4H16A

Crystal structure of a short chain alcohol dehydrogenase-related dehydrogenase (target id nysgrc-011812) from sinorhizobium meliloti 1021 in space group p6422
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
b'IEFLNLRGKRALITAGTKGAGAATVSLFLELGAQVLTTARARPEGLPEELFVEADLTTKEGCAIVAEATRQRLGGVDVIVHMLGGSSAAGGGFSALSDDDWYNELSLNLFAAVRLDRQLVPDMVARGSGVVVHVTSIQRVLPLPESTTAYAAAKAALSTYSKAMSKEVSPKGVRVVRVSPGWIETEASVRLAERLAKQAGTDLEGGKKIIMDGLGGIPLGRPAKPEEVANLIAFLASDRAASITGAEYTIDGGTVPTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short chain alcohol dehydrogenase-related dehydrogenase
publication title Crystal Structure of a short chain alcohol dehydrogenase-related dehydrogenase (target ID NYSGRC-011812) from Sinorhizobium meliloti 1021 in space group P6422
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 89
structure length 258
sequence length 258
ec nomenclature ec 1.1.1.-:
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4h16A00
3PJDA 1PS0A 2EEZA 3DL2A 3AU9A 1VL6A 4L75A 5KKAA 4KUHA 4CR7A 4AG3A 4L76A 4ALNA 1HE5A 5JBIA 4A27A 3RC9A 1L7EA 1ML3A 4E30A 4PLCA 4CMIB 2IXBA 3KEOA 1VL0A 3WB9A 2Q1UA 3RI3A 5A03A 2BLLA 1NR7A 1PZFA 5IN4A 1YS4A 3EYWA 1A71A 1NR1A 1ZEMA 3MZ0A 3WOHA 3ZNPA 4UVGA 1YVEI 3P2YA 2W98A 3UW3A 5TIIA 1NVTA 1BSVA 3F1LA 3ZHXA 4XR4A 3H8VA 4WLEA 5L7TA 3KM0A 4D3SA 4CV0A 1B26A 4GWKA 1FDWA 4YAEA 3GMSA 1I32A 3KZVA 4IJKA 4TROA 5F21A 4GLLA 1CIVA 4GVXA 3VKUA 2BH9A 5A02A 4D41A 1U4SA 3P5SA 5BR7A 1R0KA 2NACA 4FPXA 1AHHA 5T6BA 4LK3A 4XQ9A 3GG2A 3JQ8A 5EERA 4P4GA 2I67A 3STHA 4Z9XA 1WZEA 1ORRA 2BFAA 2HRBA 2OP0A 1GDHA 3RD5A 5ILOA 1H0KA 4PLFA 3BMNB 2WYWA 1EE2A 4C4OA 5KNLA 4INAA 1JWBB 1Q7GA 1E3IA 4UUNA 3HE3A 4CMAA 4OXKA 3ZWAA 1QV6A 2OFPA 4IDAA 1E1MA 2FR8A 4KDEA 4KP7A 5JY6A 1SOVA 3SJUA 2NTNA 5JE8A 3ST7A 3NJ8A 1LC0A 3DBVO 3BMQB 1XU9A 1U7HA 5B1YA 1YB5A 4CMEA 1YQGA 2DTXA 3KO8A 4AJOA 1PJ2A 4K9DA 3WFJA 1LA2A 4PZEA 1C0KA 1ZKMA 3JQGA 3DTTA 2B83A 2WE8A 1DFHA 3EGOA 3JQFA 1V9LA 1V8BA 3E6AA 4WGGA 5K6AC 2FZWA 1GPDG 3A14A 3GT0A 3HFSA 4NZ9A 5JAQA 2EP7A 4XR9A 2R00C 1LLDA 4CLHA 1QMGA 4WLUA 5DOZA 4EI2A 3QY9A 3AOEC 1Z73A 2WMDA 3E9MA 2YFQA 2HMWA 5JSFA 1EQ2A 1LU9A 1XKQA 1KOLA 3RUDA 2OZPA 1MXHA 3RKUA 2A35A 2ZB4A 3GPIA 5A1TA 1RM0A 3IOYA 5T67A 5A9TA 4IZIA 1PZGA 2Q2WA 5L7YA 1GZ3A 2DFVA 1IL0A 3IMFA 2WD7B 5HRUA 4NBVA 2JJYA 3WMXA 1RYEA 2FP4A 1ZK3A 2NQTA 1B0AA 5JFOA 1IPFA 1LUAA 3C1AA 3KVOA 5JDIC 3VTFA 3R6DA 4FFOA 3T7EA 1ISIA 5A3JA 5I7EA 4M87A 3OM9A 3I23A 3WG9A 3LSYA 1NWHA 4ZU3A 3S55A 4BUCA 1U3UA 1KYQA 2Y1FA 3GDFA 3QHAA 5CFZA 3LF2A 3ONDA 1PJSA 1KEWA 1LSOA 1JAXA 2EJWA 3OA0A 4LVUA 2HKIA 4OQYA 4R9SA 5KJ1A 1CQIA 2O7QA 4K6CA 1B3RA 1TVEA 4ZN6A 1DRWA 5COQA 5FEUA 3M2TA 4PG7A 2NVUA 3GAFA 3WGZA 2P9GA 4ALMA 5A04A 1EQUA 3EC7A 1UJMA 4IY1A 4J9UE 4IDEA 2YDXA 2VTDA 3U5TA 3QP9A 3GF4A 1ZUD1 4WNCA 3WFIA 3OJLA 4IQGA 3F6YA 1I24A 2GN4A 3JSAA 2I3AA 4D0SA 1ISJA 2IEDA 3EW7A 2GZ1A 4K1LA 3JQ6A 1LDBA 4E2ZA 5EQFA 1YRLA 4WLNA 1HL3A 4JBIA 3HNPA 3IS3A 5U9CA 1EBFA 3KXDA 1B7GO 4HV4A 1E7QA 2BRUA 3F5SA 2EGHA 2I76A 3PK0A 4E31A 1DC5A 2IEBA 4ZICA 3A06A 5JDCA 1V6AA 1SEVA 1ID1A 2OUIA 2XAAA 4OO3A 1Y5RA 1N7GA 5BSFA 4B4UA 3GAZA 3JQGB 5KVSA 1AXGA 4NBWA 3OP4A 1ZXLA 5ITWA 1AUPA 2Z1NA 3ZU4A 1HWYA 4NMHA 1X14A 4J7XA 5LCXA 2X7HA 1DIGA 1SEPA 3AFMA 5IXYA 3WYEA 5K9ZA 2J5QA 4BNLA 1P33A 1M76A 2B4TO 2VT2A 4C7JA 3E03A 2QYTA 4TRNA 4PLGA 3VZPA 1IZ9A 1NXQA 2BD0A 3PRJA 1JKFA 2JFHA 5TT1A 2O2YA 1PL8A 1H94A 2C0CA 3CH6A 4XGKA 3OMLA 4Y98A 3I9KA 4IINA 1QSGA 5LDGA 1XG5A 3HHPA 4KWIA 5F1OA 3TZCA 1N1GA 1P9LA 1YL7A 1H6AA 3H2SA 3ORFA 4DL9A 5A06A 3DWFA 1ZIDA 2FWMX 1PEDA 2QYSA 5KJEA 1JQBA 1E6UA 4NU5A 3INTA 1VKNA 4HFNA 4FDAA 4Y6SA 4Z0HO 3W6UA 3KUXA 1LJ8A 3D1LA 5A9SB 3TJRA 1QG6A 1ZH8A 3OHSX 3V1YA 3L6DA 4RLHA 1JKJA 4E3ZA 2YQ4A 4CL3A 3FR8A 4WKGA 1HZJA 4PVDA 3PYLA 2PKQO 4RPLA 3ZNOA 4AFNA 2A92A 2EV9A 1BXKA 3PWZA 4RPGA 2E48A 1QP8A 3QSGA 4M54A 1HE3A 4E0BA 4D46A 1GUFA 3DFUA 3AUTA 4FN4A 2NVUB 1UDCA 4LCEA 3C1OA 1HE2A 3MJSA 4PLHA 5A05A 4B7XA 1PJ3A 1GPJA 4ND3A 4FFPA 5G4KA 3DZHA 4PRLA 4B8WA 1HDZA 4Q3NA 1NAIA 5F1PA 2WEKA 4BNZA 4DQXA 4DIBA 2ZYDA 4BV8A 1F06A 4XEHA 5DCYA 1BRMA 4IDCA 5TS3A 3PXXA 1WDKA 2O3RA 2JFGA 3K9QO 3OJEA 4E2WA 2PD4A 3LDHA 3ETGA 3VDRA 2AE1A 3U62A 2GUGA 2E49A 3UKOA 1V3UA 2GRAA 3WX0A 4AJHA 3MOIA 5B4TA 5KJFA 2OOSA 5BNTA 2DT5A 3FNFA 4BNJA 3PJFA 1LDGA 1T26A 1YBMA 2BHLA 2CF5A 2B5WA 2Y1GA 4NDNE 2DAPA 2OBYA 3DAGA 4H3VA 4D0RA 5TLSA 4KDFA 3LC2O 5IG2A 1O6ZA 4D44A 4U6QA 1KY4A 3NJ4A 3VZQA 1H9AA 3PDUA 2AG8A 3GLQA 2Q4EA 1K6IA 3GN2A 3RC1A 1AHIA 3OQBA 4XJTA 2P4HX 5BNIA 1MFZA 4U6SA 1I3LA 4EBFA 4B7CA 1NVGA 4CUZA 1AE1A 2NU7A 3GEDA 2BGKA 3IUSA 4CV3A 4E32A 3PIIA 4HFJA 3UHAA 4XX0A 5G0WA 2BKAA 1X0VA 1I10A 3SXPA 3LU1A 4J7CA 2HSDA 1FDVA 4TVOA 3CZRA 1W0CA 3JYOA 3Q6IA 5C3MA 2X86A 3VHRA 3RBVA 2C07A 3ANNA 4DPLA 5I9NA 1I0ZA 3PHGA 3UAGA 4A26A 4BHTA 4F6CA 1VJ0A 4JCOA 4BKUA 1EK6A 1U1IA 1DIBA 5CHEA 3IQDB 5I7VA 5JC1A 4IIUA 1E77A 4R4JA 1O0SA 4DQVA 5JLAA 1E5QA 3PYXA 2YUTA 4GMGA 2YV3A 2DU8A 2Q1SA 4WJZA 2RAFA 2CF6A 4K28A 1K6JA 2OP1A 4RJTA 2ZQZA 5A5EA 2X9NA 2O7SA 1Y81A 3CUKA 1DIRA 1E6EA 1QKIA 3HFGA 4QO8A 3INRA 1M67A 5G4KB 1ZSVA 