4H16A

Crystal structure of a short chain alcohol dehydrogenase-related dehydrogenase (target id nysgrc-011812) from sinorhizobium meliloti 1021 in space group p6422
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
IEFLNLRGKRALITAGTKGAGAATVSLFLELGAQVLTTARARPEGLPEELFVEADLTTKEGCAIVAEATRQRLGGVDVIVHMLGGSSAAGGGFSALSDDDWYNELSLNLFAAVRLDRQLVPDMVARGSGVVVHVTSIQRVLPLPESTTAYAAAKAALSTYSKAMSKEVSPKGVRVVRVSPGWIETEASVRLAERLAKQAGTDLEGGKKIIMDGLGGIPLGRPAKPEEVANLIAFLASDRAASITGAEYTIDGGTVPTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short chain alcohol dehydrogenase-related dehydrogenase
publication title Crystal Structure of a short chain alcohol dehydrogenase-related dehydrogenase (target ID NYSGRC-011812) from Sinorhizobium meliloti 1021 in space group P6422
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 89
structure length 258
sequence length 258
ec nomenclature ec 1.1.1.-:
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4h16A00
2Y0CA 1UDBA 4II3A 4GX1A 4BNMA 3MTJA 3QVWA 3LU1A 1QYCA 3EY4A 1EFLA 1ZH8A 1DC4A 1RM5A 2YV2A 4RPHA 3ZWYA 4JBIA 3EAGA 1T1RA 4Q3EA 1OFGA 2GRAA 2EJVA 5DBFA 2GN8A 2HJSA 5CEEA 5HWSA 1W8DA 4OXYA 2QRLA 1XWFA 1TLTA 3WGIA 4IJUA 1P1RA 4ZN6A 4NU5A 3NRCA 2EXXA 1DBVO 4GGPA 3LVFO 2I67A 1T4DA 3RC7A 4XDZA 5JC1A 2DBQA 5TNXA 3RC1A 4NBTA 1I10A 2HRZA 3HHPA 3I5MA 3CXRA 3I9OA 4PLTA 4YAKA 1BG6A 1NVTA 3DFUA 2VT3A 3IQDB 3D7LA 5AXAA 4OXNA 2G82A 3AFMA 3U4DA 1I2CA 3GVIA 4UUMA 5DOZA 3JQBA 3RC2A 3NGLA 1G0OA 1H9BA 1BXGA 2DM6A 5DF1A 3RUFA 3PRJA 2Y99A 1HDCA 2C5AA 3DZFA 3MJCA 3L0DA 1AXGA 3PFFA 1NPTO 1J5PA 3Q2IA 5B12A 4YT8A 3JQ6A 3A4VA 4TKLA 1XU9A 2VNSA 3BMNA 1GYPA 2NQTA 3NTOA 5IN5A 1FDUA 2HDHA 4WCFB 2JCYA 1XDWA 1CYDA 9LDBA 5HA5A 3WJAA 1GQQA 2B37A 2EG9A 2YDXA 1YBMA 4I5GA 3WTCA 3QP9A 3SC6A 4J7UA 1YBVA 2H6EA 4KP7A 4BHTA 2DKNA 1PJBA 3KYDB 3F47A 3KV3O 4XX0A 4IQ0A 3PYMA 1E3LA 4Q39A 1F17A 4FS3A 3GLQA 5EMHA 1CF2O 3KSZO 2VWGA 3HN2A 5AQ1A 3GZNA 4YACA 2DLDA 4NBVA 4RV9A 1C0IA 8ADHA 4CMCA 4FIZA 2I9PA 3PIDA 5CDGA 2AMFA 1CERA 2GGSA 3Q1LA 3F9IA 4WJZA 1QV6A 1U7HA 4R54A 1UDCA 1X7DA 2J3HA 2O23A 1YOVA 3NAQA 1PS8A 5DCWA 4YA6A 3IJRA 1GYQA 3GA0A 3CMCO 1KEVA 4PVDA 1GD1O 1NNUA 4YAGA 1KOLA 1YKFA 4MO2A 2BKAA 1UDAA 2PZKA 2B4RO 3TSCA 4GH5A 5K9ZA 4D79A 3Q6IA 4I1IA 3DHEA 1LI4A 1ZO8A 4ZQGA 4R1NA 4TWRA 1ZSYA 3ZI0A 2BMAA 3ULKA 1YB4A 1NHGA 3ITDA 4CMHA 5JLAA 1HYEA 1KEUA 2I76A 4J1SA 1XELA 3G3EA 4OJNA 4Q3DA 5CDTA 1RM0A 3UGKA 4UVDA 4BNGA 4E12A 2X9VA 1YBAA 4R68A 1HZJA 1CDOA 1B3RA 3BTUA 4P8RA 4NG5A 1D1SA 3H9GA 3QA9A 1PJ3A 1MB4A 4DQUA 1N7HA 3A1NA 1LU9A 1T2DA 2NSDA 4RPLA 3TRIA 3VC7A 1A71A 2YW9A 3VPGA 2NQ8A 1SB8A 5I9LA 3KM0A 4II2A 3R6DA 3L6DA 3D1LA 5DULA 3WQQA 1NVMB 3WBFA 5A02A 4MP3A 1EZ4A 2Q1TA 4IDAA 4PGFA 5L95A 1R4NB 2ZB7A 5A3VA 2OZPA 4R3NA 1N7GA 4NH4A 1PQPA 1ID1A 4GSKA 2NTJA 3GMDA 1I2BA 3JQAD 4JP2A 1Q0QA 2JKVA 2W98A 2QG4A 3RBXA 3PQEA 3GT0A 1EQUA 3QWAA 2DFDA 3GN1A 3TZQA 4D43A 1E7WA 3NYWA 3OJOA 1LDNA 1Y8QA 2H1SA 4M49A 5CHEA 5T8KA 5TJHA 4BB5A 4EEXA 1P31A 2Q99A 3PK0A 4BUCA 3JYNA 3OECA 5BT9A 3A06A 4TVOA 1U8FO 1V9LA 4J0FA 5THQA 3TN7A 4J4TA 2BGKA 1YJQA 2LDXA 3M2PA 3QSGA 5LCXA 3E9NA 2AEMA 3DBLB 3AY3A 4UVGA 1GYRA 3ZU4A 1RKXA 3FTNA 3P7MA 3K9QO 3HDHA 5EPOA 5F1KA 4G81A 3OA2A 4DQVA 4UUPA 2X4GA 3GK3A 2PA3A 1DC6A 2VRCD 1PS9A 2VOEA 1SEPA 2DT5A 2G1UA 1BVUA 1GR0A 1HZZA 1LQUA 3GRPA 2B35A 1X15A 3GG2A 1NQOA 4AJLA 1MLDA 1MX3A 2ZCUA 4AJEA 1FDTA 5L51A 3F1LA 1DRUA 1B14A 1JKJA 1I5RA 3AOGA 1HLPA 3ZV3A 5AVOA 1MXHA 1PU2A 4JK3A 2JD1A 2UYYA 1PQWA 4FDAA 5GZ1A 1KVQA 2DFVA 1D7OA 1BTOA 2VYVD 4DPMA 5JCJD 1RWBA 2Y1OA 1R16A 2NTNA 4GL4A 4Y6SA 3DAPA 4JP3A 1X0XA 3WMWA 1VJ0A 3QIVA 1B15A 2QW8A 3CKYA 5JPIA 4U7WA 3WXBA 1PZGA 4UAGA 1XCBA 5B4VA 1U7TA 4LGVA 5CPBA 1IOLA 4B4WA 1OZAA 4KDFA 3PIIA 1HDGO 2JHFA 4MVJD 1FF9A 1Y5MA 4KMSA 1NFRA 3AUSA 3LT0A 3GRKA 3R1IA 4PRKA 4EJ6A 5JXWA 2IEDA 4BGEA 4B3IA 1VLLA 2PGLA 3R3JA 1G6KA 1GV1A 1R66A 2NTVA 1BW9B 3KSUA 4Z0HO 2CUKA 1IPEA 2VRBA 5EERA 2Z1MA 3GN2A 4FFPA 5DP1A 5BSGA 3ZZNA 1YJ8A 3L07A 4GWKA 3E9QA 1UZMA 1EVIA 2EW2A 3L4SO 2CD9A 4E5PA 1WWKA 2YV3A 3S2GA 3HDYA 1LSUA 3LT1A 4MKZA 3FPLA 4OH1A 2Q1UA 1U3WA 1HWYA 2NACA 4WLUA 1C3VA 1ZVMA 4RDHA 5AYVA 2C29D 3JYLA 2OO5A 3AUAA 1VE9A 4YJHA 4J7CA 3KEOA 4WASA 2PFGA 1HE2A 4I9HA 4EITA 3EYWA 2Q3EA 4IQ8A 1IHYA 7MDHA 2WM3A 3UKOA 3JQAB 3GHHA 3WQRA 2HUNA 3IAHA 1N5DA 2YY7A 1X13A 3RASA 2CMDA 3U9LA 2Y1FA 3KHUA 1GU7A 4QTZA 3JD0A 4CM9D 3D0OA 3O8QA 2HRBA 1RM3A 3M6IA 1R15A 4Z0PA 1I3MA 3HDQA 5IDQA 3U5TA 5A06A 1R6DA 4R3WA 4W6ZA 1VM6A 2D4AA 1I32A 3ONEA 6LDHA 3TL2A 4KDEA 4YCAA 1GFSA 2NUAA 3K8ZA 2X5JO 5KJ1A 1BXZA 3IUSA 2YUTA 4YTEA 2TMDA 2A4KA 3E48A 3NGXA 3GG9A 1MP0A 4GX0A 2HJRA 1YB1A 5KCZA 1QORA 2B36A 4BNKA 1DDOA 2GZ1A 1I2ZA 4EW6A 1ZK3A 4PG7A 2P5YA 4MVJG 4TQGA 1N1GA 3ZCXA 1T2AA 1A27A 3HZZA 3RCBA 4PG5A 3STHA 3HN7A 1AHIA 2O7QA 4M87A 1E1LA 3UVEA 3HDJA 3Q9UA 4ALLA 3CSDA 1T2CA 4R51A 1QRRA 1N9GA 5AOVA 4BV9A 3LZ6A 5C5IA 2PR2A 4NU6A 2P9EA 4IIUA 3OEWA 5AXDA 2RCYA 4F46A 3NDIA 4BO1A 1C1DB 3A14A 3WYBA 1T26A 3GAFA 1DJNA 3OIGA 3C8MA 2GF2A 4DLLA 3JQCA 5KIAA 3IL2A 1MG5A 3QWBA 5K6AA 4NJOA 5HTOA 1GEEA 4CM1A 5JYDA 2JFFA 2P2SA 1B0AA 1J49A 