4H13D

Crystal structure of the cytochrome b6f complex from mastigocladus laminosus with tds
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
168
Chain Sequence
b'DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
molecule tags Photosynthesis
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
total genus 32
structure length 168
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h13D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h13D02
2E75C 2FYUE 3C0DA 1SJGA 2YIUC 1BE3E 2E74D 3L74E 2DE5D 2DE6D 2HMNA 2ZT9C 2HMOA 2NVGA 2YFJA 3GZXA 3H1KE 4HM3A 4HM1A 4PV1C 2JZAA 1NYKA 4HM7A 4NBGD 4QURA 2BMOA 2ZYLA 4NBED 1O7NA 4H44C 3GZYA 3DQYA 3GCEA 1RFSA 2XRXA 3CWBE 4H0LD 4HM2A 4HKVA 3EQQA 2A06E 2B1XA 2GBXA 4HM0A 2E74C 2E4PA 4AAYB 4HM4A 2XSOA 1NTZE 2BMRA 4NBAD 1EZVE 2BMQA 4NB8D 2QJPC 1NTKE 1JM1A 1NTME 1VF5D 5CXMA 3L70E 1Q90C 5BOKA 5AEWA 2D2CD 1WQLA 4QCKA 1BCCE 1EG9A 4QUPA 5KLIC 1G8KB 2YVJB 2QPZA 4P1BH 4EMJB 3L72E 3BCCE 4QDFB 5KKZC 1NU1E 3GKEA 1VF5C 2XSHA 2HMMA 1UUVA 1O7WA 3GTEA 2NUKA 4OGQC 3CXHE 2CKFA 2FYNC 2JO6A 1KYOE 2IBZE 2YFIA 1SQBE 3D89A 1O7HA 1NDOA 4QDDA 4H13C 1G8JB 1SQPE 3GL2A 5KLVE 3GOBA 3H1HE 4QDFA 4QDCA 3H1IE 2E4QA 4NBCD 3GL0A 4P1CH 4H0LC 4OGQD 1RIEA 2DE7D 5HL4A 4H44D 3N0QA 2QJKC 1O7MA 1VM9A 3VCPA 2QJYC 1ULJA 3FOUA 3VMHD 4HM5A 1SQVE 1O7GA 3VCAA 4NB9D 1FQTA 1VCKA 4HJLA 2E76D 2Q3WA 3VMGD 4NBHD 2I7FA 4H13D 1UUWA 4I7ZC 4HM8A 3L75E 2E75D 4NBFD 1L0LE 2GBWA 2B24A 2HMJA 3GB4A 1O7PA 1PPJE 4AIVA 2NVEA 1PP9E 2YFLA 4QUQA 3L73E 1ULIA 2ZT9D 3L71E 3EN1A 4U3FE 2NUMA 2YMKA 2NVFA 2NWFA 4PD4E 3AZCA 1SQXE 2HMKA 3GTSA 2E76C 1L0NE 1SQQE 2HMLA 4NBBD 2D2CC 3H1LE 2XR8A 3H1JE 2BCCE 5AEUA 4PV1D 4NBDD 1KB9E 4HM6A 3VMID 3CX5E 1ZRTE 3TGUE 1P84E
chains in the Genus database with same CATH superfamily
3B5NC 2R3CA 1ZN5A 2OQQA 4OGQB 2FYUJ 2BASA 2HR3A 3M0DC 1AQTA 1JOCA 1OXZA 2M3BA 5AVTB 1NGMB 2WZ7A 4BRYA 3ZDMA 1L4AD 4WB4A 5KAFH 3L70G 4H0LD 3EQQA 4HM0A 2CPBA 2KP8A 2E74C 1DEBA 2IBZG 5APXA 2BMRA 4NB8D 3L70J 1ZOYC 2WSCJ 5CXMA 1WQLA 2YKQA 3V2RA 2ZVNB 2KOGA 4N6JA 4UB8E 3KHUA 2RN0A 1CZQA 1U57A 1RHZB 3HRNA 2GM4A 3NMDA 4CPGA 3S4RA 1N73B 3HE4A 4O9BA 1AVYA 1S5LX 1IFIA 1EC5A 1SFCA 1LT9B 2DE7D 3VN0A 3II6A 3VMHD 3VCAA 3LIEA 2L5GB 3TK1A 2KNCA 1WRGA 2QE7H 2H7HA 2QRXA 2Y9YA 3A5TA 3L75E 1IC2A 3GLMA 2HMJA 4NPFX 5E79H 3LW5J 2NVEA 4AIVA 1JMBA 2FFDC 2WMMA 3H1IJ 2IFMA 1KV4A 4U3FE 3EN1A 1VQ4P 1KILE 5AW4B 1BCCD 1JY3N 2Q3EA 2OTJP 4ZNCA 4H13B 5AVQB 1P84E 2P67A 3CMAP 2YIUC 3L74E 1JY3O 1FU1A 2DE5D 3JCUE 3B8EB 2QJYB 1VPCA 3CX5H 4C46A 4NBED 1HTLC 3AE3C 3A0HE 1LTJC 1M7LA 2GBXA 1EZVG 1YBKA 2XSOA 3KZIH 1NTZE 1W5CE 4XE5B 1L0NK 1SQVJ 3B5NA 2WSSH 2G3AA 3HTKA 2W90A 3JSVC 2OGUA 1T3UA 1PV3A 4HKZH 5E79E 1RF1B 3V6IA 3CC4P 2K37A 3H6PA 4D6TJ 1O7WA 3RL0D 1FOSF 1SQBE 4H13C 1OW6A 3S1KA 1L0NJ 4WWIA 3GOBA 3L70D 5AVYB 3TYYA 1NTKJ 1FC2C 1KILD 1PGJA 4C7RA 2WSFH 3VCPA 2QJYC 4R4LA 3CCQP 1JY2O 1K04A 1JEKA 3HUSB 3NTNA 3L75D 2FXOA 1LT9A 4MN4C 1AVOA 1PPJG 1S2EA 2N9YB 2KI7B 4PD4E 3AZCA 1SQBJ 3N4XA 3PP5A 3G6EP 3M9HA 1PP9J 4PV1D 4LGDE 4HM6A 3CX5E 1K05A 2JO6A 1PGOA 1D7MA 1OVRA 2PP6A 4L73A 1KILB 3GHGB 5AW2B 3SFDC 1Q82Q 4H44C 1NU1G 1Y47A 1QL2A 3HD7A 3Q2YA 2B1XA 5KAIH 3IN6A 1FZCB 1FZEA 3OAKA 4WVZA 3B4SA 1Q90C 1ZR2A 3WMM0 4XA4A 2AEMA 4ZKUA 4HH2A 4JBZA 1X79B 1CSBA 2WSCH 5AVVB 1KMIZ 1VF5C 1OW8A 2OTKE 2WPVB 2V7QH 1FDOA 3AE1C 3HD7C 1NTKG 1ZV8A 1SQBD 1NHLA 1KYOD 2PAJA 1FOSE 2Z5IA 4D6TG 3CXHI 3G71P 1LWUB 2YXQB 1VQLP 2B87A 3TNUA 1R5LA 1SQPD 5BU5A 1DD4A 1T6AA 5AW5B 3FX0A 5CCGC 2MJZA 2P58A 1L2PA 1RE4C 1HWTC 3BVHA 1PP9E 5KLVJ 1NU1K 5CJ4A 1LTGC 2BCCG 1SQXE 4KJMA 5AVRB 3QH9A 4NBBD 2JP3A 1KQLA 1SQQD 2LXCB 1HJBA 4A7PA 5APUA 3D70A 1X22A 2LXBA 4HM1A 2E74B 3L74D 2JZAA 3SWYA 1PGQA 1G1JA 1J1DB 1O7NA 4Z1MH 1ZR4A 1URQA 1JY2P 1RFSA 3T97B 5EFWB 1AA0A 1GL2C 4HB1A 3HD7B 1GU5A 1JO5A 2WSEH 1SFCC 2AXCA 1T2KD 1RE3C 1VF5D 1MV8A 3K5BA 2O1KA 1J2JB 2KZJA 1SP4A 3P8CE 5APYA 1XTCC 1RQUA 1LTTC 3CCEP 4ASVA 3CXHE 1VQ6P 2CKFA 3L75J 1LJ2A 4GODA 1DEEG 5KJ7D 3GL2A 2HODA 2KIKA 4QDFA 