4H18A

Three dimensional structure of corynomycoloyl tranferase c
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
335
structure length
311
Chain Sequence
AEVTPADVAGDTALSTISDSAPADEASAPRWRAHVNAADERVKEMWAYSPSMDRNVPLVVITADESAGPRPVIYLLNGGDGGEGAANWVMQTDVLDFYLEKNVNVVIPMEGKFSYYTDWVEENASLGGKQMWETFLVKELPGPLEEKLNTDGQRAIAGMSMSATTSLLFPQHFPGFYDAAASFSGCAATSSLLPWEYLKLTLDRGNATPEQMWGPRGGEYNIYNDALINSDKLRGTELYVSNASGLAGEWETGGIIEAATNKCTHDLKAKLDSAGIPADWNLRPTGTHSWGWWQDDLRGSWTTFARAFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cmt1
publication title Identification of a mycoloyl transferase selectively involved in o-acylation of polypeptides in corynebacteriales.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
total genus 119
structure length 311
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h18A00
1XZAA 1TCAA 4DGQA 1YAHA 5AM3A 1WB4A 1LPNA 1QIKA 4Y2TA 1TRHA 2GBIA 1YASA 4KAJA 1I6WA 2YASA 5HK8A 5CH5A 5BOVA 3F8SA 2ZSHA 1EINA 3WK6A 4OYYA 2WIGA 4HS9A 5E4YA 4KRYA 2XUKA 3WK7A 4PO3X 4EY8A 2OLEA 2XMCA 3N2ZB 3E0XA 3VDXA 3V1LA 4BATA 3M82A 1HLGA 1XLVA 2HHAA 2O7RA 2GYUA 3CN9A 2ORYA 5DYTA 3G9UA 5AP9A 3PUIA 4LXHA 4OPMA 3G0DA 3LS2A 1J07A 2PSDA 1QGED 5KWIA 4N5IX 3R41A 1LPPA 4EY5A 4MWTA 5FLKA 3ZLTA 3I2KA 1J2EA 1WB5A 3FYUB 1QTIA 4NVRA 1GPKA 2C5FA 2WIFA 1EDEA 1CUAA 5AI5A 5FP0A 4WFKA 5HQ3A 1EH5A 4WY8A 1THTA 4KRXA 1AX9A 4J7AA 4BVLA 1GZ7A 5EHZA 2VATA 1XQVA 3CCCA 2VF2A 4PQEA 4ZGBA 4KAFA 1LNSA 4E15A 5FOQA 4WDRA 3EQ9A 3E3AA 1L7QA 5JAPA 4FDMA 1BRTA 4L3WA 3G9XA 2PSHA 2HA7A 3BIXA 3STTA 1ZD3A 3B5EA 1EHYA 3KXPA 2OPHA 2J4FA 3ZPXA 5SYMA 2Y2UA 3HSSA 5DNUA 4ITVA 2XMDA 1BE0A 5E4JA 3H2KA 1FSSA 1K8QA 1DX4A 3WKEA 1N1MA 3PE6A 5AM1A 2XUQA 2XB6A 1HQDA 3I2JA 5ALXA 2XLCA 1UXOA 2PPLA 1SCKA 4QDXA 4Y2VA 5ALEA 5ALHA 4LYDA 2JGIA 1E8DA 1QFSA 4IHAA 2EDAA 4IH1A 5K3AA 4H7IA 1EXWA 1WHSA 4BP8A 1A8UA 3D7RA 5A2GA 1LBSA 4N8EA 5DTJA 5HZGA 1CPYA 1ISPA 1KU0A 4EA6A 3I2IA 2QM0A 2WFMA 5HK9A 2I78A 4X92A 1CQWA 3WKAA 1N5RA 2B4KA 5HF6A 4X6UA 4KE7A 2HA3A 5HF9A 3D2AA 5A6VA 1QTRA 3C6ZA 2WG1A 4AZ0A 5A71A 4LKOA 2HL6A 2ZYRA 3DL4A 1ETHA 1CUUA 3DYVA 3I28A 2OXEA 4J0KA 4J0IA 2WHPB 1W1IA 1QLWA 3FVRA 4IH4A 3WWDA 4BC1A 4XX1A 2WIKA 1CIJA 2ACKA 1IUOA 1UK6A 1NU8A 5CT5A 5LZ9A 4OB8A 3W9UA 3WWEA 4DLNA 4L9AA 3DOIA 4J3JA 1YSCA 1LPAB 5JIBA 4C87A 4B85A 4KR0A 3P2MA 2QR5A 3Q8WA 4H7DA 3ZV7A 1K5PA 1AMNA 3SX4A 1HL7A 1LPSA 3VXKA 1YAJA 1VLQA 5T4FA 3C70A 1X2BA 4BRZA 5AOCA 1XQXA 2XUGA 4X90A 5ALZA 4Y2PA 2QUBA 4TVKA 3D2BA 2PSJA 3DL7A 1XRNA 3FAKA 4PF1A 1BCRA 5J3JA 1XRRA 1AC5A 3W05A 3WK4A 2HFKA 4P93A 2WIDA 1W4LA 5DJ5A 4Y2UA 4OUKX 5CH8A 3H1AA 3SC2A 5D3KA 4AMZA 2WILA 2VTVA 4J0GA 5C8VA 4QE3A 5AOBA 3S2ZA 3BJMA 3TRDA 1OILA 4CCWA 1DU4A 3IBTA 4GBGA 4OB6A 5AK4A 3OOSA 5IKXA 4P08A 5C7YA 4ROTA 1JU3A 1DWQA 4BCCA 1XZLA 4BCDA 3L1IA 3G9TA 1UKCA 4B80A 1L7RA 3GZJA 1MNAA 2XMGA 1GKLA 1E8NA 1CUYA 4AQDA 5DYWA 4UHHA 1ODCA 1FFAA 3UUEA 2CBGA 4MXDA 1CUIA 4G1FA 4X95A 1XZKA 2XUPA 4EB0A 4Q34A 4LXGA 4J0DA 3DCNA 5I9IA 1U65A 1ZD2P 2ONCA 5HFAA 4CIAA 2WQZA 1E66A 4B9AA 2WKWA 1DQYA 1CUJA 2B9VA 3ANSA 1QIEA 4QWMA 2GZRA 3C43A 1MAAA 1VJ5A 2QXUA 1LBTA 1E8MA 1JMKC 2O2GA 3G0BA 2YYSA 4GHWA 4U2DA 1JMYA 1AZWA 5HF8A 1VZ2A 4KJXA 1O6FA 2CZQA 3DDUA 4HVTA 3D2CA 5D7BA 2AJBA 