1U8XX 4CPDA 2AE1A 2EEZA 3B20A 3WBBA 2HCTA 4TMFA 1EVJA 2IDZA 2DBZA 1JKFA 3ROPA 2HK9A 3D3WA 3CUKA 3TL3A 1UUFA 4A2CA 2NU6A 3BHMA 3ZWVA 3IP3A 2Y68A 4UEKA 1MGOA 5C3MA 2W2KB 3GGOA 4CQLB 4JN6B 1LNQA 1PJQA 1LDEA 1C1XA 5U4QA 2C07A 4PLHA 4BNJA 1WMBA 2DTEA 3C3XA 2GZ3A 4YRBA 1K0UA 2IXAA 1YO6A 4QSMA 3T7EA 5FWNA 1E3WA 2Q2QA 4BIIA 2C82A 1EDZA 2VZ9A 2XF8A 1PL7A 3FBGA 3NKLA 3FD8A 4U5QA 4PVCA 1QP8A 1M2WA 4GMGA 2H5LA 1PX0A 1B8PA 1M75A 3IC5A 1KS9A 1QKIA 5T64A 4I9NA 3D4OA 2PD3A 2VHXA 3Q11A 3RKUA 2J3JA 4PIVA 4RVDA 3UICA 2VHZA 3VPHA 4Z9XA 1P3DA 2A92A 2WYWA 1LC0A 2A35A 2DUUA 3H9JA 3HQ4O 4CM3A 2X5OA 1JVSA 1SOVA 3QVSA 3SXPA 4BNHA 5JYEA 1I3LA 1QYXA 1E3IA 1VL6A 3F6YA 2YQ4A 3FSRA 4AJIA 4LRSB 3H6KA 1GDHA 1XLTA 4FPXA 3WIEA 4D3FA 1LLQA 4GGOA 3V5NA 3OEYA 2YZ7A 2X0NA 1PGQA 4CMAA 1Y5RA 4QECA 3JQGB 4W99A 4WEOA 3PDJA 4YPOA 3PI7A 1P1KA 4XR4A 4RPKA 3DMTC 3BXXA 2C5EA 3E03A 4R1TA 3G49A 2Y05A 1CIVA 4L0QA 5TQVA 3PGXA 4INAA 1DIBA 2WMDA 3NV9A 1E6WA 1H6DA 4CUZA 4D44A 4ESOA 2PK3A 3MCVA 1DAPA 2JL1A 4B3JA 1SC6A 2SCUA 5G4KB 1AUPA 5IZCC 3IIEA 4A03A 3C85A 2R00C 3GHYA 4Z3KA 4YRAA 4PZDA 1CRWG 1RYEA 5L7TA 2CVQA 3VHRA 4CV1A 2VN8A 4AJHA 2J5KA 4ND4A 3WX0A 2UUOA 2IXBA 2VYNA 5IDXA 3E8XA 1HXHA 3ANNA 5L4NA 1NQ5A 3C24A 1ZK0A 2B69A 3LC1O 1LSSA 5DBIA 1I24A 1DPGA 1CQJA 3WGYA 4XQCA 4K9DA 2I3AA 5G0UA 1O8CA 3NX4A 4K26A 5JY1A 1IZ9A 1Z7BA 2NU8A 3AFNA 2NVWA 2E6UX 3ZDFA 1B7GO 1NP3A 3I4FA 1DIRA 4MVJH 3ZNOA 1NWCA 1Y6JA 3OJLA 1E1NA 1FK8A 3QE3A 3TOXA 4EJMA 1PZHA 1DIAA 1EQ2A 3DWFA 3PJGA 4PRLA 5FYDA 2AHRA 5F1PA 4Q3AA 2PGDA 3OHSX 5G0TA 5H82A 4EGFA 4A5OA 4BMNA 3JQ8A 5DZSA 1MFZA 3F5SA 4Z6KA 2D2IA 5JMPA 3RFTA 3EVTA 3GPDG 3KTDA 3VH2A 1B26A 3EGOA 1H94A 1BXGB 2B4TO 2EERA 4EUFA 5AXBA 2HAEA 1DB3A 1ADFA 3GDFA 2R6JA 3WS7A 2B5VA 1X7GA 4IDCA 4ZA2A 5KJEA 2B83A 5BQFA 3W8EA 3WGZA 2RH4A 3JQEA 4TROA 4M86A 3EMKA 4XQGA 3ADOA 5L4SA 5BSHA 4FN4A 4JCOA 4KWIA 1TVEA 2VWPA 3KOUA 3BMNB 2AG5A 2PNFA 4AJKA 3ZWBA 4DIOA 3I4CA 1WDKA 3OQBA 4R9RA 3H7AA 4XB1A 3GGPA 2YFQA 1IUKA 1ZEMA 4RF5A 2I65A 3OFSA 4BO9A 4C7KA 4E30A 1NQAO 3TZ6A 4DIFA 1UJMA 4DIBA 4HWKA 1Y1PA 4E2WA 1JWBB 2PKQO 3P2YA 4CUJA 2OHXA 4BMSA 1SMKA 4RF3A 4Z3DA 1WDMA 1GZ4A 1ADGA 2ZQYA 4TSKA 1I33A 3C1AA 3VVCA 4DC0A 1W73A 1A4IA 4ILKA 1CETA 3K30A 3QVXA 2HO5A 4NPCA 4NBRA 3GZNB 5TJ9A 1ZSVA 2HMVA 4G5HA 3EZLA 1KIFA 4H7PA 1DFGA 4F45A 1U2GA 4XR9A 4NFYA 4F6CA 4FOOA 4A0SA 2CDCA 2R00A 3GNSA 3FWZA 3GY0A 4BO6A 2YYYA 1EBUA 1DXYA 1YOVB 2DBVO 2EP5A 3QVOA 5F21A 1P0CA 5JDCA 2D8AA 4XYMA 3ANLA 2VHYA 4ZHSA 3CH6A 1E0DA 3RJ5A 3H4VA 4L76A 3O03A 1GPJA 3KLMX 4BQPA 2O48X 3U4IA 3ZW9A 4K6FA 3D5QA 1DC3A 2G76A 4CV0A 1DFHA 2Y1EA 4MDHA 3BZUA 3SJUA 2DPHA 4UVEA 1UZNA 1YE3A 1MFPA 1BXKA 3QY9A 4W4TA 4RO0A 4CLHA 4DYDA 2X1HA 1TEHA 1V35A 1ZSNA 3U62A 1S6YA 2A94A 1LA2A 1P1JA 5JDIC 3CEAA 3QV1A 2ZYGA 2NVUA 4GQAA 1PGJA 3G0OA 3VVBA 1SB9A 3AOEA 2X6TA 4K6CA 1QYVA 3SC4A 3DOCA 2VT2A 3MTGA 1I36A 4TKMA 2UV8A 4CMGA 2FPIA 2XAAA 4ZU3A 5CDUA 5ILOA 3GNQA 5MDHA 3G1UA 1YQXA 2DPGA 2OORA 2VNAA 1NFFA 2WYVA 3I6QA 1ISFA 4OKNA 3VDQA 4J2OA 1QMGA 4OHUA 3DB2A 5A9SA 1Y8RA 1AE1A 1VRWA 4AJOA 2OP1A 2RBEA 3VOSA 4P38A 2AXQA 3GUYA 4IDFA 4DBZA 4NNJA 3HUDA 1Z75A 4CLOA 2RAFA 4HFJA 3JV7A 3BMOA 3TJRA 1VSVA 2HLPA 4WOJA 3HADA 4HP8A 3DFZA 3JD2A 4YT5A 4WLNA 3LF2A 3WGHA 4F3YA 4OM8A 1RPNA 3OIFA 1U4SA 3DR3A 4MJLA 1Y8QB 4RVUA 5A9TA 3ZWXA 2YFHA 4AVYA 3ZV5A 1GCUA 3I83A 1W0CA 5CDYA 3ICCA 2GDZA 4N5NA 1DHRA 3BTVA 3JYPA 4PLYA 3H2ZA 4E2YA 3DO5A 3W4JA 4XYGA 2BF7A 2Q4BA 1LSJA 3GEMA 2V65A 3M2TA 4U0KA 5CG2A 3QWFA 4CL3A 4RQTA 4OQZA 1E5LA 3DDNA 4BQRA 5A5FA 4MVJI 1SCUA 2C7VA 3WICA 5KJCA 5EJ2A 4OSPA 4B4OA 1YH3A 1UH5A 4IDGA 5L7YA 3U4HA 3WLEA 1QXSA 5TRTA 2DAPA 2ZYDA 3TOZA 4ID9A 1PEDA 1LJ8A 3AM5A 1EEHA 1E1MA 4IDEA 4J43A 3N7UA 3WG9A 4WLFA 4Q3BA 1VI2A 3I9LA 4GBJA 4ZQFA 3AK4A 1EE2A 3FF4A 1E3JA 4A73A 2PV7A 1LDMA 4K1LA 4AG3A 4FD3A 4E3ZA 1UXHA 5A9RA 1ZKMA 4LVUA 1E77A 1YQDA 1X1EA 2Q2VA 4QT0A 5L53A 1LBEA 3LC7O 4AFNA 1U9JA 3W4IA 3ASUA 1PJ2A 2I99A 4DMLA 5B4UA 4LISA 1O0SA 1HYHA 4XJSA 2CDBA 2P91A 4M8SA 3PP8A 2R2GA 3HWRA 4B3HA 2NWQA 1U3VA 1V0JA 2ZB4A 3ZV4A 1HE4A 3WSWA 1GY8A 3V1UA 1OC4A 3FTPA 1H6AA 5C7IO 2E37A 3TZKA 3ZNPA 4B8ZA 1PJTA 1UAGA 1PJSA 3EK2A 4PFJA 2DVMA 3DTYA 2Q50A 4J7XA 5CEFA 3H65A 3ETGA 3OM9A 5C37A 4ROSA 1U3TA 4BV8A 1E6EA 2Y93A 1P44A 3LLVA 3TZCA 2HK7A 4DWVA 4PLWA 4UULA 3RUDA 2CY0A 4IJWA 5JO0A 2X58A 2QRKA 1DIHA 1DC5A 1DLIA 1XEAA 3HG7A 3LC2O 1YDWA 4GAEA 2ZIZA 4LMRA 5TGDA 4AJNA 4ZICA 6ADHA 2V6GA 3GDOA 2GR9A 1NAIA 1E7YA 3FR7A 1G1AA 1YWGO 1PR3A 2V7PA 3PEFA 3LF1A 2XOXA 3ASVA 3EW7A 5DT9A 1NR7A 3PHIA 3ETEA 2C54A 1K6JA 3IUPA 3PZRA 4QEDA 3ROMA 4YJHB 4H16A 2HSDA 3CZMA 3DAGA 1D3AA 4XA8A 1PIWA 1JU9A 5T6BA 4YYZA 3GEDA 3O8QB 5LC1A 1YL6A 3SX2A 4FB5A 1T2FA 1WVGA 4JXKA 1Q0LA 4XB2A 3H2SA 4BS9A 5EL0A 3F4BA 2EIHA 4S1VA 1Q0HA 1VPDA 4J1NA 1ZBQA 2NLOA 4D46A 4WCDA 2YQ5A 2X0IA 3UH1A 5T67A 5BSFA 1WAMA 5DCYA 1PGNA 4CMEC 5J23A 3V2GA 4OOEA 1WNTA 4YRDA 3I52A 4BOYA 4CL8A 3NT5A 3E9MA 4NZ9A 1EUCA 3DTTA 5B1YA 2EHDA 3AY7A 2HKIA 4J91A 4WLOA 2E49A 1F0YA 3GNTA 3KYBA 1LUAA 4AL4A 1F06A 3MWEB 4P4GA 1ULUA 3H5RA 2VYND 1LRKA 4WEQA 3KUXA 1N8KA 4YJFA 1T1SA 2EKPA 4HBGA 1N9GB 4IQGA 3RFXA 3G1TA 