1GCOA 4RVDA 5ENVA 3U49A 1GQ2A 1NPTO 5JW6A 2GPTA 1HYGA 1XGKA 2HCTA 4M55A 1WVGA 1OOEA 3VH2A 1U9JA 1DJNA 3ZZNA 2NSDA 4MO2A 2D5AA 4PRKA 4RZIA 1KERA 5L45A 5L53A 4EGFA 3ZV3A 2NADA 1P1RA 3GQVA 4HWKA 5DBFA 3QRWA 3CZMA 4R1SA 3OJOA 3HB5X 1E7MA 1OFGA 3LLSA 1DIHA 3RUCA 4CUKA 2P91A 2B36A 1SZJG 5G0UA 1NHGA 2OO5A 5LC1A 4DLLA 1HSOA 2R00A 4BNGA 2DPHA 3WMWA 2JAHA 4IDBA 4TRMA 1I3KA 3AOEA 4FB5A 1BGVA 3H9QA 1C1DA 3OEWA 3UN1A 2X9VA 4J0FA 3GZ4A 1T2EA 4BO7A 4HFMA 2ET6A 1KEVA 5FFFA 1QR6A 4BOYA 4IDGA 5KTKA 2JCVA 2BI8A 4LW8A 1NVMB 2JCYA 3FN4A 4ESOA 2VZ0A 2Y93A 4CJXA 1BXGB 1UDAA 3GVPA 2HMTA 5TT0A 2Y0EA 1XQ1A 5CG2A 4PG8A 1EEHA 1R66A 3RFVA 1P1HA 2X0JA 3DB2A 1H93A 5DBGA 3U09A 1OC4A 5JDIA 1EE9A 3VOSA 3F47A 7MDHA 3L9XA 1JDJA 5CDSA 4BB5A 4MOWA 1ISMA 2BGMA 3JQBA 3JQCA 4MVJA 3U3XA 4NJMA 3EVNA 1ZBQA 3RROA 5G0SA 4ZQEA 5I9LA 1TI7A 1VC2A 4WOJA 4CPDA 1YJQA 5KVCA 3O9ZA 1PWZA 2GLXA 2BI7A 3BMCA 2W90A 4A10A 3DBLA 3TL2A 1GEGA 1Q0HA 1A27A 1X1EA 4J90A 3O03A 1MXFA 4XYMA 4NBTA 1PS8A 4KTVE 4CQMA 3ITKA 3WXBA 5JY1A 1UAYA 2GZ3A 2HDHA 3K96A 2EKPA 4OHUA 3WSVA 1PGPA 1XQ6A 1EVZA 2PD3A 4ONEA 1N1EA 1PQUA 1Y1PA 3SX2A 2ZCUA 2XXJA 4YRBA 2IODA 2NVBA 3VKVA 4JXKA 4NG5A 4OKIA 1OC2A 2O48X 1HSZA 4FFLA 3Q9NA 1JKIA 2I65A 2YV2A 3ANMA 4UEOA 4JIGA 4XJSA 1JU9A 1EVJA 1ZJZA 1P1FA 3ICPA 9LDBA 2NU8A 2ZTMA 3I1JA 4GX5A 4UAGA 4XB2A 2Y68A 2Y1EA 4B79A 4B4VA 4W7HA 1V0JA 3N74A 4HY3A 1TEHA 5F3RA 4QTZA 4D42A 1ONOA 5DT9A 1NAHA 4FR5A 3OH8A 2ZB3A 4KZPA 4MP8A 5HWSA 1EUZA 2VOJA 2HMVA 4CLDA 4XB1A 5TSDA 3ETDA 3GK3A 2X4GA 4MVJD 4HP8A 3MJTA 2Y66A 4FCCA 3WGGA 3IKVA 1MP0A 3MJ4A 3ZWPA 1C1DB 1GUZA 1XWFA 2YJZA 1MC5A 4EEXA 1SC6A 2DVMA 2PWZA 3PI7A 4HKTA 2CVZA 2HK7A 1KVUA 1YDWA 2VQ3A 3EAGA 3GH3A 1R4NB 3N7UA 4TZKA 1W73A 4XWYA 5KCZA 2AXQA 2DBRA 4XIJA 3TDKA 1N7HA 1HT0A 5BSGA 3KYBA 4J6FA 3ZV6A 3MEQA 2G0TA 4CQMD 4JBGA 5IXSA 3V1UA 2X5OA 1UXKA 3ZU3A 4DBVO 1IZ0A 3PYMA 4IXWA 3GFBA 1T4BA 3AFNA 4BO9A 2D59A 1IYZA 2JAPA 3OQ1A 5CPFA 2JKVA 4AICA 3W8FA 1LDMA 3I6QA 1OZAA 3OIDA 1ZK1A 1PJCA 2EJVA 3DO5A 3DZBA 3HADA 1LRJA 1F0YA 4MKRA 1BW9B 4TRRA 3V1TC 3D5QA 1P0FA 1UXIA 3WGYA 2O3JA 3DOJA 1PJBA 5CP8A 5JAMA 4CL8A 2DPGA 3HG7A 2DBVO 1PU2A 3WGQA 3BMCB 4NFHA 2VWHA 4HNHA 3H5RA 2BFOA 8ADHA 2Y1DA 3ZWCA 2G17A 1B8UA 1HYEA 3ZNQA 3ZHZA 4A0SA 1WLYA 2X23A 1NFQA 5JO0A 4CQMB 4BKQA 1SCUA 2WE7A 1O94A 3RC7A 1YDEA 1B2LA 1Y5MA 2J3HA 4R3NA 3ZH2A 3JD2A 2GN9A 1K89A 3H5NA 3AJRA 4MIOA 2HAEA 2C7GA 3RVDA 4XYLA 3LT4A 2PKRA 3WDSA 3OSUA 4Z3DA 2HRZA 3CMMA 4WEOA 3SC6A 4OSPA 1Q0LA 2Y0CA 2YW9A 5TRTA 7ADHA 2EF1A 5I8WA 1C1XB 1Q7CA 1IHYA 4RPJA 4JJGA 1NFRA 2LDXA 4P4NA 2OHXA 4E2YA 1K6XA 2RIRA 4J4TA 4Y6PA 5FI3A 1FDUA 5BT9A 1E3LA 3K5PA 3R3JA 1T2DA 4KWHA 4XQEA 1E7SA 3GC6A 5CAEA 4ZRMA 3A9WA 3QA9A 1BVUA 3CXRA 4Q39A 3ASUA 4GX2A 1TXGA 1E7YA 1YE3A 4MIYA 5JCXA 2EHDA 4TMFA 4L4SA 2RCYA 3UXYA 3Q11A 3LYLA 4HXYA 2YYYA 4J1NA 4J3FA 1W4ZA 1XCBA 1DJQA 1TT5B 3BAZA 3OIGA 1E92A 2ZB7A 3QWIA 4J0EA 4JGBA 5HS6A 1KY5A 4RQUA 1IB6A 2ZJ1A 4FC6A 2O4CA 4QT0A 2G5CA 1J5PA 3IDSA 4GI2A 1VE9A 2XF8A 5COBA 3WLEA 4HADA 3OECA 1ZK4A 3VPXA 2WD7A 5TX7A 3EZYA 1V3TA 4N5MA 3TRIA 3NDIA 4I5FA 4Q3AA 5EMHA 1X7GA 4D7AA 4BB6A 2RH8A 4PZCA 4JP2A 4XCVA 3AW9A 3RUFA 4JK3A 1LC3A 1GAEO 1NYTA 1YO6A 1ENPA 1EVIA 3OQ6A 4BKPA 4GQAA 3JCZA 1ENOA 4CLOA 3IAHA 5AVOA 4O63O 4X54A 4BKOA 9LDTA 5FI5A 4UUOA 3UCXA 1CEQA 4U0JA 3LC1O 2EGGA 3HQ4O 2W2KA 3P19A 1ZCJA 2BELA 3K6JA 4YA6A 5GMOA 4LN1A 3WR5A 4GKBA 1Z75A 3AM4A 3RBZA 3QWBA 1KEPA 1GL3A 2ZYGA 2CFCA 2YY7A 1ZNQO 1UP7A 3H9UA 4R51A 3ASVA 3WQRA 3UGKA 2FSSA 1TT7A 4P22A 1HDOA 4RVGA 4WASA 2GNAA 1E0DA 2CD9A 4QX6A 1A72A 5BNFA 4CMHA 1XDWA 2AEJA 4YT4A 3DR3A 3RC2A 2Y99A 5TJ9A 1H2HA 3BMOA 1Z7EA 1B3BA 2O3SA 4YQYA 1KVSA 3WICA 1HZZA 3COSA 3KYDB 3CKYA 4L8VA 5MDHA 5IDWA 1J0XO 3DZIA 1HDCA 5I7FA 3AY7A 3DC2A 1QYDA 1FXSA 3TQHA 3HWRA 3PLNA 3PP8A 3C3XA 3FWNA 3UF0A 1SB8A 4GAEA 1JVSA 2QRKA 4KUEA 2Q49A 3AY6A 2WD8A 3LQFA 4DRYA 1BG6A 4ZQBA 1X7HA 2Q3EA 2P5YA 4BNNA 2HUNA 1GYQA 3CMCO 4OKNA 4XZ3A 3NT2A 2IXAA 3WNQA 3KTDA 1DBVO 2VUSA 2PFGA 1H5QA 1PR9A 3GN1A 4CM7A 5I7SA 3AM5A 2JCXA 5JS6A 4AJLA 1M6WA 4RGBA 1YKFA 4CV2A 4GPD1 1BTOA 4RCVA 3CINA 2Q50A 3PVZA 1M75A 2F1KA 3TZKA 3JQDA 3DXFA 3GEMA 4HFRA 4BNYA 5A9SA 1ISFA 1NQ5A 1WMBA 3L07A 5A5FA 2X5JO 3JQ9C 4LRSB 5JYDA 3I9LA 4I9UA 5EL0A 4BKRA 1E5LA 4CLOB 5FYDA 4J16A 1O95A 3PTZA 1TA4A 2C59A 1GADO 2E4AA 3MWDB 1RKXA 5BSEA 2GGSA 2NV6A 3E1KA 2DBQA 1VI2A 3RUIA 1E3WB 3GUCA 4I8XA 4AJIA 2W2KB 4ZHSA 1Q7BA 3GA0A 3ROKA 2O3UA 3GGOA 2ZIZA 3E5RA 3AI3A 4I9HA 1YOVA 1UDBA 3Q2IA 1ZMOA 1T2AA 1WP4A 1WWKA 3R0IA 2WDZA 5B37A 3RBXA 3VH4A 4OSOA 4RDIA 1DLJA 1LEHA 4LCJA 2YQ5A 4WEQA 3ZI0A 3E8XA 3JTMA 1NX6A 4EYEA 2Z95A 1XIVA 1WW8A 1Y6JA 1QXSA 2V7PA 3FTNA 4YACA 3SC4A 3VVCA 1I3NA 4Q9NA 3GG9A 3KSDO 4E13A 3C7DB 4JJIA 3BTSA 3PZRA 3I5MA 4DTIA 1E1LA 2B4QA 3BMOB 1GV1A 1QYWA 3GVHA 4NI5A 4AJJA 4XD2A 1RM5A 4JP3A 2NU6A 1YH3A 4YXFA 4RF3A 3G49A 3ZHBA 1LDNA 2HJRA 4BO4A 3C1TA 1MG0A 4IZHA 2FMUA 4R54A 2C5EA 3L77A 1MA0A 4NBRA 2DUWA 1TLTA 3CPSA 3GRKA 4DMLA 2P9EA 4FFMA 4CLEA 3MTGA 2FRDA 4PCVA 1WXDA 3ZW8A 3KEQA 3GVIA 3P2OA 4M1QA 3ROMA 4O0LA 4AJ1A 1P0CA 1M6HA 3U9LA 4AJEA 3F4LA 3DMYA 2Q1TA 1PL7A 2AHRA 4DYDA 5CDUA 2QZZA 