5AKKA 3YASA 3WK9A 3N0TA 2PVSA 1VA4A 2BUAA 3NOXA 3AUKA 4X91A 3R0VA 4OU4A 5EIHA 6YASA 2ZYIA 3I6YA 3HLKA 2DFPA 3FSGA 3PF9A 2E3JA 4PSCA 3FBWA 1UFOA 2QJWA 5C8XA 3F98A 4Q82A 2C0QA 1PFQA 2HADA 4RE6A 1ZICA 4DYHA 4KYVA 3PI6A 4X85A 3V9AA 3FNBA 3VVLA 2XUHA 5LZ2A 3A2MA 2XMSA 4E14A 1AKNA 3EBLA 3EF3A 4YX9A 3OURA 1H2XA 4ZXFA 2O7VA 1ZI6A 4F21A 1CUWA 3LLCA 4GEGA 1GXSA 5K3FA 5AJHA 4FHZA 4X6YA 4B7ZA 3FLBA 4CG2A 1EVQA 1Q83A 4BVKA 3WI7A 3WL7A 2H9YA 2VT7A 5ALSA 3IULA 4Q3OA 4HXGA 2XUOA 2GBCA 5JADA 2Y6VA 1J06A 1QZ3A 5DLPA 4Y2SA 3FSGD 2DR0A 1DX6A 3STWA 2WFLA 5LZ4A 3NUZA 3C45A 4MEBA 4QDUA 4EY4A 2X76A 3IUNA 2CEKA 3U0VA 4IQ4A 3B3QA 4UBKA 5CT8A 3FCXA 2VQ6A 5AH0A 5ALMA 5K3DA 2XDWA 3LP5A 4PSDA 1IUPA 1QOZA 4K6GA 3HYSA 1LZLA 3HZOA 4QWWA 3I6MA 2H7YA 1LZKA 4BTLA 1H23A 3WWPA 4ARBA 2ZJ6A 3D0KA 2JF0A 5AKEA 5AKIA 3GUUA 3QZUA 1XZFA 1T2NA 4BAZA 4Y2YA 1YR2A 2HA5A 3I1IA 4KACA 2CUTA 5IVDA 1S8OA 2WJ4A 1Q0RA 2BUCA 3DS8A 5ALOA 1P0PA 3W06A 5CTAA 1F8UA 4WFIA 1MNQA 3CXUA 5AK6A 3W2TA 4J0JA 5AKHA 4C89A 2CB9A 3BF7A 1QO9A 3WIOA 1ZGCA 5LP1A 1EDBA 5AI0A 2XMZA 4J0HA 1K63A 5ALPA 3AINA 1XFDA 2ZYHA 4BBZA 2Q0XA 1R50A 1F0PA 4L72A 4QNNA 4BZWA 4S0XA 3BIWA 7YASA 3H2GA 1G42A 2J4CA 4H7FA 4CCYA 5HKAA 1CUGA 2H1IA 2YH2A 2PM8A 1MX9A 1U8EA 1A8SA 1VE7A 1EA5A 1NX9A 2LIPA 1E5TA 1LLFA 3D3NA 4LYEA 5JASA 1RYYA 4I4CA 3QBJA 4GI1A 3FYTA 1F0NA 1B6GA 1QFMA 4DNOA 5ALTA 4BCBA 5CXXA 3ZLVA 1TKRA 3R3UA 3JYHA 5AM0A 2OQIA 3C8HA 1GQSA 2GYVA 2DQZA 4UPDA 3D5EA 3O0DA 4C4YA 1C7JA 4CG3A 5FV4A 2Z5GA 4WDQA 5CT9A 3O4IA 4WFJA 3GELA 3G8YA 1UOPA 4W63A 1GPLA 4EBBA 4ZWNA 3RARA 3NWOA 3H19A 4DM7A 1TK3A 2RI6A 3WK8A 5ALYA 3QM1A 4X6XA 2NW6A 4BZZA 1DT3A 3WWCA 3C6YA 1KU6A 1QIGA 1A88A 4Q3KA 5DWDA 3VVMA 2D5LA 3BWXA 2QVBA 3MUNA 4U2FA 5JALA 2PSFA 1ZIXA 3O9MA 4FFVA 1CLEA 5IVIA 1ORVA 1YB6A 2Y6UA 4YPVA 4HTAA 3JW8A 2QZPA 5AKZA 3M83A 4QA9A 5D6OA 2OQVA 4MYDA 3KSRA 5JZBA 2PKYX 5JANA 3C6BA 3TGLA 3W04A 2ZVDA 3WZMA 4AN0A 4GLBA 3DLTA 4BE9A 1L7AA 2JIDA 3C6XA 1UK7A 1ZI8A 2XUDA 5AIAA 3K9BA 4F5ZA 3GROA 3H1BA 3D59A 2K2QB 2OGSA 4G4IA 4ZREA 3ZLUA 2ROQA 1R4ZA 2C58A 1HPLA 2RIPA 3WQHA 2HU7A 3RM3A 1EDDA 4MEAA 3D4LA 3PICA 4UFNA 2WFZA 3R3WA 1RP1A 3AJAA 4UHBA 3DOHA 4G5XA 1H2YA 3WA6A 3TEJA 4DNQA 5AICA 1VXRA 2W22A 2R8BA 4X94A 3R3VA 1RWQA 4B0PA 3PFCA 3OC0A 4L0CA 2WLSA 1PV1A 4RGYA 4KAAA 5AKLA 3WL5A 2IIVA 1ZGBA 4KE6A 1F6WA 2DHDA 1BROA 5E2IA 2JGLA 4CFSA 3T52A 3AZQA 4TGLA 1JU4A 4QDTA 3PF8A 3WYNA 3STYA 4XIIA 2JEZA 1YS1X 2WJ6A 1W6RA 3SK0A 4FLEA 1DTEA 5K3BA 1IUNA 4JYPA 4BE4A 3HI4A 4O08A 4C4ZA 2WHRA 1QJ4A 5ALUA 2C5GA 4TPKA 1ORWA 4UHDA 1DWPA 2V98A 3QMWA 1UWCA 2HRQA 2XQGA 1AQLA 2G4LA 5AI6A 4NS4A 2VJAA 2OG1A 4B6GA 2HM7A 2AJLI 4OB7A 3NGMA 4BAUA 5EGNA 4ARAA 3WJ2A 1XZMA 1O6GA 4Y2JA 4U2EA 3KOOA 2ES4A 3H2JA 3O4HA 4PW0A 4M0MA 4RE5A 2ACEA 4KE9A 2OCLA 3VKFA 4CG1A 2QRUA 3WKDA 3ESBA 4X93A 3BE8A 3OM8A 4OD0A 2XMBA 3BXPA 1ZJ4A 3ESAA 4GECA 1QIDA 5ALLA 3O9VA 4W9RA 5CT4A 4B9EA 5AKXA 5JD5A 2C7BA 2H7XA 3X3HA 2IITA 3VJKA 5CXUA 2WM2A 4AZ3A 4HRYA 1XKLA 2XE4A 2WJ3A 3HC7A 4BRSA 1CUFA 1MU0A 1Y37A 3WL6A 2WSLA 3MGAA 1B41A 3EQ7A 1GQRA 2BJHA 5AM2A 1PJAA 4GW3A 5AK5A 3A6ZA 3C5WP 3DKRA 4AN1A 1EX9A 1Y7HA 3ESDA 1AGYA 5LYYA 2VA9A 5EI5A 4C88A 1C4XA 5AKGA 2WHQA 4BYMA 1LPMA 5K5EA 2I3DA 5A7HA 3I2FA 2ZYSA 3GFFA 1YCDA 