2J5RA 4CV2A 3DZBA 4OOFA 5IDYA 4WNCA 3RVDA 3B1KA 5U9CA 3GC6A 1NAHA 5COBA 5G0SA 5HS6A 4AJ2A 4CMBA 1HE5A 4BNNA 4BNFA 1I3NA 4FR5A 2CF6A 4KTVE 2O4CA 4FQ8A 2BD0A 4TRMA 4OMUA 1HT0A 5B37A 4DC1A 3IS3A 3M1LA 3WNVA 3KSDO 1K6XA 5KVVA 4RZIA 1YXMA 3S2IA 4FC7A 4W7HA 4J6FA 3RROA 4Y9DA 5GMOA 3VZQA 1JLLA 3D3WB 3RFVA 3VKUA 1O6ZA 1QLHA 1HETA 2D5AA 2O3UA 3DOOA 1NR1A 1RM4A 4ND2A 1OAAA 1T2EA 1U5AA 3ROKA 1XKQA 3HJAA 4J1TA 5CEJA 1C1XB 3PQFA 1HTBA 1TB4A 2WYUA 5HM8A 3ZWNA 2O7SA 1LDGA 3UCXA 1MC4A 3NJ4A 2UDPA 2X7HA 1E3WB 3PJDA 4MP6A 5F5LA 3PWKA 5GZ6A 3AUTA 1PZEA 3A28A 3NT2A 4MVJF 5KKAA 2X9NA 5ENVA 1GADO 1ENZA 3ETDA 3JYQA 3OMLA 4D42A 4HFRA 5L45A 2P4QA 4GVLA 2QYTA 4WECA 4PLZA 1X14A 3HE3A 5ADHA 3D3EA 1EFKA 4I5EA 2P9CA 2XPCA 4QXMA 5EESA 1GQ2A 1U3UA 4CMEA 1N92A 1H2HA 3ZNQA 3ABIA 2HQ1A 3JQFC 5I8WA 1V6AA 1OBFO 2WSBA 1L7DA 4WK6A 2I3GA 3F46A 4OO3A 4JROA 4LK3A 3RUEA 4DREA 5G0WA 2WE7A 2G17A 4LCJA 3VDRA 3ZWMA 2OBYA 2O3TA 2W4QA 4XYBA 5BNFA 2ZTUA 5ENDA 1EVYA 3E5MA 1GAEO 4GX2A 3V8BA 2IZ0A 2YHIA 3VH4A 2P4HX 5IG2A 1N1EA 3ADPA 3PTZA 4WOKA 3ZHBA 4J9VA 3K31A 4PG4A 4BNXA 5EN4A 4UREA 5T57A 3W8FA 3DZHA 1E3SA 3QVTA 2GN6A 1O9BA 2VWHA 2X9GA 1Q7BA 2BI7A 5JO9A 2D3TA 4FSHA 2B4QA 4BO7A 4ZGWA 3PHJA 1HSOA 2XXBA 1YB5A 2HMSA 3MWDB 3EZYA 2Q1SA 2OXIA 3AI3A 1U5CA 1PR9A 1Y9AA 2BFPA 3CTMA 3EHEA 3AUUA 4KUEA 5AXCA 4CR6A 1NQTA 3S55A 4IM7A 1MC5A 4E5NA 1E5QA 2G0TA 4KUGA 3WMXA 5KNLA 4ZRMA 2PGJA 3GUCA 3G17A 3DBHA 3N74A 2DUWA 3KO8A 2QZ9A 1GZ6A 3TWOA 2C59A 4L8VA 1ISGA 1WW8A 2EV9A 3ZWWA 2GD1O 3DOJA 1ZJZA 3T7CA 2PD6A 1O89A 3NDRA 3ORFA 4Y6RA 3W6UA 3X2EA 3BMCB 3JQ8B 3VKVA 2BRUA 4JIGA 4YJDA 3BIOA 4XWYA 4JBGA 4E2ZA 4RLHA 1Q2XA 1HL3A 1WZEA 4NR0A 5I7VA 4MIOA 3ZHZA 1E6UA 1BRMA 2E48A 5JSFA 4XQ9A 1ENOA 2C20A 2VWQA 3INRA 3OBBA 5C7LO 4LRTB 2BFAA 4MINA 5KJFA 2D5CA 2IZZA 3U09A 1HDYA 3CIFA 1KVUA 4IMRA 5JCXA 2Q45A 1IPFA 3NDJA 4L75A 3L4BC 3I6IA 3C7CB 3GF4A 1SEVA 5KVQA 1YQGA 3AU8A 3HFSA 2Z5LA 1P33A 3JQ7A 5A4DA 2IYOA 4FFLA 1A5ZA 1UR5A 4IS2A 4QO8A 1XIVA 2PZJA 4CQMA 3DZGA 1CJCA 5IN4A 1BWSA 5IXSA 3M1AA 1Y7TA 1A7AA 4RZHA 1ZJYA 4NJMA 3DONA 1ZZEA 5G0VA 4GX5A 1UXKA 4FBGA 4K28A 2VUTA 3E6AA 1UAYA 2JJYA 5TT1A 1H5QA 4URFA 3B6ZA 3H9EO 4DPLA 1Y81A 4LCEA 2OBNA 2UUPA 1NBOA 4XIYA 4B4VA 1EDOA 2CVOA 1GQYA 3F1KA 1V3TA 3JYOA 1U1IA 1SAYA 4GWGA 4ONEA 4P22A 3KETA 1PJCA 1Z6ZA 1ZXLA 3FN4A 3INGA 4GKVA 2ZK7A 1NXQA 2O50A 3PLNA 1ENYA 3ENKA 2JD2A 2YV1A 4BKRA 4CODB 2B0JA 2EGHA 1VKNA 5JS6A 1UZLA 5IFLA 4AJJA 2V6FA 1LQTA 4UEOA 3KVOA 4YVFA 1ONPA 3VTFA 4LW8A 5TLSA 1IE3A 2YHUA 1JQBA 4BNWA 1KEPA 2GASA 3DAFA 4MIYA 4LSMA 5TIIA 3GZ4A 3UFXA 4CLRA 4J90A 5F3RA 4CM4B 3WJ7A 1TT5A 4HADA 4FJ2A 2IRWA 3CE6A 3L9XA 3I3OA 2UAGA 4IZIA 5EIOA 1ZMTA 4BNVA 3DL2A 4GLLA 4PLVA 4RGBA 1VJ1A 1JWAB 3AI2A 2QX7A 2VHVA 3O26A 3H3JA 1G0NA 3ENNA 5HBRA 1R4MA 2W2LA 1ENPA 1Z74A 3QLJA 2ZCVA 1LDBA 1SOWA 5IDWA 1VL8A 2I5PO 4L74A 2C2YA 3DZKA 1F12A 2ZJ1A 2NVUB 5B4TA 2RIRA 3TZHA 2AQ8A 3HFGA 3BMQA 4U6SA 5KVSA 2DC1A 3PFWO 2X23A 4N5MA 1MV8A 3L9WA 2CNBA 3Q3CA 2PD4A 5FI5A 2FR0A 4BKUA 5A9SB 4OAQA 2Y1DA 1H6BA 1Y8RB 1AXEA 4CJXA 3DZJA 2AA3A 4BNTA 2ILTA 5C7OO 1BDMA 2C0CA 2WE8A 1MXFA 3AI1A 1JW9B 3D5TA 1KVRA 3KYCA 4CLOB 1IB6A 3BMOB 4R9SA 1ZK2A 4OL9A 2G5CA 2LDBA 2JCVA 1AHHA 5H83A 3I9NA 2JFHA 4EBFA 3V2HA 4D0RA 1KYQA 1PWZA 4Y67A 1KY4A 3PWSA 5DDIP 4E0BA 5ICMA 3I23A 4CLEA 1P9LA 1R0KA 3BMCA 5TSDA 3D4PA 4PG6A 3OH8A 1BMDA 4KQWA 1U28A 3INTA 3TQHA 3F3SA 4RL6A 1IZ0A 1Z7EA 2VZ0A 4IDDA 4GLOA 4B7XA 1V3VA 4XQEA 3ROQA 3RUIA 3H9UA 3GVCA 4HFMA 1WXDA 4QFDA 3ZGYA 4R1SA 1MA0A 1HEUA 1DIGA 2VUUA 1M76A 2PZMA 4XKJA 4BO3A 1XYGA 4YXFA 4RCVA 2BH9A 1Z73A 4BO5A 4IPTA 4NFHA 4RVSA 3QHAA 3O9ZA 3DMTA 4ZQBA 4NQZA 4Z0TA 4D3SA 5COAA 5EQFA 4HXYA 3FHLA 4BO8A 5A1TA 2GERA 3SLKA 4Z9FA 5GY7A 2QQ5A 2OP0A 4I8XA 4IJVA 3KEQA 2CVZA 1M6WA 2QRJA 3L77A 4ALNA 4J3FA 3Q2KA 4HKTA 3N58A 2AG8A 1ISIA 1DOHA 3B70A 5IZCA 2RHCA 1D1TA 2ZQZA 3VPSA 4OGWA 5ER9A 2PZLA 4XZ3A 3VAZA 4JJFA 4MVJP 3JQBC 3ZHXA 4B7CA 3B1JA 4XIJA 1SPXA 2IODA 1H6CA 2NU9A 4JX8A 3MEQA 3UXYA 3ZW8A 2FN7A 4J2HA 4CM4A 4GVXA 2POQX 1WDLA 3VZSA 3QJ5A 4BGVA 3IKTA 1K2WA 2NV6A 3DXFA 4J9UE 1UXGA 2WEKA 3HB5X 1XQ6A 3K2BA 4U0JA 1M66A 3E18A 4N54A 4O5OA 4R4JA 3AWDA 4NMHA 4FFOA 4N5LA 1ULSA 1CWUA 3P2OA 2C2XA 1ZK1A 3PDUA 4CM8A 3VZRA 1XG5A 4ITUA 2E82A 1WLYA 2NM0A 3FWNA 3RAJA 2EKQA 5DBGA 4J4HA 3DBRA 3MJEA 4RLSA 4WLEA 4RDIA 5DCUA 3WB9A 3K73O 4D41A 3ZNNA 1FDWA 3MJ4A 1PGOA 4MVJM 4NBWA 3WNQA 4KTTE 5ITVA 3E5RA 3LK7A 2DBRA 1F8FA 3OETA 4KQXA 2JD0A 5F1OA 4NK5A 4Z9YA 3BA1A 3VZPA 5IAAA 2CSUA 3KXDA 1DHTA 1LX6A 4R5MA 5I9MA 1A7KA 1SO8A 4CUKA 4X54A 5HRUA 1B8UA 3RSHA 3KBOA 2GZ2A 3D64A 1A9ZA 1PZFA 1PJ4A 1JVBA 4NK4A 3S2FA 1JKIA 4DLAA 1L1FA 4UEJA 5JY6A 1OMOA 4B79A 2PLAA 3WLFA 4PLCA 1K89A 4FOSA 2JCXA 1D8AA 4RF4A 4E33A 4I08A 3LQFA 1Q7GA 1ISJA 3WGTA 3JQDA 4R5HA 3MJSA 3GVXA 5LDHA 4QX6A 4IS3A 4RVFA 4O63O 1B8VA 3PLRA 1LC3A 3W6ZA 3WOHA 3ZN2A 4W82A 4FJ0A 3FNHA 4L9RA 4BKOA 1E7RA 3MZ0A 2YJZA 1GZ3A 1L7EA 4ALMA 1RYDA 3AU9A 4FW8A 4MKRA 4YDRA 1ZMOA 1PL8A 8LDHA 4PN3A 2D59A 1GUZA 1R37A 4YJFB 2XXJA 4BB6A 3MJVA 2IE0A 4Q3CA 4CV3A 5ICSA 3WQSB 2Z95A 4TRJA 3BAZA 1E92A 1EUZA 2FRDA 5FF9A 4L73A 1CQIA 4B8WA 4TZKA 1M67A 1EK5A 