4H14A

Crystal structure of bovine coronavirus spike protein lectin domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
287
structure length
287
Chain Sequence
VIGDLKCTTVSINDVDTGAPSISTDTVDVTNGLGTYYVLDRVYLNTTLLLNGYYPTSGSTYRNMALKGTLLLSRLWFKPPFLSDFINGIFAKVKNTKVIKKGVMYSEFPAITIGSTFVNTSYSVVVQPHTTNLDNKLQGLLEISVCQYTMCEYPHTICHPKLGNKRVELWHWDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGTVLSHYYVLPLTCSSAMTLEYWVTPLTSKQYLLAFNQDGVIFNAVDCKSDFMSEIKCKTHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike glycoprotein
publication title Crystal structure of bovine coronavirus spike protein lectin domain.
pubmed doi rcsb
source organism Bovine coronavirus
molecule tags Viral protein
total genus 72
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16451 Spike_NTD Spike glycoprotein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.960 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4h14A00
3R4DB 4H14A
chains in the Genus database with same CATH superfamily
3CJIA 1WCKA 2ZHKA 1KD7A 2W68A 5DAXA 4CP2A 4DXZA 3V65A 4AVCA 1FT9A 2HEWF 4ES9A 1DGLA 2RDSA 3PVEA 5FUIA 2BFUS 5IAVA 5FP9A 2C9AA 2A6ZA 3QACA 4JHZA 3Q8BA 2WAOA 4RHV3 3R4DB 3BOPA 4PDWB 4B1LA 3OUJA 1GP4A 3KCYA 1OQEA 4JKKA 1VBD3 3X29B 1T6BX 2KXLA 4AQTA 1OUXA 3DPRC 5AVPA 1QXRA 3S5AA 1OKQA 1VE0A 2CHHA 3NJXA 1OVPA 2FCTA 5C4WA 3MIDA 1QQP2 1RUNA 1YWKA 3V0BA 2VQTA 1WW5A 3O1TA 4COVA 5A80A 5BV6A 4B8EA 2AR6A 1Z7S2 3U0ZA 4G4FA 2GU9A 3IB3A 1PGW2 5AVAA 4X8NA 5LRRA 1GU3A 3ZX7A 2JDKA 1RUG3 2QTWB 1LOFC 3MYXA 5GM0A 2QKDA 2KM2A 4RGAA 5HBAA 3PURA 4LKSA 2ZZQA 1PX4A 4UFIA 2IXLA 3WNLA 4AI3A 4COZA 1VLNA 3E5XA 1AYM2 3AZVA 2J1VA 4XDPA 4ZU4A 1Q5OA 1Y3TA 1D4M2 1F15A 2A70A 3IMMA 1AL23 4XACA 4MSVA 1HJFA 1NX9A 1LHUA 2HWF3 5IFPA 4LIVA 1GYKA 1C4RA 2C5DA 3RYPA 1UPIA 3WF4A 1N1YA 2PLV2 3KCXA 3VV1A 2BERA 3DXTA 2ZMLA 4B29A 3B7MA 3BALA 3M3IA 1YFUA 1RUI1 3B01A 2RM23 5FRAA 1MS8A 2ARAA 2RS51 1ULOA 3AVSA 1T2XA 2A6XA 2E9QA 5FZAA 5BNPA 1OSGA 1QF3A 1VBE3 1ENRA 1VP6A 3T3YA 2P6CA 3VBRB 4ATFA 5FP4A 2CWMA 1VBE2 2Q0AA 5FZBA 4BA6A 3RFRA 5FZEA 1W0OA 3GZTB 5EJ1B 2J1TA 1TME2 2YYOA 4AHYA 2EIGA 2Y6KA 3H50A 4CP9B 4PHZA 3NAPB 3JD71 1PIV2 2YZ4A 3WQ1A 3N9LA 1TE1B 1FOD3 1K12A 4XMIA 4JX0A 4XXPA 2D7FA 3SQOA 1MZEA 4O61A 3ILRA 2WIIB 2ZGLA 2VCCA 1PMHX 2G9ZA 5E88A 3WQBA 4A7YA 1CX1A 1AR71 2ZX0A 1PO23 4UBGA 3I7DA 1PO13 1SPPA 1JU3A 1S2KA 4N53B 1DU3D 5KHHA 1SFNA 4K1ZA 1GFF2 1IKPA 4NHLA 1X33A 3VKFC 5ABJA 3THCA 5AC93 4LKEA 3AZZA 5A3PA 5HI0A 3IMNA 5H9PA 1VRH2 2XL9A 5KR7A 2E7TA 1S1AA 3H9AA 2VZPA 4GWMA 3SITA 4K8RB 2PHDA 2VOKA 3IBMA 1RUH3 5HCAA 2BOJA 2WAAA 2CNAA 1GOHA 4L9BA 5JCTA 3FWEA 4GJZA 1DYOA 1MQTB 2BRTA 2VMCA 4MO3M 5KC5A 1K5MB 4IEVA 2PHXA 1F31A 2HWE3 1V6IA 1KRIA 4NRQA 1R092 1YFWA 5BNOA 2ZAAA 2VNRA 3ZFGB 5EWSA 4EN9B 2FD8A 4CSWA 1NOVA 4IEQA 4XF9A 3THDA 4DMIA 5FLIA 3SH3A 5A32B 3SHRA 5JZGB 3AKPA 4PDWC 1JHNA 1VMHA 4RS5B 3ZFFB 2WA3A 5L7OB 3RRDA 4AGGA 5JXGA 2VNGA 2ZCWA 1YIPA 1YUDA 1WMFA 1W05A 2YFZA 4IV1B 2V5YA 1W8FA 3SXWA 5CKNA 4UAPA 1RVF3 1X8MA 3ACLA 3ZIWA 4ASKA 4JHTA 3NV4A 2IC1A 4Q8LA 1B35B 2EXIA 4TLGA 1CAWB 3DN7A 1W8WA 4CEWB 5IVJA 3INAA 5KHJA 4BXSV 4MGIE 5CA6A 1ODMA 2DFCA 4PBPA 1BZWA 3PUAA 1KXGA 1DG6A 5A7PA 4CU6A 4R9BA 5FOBB 4GZ9A 1CIWA 3VBSB 4L11A 2R072 3WG1A 2WL1A 4MOAA 2G9FA 2PA7A 4XJWA 3K48A 1UKRA 1KQRA 3IWZA 3V56A 2MEV1 4CXYA 4CYDA 5ANNA 1W39A 1A8MA 2VULA 3MLLA 2AUYA 5EFUA 4ORFA 4Y5TA 3OGRA 3LPGA 3T08A 1SMVA 2P17A 2DCZA 3A22A 1BLZA 2OA2A 3AKRA 3LDBA 1JODA 1GOGA 5ERLA 2MHFA 4NAOA 3UGFA 3WEZA 1OFSA 4G9SB 3MEPA 5A3UA 3EB7A 4MGSA 5GJ6A 4COWA 2VZOA 4WM7B 4CCDA 1NXD1 2XMLA 2BWAA 5T54A 5FZCA 3VBRC 3SEEA 3BTZA 1BMV1 2P3JA 3TOJA 2ADEA 2ZGSA 3NO8A 1WD3A 4YPJA 2LW8A 3FLRA 5CNAA 1WZXA 3TEZA 1HQNA 1QJX3 1CONA 1V70A 2A3XA 1VAMA 2GN3A 2ZX1A 3NAPC 3O7OA 4LKFA 1AL0G 2Y34A 4AEKA 1NCRA 3K4AA 5C5UA 2FDHA 4M3CA 4BLIA 1HW5A 1W9FA 1WW4A 1W6NB 3MV01 4H14A 2YV8A 5C3SA 2OUJA 3OTFA 1MPXA 1IS5A 5EHDA 5FZ8A 1AYN1 2GC1A 4NPLA 1HDKA 4RHV1 4XF3A 1DQ6A 3JUUA 1DGWX 4HOOA 3VL8A 1VBD1 1IHMA 2WNOA 4XE9A 5DAPA 4N53C 5E16A 3AB0A 3U37A 1D0GA 5I0SA 4Z82A 2YC2A 3GCWA 5FZIA 1PM4A 2AGSA 2VAUA 4XUOA 5ACA2 4KL1A 5K0UA 3AFKA 1DFQA 1GQHA 2HH9A 4Q4Y3 2LROA 4RGGA 4YG3A 5FKBA 5FZGA 3UGGA 5DN2A 4Q4Y2 4D69A 2FZ2A 1V9U3 2VZ3A 3JZVA 4P5YA 3KSCA 2Y0IA 5FR3A 3O1OA 4BH9A 1QY4A 5DAQA 1RUG1 3P5BA 2I74A 3L2YA 4AXOA 2UWAA 3CJIB 2AZ5A 3SKJE 2XGXA 4ZY9A 4OI2A 4FTEA 4LBJA 4I0AA 1CAXA 4IUGA 1K5MC 3RNSA 4PLMA 3W9AA 1YRZA 3AK0A 1AL21 5KXDA 5IVCA 2VUAA 1MZ6A 3ZYRA 4YW1A 1EV13 2PHLA 2HWF1 4JQTA 3ZFGC 1J84A 4OZXA 4WBBA 4WVZA 4C90A 1RHI3 2VXRA 1P8JA 4DY3A 5C4WB 5JZGC 3WF0A 5DDJ3 2JDHA 3V0BB 2G19A 2RM21 1XU1A 2PAMA 3K4DA 4RS5C 1JH5A 4OHXA 2WRAA 3ZFFC 4YM1A 2VQUA 5L7OC 2B9VA 1DQ0A 3I3MA 1XB9A 4XQWA 1MS5A 3N7MA 4IV1C 3BPSA 1MEC3 1MS0A 2C0ZA 3SNMA 3MIEA 1YJLA 3T2TA 1GBGA 4A45A 2JE7A 3U14A 3ZYFA 1B35C 3JBG3 1NY71 4MV2A 4D3WA 3JQWA 4CEWC 1W3VA 4P14A 1FOD1 2D5HA 3LSDA 3VBHA 3ZO0B 1KEXA 4XZPA 1L7LA 5CKMA 3T1LA 1NLRA 4BQ2A 2WQ8A 1DIWA 1US3A 5IWFA 2DCYA 5I8YA 1EUUA 3VBSC 4Y1YA 1B09A 1PO21 2XJVA 2E63A 4IE4A 1PO11 4DXTA 2XHNA 4IGQA 5FZ4A 4AEMA 1CX4A 1SDDB 2WS92 4XQDA 4YGBA 1MR5A 