5FRDA 1CUEA 2HIHA 1XROA 2XI4A 1ACJA 3FYUA 2OCIA 4OYLA 5D3ZA 2HRRA 3QMVA 1XQWA 5T4BA 3EIOA 5A7FA 4CI9A 5JATA 2PL5A 3HABA 4H77A 2J3QA 2Z8XA 1MPXA 4H7HA 1MO2A 2IX9A 1GGVA 3G0IA 4A23A 5K3EA 2ZJ7A 5CMLA 4B82A 3STVA 2XUIA 1XLUA 4RNCA 3AZOA 4M0FA 3Q0TA 2CMFA 3H18A 3GBSA 2BCEA 2OAEA 3LIPA 4K6KA 4D9JA 5AIBA 3R3YA 4FMPA 5HQ3B 5LZ8A 1QO7A 4FNMA 3V48A 1JT2A 3HACA 5ALRA 4Y2RA 1EK2A 3AZPA 1BEZA 4A5SA 5LZ7A 5SYNA 1CQZA 5LKAA 4G8DA 1XRQA 2WUFA 3DEAA 4C01A 4IH9A 5EHXA 1LPOA 2XMQA 4WY5A 3FLEA 2R11A 4J0CA 2QTBA 1VXOA 2G5PA 3LCRA 2ZJFA 1BU8A 3PFBA 3WJ1A 5DTIA 3IUQA 1DQZA 1WPXA 4N8SA 2JGEA 2WG0A 1JJFA 1G66A 3STUA 4JEIA 1UT6A 4UHFA 5ALFA 2FJPA 4E11A 1XZCA 1UZAA 5FPQA 3H2IA 4K2AA 1XZHA 1W52X 2V96A 1AURA 1TQHA 4OU5A 1C7IA 3HXKA 4DMCA 4QLAA 3E1GA 2C0PA 4UBLA 3ICVA 1MT3A 5JARA 3RKSA 1UKBA 4G8CA 2WHPA 4OCZA 3A2LA 4CIBA 1XZJA 3V1KA 2ZSIA 2WU3A 5FDFA 4FLMA 1VA5A 2OGTA 4HRXA 5LLSA 4DTCA 1Q0ZA 2GZSA 5LZ5A 4AO8A 1MJ5A 3PDCA 2RGUA 3S8YA 1SFRA 3IUMA 2BUBA 2OGZA 5IVKA 3FCYA 1QE3A 5BWBA 3AFIA 1MAHA 5HFNA 2Y2VA 3WYDA 1TAHA 4FLFA 3I1YA 4PV7A 4WJLA 1CVLA 5AK3A 5LKRA 2VJBA 2I03A 3FYUC 1R1DA 5LIPA 5IH7A 3DYIA 4Y7DA 1ACLA 2XQJA 4PNZA 1ODSA 2WUDA 2WUGA 3IDAA 4BTVA 5T4EA 4E46A 4RPCA 1ZOIA 1XZBA 3H0CA 5CRIA 3C87A 5BWCA 2VJCA 1GPNA 5CT6A 5F4ZA 1BN7A 1E89A 4Q1VA 4UUQA 5FKJA 1MX1A 2BAGA 2I3ZA 3H2HA 3C8DA 2PU7A 4Y9SA 2JGMA 5ISMA 4Y2QA 1QIIA 3R3ZA 2RHWA 4G9EA 4H18A 1VOTA 1XRPA 1IMJA 2VAVA 1WPRA 1WCYA 3IVMA 5HF5A 3QPAA 2PX6A 1TCBA 4YASA 4DMFA 5AO9A 4V2IA 3O4JA 1YS2X 4GDMA 4W1PA 3BDIA 4YK7A 4G9GA 5DNWA 1N5MA 3I6ZA 2RAUA 4BB0A 1AUOA 1K4YA 4AX4A 1IVYA 2JEYA 3RLIA 3DKKA 5AI9A 4MJ3A 1BEEA 5YASA 1KEZA 2QUAA 3G7NA 1Y7IA 1EB8A 4Y2XA 3ICWA 4UHEA 5C8ZA 3RK4A 4IO0A 3WKCA 5T4HA 3DQZA 3WWOA 2HA6A 3QPCA 1WB6A 2VAXA 4I19A 1QONA 3F97A 5AOAA 5DYYA 4DMHA 4U2BA 4AO6A 4ZV7A 2OCGA 4N8DA 5ALQA 1CEXA 2GYWA 5A62A 4BAGA 2BGNA 2FUKA 4EY6A 1UKAA 2BKLA 1CUXA 1BN6A 1XLWA 5AI8A 4B83A 1FFDA 2XT0A 3IA2A 3QPDA 4EHBA 4MYSA 5AKYA 2X8BA 4BDTA 4DMKA 4W1RA 2FX5A 1CV2A 1J1IA 2GBGA 5CURA 2XQKA 4FBLA 4AXBA 3LIIA 3F67A 2WTNA 1CUCA 2JGFA 4MWSA 2Z3ZA 5A7GA 5HCUA 2B20A 1VZ3A 5H3HA 1XZEA 3HEAA 4JH0A 4DIUA 3GA7A 1M33A 3JWEA 4UHCA 1WHTA 1TCCA 4DNFA 4FKBA 4UBJA 1ZD4A 1BS9A 1P0MA 4AO7A 4QZVA 3WMRA 1Q84A 3EQ8A 1A8QA 4UBOA 4H7JA 2QT9A 4N5HX 1UK8A 4Q05A 1R9NA 4EY7A 2H7CA 1SC9A 4KE8A 3IUJA 2JGJA 1A7UA 4JNCA 1TIBA 1T4MA 4H0CA 4X3CA 2XUAA 1JJBA 1SOMA 4XWGA 2QMQA 3M81A 4A16A 2DHCA 3F9CA 4X97A 1WM1A 4JUIA 2D0DA 1XZIA 2DSNA 3FWHA 3A70A 1ZI9A 2QKYA 3DD5A 4PSUA 4B81A 2BGRA 1XZDA 2PUHA 1EB9A 2XUJA 4C4XA 5ALNA 4QLOA 4H35A 3KWFA 2HU5A 4B0OA 3IIIA 4BP9A 4B84A 3AIOA 2PBLA 4U2GA 2JBWA 5K3FB 1NU6A 1CUDA 2YXPX 1W75A 3ILSA 4FWBA 4DSAA 4F60A 1R9MA 4XVCA 2JGKA 2P8SA 5CBKA 1BCSA 3ZI7A 5IVHA 1ZIYA 1H2ZA 3FVTA 1EK1A 3STXA 4X00A 1QIHA 2WFLB 3OG9A 5AM4A 1W76A 2HA2A 5JZSA 4H7EA 5EFZA 1U2EA 1XQYA 5I8PA 3M3DA 2Z3WA 3FLAA 1USWA 5KWJA 1G5FA 4FNGA 4ZRDA 1P0QA 2WU4A 3C5VA 1HDEA 1XRMA 2W6CX 2XMRA 3QH4A 5EHNA 4C6HA 3UUFA 5ALJA 2WTMA 3E4DA 5FXMA 5ALIA 4GXNA 4ZV9A 1N8SA 2WUEA 4Q3LA 2X5XA 4KEAA 4FTWA 2B61A 1WOMA 1K6EA 3QITA 1VE6A 3BF8A 1FFEA 3WA7A 1QIFA 4ETWA 3G0GA 5JD4A 2EEPA 1X70A 1MTZA 2CJPA 2DQYA 2G63A 2HFJA 4BVJA 3WKBA 1GT6A 4G8BA 2HA4A 1FFCA 3ESCA 3KDAA 