1F8GA 1MUUA 3FBTA 1KBZA 4FJ1A 3OF2A 4I5DA 4JJGA 2AEJA 2Q2WA 1DO8A 1YONA 2FPGA 3PGJA 4YJGA 2FMUA 2X22A 4BNLA 2O3QA 4FGWA 3ON5A 2Y0DA 4BKQA 4ZD6A 4F6LA 1HDOA 1QV7A 1KY5A 2BI8A 4AJ1A 4RJTA 1IYZA 1CEQA 1S7CA 1TA4A 2QYSA 3IKVA 1Z82A 3PZBA 3PYXA 2TMGA 1JTVA 3OJFA 3TFOA 5DP2A 4XRRA 5CDSA 5JDIA 2PY6A 1BSVA 3OJEA 1PSDA 3LT4A 3VH1A 1DRVA 2CDAA 5KKCA 1VL0A 3CPSA 3JQ9C 3Q0EA 5T8KC 2GLXA 5BSEA 1PWXA 2GPTA 4CMIA 4XGIA 1XR3A 4DGSA 4E31A 4WLVA 5ILGA 1NFQA 1P74A 4AJ4A 1XHLA 4FGSA 3TFQA 2FZEA 3IJPA 4NIMA 4CQMD 3DHYA 4OSOA 3RKRA 5EQDA 4ND3A 2OUIA 3QQPA 1LRLA 3IOYA 1AGNA 5KJ6A 1PL6A 4UUOA 1HF3A 2JHGA 3IMFA 4JQCA 4WCFC 2BGLA 4PLPA 2O3SA 1GUYA 3K2EA 2DU8A 4YT2A 1K3TA 4PLGA 3QW2A 4Y8VA 1IY8A 5TT0A 3V2UA 5IF3A 1KERA 2Q46A 3BYZA 2NU7A 4UVIA 1IHXA 1KC1A 4CM7A 4BGUA 2EF1A 3G79A 3FPCA 3IDSA 1ADCA 2RHRA 4B4UA 4DLBA 4XYEA 4BMVA 2WD7A 5DNAA 1O94A 2EJWA 2ZTMA 4IMPA 4QQRA 1FDVA 2RH8A 1JDJA 4NFSA 5T5QA 2IEBA 1C0LA 3U0BA 3QRWA 4R01A 2GN4A 3H5AA 4KWHA 5FI3A 4CM6A 3RQSA 4IIVA 3FCOA 4RPGA 2YHIB 1EK6A 4Q9NA 5JAQA 4DVJA 3FNFA 1A9YA 1J4AA 3RC9A 3PPIA 4FFNA 4XD2A 3WGQA 1BHSA 2FPPA 5BNIA 5L7WA 4M55A 2WJPA 4U6QA 1LSOA 3RIHA 4MIEA 4BKPA 1UP6A 4ALIA 2AQKA 4P4LA 4BO0A 1P1HA 4EUEA 4LSWA 1GCOA 2QIOA 1NM5A 2W2LD 2J8ZA 1E7MA 5KOIA 1P1FA 4CLXA 3RWBA 3RBVA 5A05A 1ADBA 3CZRA 3Q9NA 3UOGA 4CLDA 3AM4A 3GGGA 1FJHA 1WPQA 1VJTA 3RI3A 4U8GA 3VTZA 3WIDA 1I0ZA 3K6JA 3WGOA 1AN9A 2C7GA 1P45A 4JBHA 1W6UA 5F5NA 4A27A 2O3JA 4KOAA 4XRGA 3WTBA 2CZCA 1KEWA 3RD5A 1DSSG 3WFJA 4XGKA 3GMSA 3DBHB 3R3SA 2OL4A 2HMUA 2BGMA 4EJ0A 2FR8A 3JQ9A 1I01A 4YQZA 4YWJA 4IXWA 5G2OA 1HLDA 2J5QA 3AM3A 1HE3A 3AW9A 1QR6A 3PHGA 1HDXA 2Q4EA 3LLSA 3F4LA 5TF4A 2NVBA 1YDEA 4JLWA 5H81A 1GUFA 9LDTA 5I7SA 2VCYA 4ZQHA 1PGPA 4FFMA 3QWHA 4ZRNA 1SZJG 4NI5A 1T24A 3KLPX 2AEFA 1J0XO 2Z1NA 1LEHA 4YB8A 4C7JA 1P77A 4WCFA 2J6IA 3PHLA 3CMMA 4ALJA 3PHHA 4QFCA 4WUVA 4YAJA 2YDYA 1OC2A 1H93A 3A9WA 3FI9A 1C14A 3JQ7B 4BVAA 4E5YA 4LN1A 5GZ3A 4J4BA 3ZU2A 3GEGA 1IL0A 3I9KA 4CQMB 1ZEJA 1Z45A 3MJTA 1VSUA 3KYDA 2VOJA 3RBZA 4NJMB 3FNGA 1V3UA 3P5SA 3R0IA 2JAHA 4IBOA 2DQ4A 2X5KO 1I30A 5CG1A 3OQ1A 1ZIDA 3E82A 3NUGA 1LTHR 2VQ3A 3QWIA 2DTDA 5JFOA 4A26A 5ER6A 2FWMX 3JSAA 4CR7A 1GTMA 2BFMA 5JNLA 4S3MA 2O2YA 1EMDA 2WDZA 5I9NA 3NJ8A 2FZWA 1ZXBA 2GNAA 1NWHA 2V6BA 3O38A 2F00A 2FR1A 2Y0EA 4QUKA 3DZIA 3LDHA 4IINA 3WR5A 4RQUA 2GCGA 3SJ7A 3AJRA 3HSKA 1QYWA 4NBUA 3UF0A 2PKQP 4UUNA 4EDFA 1QYDA 1B2LA 4N18A 3RU7A 1TXGA 1R12A 1VKOA 3FRJA 2ZJ0A 4L4RA 1ZNQO 1NPYA 3KB6A 4HY3A 4CLRB 1JA9A 2FP4A 3GDGA 3ST7A 4DYVA 5K6AC 1TT5B 3I9JA 5DOVA 2I6TA 3ITKA 3VPFA 1ZUD1 2X0RA 2O4UX 2EGGA 2CF5A 2ET6A 3UCFA 4YQYA 1WP4A 4Q3NA 4DL9A 3KZVA 4O0LA 2Q1WA 1WZIA 4MP8A 4W9NC 1O95A 5TX7A 3S1LA 5I7FA 3ZU5A 1YRLA 3EC7A 5IJZA 3ICPA 4CR8A 1X0VA 1X7HA 1R4MB 4QO7A 4EI2A 4I9UA 1H2BA 1UP7A 1XGKA 2VZ8A 1OI7A 2BLLA 1Q7CA 1B3BA 3WWZA 3ZWPA 4WGGA 4E6PA 5A5EA 1YGYA 3GPIA 3BMQB 5MGBA 4OXKA 4M89A 4JJIA 3L6EA 1NTOA 1TT7A 4GPD1 5FFFA 1LDYA 4WE3A 4YAIA 2OFPA 3OJ0A 4HFNA 4XYLA 1ORRA 5JW6A 1R4NA 2Q49A 2Y66A 2FOIA 3DHNA 3UN1A 4BNUA 3JCZA 2BHLA 2O2SA 2PTGA 2F1KA 4D3DA 4DMMA 4A10A 3OA0A 2V6MA 3GQVA 5JC8A 1DLJA 1HDZA 1YL5A 3PWZA 4HNHA 3LSYA 4BO2A 4YT4A 3EUWA 4A7PA 3KYCB 1XSEA 4EZBA 3K96A 3BHJA 3P19A 5HS4A 2A9FA 4PCVA 4UVHA 3CINA 5FEUA 4DA9A 3C1TA 7ADHA 4O1MA 3OSUA 3SVTA 3RUCA 4BGIA 1KVSA 1Q1NA 3WYEA 1PQUA 4MVJE 3FR8A 4XDYA 1E3EA 3SLGA 3UHAA 1LLCA 3PXXA 1YVEI 4HNGA 2HMTA 1J6UA 1TI7A 3V1TC 3DBLA 3WYCA 3MOGA 3ONFA 1UXIA 4IGEA 5ES3A 2NADA 4NHEA 5A03A 2FSVA 1EE9A 2GUGA 4AICA 1ONOA 2OGUA 4ND1A 2P68A 3DMYA 1BVRA 5IZ4A 4YBZA 3H3FA 4EEZA 1P0FA 3LT2A 3UW3A 4DQXA 1U2DA 1JN0A 2B5WA 1FMCA 4J16A 2E4AA 1LRJA 4OKIA 2ZB8A 1KETA 2NNLD 2BELA 3JQFA 1C0KA 2WTBA 3I9MA 2PH3A 5L3ZA 3AY6A 3GR6A 3JD3A 4DPKA 1T4BA 1DEHA 3S2EA 1P1IA 1HSZA 1X1TA 1E7QA 2GN9A 1UP4A 4Y98A 5LDGA 3UUWA 4ND5A 5JE8A 2DTXA 4W9NA 4DRYA 4E5MA 5A04A 4G2NA 2Y1GA 4CMJA 1NPDA 1Y9EA 3H8VA 4L4XA 3WWYA 3W8DA 1DJQA 2VTEA 4MKXA 5U1PA 3W4KA 3OICA 4PZEA 4C4OA 1C0PA 1R0LA 1PJLA 4Y6PA 3DQPA 5JAMA 3H9QA 1ZW1A 4ZJUA 4WPGA 1IULA 3GOHA 3HNPA 3SEFA 1A72A 1BGVA 1QG6A 3U4CA 1BW9A 1I8TA 3RU9A 4RVGA 1V8BA 1OOEA 5DN9A 4TZTA 5JAZA 1HDRA 4R16A 4WNIA 2BFOA 1YS4A 2JFGA 2IZ1A 4H15A 2OMEA 1K6IA 1F14A 2X8LA 3PJFA 4BL5A 5KTKA 3V1YA 5JMWA 3PJEA 4BO4A 4BNZA 4EYEA 4CM8B 4KUHA 1GEGA 3ZHYA 4CMKA 2AE2A 4ZQEA 3FNEA 1A4UA 1PS0A 1ML3A 4I5FA 3DBRB 5CFZA 5I8ZA 4PLFA 1LLUA 1XA0A 2WD8A 2GYYA 4WKGA 2AQIA 1B16A 2PWZA 4MOWA 3OIDA 1GL3A 3JQAA 1FXSA 3GFBA 1DAOA 2AQHA 5THKA 3COSA 1D4FA 4NDNE 4J0EA 4M54A 3B1FA 2I66A 1EVZA 5G4LA 1RJWA 3JTMA 4PZCA 5L40A 5BNTA 2PKRA 3L4BA 4R41A 1DFIA 3UAGA 2GO1A 2OOSA 3OP4A 2IYPA 1O5IA 3W1VA 1ONNA 1WMAA 4EUHA 3WFIA 4LVCA 4GKBA 2EW8A 2ZATA 5COQA 1NVGA 2QZZA 3OQ6A 5JDCC 3GFGA 3X2FA 1ISMA 3BTSA 4BNYA 3ZWAA 3DC2A 1QLJA 3LYLA 4D45A 3ZU3A 4DUPA 4TRRA 3TPCA 4IY1A 4HUJA 5TS3A 3NEPX 1PTJA 2VRCA 4W7IA 5A3JA 1NX6A 5EINA 4O59O 2J3KA 5JBIA 4RVHA 4R69A 4DTIA 5K0ZA 4E13A 2EKLA 3PYLA 3MOIA 5I7EA 3U49A 4CM5A 1GV0A 2WWRA 3C7DB 4GMFA 3WGGA 3T4EA 1XU7A 3ZH2A 4JNKA 4GSLA 2W90A 2PH5A 5CP8A 3U3XA 4L4SA 2P9GA 3ZV6A 3VPXA 1ARZA 5L4LA 4ZVVA 4IUYA 2FSSA 1FDSA 2H9IA 4YR9A 