D;  3EWK A;  1L0N E;  1HF9 A;  1RQV A;  2V7Q J;  2I7F A;  4OGQ C;  4IL6 X;  5L8R J;  1NTK E;  3D89 A;  1OW8 A;  1KQF B;  3VMI D;  4GDO A;  1SJG A;  1EXI A;  3EQQ A;  1ULJ A;  4P1C H;  5HL4 A;  1PIX A;  3ABV C;  5KLI C;  4H44 C;  2WSC J;  3GL0 A;  3Q2Y A;  3AE8 C;  5KLV E;  4HM3 A;  2YVJ B;  2YFJ A;  1ZME C;  2A06 E;  1IK7 A;  5M1B A;  1BCC E;  1RFS A;  2FYN C;  3T97 B;  3AE7 C;  3GKE A;  2NVF A;  5AEU A;  3DQY A;  3BCC E;  2D2C B;  4R4L A;  2E4P A;  1ZOY C;  4AAY B;  3GZY A;  3GL2 A;  1U57 A;  1Y9B A;  2B1X A;  3GTS A;  3GF3 A;  3R4Y A;  3CWB E;  2YFL A;  4KT0 J;  4QUP A;  1RIE A;  2DE6 D;  4HM5 A;  2ZYL A;  2QJP C;  3AED C;  4NBH D;  1O7G A;  4H13 C;  2NUK A;  3AE6 C;  2D2C D;  2DE5 D;  2NUM A;  3H1L E;  2GBW A;  4NBC D;  2NWF A;  3AE4 C;  5CXM A;  2YMK A;  3GCE A;  1PP9 E;  1O7W A;  3L71 E;  1K04 A;  1OW6 A;  3H1K E;  3AE5 C;  2HMM A;  1FDO A;  4NBA D;  4I7Z B;  1OW7 A;  4RKU J;  4QDF A;  2G3A A;  1OMI A;  2NVG A;  2QJY C;  4HM4 A;  2CKF A;  3VCP A;  3C0D A;  1Q90 D;  3Q5P A;  2XR8 A;  4R4M A;  1ZRT E;  2OQQ A;  3LW5 J;  3GB4 A;  4H13 B;  2E76 B;  3L73 E;  4AIV A;  2H88 C;  3AEA C;  3GZX A;  4HM0 A;  1YQ4 C;  2D2C C;  3L70 E;  1KYO E;  3AE2 C;  2FYU E;  1DIP A;  2WPV B;  2YIU C;  2HMK A;  4XFJ A;  4YTP C;  4Y28 J;  2XSO A;  3SFD C;  1FDI A;  1PV3 A;  2IBZ E;  4H13 D;  2E76 D;  3RL0 g;  3IAO A;  4H0L B;  3FOU A;  1PL5 A;  3GOB A;  3L75 E;  1DD3 A;  2HMJ A;  1UUW A;  1Q90 C;  1EZV E;  4HM1 A;  3AEC C;  1VL2 A;  4I7Z C;  2E74 C;  3IN6 A;  1SQP E;  4H0L D;  1FQT A;  3AE1 C;  1NGM B;  1KMI Z;  2E75 B;  1SQB E;  2HMN A;  2NVE A;  1AJY A;  1NTM E;  4Z1M H;  2P10 A;  3GLM A;  2JP3 A;  4NBF D;  1VM9 A;  1ZP0 C;  3O6Q A;  1WQL A;  2E76 C;  2E4Q A;  3L74 E;  3AEB C;  1MKM A;  2HMO A;  1S5L X;  4QUR A;  1YQ3 C;  3B71 A;  4PV1 B;  3D71 A;  4HM7 A;  4PD4 E;  3AEG C;  4NBE D;  1SQQ E;  4U3F E;  4P1B H;  4QDD A;  1KTM A;  2E74 B;  1DD4 A;  5KKZ C;  4HKV A;  2JZA A;  2GBX A;  4NB8 D;  2WQY C;  2FXP A;  1VF5 B;  3G9R A;  1R8E A;  3AZC A;  1KIL E;  4H0L C;  1RQU A;  4NB9 D;  1SQV E;  1O7P A;  1G8K B;  2ZT9 C;  3Q3D A;  2HML A;  2QIW A;  3RK3 E;  3L72 E;  4HM6 A;  1G8J B;  2BMR A;  2MKV A;  2E74 D;  1GMJ A;  3H1H E;  1BE3 E;  4QUQ A;  3H1J E;  3CXH E;  2H89 C;  4NBG D;  1VF5 D;  4HM2 A;  4QDC A;  3AEE C;  4QDF B;  3FGA D;  2E75 C;  2JO6 A;  3C8V A;  1HJ0 A;  1KQG B;  1P84 E;  2QSI A;  3AE9 C;  3AEF C;  1PPJ E;  3N0Q A;  2G8Y A;  1JM1 A;  3Q5S A;  2IDB A;  2QJK C;  3S9O A;  2XSH A;  3Q1M A;  1ULI A;  2BEZ F;  1KB9 E;  4YXD C;  4PV1 C;  3D6Z A;  2ZT9 B;  3TGU E;  3AE3 C;  1KOR A;  1JB0 J;  1O7M A;  1O7N A;  1VF5 C;  4OGQ B;  3H25 A;  1NU1 E;  4U7J A;  2WSF J;  4EMJ B;  1O7H A;  4HM8 A;  2ZT9 D;  2BCC E;  2YFI A;  4H44 B;  2J5U A;  1S1C X;  2O01 J;  3CX5 E;  1UIX A;  2JO1 A;  2DE7 D;  1TU3 F;  1WMK A;  3GMA A;  2NZ2 A;  5BOK A;  4OGQ D;  3Q5R A;  4NBB D;  4HJL A;  1NYH A;  2E75 D;  2FBW C;  3VMH D;  4QCK A;  2K9Y A;  2BMO A;  1EG9 A;  2QPZ A;  4H44 D;  1K05 A;  3D70 A;  3SFE C;  3VCA A;  2BEQ D;  1EXJ A;  3H1I E;  4TT3 H;  3D6Y A;  2Q3W A;  2XRX A;  2BMQ A;  3EN1 A;  4PV1 D;  1VCK A;  2B24 A;  1SQX E;  3VMG D;  1NDO A;  1NYK A;  5AEW A;  1L0L E;  1NTZ E;  3GF7 A;  1UUV A;  3GTE A;  2WSE J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...