1ZZ8A 3VKLA 5BNPB 3WXPA 5AC91 2BWCA 4GKYA 1E5HA 4Q0SA 2EICA 1T6GC 4ZS3A 1RIRA 3ALQA 4NHYA 4AI1A 1DP0A 2ERFA 5J09A 2EAKA 3DKWA 4YW4A 1IS3A 3T0BA 4WM7C 3UNPA 1RUH1 2A3WA 3QLQA 1X9PA 1X9TA 1DZQA 2ZHLA 5D8AA 5APAA 5JPNB 1RL3A 2UYBA 2ZGNA 2QVSB 2CY6A 3POJA 4L97A 4TXWA 2HWE1 2QJVA 1XU2A 2XLFA 1PGSA 1QJFA 2QQLA 3VLBB 1SPPB 1H8TA 1OOPA 1RUF2 3DGTA 4O9GA 1SLAA 1UOFA 3I97A 1LGNA 1RUJ1 5JAXA 4CDUA 4AEJA 2FDKA 3K4ZA 5ABJB 3Q8EA 4PIZA 2LM3A 1IOAA 3J7NA 5F1RA 1QJU3 5L9RA 1U5IA 3I3EA 1DYPA 1SHWB 3CU7A 4QDQA 4XF0A 4Y20A 2BNOA 1DQ1A 1RVF1 4NOTA 1X50A 2R16A 4I02A 2JEMA 4HK9A 4QB2A 5IFTA 3AKQA 1XPWA 1TMF2 1RUC3 1ND2B 1YJKA 1LRHA 3CJIC 2H6CA 1RUC2 1SLTA 3JB4C 2VL4A 3ROUA 3ZYHA 1VPHA 3WW3A 1RMU1 1W9WA 1I5ZA 4OHZA 5FMOS 3LE0A 3GHMA 1YQCA 4XZUG 4Z8BA 4DZGA 5H9RA 2ORZA 2GC2A 2WINB 3LAGA 3ZSLA 5A1AA 2R49A 3A7QA 1ZBA3 2VY0A 5FZKA 5C4WC 1LJ7A 3LEKA 4CUGA 1ULGA 3WG4A 1REDA 4E4HA 2XG3A 5B4NA 2YROA 2SLIA 1GANA 4S2HA 4XFGA 4AGVA 3N36A 4QXBA 2W47A 1SACA 2QQMA 2XVLA 4XURA 2B7YA 3FHAA 1TVGA 3WNNA 1GWLA 4BQ5A 4MLOA 1HLCA 1SQ4A 5IUQA 1N3QA 3WP5A 3ZXAC 3QBQA 1G7YA 3KV5A 5K8SA 2ZGMA 4QKBA 2P4EA 1US2A 2OZJA 2R30A 1A3KA 3A4UA 4WVVA 2NP0A 2D6NA 3PHMA 4YWAA 3IKWA 1QJX1 2OPKA 4XCBA 5FZ7A 5JMCA 3HNYM 3EYPA 4IL7A 3M8LA 3S57A 5A7SA 1RUE2 3IN9A 4SLIA 5FP3A 3ZN6B 3ZYBA 1ZA7A 4PCRA 4CU8A 2AENA 3ZM8A 3O1MA 2Q8CA 2IUWA 1HN1A 2ZX3A 4JDOA 4L8QA 4PI0A 2CGNA 2LRPA 1OFNA 2O1QA 1E5RA 2OIIA 2R043 1HX6A 1XRUA 1GOFA 4LUKA 4QMAA 4IEOA 4Q8KA 3LOIA 2VPVA 4CU7A 1BEV3 4LBQB 3RDIA 3WSOA 5FFOC 3WNOA 5BNPC 1ZNPA 4Y5Z0 3B93A 5F39A 5K4LA 3PDQA 3E6CC 4BIFA 2VZSA 4I2OA 1V9U1 3J9SA 5BPXA 1W9YA 5KC6A 4CP0A 3WNXA 2PAEA 4LUMA 2DU1A 1H1IA 4QX8A 1UIJA 1IPKA 1Q3EA 2YGLA 2R063 4YNIA 2W9XA 1XNTA 1KGYA 1NA1A 5FYSA 1NCRB 3WF1A 1H9PA 1AR82 2E7QA 1H2NA 4Y4RA 4M3CB 1GZCA 2PHUA 4P9GA 4UFLA 5FDBA 5BNNA 4GWNA 5C3PA 4JCKA 1RUD3 4OUSA 4AAPA 5KXCA 2HBTA 1V6MA 1AR63 1LHVA 4LJHA 1FMD2 1EV11 2LS6A 2OZ6A 2VUCA 4MH0E 4N7UA 4CCJA 3OJBA 1VMFA 4ARXA 5JXJA 4LBLA 4M4RA 1RHI1 2EIBA 3LWCA 2W1SA 4P00B 4FOYA 3J8F2 4QPIB 5ABJC 5K0UB 1LEMA 5DDJ1 5T3NA 3LKJA 3HT1A 3DEMA 2C9KA 4KGQA 3ZXDA 2ZJCA 1LU2A 1GSLA 1OI6A 3UKVA 3ZYGA 2JICA 2PHFA 4OUMA 2RE9A 4TN7A 5EZWA 5F8PA 1SBFA 5FYZA 3TAYA 4I30A 2YC4A 3Q8FA 5A7OA 1HRV2 3GZAA 1MEC1 2KR2A 3WW2A 4NE9A 3N7LA 2GC3A 2JD4A 3PJQA 1BJQA 3LGRA 1LOBA 5GLZA 3UL2A 3R6SA 2B9UA 1PZ9A 3AMNA 3JBG1 2ATFA 1MS1A 1ND2C 4W6WA 1K3IA 3O5SA 2VH9A 4CA9A 1CR7A 4LXLA 5EQUA 1G9AA 4J1WA 4CXXA 1IPJA 4C91A 4DOUA 1JZ4A 2PHTA 2O8QA 3ZFEA 1XE8A 5CU1A 3OGJA 5FZ9A 2NN8A 4KG0A 1LGCA 4HL0A 1XJAA 2VW2A 1UY1A 2PFWA 3ACHA 1VBC2 1WMEA 1AR91 1CPNA 1AZDA 3HWJA 4IV3C 3THPA 1K42A 1YQ2A 3MDPA 1UZVA 5E1RA 1BHGA 5L73A 2ZA9A 4FP2A 1D2QA 2Q8OA 3SCGA 1JUIA 4AF9A 5SV5A 4Z2AA 1UY3A 2JKBA 4META 1RJ8A 2WO2A 3WNKA 1YEWA 1GZTA 4EE2A 5K9YA 2LUWA 2XBO3 1DQ4A 2XQRA 1E5IA 4IGOA 2XBO2 4AWDA 5LB6A 1H30A 3K46A 3WG2A 4YM2A 1PZ7A 5B2GB 4RN5A 1QOSA 5B4XA 2JG9A 1ND3A 2GAUA 5F3GA 3WLUA 1LECA 3WQ0A 1Y4WA 1OA4A 3UJOA 1JOJA 1ULPA 5FYMA 4C0HA 3IAQA 2O14A 5C8CA 2RS33 2VGDA 4Q4W2 4N90A 4Q26A 3B02A 5HCHA 1FPN3 5TSWA 4QD2A 2HWB3 3WT3A 4A44A 5LY1A 2FDFA 1CVNA 4K20A 1G8WA 3AYDA 3SCFA 2BGPA 3CO2A 4LO8A 1QJU1 3PUHA 4XFFA 3AFGA 1UZ0A 4N43A 1UXXX 3AP6A 1UZYA 3WCSA 3ZMOA 3EQEA 4QQOA 1JYNA 1W2NA 4QDSA 2WKKA 1WA4A 1F8VA 4YM3A 5LBBA 3H8RA 3DUIA 5F3EA 4DUXA 2WN2A 5D8AB 2YU1A 4LBOA 1OD5A 2JB8A 2VZRA 4MGYE 2B4KA 4XFIA 1REFA 2X29A 1G9FA 1Q8PA 3RWKX 3J7HA 1OQ1A 1NCRC 3N9NA 3WP4A 4KNCA 1H8TB 5KHIA 1OOPB 1WLDA 2AEZA 2J1AA 2Q8EA 5FZ1A 2ZGRA 4CDXA 4QX5A 4HKWA 5FQ0A 1D2SA 3B00A 2XJUA 3PTYA 1OF4A 1HB4A 1W9SA 4QQ2A 1W2TA 5EYYA 1DGRN 4P08A 2JG8A 1JOPA 2WQZC 3KV4A 1Z0HA 1XNCA 1ZBA1 4A7ZA 3C7GA 1ST8A 4XUTA 4QPIC 1ZZ7A 2DFBA 4DXRA 1Q8OA 5K0UC 3GXUA 3ILFA 4Y20B 4Q4V1 4QB1A 4QPGA 4XIOA 4BDVB 3OD0A 4KG8A 4KU7A 4FPOB 2ILMA 4NJ4A 3T0AA 2WLQA 4XBQA 5GZCA 2I45A 4W50A 3LEIA 3Q9OA 3T2PA 2XH6A 1Q8QA 1GICA 1BK1A 1VBA3 4LO7A 1QIQA 2HLEA 1JHJA 4R52A 1JOBA 3HN3A 4JC1A 1ONAA 2HWD3 3PU3A 1ZZ6A 3RZHA 3DXUA 2HWD2 3PVNA 3T4VA 4BE3A 4K21A 4MHUA 1EAH3 5CFDA 5A6ZA 3U07A 3WNPA 2JD9A 1EAH2 1UXZA 1YYNA 4ASLA 4E2GA 1YQ6A 3POBA 1JZ8A 4NHKA 3U75A 4XDOA 4OCTA 3E1F1 5C9AA 3FHQA 1MS9A 1EY2A 4NIHA 4QGNA 4GB33 2XQXA 3I8TA 2WABA 4GB32 2R041 3VD5A 1DQ5A 2VECA 5J36A 3VKOA 1LTEA 3KGLA 1JYIA 3H3LA 1BEV1 4P9WA 2GDFA 4UW6A 2WBKA 4YG6A 4W6XA 3RVHA 4F7ZA 4BK4A 1ZZBA 1W90A 4KGGA 2A5ZA 3VHOA 1HRI3 4PQQA 5CIRA 3OCPA 5FMOL 1HRI2 1AF9A 1MVQA 3PIJA 2BW8A 4YW3A 2DF7A 3I2HA 2YPDA 2GMMA 2R061 5F7UA 1DYKA 2QDRA 2GP3A 2K9ZA 3LDRA 4DUWA 2W87A 4GWJA 4Q0VA 1O3QA 4FSJA 1TEIA 1I9RA 3I2IA 2D6KA 1RUD1 4FOWA 3SKVA 4IEXA 4AVAA 1AR61 3J7LA 3C3VA 1L3JA 2E51A 2OS2A 3H7YA 4LBKA 5JWPA 4KQ7A 4JAAA 5J37A 1V6OA 2XL7A 1W2OA 2BBVA 4F3JA 2D3RA 2NMOA 2YBSA 3C7EA 4HETA 3LEMA 2IXHA 1N3PA 1QXPA 1UPSA 3UJQA 4BCUA 3FLTA 1H2KA 1QQP3 2JDAA 3DECA 4IGPA 2JJ6A 1W06A 2J1UA 3MLKA 4TLFA 1LHOA 2BZDA 1Z7S3 1NXMA 1AXZA 1XE0A 5DZEA 4LNVA 4NR1A 4FFGA 1NA1B 2Y6FA 1LEDA 4QPYA 3UYJA 5D8AC 5FY1A 5GZFA 2HWC1 2DWRA 3OPZA 3VZOA 4XIKA 1LGBA 2C26A 5BNNB 3MV11 4YVSA 5FXWA 1AYM3 1QKQA 4CCCA 1H4HA 3KHCA 3AZWA 1D4M3 2IXCA 4FPYA 3ZN4A 3NJYA 4HVOA 1LOAA 