3AOEC 2EP7A 1C1DA 2VYVA 5JCJA 3ONDA 4N7RA 4G65A 2H63A 4HV4A 1H9AA 1KC3A 3E1KA 5BR7A 3JD1A 3NTQA 4XCVA 4P4NA 3RUHA 2Y67A 4XEHA 4YJGB 1MG0A 2VTDA 4E4YA 3KRTA 3HB4X 1VC2A 2FHSA 2FY8A 4J49A 4YEDA 1GPDG 1NASA 1LLDA 4GI2A 4FCCA 4JGBA 2HMWA 4FC6A 5KWEA 3NT4A 2W2KA 3T4XA 4MVJA 1T25A 4J1QA 4CQLA 3RJ9A 1H0KA 1SBYA 1ZK4A 4IDBA 1EBFA 4FFRA 3ZWOA 4TRNA 1K5HA 5CPFA 5CAEA 5ITWA 4RPJA 1M6HA 3TNLA 1ZCJA 3DBVO 4H3VA 4CMIB 3I1JA 1E7SA 1KVTA 2VUSA 3O4RA 3GAZA 1LXCA 2D0IA 2HK8A 1ZFNA 4MPDA 5KVCA 3BHIA 1QSGA 5TC4A 1JAXA 2VHWA 2GSDA 3VH3A 3NTRA 1HRDA 1HYGA 1SNYA 1EUDA 3EDMA 4R1UA 3S8MA 3PVZA 2O3RA 4D0SA 3WSVA 1DRWA 2ZYAA 3IP1A 2HU2A 4O6VA 4ALKA 3C1OA 1NHWA 4E32A 4BNIA 2EWMA 4OQYA 4E5KA 1N2SA 4RF2A 2ZTVA 3TF5A 4DXHA 1E1KA 4OYRA 3GVHA 3RUAA 1W4ZA 2QHXA 2X0JA 5L9AA 2P5UA 1HKUA 3K5PA 4IJKA 2X86A 4CM9A 3EVNA 4RORA 3PQDA 4PG8A 2WD7B 3JQGA 1JAYA 2CFCA 2ZKLA 2Y1CA 4XJTA 2J3IA 3D4NA 3TDKA 2ZTLA 4XGNA 4E21A 4AJPA 2D1YA 3H5NA 4HX5A 3SBOA 3DEYX 1XQ1A 2JAPA 2UVDA 5IXYA 3L6OO 4M1QA 3BTOA 2ZB3A 3JD4A 4D7AA 1NYTA 3C7AA 1U4OA 1I3KA 1YL7A 2AW5A 4LMPA 3F5QA 1UXJA 1ISHA 4OIMA 4KZPA 3UCEA 4B7UA 3K92A 5G4KA 2W8ZA 4TVBA 4IZHA 3WDSA 3ZWCA 4YAEA 4IXTA 3GH3A 4DBVO 3GVPA 1R0SA 4E2XA 4IGFA 3ANMA 1BDBA 5JAIA
chains in the Genus database with same CATH superfamily
3LFTA 3L0PA 3C3BA 3EY4A 1ZH8A 2UZ4A 4RPHA 3CC8A 3ZWYA 1DKNA 1ZLXA 4JBIA 3ABOB 3WK7A 4JI6B 2L2QA 3IV7A 3UT5B 2JLXA 4DZRA 1DARA 3EAGA 3GLVA 3VUEA 1U0TA 1R4ZA 1X80A 3PXEA 1OFGA 5JS7A 1JUDA 2GN8A 3NIFB 4O02B 2PJUA 5DBFA 1F4VA 1UJ5A 2AC2A 3MBIA 5EIBD 1GU1A 1X1AA 2VATA 1X8KA 3T61A 5HWSA 3K6KA 4CGZA 3OEHD 1XWFA 1TLTA 1TUIA 1GQFA 2HB6A 1XNHA 3LUFA 5JNSA 1Q22A 1M0SA 1Q83A 5KSPA 1C9EA 2WG2A 3R6WA 3LVFO 3OU2A 3RC7A 3RVPA 2WSMA 4HLQB 5FBZA 3NW9A 1Q3TA 5KYWB 4YYEA 3RC1A 2ZZKA 3AKDA 4NBTA 1ACJA 3HHPA 1GLNA 1ZN9A 4YAKA 3ICEA 1NVTA 2IZ5A 2QMUA 1W581 4IFTA 3ZCTA 4ZAWA 3BD8A 4OXNA 3AFMA 4LJ6A 3GVIA 1T36A 3SZLA 4D0LB 2GJ9A 4IRMA 3RC2A 2YS6A 3L41A 5KBYA 2DM6A 3BILA 5DF1A 2VXBA 5FTWA 1ISPA 1BHJA 2ZJBA 3QV2A 3UJDA 3N28A 2C5AA 3MFYA 3DZFA 3FFAA 4KSBA 2K87A 4GXQA 4KFUA 4KYVA 4W5WA 2W6MA 4ND6A 2P67A 4P5PA 1QGZA 2WP8J 1ZL0A 3WLNA 3TSAA 4D5EA 3A4VA 4ETWA 5DM1A 4JCCA 2Q6IA 2QRVA 3BMNA 4BC1A 4RCZA 1FDUA 2VDJA 5LZ2A 1LPMA 2A14A 1GG8A 2V3WA 2VHQA 5HA5A 3V8RA 3WJAA 4ZYTA 2B37A 9LDBA 5K8JB 1FFCA 2OR3A 4QYWA 2OYCA 2YDXA 3WRXC 3O84A 1FSZA 2C58A 2YL2A 2FK8A 4NRDA 2IOHA 3N1UA 4LBVA 1V8FA 4N3CA 3HB9A 1FMTA 4I5GA 1ZJWA 1T0JB 3N05A 2H6EA 2OV4A 1M9NA 4KP7A 3WL8A 4BHTA 3AKZA 5LD2B 4KR6A 2H1CA 4FILA 3PYMA 1E3LA 4L51A 5EMHA 1KIAA 3GLQA 3FBWA 1NKSA 3EGDB 2VWGA 1SRRA 4N0MA 4A2QA 1ZR2A 1NZFA 3DE6X 3B1VA 1O0BA 4G4SP 4YACA 5BYAA 4NBVA 4RV9A 1MVLA 3QKWA 5K8VA 1WP9A 2JCGA 3JVIA 3VJRA 2OV2A 4K0RA 4ZZ3A 1CERA 2H9AA 2QTVB 4M21A 5EJ6A 1U1EA 3IP6A 5EVJA 2IHZA 3HBNA 2WWHA 5LOVB 4EABA 4HMOA 3I5UA 2E55A 1UDCA 1GQOA 2J48A 2FEMA 3UY4A 4CIWA 5J1SB 2IYUA 2PLNA 1QDEA 1QHXA 3GJ0A 1GYQA 2QQ0A 1RP7A 4DABA 3C5CA 1CZOA 5B7QA 3CMCO 3KPYA 2OV8A 5ALVA 2X14A 4V1CB 1KEVA 3B6KA 2G40A 4D6YA 1R8JA 1YR6A 3T9FA 3X3HA 5C4GB 3TSCA 4ZYWA 2ID9A 3FYSA 3TIVA 3Q6IA 2CGEA 4A9AA 2XDAA 1ZO8A 1JR2A 4QDUA 3ZI0A 1I3CA 3I6BA 4CBVA 1YB4A 3MUOA 1MB0A 3B5JA 2XCOA 4RULA 2VH5R 5JLAA 1OAKA 3KR0A 3PSHA 3HO6A 3S1AB 4Z54A 1NQXA 3H99A 3L7KA 5CDTA 4QDKA 4R9NA 5NULA 4EJFA 1E66A 1R5OA 2Q6TA 3KL2A 3P9RA 4MULA 4BNGA 3HRHA 1HQKA 3PNBA 4Q48A 1YBAA 4L5IA 1R6TA 3RSCA 4W5NA 1CDOA 3BIWA 3KKKA 1B3RA 3BTUA 2BE7A 3LKZA 3OCZA 3QUAA 4GBGA 1NVDA 4AKGA 4ZMBA 1GTZA 1PJ3A 1MB4A 2J7PA 2VC2B 2OAQ1 1CXZA 3R44A 1SK8A 4V3BA 3R7SA 1XVIA 3EDRA 3FUUA 1XTRA 1PD0A 3YASA 2NQ8A 3H16A 1JDBB 6AT1A 3DQZA 3GBPA 3PPYA 2PPVA 2R8PA 4II2A 3R6DA 3W7BA 5A4JA 3UXMA 3D1LA 4XOIA 3WBFA 2JEZA 2QTZA 2Q9BA 4G97A 4MP3A 4YIKA 2Z8XA 3PVCA 1NLMA 5GP1A 1G20E 1KJNA 4HAOA 1JG7A 5K3OA 5HP4A 2L18A 1R4NB 4PC3A 1FUIA 1NLYA 1VGQA 3HS3A 3RIMA 3G5TA 1DU4A 3BMXA 2I0FA 4RK0A 3TMAA 1ID1A 4G26A 4U2DA 4PIPA 4UEWA 4KPUA 2ZRKA 1ZVKA 2OE2A 1OW3B 1RZRA 5KQMA 4BQFA 3K7EA 3RBXA 3TW6A 3RC8A 1Q3KA 3GT0A 1EQUA 3PQEA 3PEEA 3GN1A 3QWAA 1MU0A 3TZQA 2P1RA 2WNHA 3OJOA 4HDRA 1Y8QA 4MB2A 3CUUA 1SWWA 1JBQA 3WDLA 4EEXA 4B6JA 1NDQA 3D6NB 5MN5A 2NMVA 2CC2A 3WKAA 5CFNA 5BT9A 1H2RS 2FW7A 2VVTA 3A9CA 3CRZA 1OASA 3TN7A 5THQA 2OESA 1QH0A 1EVLA 1LF0A 3OCVA 4RA6A 4UE3S 5LCXA 3DOIA 3E9NA 1AKVA 4DLTA 3DD1A 4MGEA 1TLFA 1MVOA 2VJKA 1U0NA 3KZ1E 4D9KA 1RKXA 3L43A 4YWHA 1C8BA 4FGJA 2GRUA 4Q7QA 1IM5A 1H3FA 2WR8A 1E2BA 4CNBA 3ZJ4A 2G1AA 1XTTA 4G81A 3B38A 3IBGA 1RQXA 5I8PA 1LS1A 2QJOA 2GTIA 2X4GA 5AM2A 3SYRA 4B6SA 1GXSA 4HQOA 2UU9B 5GONF 3IEIA 3LO5A 1BVUA 1OXTA 4PC7A 1GR0A 1HZZA 4KH1A 1LQUA 2FG6C 3NHUA 4B47A 3QEAZ 4Q9IA 5ALWA 1K5PA 1CUEA 3GG2A 5D3MA 3WYFA 1JIIA 1ZGGA 1Z25A 4C0JA 1MX3A 4WXRA 3GEHA 2QMHA 1SVNA 1RLMA 3HBFA 1P72A 1ZN8A 4MGYR 1B14A 1QLWA 1U2PA 1PWEA 1HLPA 1T4MA 3W5CA 4JK3A 3O3NB 1IN8A 1Z4QA 4FDAA 2J33A 3ZXXA 1KVQA 2DFVA 1YC2A 2DERA 4ZO7A 2M6LA 2EJCA 2EFCB 1XCGB 4QYTA 1VYUA 2J30A 4KIGA 4W5TA 2VPZA 2VYVD 4LJ4A 4LJRA 2A8YA 1R16A 2PBZA 2NTNA 2VXCA 4GL4A 5HIJA 3QX9A 1P60A 2J59A 1P0MA 5DGDA 1TQDA 2FX3A 3TD6A 3CZ4A 4MVYA 4O2AA 2UZ3A 4WERA 1Y5LA 4FYWA 4B9EA 1V1JA 4RM2A 3B1ZA 