1G4HA 1E3QA 2VEOA 3OPMA 4ZI5A 5KBYA 3MVEA 4J03A 4NZZA 3CCBA 2HU8A 1YA8A 5AM5A 3K6KA 1XZGA 5EHQA 1H2WA 3K2IA 1CUVA 3OTQA 4MQMA 1HKHA 5K3CA 5JD6A 3PUHA 5AI4A 4G4JA 3VJLA 3TJMA 4UBIA 4DSZA 3I2GA 3VISA 4MQLA 4P92A 3WZLA 4CCYB 1UK9A 2V9ZA 3BDVA 3IURA 4INZA 3H17A 5JZ9A 3L1HA 4P9NA 1R88A 3AIMA 1HBJA 5C81A 1SCQA 2DCMA 3AIKA 4Z49A 3WIBA 1LPBB 2O2HA 4LXIA 2GBFA 1ODTC 2Y1KA 2V97A 3R3XA 1R3DA 1P0IA 4X7BA 4HAIA 2HDWA 3V1MA 2PU5A 1ZJ5A 4HXEB 3HRHA 2Z8ZA 3DNMA 1QIMA 1CRLA 4UBNA 2AJ8A 1Z68A 2BFNA 4DNPA 5CW2A 1YA4A 3AILA 3V1NA 1H22A 3IB3A 4H7KA 4OSEA 2PUJA 3L1JA 2QS9A 1MN6A 3F96A 1CUZA 3G02A 4GWLA 4UFOA 5E4TA 1OCEA 1JFRA 2XQIA 1GKKA 1EVEA 2XQFA 3KWJA 3KD2A 5ALWA 2ECFA 2O2IA 1UOOA 4X71A 5ALVA 1LGYA 3BJRA 3A2NA 2QOEA 2UZ0A 5AKJA 2QXTA 1UOQA 1QIJA 3UMJA 5KREA 3HJUA 5I7UA 2C4HA 4QDOA 1U4NA 1THGA 3SWWA 5CH3A 4W1QA 1IZ8A 3QVMA 3ZWQA 1ZD5A 5FUMA 4I3FA 4G4GA 3O95A 4U2CA 1YB7A 1XRLA 4EUSA 2FJ0A 5FPPA 1D07A 1XKTA 5JAHA 2WIJA 3QMMA 3I2HA 1CFJA 3R40A 1MX5A 2VJDA 4NMWA 3BL8A 5HKBA 2EDCA 3DJYA 1DWOA 3QYJA 3O4GA 5EIEA 1CUBA 4FFWA 2OCKA 1JI3A 1DT5A 4BDSA 4EZIA 4AMYA 5ALDA 1JKMA 2RONA 3H04A 3U1TA 3ED1A 4HZGA 2VSQA 5JYCA 5JAUA 4LHEA 3ANTA 3WL8A 2AXEA 1CR6A 1FJ2A 4BC0A 4F0JA 2AJCA 4K5QA 2J3DA 2DHEA 1JJIA 2PSEA 1SCIA 4UFPA 1DINA 3G0CA 4JYMA 2RHTA 2QJRA 2G5TA 2OAGA 5DNVA 2CKMA 5EIAA 4AB1A 5ALKA 4FBMA 3WK5A 1IZ7A 3MUOA 1OXMA 3VJMA 5ALGA 5BV7A 2VT6A 3B12A 2WG2A 3WLAA 1EI9A 5ESRA 4QDZA 4QEKA 4WCVA 2XLBA 3T4UA 4K6HA 4M0EA 3G9ZA 2HA0A 4FOLA 1CUSA 1VKHA 4W1SA 4UBMA 1FFBA 5AHXA 3FOBA 1CUHA 5JAOA 4LIPD 3CN7A 1X2EA 3W9BA 2XUFA 4XJVA 4HXFB 2AJDA
chains in the Genus database with same CATH superfamily
2AOUB 4IVQA 3RAEC 1TCAA 4NHEA 4DGQA 4BQIA 4PSAA 1F2DA 4G36A 3UMYA 4YI5A 1QIKA 1SEVA 2EF1A 1CR4A 4KSYA 4MOWA 4GZ5A 3ZWAA 4EATA 2GBIA 1E9VA 2YVKA 3BEOA 1KS9A 4EUFA 5JWHA 1YZTA 1XAGA 4FVTA 3V4SA 5BN3A 1ZH2A 2QZ9A 5BOVA 4UOQA 2HYIC 3VTZA 3R6LA 1KE1A 1EINA 2CDNA 1DAKA 1U4SA 3IB6A 3P71T 1OZ0A 3RRBA 4IV8A 4BB6A 4W5NA 3B1ZA 1KWGA 1GUDA 2FEMA 3VR6A 4HYYA 2CCJA 2JHAA 3BRWD 1FZTA 4BIMA 1MAVA 5EMKA 1H69A 3H8WA 1XVUA 2OFWA 5FUXA 2OLEA 5CD9A 3SAJA 4YACA 2ADFA 2ZVPX 4DLXA 3WAJA 2D7DA 3NTUA 4RVGA 2VT3A 1QV6A 3H9JA 3V1LA 1VDZA 2X5NA 4LQ4A 1BX0A 1LFDB 2PFSA 4B4VA 2O8EB 2QLMA 3GIDA 5KI6A 2QLNA 5TQ0B 1J00A 3M82A 3WLQA 3LE8A 4EG7A 4FXOA 4QGGA 3ZH9B 3ZDAA 1JT9A 3ZUGA 1GA4A 1TF5A 3CN9A 3DE0X 4LOJA 4CEIB 4TYWA 1A4UA 3G9UA 4ER0A 3ST7A 1A2BA 4YRFA 1GARA 1W36B 5FI0B 3SXJA 1FDUA 4D9CA 2IS2A 4HGZA 4LXHA 4CODB 1W88A 1XDSA 1FX0A 2CLLB 4LGMA 4P31A 4OPMA 1EIWA 4GVLA 3D8RA 3BD8A 4ZCPA 4B6JA 4BMPB 2VWPA 1IY2A 1UP4A 4UNSA 1U0RA 4KQWA 2R68A 4ZO7A 1BW9B 1W5EA 3IJRA 5KWIA 1SXGA 4OBEA 3CVOA 2W58A 3QA3E 1Q0SA 3ICPA 1M2OA 4XGIA 3ZVRA 1SQ6A 1UAYA 4DF3A 1HTWA 5BMVB 3PWKA 3OCYA 3KKOA 2GEDA 2NYVA 1RZUA 3RU2A 3LPNA 1W9MA 3JPWA 4FI3C 4KQ6A 3B52X 2C07A 5A4AA 3DOJA 2ARKA 3PJEA 1H4TA 5LBIA 3SDSA 3PLNA 3WR5A 1QR2A 1J2EA 1WB5A 1UJBA 3FYUB 5ELMA 2TYSB 3EMVA 5GVRA 2VP0A 2ON6A 1YB5A 3HVUA 3IP7A 4MYTA 4L1KA 2XDQA 3GJ5A 1U9IA 3R0XA 3MS7A 1HEYA 5TPWB 3BWDD 5J4VA 3NBXX 2ACWA 2C5FA 2H16A 3DR5A 1UPFA 3OD5A 3UF0A 3V8NA 3CS3A 2REXB 2WIFA 3D1LA 3IP6A 4GM4A 5A0FA 3FETA 3SFTA 4X24A 4BQSA 1CUAA 1T0IA 3E0QA 6GPBA 5AI5A 5FP0A 2V6JA 3BMCA 3UFXA 