4J1XA 1H8TC 4EWAA 1OOPC 3MW3A 4P5HA 5FMCA 3MUY1 3B69A 3CZUA 5FMDA 3JCIA 3N35A 3RZMA 1SLIA 2YGMA 2PLV3 3USUA 4CRQA 4OUEA 2YBKA 4L0PA 1PK6A 5AFBA 2CGPA 2KA3A 5CFCB 1APNA 1JBCA 3HQUA 1NLQA 4IE5A 4ZU7A 1R1A2 1O59A 1WA6X 2WFPA 1U5ZA 1D4VB 1UZWA 3ZSJA 5FZ0A 4ISQA 3B94A 3LSEA 3POIA 3BOWA 4I3PA 5H9SA 3NKTA 4DFSA 3Q8CA 4C1WA 4XUPA 3CKHA 3OOXA 2C24A 2WZPP 5FPZA 4B4QA 2MNGA 5EIYB 5F5QA 1CAUA 2D6OX 2A73B 1CQ9A 4W4ZA 5J1XA 1TME3 5FXZA 3PMSA 1REEA 2RR12 5FZLA 3ZPOA 2NZ9A 2XLGA 4XC9A 1K5JA 1PIV3 4L2NA 5FK8A 2AACA 2RDRA 2VBPA 1NG0A 4UFKA 1FI2A 5FLJA 5C8WA 1ZX5A 3WDUA 3HNMA 4Q5OA 5FBZA 1W0PA 4UFMA 4IEPA 3RMXA 2BBAA 2RS31 1PVC3 3BGAA 2YU2A 2DVBA 4AVVA 4FT8A 1FPN1 1PVC2 2X5IB 2HWB1 2WZR2 4LHNA 2W0XA 1CWPA 1NT0A 1LB2A 4U36A 3RPQA 4F83A 3O1UA 3CNAA 2XKOA 1CN1A 2QNKA 3UV9A 1BKZA 1VRH3 4XTMA 4O65A 5FY7A 3HD8B 4H2AA 3VZKA 5JXHA 1LESA 4M3CE 3HIFA 1IGOA 3OG2A 3PU8A 1ULEA 1ASJ3 4DRRA 4FOVA 3CZJA 1ASJ2 1QJEA 3VBOC 5IVEA 2JG9B 1ND3B 4RL7A 1IPSA 2GNMA 5C8CB 5J3UA 2QQPA 1LR5A 4ATEA 1IQDC 4WZFA 1R093 4XFHA 4CUBA 3SMHA 1VR3A 4ISRA 2QZ3A 2VG9A 2VBDA 1XYNA 4JZRA 3GHNA 1ZRIA 4HT1T 4AVBA 3S7IA 5FJKA 3ETPA 5FWEA 1N1SA 2OQ7A 1BCXA 3AP9A 4Y5SA 3ST7A 5DG1A 1UOBA 2JDUA 2OUHA 3HQRA 2PN5A 1UX7A 1DDLA 2X05A 1HIXA 1WW6A 3E97A 5EJZB 2ZTNA 2R1DA 4GA9A 3S0MA 1O5UA 1VBA1 2VZQA 3PVOA 4FPCA 1ALYA 1OF3A 1Q8VA 3FN9A 1NA1C 2FDIA 1FV2A 3K3OA 4PLNA 5FZFA 5A3OA 3R4UA 2GZWA 5BNNC 3W5NA 2JDZA 2BYVE 2BGOA 1Y9QA 4IEZA 3TNQA 5EYXA 4CDXB 1XNAA 5FWJA 5FQ0B 1ZBE1 1AX0A 3MHZA 5FYBA 5I8SA 5CISA 4YVWA 4QXHA 3ZSEA 4CEYA 2R073 4GJYA 3GJBA 1GR3A 4E9KA 2JG8B 2B46X 3ZPYA 5T5LA 2JENA 1C5HA 1AHSA 1UYPA 2V4VA 4Q4X2 5JPMB 4LMFA 2ZKLA 5EXOA 3GZEA 5JSOA 2WO7A 4XYXA 5CFCC 3DV8A 4FFIA 2VMDA 2HBUA 3JXSA 1H6XA 4UBHA 2OKXA 3RZZA 4CPBA 4XMAA 3HVDA 4ZHNA 5CKQA 3H1WA 4XFBA 4FPGA 4QKNA 5FZOA 1RJ7A 3V0AA 3NNGA 2ZGUA 5KHKA 3WDTA 1ACCA 4QXCA 5EJ3A 2ZMKA 1X82A 2W92A 1DGRA 4XJAA 4YW5A 4DINB 5CFDB 1H8VA 1JXNA 1PNFA 1S4CA 3I2KA 3VB9A 2OT7A 4GMP0 1LHNA 1WD4A 1BQPA 5A7NA 1FYUA 2DBIA 3WUCA 4FP3A 3TEWA 5C9AB 1CIYA 1IG0A 3FFZA 4QPWA 4AE2A 3KS7A 2XWBB 5LK7B 2GMEA 3P6BA 3C2UA 5FYHA 3J7MA 4PQ9A 2DTYA 4QX0A 4MGKE 3GM8A 5GZDA 1XNBA 2X5IC 3VDDA 3W20A 4BISA 4TTGA 1G86A 2IVIB 3POSA 4N7IA 3KHBA 4O7XA 1HB3A 1W6OA 3SH5A 4AI8A 4E2QA 2H0VA 1ZYBA 1DLLA 4KU8A 5ACA3 1HQLA 1QQP1 1GP6A 5JI7A 4AQ2A 4EJRA 2W94A 4QQPA 2L9LA 4HFSA 3BTXA 2AC1A 3HR9A 2Q1MA 4OHYA 2RJLA 2VCMA 2D6MA 1DZTA 1Z7S1 1ODNA 2WNUA 1PGW1 3WP3A 2GNTA 4YSFA 4Y1VA 4FTBA 5LY2A 3IDEA 1LENA 2CL2A 1VJ2A 1DF0A 3FUOA 4HVQA 2TNFA 3I2OA 1TG7A 5FY4A 5GKAC 2JG9C 1ND3C 3TN92 1AYM1 1MQTC 3WINE 1KITA 3OGGA 4A3ZA 1XNKA 1YHFA 5C8CC 1D4M1 1RXGA 4Z1VA 3PUIA 1DQ2A 4P9IA 4BB3A 3LDKA 4PF5A 2XLAA 3GGLA 3QOPA 5FYUA 5J48A 2VUDA 4O9EA 5GLUA 3U4SA 2R1BA 4MXWA 3ZKUA 2W91A 1MVEA 3EXUA 4XAAA 2PLV1 5C5TA 4WZCA 5FYVA 4BLJA 2XHKA 3CQOA 4HZFA 5LATA 3C8XA 1W8HA 3HT2A 4LULA 3I3QA 2D44A 4U2AA 5G05L 3RYKA 4H3WA 1W99A 3D82A 2VNVA 4LIUA 3NNMA 2WT1A 4FFHA 2ZMNA 4I0BA 2DU0A 3THTA 1JZ3A 1KFXL 3PVBB 1GNZA 4W6YA 4YZ1A 1UX6A 3MICA 4W8JA 4OQ9A 1VBE1 5IVVA 3ZYJB 2YG0A 2WWSA 5J98B 5CBLA 1TME1 3DYOA 3PMEA 4YVSB 3N3HA 2AREA 2BFUL 3HOBA 1QGLA 2VZUA 1PIV1 4GMP3 3KT4A 2CWSA 1XXNA 4ES8A 5LA1A 4BQ3A 1FXZA 4RD7A 3VZNA 5JIUA 4R9DA 2RDQA 1H1MA 4CDXC 5C71A 2FQPA 4AW7A 3USUB 3WHUA 3SCHA 3KVAA 5T5JA 1LKNA 1WKYA 1ZZCA 1PK6B 3VD7A 4RA0A 2JG8C 1XSQA 2J7MA 3O0VA 3SEPA 4JGYA 2ID4A 4YGEA 1R1ZA 1COV2 3NQHA 2WS93 3ES4A 3AP5A 2Q30A 1F5FA 2EIEA 5IYYA 4QHZA 2JDYA 3F95A 2JWPA 2WFF3 5EP9A 1VRH1 2Z69A 3GBWA 2WFF2 5HV4A 4FXKB 2GNBA 1CAUB 1GLHA 4LHSA 5HXMA 5IAXA 3HN1A 3N7JA 4IEWA 5I0UA 2RG4A 4Y1UA 4AFDA 1BK0A 2VOXA 1HKDA 3CBNA 3AXDA 3HMYA 4R9CA 3I3BA 1H2LA 5CFDC 2VVFA 4Q1RA 2XPJA 2BOIA 3QH6A 1R091 1EUTA 3UETA 1QWRA 2PQQA 3DPRA 4DEVA 1QDOA 1RUF3 4LR4A 3AC0A 5C9AC 1W8UA 1VMJA 4HPKA 1MS4A 3ELNA 4FPEA 4AFMA 4XJUA 1OH3A 3NW4A 3MPBA 1SBEA 3BUCA 2GP5A 4IERA 2J1RA 3AKSA 4NIDA 2Q4SA 2RMU2 5I8TA 3BI3A 3E6BA 1QDCA 1POV0 5DUWA 2QQUA 1WCUA 3GNEA 3VHPA 1LOFA 4YARA 4XEZA 1AXYA 2Z2SB 1I6XA 5IHRA 3W59A 1GZWA 1XOYA 2DUQA 2G4IA 2P37A 1R083 4YG0A 2WWJA 1H0BA 1R082 4BK5A 3WG3A 2XUMA 4AGRA 1UF2C 1TMF3 1O5LA 2VQAA 1SDWA 3IIAA 2OYZA 1QH6A 3ZDVA 1K45A 2YHJA 3M7AA 3WQ7A 3R0RA 1SG3A 4LHLA 5BNOB 3O1SA 2BVBA 2VR4A 2HEYF 3M3QA 2R071 3KCCA 2ZGTA 3TNPB 1A8DA 5JIAA 4BQ1A 1J3PA 2XWJB 1HXS2 1V00A 2GH2A 2WQ4A 1GP5A 1ENQA 1FX5A 4Q29A 3VZJA 3MIHA 1UKGA 1PGL2 5CB7A 1NZIA 5F5IA 3BYWA 4EWDA 5CAZA 2Y6LA 1ULFA 1XQNA 4P9XA 3RGBA 4OHWA 4P9JA 4Y26A 3M3EA 4MGTA 2BVVA 1X8EA 4J25A 4V2VA 1LODA 4AHZA 4QB6A 2H0BA 2VU9A 3V64A 1QOTA 3K2OA 5DUXA 3M70A 5LBFA 4LE4A 2EXJA 2WSUA 4LBMA 5F3IA 4E4DX 4KH9A 2W46A 5LASA 4XUNA 2WWUA 4FTSA 3OGVA 4LA2A 4LLOA 1KDKA 3UK9A 4JDMA 3A21A 3W21A 1VBB2 5FZMA 4MUVA 2DVDA 2JE8A 3NV1A 1FNYA 1DGWA 4YVWB 3POWA 5I0TA 5A33A 4Z07A 4BQ4A 5F9TA 2VCAA 1C28A 1OD3A 1RUE3 4OMCA 5FAXA 1NLSA 4EZHA 3PIGA 4OMDA 2PYTA 2V4AA 4E4SA 1YLLA 2PQSA 2G9GA 3OUHA 1PK6C 4C8DA 5FXVA 4HN1A 1W2UA 3PLQA 1EPZA 1RITA 3LF7A 1UU5A 4YW6A 3D3AA 1POV3 5F3CA 1U5XA 3UESA 1QNWA 3T2QA 5IT6A 5ACA1 1F4AA 1WMDA 3MBWA 2E31A 2Y64A 4L99A 3RJ2X 4CDWA 2WZEA 1QH7A 4P9YA 2JIGA 3RSJA 3ZXKA 