5TR9A 3UTDA 5DYWA 1JH8A 2LE0A 3RIXA 2BH2A 4FSDA 3KP1A 4GVPA 4RFLA 2C4MA 4B4WA 1WCWA 1C3LA 1VRCA 1M1NA 1RRFA 2XOKD 3CTPA 1Y9ZA 5HCIA 2P11A 3PIIA 1HDGO 4ND8B 4UQOA 1G98A 1ODLA 2JHFA 4ZV9A 4IZOA 4EY6A 5JASA 1W0KA 3P9KA 3VAAA 3GRKA 4PRKA 4HATA 2EZ8A 5JXWA 2CWWA 2VQEB 4E5SA 2PGLA 3OT5A 2XT9A 2NTVA 4AC9A 4L9AA 2ZLBA 3KQOA 3FGPA 5CM2Z 1Z6AA 4Z0HO 1M3SA 4FHZA 2FUKA 4JI4B 2Z1MA 4KAAA 4Q7JB 2RGXA 1ULTA 2CHQA 4LDPA 2HR1A 1P75A 2DULA 3PT9A 3VU3A 2DWOA 4Z9BA 3L4SO 4FDTA 5JAHA 1IRIA 2CD9A 3HGTA 4QGBA 3VMMA 4E5PA 2YV3A 1MTOA 4ZARA 1A2OA 1G17A 1Z0AA 4DSOA 3QU9A 1L5NA 1VJDA 2PUBA 2A30A 3B7GA 5ULLA 3SZMA 4BFCA 4F3KA 3JYLA 4B0PA 4ZEMA 1S3GA 4YP7A 1M7BA 3AUAA 3AVWA 3IO5A 4KPFC 1AXRA 4J7CA 3T3GA 1YMUA 1UT5A 4I9HA 1T5SA 1Y6RA 4EITA 5BUQA 1U9IC 3PXDA 1KE2A 5J2TA 1RLIA 1QKKA 3MA0A 3GLRA 4F5EA 5LWQA 2FMKA 1NXWA 1ST3A 8GPBA 4CKWA 4QTZA 3S5JA 3EPJA 1I1OA 2HRBA 2GFQA 4A2WA 3C5EA 4C0SA 2QW1A 2NO4A 2PQ0A 1JR3A 1Z5GA 3ONEA 3R5TA 3NFYA 4EA6A 5K1ZA 5CFMA 1XV5A 5LQNA 1OHHD 2PUCA 1FJ2A 1OCEA 3H1BA 1IWPB 3K8ZA 2GS9A 4CTKA 2G4VA 4Y6OA 1EIWA 3L84A 2NO7A 2YUTA 3H9CA 2NXJA 4C1NA 1SR8A 3DNMA 1JV2B 1ID8A 2G1KA 2A4KA 2QAIA 3E48A 1VXRA 3CSSA 1MP0A 2XNDA 4B35A 1G2IA 1QORA 2B36A 3HXLA 2GZ1A 4BRWA 1UFOA 1ZK3A 1M0EA 2J7KA 4DLPA 1JDZA 1PG5A 1Z12A 3SHVA 3AUYA 3D4LA 4L72A 1KJWA 3S70A 1EP9A 3FPSA 2XI4A 4OI0A 3UWMA 1SKAA 1A27A 1LW7A 5B3JA 4PG5A 3RCBA 1WUKS 3QBEA 1I4DD 3FH0A 3K4HA 2VP9A 3A4LA 4ME6A 3VYVA 2O7QA 4M87A 3UVEA 1A5BB 5KQLA 4ALLA 1SH7A 4YJ2F 2GMWA 4GRDA 4LOHA 4QOJA 1JMYA 5D01A 4I55B 5DSZA 2NW6A 4X3CA 4GPBA 2PR2A 1NXVA 5CA0A 5B55A 1NNLA 1X9GA 4BTEA 3DLHA 3VO1A 2G4LA 1Z5PA 1S2LA 4BO1A 3DVAA 1T26A 3GAFA 4QUBA 5I5GA 2PIAA 3LZDA 2YN4A 2NXWA 4Q6BA 4ESHA 1KP3A 3JQCA 2R1ZA 4LTMA 3OZUA 5K4AA 3KIPA 2NUTB 4NJOA 2R9VA 2NPOA 1T8TA 2N47A 2VAMA 3PUWA 4B4DA 1NVBA 4PYRA 1IN7A 5JNUA 4TL8A 3J7TA 4CM1A 5JYDA 1RFGE 2P2SA 4RY2A 5LXTA 1K8XB 3E7XA 4MRPA 4G4SO 4OQ4A 4RELA 4JLPA 3U13A 2EEZA 3B20A 3DPSA 2HCTA 4LVNA 2WYIA 2IDZA 3OX3A 3D3WA 2GESA 1NVUQ 3CHYA 5KZMB 1DZ3A 1Y3CE 2J07A 3BHMA 5F7JA 1XB2A 3IP3A 3ZWVA 1Q3HA 3NHRA 5CA1F 2I4RA 5LM3A 1QQ6A 3DJFA 4DDVA 3ZWDA 4JXZA 5TE9A 1LDEA 3PG5A 2C07A 3LY9A 2IXGA 5BUSA 1WMBA 1G63A 4EY3A 1ZX1A 5IH7A 1U6KA 2GZ3A 4KWTA 4UTXA 1YMVA 4P7JA 4ZCTA 2XECA 5FL3A 1Q77A 5FWNA 3SVLA 2Q2QA 4XIFA 3CISA 4P1ZA 3CUEF 2C82A 5IF9A 3CRNA 4UHCA 3C6ZA 2AJ8A 3URMA 3LMKA 4BLWA 3DH0A 4GPAA 2VZ9A 1N6KA 3GCDA 2OV3A 1PL7A 4MWOA 4D8UA 2VAXA 3CH4B 2V5UA 2V5VA 1J1ZA 1UFRA 1QP8A 1U9CA 4PVCA 1U28C 4R1PA 4BFZA 3VHQA 1UOOA 3KQHA 4OATA 1QKIA 5T64A 3WGKA 1TAGA 2V54A 2UYQA 4WOJA 3GJQA 2FUCA 3Q11A 4HGRA 2A9RA 3KTAB 3N6XA 3RKUA 2CLKB 3NM5A 3ZXYA 3N59A 2VBCA 3DL0A 3UICA 3S2YA 5KNDD 3VPHA 1G6OA 1GARA 2WYWA 3OLZA 3RGGA 1X1QA 1QCZA 3HQ4O 1KZ4A 1E9AA 1NG1A 3CLKA 3U40A 4G0WA 2D0PB 1VL6A 3AHEA 4MX8A 2PWBA 3G5MA 3THXA 1G8JA 3T3NA 1VMIA 2QJTA 5BWNA 3ZIDA 4D3FA 1DBPA 5A5GA 4LXQA 2QP9X 3G1WA 3OEYA 3T54A 2X0NA 1SELA 3GWZA 2PUWA 2RONA 1V7CA 1CULC 3JQGB 3TM5A 3PDJA 5HMLA 3O1HB 5IVDA 2ZUUA 4AU1A 4KQCA 4Q7MB 4XR4A 3E03A 4DMCA 1VHDA 2OENG 4PW0A 4XLLA 3UK2A 4O4HF 1AB5A 3H8WA 4ANFA 1CIVA 3E22B 2WF8A 3COPA 2M2IA 4NCAA 1BXRA 1QF6A 1R8XA 3TRHA 5F76A 5HE9A 1WEKA 4CUZA 1BJTA 3UOAB 4DLXA 4Q9DA 4IHQA 5EXXA 5KQSA 2VA8A 1VMAA 4JJ4A 1LKZA 1CVIA 4QM6A 1WO8A 2XNSA 1XDGA 2FFJA 3IIEA 3AL3A 1Z7YA 2JZOA 5HK8A 4XVCA 2WFLA 3GZJA 3Q3VA 2J6HA 4Z3KA 3DHWC 2HMYB 4FR0A 2C9BA 1XCOA 2QUKA 4FNGA 2WW8A 2CVQA 5AHOA 3K6SA 4GOOD 2VN8A 3B7PA 3PNLA 2J5KA 1E6LA 5BV7A 3TX6A 4RNCA 1X2BA 4TQAA 4UU1A 1ZH6A 3D4IA 1IMOA 1DJPA 3W79A 4BX9A 5I4IA 4G0PA 2C4HA 1I6WA 2DZDA 4F1JA 2VLBA 3UJPA 1X80B 2J7PD 1QQAA 3SYTA 3C24A 4B5LA 3MW8A 5DBIA 2JPDA 5BYKA 2WM2A 4PINA 5JALA 4X9XA 2J6BA 4K9DA 1AGPA 1O8CA 3L7CA 3NX4A 2Y76A 1RKQA 4K26A 2NU8A 3O7MA 4HEA6 4OM7A 2CWDA 3AFNA 3OU7A 3ZDFA 4W1SA 1NUTA 1DINA 1E1NA 1ZJ5A 3RTGA 4I3GA 2CUNA 2VSXA 1H2YA 1KDPA 4PRLA 2AHRA 4WXHA 4D3XA 1NF8A 2PGDA 5H82A 4EGFA 1WL8A 2PLFA 1WXEA 3F5SA 1T36B 4Q15A 4ZT7A 3EVTA 5J5VA 2QUZA 2QRHA 3AGQA 3KUUA 3NC0C 3VH2A 3WC4A 4C9BA 2EERA 1RZRD 2RGNA 4BX3A 1SZDA 2V7QA 1J8FA 5TSDA 3EFBA 3Q88A 4QOIA 3H5LA 3C2QA 2JLSA 5BQFA 3IURA 3W8EA 5EGNA 4A6DA 4BWVA 1E4OA 3KJIA 3HC7A 5BW8A 4JNCA 1RKUA 3ZW7A 3LQYA 3Q9LA 4W5JA 2QSUA 3PNSA 4G4JA 4PGMA 2J1LA 3RHFA 2K5UA 3TI9A 2VWPA 5LQMA 4IJMA 4M8LA 4EELA 3W5BA 4UBIA 2G4CA 2MYPA 1CDDA 2QRVB 3BMNB 2AG5A 3OKPA 4UUQA 3G7UA 3I4CA 1Y3IA 4DIDA 3UG7A 3H7AA 4FLEA 3UOWA 1IOVA 3GGPA 4BFTA 1YR1A 4FMPA 1XTKA 4LYEA 2IT1A 2Q3BA 3OFSA 5DX0A 4C3VA 2DUNA 2RB4A 4O3FA 2G1PA 4ZCSA 3AIIA 3SFZA 2ID7A 3I37X 5DTEA 2AZDA 3C3WA 4DIFA 5DM70 5IYZA 1CUWA 1XLWA 1UIMA 4E2WA 1RXVA 3RLIA 1E2HA 1K7FB 1OWLA 4KIUA 3VR6A 4BMSA 1N5KA 1SMKA 2IL1A 4DLSA 1QGED 3OE5A 1QGOA 2IEAA 4DR5B 1A4IA 1CIJA 1XVLA 2WHPA 4XWKA 3QVXA 3R6TA 3DGEC 4NPCA 5KSZA 3HO1A 3MUEA 4EGQA 2CJWA 3WWCA 1N1DA 5TJ9A 4G5HA 3EN0A 1KIFA 3EZLA 3SQWA 3IDOA 4I4IA 4QOSA 5AKHA 4LRQA 3LDFA 1Z2OX 2H08A 3GNSA 1PEYA 1IXYA 3GY0A 3B1YA 1CVLA 2X7XA 1ES9A 3TE6A 3JQPA 1HE8B 1P0CA 2ATEA 1I6KA 2O20A 2P2LA 2QL5A 2VHYA 2X7JA 2CHFA 2Y4NA 3N3BC 1I5OA 1T29A 4OTZA 3VPDA 1X86B 3RJ5A 2JLYA 1IBKB 3O03A 3ETJA 5I51A 4I9GA 3WNBA 