2G1PA 1TUIA 2VNAA 1EH5A 3H7AA 1JLSA 3DHVA 3TZ6A 5SZIA 3AKDA 2HLDA 3VR6D 1R0XA 4MAFA 4ZZ1A 3I04A 2I55A 3BKWA 3VR1A 4BVLA 2X40A 2PVPA 5FL7A 1DKOA 3L0BA 3MUFA 1UC8A 3AJ9A 2AK3A 2VF2A 4LMRA 5G53C 2O5VA 3WP1B 1N57A 2OXRA 4WAUA 4CDRA 1GRVA 4ZGBA 1OFHA 7AT1A 3N9IA 3F5DA 3V8PA 2AMFA 1BSVA 2LDBA 4ZVKA 4PPYA 1Z4PX 2PS0A 5AVXA 4YRNA 3H87A 3CVVA 4DUZB 1L7QA 1UJ5A 1UT5A 4UVGA 3V4VB 4RYDA 5JAPA 2EZ4A 4FDMA 5F64A 1T4CB 3MD0A 1BRTA 2R7LA 2DWQA 4JYCA 1CT9A 3I4FA 5FOTA 5KC8A 2C7PA 2QTFA 2JBAB 2UUOA 3IHLA 3CZQA 4O2BB 3Q8LA 1KRXA 2ZWOA 1PR4A 4UHKA 3BIXA 3DZIA 4UEWA 5JLAA 3DFFA 1LX7A 4Q16A 2XOEA 2J9FA 2ZVQX 2JAOA 2OPHA 1S1CA 3EWNA 2B8NA 1CQXA 2Y2UA 4EHAA 3CKMA 5A4MS 1AS2A 3HSSA 5IANA 4HDMA 4MDEA 3L92A 2FAXA 5B1YA 1B3RA 2HXYA 3A0UA 3IX7A 4HUQA 1M6HA 4TV8B 3RRZA 2VHCA 2FR8C 2OOSA 3FFTA 2BPOA 4CM8A 1VG0B 3L8ZA 5E4JA 3DEZA 3COJA 3GZNA 4XRRA 3C5CA 5EL0A 4JLPA 4C9BA 3C14C 4JDPA 2XCRB 1RRMA 5BMVF 1DX4A 1OWPA 1RLMA 4Q3DA 1U2QA 1TYCA 3G2PA 5AJZA 4C6TA 3QLUA 1CYEA 3FWPA 1A9QA 1W44A 1N9ZA 2PPLA 3TQIA 4HNVA 1X1RA 2B6HA 2J3LA 3PR3A 1JQEA 3FPSA 4HWKA 3ZTWA 3KZNA 3H65A 3VNRA 4DREA 4Z7OB 1GFSA 2NU7B 2W4MA 1E0SA 5ALEA 5NULA 4EFLA 1WY5A 4F8EA 1U2TA 3RUCA 4PRZA 4IHAA 1DC7A 5DNCA 3F7TA 4P4TA 2HLDD 4QYSA 5F7ZA 1PTKA 1WHSA 2Q5EA 1RZ3A 1VKOA 2JH8A 1TZBA 3F7MA 1OWLA 3IHKA 2IYFA 1OI3A 3TGWA 2GZMA 4GMHA 1N6LA 5FL7D 3A3NA 1E98A 5CB0A 1EFHA 3WTBA 1NWHA 1RAFA 4ZQCB 4D41A 5IT4A 3B7WA 4NF2A 4FE7A 1HRDA 1Z5PA 1NQ5A 4W7HA 3TW8A 1M2JA 4UU0A 1CPYA 4PC3A 3RSGA 2O52A 1E4EA 4M1YA 3TF5A 4FGJA 4Z3OA 5BWMA 2ZE5A 4XDHA 3QEAZ 3BXXA 1B7GO 2I78A 4X92A 5F4BA 5CFLA 3B3JA 1MGOA 2YC4C 4MGEA 5CNJA 2IHYA 1LSOA 3UW1A 2FU5C 2GLXA 3NBKA 3WYAA 1TMGE 4X6UA 5FFNA 3B60A 3U4HA 2ODTX 4EKNB 4R81A 4AI6A 3QEMA 2EJTA 1DXYA 3U7HB 4JUCA 1VRCA 4KO3S 4O2BF 1YOVB 2RI0A 4HX9A 3U17A 5I4BA 4P7GA 5KX5A 2TMDA 3KZ1E 3IQZA 3M8KA 4HGOA 1KJNA 2X1HA 1QAMA 4KYUA 5A71A 4C4AA 1USUA 3JQ8B 4WLVA 1LBEA 1P0CA 1ADCA 2A9KA 2ZS9A 5AW3A 1WMEA 2V0GA 1IY1A 2RHDA 1I7SB 4W9NA 3I28A 1E9BA 4TV8F 3SHWA 1RM0A 2OXEA 2QWXA 4J0KA 1SQGA 1E9EA 1W29A 4FEEA 1W1IA 4K9SA 2P9GA 5DPMA 4US0R 1ISGA 5SZKB 2Q5JA 4LSMA 4OI4A 3K0HA 2G1KA 1MAWA 2WIKA 4Y7CA 2YYYA 4Q18A 1CIJA 1ZNXA 2UU9B 3C7AA 1NU8A 5CTJA 1XYYA 3ETHA 3M6VA 4ZO8A 3VDRA 1KH3A 3M2PA 3CX7A 3F74A 2O8FA 5PNTA 3O8CA 3ZVNA 2BFBB 4KWTA 4QATA 4YP6A 5FNZA 5JTUA 1C3OB 4BV3A 3MELA 2P0EA 1FUUA 2CCKA 3BQ9A 3ETCA 1AD2A 3PIDA 4JELA 5C9ZA 1NBOA 3OCXA 3IDZA 4NBWA 2WJGA 5EY5B 2ONKA 3JZMA 3RTGA 2QTRA 2CK3D 2JJ2A 3KCNA 1YTLA 3NB0A 1K5DA 4CMCA 4HH4A 1U2DC 2ZAOA 4BQFA 1Y6JA 3D3KA 5LMUB 5BWOA 4IILA 1C30B 1EWVA 2WWIA 1Z16A 2YFQA 3P4YA 4GQBA 3K9LA 4YRRA 5DF1A 3ZV7A 1XMOB 2PUGA 5K3OA 4WLEA 3HFJA 5H16A 4CCSA 1Q20A 1ZL2A 3DMHA 5HRAA 2ZW9A 3PKJA 1YMUA 2VTBB 3I42A 4I55B 2P2CA 1L4UA 1L5YA 3I1FA 2ZTLA 1YAJA 3ZHOA 3O5AA 2GAJA 3PJDA 1XMVA 1VLQA 1ZL0A 4AN4A 4BO7A 1LFAA 4PYOA 4QJ5A 5BW5A 2J85A 3QP9A 1BXZA 2JD0A 3F1KA 1EEHA 2PMFA 3GGJA 4MROA 3VR4A 3AEKB 5JY1A 3BG5A 3HA2A 2XOXA 1XQXA 2VRCA 4HS4A 4CUJA 2XUGA 4YAUA 2AKAB 2P91A 3A6PC 3EFOB 1L5VA 2RHOA 5TF0A 4Z5XA 2HUPA 3D2BA 5CEFA 4YCJA 3DAYA 4ZVLA 2GYYA 1GGMA 3DMFA 2O19A 4RQAA 1AHHA 4EJ2A 2Z2IA 4HLDA 1LNQA 2CLIB 1AC5A 3F8WA 4C7VA 1YK0A 3P1JA 2QN3A 4CMHA 1L4BA 3W05A 3WK6A 3ASVA 3RTDA 