5FZOB 4RSUA 4OULA 4Q4Y1 3V0AB 4EN6B 1S0BA 4QWNA 2LTNA 4NMIA 1QEXA 5GLTA 1W04A 1C8M3 2FDJA 4AOCA 5K7PA 1C8M2 4LOSA 1QJY2 5DPNA 1POQA 2B8MA 3WDVA 1UN1A 3PJYA 2A75A 1AR83 1YQ5A 2XB6C 3ZR5A 4EN8B 4HXCA 2CAVA 2HJIA 4XF1A 2IFRA 3NNFA 1E57A 1EP0A 1WCDJ 1CZTA 4COYA 3FLPA 1FMD3 3VDDB 4XUQA 2RS13 2GNDA 4K40A 3O1PA 4RQPA 4QM8A 3SISA 2RS12 4NWVA 4LHKA 4UW3A 3T1MA 4DEQA 1JN2P 3J8F3 2D6LX 1F5JA 3FC0A 4K7JA 5FYYA 1BBT3 3R4SA 1CESA 1PZ8A 2OQ6A 2WJSA 4IW3A 4ZXEA 5T5PA 1BBT2 4Y22A 2D98A 3URFA 2EALA 2WNUB 3HAGA 1I3HA 5SV8A 4HVRA 2CU5A 2N7GA 1HRV3 5BUVA 4IXLA 3RZKA 4GWIA 4BWOA 3LPFA 3OUIA 3M3CA 1W6QA 1W8TA 5DUVA 4CCNA 4CPBD 2UWCA 4KWUA 1CAXB 1V6NA 3CLPA 4GMP1 3W5MA 4GULA 1SCSA 1N3OA 4Y24A 4YM0A 5A3WA 1O4TA 3GALA 3BKZA 1W28A 1OPMA 4R4ZA 5BNOC 1XNDA 2W39A 4MXWB 2VJXA 3GJAA 3ASIA 1SLBA 2WDBA 4XTPA 5KWRA 2WYSA 1U12A 2D3SA 1Y7BA 3I2DA 3OEBA 4G3YC 4D8MA 2OVUA 1VBC3 2WS91 1TZOA 2DBNA 4AZZA 1S2BA 2IXJA 2NPIA 2YFUA 5FMBA 1SFPA 2BEOA 2EXKA 3OEAA 3CHXA 2W95A 2JB4A 1S0DA 5FYIA 3WX5A 3MW4A 4Z2WA 1BYHA 5JUVA 4I09A 5BYNA 3ETQA 3IDBB 4TZDA 1ZM1A 1F35A 1LULA 2BUKA 4EROA 3N9QA 3JQXA 1C57A 3BTYA 1SBDA 3VBHB 1WWYA 5G04L 4Y1ZA 4D0QA 3GDBA 1CZVA 1L7RA 3MIFA 4YVWC 3BODA 2VMGA 3S7EA 3VBFA 4Q4W3 4EV0A 1O4YA 2ZBJA 1RUI2 1RUF1 3KVBA 2VQ0A 4JGYB 2PAKA 2QZ2A 2RS53 3FHIB 4GH4A 4Y1XA 4YGCA 3FBYA 3TEXA 2RS52 1HB2A 2VD7A 3ATGA 4YFWA 1QU0A 2EA7A 3FMGA 2VCBA 4DO0A 3LCPA 1VB4A 4XDQA 1JZ2A 3AX4A 2E33A 3H3UA 4R4XA 2GALA 4URAA 3FJSA 2R7EB 3VKNA 4CVUA 4NHMA 1VRBA 3JD73 2ZKNA 3MGUA 4JDNA 1WCQA 3H1YA 4UW5A 3JD72 3LFIA 4UYBA 4NIGA 5F32A 2FCVA 2K2SA 4R9AA 1NCQA 4NROA 3RI8A 1PHMA 4FFFA 1KJLA 3AKTA 4H7MA 4HONA 1NQDA 1TMF1 4GXLA 4CXWA 1RUC1 3E5UA 1OA2A 5LEKA 1AR72 4CE8A 5FUPA 2UY9A 5LA9A 2A6VA 4XHXA 3CJXA 1XYPA 1W6MA 2Q1ZB 3T2OA 3ZDSA 5FZHA 4D6RA 5JMOA 2EAAA 4IE0A 3VDDC 3ZR6A 4CDUB 3WCRA 3AYCA 3M4FA 5DABA 5KHGA 4RS5A 3VD4A 2ZEXA 3J4UH 3NMBA 5A7WA 3ZFFA 3ZLIA 1GWKA 3RG0A 1CJDA 3AP7A 3T0DA 3U1XA 1GZWB 4C1XA 2NQYA 2WYFA 3VGIA 1OT5A 3ZXLA 4UFJA 2VBBA 2WNUC 3ZMNA 3CEWA 5LA2A 5A6XA 5T52A 1B35A 5FPVA 4LO5B 3LEGA 1VIWB 2ORXA 4BZ4A 5JR2A 3U10A 4HMZA 2YDEA 1ZA4A 3VBSA 4X6RB 4QX7A 2NLRA 1W9TA 2ZGOA 4OZOA 3BPZA 4XILA 1RUE1 1TNRA 4QGMA 4IE7A 1UWWA 3WNMA 5CADA 3KV6A 3ZN5A 1UZZA 2ET1A 4FPHA 5FY8A 3ZVXA 5A1FA 5F37A 1UYXA 3D6EA 3F2ZA 1CGPA 2QCSB 3VD3A 3KM5A 1A78A 3ZKYA 1POV1 1S0EA 3QD6A 1WMXA 2VW0A 2XDVA 4LTAA 1G9CA 2YPJA 4W65A 4CUCA 4AEDA 3MIBA 4DY5A 3RZJA 2WC2A 5F6LB 3I3DA 5FPLA 3LIGA 1KDMA 4YZ4A 2DCKA 3TYJA 3VBUA 1W8NA 1UD1A 2ZHNA 3TWIA 1FATA 2QQOA 1I5PA 1BXHA 5LRSA 1SLLA 1JYCA 1OUSA 1JZ7A 2J1EA 3CDZB 2J1SA 3LB9A 2QQJA 5FY5A 1AR81 3VBHC 3ZXJA 3C7OA 3CMGA 1JS9A 2WT0A 4QKDA 2MEV2 4LEJA 1YI7A 5KXBA 2GN7A 3A23A 3EMRA 4IESA 3TBDA 1FMD1 3H7JA 1V6JA 4M0NA 4JGYC 3PL0A 4YFZA 1Z78A 3AM2A 3BU7A 3J8F1 3HNBM 2HKXA 4CDWB 4TYSA 1S0GA 2DVFA 2D40A 2ZGQA 3E5QA 4XFCA 3SC7X 3PUSA 4FAHA 1BMV2 4CCEA 3KT7A 3VKMA 3B9CA 3VZMA 2VTFA 2Z5WA 1HRV1 3BVCA 5KXEA 5AFEA 5HCFA 2QQWA 2GSYA 1WLWA 2IZWA 2WNEA 3KF5A 4PT6A 4D7YA 5I0RA 3I2JA 1A34A 5FPUA 2VW1A 3O1RA 4QX1A 1AYN3 2VZTA 2PELA 1AYN2 4JV4A 4DNYA 4LE3A 3LIHA 4RHV2 3T30A 2CGOA 4RQPB 1VBD2 4WV8A 3VZLA 4AK3A 3UGHA 1NKGA 1SLCA 1J3RA 3WP6A 3AZXA 4Y3OA 4CDUC 4YW7A 2YC0A 3D8CA 4BM8A 2W1QA 1W3XA 2BPA2 1VBC1 2XOMA 3AL5A 4Y22B 2R0HA 1JTZX 3NKGA 1O91A 1S0FA 4E27A 3O12A 1W8ZA 3UKTA 1R1A3 2IXKA 4JTNA 1RUG2 2A71A 3MF9A 4D94A 1QMJA 2D93A 4M00A 1JYXA 3D0JA 4KWJA 4AFCA 1W6QB 2UYAA 5JOXA 1RYYA 4E8CA 4NUBA 3VDAA 1MZFA 3ZYIB 5L36A 1NZCA 2JKXA 3FZ3A 2WUHA 3ZOIA 2RR13 1AL22 2SBAA 2XBO1 2XKPA 1D0HA 3AMQA 4H55A 2HWF2 1O3SA 4KWLA 4XJ8A 1AX2A 3APBA 4MHRA 3NJVA 4ZU5A 3U78A 4XBNA 5A70A 4XPVA 1IQAA 1E5SA 2DCJA 4MADA 3ZFEB 5EV7A 3MIGA 4M3CF 3WOGA 1IS4A 5JR7B 2Y0OA 4Q4W1 5F5AA 3USSA 1UMZA 1S0CA 2JDMA 4E4ZA 4LPLA 2D5FA 2E32A 2RM22 4QGLA 2WZR3 3LA2A 1AX1A 3J26N 3I2GA 2VUJA 4TWTA 4B7EA 2V73A 2QQNA 4YYOA 3H3ZA 3B9IA 2NYYA 4IDZA 4ZKTB 3IDCB 4EQVA 1OC1A 5E6HA 5A7QA 3KQRA 4GQ7A 2W3JA 3HQXA 2VM9A 1NY72 3K75B 4ASMB 4IETA 4ZS2A 1JYWA 1M06G 1FOD2 4WM8A 2AEYA 2CDOA 4CZSA 5ANQA 4M4PA 1AUYA 5IVYA 2OXBA 1AJKA 3MFCA 1O6UA 2ZAHA 1QHDA 4AVTA 5LWBA 1UL9A 2IVJA 1HB1A 4JRLA 4P9LA 4XW3A 2QQVA 3VBFB 1OVSA 1PO22 4BQWA 2ARCA 1PO12 3M2MA 4XCAA 3L9JT 4ZXKA 1F9KA 2ZS6B 4GH4B 1DLCA 3RZLA 4A6SA 5T55A 5J7MA 4K6BA 1KS5A 1PMJX 2CDPA 5AC92 5FIXA 3BU0A 3OBZA 1X7NA 5L19A 3D0SA 4LOTA 3KF3A 5A3NA 5CVRA 1XBFA 4GKXA 4N43B 3RQ0A 5FO7B 3WW4A 2BNNA 1PVXA 4IEYA 5JOYA 4CDWC 2PHRA 1G6NA 2DUOA 2VO5A 2P34A 3LOBA 1RUH2 1O8PA 2FCUA 3NV2A 1V0AA 1W6PA 2JDPA 1NCQB 1X36A 3C7HA 1UO9A 4HBNA 3O1VA 4XAEA 1GNHA 4KBBA 4EWEA 4AAXA 3CL1A 1ND2A 4R8HA 5JOWA 3MZHA 2HWE2 4S2GA 2ZX2A 4BMEA 2OPWA 5IK8A 2C6SA 1JZ6A 4XHBA 1VAVA 3FL7A 1RUJ3 3N9PA 1W6MB 2BU9A 2HWD1 2Z42A 1RUJ2 4LORA 3CF6E 2VVDA 1F4HA 5FK7A 1EAH1 4RYDA 2AYHA 1AJOA 2EVXA 2CYFA 4RQPC 4UF0A 3K3NA 5A7WB 4D7TA 2ZZJA 4FPFA 4IV3A 4C0BA 1H6YA 1UCXA 2P3KA 5HCBA 1XE7A 4Q4X3 2YY1A 4K9SA 1Y9MA 1F2NA 1TNFA 2ZABA 1NAEA 2P6HA 1NYWA 1RINA 4GB31 5DUUA 1J59A 2P1BA 4UXAA 4QPGB 3WV6A 2QE3A 4A4AA 5L9VA 1RVF2 3ZSMA 2B5HA 1OBNA 1GNYA 3KV9A 4HANA 4YZ3A 2ADDA 2WNVA 2DCTA 3IPVA 3KGZA 2CTVA 4XBLA 4A3XA 