4DZOA 1G2CB 3H1IE 1DIPA 4OGQD 5HL4A 1KYOH 2NPSC 1VDFA 2K1AA 1O7GA 3TNUB 3O6QB 2IBZI 1DH3A 1Y8AA 3Q5RA 3L73G 3GB4A 1LT1A 1JY3P 3H25A 1NU1D 1VQ7P 2BEQD 2ZT9D 4N78D 5KKZB 5TISE 3H1LG 2IZ1A 2B9BA 3H32B 2OYHB 1RE4A 2WT7A 5CBOA 2WSEJ 4D6TD 2E5YA 3H1IG 4UB8H 3ITKA 3RBXA 3D6YA 5AVSB 4HM3A 4DT0A 3B71A 2QIWA 1NTMK 2FYUK 3L72G 1J1EC 1YI2P 1UIIA 3CCLP 3AEAC 1ZXGA 2FXPA 1KILA 1JM1A 2KXPB 5K5GB 1EXJA 5GTHH 3L70E 3CD6P 5C39A 3UIAA 4QUPA 1G8KB 3AE9C 2XU6A 1IZNB 1USEA 3RBZA 5KKZC 2Q7CA 2RH0A 3GF3A 2Q3IA 4AQRD 2FYNC 1KYOE 3TGUJ 5AW6B 5APVA 2YFIA 3D89A 1NDOA 5TISH 3G4SP 3CCVP 1BSHA 1FAVA 1ZLLA 1FE6A 4RJTA 2XNDH 1SQQG 2W8ZA 2AXTH 1FJPA 3Q1MA 1ULJA 1N73A 1PP9D 1FQTA 1VCKA 3PJSK 2E76D 3VMYA 2KNCB 3C8VA 3L74G 2B88A 4H13D 3AEGC 5DJTB 3EFGA 2FYUG 3USSA 2IYOA 3MTUE 1EZVI 3HE5A 4U3FG 1RY3A 3P32A 3H1LE 3TSIA 1VQNP 2ZVOB 1BCCJ 3HUSA 3RL0C 1JB0J 1FJKA 2K88A 3L75G 2E75C 5CCHD 1SJGA 3CCUP 4M3LA 3MZWB 2DE6D 3A7OA 1R5SA 2KUBA 1L0LG 1M8OB 3CX5D 2JWAA 5B66E 2POHA 1TU3F 2XRXA 1N2DC 3SFEC 3A0BE 1FDMA 2R5BA 1M90Q 1GD2E 3H1LJ 4B86A 3C9IA 1BCCE 1BGYG 1EG9A 5KLIC 4OWFA 2QPZA 4Y99C 3H32A 3M0DA 3WUTA 1URQC 2Y0CA 3PRJA 3CI9A 2IBZE 4RO0A 3D71A 2WWWA 3VMXA 2CK3H 3H1LD 5AW1B 3VMZA 1S9KD 3FXEA 3RL0g 2FFDA 3KZIE 2HPCA 3CC2P 3N0QA 3AEBC 2QJKC 2OYIA 3H1ID 4HM5A 1WT6A 4HJLA 3CPWO 4I1LA 1KQSO 1IFMA 1KB9I 1NTKD 1O7PA 1PPJE 3U59A 2YFLA 4QUQA 3FXDA 2M3EA 4PJ0H 3U1CA 1EXIA 2JKVA 1FZFA 2K9JB 3IFMA 2XR8A 2BCCE 3L4FA 1N73C 4NBDD 1H0TB 1SQPG 4EIJA 3P8MC 4WBAA 1LTAC 3A0HH 1BE3E 3WU2H 1M57D 3GZXA 3F89A 4H44B 2YKOA 1P84D 1GK4A 2WT7B 1GL2A 2BCCD 3E7KA 1MZ9A 1U7JA 3CWBE 3GW6A 5L8RJ 1PL5A 2A06E 5CCHA 4U3FD 3TGUD 4IOIH 1NTKE 3H1JD 2J5UA 2D2CD 5AW0B 1GK6A 3VOPA 1L0ND 3I55P 1QVFO 3KDPB 1KTMA 3EQ2A 1NTKK 2QJPB 2HMMA 4GDOA 5TJHA 5CCGD 3SSUA 4HJGH 1LWUA 1SQPE 2KB7P 2FYNB 3OJAB 1GU4A 4BRYB 1NYHA 1HBWA 2R5DA 3MHVA 2YMYA 5H2FH 3HE5B 5BU8B 1KD1Q 1NOHA 2L91A 2W83C 4AUWA 3RK3B 2HMKA 3G3ZA 4XFJA 2H89C 3AE7C 2HMLA 1YQ3C 3EFFK 2KLVA 2OYIC 3GMAA 3TF5A 4L74A 2ZT9C 2YFJA 2B87B 1N7SC 2BMOA 3GZYA 1BCCG 3H1KJ 2AEJA 3FWLA 2M5AA 2M8RA 4U3FJ 1KILC 2E4PA 5GTIH 1OX3A 1NTMG 2GA1A 4LC1A 2XNXA 2OYHA 1T8ZA 5KJ7C 3SWFA 2NPSD 3RK2C 1EDIA 2AEFA 3H1KD 4GT1A 3RK3C 2M5AB 1FZCC 2FYZA 2NUKA 4OGQC 3Q5PA 2JJLA 4RKUJ 4IL6E 3AECC 5KLVE 2KK7A 2R32A 1NTZG 4ZKPA 2HG5D 4P1CH 3TGUG 5APWA 1HF9A 2ZJSE 2N1TB 1L0NG 2I7FA 1OIPA 1BE3G 2A45H 3BATA 1SQQK 4GIFA 1Z56A 2SPZA 3CCJP 2YMKA 2H88C 2NWFA 4TT3H 5B5EH 1L0NE 1WMKA 2D2CC 1S72P 4ZMDA 4UB6H 1G2CA 2P1JA 1PPJD 3H1KE 1NYKA 2FYUD 5KTBA 2ZYLA 1N7SD 5CMZA 3DQYA 4IL6H 3M9BA 3VMAA 4N78E 1H8AA 1W2BO 1SQVK 3O6QA 2OARA 1NTME 1VQ9P 5BOKA 1L0LD 1LNQA 3C1LA 3AE5C 3GKEA 2KYVA 2YIUB 1NH4A 1N86A 3CX5I 3LIDA 3H1HE 4K35A 2JDIH 1KB9H 1BGYD 1KORA 1E79H 3ABVC 1VM9A 3PHLA 3L72J 1HH0A 1PIXA 1RE3A 2YKPA 1UUWA 2ITAA 2JEEA 2E75D 1RF1C 2W6AA 3KPEA 1L4AC 1S4XA 3FGAD 1ZP0C 1ULIA 3VP9A 2IPPA 2NVFA 1SFCD 2Q1KA 2QA4P 2QSIA 2E75B 1LGHB 1NTMD 1URQD 3T97A 1ZRTE 1H89A 3O8ZA 1J1DC 3PTZA 3R4YA 1BE3D 5M1BA 3JC22 4W80A 4L75A 1S3JA 2OYHC 3L71J 3CL3D 3M06A 1SFCB 1NTMJ 4BXLA 4YPCA 3SWKA 1NTZD 3BRTB 1YITP 5AW7B 3PLNA 4AAYB 2IZ0A 2M0BA 4NBAD 5KLVG 2RMZA 1Q81Q 3OW2O 1VQOP 1L4AB 2VRSA 2FFDB 2N1TD 1JMMA 3P7KA 3F5HA 1OMIA 2PFXA 3BCCE 3CWBG 2WITA 3BASA 3CCSP 1RF0A 2XSHA 5B66H 3PH0A 2HLOA 2HYNA 1VQMP 1EDLA 1PGPA 3H1JG 1JY2N 1IO4A 2ZT9B 3AE8C 1U7MA 3L71D 3R2PA 1LP1B 1SQVE 2E43A 1N8RQ 1PFIA 2Q3WA 2IDBA 3M0AA 2A45G 4HM8A 2C9LY 2XV5A 3W67A 1OW7A 1LTBC 2WTYA 3BCCJ 1VQPP 4WY4A 3V4QA 1ZRTD 2QVAA 1NO4A 2ZAEB 1QGKB 1FDIA 4JYBA 3H1HD 1MFTA 2GUSA 1PZQA 1YTZT 2ZXEB 3U1AA 5AVUB 4W7ZA 2IBZD 3C0DA 1SS1A 2E74D 3L73D 2HMNA 2ZYAA 1A02J 1OWAA 3M9QA 5GTHE 3GF7A 5CCGA 2P10A 1NAFA 4PD4D 1JUNA 1GDTA 2NPSB 2Y0EA 4HYTB 1LTIC 2Z5HA 3WUVA 5APQA 1SQPK 3RL0B 3L72D 1UUVA 2Q6QA 1GTWA 1VQ8P 1K73Q 3CCRP 1FZAA 3H1JJ 1L4AA 4K3AA 3HTKB 2E4QA 1YYCA 2FBWC 1Q86Q 1USDA 1O7MA 1NVOA 3IAOA 3CMEP 1JTHB 1X9VA 3CWBJ 1OVVA 4PD4I 4IFFA 1FS0E 2XKMA 1SQXK 4YXDC 2B24A 1P84I 2YNYA 4QMAA 1NKZB 1GMJA 3B5NB 5CHXA 1M56D 