4TKMA 2DQ4A 2PTGA 2BF7A 1NP3A 2J3JA 4I08A 5LDHA 1JVBA 1VLLA 2IRWA 4MJLA 2C7VA 1CJCA 1XR3A 2J8ZA 2X58A 2IZZA 5L3ZA 3DBHB 2EW2A 1NNUA 3PHHA 3BIOA 1P3DA 4AJ2A 1GV0A 3C8MA 4N5LA 3PEFA 3TZHA 3VPGA 1UP6A 4FD3A 1IY8A 3ZN2A 3ZNNA 1A7AA 1ZSYA 4R16A 4W82A 4W4TA 4IJUA 1BDMA 4YT5A 4EEZA 4F46A 1TB4A 1I01A 1LQUA 4PZDA 4E5YA 3N58A 2QRJA 3WBBA 1UXHA 1RYDA 3IL2A 3DEYX 3SJ7A 3ZWVA 2CVQA 4E33A 1CWUA 2J5KA 3ETEA 4YAJA 4YJGA 3WS7A 4CUJA 4E5KA 2X8LA 4IGEA 3PGXA 1YOVB 3TZ6A 3S1LA 1SMKA 2Y1CA 5KJ6A 2HU2A 3GEGA 4W6ZA 3M2PA 3WGIA 3MWEB 3TN7A 3AK4A 3BHIA 4LSWA 4FJ1A 1N5DA 1QYVA 4GKVA 4D43A 5IDXA 1FMCA 3DZJA 2QW8A 1U7TA 3OFSA 5ICMA 5L4LA 5JPIA 3RSHA 4IMPA 3L0DA 3WQQA 1AXEA 3ON5A 1E1KA 1K3TA 1N8KA 1UZNA 1DHRA 3RFTA 2Y1OA 2RHCA 1GEEA 3GRPA 3NYWA 3F5QA 1LSJA 3DMTC 4IPTA 3OETA 2WTBA 2PLAA 4BV9A 2FHSA 2VN8A 3H6KA 3LT1A 3A28A 3VPFA 3B1FA 5JMPA 4E5NA 3OBBA 4YJFA 2BGLA 1DC3A 1P44A 1D1TA 3QVTA 2E6UX 1O8CA 4CM8B 5IZCC 3Q3CA 1B8PA 1T25A 3UICA 3EHEA 3S2IA 1V3VA 1BXGA 4YCAA 4LMRA 3WJ7A 2AEFA 1LTHR 1U28A 3JV7A 2P68A 1JN0A 3UOGA 4YDRA 1PJQA 1PJTA 5CPBA 3SEFA 4ND2A 3DZKA 3B6ZA 4GX0A 3RUHA 4B4OA 2EP5A 3AUUA 3ZWWA 1OBFO 1SB9A 1AGNA 1K5HA 2Q46A 4RF2A 1ADCA 4TKLA 2I99A 3W4KA 1BHSA 4J4BA 2D1YA 2QHXA 4FJ0A 4H7PA 3B1KA 5EN4A 4NU6A 1DFGA 3FD8A 4Q3EA 4YTEA 3RAJA 5CG1A 1XHLA 1J6UA 4MPDA 4N18A 1NPYA 2VZ8A 1Q2XA 4CMCA 3MOGA 5IJZA 3JD4A 1Z82A 2EKLA 1U4OA 4PIVA 3GPDG 1MLDA 3FF4A 1LLQA 1ULUA 3DTYA 2Q2VA 2YV1A 3T4XA 4L0QA 4P38A 4RO0A 3WWZA 1KS9A 1LSUA 2IDZA 4OAQA 5F5LA 1KETA 4N54A 4O6VA 4NPCA 3E48A 1HRDA 4QXMA 3ROPA 4R3WA 4YJGB 2WYUA 4B8ZA 2XOXA 4RF5A 3X2FA 3EMKA 1NBOA 3H65A 1PWXA 4FGSA 4B4WA 2CY0A 4OJNA 5U4QA 5JCJA 4IJVA 2LDBA 4R1NA 6LDHA 2B4RO 5DCWA 3NTRA 1PSDA 3F3SA 1NASA 1GZ4A 4B7UA 4O1MA 2IYPA 3HSKA 3NUGA 1I2ZA 3JQEA 3RJ9A 2FSVA 4BO2A 2VWGA 4RZHA 4CM5A 4XKJA 3DFZA 3TF5A 4DC0A 3JQAA 5BQFA 4IQ8A 4MVJE 5K6AA 4R68A 2X5KO 3C7CB 3H9GA 4W9NC 3UH1A 2JFFA 4J1SA 1MGOA 3FNEA 4XQGA 3E9NA 1SO8A 1HLDA 3IP3A 5TNXA 2FOIA 2CUKA 2G76A 5DDIP 1G0OA 3CE6A 1UUFA 4WK6A 4L73A 1GQYA 1R4NA 4YJFB 5KWEA 5L7WA 2FZEA 3WGTA 2CSUA 4L74A 4ZQGA 4AJPA 3D4NA 3GHYA 3FPCA 1PX0A 3NDRA 1CERA 2CZCA 3CEAA 2OGUA 3GOHA 4CMEC 4FSHA 3I9JA 3I9OA 4BNMA 1GD1O 1KVRA 3PWKA 4DPKA 2P2SA 2HMUA 2ZTVA 1GZ6A 4DBZA 2DBZA 3FR7A 4L4XA 1BW9A 2NUAA 1JWAB 3DOOA 2X9GA 3JQ9A 1EZ4A 3PWSA 1R4MA 3PPIA 1E3SA 3AU8A 2NM0A 5EJ2A 5IF3A 5JCJD 1E7RA 3TSCA 4YAGA 5I8ZA 4FQ8A 2NU9A 3KSZO 4JNKA 3JYLA 4I9NA 4CODB 3ZU5A 4ID9A 1HDXA 4HX5A 1FK8A 5G0VA 4BMNA 4BO1A 4D3FA 3BYZA 4WE3A 4QSMA 3PDJA 4LISA 3JQAD 2VRBA 3KB6A 3UCFA 3IIEA 2PKQP 4MIEA 4XYBA 2GO1A 4S1VA 1O89A 1EFLA 1LLUA 2VRCA 3F9IA 3OJFA 2PA3A 3EDMA 1WNTA 5L95A 3KLMX 2FPGA 4NFYA 3RWBA 5DULA 3PJGA 5CDTA 4CM6A 4ALKA 4E6PA 2NWQA 4JROA 1C1XA 1OAAA 4EUFA 4EJ6A 5H82A 1I33A 5DBIA 1ENZA 1ZJYA 2E37A 4U7WA 1OI7A 2PZMA 3W1VA 1IPEA 4XDYA 1DAOA 1RM4A 4Z3KA 4R9RA 3E82A 2AQIA 3HUDA 2JD1A 3L6EA 5JNLA 2B69A 4OH1A 3LT0A 4GX1A 1GCUA 3PFWO 2JD2A 3HN2A 3I4FA 3D4PA 3JQAB 4NH4A 1CF2O 1YJ8A 2RHRA 3S2GA 1MB4A 1BXZA 3WGOA 3KBOA 3QVXA 2O50A 5JO9A 3T7CA 1Z45A 1D4FA 4EZBA 2B5VA 4NIMA 5H81A 1ISGA 4BNKA 1E7WA 4GL4A 1JA9A 2YHIA 2GN8A 4BIIA 1XSEA 2JHGA 4KQXA 1TT5A 3DBRA 5T57A 4XRGA 3U4DA 5ES3A 1A4UA 3QVSA 1CETA 2Z5LA 4ZD6A 4IJWA 3NT4A 4P8RA 5THQA 3SLGA 1I2BA 1K2WA 3WTCA 3FBTA 1ULSA 4LRTB 3K73O 5KOIA 3FNHA 3EY4A 3RIHA 1S7CA 2VYVD 2AEMA 2W8ZA 5DP1A 4BNUA 3E5MA 5I9MA 2VRCD 3RUEA 1P77A 3KSUA 4TSKA 2G1UA 4MVJI 4HUJA 1BVRA 1E1NA 2DC1A 2Q45A 4O5OA 4ZA2A 5JAIA 3RU9A 3R1IA 1R4MB 3D7LA 3I83A 4XIYA 3U4IA 2RH4A 3IC5A 1F14A 1F12A 4F3YA 4YAIA 1ZMTA 2J6IA 4OGWA 4JN6B 3WJAA 3O8QA 3I9NA 4MP6A 2EKQA 4YB8A 5C7IO 4ND1A 1BMDA 4BO5A 3NGXA 4XA8A 4XQCA 1O5IA 2UYYA 1WPQA 3JYPA 3PZBA 1KC1A 4YEDA 4DLAA 5JC8A 4MVJP 4RLSA 3ZV5A 5ILGA 3HDYA 3MJEA 5CDGA 3E9QA 1LQTA 3GZNB 4QUKA 1CRWG 1ONNA 2OMEA 4JJFA 4H15A 5IN5A 1P31A 3IJRA 1I8TA 4YPOA 1YL5A 3PJEA 2VUUA 2C5AA 4GWGA 4CLXA 3GGGA 3QQPA 4DWVA 3K92A 2VWQA 1HLPA 4GSLA 2VZ9A 4II3A 1DDOA 3M1AA 2EIHA 4OXYA 5TJHA 4FBGA 3WQSB 4ZVVA 3ZDFA 1LNQA 2GDZA 3DMTA 4A5OA 3BTUA 3KYDA 5A9RA 1X15A 1UXJA 3ZGYA 3G0OA 1IOLA 1QORA 1RM3A 3ICCA 1ADFA 2PNFA 4YWJA 4M86A 1LDYA 1FJHA 2EW8A 1DB3A 4RPKA 5L4SA 4IQ0A 5THKA 4TZTA 4AL4A 4LSMA 3O4RA 5DOVA 4RVUA 3VAZA 1IHXA 3ZWBA 3DDNA 1AN9A 4PVCA 3OF2A 1LI4A 4PGFA 4Y8VA 2BMAA 5IZCA 4L4RA 3WYBA 1Y8QA 3ZV4A 2YHIB 3AI1A 5JYEA 4EITA 3RU7A 3DBRB 2C82A 1DO8A 2G82A 2I3GA 3CSDA 4RVFA 4ZGWA 1QV7A 4MVJG 4PG4A 3V2UA 3F46A 4GSKA 3UFXA 4CM3A 3TZQA 1I3MA 1YQDA 3GVXA 1E3EA 3G79A 1LRLA 2V6BA 1R0SA 3A1NA 1EK5A 1EUDA 4D45A 1VSVA 1ADBA 4BNWA 3WIEA 2GF2A 1LX6A 4GGOA 2D4AA 3ZWOA 2Y0DA 5AXCA 2HO5A 1FF9A 1I30A 2PZKA 3D4OA 4IS2A 2QG4A 1EDZA 5JAZA 2J3KA 1DAPA 1DRUA 2D2IA 4Q3DA 4QO7A 5DZSA 4Z6KA 2PGJA 1G1AA 3LVFO 2IE0A 3TL3A 2X22A 4BO6A 3NAQA 4TVBA 5B4VA 3K2BA 3LZ6A 3HZZA 4YYZA 4XGIA 2FPPA 4OM8A 4DIOA 3JD1A 4MKZA 1E3WA 4U8GA 3ADOA 3O8QB 1WAMA 1RPNA 4P4LA 4DPMA 1I5RA 4BNIA 3NX4A 5KIAA 2V6GA 3NDJA 1VKOA 4R1UA 5T5QA 4NHEA 1YBAA 1XLTA 3L4BC 2WWRA 4Z9FA 2PGLA 2H63A 1U8XX 4JX8A 1P1JA 2CDAA 2GR9A 1C0PA 4G2NA 2FY8A 1C0IA 1DPGA 5IFLA 2YDYA 3HN7A 3QV1A 4KTTE 2VHXA 5ENDA 4YT2A 3JQ7A 1CQJA 1YBVA 4KQWA 