4BJ0A 5JVVA 4B1MA 3N4MA 1RMU3 2Y60A 2HYXA 1HRI1 1Q56A 3I2FA 1RMU2 3LA7A 4AHWA 5H9QA 3QH7A 4I01A 4PBOA 2E26A 2JX9A 4JGZA 3WDWA 2QQKA 3ZN6A 1JI6A 4Q27A 5JSPA 1LOEA 3GYDA 1RB8G 4D6QA 2P3IA 2A6YA 4JRAA 5DMYA 2EIDA 3ZFEC 3OF1A 1W0NA 5FZDA 1ZRDA 1G9DA 2K46A 4OI1A 4H7LA 5JXIA 4NAMA 3KWVA 1OURA 3GZUC 3TRSB 4LBQA 3N7KA 1JMUB 5LZ6A 3MUZ1 5A6QA 2Y6HA 3PNAA 4MZUA 3DYMA 4AEDB 1GZ9A 2DYCA 2XONA 2YBPA 3UT0A 4PF1A 2ET7A 4FPJA 3ITQA 1OLME 4RR3A 3VBUB 3NWKA 3N9MA 4YZ2A 2ZX4A 4HKLA 1J58A 4XOGA 1QJX2 2VOTA 3IT8A 4QM9A 5A3MA 4PJYA 1R64A 2DDUA 2W1WA 5FPBA 4UOJA 2ZGKA 1MS3A 1HQWA 1MZ5A 3MW2A 1A6CA 3M1HA 4TSVA 4X8PA 4ET7A 4ITCA 3SLIA 3I49A 3POFA 2MPFA 2AH2A 3TN93 3WD5A 2VNOA 1LOCA 2YUEA 4SBVA 4WVMA 3VBFC 5FJHA 1IS6A 2B45X 2TBVA 3AJZA 3P3NA 3POGA 2W1UA 4BHPA 4EN7B 4GH4C 4UW4A 5GLWA 4QPIA 1C3HA 1UU4A 4CDQA 1ENXA 2DURA 3HBKA 4JKLA 5IK5A 5IK7A 2A1XA 2D43A 2Q5TA 2HEVF 2WA4A 4XABA 1V6KA 2FMYA 2VOVA 5T50A 1LNSA 1V9U2 2X10A 1O3RA 2PHWA 4N43C 1S0IA 1YXWA 3ECQA 3MFAA 2RHPA 3RJRA 3WR0A 1OLRA 1YNAA 2BDRA 1R1A1 4B4PA 5CG9A 3OBRA 3GBFA 2XJSA 5FPXA 3HJRA 4LT5A 4OHVA 1N1TA 2ZACA 3IAPA 1NCQC 3ABZA 3AZYA 1J1TA 2VMFA 3O0WA 4MXVA 4XF4A 5C3QA 5DG2A 3OPWA 4NPMA 1IKQA 1OHFA 2RR11 3HPNA 2UWBA 4YLZA 5FY0A 2QBXA 2F6BA 1EV12 1O4ZA 5GLVA 5FP7A 4RFT0 2B39A 4QAWA 2WO3A 4BPZA 1YO8A 4YW2A 1RHI2 2J42A 3EJKA 4CCMA 5JI9A 5JSRA 4FBFA 2PXJA 1FAYA 2RDNA 2G1MA 2DVAA 2XXZA 2ZPXA 1STMA 3AYEA 3C7FA 3GCXA 1PVC1 5DDJ2 5LK5A 2WZR1 3T09A 4AQ6A 1LCLA 2ENRA 2Y38A 3OGSA 4J6GA 4GIQA 2BJSA 5J96B 2VMEA 1COV3 2V09A 3MO4A 5D1IA 4AFAA 4EZ4A 2K0GA 3H8OA 4PIYA 1MEC2 4QPGC 1GWMA 1WW7A 3IZOA 4LO4B 3E6DA 5F5CA 4DIQA 5KBFA 2ARXA 1JUHA 4N9IA 1JYVA 2GC0A 2Z4FA 3JBG2 3M3OA 3KZ4C 1RGSA 1XYOA 3K51A 3LFMA 3WF3A 1OQDA 3FFQA 5CG8A 4I0WB 5JDBA 3OYWA 1ASJ1 4UT5A 1GMMA 3TB0A 2EF6A 3H42B 4QQLA 3UKNA 1URXA 4KMQA 3BN6A 4CUAA 1PM7A 3OSDA 2RJ2A 3AYAA 4AI2A 1W03A 1UY2A 1OLMA 1MACA 2CAUA 2E53A 3WHTA 1AR93 3AMPA 1NQJA 3OD4A 1AR92 1WGPA 2VTXA 2VVEA 4NN0A 4QDRA 2KD7A 4HK8A 4QHBA 3VHRA 2V5DA 2ZXQA 4NRMA 1RC6A 2XVKA 3FX3A 3G6JB 5CYYA 5FXXA 1O3TA 2VE1A 2XR4A 4EYUA 3DYPA 4QQHA 2RMU3 1OXCA 1UOGA 3I59A 5IK4A 2HYKA 4AEDC 2Y26A 3A0KA 2JDNA 3VL9A 2ZEWA 3ILNA 1GV9A 3PUQA 1WLCA 5EPAA 2VMIA 3ACFA 3P1IA 1O7FA 4WM8B 3VBUC 1ULCA 4BOWA 5I0DA 3OBTA 5C33A 2VTXJ 3OB8A 4B7KA 2BTVC 3W58A 1ZVFA 1NE6A 1C1FA 4S2FA 1YFXA 3MF6A 3OPTA 1ZRCA 1LOGA 1OLQA 5ISLA 1IG3A 3LQCA 5LA0A 2J22A 5JOZA 4MX3A 3BIWE 5DXDA 3ORJA 1QJU2 2OX0A 5LBEA 2X53S 1HXS3 1H9WA 2Q1FA 5FKCA 5T5OA 2D97A 4Q4X1 4QXKA 4IE6A 3R05A 1DBNA 5BNQA 3NRUA 1VALA 3GBGA 4FVVA 5FREA 3T4HB 1W6PB 1HJGA 4HSJA 1UAIA 1JW6A 4BQYA 2JE9A 2XJTA 3B3QE 2F4LA 4K3UA 3IM0A 4BYYA 3ZXFA 1OA3A 2ZOEB 3OY8A 2ZHMA 1CAVA 3KD4A 4FPLA 1OH4A 2DUPA 3POYA 4HKOA 1RUOA 1WUVA 1QJZA 2I2SA 1TQ5A 2VZVA 4UFHA 4F8AA 1ZRFA 4FPKA 4AQSA 3U4XA 1JU4A 1VBB3 4YRDA 3H0OA 4YVSC 4BIOA 4QHOA 1OKOA 3WY6A 4XJ9A 5F2SA 5A3TA 3FUQA 1YFYA 2FMDA 3ENRA 4UF0B 1ZRRA 4K1YA 4CEYB 4DRVA 3KLSA 2Y33A 3AJYA 3EBRA 4IV3B 1ZBA2 4RFRB 1PNGA 2VC9A 2VOWA 2IFWA 2YMZA 1GKBA 3K77A 4KWKA 3RZGA 4Q4V3 1UMIA 4WVWA 1C8NA 5GALA 4Q4V2 3IDAA 4ZONA 5FZ6A 3NV3A 3HBZA 3DL3A 3I54A 1J83A 1Y43B 5C3OA 1VB2A 5GZGA 1Q43A 3L2HA 2DVGA 1U5YA 4Q2FA 4XETA 4Q0UA 4INDA 2WNVB 3NNLA 5FYCA 3IPVB 1PMIA 4AYUA 2ZEZA 3ES1A 5C7GA 3VBOA 2XJRA 4FXGB 4LLFA 3RS6A 3VHNA 4AI0A 5D2AA 4NHXA 2X8KA 4EN0A 4JGZB 2FBEA 4URTA 5LW9A 1QJY3 2PTMA 1UMHA 4HN0A 4A2UA 5L9BA 3S30A 3WF2A 2XVGA 4LKDA 4B3NA 3QCWA 4AHXA 3TN91 2WLPA 4UI9L 1UQXA 2F17A 1UIKA 2B42B 2I07B 2D6PA 5E89A 2E7AA 4COUA 4HLTA 5DAVA 2XUEA 4QX2A 3OBAA 5I91A 2R042 2WSVA 4PDWA 1BVP1 5LBCA 2XJQA 4FQ4A 2ZGPA 5FPAA 3S6PA 5C6CA 5HV0A 4D7SA 1BEV2 1C5IA 5F6KA 1W6OB 1GUIA 4AFBA 3JU9A 1SEFA 2TUNA 3U11A 4GAZA 3I4IA 2Q8DA 4OVEA 4OFGA 4FO9A 4RR3B 1QNYA 1J1LA 1NUKA 4DB5A 4PIXA 4DUVA 1G9BA 4CCKA 3WDYA 2JECA 1S0JA 3LZZA 2R062 2W2IA 3NL1A 4CCOA 3KQ4B 4JVAA 1RXFA 4KBZA 4WM8C 4N9HA 5A1LA 4RGKA 1RUD2 5FCCA 2Y6GA 1CPMA 2YB7A 2VXJA 3AL6A 1D7PM 4HSLA 4WVMB 1AR62 2E6VA 2P3YA 3DKQA 4QT6A 5A6YA 1WBLA 4M0HA 4HG6B 4QU1A 2CV6A 4ZZ8A 1IZ3A 2WR9A 3FE5A 3ZYPA 4LK7A 4NVPA 1Y9GA 4MYEA 2GH8A 5DAWA 5FV3A 5FY9A 4CDQB 2EXHA 4PLOA 4AR2A 3EO6A 3AMMA 1NE4A 1BVVA 4FCAA 4JQRA 2P5BA 4ONUA 1HV0A 5C3RA 5CFCA 1EPWA 4MVTA 4OI0A 4XVHA 4N8MA 2WZ8A 1COV1 5IATA 4A42A 3POEA 3A0NA 1AVBA 1WLTA 2WO1A 4BMBA 2QFEA 1QOOA 3EHKA 4A41A 2NMNA 4Q0QA 4LBQD 3VBRA 2HWC3 2WFF1 3AVRA 1UOJA 4PI2A 2HWC2 4B4RA 2QQIA 4AL9A 4E2SA 4KI5M 1KFUL 2Y6JA 3BB6A 4XFAA 4NRPA 3P3PA 4Y4YA 3LA3A 2DV9A 4CP9A 4YZ5A 3NAPA 2A6WA 4LO6B 1RTVA 2NM1A 1SZBA 4MGZE 1PX3A 1AXKA 2ARBA 1GQGA 1S2EA 3RWNA 4S2DA 5FYTA 3LD8A 2FZ1A 4LK6A 4LITA 4BXFA 2R0FA 1EYBA 1UNBA 4V2WA 2X5IA 3G7DA 5FOJB 2OW4A 2V72A 3KB5A 4A7KA 3TEYA 1JYTA 1L7QA 4CEYC 2QUOA 5D21A 2BNMA 1RUI3 4IEUA 4P02B 4CP1A 4N53A 4FQZA 4ZPIA 1LHWA 2W52A 3D4KA 4NWWA 4XJZA 4CCLA 1XC6A 3ME2A 1N47A 3DF0A 3Q8AA 4OYUA 1ULDA 2FHRA 2RMU1 4MGQA 4DS0A 1OPOA 4GALA 1S55A 1UU6A 1W8OA 1WBFA 2WNVC 3VDBA 3WDXA 4NIIA 5HXVA 2YXSA 4Q0PA 2BV4A 4BU2A 4LA3A 1O8SA 3FBMA 4V1PA 4YGDA 2WT2A 3WZ1A 2GMPA 3OYWB 4AI9A 3ZXEA 4IQPA 1GQPA 1MQTA 1R081 2P2KA 3ON7A 4NO4A 1K5MA 1ZZ9A 1I1EA 2A7AA 4JGZC 