3LYLA 5A2QA 2LR0A 3NTXA 1WVMA 4QODA 2QUZA 2CLHB 3DDWA 3M5CA 3BD6A 1ZLYA 1AY0A 2QN7A 1S0UA 5B53A 4NYMQ 3NJRA 2B5WA 2BR5A 1VIAA 1R8QA 2ODPA 4I1IA 3H1AA 4OJQA 3KWLA 2V7VA 1AV6A 2HBQA 3KJGA 3P0FA 2ZUCA 2CXSA 3E03A 4KLAA 4PHTA 4J0GA 3HDGA 3HJRA 5C8VA 4N5DA 1ONPA 3DBHB 5AOBA 4ZHSA 3TRDA 5KU7A 3GUYA 3OT1B 5KYVA 1EFPB 1DU4A 1PCXA 1QRDA 2I2BA 1N7JA 3AWIA 3MCWA 2OBMA 3QNWA 4K3UA 4OB6A 5AK4A 5KYUB 1WSBA 4DB4A 3ZHRA 3OOSA 1QHIA 2B98A 2ZIWB 4I4TB 4P82A 5ES3A 5CX1A 2JJ2D 3GFBA 3H3JA 1JU3A 2HJWA 4QQFA 5CLHA 1DWQA 3A36A 4ZI7F 4RIHA 1UP7A 4NTZA 1IQUA 4OM7A 2IZOA 4HBGA 3WIVA 3ADDA 1XZLA 2F43A 3VPCA 5DHPA 1FSGA 4CT5A 1YR3A 1RLIA 3G9TA 4RHXA 3SSAA 4EDFA 4OMCA 3WSTA 5JMWA 5EP4A 2PH1A 2ABWA 3UUWA 4D9NA 2DTDA 4D4KA 4RIIA 3DVSX 4KTTE 1NRJB 2EP5A 4AQDA 4P32A 1DQSA 1VMDA 4COKA 3M4JA 2ZB8A 3QEJA 1GEGA 2H5LA 3VR4D 3QPWA 3GLFB 1RXVA 3AH8A 1J22A 3DMNA 5F78A 1N7IA 2OO7A 3QUQA 1CUIA 3SMQA 2VRCD 4RJKA 1IY0A 2UXDB 3HP1A 4L8GA 5COQA 2Q3LA 3N07A 4IL5A 4XGQA 3AEXA 2XUPA 4CEJA 3K70D 5CM2Z 4EX6A 1NV9A 5IBCA 2GO1A 2JD2A 3EUFA 4ISBA 2VXOA 5BUQA 1ZH4A 2ONCA 1JE0A 1I1OA 5D8DA 5HFAA 1OB2A 2G0AA 2WQZA 1E66A 4B9AA 1CIVA 3EVNA 1KBQA 3ABRB 3NBMA 1OAOC 4GEKA 3QVWA 4KDEA 2H48A 4AJPA 4AKIA 2WT8A 5LOVB 1CUJA 2IEZA 3KL2A 4LJKA 2QMOA 3WMXA 4YRPA 2Z8YM 2JG3A 3UPTA 3HZRA 1VHQA 3REOA 2EV9A 4LV5B 4BHTA 1NUUA 3D64A 5KOHA 2I0FA 4CZ2A 3CF2A 5EJ4A 3CZPA 2IYYA 1JHYA 1BE1A 1QG6A 1KFCB 1ODKA 1OI7A 3GJQA 2BDUA 1YIAA 1I3OA 3I01M 3UGTA 3FTFA 4J07A 1JMKC 2J8ZA 4U9UA 4ZFNA 2XIJA 4BNXA 1L5ZA 2MR5A 2CFIA 2HRDA 3QFHA 1SCDA 4YP1A 2CMKA 3CR3C 3G0BA 1AQYA 2YYSA 3GNSA 3BSWA 3TD9A 1ESZA 2AEFA 1WUYA 2W93A 3DLCA 4YP5A 2PFKA 5AYVA 4YREA 2W0SA 4BX9A 5CA1B 2ZM6B 1M7BA 3G59A 3ASUA 4G56A 3TSYA 4EGCB 1AKRA 1R0LA 3OQIA 3X1WA 3WS7A 1HG1A 1OY1A 2ZJBA 4RTLA 3ZWYA 2P9YA 3G8AA 2FEKA 1O6FA 1THMA 5EN4A 4CVNA 2CZQA 5BVHB 2OZPA 2QX9A 3REQB 5J4KA 2N1MA 4R5HA 3T3DA 4EECA 4HDRA 1KJ9A 1L8OA 1OD6A 2FYTA 1S8NA 4EVRA 2QY9A 4QXAA 4TUYA 3T3GA 5BXQC 2I33A 3WOHA 3VMMA 2FEAA 1HNWB 1YV9A 1ZITA 4MGZR 2ZIUB 4QVKA 4UNRA 4JLWA 1J5XA 3VH4A 2BFCA 2BUAA 4P4LA 2QL9A 4LI0A 3SU8A 3U1VA 1Z6ZA 4WXEA 4LRXA 3D5QA 4WA7A 5J9FA 3FM9A 2P5YA 4XFDA 1W4RA 3HLKA 4HTFB 2QUHA 5CCXA 1SD5A 1DEOA 2PXAA 3FCEA 3PNSA 4KP7A 3EDYA 4NJEA 3KR1A 1TZKA 1YL6A 1A9ZA 3HN2A 2PGDA 4O63O 1OREA 4M37A 3DG9A 2WPNA 4L9RA 5ICGA 3UHPA 1KZ9A 3QU2A 2ZAMA 1JPUA 3IUBA 3VAZA 3ROMA 4C1BA 5C8XA 4JKOA 1QANA 3FMVA 5JSFA 2P9TA 3AESB 4BL5A 2BHSA 3ZDZB 2IBSA 2PKQO 3F98A 1B6TA 1VLVA 3LL7A 1ST3A 4NFYA 1KHHA 5KYWA 5LOVF 1F3OA 1DDOA 1TLTA 3VFDA 1HQKA 2I6QA 3ORSA 4HPWA 1S6YA 1L5QA 3LC0A 3LDGA 4FGUA 3RJ5A 1RRKA 3ET4A 3TIIA 2WC1A 2ZI6A 1PD1A 3HCEA 4ZVMA 4X85A 1GQYA 1MIOA 4PBTA 2WB2A 3V4LA 4W8HA 3P9PA 2FUEA 5HJ5A 5I7EA 2G67A 1E0JA 5FA8A 3RGGA 2ZRGA 3ANYB 4PAWA 4WIAA 1OKKA 1M8FA 3BKXA 3HA7A 2C2WA 3NHYA 1D9ZA 1FRFS 2D1TA 1V7PC 1ZJWA 5K0SA 2FZWA 1ZVQA 2PO5A 1HORA 2GKGA 1V16A 3EBLA 4XGKA 4XIYA 2PUBA 1QYVA 1PFWA 3MCAA 4LPKA 3HGQA 4Z51A 3QKSA 4RJJA 1H2XA 3TWOA 2C7VA 2O7VA 4ZXFA 2R97A 2YWRA 2NXNA 2ZUWA 1P8JA 4Y1GA 4B87A 4DLZA 4B8WA 4GEGA 4QPNA 5C32A 3NTQA 4YRMA 3A9UA 4ZTUB 1STOA 3N1UA 4JS0A 2Q41A 2PLRA 2WTUA 1HOTA 1A50B 3ENZA 4DVJA 3D2LA 1O95A 4HQ0A 4B7ZA 3V6MA 2AN1A 1WMSA 3CUWA 3LU1A 1L5MA 3OX4A 4O1IA 