4II2A 3BTOA 4I1IA 4Y6RA 2CMDA 3HDQA 4IMRA 1RJWA 4FJ2A 4RL6A 1DRVA 1B14A 5B4UA 4DLBA 1H6DA 2HJSA 5A4DA 3K2EA 3K30A 5MGBA 2EXXA 4E21A 3JYNA 3BHJA 2OL4A 2GCGA 3FWZA 4BGUA 4D3DA 3GNSA 5U1PA 5TGDA 4W9NA 1H6BA 4XGNA 1XEAA 3ZHYA 1L7DA 4YJHA 1R0LA 4EJMA 3AY3A 1DXYA 4ZJUA 3D0OA 2W4QA 1YWGO 2J5RA 1D8AA 3H2ZA 4N5NA 4OIMA 4TQGA 1EUCA 3ADPA 4CM4A 2JHFA 3EZLA 5B12A 3WTBA 3WGHA 1WZIA 2V6FA 4NK4A 4BMVA 2PZJA 3QWHA 3PIDA 1P1KA 2HLPA 5L9AA 2D8AA 1Y8QB 4OOEA 3U0BA 4A7PA 4WCFC 2TMDA 4OXNA 5G4LA 4IDFA 3F1KA 3FCOA 3ITDA 2FR0A 4J2OA 2VT3A 4I5GA 3S2EA 3RJ5A 1YGYA 1U5AA 2PH3A 5HS4A 4RV9A 4YT8A 5JMWA 2VHVA 3D3EA 3GMDA 3GR6A 4CR6A 3DBHA 3Q0EA 4DQUA 4ND5A 3TPCA 4D79A 3AM3A 1VL8A 1YL6A 1UZMA 2EERA 3E18A 5DF1A 5CEJA 2GYYA 3V2HA 1R16A 2HK8A 1Y8RA 5C37A 3MJCA 3PFFA 4W7IA 2PZLA 3WSWA 1NQAO 4BGVA 5EQDA 3OICA 3ANLA 3DHEA 2X0IA 4BNTA 2WJPA 3QVWA 1PR3A 2F00A 3KV3O 3Q9UA 4WUVA 4UUMA 4PG5A 1C3VA 3ZWMA 4EW6A 5HM8A 4Z0TA 1DHTA 3QVOA 1ZXBA 4J9VA 2PH5A 3RQSA 1F8FA 1GY8A 5F5NA 1CDOA 2PV7A 3G1TA 4IUYA 1J4AA 3PLRA 1Z6ZA 1NPDA 3JQBC 4PLVA 4MINA 4IBOA 1PQPA 1XA0A 4RORA 3DZFA 3MJVA 1U3TA 4HNGA 1HTBA 3NRCA 1ONPA 1ADGA 3UVEA 2D5CA 2ZQYA 2UAGA 4AJ4A 3JQ7B 5GZ3A 4YRDA 3H4VA 1J49A 2WM3A 2PD6A 1MG5A 4UULA 4A73A 1Y9AA 5IDYA 4E4YA 2O3TA 2PY6A 4Q3CA 2Q2QA 5IDQA 2UDPA 1B16A 2ZK7A 2IZ0A 4CQLA 4G81A 2OXIA 5BSHA 4Z9YA 4DREA 3JQ8B 1W8DA 4BQPA 5C7LO 5K0ZA 1KVTA 1PJ4A 2NLOA 3LLVA 2NNLD 4YJHB 6ADHA 1EMDA 2H6EA 1QLJA 4CMGA 3QWAA 1EFKA 2R2GA 4Q3BA 2O4UX 1MUUA 2HK9A 1P45A 1WMAA 1WDLA 3T4EA 4E5MA 4BL5A 4CM4B 1PTJA 3KLPX 4G65A 4CM8A 4ZQFA 1G0NA 4J1TA 4YVFA 3ENKA 1PJLA 1XYGA 2Q4BA 4LVCA 1HEUA 3RCBA 4BNFA 1MV8A 2Q99A 1IULA 2X0RA 4DA9A 3LK7A 4BNXA 3VDQA 1NM5A 2IYOA 4U0KA 3I52A 4DUPA 1T24A 3UUWA 5AYVA 3VTZA 1A9YA 2B37A 3D64A 4TRJA 5T64A 5ADHA 1HDYA 2DLDA 2C2XA 3IJPA 5ITVA 4J2HA 1HF3A 4RDHA 5DCUA 2VNAA 5EINA 1PGQA 1T1RA 3I3OA 2GERA 3BHMA 1L1FA 1Y8RB 3KYCA 4BQRA 1MC4A 4MVJH 1GYPA 3HB4X 1XU7A 3GVCA 3DAFA 1VJTA 4EJ0A 1BDBA 4R69A 4GGPA 3PGJA 4N7RA 3WBFA 3H3FA 3JYQA 4YJDA 2ZKLA 5L40A 5C5IA 3L6OO 4AJKA 2BFPA 4A2CA 4CMJA 4F45A 1GR0A 1Q1NA 1XELA 3PHIA 3HJAA 3QIVA 3CTMA 1SBYA 3SLKA 4ZQHA 2OBNA 4WNIA 2EWMA 3ZWNA 1NWCA 2P5UA 3SVTA 2AE2A 3GHHA 1UAGA 4HBGA 4BVAA 3K31A 1DC4A 1C14A 4WLFA 2UUOA 2IZ1A 3GNQA 3IKTA 4Z0PA 3OIFA 1PZEA 2VNSA 1N2SA 3DHNA 4O59O 3FNGA 1LBEA 1NHWA 3DONA 4YQZA 4MP3A 4ZRNA 2AQHA 1DSSG 3OJ0A 2AA3A 1MFPA 2JD0A 2VOEA 4UEKA 1I2CA 3G17A 1JW9B 4PLWA 4ALLA 4IM7A 3QLJA 4BO0A 3C24A 3B1JA 2ZYAA 1DEHA 1ZW1A 4IS3A 1WDMA 1KIFA 4YAKA 4KMSA 4J43A 4XDZA 1SPXA 2VTEA 3H5AA 2XPCA 3B70A 3RFXA 4BS9A 4BNHA 4URFA 4CQLB 1DIAA 1Y7TA 4BMSA 3M1LA 4I5EA 3TFQA 4CMKA 3VZRA 4U5QA 4AJNA 1QLHA 1RWBA 4OL9A 5T8KC 3WIDA 3QW2A 4B3IA 4NJOA 4FC7A 5L51A 3NT5A 4LGVA 4R01A 2X6TA 3O26A 1VM6A 2DM6A 2YZ7A 5TC4A 5CDYA 2DTDA 3BXXA 4J4HA 1OMOA 1ZSNA 2V65A 1GTMA 1T1SA 2AQKA 2AW5A 4UVEA 1M2WA 4ROSA 1YB1A 4J91A 3LF1A 5AOVA 1KVQA 5ER6A 1D3AA 4WLVA 2E82A 3EVTA 4GVLA 2HQ1A 1UR5A 3PQDA 4CM1A 2VYNA 2XXBA 1JLLA 3D5TA 3ENNA 3FTPA 3O38A 5KVQA 1A5ZA 4FFRA 4M8SA 4J49A 1LSSA 3AOGA 1D1SA 3IP1A 1JAYA 3WWYA 1D7OA 4FGWA 5DNAA 1P74A 1NTOA 3PHJA 1M66A 4FIZA 2V6MA 1F17A 2ZB8A 3UCEA 2C20A 3KYCB 1PQWA 4B3HA 4DXHA 1HYHA 2YHUA 1T4DA 2A94A 3GNTA 1IE3A 2PR2A 4A03A 1I36A 5IAAA 2I66A 4PLPA 3IUPA 3FSRA 3L4BA 5EESA 2I6TA 3L9WA 3RKRA 5COAA 5KJCA 2DTEA 1H2BA 2CNBA 2GD1O 2H5LA 3DOCA 3KETA 1R6DA 5DN9A 1ARZA 4KUGA 2BFMA 3RUAA 4UVHA 3FPLA 4OOFA 5AXAA 4ALJA 3TFOA 1U2DA 4FS3A 2YFHA 1GYRA 1KBZA 1QYXA 5KKCA 4RQTA 4JBHA 1ENYA 1H6CA 1PGJA 3GDOA 4ND4A 1JTVA 2B0JA 2VCYA 3D3WA 3TWOA 3W4IA 3ABIA 3ZW9A 1GQQA 1YXMA 4NK5A 4QEDA 4NBUA 2VHWA 3OA2A 3WNVA 1U5CA 4XRRA 4K26A 2D0IA 1EBUA 1LXCA 3I9MA 4MVJM 4NQZA 4PG6A 1ZO8A 1YQXA 4RPHA 4YR9A 4WOKA 2VYND 2PK3A 2OORA 4IDDA 4CM9A 4RVHA 4YRAA 1CYDA 5GY7A 4EDFA 1KEUA 2H1SA 4KOAA 3HDJA 3EUWA 2I5PO 8LDHA 1F8GA 4ALIA 1UXGA 2QX7A 5FF9A 1UZLA 5AQ1A 3DQPA 4WCFA 4XYEA 5H83A 4PLZA 3WLFA 5EIOA 3LT2A 3H3JA 3TOZA 5TF4A 4DC1A 1V35A 1W6UA 4BO3A 4J7UA 3V2GA 3PQFA 1SNYA 1IUKA 3SBOA 3H9EO 5HTOA 4PFJA 2GASA 1ISHA 2HMSA 4S3MA 3TNLA 1T2FA 1X7DA 5TQVA 3AI2A 2CVOA 3NV9A 1X1TA 1VRWA 3JQFC 3B20A 4CMBA 4M89A 3KRTA 4OMUA 3X2EA 4E5PA 3JD0A 3K8ZA 1HETA 5ICSA 3VPHA 1X0XA 5FWNA 2ZJ0A 4F6LA 5AXBA 1H9BA 1B15A 4IIVA 4CLRA 3VVBA 4TWRA 5GZ6A 3DZGA 2Y05A 3MCVA 3FBGA 3ULKA 2P4QA 4FOOA 4JLWA 2DUUA 3S2FA 5CEEA 3ZWXA 1Z7BA 4WLOA 5HA5A 4ILKA 2W2LA 3Q1LA 2O2SA 4QQRA 2P9CA 3AUAA 4XYGA 3NGLA 2VYVA 1R12A 4R5MA 3FI9A 4CM9D 4RVSA 3GZNA 3BZUA 4G5HA 2AQ8A 3AWDA 1SAYA 3INGA 1FDTA 4OYRA 4E2XA 4GBJA 4UVDA 1HXHA 1VPDA 2POQX 3VH1A 2AMFA 1NFFA 3TOXA 2J3IA 4QFDA 1O9BA 3KOUA 2O23A 1PZHA 5L4NA 1P1IA 4W99A 3PQEA 1ZZEA 4FFNA 3GY0A 1U2GA 3ONEA 4NFSA 2QIOA 4OQZA 3D3WB 4EUHA 1K0UA 1MX3A 3OEYA 2Y67A 1HE4A 1DLIA 2O3QA 4FOSA 3G3EA 2A9FA 2VWPA 3NTQA 1N9GA 1FDSA 1HDRA 3F4BA 3MTJA 2GN6A 3GGPA 1X13A 3FHLA 2EG9A 4GLOA 4NNJA 4R41A 3C85A 1ZVMA 2CDBA 2I9PA 2DKNA 2FR1A 5AXDA 3NTOA 2WYVA 4Y67A 4M49A 1LRKA 1QYCA 1LDEA 1PS9A 3ZU2A 1UP4A 1ZK2A 1DOHA 2C54A 2QQ5A 4NR0A 4WCFB 1VSUA 2VUTA 1PIWA 1U3WA 1A9ZA 2CDCA 4DVJA 2R6JA 3CIFA 1ZFNA 3DAPA 3S8MA 1Q0QA 4BGEA 2NTVA 1U8FO 2W2LD 2ZTLA 