5FBJA 1UY4A 1WCSA 3ACGA 4AG4A 2RS32 2Z79A 4DPNA 1AR73 1W2AX 1FPN2 3NNJA 2HWB2 3ZFGA 5JLVA 3S5QA 1CZSA 5FO8B 5E8AA 3DPRB 4DXSA 4OI4A 3B5LB 4HPKB 3RI9A 5A32A 4MG2A 1U0AA 3ZXGA 4JTOA 1YC61 2F4PA 3AMHA 3KT1A 5C70A 5FO9B 5JZGA 3VD9A 1HXS1 3AXEA 2JXAA 2JIJA 2ETEA 2VMHA 2XJPA 3I59B 5M0TA 1PGL1 5HPOA 5L7OA 3RMYA 1FNZA 4XXAA 4NIAA 5IW0A 3MLJA 1YCIA 2Y8KA 4IV1A 2WN3A 4RR3C 3RYRA 3VN4A 5FLHA 3IIIA 2W5FA 1ENSA 3WW1A 1CD3G 2PMWB 4OQ8A 2O0OA 2R32A 2FDGA 3NJZA 1CAWA 4OLLA 4CEWA 3O0XA 4JKMA 5LCWL 4BQXA 3AP4A 2D3PA 1VBB1 1UYYA 5DZGA 5IVBA 2BGCA 2RV9A 1SFYA 2A3YA 3H1MA 4NPRA 1JZ5A 1QXJA 1H4GA 2BQPA 4FOQA 2ZEYA 5GZEA 3H8UA 1ZREA 4CDQC 1FV3A 5DQ0A 1UW8A 1C1LA 3ZIXA 1H1AA 3DCQA 2O8OA 2RJKA 3CIHA 3HEIA 1H2MA 3JB8A 1KJRA 2IWGB 1CJPA 1YI9A 3BCWA 4LBNA 3GF6A 4QX3A 2TEPA 3BTAA 1LU1A 4UWDA 1V6LA 5FUNA 3VDCA 2R6QA 3OY8B 1CAVB 1VBA2 4CTEA 2RVAA 4GD4A 1M4WA 2CSGA 3D5OA 4QKFA 4WM7A 3WUDA 3H8XA 2X09A 3VUOA 4D6SA 3NVCA 2UU8A 5CEHA 4Z92B 2H6BA 3N9OA 1XSRA 3KMHA 2UURA 5BXXA 4X6QB 1ZBE3 1C8M1 5IVFA 5I93A 1QJY1 4CU9A 1ZBE2 2IXIA 1HN0A 2W08A 1UY0A 3MI8A 3WVJA 1KS4A 4FI9A 1HV1A 5A33B 3ACIA 1UYZA 3BIEA 1DCSA 1W6NA 2LALA 1DZRA 2MEV3 4QU2A 1VAKA 5BY5A 5FP8A 4M01A 4ZZ5A 1OMIA 2C1FA 2DTWA 3O14A 4LQRA 4E8DA 3SH4A 1SCRA 5IJRA 2RS11 4I3GA 2QDNA 4FAGA 4Q1PA 1LAJA 2ES3A 5FTTC 3PTRB 5FZ3A 1DHKB 2C4XA 5LEJA 3ZSKA 4Y33A 1BBT1 3MPPG 5DZFA 3VBOB 4ARYA 4DQAA 1YQ8A 1Q8SA 4K8FA 5A3LA 4AVSA 1N1VA 2UY8A 4L92A 5F2WA 2VZ1A 2BP6A 5CZKA 4A6OA 3NSTA 1J3QA 4XQ4A 1YIFA
chains in the Genus database with same CATH topology
3CJIA 1WCKA 2ZHKA 1KD7A 2W68A 4CP2A 4DXZA 3V65A 4AVCA 1FT9A 2HEWF 4ES9A 1DGLA 3PVEA 2BFUS 2C9AA 2A6ZA 3QACA 4RHV3 3R4DB 3BOPA 4PDWB 3X29B 3KCYA 1OQEA 1VBD3 2KXLA 4AQTA 3DPRC 5AVPA 1QXRA 1OKQA 5C4WA 3MIDA 1QQP2 1RUNA 1YWKA 3V0BA 1WW5A 4COVA 5BV6A 2AR6A 1Z7S2 3U0ZA 4G4FA 2GU9A 5AVAA 1PGW2 5LRRA 4X8NA 3ZX7A 5GM0A 1RUG3 1LOFC 3MYXA 2QKDA 2KM2A 4RGAA 5HBAA 2ZZQA 2IXLA 4AI3A 4COZA 1VLNA 3E5XA 1AYM2 3AZVA 4ZU4A 1Q5OA 1Y3TA 1D4M2 2A70A 1AL23 4MSVA 1LHUA 2HWF3 1GYKA 1C4RA 2C5DA 3RYPA 1UPIA 1N1YA 2PLV2 3KCXA 3VV1A 2ZMLA 4B29A 3B7MA 3BALA 3M3IA 1YFUA 1RUI1 3B01A 2RM23 5FRAA 1MS8A 2RS51 2A6XA 2E9QA 5BNPA 1OSGA 1QF3A 1VBE3 1ENRA 1VP6A 3VBRB 4ATFA 2CWMA 1VBE2 2Q0AA 4BA6A 1W0OA 3GZTB 1TME2 2YYOA 4AHYA 2EIGA 3H50A 3NAPB 3JD71 1PIV2 2YZ4A 3WQ1A 1TE1B 1FOD3 4XMIA 4XXPA 2D7FA 1MZEA 3ILRA 2WIIB 2ZGLA 5E88A 4A7YA 1AR71 2ZX0A 1PO23 4UBGA 3I7DA 1PO13 1S2KA 4N53B 1DU3D 5KHHA 1SFNA 4K1ZA 1GFF2 1IKPA 4NHLA 1X33A 3VKFC 5ABJA 5AC93 3AZZA 5HI0A 3IMNA 5H9PA 1VRH2 2XL9A 2E7TA 1S1AA 3H9AA 4GWMA 3SITA 2PHDA 2VOKA 3IBMA 1RUH3 5HCAA 4L9BA 2CNAA 5JCTA 3FWEA 1MQTB 5KC5A 1K5MB 4IEVA 2PHXA 1F31A 2HWE3 1V6IA 1KRIA 1R092 1YFWA 5BNOA 2ZAAA 2VNRA 3ZFGB 5EWSA 4EN9B 1NOVA 4IEQA 4XF9A 4DMIA 5FLIA 3SH3A 5A32B 3SHRA 5JZGB 3AKPA 4PDWC 1JHNA 4RS5B 3ZFFB 2WA3A 5L7OB 3RRDA 4AGGA 2VNGA 2ZCWA 1YIPA 1YUDA 1WMFA 4IV1B 2V5YA 3SXWA 1RVF3 1X8MA 3ACLA 3ZIWA 3NV4A 2IC1A 4Q8LA 1B35B 2EXIA 1CAWB 3DN7A 4CEWB 5KHJA 3INAA 4MGIE 5CA6A 2DFCA 4PBPA 1BZWA 1KXGA 1DG6A 4R9BA 5FOBB 1CIWA 3VBSB 4L11A 2R072 3WG1A 2WL1A 2G9FA 2PA7A 4XJWA 3K48A 1UKRA 1KQRA 3IWZA 3V56A 2MEV1 4CYDA 1W39A 1A8MA 2VULA 3MLLA 2AUYA 5EFUA 4ORFA 1SMVA 2P17A 2DCZA 2OA2A 3AKRA 2MHFA 1OFSA 4G9SB 3MEPA 5GJ6A 4COWA 4WM7B 1NXD1 3VBRC 2BWAA 5T54A 1BMV1 2P3JA 3TOJA 2ZGSA 3NO8A 1WD3A 3FLRA 5CNAA 1HQNA 1QJX3 1CONA 1V70A 2A3XA 1VAMA 2GN3A 2ZX1A 3NAPC 3O7OA 1AL0G 4AEKA 1NCRA 4M3CA 4BLIA 1HW5A 1WW4A 1W6NB 4H14A 2YV8A 2OUJA 3OTFA 1IS5A 1AYN1 2GC1A 4RHV1 1HDKA 4XF3A 1DQ6A 3JUUA 1DGWX 3VL8A 1VBD1 1IHMA 4XE9A 4N53C 5E16A 3AB0A 1D0GA 5I0SA 4Z82A 5ACA2 2AGSA 4KL1A 5K0UA 3AFKA 1DFQA 1GQHA 4Q4Y3 4YG3A 4D69A 4RGGA 4ZU7A 2FZ2A 4Q4Y2 1V9U3 3JZVA 3KSCA 2Y0IA 4BH9A 1QY4A 1RUG1 2I74A 3L2YA 4AXOA 2UWAA 3CJIB 2AZ5A 2XGXA 4OI2A 4FTEA 4LBJA 4I0AA 1CAXA 1K5MC 3RNSA 4PLMA 3W9AA 1YRZA 3AK0A 1AL21 5KXDA 2VUAA 1MZ6A 3ZYRA 4YW1A 1EV13 2PHLA 2HWF1 3ZFGC 4OZXA 4WBBA 4WVZA 4C90A 1RHI3 2VXRA 4DY3A 5C4WB 5JZGC 5DDJ3 3V0BB 2RM21 1XU1A 2PAMA 4RS5C 1JH5A 4OHXA 3ZFFC 4YM1A 5L7OC 1DQ0A 4XQWA 1MS5A 3N7MA 4IV1C 1MEC3 1MS0A 2C0ZA 3SNMA 3MIEA 1YJLA 3T2TA 1GBGA 2JE7A 1B35C 3JBG3 1NY71 4MV2A 4D3WA 3JQWA 4CEWC 4P14A 3ZO0B 1FOD1 2D5HA 3LSDA 3VBHA 4XZPA 3T1LA 1NLRA 1DIWA 2DCYA 5I8YA 3VBSC 4Y1YA 1B09A 1PO21 2XJVA 2E63A 1PO11 4AEMA 1CX4A 2WS92 4XQDA 4YGBA 1MR5A 1ZZ8A 3VKLA 5BNPB 3WXPA 5AC91 2BWCA 4GKYA 4Q0SA 1T6GC 1RIRA 3ALQA 4AI1A 2ERFA 5J09A 2EAKA 3DKWA 4YW4A 1IS3A 4WM7C 1RUH1 2A3WA 3QLQA 1DZQA 2ZHLA 5D8AA 5JPNB 1RL3A 2UYBA 2ZGNA 2QVSB 2CY6A 4L97A 2QJVA 2HWE1 1XU2A 2XLFA 1PGSA 3VLBB 1H8TA 1OOPA 1RUF2 3DGTA 4O9GA 1SLAA 1LGNA 1RUJ1 5JAXA 4CDUA 4AEJA 5ABJB 4PIZA 2LM3A 1IOAA 5F1RA 1QJU3 1U5IA 1DYPA 3CU7A 4XF0A 4Y20A 2BNOA 1DQ1A 1RVF1 4NOTA 1X50A 2R16A 4I02A 2JEMA 4HK9A 3AKQA 1TMF2 1RUC3 1ND2B 1YJKA 1LRHA 3CJIC 2H6CA 1RUC2 1SLTA 3JB4C 3ROUA 3WW3A 1RMU1 1I5ZA 4OHZA 5FMOS 4Z8BA 3GHMA 4DZGA 5H9RA 2GC2A 2WINB 3LAGA 3ZSLA 2R49A 1ZBA3 2VY0A 5C4WC 1LJ7A 1ULGA 3WG4A 1REDA 2XG3A 2YROA 2SLIA 1GANA 4S2HA 4XFGA 4AGVA 3N36A 1SACA 2XVLA 2B7YA 4MLOA 1HLCA 1SQ4A 5IUQA 1N3QA 3WP5A 3ZXAC 3QBQA 1G7YA 5K8SA 