2E76C 1AJYA 2YXRB 1PP9G 2IFNA 3V2QA 1SLQA 2C0XA 3H1JE 2JWDA 2YO3A 4IL6X 1QEXA 3L71G 3Q3DA 3MD0A 1X0TA 3HUSC 1KYOI 3CLQA 4QURA 1JCDA 4HM7A 2NPSA 4D6TE 5KAIE 1N7SB 1MKMA 3GCEA 1VL2A 2I1KA 1YJWP 5APTA 1YHQP 3RK3D 1E5WA 2P2UA 1Y9BA 4HM2A 3KXDA 1SQPJ 3CCMP 1HGZA 1EZVE 2N1TA 1HGVA 4WY4B 1ZMEC 3V5BA 5H2FE 4UB6E 4TLFA 1K8AQ 3OA7A 1XTGB 4Y99B 3KYQA 3L72E 4KT0J 1KFMA 2UWJE 1FZBA 4GOFA 3A3YB 1BGYE 4IFMA 3IF4A 1M1JC 5B5EE 1N7SA 4L76A 1OFCX 2QJKB 3AE4C 4NBCD 3Q5SA 2R44A 4H44D 2KSEA 1X8YA 2Y9ZA 1QL1A 4I7ZB 1KN7A 5AVWB 1FZGA 1CW5A 1NAYA 3VMGD 4JYCA 1IFDA 1RH5B 2K3RA 1SVFA 1L0LE 2GBWA 4BWNA 2ZYGA 3GG2A 5KAFE 3L73E 1BGYJ 1Q2NA 2GUVA 3RK3E 1S1CX 1EQ7A 3S9OA 3LW5H 3VYIA 2QG4A 4EI2A 3V2NA 2FYUE 3MUDC 4YTPC 1GW3A 1K9MQ 2NVGA 2PRRA 1NWQA 1QLED 1SQBK 5AW8B 1VQKP 5GTIE 1P84H 2KS1B 3TDKA 3KQGA 3JCUH 4ASWA 1IFPA 3AEDC 3FWNA 1M1JB 2E5TA 2YVJB 1BE3J 1HVVA 3AEEC 2E42A 5CJ0A 3M91A 2JO1A 1Q7YQ 4NPDA 2CPSA 3GTEA 2WSFJ 2ZXXA 3CC7P 1OVUA 3AE6C 1SQXJ 3L74J 4GOEA 1NTZJ 4WY4D 4NPEA 4QDCA 2V4HA 3VTPC 1NJIQ 2O01N 2B89A 5AW3B 3A0BH 1EDJA 2NRGA 2LR2A 4NB9D 4I6MC 4JF7A 5KLIB 3MUDA 3L73J 1SQXG 4GKGA 2Q5UA 4C7NB 1G1IA 1BDCA 3I56P 2I8DA 2MKVA 4W7YA 4YXWH 1GW4A 1LTSC 2W6JH 4EYYQ 1KB9E 3VMID 4C7NA 1J1EB 1AV1A 4PV1C 3IR9A 2Q9IA 1N7LA 4R4MA 5CCHC 2N1TC 2O1JA 3I5CA 3WU2E 3H1HG 1IJDB 1HUCA 4I2LC 4AYCA 4HKVA 4Y28J 1LTJB 1CI6B 2BMQA 2DW3A 2HODB 2QM7A 2FY8A 4QCKA 3E1IA 1QVGO 1IFNA 1H88A 2P7JA 1Q90D 1NU1E 2W6BA 1IFJA 1LWUC 2H8PD 2O01J 1O7HA 4PD4H 4DOJA 4OVNF 2BCCJ 2KSJA 2XZRA 1LP1A 1T2KC 2C9NY 2A45I 3H1KG 3W68A 1JCCA 3V4WA 1R8EA 4NBHD 3MGNA 4I7ZC 1KC8Q 1BDDA 1GL2B 2V7QJ 1AQ5A 1LT9C 3CXHD 1BSNA 2IX7C 1SQVD 2FKWB 3L71E 4DCKA 2WPSA 1FZCA 5DJUB 3L35A 3GTSA 2PGDA 1AFOA 4OH8B 5KJ7A 5AEUA 3MP7B 4N3YB 5AVZB 2G8YA 2C0WA 2HMOA 3BCCD 1YJ9P 2WQYC 3GHGA 1MUUA 2Y0DA 3HE4B 4WY4C 2ZFCA 2K9YA 1QX8A 3QWOC 4RESB 2R3SA 1M1KQ 2A06G 3VP8A 1URQB 2HFED 1NU1J 3L36A 1YQ4C 2J58A 2BEZF 1YJNP 1LTJA 1RF0C 1VF5B 1S5LE 4LLHA 4EMJB 1YIJP 4IFDK 2KLUA 5AW9B 1FBMA 3HD7D 2AXTE 1S9KE 1EDKA 2KS1A 3EWKA 2QM8A 3NFQA 3AE2C 3GL0A 3B5ND 4H0LC 5BVZA 2KZIA 2WPRA 1DX7A 4JPZB 1CI6A 2YO2A 3RK2B 4PJ0E 3RK2D 4NBFD 1IK7A 4U7JA 1NKNA 1RQVA 2NUMA 1DD3A 2QEXP 5CBNA 2K9JA 3MIWA 3H1HJ 1MFZA 2XDJA 2E76B 4KHXA 1T3JA 3RGUA 5APSA 1S5LH 2OTLP 1IK9A 1RF1A 1JTHA 1UIXA 4NBGD 1KB9D 4PV1B 1SQVG 2NZ2A 1H0TA 1W2EA 2O01H 3D6ZA 3GHGC 4HM4A 2QJPC 4EDFA 2N9BA 2LKMA 3AEFC 1SQBG 5AEWA 1GL2D 2Z4EA 2FXMA 2D2CB 2OYOA 4P1BH 2I1JA 3BCCG 3WUUA 4EOTA 1KZUB 4QDFB 3N7NA 2ZYDA 4H0LB 3G9RA 3P8CD 1SQQJ 4QDDA 2WPQA 2OYIB 1G8JB 2RKLA 5KLVD 1ZW0A 3V2PA 2JR8A 4DJGA 1EZVD 1KFNA 2WVRA 1RIEA 2J59M 3BRVB 1JM0A 2A06D 3FOUA 3CWBD 4JQ0D 2IYPA 1OZHA 3L37A 5KLVK 1JNMA 1HJ0A 2HPCB 1KQGB 1L0LJ 2H43A 1A02F 3NXSA 1M1JA 3E1RA 3CXHH 2W27A 1NTZK 3A2AA 1VQ5P 5AVXB 1SQQE 1L0LK 2O3JA 1YTZI 1GZLA 1SQXD 3TGUE 1KQFB
chains in the Genus database with same CATH topology
2WSEJ 2FYUE 2OQQA 4YTPC 4OGQB 4HM3A 3D6YA 2NVGA 3H1KE 3B71A 2QIWA 1NYKA 1NGMB 2ZYLA 3DQYA 4H0LD 3EQQA 4HM0A 2E74C 3AEDC 3AEAC 2BMRA 3O6QA 2FXPA 4NB8D 1JM1A 1EXJA 1NTME 1ZOYC 2WSCJ 3L70E 5CXMA 5BOKA 1WQLA 4QUPA 1G8KB 3AE9C 2YVJB 3AEEC 3AE5C 1U57A 5KKZC 2JO1A 3GKEA 3GF3A 3GTEA 2FYNC 2WSFJ 1KYOE 3AE6C 2YFIA 3D89A 1NDOA 3H1HE 1S5LX 4QDCA 1KORA 2DE7D 3ABVC 3Q1MA 1VM9A 1ULJA 3VMHD 3VCAA 1PIXA 4NB9D 1FQTA 1VCKA 2E76D 3C8VA 4H13D 1UUWA 3L75E 2E75D 3AEGC 3GLMA 2HMJA 3FGAD 4AIVA 3LW5J 2NVEA 1ZP0C 2MKVA 1ULIA 3EN1A 4U3FE 2NVFA 1KILE 2QSIA 3H1LE 2E75B 4H13B 1KB9E 3VMID 1JB0J 1ZRTE 1P84E 2E75C 1SJGA 2YIUC 3L74E 2DE5D 2DE6D 3R4YA 4PV1C 5M1BA 4R4MA 4NBED 3AE3C 1TU3F 2XRXA 4HKVA 4Y28J 2GBXA 3SFEC 4AAYB 2XSOA 1NTZE 4NBAD 2BMQA 4QCKA 1BCCE 2G3AA 1EG9A 5KLIC 2QPZA 1OMIA 3BCCE 1PV3A 1Q90D 1NU1E 2XSHA 1O7WA 2IBZE 2O01J 1SQBE 3D71A 1O7HA 4H13C 1OW6A 3GOBA 3RL0g 2ZT9B 3AE8C 3N0QA 3AEBC 2QJKC 3VCPA 2QJYC 4R4LA 4HM5A 1SQVE 1K04A 4HJLA 2Q3WA 1R8EA 2IDBA 4NBHD 4I7ZC 4HM8A 2V7QJ 1OW7A 1O7PA 1PPJE 2YFLA 4QUQA 3L71E 4PD4E 3AZCA 3GTSA 1FDIA 1EXIA 2XR8A 2BCCE 5AEUA 4PV1D 4NBDD 4HM6A 