1GPJA 2XIQA 2YIMA 3HB7A 3JARA 1XTSA 2I34A 3KUDA 3M3DA 2J32A 2WICA 4BECA 1DC3A 2VNJA 3MYRA 1FNMA 2QROA 1K88A 3PT5A 4MDHA 1C4OA 2FVXA 5FTMA 4GKAA 4ZOAA 1UZNA 1MFPA 4NOKA 1X42A 1W0KD 2YWXA 4TMWA 4DYDA 1CRPA 1A2QA 2ERCA 1TEHA 1V35A 4MWBA 1S6YA 1X87A 3BK2A 5ALTA 3V4RA 2ESRA 3CEAA 3QV1A 2ZYGA 3P20A 4H59A 4HQFA 1AG9A 4Q1DA 4R05A 3G8BA 3LY7A 4JLAA 4XJVA 1MCZA 5ALSA 3AVYA 1SB9A 2FAXA 4QJIA 3FRIA 5DEOA 1TK9A 2H48A 3JZDA 3DOCA 2NPFA 2YZKA 3V7NA 1YJ5A 4FHDA 4TKMA 2FPIA 4AZSA 4D4MA 3GRRA 1I4WA 4WHMA 5AI6A 2PX5A 4EHIA 4G0OA 4H1UA 2PZFA 2DPGA 1U1DA 4IKPA 3I6QA 3HI4A 1E1DA 2WU8A 2QK4A 3VU1A 3KDPA 3HU5A 4OQXA 5A9SA 1VMDA 3V80A 2JARA 1CV2A 1O08A 3VRHA 3ZZTA 3VOSA 5BQ3A 2AXQA 5DHAA 2GUWA 2XRFA 3JU3A 4A15A 4NNJA 4HFJA 1JHOA 3FOFC 3BMOA 2ZTSA 3SIRA 1N33B 2WIBA 4TTIA 4RMNA 4KPUB 3OZFA 3HADA 4HP8A 1NXXA 1PDWA 2ASEA 2R4TA 3BGSA 3C1UA 4YT5A 4WLNA 4A1OA 4IF6A 2SBTA 3LF2A 4NESA 4F3YA 4JHXA 1U4SA 4HDRB 4ENWA 1Y8QB 2C9DA 2R4QA 1OU0A 3AJ8A 4C7MA 4MQEA 3VVMA 2DPXA 3O3MB 2ZBQA 4MW1A 4RMHA 2JH3A 1CHNA 1JR3D 2OHIA 2PZBA 3P2JA 2JGJA 4IOMA 1O94C 4HYTA 1Z36A 4JLDA 5EPEA 2G06A 4E1BA 3VNVA 4QBTA 1JDPA 5KNDH 2WQ6A 2FSGA 2CW5A 3KJQA 3TLJA 1G55A 4IH4A 1O97D 4OJYA 2Q4RA 2R5WA 1O96A 4RA6B 3WK4A 4C1BA 1CB7A 2NZVG 5BNZA 1DHRA 5GJBA 1JG1A 1IC6A 2XA9A 1CUBA 2PQMA 3JYPA 4J75A 4KMOA 4Q12A 3FUTA 1C3EA 3H2ZA 3RYCA 1ZD3A 2MSDB 4E2YA 4DEYA 1P4RA 3DZDA 1FJGB 3QYPA 2FTKE 4U0KA 3M2TA 4LYYA 2GETA 2XNDD 1KI4A 3BC1A 2IGTA 1E5LA 3DDNA 3MRXA 3Q4GA 1N2CA 2XITA 4RE5A 4ZANA 2WHEA 1GXSB 2V0CA 3OWHA 4XAQA 1ECGA 1N6LA 1WTCA 3BE4A 4BMCA 5L7YA 3U4HA 1H2FA 2PL1A 1U7XA 4TL6A 3RS2A 1S2IA 4B80A 1P2TA 1QXSA 2DAPA 2ZYDA 1IUOA 2KLHA 2MMGA 2X8WA 5D3MB 1NOIA 4RD2A 1N2IA 4MV0A 2ZIGA 2FRXA 3QXSA 1EEHA 4J43A 3II6X 3DE3X 4EW2A 4F9EA 2WA2A 1A0OA 1EE2A 5AI9A 4W1PA 2PV7A 1LDMA 1M34A 5BW6B 4HT3B 2JJ8A 3O91A 5JJCA 1XPUA 1WPXA 3LXXA 2ETVA 4MGKR 1ECJA 1L5MA 1W29A 2O2CA 1AQ6A 3TG2A 3AL0C 3PC4A 2WJIA 3PGVA 1YRAA 4CL0A 4CIAA 5E95A 1XP8A 1J2JA 2JCSA 5H16A 1ZI9A 1CDZA 1S96A 4QT0A 1W44A 2DX7A 1IDOA 4TN1A 1U9JA 2GAOA 3V00A 3W4IA 3GBSA 4MWCA 4P4UA 4MV9A 5B4UA 2NO9A 4OVKA 4ZCMA 5CUQA 1DADA 1HM5A 4I7EA 3RYIA 2NWQA 3LD9A 4ZODA 1V0JA 1ZGZA 3ZPXA 2ZB4A 1OR8A 1EHYA 2BKLA 2R6ZA 2YWEA 3SYKA 3ZV4A 5JVDA 3WSWA 1M1NB 1GY8A 2PUDA 2E4WA 3HEAA 1OTXA 1OC4A 2RCNA 3FTPA 2EQAA 1H6AA 2LTAA 1TLLA 3IAS1 2YY6A 3RPEA 1KYTA 4HGYA 3SF0A 1UAGA 5AK3A 3TUIC 2XWSA 3ZNPA 1W2GA 4ER6A 3RVNA 4Y7DA 4MDEA 1PT6A 3DTYA 2M6RA 2Q50A 4HSGA 3CCCA 4J7XA 1CC1S 1VJCA 3OM9A 5CCDA 4BP8A 4ROSA 4BV8A 1E6EA 1PWYE 3G8AA 3H2BA 3KSRA 4OQEA 2F90A 2OD7A 5E9WA 1U0LA 1QRTA 1V1RA 3R5SA 3WFZA 1ML4A 5C8XA 4G9EA 1Q57A 2VBIA 5FUMA 5K8TA 2OUKA 3GNLA 2X58A 3HG7A 1DLIA 1GNSA 1YV9A 2XH8A 4WNAA 5EHNA 4LI0A 4F5WA 3CVJA 2WWYA 1G8HA 2GR9A 3GDOA 3UG6A 1YJAA 2VHEA 5K3SA 3ZC3A 2AR7A 2KMLA 3J81A 2BFNA 3QJGA 4JVOA 2I2BA 3FGOA 4IYJA 4BDSA 1PR3A 1HKHA 1RWPA 4BP3A 3LF1A 3REOA 4AZ0A 1L4HA 1NBWB 1VOTA 1NP7A 3ASVA 5DT9A 1PX2A 3BXHA 1UWLA 1Q14A 3CLRC 3IUPA 3PZRA 5TMBA 4MGIR 5IXJA 5D87A 3QUTA 1J0BA 2D00A 1JIUA 2Z3VA 3L1IA 5K5EA 5BN3A 3CZMA 2P9BA 4MV1A 4QVKA 2O1EA 4BZZA 4JZYA 1WKBA 1PG0A 1R4AA 4XA8A 1P2VA 2P69A 3R3YA 3H2IA 4NS4A 4QU8A 2PGOA 4KBFA 4YYZA 4EFNA 4X65B 3CUWA 5JQWA 5LC1A 1ZBDA 4ZOLA 1RJFA 1F3OA 4FB5A 1Y82A 4LV6A 3ZD6A 4OHKA 1T2FA 1DXOA 4BLUA 4N12A 2OHVA 2QTBA 1QOZA 4XB2A 5HIIA 5F23A 3H2SA 2ABWA 4BS9A 1GHTA 5HF6A 3IHTA 4DDWA 1OWMA 4FWBA 4BXOA 1YR3A 2QMOA 3FUWA 4AI6A 1KZ6A 1T2VA 3GYGA 1IRXA 4D4IA 5ESXA 4WCDA 3DMNA 1L5GB 1GILA 4LE2A 1JDUA 3ILYA 4RHTA 4UJ3A 5T67A 5BSFA 3T0IA 4OOEA 5JOQA 3VO2A 2D5IA 2HEIA 3MWLA 4MLZA 3SS9X 1ONBA 4CL8A 5ALJA 3E9MA 1EUCA 2H11A 3N0VA 4F04A 2C31A 1YCGA 1DZIA 4OHCA 1T8WA 7AT1A 2EHDA 3BWXA 3AY7A 2JG3A 5LNK6 3W04A 2E49A 3KYBA 2CLCX 1LUAA 4AL4A 5DNCA 3UAZA 1F06A 2F9LA 4NLLA 4CFZA 2J0UA 1ULUA 4L08A 1LRKA 2QMQA 1ZUWA 1OWNA 4JSRA 4WEQA 4YGYA 1Y4ZA 1K7SN 1T1SA 1OXXK 1J0AA 1SKYE 1U02A 2EKPA 3VI3B 4E03A 2Q3LA 2LCFA 5E2AA 4X6LA 3G1TA 2FZVA 1K7EB 5IDYA 2OZLA 1ZOPA 1QNFA 2JZCA 3AKEA 4WNCA 2B8WA 3B1KA 3F3KA 1SBHA 4LXHA 1J90A 4AJ2A 1KH3A 3DVAB 4P31A 5JZVA 1VQ1A 1XZ8A 5A4FS 1YA6A 1YFJA 4LOKA 5SY9A 2CF6A 4KTVE 2O4CA 4FQ8A 4NZZA 1GUBA 1SVKA 3TIGA 5B37A 3H1TA 4JP8A 3TQFA 1NW5A 1ZC3A 3NWJA 3RC3A 4DG9A 1JZSA 1VSTA 1NQVA 3L6RA 5LXTB 2I22A 1EX7A 2R4UA 1XD9A 4I55F 2PUGA 2OOKA 2WJZB 2WV7A 3LBHA 3R23A 4FC7A 4KFSA 3QEBZ 3UJ3X 2YN0A 1MBZA 3R0XA 3RROA 2V7QD 5GMOA 1JLLA 2JFYA 3D3WB 3H97A 1SC9A 2CLFB 3H83A 4TYPA 3VKUA 1QLHA 2D5AA 2PBFA 4NZYA 3HP1A 5HKAA 3DOOA 4PSKA 5LZ5A 4G5OA 2NYAA 5AW3A 1ZA2A 3LDAA 2VUHB 1U5AA 2AI1A 2FLKA 3HJAA 3PE4A 4WGFA 3S5UA 3Q72A 4LPKA 3CE9A 5IBCA 1TB4A 3L40A 4KFRA 1U6JA 3ROFA 4DCPA 3MT7A 3CZ9A 5DWDA 1RRCA 2ZULA 2PKWA 2VH2A 3PJDA 4LOIA 3OQMA 5BQ5A 3NBAA 3MC1A 1VHLA 3PWKA 1PBTA 2WF6A 3A2LA 4H3SA 1QQBA 4BP9A 3NG1A 2FSVC 1GADO 2F8LA 5K4HA 3VR6D 3ZIAD 4AUNA 5B58C 1BA3A 2X2FA 3EQ2A 2GAIA 1G6Q1 1JHXA 1UM9A 1QFMA 2OGTA 2QYTA 4OBBA 4XCXA 2EFYA 5TB5A 3GWGA 5I3ZA 4WECA 1R6AA 4F9GA 3D8UA 2E0IA 1IQ0A 3N07A 2B82A 1EFKA 2P9CA 2X41A 4QPNA 1GZDA 1ZRHA 4QXMA 4UAUA 3THXB 5CB8A 1U3UA 1N92A 2WU1A 3LUBA 1Y1TA 2MHCA 3ABIA 3D0RA 1RXSA 2OV1A 2OXCA 3SM3A 