2UV8A 4FW8A 4MVJF 4UEJA 4C7KA 5JDCC 5CEFA 2ILTA 4JQCA 2QRLA 4IGFA 1E6WA 3ZCXA 2VHYA 1NQTA 1Z74A 3H7AA 4QFCA 5G2OA 1NQOA 4GH5A 3AUSA 2ZATA 4AVYA 4BNVA 1N92A 1HDGO 5GZ1A 1BWSA 1Y9EA 3ONFA 4UUPA 3GUYA 2X0NA 1S6YA 3QE3A 5JXWA 3L4SO 4PLTA 3P7MA 3W4JA 1PGOA 1ZK0A 4YBZA 2AG5A 5J23A 4K6FA 3EK2A 3U4CA 4EUEA 4CLRB 4CMIA 3U4HA 4DGSA 3BA1A 4L9RA 3NEPX 4WCDA 2C2YA 1VJ1A 2QZ9A 4IXTA 3VPSA 3W8DA 1HKUA 3GDGA 3VH3A 2ZTUA 4I5DA 2RBEA 1DC6A 3G1UA 5EPOA 4MKXA 1PGNA 4QECA 1GU7A 1SOWA 1GFSA 4WECA 4R1TA 2D3TA 4NJMB 3JD3A 1PL6A 2UUPA 5ER9A 3V8BA 4J1QA 3FRJA 3QJ5A 3RASA 3PHLA 4ITUA 1EDOA 2H9IA 4R5HA 4BGIA 3I4CA 1G6KA 2FN7A 2C29D 3DBLB 4DYVA 1A4IA 4B3JA 5F1KA 3WYCA 4PN3A 2PGDA 2GZ2A 3QWFA 2WSBA 1R37A 2TMGA 3R3SA 1T2CA 3HDHA 3VC7A 2UVDA 4UREA 4GMFA 3I6IA 3Q2KA 2NVWA 5HBRA 3VZSA 5KVVA 4MDHA 1R15A 1KC3A 5A3VA 2B35A 3BMNA 3LC7O 5T8KA 1A7KA 2GSDA 2JL1A 2NQ8A 1N9GB 4PLYA 5C7OO 4LMPA 1YONA 4WPGA 4CV1A 4DMMA 2Q1WA 2FPIA 1UH5A 4UVIA 3KHUA 2DFDA 3DHYA 3BMQA 3A4VA 3W6ZA 1ZEJA 3NKLA 2Z1MA 4RF4A 1DFIA 1GUYA 1C0LA 3ROQA 3W8EA 1QRRA 5G0TA 4BO8A 2SCUA 2A4KA 5IZ4A 1LLCA 2VHZA 4E12A 1B8VA 1YB4A 4CR8A 4Y9DA 5DP2A 1E3JA 1U3VA 3H9JA 4DIFA 4H16A 2X1HA 2NTJA 3C7AA 3M6IA 2ZCVA 3V5NA 3BTVA 3GFGA 3ZWYA 1EVYA
chains in the Genus database with same CATH superfamily
1I2AA 1PS0A 1T15A 5CLGA 3THSA 4NECA 3DL2A 1GLGA 4L75A 2RK4A 1KYYA 3SC3A 2EQAA 3QI7A 4M99A 4DDWA 1IAQA 3KWLA 2A7XA 3W5HA 1ML3A 2IP4A 4E30A 4INJA 1EXMA 1YR6A 5CK4A 5ARDA 4GI3A 3VISA 1XCJA 3CNNA 1FXWA 4RMNA 5L3SB 3RI3A 2BFCA 5A03A 3MLAA 1JH8A 2AZDA 4DFDA 3EASA 1J2TA 2VBCA 3K8OE 2QYHA 1JFRA 2QN6A 4OQLA 4ZP1A 3ZNPA 1GM5A 4W5NA 2WU4A 3LW7A 1YVEI 3P2YA 4OQPA 1N33B 4A0HA 1BSVA 1TYEB 2ECKA 2LIPA 2YZMA 2XVYA 5TGZA 3U7RA 1UBGA 4QNRA 1PZMA 5MN6A 3I8SA 2QR2A 4WLEA 2G6BA 3DVAB 1S4QA 1CR2A 2FH5B 2XWPA 3L3BA 1YBHA 3GLGA 1JHXA 3P0HA 3GMSA 4HDMB 2UZIR 4WA8A 2QM8A 4TROA 5EAIA 5LD2C 3CZAA 2XGJA 5CNKA 3RR2A 2BH9A 5ALKA 1T0HB 2GEKA 3SQLA 1LD3A 3USCS 1R0KA 4Y0AA 2SKEA 2ERCA 1AHHA 2ACKA 2P62A 4FPXA 4XQ9A 1YQWA 3JQ8A 2BTQA 3WJ1A 1I6LA 1GQOA 3LIIA 2PX5A 2L42A 2ZWOA 1P6QA 4L7VA 1I5OA 1Z12A 4G0WA 2HRBA 2ZULA 1GDHA 1RWMA 2YNMC 2IWHA 1UBCA 4C20A 5ILOA 4PLFA 4RTJA 3CRVA 1EE2A 5D1NA 2ZRQA 3ZBUA 2REQA 4EGJA 2P67A 3HZRA 1A8UA 4TUYB 3KLOA 1O5TA 4UUNA 3H84A 2AR9A 1KARA 1QRAA 2AFHB 2CK3A 2I4OA 4G01B 2HI0A 1E1MA 2FR8A 3IAM1 4KDEA 4A4DA 1GN8A 5JY6A 1SOVA 2WWGA 1XAGA 2NTNA 3NDPA 3KKNA 4JI5B 1O6GA 1Z6AA 3NJ8A 1LC0A 5JZMA 3DBVO 5D86A 3IT0A 4LEIA 1GAWA 2HA7A 2OXRA 2HTFA 3AB7A 5FWAA 4C43A 5I48A 5KNDA 1XPOA 4EJSB 1AQ6A 3NAGA 1Y5IA 5M34A 2O0KA 2FSIA 2YJGA 4JGGA 2H2IA 2IHTA 4FHZA 2UYOA 1CU1A 1DFHA 1YS1X 1UODA 3EGOA 1T0BA 3EZ2A 1V9LA 3HM2A 4MUFA 4WGGA 1NW5A 4DCTA 1H4VB 4AF6A 2SCUB 2FZWA 3A14A 3GT0A 3O4FA 1KI2A 2YOGA 4N3AA 2AG1A 3N0WA 4CLHA 2B8NA 4JWKA 2HLNA 1P7WA 3PSHA 3WOVA 1ZMBA 2WMDA 2YFQA 3D8TA 2HMWA 5DU2A 2NNWB 3SR4A 4HB2A 3AINA 1TYZA 3DPIA 3QKSA 4D25A 1LU9A 4DDUA 2ZYVX 4XJVA 5IWAB 2ZBRA 1YI1A 4AYTA 5JJBA 3RKUA 2A35A 2EGUA 3GD7A 4KPFC 4OI1A 1RM0A 1IATA 3IOYA 1CB7A 4P98A 2R8YA 4LF5B 4F93B 1EUQA 1IHPA 4M0KA 3IPRA 1USKA 5KTTA 1Q1EA 1DAFA 1IBSA 1XV5A 3IMFA 4CDGA 4NBVA 3H5WA 3WMXA 3RS4A 3BVPA 2R4TA 1TPYA 3II6X 3P45A 1QQ5A 1FTNA 1LUAA 3KVOA 3DQZA 1Z22A 3NAZA 4FFOA 2BFCB 5FBLB 4BN0A 1C3OA 1ISIA 5A3JA 3DEFA 3AVWA 3B6KA 4WI1A 1VHDA 4HGQA 4WHMA 1GQRA 1NWHA 5CNMA 3WG9A 4ZU3A 3S55A 5KNBA 3OY7A 1KYQA 5DTIA 4A3SA 2O5RA 3QHAA 5T4BA 4RGVA 3SHOA 3WZ2A 1KEWA 4LVUA 3QX9A 4OQYA 5ITZB 5IT9A 2HKIA 3TR0A 4F4IA 1DXHA 4GYYA 4PTLA 2O7QA 1E4EA 2ID9A 3M2TA 3GLGB 4H7IA 2H59A 2NVUA 3F73A 4WZ6A 2D1FA 4LRQA 2P9GA 4TL9A 2J0QA 3TFWA 1YA8A 4IY1A 4R1PA 4S24A 2XUAA 5AJXA 4BTVA 3HKEA 3H4IA 4MQLA 4S1OA 4F8YA 2WJGA 2YYAA 3F6YA 2PKWA 2IPXA 2ZWAA 2XLBA 4YMWA 1W94A 2GN4A 5J9FA 3REOA 3WL7A 4CGYA 3HVJA 1FYWA 2BTQB 3MWLA 3CZ9A 3WLMA 4X20A 4D0SA 4MCAA 3ZDXB 2IEDA 1M8JA 3EW7A 3WLHA 1JTFA 5CBPA 1S2NA 5F3DA 1GPBA 4IGAA 3QI2A 1JPVA 3R09A 4AWBA 2Z4TA 4G97A 2IV2X 4C0AC 3MW8A 5EQFA 3UO8B 4Y2HA 1YRLA 1GSOA 1RAEA 4B3CA 2REQB 4P9NA 3ETLA 3IS3A 2BSQA 4H31A 1B7GO 2J5BA 2ODQA 2PUFA 1TZMA 3F5SA 3F5DA 3R9KA 3ZHUA 4QM7A 4E31A 3O0TA 3PGLA 2C4MA 3A06A 1JFVA 4ZICA 1E89A 1M9NA 5BN5A 2OHIA 2XAAA 1ID1A 1YASA 2JLCA 2WOOA 4XD7A 3O7MA 4LBVA 1E0KA 4HNVA 2P8JA 4B4UA 3KDAA 1MIOA 5EP4A 3JW8A 3MAGA 4Q1VA 4KQ2A 1ZXLA 3I58A 4C06A 2C58A 2FEXA 3DW3X 3QLVA 3ITEA 3WWOA 5KNBD 1DWOA 5LCXA 1X14A 3Q88A 3S40A 1ZLYA 2X7HA 1SEPA 2Q5LA 5IXYA 3WYEA 2R62A 4U5XA 3VUFA 1P33A 1N5KA 2VT2A 3V8VA 1YRHA 1MIHA 4C7JA 1ADJA 3E03A 1B0UA 4DG9A 1S2OA 1Z88A 4TRNA 2HA5A 1GCAA 4M8NE 3KC2A 2FOXA 5TT1A 1TUEA 4M4SA 1GPUA 1JEYA 1W4BA 4XGKA 3DOFA 4YCNA 1WF6A 4NAUA 3W5AA 1RHQA 2RG1A 4OPMA 1TUGA 4KFTA 5HUQA 4RWEA 5LDGA 1SOUA 4XQ0A 5P21A 5AW9A 5HKBA 1DIOB 2FSHA 3RRNA 4B75A 3ESDA 3I9V6 6ABPA 3EMVA 2NZWA 4ENPA 5KJEA 4IQ4A 5DGDA 1DG1G 3UHFA 5BUCA 1X39A 3INTA 1YZHA 3WLQA 3F96A 2XNCA 4PQFA 3TW4A 2DGDA 1JLKA 3CF6R 1K7FB 3D1LA 3TJRA 4DCCA 1EVLA 4CWAA 1ZH8A 3OHSX 4I4TA 4RLHA 1KQNA 4N7JA 1JKJA 3EVGA 3C3WA 3I30X 1A69A 1ZGZA 2B92A 1GLVA 1DZIA 1HZJA 1KBQA 1X74A 2JRCA 3EZNA 3OOEA 1FJGB 3AVVA 3V42A 1BXKA 2E48A 4MJ3A 4OHVA 5IH7A 2FN8A 1I6WA 1G98A 