3CX5E 2JO6A 1K05A 3C0DA 1BE3E 2E74D 2G8YA 2HMNA 2HMOA 3GZXA 4H44B 3SFDC 2WQYC 4H44C 3CWBE 3GF7A 5L8RJ 2P10A 3Q2YA 1PL5A 2K9YA 2A06E 2B1XA 3IN6A 1NTKE 1YQ4C 1Q90C 2J5UA 2D2CD 2BEZF 1VF5B 4EMJB 1KMIZ 1KTMA 1VF5C 2HMMA 1UUVA 1OW8A 4GDOA 2WPVB 1FDOA 3AE1C 1SQPE 3EWKA 1NYHA 2E4QA 3GL0A 3AE2C 4H0LC 2FBWC 1O7MA 3IAOA 1DD4A 4YXDC 4NBFD 2B24A 1IK7A 4U7JA 1PP9E 1GMJA 1RQVA 2NUMA 1DD3A 1SQXE 2HMKA 4XFJA 2E76C 1AJYA 2H89C 3AE7C 2HMLA 4NBBD 1YQ3C 2JP3A 3H1JE 2E76B 4IL6X 3Q3DA 3GMAA 3D70A 2ZT9C 4HM1A 2YFJA 2E74B 2JZAA 4QURA 4HM7A 1UIXA 4NBGD 2BMOA 1O7NA 4PV1B 4Z1MH 3GZYA 1MKMA 3GCEA 1RFSA 1VL2A 3T97B 2NZ2A 4HM2A 1Y9BA 3D6ZA 2E4PA 4HM4A 1EZVE 2QJPC 1VF5D 3AEFC 1ZMEC 5AEWA 2D2CB 4P1BH 3L72E 4QDFB 4KT0J 1RQUA 4H0LB 3G9RA 2NUKA 4OGQC 3CXHE 2CKFA 3Q5PA 4QDDA 4RKUJ 3AECC 1G8JB 3GL2A 5KLVE 4QDFA 3H1IE 3AE4C 1DIPA 4NBCD 3Q5SA 4P1CH 4OGQD 1RIEA 5HL4A 4H44D 1HF9A 3FOUA 1O7GA 4I7ZB 3VMGD 2I7FA 1L0LE 1HJ0A 3Q5RA 2GBWA 1KQGB 3GB4A 3H25A 3L73E 2BEQD 2ZT9D 2YMKA 2H88C 2NWFA 4TT3H 3RK3E 1L0NE 1S1CX 3S9OA 1SQQE 1WMKA 2D2CC 3TGUE 1KQFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E75 C;  2FYU E;  3C0D A;  1SJG A;  2YIU C;  1BE3 E;  2E74 D;  3L74 E;  2DE5 D;  2DE6 D;  2HMN A;  2ZT9 C;  2HMO A;  2NVG A;  2YFJ A;  3GZX A;  3H1K E;  4HM3 A;  4HM1 A;  4PV1 C;  2JZA A;  1NYK A;  4HM7 A;  4NBG D;  4QUR A;  2BMO A;  2ZYL A;  4NBE D;  1O7N A;  4H44 C;  3GZY A;  3DQY A;  3GCE A;  1RFS A;  2XRX A;  3CWB E;  4H0L D;  4HM2 A;  4HKV A;  3EQQ A;  2A06 E;  2B1X A;  2GBX A;  4HM0 A;  2E74 C;  2E4P A;  4AAY B;  4HM4 A;  2XSO A;  1NTZ E;  2BMR A;  4NBA D;  1EZV E;  2BMQ A;  4NB8 D;  2QJP C;  1NTK E;  1JM1 A;  1NTM E;  1VF5 D;  5CXM A;  3L70 E;  1Q90 C;  5BOK A;  5AEW A;  2D2C D;  1WQL A;  4QCK A;  1BCC E;  1EG9 A;  4QUP A;  5KLI C;  1G8K B;  2YVJ B;  2QPZ A;  4P1B H;  4EMJ B;  3L72 E;  3BCC E;  4QDF B;  5KKZ C;  1NU1 E;  3GKE A;  1VF5 C;  2XSH A;  2HMM A;  1UUV A;  1O7W A;  3GTE A;  2NUK A;  4OGQ C;  3CXH E;  2CKF A;  2FYN C;  2JO6 A;  1KYO E;  2IBZ E;  2YFI A;  1SQB E;  3D89 A;  1O7H A;  1NDO A;  4QDD A;  4H13 C;  1G8J B;  1SQP E;  3GL2 A;  5KLV E;  3GOB A;  3H1H E;  4QDF A;  4QDC A;  3H1I E;  2E4Q A;  4NBC D;  3GL0 A;  4P1C H;  4H0L C;  4OGQ D;  1RIE A;  2DE7 D;  5HL4 A;  4H44 D;  3N0Q A;  2QJK C;  1O7M A;  1VM9 A;  3VCP A;  2QJY C;  1ULJ A;  3FOU A;  3VMH D;  4HM5 A;  1SQV E;  1O7G A;  3VCA A;  4NB9 D;  1FQT A;  1VCK A;  4HJL A;  2E76 D;  2Q3W A;  3VMG D;  4NBH D;  2I7F A;  4H13 D;  1UUW A;  4I7Z C;  4HM8 A;  3L75 E;  2E75 D;  4NBF D;  1L0L E;  2GBW A;  2B24 A;  2HMJ A;  3GB4 A;  1O7P A;  1PPJ E;  4AIV A;  2NVE A;  1PP9 E;  2YFL A;  4QUQ A;  3L73 E;  1ULI A;  2ZT9 D;  3L71 E;  3EN1 A;  4U3F E;  2NUM A;  2YMK A;  2NVF A;  2NWF A;  4PD4 E;  3AZC A;  1SQX E;  2HMK A;  3GTS A;  2E76 C;  1L0N E;  1SQQ E;  2HML A;  4NBB D;  2D2C C;  3H1L E;  2XR8 A;  3H1J E;  2BCC E;  5AEU A;  4PV1 D;  4NBD D;  1KB9 E;  4HM6 A;  3VMI D;  3CX5 E;  1ZRT E;  3TGU E;  1P84 E; 
#chains in the Genus database with same CATH topology
 3B5N C;  2R3C A;  1ZN5 A;  2OQQ A;  4OGQ B;  2FYU J;  2BAS A;  2HR3 A;  3M0D C;  1AQT A;  1JOC A;  1OXZ A;  2M3B A;  5AVT B;  1NGM B;  2WZ7 A;  4BRY A;  3ZDM A;  1L4A D;  4WB4 A;  5KAF H;  3L70 G;  4H0L D;  3EQQ A;  4HM0 A;  2CPB A;  2KP8 A;  2E74 C;  1DEB A;  2IBZ G;  5APX A;  2BMR A;  4NB8 D;  3L70 J;  1ZOY C;  2WSC J;  5CXM A;  1WQL A;  2YKQ A;  3V2R A;  2ZVN B;  2KOG A;  4N6J A;  4UB8 E;  3KHU A;  2RN0 A;  1CZQ A;  1U57 A;  1RHZ B;  3HRN A;  2GM4 A;  3NMD A;  4CPG A;  3S4R A;  1N73 B;  3HE4 A;  4O9B A;  1AVY A;  1S5L X;  1IFI A;  1EC5 A;  1SFC A;  1LT9 B;  2DE7 D;  3VN0 A;  3II6 A;  3VMH D;  3VCA A;  3LIE A;  2L5G B;  3TK1 A;  2KNC A;  1WRG A;  2QE7 H;  2H7H A;  2QRX A;  2Y9Y A;  3A5T A;  3L75 E;  1IC2 A;  3GLM A;  2HMJ A;  4NPF X;  5E79 H;  3LW5 J;  2NVE A;  4AIV A;  1JMB A;  2FFD C;  2WMM A;  3H1I J;  2IFM A;  1KV4 A;  4U3F E;  3EN1 A;  1VQ4 P;  1KIL E;  5AW4 B;  1BCC D;  1JY3 N;  2Q3E