5ECDA 3U3DA 4FCCA 3WL7A 5F1PA 5ALSA 1QPZA 3EPLA 3BMNB 3SJUA 1K89A 1AXRA 1RZVA 1YS4A 3EQ6A 5EWMB 3ZQUA 3K72B 2HPVA 5GJBA 2F64A 2G4VA 2GAIA 2GBCA 2ZITA 3GUHA 4QARA 1F3LA 4X54A 2CY0A 1ZNYA 2ERYA 4XI9A 1UMBA 3ZEIA 2BF7A 3MMPA 3JCZA 2BHLA 1YBAA 3LMKA 2HIMA 3CH5A 4J7XA 5C8YA 3ABQB 1RPJA 2D2IA 1TU4A 2RMKA 3H13A 4Q4LA 3SBXA 1MP0A 2GNPA 2JW5A 2QQEA 3KVYA 4WCFB 3ZEAA 2AWNA 1V26A 5BOSA 2NWQA 4YRLA 1N5LA 2CMDA 3QFCA 1NMYA 1ODFA 3EARA 1H1LB 1OLSA 2Q3EA 3EXHA 3NDRA 4YQEA 3RV4A 4U00A 3STWA 1NRXA 4KN8A 1N5IA 5LZ4A 3NUZA 2E4AA 4M9QA 5ADUS 3D8HA 2EX4A 2P1RA 4QDUA 1M2NA 1XELA 3E5NA 4B3SB 3EXAA 3PPWA 3P9CA 1DPFA 2UXCB 1HE1C 3E81A 5A9TA 2FDCA 2H07A 4CL8A 2BCJQ 1KK1A 1FL9A 2A1IA 3OQOA 1CZKA 5AHOA 1J2RA 1HYGA 1QQAA 1S3FA 1XEAA 3NAZA 2J1LA 1DQPA 1ULUA 4RADA 5K0FA 3CPHA 4MVYA 5AH0A 4CM4A 3DBIA 4CDGA 4HAOA 3TOSA 4N40A 5K3DA 3ZJUA 3AFNA 2XDWA 3RQSA 2UYHA 3LPDA 1C9NA 3BSYA 4RHFA 3AERB 4FFBA 3IVGA 3PSHA 1NVGA 4FZ3A 4JL6A 2BEJA 1JXQA 1N2CB 1BCSB 3IEIA 1QOZA 3PD0A 5LUBA 3HYSA 3OLQA 4JC5A 4WD3A 3TUJC 1OKKD 1ZA1A 3HZOA 4JBGA 8ATCA 5HKOA 1Z0SA 1QV9A 2H7YA 1X8XA 2FW0A 4BFYA 4JI6B 3ROTA 4R31A 3P2OA 4ARBA 2ZJ6A 1GZ5A 2C0CA 2VQ3A 1MB2A 1CQJA 1I6MA 1RNLA 4KKVA 3UXYA 3Q11A 4D4MA 5AKEA 4YRAA 1TQ6A 3GRYA 5FHQA 3SIWA 4AQ7A 5DO9A 3QZUA 1XZFA 4R3NA 2DKOA 3PRJA 1T2NA 2FKNA 3A11A 4P3XA 3AM4A 3LX5A 1SKAA 3UW3A 4BEJA 3GT4A 1D2RA 1CHDA 4CUZA 1O95D 1LD3A 4BNZA 1DV1A 1KSHA 1ZQ9A 4E21A 4TL9A 1SIBE 1E9RA 4NE2A 1S4QA 4L6IA 1HFWA 4FS8A 3WLMA 4GPEA 4MMXB 2KBFA 4RKYA 4RLFA 4WZBA 3GEDA 1D5CA 3QX7A 3TK1A 1PTJC 2WUVA 3ND8A 5DX0A 2ZE7A 4IIFA 3O92A 4J0JA 2R7AA 4J0FA 2HSJA 5HM8A 5EVJA 1PT7A 1N1EA 4PO9A 4IWYA 5J40A 4EKIA 3WRYA 2FTKE 1D09A 1GR1A 1F4LA 2ZRNA 3OQBA 3C2QA 1TUEA 2IDKA 4ZYZA 2MINB 3INGA 3DKPA 3H5TA 4UNIA 1ISSA 1VRWA 3OUUA 4Z9FA 1UM8A 5JPCA 1EDBA 4L16A 4BLVA 4I8XA 4XYLA 5LUAA 2XMZA 1P4RA 5LWHA 3EMDA 2NT3A 4J0HA 5JYEA 2RH5A 1YZLA 5ALPA 1EBBA 1KKUA 3AINA 4WNIA 1XFDA 1SC3A 1VMAA 1ZN9A 4B45A 3E3NA 1Y1SA 3N59A 1Q0LA 3C3XA 2PUTA 3KOUA 5JZVA 4OI0A 1RYNA 5AFSA 3FOZA 1EX6A 3EVFA 2VG8A 1APBA 4BPBA 1YZGA 1FNBA 1IM2A 1IG3A 2J09A 4U3JB 2DU8A 3O3MB 4EUKA 5CJ2A 1CZOA 1HDOA 4S0XA 2QU7A 1GPAA 1YR6A 4LECA 4U7FA 2FKAA 2E0IA 2P5TB 5I4KA 1MZPA 2CJWB 3ECCA 3STHA 2MU1A 1ODLA 2XQVA 4C5CA 4X9XA 1G42A 2D6FA 3CH7A 1A2KC 2VLIA 2HMSA 2F7SA 3VUEA 3A10A 4GAEA 1IK6A 5HKAA 3GPBA 4Q1EA 4ZT3A 2ZM5A 3JX9A 4X7PA 1VSBA 4Z0HO 1R10A 4BUJA 3TD2A 3A6HA 3JWHA 2YDXA 1W1WA 4M9ZA 3RHZA 2EQ5A 3AOEC 3DCYA 3WGJA 3ED5A 3WGVA 1T4DA 2GCPA 2FZCA 1YDMA 1E5TA 2OMEA 4U7HA 2XNSA 1F2UB 5JASA 1NI3A 4FMDB 1YKGA 2VDLB 4F3YA 4Z7NB 3X1ZA 1UFVA 4GG1A 4HJRA 4IX9A 5JNVA 1FLAA 5ECWA 2E87A 2VHZA 1UC5B 2C84A 3G5TA 2VR1A 1SUAA 1GGEA 3O90A 5ALTA 3VV2A 5EJIA 1TKCA 1NT2A 1G7RA 3ZLVA 1TKRA 2QENA 2JFPA 1M5TA 2AMJA 3QJ5A 4AVYA 5K0BA 2AR7A 4JGIA 4XTRA 3IHTA 3PUXA 1U3TA 3ZIUA 5BORA 2QE6A 3L0OA 4DCUA 1VI5A 2AE1A 4G2TA 3QVVA 3Q1KA 5FI1B 1FP7A 3E8XA 3N86A 4C4YA 1C7JA 2WKSA 4FQ7A 4K9DA 1EJBA 2IS1A 3I9NA 2HRZA 1NL3A 5BW4A 1JFFA 2C5AA 3Q41A 1T2CA 1SC1A 3UMVA 3EVZA 1ND5A 1OIWA 1UOPA 3MSXA 1BG6A 3I3OA 3O8OA 4HRAA 2AD1A 4LZLA 2KX7A 3Q7RA 4W63A 2JZOA 3NWOA 1DUSA 1PJZA 4LK2A 5DHSA 3U4AA 3IXQA 3H19A 3QKRB 2ZZNA 5KINB 4Q12A 4A82A 4DLKA 1KDRA 1TF7A 2NU6B 2R66A 2RHLA 