1E4EB 3WFZA 1GUFA 5FV7A 4UCFA 3EQ8A 2QUIA 1Z4NA 2LD4A 4HEQA 4JDUA 3R9WA 2NVUB 1JEEA 1UDCA 3IT3A 2VSQA 3C6YA 3N8GA 4XD7D 4ZU6X 3MB8A 3K5WA 3MJSA 2FWIA 4PLHA 5A05A 4B7XA 5JAHA 5TMPA 1PJ3A 3WL8A 2HSWA 1W4RA 3X3HA 1MQ9A 4ND3A 1CZLA 5G4KA 2ILVA 4HN4B 4Q3NA 3AHCA 3NNDA 4JVNA 3T6KA 1WRBA 3FVRA 4DQXA 3OQNA 2KBFA 2ZYDA 4RD6A 1X3SA 4BV8A 4X20B 3GBPA 1HYBA 1DQPA 3A0RB 4PZLA 1EVEA 5JR3A 3L7IA 1H3FA 2WF8A 3CA8A 1L9KA 2WU3A 1WDKA 2FUG1 2O3RA 5CA1F 3H2GA 3ER9A 4D4MA 1KEKA 4TLAA 4DLPA 4UTVA 2DKOA 4EFKA 5BNTA 1Q6YA 2DT5A 3FNFA 4Y6GB 5A6VA 3OZGA 5L6MB 3A4YA 4MR7A 3WLTA 3HXMA 5TMBA 4PC2A 3DAGA 3DEHA 2RHBA 1Y3AA 4H3VA 2UZ1A 5BN5B 5IG2A 3N86A 1A5BB 1O6ZA 4U2GA 2NU6B 4UQPA 4KE8A 1KY4A 1UPXA 5HIJA 5HCIA 4UQOA 2H9YA 5K2OA 4MI6A 3AR4A 4PR3A 2XTJA 4NCAA 1MIOB 2HHLA 4KU4A 2IPLA 4OQ4A 2W6MA 3O9MA 4XJTA 1KJYA 2P4HX 4HNTA 4OGGA 5BNIA 1PEKE 2ZS9A 4QGBA 4NU0A 1OWOA 1XU4A 3Q7QA 4C0XA 1YMVA 3VHLB 5KPJA 4LUCA 2ZJ5A 4CUZA 1ACMA 1GXSB 2J6CA 4EKEA 4YPOA 2PE5A 4M9UA 3C5WP 2H1VA 1ZC4A 4NCIA 1T1GA 3TB6A 2PMWB 4G5YA 4E32A 2ZJ8A 3VV2A 5JVDF 3S1AA 1Y1TA 4C1NA 1I1QB 3DOIA 2CHGA 4QQNA 5JMTA 3KJGA 2ZUTA 1I10A 1PUIA 1I7LA 3OE4A 3SXPA 2CLFB 2WUGA 4J7CA 3VX3A 1WF3A 3RSSA 4EMUA 1JEYB 3AUXA 1W0CA 2H1FA 4CIAA 3Q6IA 2GLTA 4WNAB 1VOTA 3M6UA 3UB3A 2GPWA 1V8DA 3RBVA 1YDHA 4BAZA 2CMGA 4XH9B 1TM2A 4FEAA 1IJKA 3UTDA 1ULZA 3UAGA 4KIGA 2XZOA 5G41A 1M1XB 1XMVA 2HGZA 1E62A 4JCOA 4EUSA 1EK6A 1U1IA 4YJ2A 4B3SB 5AVKA 3WKBA 1CFZA 4GPEA 4U6NA 5ESDA 3UAZA 4NE7A 5I7VA 3GRUA 6GPBA 1D4AA 5JC1A 5KOYA 4R4JA 3WQBA 1LH0A 1WUHS 2A0FA 3OQIB 4DQVA 4I4TB 5DLEA 1ZOSA 1M34A 4WACA 4XIIA 5JLAA 2C7BA 1CCWA 3PVSA 5LA6A 3TLYA 3QUTA 4AD8A 4GMGA 2Q1SA 2VPYA 1OW3B 1GPNA 2KM1A 2RAFA 1IEQA 5C8YF 1TLFA 2GCNA 2PEYA 3L04A 5LYYA 4F3RA 2NXJA 1MAAA 4YWHA 1TQDA 3BX1A 3CNQS 4IVRA 4W1PA 2PL3A 4W1RA 4BGDA 4MV0A 4F1WA 1Y81A 1DIRA 1G6Q1 1FVXA 1TD1A 1ZNXA 2YINC 2FW0A 4FZRA 4MRPA 1OAOC 4LMBA 5G4KB 5FOVA 3ADDA 1GCOA 4FCWA 2QRPA 4I5IA 3FTFA 3DPUA 4YCDA 3U49A 2VPWA 5HKOA 2Z83A 2GPTA 4L4ZA 1HYGA 2BM8A 2ZAIA 1FQKA 3EH1A 3HWX1 4M55A 5KNDD 1QHIA 3UA3A 2BFEA 1DJNA 2PWBA 2NSDA 5DHTA 4BQQA 2D5AA 1GPAA 4R2JA 1EJ0A 3ODGA 2O52A 1I51A 5DBFA 3M83A 3VU3A 1QU2A 3NBUA 1A9RA 1X8JA 3C5CA 3I34X 3F97A 3MOSA 4ZOLA 2W48A 3E1GA 4S04A 1KY3A 1XMXA 3B1VA 2YJ6A 3OE7A 3QX8A 3RUCA 3R6GA 1YJBA 2CUNA 1QDEA 2OG1A 2IWRA 1NHGA 4MR7B 5KTOA 3L8DA 1J9GA 1UBHS 4LYGA 4BNGA 2PANA 3CRW1 2UZ1B 4KRYA 1GPKA 4IDBA 3WMWA 4BJ1A 4CF4A 5JZVA 4FB5A 1LTKA 2XGMA 3CKKA 2P6OA 2WJIA 3CR3C 3HJGA 1AA6A 3KQWA 1BGXT 2A8YA 2LBPA 2OV4A 1GITA 2XQKA 2ET6A 2RCNA 5B3AA 5CXUA 2K2WA 4HMOA 4N12A 2G80A 4W8GA 3HSSA 1MOQA 5DW0A 4OHZA 1Z2PX 5FLKA 3KT0A 4MYUA 4IDGA 2FX5A 4S0ZA 5KTKA 2FEKA 5KYXA 1F0KA 1KNQA 4M60A 2O57A 3ENZA 4XVRA 1DL5A 5IC4A 4TVSA 2F9MA 3AILA 3N2ZB 4F9FA 2GD0A 3U39A 1OX6A 1UDAA 3GVPA 5TT0A 4REMA 5E2IA 4BLWA 4ZCPA 5CR9A 1EEHA 4PG8A 2XRMA 3LPAA 3RFVA 1P1HA 3S1AB 2G7MC 4FGJA 4OHXA 5C35A 5AHXA 4M0FA 4D9CA 4PZ0A 5C52B 5I01A 3L9XA 5ERGB 2BHTA 1QPBA 2LR0A 2O7VA 5F76A 4BB5A 4N41A 1TMYA 3NIDB 3SK0A 3D4IA 5HKAA 4ABTA 4Q19A 4JJAA 1L4HA 3JQCA 3QXSA 4MVJA 5HOQA 3GYBA 4ZZ0A 4CFYA 1J8FA 5C1BA 5I9LA 1NXOA 4QGAA 2XECA 5IVPA 1VE3A 5JAPA 1KH2A 3O9ZA 1PWZA 4BRWA 1UOPA 2PZGA 4LBWA 1Z8DA 1OIXA 2CVFA 1XN4A 4Y1RA 4YJ2B 3TL2A 4A10A 8ABPA 2XB4A 1AT1A 1Q3TA 5DYYA 3TNFA 1CDDA 1SIWA 5EIFA 4D57A 1XF9A 4RTNA 1PS8A 5DX1A 2WQ7A 4MWDA 3CPJB 1RRMA 4KTVE 2BEVA 2IYVA 1TEVA 4ARZB 2O14A 3WXBA 3NHKA 3OE7D 1S2DA 4QUDA 4R1MA 5LA6B 4X66B 1M73E 4BV3A 3VHQA 1UAYA 1Y1LA 2HDHA 3A9VA 3G2OA 2HYDA 3K96A 2DXIA 4ZOAA 1TKRA 3CGWA 3WSVA 3O8RA 5HCNA 3SN6A 3GJ3A 1PQUA 4F9GA 2BTOA 4NC9A 3HCBA 3ND5A 5JNRA 1QX3A 1AGPA 2QX4A 4HDSA 4LHVA 4UFPA 3CX8A 3UAVA 2NVBA 4YRBA 3QEJA 4U1RA 3R9XA 1NLUA 3G8BA 2V45A 2CD7A 5LMNB 4IZ6A 4UATA 2I65A 1BFKA 1CVIA 4MQBA 4RQBA 4UEOA 4F6RA 4EJ2A 1RYMA 1SCIA 1ZJZA 4K46A 4Q1BA 1TYBE 1LKZA 2ZTMA 5EUCA 4GX5A 2B8EA 2Y68A 3I5UA 4MNTA 1QIGA 1RD4A 3Q3HA 5EWLA 4W5OA 3G0IA 1T35A 2BFEB 3TAHA 4HY3A 3G9TA 4DM7A 1P4HA 2PRZA 4MV7A 1VGQA 1ONOA 1X3LA 2AKYA 2HXGA 1UT8A 1YCGA 1PJRA 4ZOLB 3P9NA 2E2WA 4QDKA 4KZPA 5SZJA 1W76A 4EAQA 4TYYA 4OCZA 2HMVA 3E22A 1RLIA 2HGSA 2ZJFA 4RIIA 3GK3A 5DHPA 5TSDA 4EHAA 2X4GA 4MVJD 2CHEA 3USZA 1M3SA 1M2OA 3HCRA 1YR7A 1Z63A 1EDBA 4ZI7F 4OI0A 4DLKA 2KJQA 1GUZA 3DLBA 4F84A 2R7NA 1MC5A 2G9QA 3M0EA 4JYPA 4A5SA 3KFVA 2P40A 1T1IA 5A4KA 2VDJA 4DCMA 4FT4A 4Q4LA 3HPRA 3PIRA 4RAOA 4RPCA 2JGKA 3GH3A 3LTEA 1R4NB 3DLPX 2ORYA 4ENUA 3D8HA 3MSXA 2DBRA 4WADA 3TDKA 1N7HA 2H7XA 2H8KA 4PSKA 5BSGA 1T36A 2PPVA 4CQMD 2FAXA 1Q5PA 1GTG1 2FG5A 1UXKA 1GRCA 1ST3A 2H11A 5GWXA 3IAFA 4ZXPA 4C2BA 3N1UA 5LUAA 3RADC 4IXWA 4OTZA 3OQJA 3I6ZA 2D59A 1GVNB 3UK6A 4AICA 3NHAA 2JZCA 3VR0A 1ZK1A 1HMYA 2AFHE 3MXTA 3ZDDA 1A7JA 3LLMA 2Y4OA 3RK1A 3UYKA 4R05A 3STUA 4EVRA 1M74A 2XCSB 1M83A 2WWTA 1P0FA 3D5QA 4KBYA 3TE6A 2CXTA 4QYTA 5AVUA 3VA7A 2DR2A 3DOJA 5CP8A 3ICQB 2HU8A 1KS2A 4CL8A 3RVRA 2IYNA 2NAFA 2FETA 4WY5A 4QBGB 4UD2A 5DSZA 1TC1A 1P7PA 4Q9JA 3WGQA 5GADl 4Y1RB 4N4AA 1PI3A 1QE5A 2BE9A 1B8UA 1HYEA 2C2HA 3C0KA 4PYIA 3ZHZA 1E8MA 4A0SA 4AY2A 1TNDA 3DLCA 1NFQA 1ABBA 1XMJA 4CQMB 2BEVB 3KKOA 5EZ5A 3W7BA 1XD2A 