A;  2OTJ P;  4ZNC A;  4H13 B;  5AVQ B;  1P84 E;  2P67 A;  3CMA P;  2YIU C;  3L74 E;  1JY3 O;  1FU1 A;  2DE5 D;  3JCU E;  3B8E B;  2QJY B;  1VPC A;  3CX5 H;  4C46 A;  4NBE D;  1HTL C;  3AE3 C;  3A0H E;  1LTJ C;  1M7L A;  2GBX A;  1EZV G;  1YBK A;  2XSO A;  3KZI H;  1NTZ E;  1W5C E;  4XE5 B;  1L0N K;  1SQV J;  3B5N A;  2WSS H;  2G3A A;  3HTK A;  2W90 A;  3JSV C;  2OGU A;  1T3U A;  1PV3 A;  4HKZ H;  5E79 E;  1RF1 B;  3V6I A;  3CC4 P;  2K37 A;  3H6P A;  4D6T J;  1O7W A;  3RL0 D;  1FOS F;  1SQB E;  4H13 C;  1OW6 A;  3S1K A;  1L0N J;  4WWI A;  3GOB A;  3L70 D;  5AVY B;  3TYY A;  1NTK J;  1FC2 C;  1KIL D;  1PGJ A;  4C7R A;  2WSF H;  3VCP A;  2QJY C;  4R4L A;  3CCQ P;  1JY2 O;  1K04 A;  1JEK A;  3HUS B;  3NTN A;  3L75 D;  2FXO A;  1LT9 A;  4MN4 C;  1AVO A;  1PPJ G;  1S2E A;  2N9Y B;  2KI7 B;  4PD4 E;  3AZC A;  1SQB J;  3N4X A;  3PP5 A;  3G6E P;  3M9H A;  1PP9 J;  4PV1 D;  4LGD E;  4HM6 A;  3CX5 E;  1K05 A;  2JO6 A;  1PGO A;  1D7M A;  1OVR A;  2PP6 A;  4L73 A;  1KIL B;  3GHG B;  5AW2 B;  3SFD C;  1Q82 Q;  4H44 C;  1NU1 G;  1Y47 A;  1QL2 A;  3HD7 A;  3Q2Y A;  2B1X A;  5KAI H;  3IN6 A;  1FZC B;  1FZE A;  3OAK A;  4WVZ A;  3B4S A;  1Q90 C;  1ZR2 A;  3WMM 0;  4XA4 A;  2AEM A;  4ZKU A;  4HH2 A;  4JBZ A;  1X79 B;  1CSB A;  2WSC H;  5AVV B;  1KMI Z;  1VF5 C;  1OW8 A;  2OTK E;  2WPV B;  2V7Q H;  1FDO A;  3AE1 C;  3HD7 C;  1NTK G;  1ZV8 A;  1SQB D;  1NHL A;  1KYO D;  2PAJ A;  1FOS E;  2Z5I A;  4D6T G;  3CXH I;  3G71 P;  1LWU B;  2YXQ B;  1VQL P;  2B87 A;  3TNU A;  1R5L A;  1SQP D;  5BU5 A;  1DD4 A;  1T6A A;  5AW5 B;  3FX0 A;  5CCG C;  2MJZ A;  2P58 A;  1L2P A;  1RE4 C;  1HWT C;  3BVH A;  1PP9 E;  5KLV J;  1NU1 K;  5CJ4 A;  1LTG C;  2BCC G;  1SQX E;  4KJM A;  5AVR B;  3QH9 A;  4NBB D;  2JP3 A;  1KQL A;  1SQQ D;  2LXC B;  1HJB A;  4A7P A;  5APU A;  3D70 A;  1X22 A;  2LXB A;  4HM1 A;  2E74 B;  3L74 D;  2JZA A;  3SWY A;  1PGQ A;  1G1J A;  1J1D B;  1O7N A;  4Z1M H;  1ZR4 A;  1URQ A;  1JY2 P;  1RFS A;  3T97 B;  5EFW B;  1AA0 A;  1GL2 C;  4HB1 A;  3HD7 B;  1GU5 A;  1JO5 A;  2WSE H;  1SFC C;  2AXC A;  1T2K D;  1RE3 C;  1VF5 D;  1MV8 A;  3K5B A;  2O1K A;  1J2J B;  2KZJ A;  1SP4 A;  3P8C E;  5APY A;  1XTC C;  1RQU A;  1LTT C;  3CCE P;  4ASV A;  3CXH E;  1VQ6 P;  2CKF A;  3L75 J;  1LJ2 A;  4GOD A;  1DEE G;  5KJ7 D;  3GL2 A;  2HOD A;  2KIK A;  4QDF A;  4DZO A;  1G2C B;  3H1I E;  1DIP A;  4OGQ D;  5HL4 A;  1KYO H;  2NPS C;  1VDF A;  2K1A A;  1O7G A;  3TNU B;  3O6Q B;  2IBZ I;  1DH3 A;  1Y8A A;  3Q5R A;  3L73 G;  3GB4 A;  1LT1 A;  1JY3 P;  3H25 A;  1NU1 D;  1VQ7 P;  2BEQ D;  2ZT9 D;  4N78 D;  5KKZ B;  5TIS E;  3H1L G;  2IZ1 A;  2B9B A;  3H32 B;  2OYH B;  1RE4 A;  2WT7 A;  5CBO A;  2WSE J;  4D6T D;  2E5Y A;  3H1I G;  4UB8 H;  3ITK A;  3RBX A;  3D6Y A;  5AVS B;  4HM3 A;  4DT0 A;  3B71 A;  2QIW A;  1NTM K;  2FYU K;  3L72 G;  1J1E C;  1YI2 P;  1UII A;  3CCL P;  3AEA C;  1ZXG A;  2FXP A;  1KIL A;  1JM1 A;  2KXP B;  5K5G B;  1EXJ A;  5GTH H;  3L70 E;  3CD6 P;  5C39 A;  3UIA A;  4QUP A;  1G8K B;  3AE9 C;  2XU6 A;  1IZN B;  1USE A;  3RBZ A;  5KKZ C;  2Q7C A;  2RH0 A;  3GF3 A;  2Q3I A;  4AQR D;  2FYN C;  1KYO E;  3TGU J;  5AW6 B;  5APV A;  2YFI A;  3D89 A;  1NDO A;  5TIS H;  3G4S P;  3CCV P;  1BSH A;  1FAV A;  1ZLL A;  1FE6 A;  4RJT A;  2XND H;  1SQQ G;  2W8Z A;  2AXT H;  1FJP A;  3Q1M A;  1ULJ A;  1N73 A;  1PP9 D;  1FQT A;  1VCK A;  3PJS K;  2E76 D;  3VMY A;  2KNC B;  3C8V A;  3L74 G;  2B88 A;  4H13 D;  3AEG C;  5DJT B;  3EFG A;  2FYU G;  3USS A;  2IYO A;  3MTU E;  1EZV I;  3HE5 A;  4U3F G;  1RY3 A;  3P32 A;  3H1L E;  3TSI A;  1VQN P;  2ZVO B;  1BCC J;  3HUS A;  3RL0 C;  1JB0 J;  1FJK A;  2K88 A;  3L75 G;  2E75 C;  5CCH D;  1SJG A;  3CCU P;  4M3L A;  3MZW B;  2DE6 D;  3A7O A;  1R5S A;  2KUB A;  1L0L G;  1M8O B;  3CX5 D;  2JWA A;  5B66 E;  2POH A;  1TU3 F;  2XRX A;  1N2D C;  3SFE C;  3A0B E;  1FDM A;  2R5B A;  1M90 Q;  1GD2 E;  3H1L J;  4B86 A;  3C9I A;  1BCC E;  1BGY G;  1EG9 A;  5KLI