1H4SA 5IT9A 3IB3A 3U44A 1NUQA 2R25B 4GZMA 4JROA 2DCMA 4JJAA 3CWCA 3OOEA 4MKGA 1SQFA 1HDEA 1K98A 1KJIA 4LCJA 2F17A 3WHIA 5DN6A 3ZX5A 4O0MA 3ZK9A 3TGWA 4MV6A 3VSBA 3R0JA 4TTJA 1O4WA 1EVYA 1I4LD 1GAEO 3DOHA 3E5MA 3LLUA 4R83A 2GTHA 3R7LA 4GXNA 5AK4A 1BXRB 3GRAA 1MNQA 1V7QA 1XRNA 2RGDA 3SSNA 4J9VA 4GOMD 3A3PA 3B5IA 1S8OA 4WW0A 3TL6A 4ZMSA 5IKMA 1ILWA 1ICEA 3Q7TA 5G1PA 2QVZX 1NBEA 2XTAA 1E3SA 2D5BA 2ZROA 4A8HA 2FSUA 5FBQB 2I8LA 1O9BA 4PYIA 3IBFA 3K09A 2WFLB 4YJKA 5HCUA 1WX1A 3FJ1A 4MYRA 3ADCA 2QV7A 3PHJA 3IBSA 3K6SB 4FZJA 1HSOA 1YB7A 3BUSA 1RJGA 3VR2A 5JJ5A 2YWFA 3EZYA 3ORHA 4BE4A 5HUHA 2O2DA 5FDFA 1ATIA 2OXIA 5I7OA 3RJZA 4NY1A 1PR9A 2J4FA 5CK5A 4TTSA 4EHAA 3ZOZA 1L5QA 3R0VA 5C2JB 1DQSA 2DMRA 3A6FA 3U7FB 2XE6A 1WKCA 3L92A 4C7VA 1MC5A 3AX6A 4E5NA 1E5QA 2C2HA 2X5XA 3E9RA 3TR5A 5KNLA 1NF2A 3O0TA 5LU9A 2IEYA 4V0NA 3G17A 3H3XA 3L7OA 2B9VA 2NU8B 1A5SB 2JGIA 1X8LA 3Q98A 3D0KA 1OH7A 4DCGA 2GZMA 1II9A 7ABPA 3ESYA 4L8VA 1ISGA 1WW8A 3N8DA 2GM3A 3OTWA 3ZWWA 4EW3A 2FEXA 3L0CA 3DOJA 4Q4CA 2AD1A 1EB9A 1U80A 2AL7A 2VP4A 4YUAA 4CVNA 2PS1A 3NDRA 3ED5A 3MCWA 1KYYA 3ORFA 3X2EA 2QB5A 2F8SA 5EVCA 3VKVA 2H29A 2J3MA 4A82A 1Z3CA 4KPEC 1YU9A 2WIDA 4OMFG 3QW4B 3SBDA 5HK9A 2AWOA 2D2FA 2VT7A 5FQOA 5HXAA 2ZSEA 5I7VA 3R76A 1NW7A 1BRMA 2E48A 3CLTD 5BW4A 4XQ9A 2VF8A 2ZITA 1ENOA 1N8NA 2VWQA 4HZGA 4JFRA 3S28A 2DLCX 3KU1A 3PL1A 1QHYA 4LRTB 3BFXA 2E1RA 4G8CA 4JB8A 4MB6A 5J2UB 2IZZA 4D3ZA 3CIFA 1KVUA 1DWQA 2Q45A 3G6WA 1RZVA 1ZWLA 1SEVA 3DEFA 5FO1A 1L4KA 2SHKA 1P33A 2GK3A 2Z5LA 4ZK6A 3COVA 2F59A 2QVCA 1GO2A 2HGSA 3TO5A 1W5AA 4JQZA 1CJCA 2ZR8A 4PQFA 3A9SA 1QBKC 1JA1A 4PZLA 5IYZB 3O4IA 4FKBA 1NVVR 1ZZEA 3IEPA 4MW5A 4NJMA 1UBSB 5FL7A 3MS2A 5AK0A 1E59A 3UK1A 3VR4A 2JJYA 4OQPA 5KS2A 5L3QB 3QOYA 1N0WA 5EZQA 1BFUA 2HPVA 1YK0A 3ZTYA 2R3SA 1ZOSA 5LQAA 4NZNA 2CVOA 2QM3A 3F1KA 3JYOA 2RGYA 4JT9A 3OC6A 3VSDA 1SVSA 2X5NA 3L46A 3ZG6A 4EMBA 1U1IA 1H9CA 2WHPB 5CMLA 4P22A 3SNHA 3KETA 4IKOA 2YXDA 2CJWB 1QR2A 2FW1A 4PC2A 4WH0A 1ENYA 3ENKA 2JD2A 2IYRA 1S8FA 5CLFA 5TV2A 4F2HA 2XX3A 4KNWA 2B0JA 5TS2A 4BAUA 4E4RA 4ER5A 2HF7A 4ZK2A 5IFLA 4AJJA 5JSQA 3EZ7A 1ZCFA 2R8ZA 3GFTA 1CY1A 1UQRA 4O2LA 3MPUA 3UV6A 4EEKA 3N8KA 5JZBA 1IVSA 2FQYA 1EM8A 1JQBA 1W34A 2VNHA 2YHUA 3B3FA 5KINB 1J5EB 2JS7A 3DAFA 4MPTA 3IXMA 1BH2A 4MIYA 5C8DA 4JYCA 4CLRA 3SY8A 3WAGA 1H23A 4HADA 4NSNA 3KD3A 3JARB 2W2XA 3M3PA 2QVXX 2B98A 3H0KA 5K0BA 2FQQA 3L9XA 3OTQA 4H17A 4EG1A 3LWNA 1V48A 1T34A 2HT1A 2D13A 1V26A 3DL2A 3V7WA 2G5PA 1USWA 5IULC 3OOSA 3AI2A 4DM4A 5E6RA 2QX7A 1CJKC 1P5RA 4JVSB 1KHTA 2AN1A 1M1XB 3H2KA 5EA2A 1G291 2GPBA 4NZPA 4YP0A 3GLFE 2GTPA 2IPLA 3DFKA 1VL8A 4X1YB 1XQ9A 1WXXA 1XTPA 2SKEA 4I14A 1FTWA 1H0HA 5B4TA 4DR7B 1REQA 3LHKA 5CDHA 3L8GA 5H1YA 1Y5NA 2Y2UA 2Z2YA 4B7AA 1WVMA 1QJCA 3BMQA 3S44A 5KQGA 2DC1A 5IK2A 4F12A 1RXIA 2FPIB 1V5WA 5JTTA 1DXQA 1A50B 3K4PA 3HCDA 1FMJA 1PLKA 3AVUA 3A36A 4RVNA 1MV8A 1VL5A 121PA 3VDNB 1S2MA 2GA8A 1JA0A 1G6HA 4E5DA 2FR0A 5JTUA 4BKUA 2PT6A 5A9SB 3C8DA 2FEKA 1E2JA 3H5VA 2G6TA 3GUVA 1QQ5A 3EF3A 1K86A 2ZM5A 2N9UA 2O1SA 2GHRA 1USUA 3IT1A 5KOJA 2PO7A 4ZVQA 2A67A 5IT4A 1P7ZA 1Z6TA 3KQWA 3BMOB 4LGYA 1F5NA 5DM60 3U61B 4LQLA 5CVUA 4KQIA 5H83A 4DTCA 2O8VA 4EBFA 4U7HA 1YZQA 5DDIP 5CIQA 3WLSA 4RK5A 4WKCA 3GLHA 3I23A 5KPDA 2QPTA 4MQEB 3PNKA 1P9LA 4KIFA 4MDYA 3BMCA 3MK31 2I1WA 4X00A 3CNEA 2J9ZB 1M2KA 1R8SA 1SC1A 4J0IA 2FXVA 4LNUA 2X4IA 4LWQA 3P0FA 5TDHA 1AS2A 1NXSA 5B7NA 3I2KA 1ZH4A 2BM0A 2BZSA 3P9PA 4K6HA 1YBHA 3G0BA 1V6CA 4OX9Y 2PYDA 3CX7A 2JVJA 2ECOA 1GG2A 1O96B 4MKFA 1IZ0A 3TLCA 5KYNA 1DUSA 1I2AA 5EGSA 4Z1MA 1SIOA 3UATA 3ZY3A 3TGPA 3ZE1B 1V3VA 1E8NA 4AN4A 3RYCB 3ROQA 4IMJB 4N5HX 3RUIA 1GGEA 1AS3A 1RRMA 2QVLA 1FXWA 2FJUA 4Q0MA 3ZJVA 1MGPA 4MXDA 3FDJA 1A4RA 4RJ2A 5FA5A 2YC2C 1AQJA 4M7RA 3NIWA 1RD4A 5F51A 3ZGYA 1LX7A 1N2CB 4OAOA 3E23A 3OIWA 4R1SA 3HTXA 3AEKA 2DETA 1LBSA 1JP7A 2W43A 3K0HA 1TKRA 2PLRA 1Q1EA 1JXQA 1WJGA 4GM0A 1RTTA 4YRFA 2DEUA 4QLOA 3STYA 2BH9A 6YASA 3AQIA 4FSXA 4QUEA 4RVSA 3OQVA 3O9ZA 2X3FA 1P4HA 4I36A 4K7JA 2P2NA 4EY8A 5K51A 1SHTX 2A9KA 1EA5A 1UKVY 3EC1A 4JU9A 4D3SA 3ZTWA 2VDQB 5BR4A 3TGLA 2BVNA 4CKBA 1M34B 2GERA 5A1TA 4Z9FA 2QQ5A 3BCSA 1T6ZA 3A0RB 3G0HA 3L77A 2QTLA 3VU9A 4ALNA 2DRIA 3B9BA 2Y0PA 4RL4A 2ZJOA 1QZXA 2AG8A 1ISIA 3N58A 3NS7A 4QL3A 2VF7A 2RHCA 5EXTA 3V97A 5IZCA 1D1TA 4BBZA 2PMFA 2NVOA 3BEDA 5BSVA 3DD5A 3D8HA 4YO8A 1ABEA 2H85A 2MR5A 3GLTA 3DDHA 1L6IA 3C3PA 4P2BA 3RYIB 4TV9A 3ZHXA 5JVDB 3B1JA 1SPXA 2IODA 2YVUA 1H6CA 2NU9A 2PT7A 3UXYA 1XALA 1G5FA 1P80A 3ZW8A 2HZBA 3HR7A 4I1UA 2QYHA 5BN4B 1ZNWA 4GOLD 5ALDA 3L1HA 2ATXA 2VDKB 3THYB 2XB8A 2I2AA 4C76A 3LLCA 3AEYA 2HHHB 1M2JA 1SFRA 4U0JA 4UUAA 2ORVA 1M66A 4O5OA 2O6HA 3ER9A 5BN5A 2ONCA 3AWDA 3M6AA 1TJ5A 4NMHA 3T7RA 4DA6A 5AUPB 1CWUA 1WMDA 3PGMA 1V1RB 2V6JA 2F1OA 1X77A 3P2OA 4Z7NB 3PRHA 4S1NA 3JWJA 3PUVA 4CM8A 4DNXA 3CWQA 4AN1A 4Q16A 2IDJA 2Y3IA 4Q9JA 5T4EA 4K9LA 5ES4B 5AVQA 2IDMA 1WLYA 2NM0A 3QVJA 4WNAB 8OHMA 2PUJA 4HJXA 5DBGA 1PW5A 3MVEA 1UINA 4J4HA 4D74A 3O2JA 2XXAA 4M99A 2AJTA 3O9VA 2OCKA 2ZRGA 4IH1A 3OQOA 2X8JA 3T5AA 10MHA 3VDMA 4FUQA 3BIFA 3LP8A 1F8FA 3CSUA 2P9FA 5JSYA 1SXJA 2GLTA 4Z9YA