3MD0A 1O94A 5KU1A 3R76A 4R3NA 1AKYA 3LDUA 1SBQA 3R9IA 5JWRA 1NOKA 4DLSA 4WFKA 3CKLA 4MWGA 2ID4A 1CC1S 2OZLA 3GB9A 4BMDA 821PA 1B6SA 1H66A 3FPGA 5LWQA 4BTEA 5CIYA 1CUFA 1WXIA 4GECA 5KKNB 1GNQA 4WEOA 3L41A 5F35A 2YW9A 2ZTSA 4ETIA 5I8WA 1ZC3A 1KE2A 2QN8A 1RC0A 1T9CA 1ULTA 1MQSA 1ZI9A 4Z9BA 1VXOA 1SHZA 4LHWA 1EM6A 5EWLB 5FADA 2OHXA 1U0RA 1JB1A 5GONF 3H1EA 3KVNA 2RIRA 3Q3IA 2ZTHA 4HZGA 4QPDA 5FI3A 1L6IA 4D9KA 5BT9A 1J9EA 2QTVA 1BXRA 2WC1A 4K3VA 2LWIA 3DS8A 3GC6A 3KR1A 4O2RA 4HVAA 1OTHA 4ZRMA 3HI4A 4BE4A 1ZN8A 1ZIPA 1YQQA 4TXJA 2G9ZA 1PQYA 1QHXA 3ASUA 4TN5A 3U4MA 2PKEA 4MRRA 3EMDA 2EHDA 3P5BA 1JDBB 1ATZA 1M2OB 4JLKA 2RCYA 2G40A 3V7YA 3Q11A 2OVBA 3QEMB 1I6MA 3LYLA 4LKOA 3VYSB 3K3PA 3GLGE 1RAFA 3RYCA 4EECA 3P2EA 4J3FA 2O7NA 5A4MS 1W4ZA 5ERYA 3CR7A 1E6LA 1WIWA 2I6FA 2IYZA 2JEYA 3N2KA 1VLVA 3OO1A 2YUIA 5DB4A 5A5GA 4ERXA 1KY5A 4RQUA 1E9BA 2J0VA 5F9MA 2ZJ1A 2DQZA 3RYHB 4C2UA 3UQZA 2XF8A 3Q0TA 3IJEB 3OECA 4IRUB 4AS2A 1CULC 3TPFA 3TQTA 1QGYA 2CLHB 3ZCRA 4GDFA 1WG8A 3THYA 4LF8B 1O94D 4ACAA 3PFKA 3QPUA 4Q3AA 5CB6A 1ISPA 5K20A 2I7TA 1E59A 2C2WA 2HJHA 3VR4A 4BFUA 4C3ZA 1SC9A 2OSBA 3OOSA 1VLQA 4F86A 3AW9A 1OA0A 3RUFA 4C4TA 4GE0A 3TLBA 5ALHA 1XWIA 1LC3A 4GM0A 1GAEO 1YO6A 1M2NA 3YASA 3RUPA 4UOZA 1XCPA 4N47A 4KXYA 3HS3A 4EABA 2YVQA 3DTNA 3AM1A 1PR1A 3JCZA 4KXUA 1ENOA 4CLOA 1SXJA 4IP0A 2EFDB 2JIZA 3PF9A 4ZOBA 4BATA 1TX4B 4O63O 3FWKA 1FX0A 4WW0A 4BKOA 3MWDA 4PQYA 4UUOA 4YROA 1GZHB 5K09A 2XRYA 2D54A 2HMAA 4G4IA 4XB6B 5DBOA 3ZXYA 3WAJA 4OF4A 4L51A 3NU1A 1YF3A 1D0SA 3O1JC 1KAQA 2L2QA 4MYHA 3VR5D 3UJ9A 5EKTA 1GL3A 3UKDA 4OATA 3VDNB 2ZYGA 1S96A 1AV6A 1S4MA 1UP7A 3H9UA 3PWTA 1EFVB 3WQRA 1CW2B 5EIWA 4JBXA 5B7GA 1ZZGA 3CCCA 1HDOA 5DX8A 3SIRA 2CDRA 4RKFA 2ZE8A 2QPAA 4WASA 2OZLB 2XNJA 4OP2A 1H2AS 2ZYRA 1A72A 4HGOA 1VB3A 3W7VA 4JC8A 4K6MA 1JH9A 5EWMA 1E20A 5DHFA 2H2GA 2ZSHA 5SYNA 5EIEA 3M81A 2A9QA 4YQEA 3OOWA 3QYPA 3KKPA 4AU1A 3H11A 1F20A 1H2HA 2G9UA 3BMOA 4BTLA 1LVGA 1Z7EA 5KYGA 3I12A 2NYAA 3WLRA 4MTLA 3AG5A 3LDGA 2NO6A 2IEIA 4EDHA 1KVSA 4PCAA 3ELWA 4QPZA 1HZZA 3COSA 2ODTX 4ZIRA 4HYQA 3SD7A 3KYDB 5FOTA 4CKWA 4RKEA 3STXA 4L8VA 1WPRA 1M2VA 1N77A 1VFNA 3DD1A 5JUWA 4PXYA 3ZXUB 3HV2A 2QTVB 1BXRB 3AY7A 3DC2A 1ZU4A 2VF7A 3VR4D 3HWRA 3PP8A 1ILWA 1R10A 1A8SA 4JYZA 3UF0A 1SB8A 1Z4QA 2C61A 2O8DB 3GW8A 3LUFA 3LX6A 1E2IA 3IB3A 4JHXA 1SK9A 1SXJD 2IP2A 5DMXA 2JIZD 2Q49A 3UA4A 3GRCA 2WD8A 3LQFA 3B52X 3U3MA 3RYCB 1XFAA 3PC4A 3QH4A 3OEED 1FXWF 3HCOA 2AJ8A 3N2KB 1HFEL 2OTCA 2GXSA 3WNQA 4LA4A 1DBVO 4GOMD 1YCFA 5CVUA 2VUSA 1H5QA 2GM4A 2PLNA 1PR9A 1NLZA 5DE3A 8GPBA 5DLDA 3HZOA 3AM5A 4MS3A 3GLHA 4P0PB 1G18A 3PD1A 3PT9A 4YDQA 1ACJA 10MHA 2GN2A 3THYB 5MHTA 1N6PA 4NV0A 4ZT5A 3QE9Y 3KUCA 2B1IA 2ZB2A 1NBMA 3HKDA 1BTOA 1YQTA 4GPD1 4R2XA 1YVDA 4ZK2A 3PVZA 2ADMA 2QX8A 3P4UA 3HCDA 1ZIYA 2VP5A 1CZOA 5GJWC 3UWPA 4CTMA 4BVBA 1ISFA 3TCXB 5A5FA 4IH9A 1XZBA 2X5JO 3JQ9C 4L08A 1KGSA 1B1AA 4WN3A 3T35A 1SKQA 4BJ6A 3FOZA 1EHCA 4BKRA 5IW8A 2VKQA 3SKYA 4X1YA 4CLOB 5KI6A 1G5RA 2X7JA 3LAWA 4MYCA 4AKTA 1ETHA 1O95A 2BBSA 1KO5A 2Z09A 1FX0B 5KQPA 1GADO 1Z3CA 3MWDB 4AMVA 4BCDA 1RKXA 4CKEA 2PJDA 2DBQA 3RUIA 2IBSA 3GUCA 3T1QA 1RE0A 1Q1QA 1US8A 3OZSA 3GA0A 5KYNA 1J8MF 1KMNA 1Y4DE 3OMWA 1K6EA 1ZVJA 4KIUA 4XSVA 2OV3A 2F1OA 2WSLA 3C6ZA 4JUIA 2YMMA 4K86A 1ZMOA 4QRDA 3WKCA 2V03A 4IILA 4G0XA 4KQFA 1U65A 4EHHA 3LUPA 4OSOA 1NOJA 1HPLA 2Z8XA 2MINB 3ZI0A 2EJBA 4M1MA 2XGSA 3IOMA 1QONA 4OB8A 1U7OA 2HZ7A 2IT1A 5TMEA 2Z95A 1OXVA 3BSWA 3MUEA 3O5AA 4KEAA 1K27A 4YACA 3S7ZA 1I3NA 1SBHA 1V96A 1VE6A 5C81A 5EWMB 1BDIA 2WIBA 1QGUB 1PYGA 2QVLA 4H4DA 4KH1A 4JJIA 4NOMA 4E5UA 3N9IA 3IIKA 1C2TA 3R6LA 1Z16A 3I5MA 3H11B 1E1LA 4BRZA 3BMOB 1QYWA 4AJJA 3ZE2B 4XD2A 1RM5A 4GXQA 2WVGA 2AX3A 2XE7A 2ZBDA 4GZ3A 1KK0A 4YXFA 4ZIRB 3KEFA 4JLSA 1ZCZA 3QFCA 4S2UA 4NY1A 1PBNA 4AZ3A 1N5IA 4KK4A 5K4GA 1M2VB 1TRHA 3EODA 3QF7A 3ZHBA 3IEPA 121PA 1LDNA 1NBMD 1EG7A 3BOSA 3C1TA 3KOXA 4PZ9A 1M1YA 4LMAA 4GKAA 5AI0A 2C5EA 4LDRA 1OXBB 2XTZA 2QDXA 2G9VA 5A5EA 3BE6A 3BXHA 4DMLA 2P9EA 1SCBA 3I01A 3Q40A 4LF4B 3MTGA 2FRDA 5AI9A 4YI5A 4BE7B 1WXDA 4HDQB 3I6YA 4XOIA 3ECSA 3D2AA 3BXFA 4AJ1A 5FWYA 3ZVMA 1O95D 4RZ2A 5DYTA 4H77A 2LCFA 2B5OA 2EX0A 4MICA 4JOCA 4DA7A 5CDUA 2GK6A 5I7AA 2E4VA 1CT9A 2BF7A 2J3JA 3EB9A 2OV1A 1XMIA 1XFDA 2H18A 1JVBA 1JECA 4V0KA 3WHPA 2IS6A 1CJCA 3CLHA 1F1BA 4ZVNA 3THXB 1YUMA 3GLHB 2IZZA 1EIWA 4UTOA 4HDAA 5EJ4A 1SG9A 3NI2A 4EYOA 4K8OA 2DUNA 3TVTA 4AJ2A 1EFAA 1SULA 3HKDB 1PT7A 3HCWA 3IEMA 2OB2A 1Q1AA 1AZWA 3I0ZA 4GIBA 4G89A 5CT4A 2G0AA 1GCGA 3VPGA 2VP3A 1QCZA 2VSXA 5JFOA 1IY8A 3PXAA 3ZN2A 3ZNNA 4QT4A 5KTMA 1IN7A 3CRNA 3IE0A 4K9LA 4QEKA 4EEZA 1GQFA 4LECA 5HIAA 1I01A 4PZDA 4X1YB 1SBNE 5BMVA 3N58A 2ES4A 2BFWA 2VKTA 5T4HA 4YRGA 5EIXA 1LW6E 3QU2A 1RYDA 3JSXA 4E1BA 1Q0UA 1OLXA 4JT4A 4JLBA 3EA4A 1QR2A 1V2HE 1AKWA 2CVQA 4CKEB 1C29B 3TLEA 1XK6A 4E33A 2AH5A 1NXXA 3H8WA 1WMSA 1VI6A 2GPNA 2OFFA 3E5HA 3ZGVA 3G2IA 2X1LA 2H85A 2Y2UA 3RVLA 3SXUB 2PX4A 4FHFA 2HQOA 4M37A 4YAWA 1RC8A 2CVHA 3DXYA 4MUMA 2EKZA 4Z5XA 3BHIA 4JC5A 4FJ1A 1N5DA 3ROGA 4LOJA 4ER6A 1BS1A 4YRQA 1R3UA 2WZQA 1P4SA 1FMCA 2E18A 3LQYA 3OESA 1PWHA 1DT3A 1F8XA 3DZJA 