C;  4OWF A;  2QPZ A;  4Y99 C;  3H32 A;  3M0D A;  3WUT A;  1URQ C;  2Y0C A;  3PRJ A;  3CI9 A;  2IBZ E;  4RO0 A;  3D71 A;  2WWW A;  3VMX A;  2CK3 H;  3H1L D;  5AW1 B;  3VMZ A;  1S9K D;  3FXE A;  3RL0 g;  2FFD A;  3KZI E;  2HPC A;  3CC2 P;  3N0Q A;  3AEB C;  2QJK C;  2OYI A;  3H1I D;  4HM5 A;  1WT6 A;  4HJL A;  3CPW O;  4I1L A;  1KQS O;  1IFM A;  1KB9 I;  1NTK D;  1O7P A;  1PPJ E;  3U59 A;  2YFL A;  4QUQ A;  3FXD A;  2M3E A;  4PJ0 H;  3U1C A;  1EXI A;  2JKV A;  1FZF A;  2K9J B;  3IFM A;  2XR8 A;  2BCC E;  3L4F A;  1N73 C;  4NBD D;  1H0T B;  1SQP G;  4EIJ A;  3P8M C;  4WBA A;  1LTA C;  3A0H H;  1BE3 E;  3WU2 H;  1M57 D;  3GZX A;  3F89 A;  4H44 B;  2YKO A;  1P84 D;  1GK4 A;  2WT7 B;  1GL2 A;  2BCC D;  3E7K A;  1MZ9 A;  1U7J A;  3CWB E;  3GW6 A;  5L8R J;  1PL5 A;  2A06 E;  5CCH A;  4U3F D;  3TGU D;  4IOI H;  1NTK E;  3H1J D;  2J5U A;  2D2C D;  5AW0 B;  1GK6 A;  3VOP A;  1L0N D;  3I55 P;  1QVF O;  3KDP B;  1KTM A;  3EQ2 A;  1NTK K;  2QJP B;  2HMM A;  4GDO A;  5TJH A;  5CCG D;  3SSU A;  4HJG H;  1LWU A;  1SQP E;  2KB7 P;  2FYN B;  3OJA B;  1GU4 A;  4BRY B;  1NYH A;  1HBW A;  2R5D A;  3MHV A;  2YMY A;  5H2F H;  3HE5 B;  5BU8 B;  1KD1 Q;  1NOH A;  2L91 A;  2W83 C;  4AUW A;  3RK3 B;  2HMK A;  3G3Z A;  4XFJ A;  2H89 C;  3AE7 C;  2HML A;  1YQ3 C;  3EFF K;  2KLV A;  2OYI C;  3GMA A;  3TF5 A;  4L74 A;  2ZT9 C;  2YFJ A;  2B87 B;  1N7S C;  2BMO A;  3GZY A;  1BCC G;  3H1K J;  2AEJ A;  3FWL A;  2M5A A;  2M8R A;  4U3F J;  1KIL C;  2E4P A;  5GTI H;  1OX3 A;  1NTM G;  2GA1 A;  4LC1 A;  2XNX A;  2OYH A;  1T8Z A;  5KJ7 C;  3SWF A;  2NPS D;  3RK2 C;  1EDI A;  2AEF A;  3H1K D;  4GT1 A;  3RK3 C;  2M5A B;  1FZC C;  2FYZ A;  2NUK A;  4OGQ C;  3Q5P A;  2JJL A;  4RKU J;  4IL6 E;  3AEC C;  5KLV E;  2KK7 A;  2R32 A;  1NTZ G;  4ZKP A;  2HG5 D;  4P1C H;  3TGU G;  5APW A;  1HF9 A;  2ZJS E;  2N1T B;  1L0N G;  2I7F A;  1OIP A;  1BE3 G;  2A45 H;  3BAT A;  1SQQ K;  4GIF A;  1Z56 A;  2SPZ A;  3CCJ P;  2YMK A;  2H88 C;  2NWF A;  4TT3 H;  5B5E H;  1L0N E;  1WMK A;  2D2C C;  1S72 P;  4ZMD A;  4UB6 H;  1G2C A;  2P1J A;  1PPJ D;  3H1K E;  1NYK A;  2FYU D;  5KTB A;  2ZYL A;  1N7S D;  5CMZ A;  3DQY A;  4IL6 H;  3M9B A;  3VMA A;  4N78 E;  1H8A A;  1W2B O;  1SQV K;  3O6Q A;  2OAR A;  1NTM E;  1VQ9 P;  5BOK A;  1L0L D;  1LNQ A;  3C1L A;  3AE5 C;  3GKE A;  2KYV A;  2YIU B;  1NH4 A;  1N86 A;  3CX5 I;  3LID A;  3H1H E;  4K35 A;  2JDI H;  1KB9 H;  1BGY D;  1KOR A;  1E79 H;  3ABV C;  1VM9 A;  3PHL A;  3L72 J;  1HH0 A;  1PIX A;  1RE3 A;  2YKP A;  1UUW A;  2ITA A;  2JEE A;  2E75 D;  1RF1 C;  2W6A A;  3KPE A;  1L4A C;  1S4X A;  3FGA D;  1ZP0 C;  1ULI A;  3VP9 A;  2IPP A;  2NVF A;  1SFC D;  2Q1K A;  2QA4 P;  2QSI A;  2E75 B;  1LGH B;  1NTM D;  1URQ D;  3T97 A;  1ZRT E;  1H89 A;  3O8Z A;  1J1D C;  3PTZ A;  3R4Y A;  1BE3 D;  5M1B A;  3JC2 2;  4W80 A;  4L75 A;  1S3J A;  2OYH C;  3L71 J;  3CL3 D;  3M06 A;  1SFC B;  1NTM J;  4BXL A;  4YPC A;  3SWK A;  1NTZ D;  3BRT B;  1YIT P;  5AW7 B;  3PLN A;  4AAY B;  2IZ0 A;  2M0B A;  4NBA D;  5KLV G;  2RMZ A;  1Q81 Q;  3OW2 O;  1VQO P;  1L4A B;  2VRS A;  2FFD B;  2N1T D;  1JMM A;  3P7K A;  3F5H A;  1OMI A;  2PFX A;  3BCC E;  3CWB G;  2WIT A;  3BAS A;  3CCS P;  1RF0 A;  2XSH A;  5B66 H;  3PH0 A;  2HLO A;  2HYN A;  1VQM P;  1EDL A;  1PGP A;  3H1J G;  1JY2 N;  1IO4 A;  2ZT9 B;  3AE8 C;  1U7M A;  3L71 D;  3R2P A;  1LP1 B;  1SQV E;  2E43 A;  1N8R Q;  1PFI A;  2Q3W A;  2IDB A;  3M0A A;  2A45 G;  4HM8 A;  2C9L Y;  2XV5 A;  3W67 A;  1OW7 A;  1LTB C;  2WTY A;  3BCC J;  1VQP P;  4WY4 A;  3V4Q A;  1ZRT D;  2QVA A;  1NO4 A;  2ZAE B;  1QGK B;  1FDI A;  4JYB A;  3H1H D;  1MFT A;  2GUS A;  1PZQ A;  1YTZ T;  2ZXE B;  3U1A A;  5AVU B;  4W7Z A;  2IBZ D;  3C0D A;  1SS1 A;  2E74 D;  3L73 D;  2HMN A;  2ZYA A;  1A02 J;  1OWA A;  3M9Q A;  5GTH E;  3GF7 A;  5CCG A;  2P10 A;  1NAF A;  4PD4 D;  1JUN A;  1GDT A;  2NPS B;  2Y0E A;  4HYT B;  1LTI C;  2Z5H A;  3WUV A;  5APQ A;  1SQP K;  3RL0 B;  3L72 D;  