2ZGMA 2OZJA 2R30A 3A4UA 1A3KA 4WVVA 2NP0A 2D6NA 3PHMA 3IKWA 1QJX1 2OPKA 5JMCA 4IL7A 3M8LA 1RUE2 3IN9A 4SLIA 3ZN6B 4PCRA 2AENA 2ZX3A 4JDOA 4L8QA 2CGNA 1OFNA 2O1QA 2OIIA 2R043 1HX6A 1XRUA 4QMAA 4LUKA 4IEOA 4Q8KA 3LOIA 2VPVA 1BEV3 4LBQB 3RDIA 5FFOC 5BNPC 1ZNPA 4Y5Z0 3B93A 3E6CC 4BIFA 4I2OA 1V9U1 3J9SA 5BPXA 5KC6A 4CP0A 3WNXA 2PAEA 4LUMA 2DU1A 1H1IA 1UIJA 1IPKA 1Q3EA 2YGLA 2R063 4YNIA 1NA1A 1NCRB 1H9PA 1AR82 2E7QA 1H2NA 4M3CB 1GZCA 2PHUA 4P9GA 5FDBA 5BNNA 4GWNA 4JCKA 1RUD3 4OUSA 5KXCA 1V6MA 1AR63 1LHVA 1FMD2 1EV11 2OZ6A 4MH0E 4N7UA 3OJBA 4LBLA 1RHI1 3LWCA 4FOYA 3J8F2 4QPIB 5ABJC 5K0UB 1LEMA 5DDJ1 5T3NA 3LKJA 3HT1A 4KGQA 3ZXDA 2ZJCA 1LU2A 1GSLA 1OI6A 3UKVA 3ZYGA 2JICA 2PHFA 4OUMA 2RE9A 5EZWA 1SBFA 3TAYA 4I30A 1HRV2 3GZAA 1MEC1 3WW2A 3N7LA 2GC3A 2JD4A 3PJQA 1BJQA 3LGRA 1LOBA 5GLZA 3UL2A 3R6SA 2B9UA 1PZ9A 3AMNA 3JBG1 2ATFA 1MS1A 1ND2C 4W6WA 3O5SA 2VH9A 1CR7A 1G9AA 4J1WA 1IPJA 4C91A 4DOUA 2PHTA 2O8QA 3ZFEA 1XE8A 5CU1A 3OGJA 2NN8A 4KG0A 1LGCA 4HL0A 2VW2A 2PFWA 1VBC2 1WMEA 1AR91 1CPNA 1AZDA 3HWJA 4IV3C 3THPA 5L73A 3MDPA 5E1RA 2ZA9A 4FP2A 1D2QA 2Q8OA 3SCGA 1JUIA 4AF9A 5SV5A 2JKBA 5K9YA 4META 1RJ8A 2LUWA 2XBO3 1DQ4A 4AWDA 2XBO2 1H30A 3WG2A 4YM2A 1PZ7A 5B2GB 1QOSA 2JG9A 1ND3A 2GAUA 3WLUA 1LECA 3WQ0A 1OA4A 3UJOA 1JOJA 5C8CA 4C0HA 2RS33 2VGDA 4Q4W2 4N90A 4Q26A 3B02A 1FPN3 5TSWA 4QD2A 2HWB3 3WT3A 1CVNA 4K20A 1G8WA 3AYDA 3SCFA 3CO2A 4LO8A 1QJU1 4XFFA 3AFGA 4N43A 3AP6A 1UZYA 3WCSA 3ZMOA 3EQEA 4QQOA 2WKKA 1WA4A 1F8VA 4YM3A 3DUIA 5D8AB 4LBOA 1OD5A 4MGYE 4XFIA 1REFA 2X29A 1G9FA 1Q8PA 1OQ1A 1NCRC 3WP4A 4KNCA 1H8TB 5KHIA 1OOPB 1WLDA 2ZGRA 4CDXA 4QX5A 4HKWA 5FQ0A 1D2SA 3B00A 2XJUA 3PTYA 4QQ2A 5EYYA 1DGRN 2JG8A 2WQZC 1Z0HA 1XNCA 1ZBA1 4A7ZA 4QPIC 1ZZ7A 2DFBA 5K0UC 1Q8OA 4Y20B 3ILFA 4Q4V1 4QPGA 4XIOA 3OD0A 4KG8A 4KU7A 4FPOB 2ILMA 2WLQA 4XBQA 5GZCA 2I45A 3Q9OA 2XH6A 1Q8QA 1GICA 1BK1A 1VBA3 4LO7A 4R52A 4JC1A 1ONAA 2HWD3 1ZZ6A 2HWD2 3PVNA 4BE3A 4K21A 5CFDA 1EAH3 3U07A 1EAH2 1YYNA 4ASLA 4E2GA 4NHKA 5C9AA 1MS9A 1EY2A 4QGNA 4GB33 3I8TA 4GB32 2R041 1DQ5A 2VECA 5J36A 3VKOA 1LTEA 3KGLA 1JYIA 1BEV1 4P9WA 2GDFA 4UW6A 4YG6A 4W6XA 4F7ZA 1ZZBA 4KGGA 3VHOA 2A5ZA 1HRI3 5CIRA 3OCPA 5FMOL 1HRI2 1AF9A 1MVQA 2BW8A 4YW3A 2DF7A 2GMMA 2R061 1DYKA 2QDRA 2K9ZA 4Q0VA 1O3QA 4FSJA 1TEIA 1I9RA 2D6KA 1RUD1 4FOWA 4IEXA 4AVAA 1AR61 3C3VA 1L3JA 2E51A 3H7YA 4LBKA 5JWPA 4KQ7A 4JAAA 5J37A 1V6OA 2XL7A 2BBVA 4F3JA 2D3RA 2NMOA 4HETA 2IXHA 1N3PA 1QXPA 1UPSA 3UJQA 4BCUA 3FLTA 1H2KA 1QQP3 2JJ6A 3MLKA 4TLFA 1LHOA 1Z7S3 1NXMA 1AXZA 5DZEA 4LNVA 4NR1A 1NA1B 1LEDA 4QPYA 5D8AC 5GZFA 2HWC1 2DWRA 3OPZA 3VZOA 4XIKA 1LGBA 5BNNB 4YVSA 1AYM3 1QKQA 1H4HA 3AZWA 1D4M3 2IXCA 4FPYA 3ZN4A 4HVOA 1LOAA 4J1XA 1H8TC 4EWAA 1OOPC 3MW3A 4P5HA 3B69A 3JCIA 3N35A 1SLIA 2YGMA 2PLV3 3USUA 4CRQA 5AFBA 1PK6A 2CGPA 2KA3A 5CFCB 1APNA 1JBCA 1R1A2 2WFPA 1U5ZA 1D4VB 3ZSJA 4ISQA 3B94A 3LSEA 3BOWA 4I3PA 5H9SA 3NKTA 4DFSA 4C1WA 2WZPP 5FPZA 4B4QA 2MNGA 5F5QA 1CAUA 2D6OX 2A73B 1CQ9A 1TME3 3PMSA 1REEA 2RR12 2NZ9A 2XLGA 1PIV3 4L2NA 1NG0A 1FI2A 5FLJA 5C8WA 1ZX5A 3WDUA 5FBZA 1W0PA 4IEPA 3RMXA 2RS31 1PVC3 4AVVA 2DVBA 4FT8A 1FPN1 1PVC2 2X5IB 2HWB1 2WZR2 4LHNA 2W0XA 1LB2A 4U36A 3RPQA 4F83A 3CNAA 2XKOA 1CN1A 2QNKA 3UV9A 1BKZA 1VRH3 4XTMA 3HD8B 3VZKA 1LESA 4M3CE 3HIFA 1IGOA 1ULEA 1ASJ3 4DRRA 4FOVA 1ASJ2 3VBOC 2JG9B 1ND3B 4RL7A 2GNMA 5C8CB 5J3UA 2QQPA 1LR5A 4ATEA 4WZFA 1R093 4XFHA 3SMHA 1VR3A 4ISRA 2QZ3A 2VG9A 1XYNA 3GHNA 4AVBA 4HT1T 3S7IA 1N1SA 1BCXA 3AP9A 3ST7A 5DG1A 2OUHA 2PN5A 1DDLA 1HIXA 1WW6A 3E97A 2ZTNA 2R1DA 4GA9A 3S0MA 1O5UA 1VBA1 3PVOA 4FPCA 1ALYA 1Q8VA 1NA1C 1FV2A 4PLNA 3R4UA 2GZWA 5BNNC 2JDZA 2BYVE 1Y9QA 4IEZA 3TNQA 5EYXA 4CDXB 5FQ0B 1ZBE1 1AX0A 5I8SA 4YVWA 3ZSEA 4CEYA 2R073 4E9KA 1GR3A 2JG8B 2B46X 3ZPYA 5T5LA 2JENA 1C5HA 1AHSA 4Q4X2 5JPMB 2ZKLA 5EXOA 5JSOA 4XYXA 5CFCC 3DV8A 4UBHA 3RZZA 4XMAA 3H1WA 4XFBA 4FPGA 1RJ7A 3V0AA 2ZGUA 5KHKA 3WDTA 5EJ3A 2ZMKA 1X82A 4XJAA 1DGRA 4YW5A 4DINB 5CFDB 1H8VA 1JXNA 1PNFA 4GMP0 1LHNA 1WD4A 1BQPA 1FYUA 3WUCA 4FP3A 5C9AB 3FFZA 4AE2A 3KS7A 2XWBB 5LK7B 2GMEA 3C2UA 4PQ9A 2DTYA 5GZDA 4MGKE 1XNBA 2X5IC 3VDDA 1G86A 3POSA 4N7IA 3SH5A 4AI8A 1W6OA 4E2QA 2H0VA 1ZYBA 1DLLA 4KU8A 5ACA3 1HQLA 1QQP1 4AQ2A 5JI7A 4EJRA 4QQPA 4HFSA 3HR9A 2Q1MA 4OHYA 2RJLA 2D6MA 1DZTA 1Z7S1 2WNUA 1PGW1 3WP3A 2GNTA 4YSFA 4Y1VA 4FTBA 3IDEA 1LENA 2CL2A 1VJ2A 1DF0A 3FUOA 4HVQA 2TNFA 5GKAC 2JG9C 1ND3C 3TN92 1AYM1 1MQTC 3WINE 1KITA 3OGGA 1XNKA 1YHFA 5C8CC 1D4M1 4Z1VA 1DQ2A 4P9IA 4PF5A 2XLAA 3QOPA 5J48A 4O9EA 5GLUA 2R1BA 4MXWA 1MVEA 3EXUA 2PLV1 4WZCA 4BLJA 2XHKA 4HZFA 3HT2A 4LULA 2D44A 4U2AA 3RYKA 4H3WA 3D82A 2WT1A 2ZMNA 4I0BA 2DU0A 3THTA 1KFXL 3PVBB 1GNZA 4W6YA 4YZ1A 1UX6A 3MICA 1VBE1 3ZYJB 2WWSA 5J98B 5CBLA 1TME1 3PMEA 4YVSB 3N3HA 2AREA 2BFUL 1QGLA 1PIV1 4GMP3 3KT4A 2CWSA 1XXNA 4ES8A 1FXZA 4RD7A 3VZNA 5JIUA 4R9DA 1H1MA 4CDXC 2FQPA 4AW7A 3USUB 3WHUA 3SCHA 5T5JA 1LKNA 1ZZCA 1PK6B 4RA0A 2JG8C 3O0VA 4JGYA 4YGEA 1R1ZA 1COV2 2WS93 3ES4A 3AP5A 2Q30A 1F5FA 2WFF3 1VRH1 2Z69A 3GBWA 2WFF2 4FXKB 2GNBA 1CAUB 1GLHA 3HN1A 3N7JA 4IEWA 5I0UA 4Y1UA 4AFDA 2VOXA 1HKDA 3AXDA 3HMYA 4R9CA 1H2LA 5CFDC 2VVFA 4Q1RA 2XPJA 