2QW8A 2BKXA 2OCIA 5AI8A 3VSEA 1QK3A 5JPIA 2AK3A 2YZ2A 2C9MA 3L0DA 1V16A 1ST2A 2FEWB 3C15C 2V1UA 4F5ZA 3C3PA 4RK1A 1K3TA 3A32A 2CXQA 3W3AH 2RHCA 1BH2A 1GEEA 3NLLA 3RYFB 4CG2A 4MKIA 3F5QA 3DMTC 1DEXA 1JHAA 3OAAA 1OV4A 4IPTA 1R50A 4Q47A 2P27A 4BLUA 5EXXA 3DFMA 1V1MA 1WUKS 1M54A 4LTMA 1M2GA 4AP6A 4AZ3B 3N2LA 3TH5A 3A28A 4C6HA 4EHFA 2W6JD 1IQPA 4K3UA 3BWEA 3B1FA 1DXQA 1HNWB 1NE2A 1X94A 3WLJA 1GN9A 4TWZA 3FYDA 2QNIA 3SHQA 3ZOZA 4HGNA 1QB8A 3S1SA 2E6UX 2VA8A 3LPLA 1SHJA 2J6HA 3PL5A 1J07A 1JHPA 2Q8PA 4UZFA 1B8PA 2PXAA 1GG2A 2I2XB 5IZCC 3HA7A 2O06A 5CBKA 1BXGA 1XNQB 1YMQA 2PM8A 3KSBC 5FWYB 1U28A 3K8YA 3TOCA 2ZBFA 1C9JA 2FPWA 3UOGA 1KRXA 3A9SA 4YAFA 2HTEA 3IPYA 5ALXA 3TW6A 3MUOA 1J2RA 2L18A 4ND2A 3L6UA 2IK8A 1FUKA 3FMPB 4B4OA 1T10A 2OHGA 1VKRA 2AOUA 1OBFO 3B2QA 3ZWWA 4B32A 1A9XA 2FMKA 1AGNA 2X19A 1K5HA 1ZD1A 2BDEA 3B7PA 5I5GA 3H8SA 1RKBA 5H1YA 3FTEA 3EQZA 3T1VA 3MJHA 4BQSA 5D3KA 4J4BA 4QTYA 1NP6A 3K9NA 1Y37A 1Y7IA 4M1SA 4Q1DA 3B1KA 1XUOA 2FLWA 4C05A 4WOCA 1DFGA 1WPXA 2QPTA 3CONA 1U4NA 3RAJA 5CG1A 5HMMA 1KRHA 3W79A 5BR1A 4I50F 4B6RA 2IBTA 4PAMA 1Z82A 3F7MA 4JH0A 3AWIA 1VIAA 3G2HA 4ND8A 1RWQA 4Z8XA 1LLQA 4V0MA 3R8XA 3TM4A 4P93A 4JWTA 2JLQA 2VLBA 5BMVB 3VZCA 3T4XA 2JFNA 1GLNA 4L0QA 4IV0A 5D6OA 3EG9A 1UXOA 3T3HA 3PFBA 1T6NA 2I7VA 3WP1B 1N5JA 1S8OA 3CUWA 4V2UA 1RJGA 3IVRA 2XWQA 2QEQA 4HLDA 1YNOA 4QXMA 1OI4A 1G5QA 5AP9A 4ZYWA 1QOQB 2QVXX 3EMKA 1NBOA 3IBSA 1LJUA 3SHTA 2H4ZA 4LHEA 3GJYA 4B4WA 3W7AA 1L5ZA 1NW4A 3CJTA 4W1SA 5JCJA 1SOMA 2XEDA 3ASZA 2ROQA 1P2UA 2OYSA 2H7CA 4Y9TA 3JAWA 4R1NA 4A2WA 2C00A 4Q18A 1RPZA 3JVIA 4C0WA 1PSDA 3L7JA 1NASA 3MIZA 4M1YA 4BJ3A 1GFIA 2MWMA 4B7UA 2HIAA 4O1MA 1THTA 2IYPA 3LYHA 1W96A 1I2ZA 4TN1A 3RJ9A 3S2ZA 4CIBA 5KQMA 3MA0A 1Z26A 2AJDA 3O95A 3RK0A 2OQIA 1OILA 4CM5A 3DFZA 3GLIA 4DC0A 1CFJA 1W19A 1ZGBA 1W5BA 4LXQA 4D8WA 4MVJE 2BM1A 4R68A 3RBAA 1S0UA 2Y1KA 4RJLA 4NV1A 1NBWB 3O2JA 4B3RB 1G7CA 1YQUA 1E6MA 1GZSA 2K4MA 3AFIA 2RHJA 1NC3A 2WUEA 3C6MA 3CISA 3FF1A 3P9YA 1ML4A 3U6KA 3HK2A 2JGMA 3RVQA 1HLDA 2EW1A 4EHLA 3IERA 3IP9A 5TNXA 5LMUB 3O83A 4F7WA 5E7IA 2R65A 3CE6A 4G24A 4WRRA 1UUFA 5EIHA 2XB8A 2FDCA 1XDGA 2ZJZA 1W4LA 4Y6LA 2V58A 2IYRA 5A0FA 5REQA 3WGTA 2XUIA 2CSUA 4L74A 4RFVA 1N0IA 5JTTA 3GT7A 2J46A 4OFWA 3UB2A 1X1SA 2J4DA 1UBLS 3WO0A 1P2GA 2VP4A 4MDFA 3BKXA 2RHHA 4CF3A 4N6GA 1N3IA 3PEVA 5CJ2A 1NQWA 3ZPXA 4NX2A 4WZAA 3PWKA 1RRVA 3P4YA 4YJ2F 1XRRA 2P2SA 2HMUA 1B93A 1K88A 4OG2A 5ENZA 3O31A 1QHNA 2YS6A 4BJHB 4DBZA 1FW6A 4L4XA 1BW9A 3SCZA 3WRXA 1A9XB 2AOUB 2W6ZA 2OM6A 2R5FA 3FTCA 3EIFA 3W5UA 3PPIA 5IKMA 3PPWA 1DOZA 2D5BA 2NM0A 1NSTA 2R1UA 5JCJD 1Q0PA 3EZ6A 1NIJA 4DV2B 2V7UA 3FHTA 2BHSA 2ZYWX 3TSCA 1TJ5A 2G28A 4WZBA 2Q3JA 5EJ5A 5IVKA 3V00A 2MYTA 3NASA 2NU9A 1UKYA 2HF2A 4I9NA 1WZCA 2YWFA 4ID9A 4HX5A 2ZANA 5G0VA 5LXTA 4IXNA 3P9ZA 4C89A 4D3FA 4A23A 1CY7A 1N2OA 4RZUA 3TLGB 3T0GA 2GDJA 4W1QA 1M1UA 4TT8A 4BRUA 4N82A 4ND8B 2WYOA 2PTHA 4UXHA 3UCFA 4LNAA 3RJMA 4KC0A 4XYBA 3BWYA 1O89A 1EFLA 2OMKA 2QB5A 4IIDA 3DVQX 5CA0A 2VRCA 1CUSA 4GEGA 4PWZA 3F9IA 3OJFA 3JZDA 4JEMA 1WTCA 4EPWA 2HA4A 3G85A 1K9SA 2FPGA 3E0QA 4MW6A 4JKIA 5DULA 2UUCB 3OJXA 5K4HA 2A5LA 2JH3A 4OQMA 1OFUA 5CDTA 4ZOLF 2H2DA 3U9SA 1LF0A 4ALKA 4E6PA 2NWQA 3R3YA 4GYKA 3VI3B 3GH1A 3DKRA 2YYSA 4O2LA 1JZSA 4EJ6A 2FUEA 5DW3A 2MJLA 5HJ2A 4XUGB 2ZU0C 1P81A 4S0XA 2E37A 3P71T 4JOSA 1AKQA 1VYHA 3W3ZB 4MZXA 1DAOA 1WETA 2FSGA 4KVZA 3E82A 2AQIA 3NHBA 4R2MA 4C0KA 3TFOA 4OH1A 2CL6X 1C81A 3LT0A 1G63A 4GX1A 1B6RA 3GLIB 2JD2A 3HN2A 1C7QA 3I4FA 3D4PA 3L02A 4ZVKA 2NIPA 4LC9A 5E1MA 5HZMA 1ATIA 3S2GA 2XY4A 1MB4A 3DF7A 2EG5A 1FEZA 3QVXA 5JO9A 1OIVA 2XMGA 3A05A 1D4FA 1JPJA 2K2QB 2VTVA 3D02A 3LG2A 3MYRA 3P0EA 4N01A 4BNKA 1JA9A 3UXEA 3OSZA 1WULS 1XSEA 2DY0A 1XTPA 5JJKA 1MZPA 1LK7A 2O5VA 1MC8A 4P35A 5T57A 4ZO4A 4XRGA 3KQVA 1VSQA 1KHTA 5ES3A 1REQA 3PX3A 3FNBA 3GJRA 2FPLA 3HBFA 1I2BA 2QW1A 2BUBA 1ULSA 4LRTB 4WUTA 1L1EA 4I2NA 3H2YA 5AVRA 2N46A 1BKYA 3K7EA 5CEJA 2V55B 3FNHA 3WIUA 3EY4A 3RIHA 1S7CA 1MT3A 1RQPA 2VDRB 4P80A 1J42A 1ORWA 4UCXA 4WY2A 1SVSA 5EXDA 3T4PA 4BNUA 1V8FA 2X6QA 3L1IA 1WMEA 2X13A 5EIAA 5I9MA 2VRCD 4WZAB 4DLVA 3UT5B 4MVJI 2GESA 3K0CA 4HUJA 4RHTA 5AIAA 1BVRA 1QO0A 2Q45A 2DC1A 5HYVA 5JAIA 1LPOA 1RRGA 1ZOIA 2CB9A 4JIMA 5E8RA 3RU9A 3CPEA 2C5LA 3I83A 3R23A 2JI6A 4XIYA 2GSWA 2QD4A 3JRXA 4B8YA 2GCOA 2ST1A 3EULA 2WVJA 1UOOA 3ES9A 1QRSA 3IE1A 4EG7A 2J6IA 5K8CA 1M8FA 3WJAA 5KNBH 3NTVA 3O8QA 4PAGA 4EGCB 4AY5A 3I9NA 2DLNA 1MO3A 1HFJA 4LX8A 5E4TA 5C7IO 1BMDA 1CY0A 3E9CA 3OU7A 4DLUA 4OLJA 4XA8A 1AKRA 2Q6KA 4E11A 4E7PA 4EG1A 4K0KB 1X7XA 2UYYA 1WPQA 3JYPA 1YUNA 2O2JA 1KC1A 2DCUA 1A9TA 3IP7A 3OE5A 4GI5A 4MVJP 4MYSA 4OSEA 5ILGA 4V0LA 4AULA 4DSOA 4QPPA 1K08A 1N2XA 1DJMA 3KZXA 2FTKE 2YVKA 4MWZA 2HM7A 3E9QA 2Q4RA 2PVCA 4B6OA 1ESZA 3GZNB 3QNMA 1KMHA 1CRWG 4AB1A 3AZOA 3ZCUA 5CA0B 1H65A 4XM2A 1XQVA 1C1YA 3EOAI 2DYKA 3N8IA 4NICA 3GQBB 4AP5A 1YL5A 2QWXA 1ZS9A 1C3XA 3K92A 2P0YA 1RLUA 3GXBA 1F60A 2VZ9A 4II3A 3RIMA 4EP1A 1DDOA 4HQFA 4B48A 1NW9B 1ZJ6A 4HBZA 1KJ9A 1T8WA 1V7ZA 1T3GA 3HY3A 5GGYA 4F5DA 5IEJA 5DNVA 2VIIA 2NSJA 3MMXA 4FBGA 5TEWA 3ZDFA 3LYAA 4FYXA 1R00A 4G63A 2C94A