1UUV A;  2Q6Q A;  1GTW A;  1VQ8 P;  1K73 Q;  3CCR P;  1FZA A;  3H1J J;  1L4A A;  4K3A A;  3HTK B;  2E4Q A;  1YYC A;  2FBW C;  1Q86 Q;  1USD A;  1O7M A;  1NVO A;  3IAO A;  3CME P;  1JTH B;  1X9V A;  3CWB J;  1OVV A;  4PD4 I;  4IFF A;  1FS0 E;  2XKM A;  1SQX K;  4YXD C;  2B24 A;  1P84 I;  2YNY A;  4QMA A;  1NKZ B;  1GMJ A;  3B5N B;  5CHX A;  1M56 D;  2E76 C;  1AJY A;  2YXR B;  1PP9 G;  2IFN A;  3V2Q A;  1SLQ A;  2C0X A;  3H1J E;  2JWD A;  2YO3 A;  4IL6 X;  1QEX A;  3L71 G;  3Q3D A;  3MD0 A;  1X0T A;  3HUS C;  1KYO I;  3CLQ A;  4QUR A;  1JCD A;  4HM7 A;  2NPS A;  4D6T E;  5KAI E;  1N7S B;  1MKM A;  3GCE A;  1VL2 A;  2I1K A;  1YJW P;  5APT A;  1YHQ P;  3RK3 D;  1E5W A;  2P2U A;  1Y9B A;  4HM2 A;  3KXD A;  1SQP J;  3CCM P;  1HGZ A;  1EZV E;  2N1T A;  1HGV A;  4WY4 B;  1ZME C;  3V5B A;  5H2F E;  4UB6 E;  4TLF A;  1K8A Q;  3OA7 A;  1XTG B;  4Y99 B;  3KYQ A;  3L72 E;  4KT0 J;  1KFM A;  2UWJ E;  1FZB A;  4GOF A;  3A3Y B;  1BGY E;  4IFM A;  3IF4 A;  1M1J C;  5B5E E;  1N7S A;  4L76 A;  1OFC X;  2QJK B;  3AE4 C;  4NBC D;  3Q5S A;  2R44 A;  4H44 D;  2KSE A;  1X8Y A;  2Y9Z A;  1QL1 A;  4I7Z B;  1KN7 A;  5AVW B;  1FZG A;  1CW5 A;  1NAY A;  3VMG D;  4JYC A;  1IFD A;  1RH5 B;  2K3R A;  1SVF A;  1L0L E;  2GBW A;  4BWN A;  2ZYG A;  3GG2 A;  5KAF E;  3L73 E;  1BGY J;  1Q2N A;  2GUV A;  3RK3 E;  1S1C X;  1EQ7 A;  3S9O A;  3LW5 H;  3VYI A;  2QG4 A;  4EI2 A;  3V2N A;  2FYU E;  3MUD C;  4YTP C;  1GW3 A;  1K9M Q;  2NVG A;  2PRR A;  1NWQ A;  1QLE D;  1SQB K;  5AW8 B;  1VQK P;  5GTI E;  1P84 H;  2KS1 B;  3TDK A;  3KQG A;  3JCU H;  4ASW A;  1IFP A;  3AED C;  3FWN A;  1M1J B;  2E5T A;  2YVJ B;  1BE3 J;  1HVV A;  3AEE C;  2E42 A;  5CJ0 A;  3M91 A;  2JO1 A;  1Q7Y Q;  4NPD A;  2CPS A;  3GTE A;  2WSF J;  2ZXX A;  3CC7 P;  1OVU A;  3AE6 C;  1SQX J;  3L74 J;  4GOE A;  1NTZ J;  4WY4 D;  4NPE A;  4QDC A;  2V4H A;  3VTP C;  1NJI Q;  2O01 N;  2B89 A;  5AW3 B;  3A0B H;  1EDJ A;  2NRG A;  2LR2 A;  4NB9 D;  4I6M C;  4JF7 A;  5KLI B;  3MUD A;  3L73 J;  1SQX G;  4GKG A;  2Q5U A;  4C7N B;  1G1I A;  1BDC A;  3I56 P;  2I8D A;  2MKV A;  4W7Y A;  4YXW H;  1GW4 A;  1LTS C;  2W6J H;  4EYY Q;  1KB9 E;  3VMI D;  4C7N A;  1J1E B;  1AV1 A;  4PV1 C;  3IR9 A;  2Q9I A;  1N7L A;  4R4M A;  5CCH C;  2N1T C;  2O1J A;  3I5C A;  3WU2 E;  3H1H G;  1IJD B;  1HUC A;  4I2L C;  4AYC A;  4HKV A;  4Y28 J;  1LTJ B;  1CI6 B;  2BMQ A;  2DW3 A;  2HOD B;  2QM7 A;  2FY8 A;  4QCK A;  3E1I A;  1QVG O;  1IFN A;  1H88 A;  2P7J A;  1Q90 D;  1NU1 E;  2W6B A;  1IFJ A;  1LWU C;  2H8P D;  2O01 J;  1O7H A;  4PD4 H;  4DOJ A;  4OVN F;  2BCC J;  2KSJ A;  2XZR A;  1LP1 A;  1T2K C;  2C9N Y;  2A45 I;  3H1K G;  3W68 A;  1JCC A;  3V4W A;  1R8E A;  4NBH D;  3MGN A;  4I7Z C;  1KC8 Q;  1BDD A;  1GL2 B;  2V7Q J;  1AQ5 A;  1LT9 C;  3CXH D;  1BSN A;  2IX7 C;  1SQV D;  2FKW B;  3L71 E;  4DCK A;  2WPS A;  1FZC A;  5DJU B;  3L35 A;  3GTS A;  2PGD A;  1AFO A;  4OH8 B;  5KJ7 A;  5AEU A;  3MP7 B;  4N3Y B;  5AVZ B;  2G8Y A;  2C0W A;  2HMO A;  3BCC D;  1YJ9 P;  2WQY C;  3GHG A;  1MUU A;  2Y0D A;  3HE4 B;  4WY4 C;  2ZFC A;  2K9Y A;  1QX8 A;  3QWO C;  4RES B;  2R3S A;  1M1K Q;  2A06 G;  3VP8 A;  1URQ B;  2HFE D;  1NU1 J;  3L36 A;  1YQ4 C;  2J58 A;  2BEZ F;  1YJN P;  1LTJ A;  1RF0 C;  1VF5 B;  1S5L E;  4LLH A;  4EMJ B;  1YIJ P;  4IFD K;  2KLU A;  5AW9 B;  1FBM A;  3HD7 D;  2AXT E;  1S9K E;  1EDK A;  2KS1 A;  3EWK A;  2QM8 A;  3NFQ A;  3AE2 C;  3GL0 A;  3B5N D;  4H0L C;  5BVZ A;  2KZI A;  2WPR A;  1DX7 A;  4JPZ B;  1CI6 A;  2YO2 A;  3RK2 B;  4PJ0 E;  3RK2 D;  4NBF D;  1IK7 A;  4U7J A;  1NKN A;  1RQV A;  2NUM A;  1DD3 A;  2QEX P;  5CBN A;  2K9J A;  3MIW A;  3H1H J;  1MFZ A;  2XDJ A;  2E76 B;  4KHX A;  1T3J A;  3RGU A;  5APS A;  1S5L H;  2OTL P;  1IK9 A;  1RF1 A;  1JTH A;  1UIX A;  4NBG D;  1KB9 D;  4PV1 B;  1SQV G;  2NZ2 A;  1H0T A;  1W2E A;  2O01 H;  3D6Z A;  3GHG C;  4HM4 A;  2QJP C;  4EDF A;  2N9B A;  2LKM A;  3AEF C;  1SQB G;  5AEW A;  1GL2 D;  2Z4E A;  2FXM