3QH6A 1R091 1QWRA 2PQQA 3DPRA 1QDOA 1RUF3 4LR4A 5C9AC 4HPKA 1MS4A 3ELNA 4FPEA 4AFMA 4XJUA 3NW4A 3MPBA 1SBEA 4IERA 3AKSA 2Q4SA 2RMU2 5I8TA 3E6BA 1QDCA 1POV0 5DUWA 3GNEA 3VHPA 1LOFA 4YARA 4XEZA 1AXYA 2Z2SB 1I6XA 3W59A 1GZWA 2DUQA 2G4IA 2P37A 1R083 4YG0A 1H0BA 1R082 3WG3A 2XUMA 4AGRA 1UF2C 1TMF3 1O5LA 2VQAA 1SDWA 3IIAA 2OYZA 1QH6A 2YHJA 3M7AA 3WQ7A 3R0RA 4LHLA 5BNOB 2BVBA 2HEYF 3M3QA 2R071 3KCCA 2ZGTA 3TNPB 1A8DA 5JIAA 4BQ1A 1J3PA 2XWJB 1HXS2 1V00A 2GH2A 2WQ4A 4Q29A 1ENQA 1FX5A 3VZJA 3MIHA 1UKGA 1PGL2 5CB7A 4EWDA 5CAZA 4P9XA 1ULFA 1XQNA 4OHWA 4P9JA 4Y26A 3M3EA 2BVVA 1X8EA 1LODA 4AHZA 2H0BA 2VU9A 3V64A 1QOTA 5DUXA 3M70A 4LE4A 2EXJA 2WSUA 4LBMA 4E4DX 4KH9A 4FTSA 4LA2A 4LLOA 1KDKA 3UK9A 4JDMA 1VBB2 4MUVA 2DVDA 3NV1A 1FNYA 1DGWA 4YVWB 3POWA 5I0TA 5A33A 4Z07A 5F9TA 1C28A 1RUE3 5FAXA 1NLSA 2PYTA 4E4SA 1YLLA 2G9GA 1PK6C 4HN1A 1W2UA 3PLQA 1EPZA 1RITA 1UU5A 1POV3 1U5XA 1QNWA 5IT6A 5ACA1 1WMDA 4L99A 3RJ2X 4CDWA 1QH7A 4P9YA 3RSJA 3ZXKA 4RSUA 4OULA 4Q4Y1 3V0AB 4EN6B 1S0BA 5GLTA 2LTNA 1C8M3 5K7PA 1C8M2 1QJY2 2B8MA 3WDVA 1UN1A 3PJYA 2A75A 1AR83 2XB6C 4EN8B 2CAVA 2HJIA 4XF1A 2IFRA 4COYA 1E57A 1EP0A 1WCDJ 3FLPA 1FMD3 3VDDB 2RS13 2GNDA 4K40A 4RQPA 4QM8A 3SISA 2RS12 4NWVA 4LHKA 4UW3A 3T1MA 1JN2P 3J8F3 2D6LX 1F5JA 3FC0A 4K7JA 1BBT3 3R4SA 1CESA 1PZ8A 2WJSA 5T5PA 1BBT2 4Y22A 2D98A 3URFA 2EALA 2WNUB 3HAGA 1I3HA 5SV8A 4HVRA 2N7GA 1HRV3 5BUVA 4IXLA 4BWOA 3M3CA 1W6QA 5DUVA 2UWCA 1CAXB 1V6NA 3CLPA 4GMP1 4GULA 1SCSA 1N3OA 4Y24A 4YM0A 1O4TA 3GALA 1OPMA 4R4ZA 5BNOC 1XNDA 2W39A 4MXWB 3ASIA 1SLBA 4XTPA 5KWRA 1U12A 2D3SA 1Y7BA 3I2DA 4G3YC 2OVUA 1VBC3 2WS91 1S2BA 2IXJA 2NPIA 2BEOA 2EXKA 3WX5A 1S0DA 3MW4A 4Z2WA 1BYHA 4I09A 5BYNA 3ETQA 3IDBB 4TZDA 1ZM1A 1LULA 2BUKA 4EROA 3JQXA 1C57A 1SBDA 3VBHB 4Y1ZA 3MIFA 4YVWC 3BODA 2VMGA 3S7EA 3VBFA 4Q4W3 4EV0A 1O4YA 2ZBJA 1RUI2 1RUF1 2VQ0A 4JGYB 2PAKA 2QZ2A 2RS53 3FHIB 4GH4A 4Y1XA 4YGCA 3FBYA 2RS52 3ATGA 4YFWA 1QU0A 2EA7A 3FMGA 3LCPA 1VB4A 4XDQA 3AX4A 3H3UA 4R4XA 2GALA 3FJSA 3VKNA 4NHMA 3JD73 2ZKNA 3MGUA 4JDNA 4UW5A 3H1YA 3JD72 4R9AA 2K2SA 1NCQA 3RI8A 1PHMA 1KJLA 3AKTA 4H7MA 1NQDA 1TMF1 4GXLA 1RUC1 3E5UA 1OA2A 5LEKA 1AR72 2UY9A 2A6VA 4XHXA 3CJXA 1XYPA 1W6MA 2Q1ZB 3ZDSA 2EAAA 3VDDC 4CDUB 5KHGA 3WCRA 3AYCA 3M4FA 4RS5A 3J4UH 3ZFFA 3RG0A 1CJDA 3AP7A 1GZWB 4C1XA 2NQYA 3VGIA 3ZXLA 2WNUC 3ZMNA 3CEWA 5T52A 1B35A 4LO5B 1VIWB 4BZ4A 3U10A 4HMZA 2YDEA 1ZA4A 3VBSA 4X6RB 2NLRA 2ZGOA 3BPZA 4XILA 1RUE1 1TNRA 4QGMA 5CADA 3ZN5A 1UZZA 2ET1A 4FPHA 3ZVXA 3D6EA 1CGPA 2QCSB 3KM5A 1A78A 1POV1 1S0EA 3QD6A 2VW0A 4LTAA 1G9CA 2YPJA 4W65A 4AEDA 3MIBA 4DY5A 2WC2A 5F6LB 1KDMA 4YZ4A 2DCKA 3TYJA 3VBUA 3TWIA 1UD1A 2ZHNA 1FATA 1BXHA 5LRSA 1SLLA 1JYCA 3LB9A 1AR81 3VBHC 3ZXJA 2WT0A 2MEV2 4LEJA 1YI7A 5KXBA 2GN7A 4IESA 3TBDA 1FMD1 3H7JA 1V6JA 4M0NA 4JGYC 4YFZA 1Z78A 3AM2A 3BU7A 3J8F1 2HKXA 4CDWB 4TYSA 1S0GA 2DVFA 2D40A 2ZGQA 3E5QA 4XFCA 4FAHA 1BMV2 3KT7A 3VKMA 3B9CA 3VZMA 2Z5WA 1HRV1 5KXEA 5AFEA 5HCFA 2GSYA 1WLWA 2IZWA 2WNEA 4D7YA 5I0RA 2VW1A 1AYN3 2PELA 1AYN2 4JV4A 4DNYA 4LE3A 4RHV2 2CGOA 4RQPB 1VBD2 4WV8A 3VZLA 4AK3A 1SLCA 1J3RA 3WP6A 3AZXA 4CDUC 2YC0A 3D8CA 4BM8A 2BPA2 1VBC1 4Y22B 2R0HA 1JTZX 3NKGA 1O91A 1S0FA 4E27A 3O12A 3UKTA 1R1A3 2IXKA 4JTNA 1RUG2 2A71A 3MF9A 4D94A 1QMJA 2D93A 4M00A 3D0JA 4KWJA 4AFCA 1W6QB 2UYAA 5JOXA 1MZFA 3ZYIB 5L36A 1NZCA 3FZ3A 2RR13 1AL22 2XKPA 2SBAA 2XBO1 1D0HA 3AMQA 4H55A 2HWF2 1O3SA 4KWLA 4XJ8A 1AX2A 3APBA 4ZU5A 4XBNA 4XPVA 1IQAA 2DCJA 3ZFEB 5EV7A 3MIGA 4M3CF 3WOGA 1IS4A 5JR7B 2Y0OA 4Q4W1 3USSA 1UMZA 1S0CA 4E4ZA 2D5FA 2RM22 4QGLA 2WZR3 3LA2A 1AX1A 3J26N 4TWTA 2VUJA 4B7EA 2V73A 4YYOA 3H3ZA 3B9IA 2NYYA 4ZKTB 3IDCB 3KQRA 4GQ7A 1M06G 3HQXA 1NY72 4ASMB 4IETA 1FOD2 4WM8A 4CZSA 1AUYA 1AJKA 3MFCA 2ZAHA 4AVTA 1QHDA 1UL9A 4JRLA 4P9LA 4XW3A 3VBFB 1PO22 1PO12 3M2MA 3L9JT 4ZXKA 1F9KA 2ZS6B 4GH4B 5T55A 5J7MA 4K6BA 1KS5A 5AC92 1X7NA 5L19A 3D0SA 5CVRA 4GKXA 4N43B 3RQ0A 5FO7B 3WW4A 2BNNA 1PVXA 4IEYA 5JOYA 4CDWC 2PHRA 1G6NA 2DUOA 2P34A 3LOBA 1RUH2 3NV2A 1W6PA 4HBNA 1NCQB 1X36A 1GNHA 4KBBA 4EWEA 3CL1A 1ND2A 4R8HA 5JOWA 3MZHA 2HWE2 4S2GA 2ZX2A 4BMEA 5IK8A 4XHBA 1VAVA 1RUJ3 1W6MB 2HWD1 2Z42A 1RUJ2 3CF6E 2VVDA 1EAH1 2AYHA 1AJOA 2EVXA 2CYFA 4RQPC 4D7TA 2ZZJA 4FPFA 4IV3A 4C0BA 1UCXA 2P3KA 5HCBA 1XE7A 4Q4X3 2YY1A 4K9SA 1F2NA 1TNFA 2ZABA 1NYWA 1RINA 4GB31 5DUUA 1J59A 4UXAA 4QPGB 3WV6A 2QE3A 1RVF2 3ZSMA 2B5HA 4HANA 4YZ3A 2WNVA 2DCTA 3IPVA 3KGZA 2CTVA 4XBLA 4A3XA 5JVVA 3N4MA 1RMU3 1HRI1 1Q56A 1RMU2 3LA7A 4AHWA 5H9QA 3QH7A 4I01A 4PBOA 2JX9A 4JGZA 3WDWA 3ZN6A 4Q27A 5JSPA 1LOEA 3GYDA 1RB8G 2P3IA 2A6YA 4JRAA 3ZFEC 3OF1A 1ZRDA 1G9DA 4OI1A 4H7LA 3TRSB 3GZUC 4LBQA 3N7KA 3PNAA 4MZUA 4AEDB 1GZ9A 2DYCA 2ET7A 4FPJA 4RR3A 3VBUB 3NWKA 4YZ2A 2ZX4A 4HKLA 1J58A 4XOGA 1QJX2 3IT8A 4QM9A 5A3MA 4PJYA 2ZGKA 1MS3A 1HQWA 1MZ5A 3MW2A 1A6CA 3M1HA 4TSVA 4X8PA 4ITCA 3SLIA 3TN93 2MPFA 2AH2A 3WD5A 2VNOA 1LOCA 2YUEA 4SBVA 4WVMA 3VBFC 1IS6A 2B45X 2TBVA 3AJZA 3P3NA 4BHPA 4EN7B 4GH4C 4UW4A 5GLWA 4QPIA 1C3HA 1UU4A 4CDQA 1ENXA 2DURA 5IK5A 5IK7A 2D43A 2Q5TA 2HEVF 2WA4A 5T50A 1V6KA 2FMYA 2VOVA 1V9U2 1O3RA 2PHWA 4N43C 1S0IA 1YXWA 3ECQA 3MFAA 2RHPA 3RJRA