A;  2D2C B;  2OYO A;  4P1B H;  2I1J A;  3BCC G;  3WUU A;  4EOT A;  1KZU B;  4QDF B;  3N7N A;  2ZYD A;  4H0L B;  3G9R A;  3P8C D;  1SQQ J;  4QDD A;  2WPQ A;  2OYI B;  1G8J B;  2RKL A;  5KLV D;  1ZW0 A;  3V2P A;  2JR8 A;  4DJG A;  1EZV D;  1KFN A;  2WVR A;  1RIE A;  2J59 M;  3BRV B;  1JM0 A;  2A06 D;  3FOU A;  3CWB D;  4JQ0 D;  2IYP A;  1OZH A;  3L37 A;  5KLV K;  1JNM A;  1HJ0 A;  2HPC B;  1KQG B;  1L0L J;  2H43 A;  1A02 F;  3NXS A;  1M1J A;  3E1R A;  3CXH H;  2W27 A;  1NTZ K;  3A2A A;  1VQ5 P;  5AVX B;  1SQQ E;  1L0L K;  2O3J A;  1YTZ I;  1GZL A;  1SQX D;  3TGU E;  1KQF B; 
#chains in the Genus database with same CATH homology
 2WSE J;  2FYU E;  2OQQ A;  4YTP C;  4OGQ B;  4HM3 A;  3D6Y A;  2NVG A;  3H1K E;  3B71 A;  2QIW A;  1NYK A;  1NGM B;  2ZYL A;  3DQY A;  4H0L D;  3EQQ A;  4HM0 A;  2E74 C;  3AED C;  3AEA C;  2BMR A;  3O6Q A;  2FXP A;  4NB8 D;  1JM1 A;  1EXJ A;  1NTM E;  1ZOY C;  2WSC J;  3L70 E;  5CXM A;  5BOK A;  1WQL A;  4QUP A;  1G8K B;  3AE9 C;  2YVJ B;  3AEE C;  3AE5 C;  1U57 A;  5KKZ C;  2JO1 A;  3GKE A;  3GF3 A;  3GTE A;  2FYN C;  2WSF J;  1KYO E;  3AE6 C;  2YFI A;  3D89 A;  1NDO A;  3H1H E;  1S5L X;  4QDC A;  1KOR A;  2DE7 D;  3ABV C;  3Q1M A;  1VM9 A;  1ULJ A;  3VMH D;  3VCA A;  1PIX A;  4NB9 D;  1FQT A;  1VCK A;  2E76 D;  3C8V A;  4H13 D;  1UUW A;  3L75 E;  2E75 D;  3AEG C;  3GLM A;  2HMJ A;  3FGA D;  4AIV A;  3LW5 J;  2NVE A;  1ZP0 C;  2MKV A;  1ULI A;  3EN1 A;  4U3F E;  2NVF A;  1KIL E;  2QSI A;  3H1L E;  2E75 B;  4H13 B;  1KB9 E;  3VMI D;  1JB0 J;  1ZRT E;  1P84 E;  2E75 C;  1SJG A;  2YIU C;  3L74 E;  2DE5 D;  2DE6 D;  3R4Y A;  4PV1 C;  5M1B A;  4R4M A;  4NBE D;  3AE3 C;  1TU3 F;  2XRX A;  4HKV A;  4Y28 J;  2GBX A;  3SFE C;  4AAY B;  2XSO A;  1NTZ E;  4NBA D;  2BMQ A;  4QCK A;  1BCC E;  2G3A A;  1EG9 A;  5KLI C;  2QPZ A;  1OMI A;  3BCC E;  1PV3 A;  1Q90 D;  1NU1 E;  2XSH A;  1O7W A;  2IBZ E;  2O01 J;  1SQB E;  3D71 A;  1O7H A;  4H13 C;  1OW6 A;  3GOB A;  3RL0 g;  2ZT9 B;  3AE8 C;  3N0Q A;  3AEB C;  2QJK C;  3VCP A;  2QJY C;  4R4L A;  4HM5 A;  1SQV E;  1K04 A;  4HJL A;  2Q3W A;  1R8E A;  2IDB A;  4NBH D;  4I7Z C;  4HM8 A;  2V7Q J;  1OW7 A;  1O7P A;  1PPJ E;  2YFL A;  4QUQ A;  3L71 E;  4PD4 E;  3AZC A;  3GTS A;  1FDI A;  1EXI A;  2XR8 A;  2BCC E;  5AEU A;  4PV1 D;  4NBD D;  4HM6 A;  3CX5 E;  2JO6 A;  1K05 A;  3C0D A;  1BE3 E;  2E74 D;  2G8Y A;  2HMN A;  2HMO A;  3GZX A;  4H44 B;  3SFD C;  2WQY C;  4H44 C;  3CWB E;  3GF7 A;  5L8R J;  2P10 A;  3Q2Y A;  1PL5 A;  2K9Y A;  2A06 E;  2B1X A;  3IN6 A;  1NTK E;  1YQ4 C;  1Q90 C;  2J5U A;  2D2C D;  2BEZ F;  1VF5 B;  4EMJ B;  1KMI Z;  1KTM A;  1VF5 C;  2HMM A;  1UUV A;  1OW8 A;  4GDO A;  2WPV B;  1FDO A;  3AE1 C;  1SQP E;  3EWK A;  1NYH A;  2E4Q A;  3GL0 A;  3AE2 C;  4H0L C;  2FBW C;  1O7M A;  3IAO A;  1DD4 A;  4YXD C;  4NBF D;  2B24 A;  1IK7 A;  4U7J A;  1PP9 E;  1GMJ A;  1RQV A;  2NUM A;  1DD3 A;  1SQX E;  2HMK A;  4XFJ A;  2E76 C;  1AJY A;  2H89 C;  3AE7 C;  2HML A;  4NBB D;  1YQ3 C;  2JP3 A;  3H1J E;  2E76 B;  4IL6 X;  3Q3D A;  3GMA A;  3D70 A;  2ZT9 C;  4HM1 A;  2YFJ A;  2E74 B;  2JZA A;  4QUR A;  4HM7 A;  1UIX A;  4NBG D;  2BMO A;  1O7N A;  4PV1 B;  4Z1M H;  3GZY A;  1MKM A;  3GCE A;  1RFS A;  1VL2 A;  3T97 B;  2NZ2 A;  4HM2 A;  1Y9B A;  3D6Z A;  2E4P A;  4HM4 A;  1EZV E;  2QJP C;  1VF5 D;  3AEF C;  1ZME C;  5AEW A;  2D2C B;  4P1B H;  3L72 E;  4QDF B;  4KT0 J;  1RQU A;  4H0L B;  3G9R A;  2NUK A;  4OGQ C;  3CXH E;  2CKF A;  3Q5P A;  4QDD A;  4RKU J;  3AEC C;  1G8J B;  3GL2 A;  5KLV E;  4QDF A;  3H1I E;  3AE4 C;  1DIP A;  4NBC D;  3Q5S A;  4P1C H;  4OGQ D;  1RIE A;  5HL4 A;  4H44 D;  1HF9 A;  3FOU A;  1O7G A;  4I7Z B;  3VMG D;  2I7F A;  1L0L E;  1HJ0 A;  3Q5R A;  2GBW A;  1KQG B;  3GB4 A;  3H25 A;  3L73 E;  2BEQ D;  2ZT9 D;  2YMK A;  2H88 C;  2NWF A;  4TT3 H;  3RK3 E;  1L0N E;  1S1C X;  3S9O A;  1SQQ E;  1WMK A;  2D2C C;  3TGU E;  1KQF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...