1SHKA 3DUFB 2QROA 3G49A 1WEHA 3KFVA 3O3OB 1OFVA 4PNPA 4JFAA 1T0PA 1ZCBA 2JCGA 4L7QA 4LC9A 4PFQA 1F51E 2W2QA 3KXKA 3TR6A 1DT3A 4BZZA 3AUXA 1BH6A 3SX0A 4G1EB 3FWYA 3AVTA 4DTIA 1KQNA 3T5GA 4CW7A 1BMDA 5REQB 2O23A 4Q3KA 1AB6A 4MHOA 1I1HA 1PWEA 4PQFA 2QVBA 1C9YA 2IOFK 1BDJA 3MUNA 4EGAA 2HX1A 2P11A 1VKZA 3NRBA 1R6UA 2I1VB 3BEDA 4C4PA 3VV3A 4KTVE 4AKSA 3R7WB 4CKZA 3EZ7A 1KZ7B 4BX8A 5LNK6 2CBZA 2WF7A 3QVLA 1RYBA 1V8BA 4UCFA 3O8QB 3Q5DA 4GUAA 3JW8A 3OU7A 4JBHA 2QZPA 5EWJB 2PKRA 2K7FA 2CSXA 3P2JA 5I7AA 1B2LA 1PFVA 4NICA 4NIMA 4GWKA 4S0ZA 4CMJA 2WM3A 3GDHA 4MYDA 3AIIA 3W8DA 5D5HA 1Q7TA 2JH9A 4LHZA 3ZH2A 1QH0A 4IWNA 3PV0A 3R5KA 2FPGB 2W6PA 1I2AA 5ER9A 5HS6A 3TDMA 1OWMA 2HPZA 1T6YA 2ZVDA 1DO2A 5C1DA 5I9SA 4FMDF 5I4CA 1KVRA 3MWYW 4AN0A 3M4XA 3HM2A 3PPIA 2DMRA 4MRVA 5GM1A 2I87A 3I4CA 3R7FA 4BNWA 4IQGA 3FI0A 1KDYA 3ER6A 2Q1SA 1MRSA 5LCXA 1LRKA 1L7AA 3LQFA 3INRA 3VNUA 1L8AA 1UK7A 1ZI8A 3KTDA 3QXJA 4IVNA 4XM2A 4Q01A 3WYBA 3KQKA 4LF5B 1NDUA 4UE2A 3RS2A 5EERA 2C3MA 3I9OA 5A06A 3E7FA 4QRIA 4HDKB 3IAFA 4O33A 2CVFA 4NCIA 5I7RA 1MC4A 3GROA 4D26A 1MMFB 3A31A 5DGTA 4E1AA 2MCFA 4ZEOA 2Q21A 2V55B 2M32A 3LQKA 5F21A 4LVNA 3KKPA 3ELWA 5IM5A 2O06A 3UK6A 2YZNA 1RTTA 2OV3A 2XTAA 3AV0B 5LR6A 1IEXA 2IIBA 1XR3A 2DHQA 1PNTA 2QAGB 2XITA 4NBRA 2VWGA 3RJTA 2HU7A 3LXXA 2FPRA 4EHHA 5H1YA 4MLDA 3D4LA 3EC7A 3SGLA 3PICA 2O2ZA 3D5TA 2WFZA 4UEQA 1RABA 3L04A 2J08A 1OLUA 5K0LA 2JIBA 5B36A 2O8CA 2OXIA 4UHBA 1B8NA 3IBFA 1H85A 4NNPA 4R9UC 2WE8A 3VI3B 1T0HB 4KPGA 5T67A 1E2EA 5EJEA 1AGNA 5IUKC 3FW1A 4E30A 4IS2A 4IIDA 5EXEA 3EIWA 1QYDA 1RWQA 1VQ1A 3Q98A 2I6XA 2W11A 4QREA 3AYXB 2E4VA 3CNEA 3FY4A 3L0SA 4FCTA 4XUDA 5ALYA 1KEUA 3T1YB 1BDMA 4JCCA 1ULZA 2GAFA 5DFAA 1YZVA 4MV6A 1HRKA 3TTWA 4XX0B 1W0CA 4ARZB 2V1UA 3GLFE 3O73A 2H08A 1DKQA 1ZK4A 4LRUA 1E3WB 1F8FA 1G1AA 4KXWA 2IIVA 5AKLA 1ZGBA 5L95A 1OH6A 5E2IA 3L6OO 2WM9B 1RLOA 1LI5A 3ORHA 3GOQA 4K9QA 3AZQA 4R05A 4MVJF 4TGLA 3R1IA 3OJEA 1AJEA 1KL7A 1XTRA 4Q37A 3AU8A 2GZ2A 4OJNA 1V1MB 2GHRA 4IJQA 1C7RA 5B3JA 3FNGA 1CS0A 1Z28A 5BUCA 1IZ0A 2JGNA 5D5QA 1UM9B 3CNLA 4TQUS 3GV0A 2Q4EA 5IP5A 4IEFB 3G2JA 5DMHA 4ZOCA 3V2IA 3ADOA 4HY3A 3IPCA 1NI5A 1GPH1 2I4NA 2JHFA 3SK0A 1UPUA 4GP6A 3T7RA 4RJTA 5LD2B 5A04A 1JEEA 1DTEA 4A2CA 2R3SA 5THQA 3GLRA 1ZISA 1TVKA 1H2AS 4ME6A 1P5JA 1TGYA 4HEA1 5K3BA 1BWSA 1VFPA 1HQCA 5TRTA 3HI4A 1L3IA 3L0YA 3DLHA 5EGSA 6REQA 2WHRA 3BCRA 4JC8A 4Q19A 2Z2JA 2A4MA 4DCOA 3RRXA 3C3AA 4EJSA 1G6OA 4FW9A 1OFUA 5TGDA 3DDHA 3DOUA 4TPKA 1ORWA 1MZVA 4Y98A 3U9SA 3C0KA 1U7ZA 4ID3A 4IHKA 3D3WA 3FTDA 2YXDA 3BGVA 3C48A 3UNXA 3HNRA 1DSSG 3K0AA 3QMWA 1XNHA 2Q1XA 2VHYA 1KFEB 1INLA 1UWCA 2XQGA 3QUAA 4FU0A 1T36B 1ZZEA 1CP2A 3KU4A 3ZGOA 2JFUA 2LUOA 5AI6A 3PC2A 1V6SA 4Q4JA 4UUMA 1PJLA 1Y5RA 4LE0A 2OQ2A 2MYPA 1FQKA 4JJ6A 4DUGA 2LNDA 4Q66C 1XCPA 1MEEA 4BAUA 5A9RA 3MCUA 1GNVA 3T34A 5D85A 3PDIA 4QYIA 4U5XA 5DTRA 3VDMA 3VR2D 4ARAA 2QMEA 3EC1A 5L6LB 2FUG1 1FYWA 2YS6A 4NAVA 1O6GA 4KUGA 1NPYA 1IDN1 1XZ8A 3CX3A 3N5CA 3OJLA 2O9JA 4I36A 4XQ9A 5EUBA 3NHFA 3I62A 3PCXA 5JVDB 5CIWA 3F9IA 3I9MA 1Y8CA 3I12A 3WJ7A 1JIXA 1JG7A 2ZG6A 4ZGGA 4Y2JA 2Q9CA 1AHIA 4U2EA 2N42A 3BJZA 5DRYA 1CY6A 2IEAA 2F1IA 3RS8A 3M89A 5IKOA 2HCTA 1GYPA 1VIVA 2EJUA 3O4HA 4M4SA 4M0MA 3DB2A 4XSGA 4AJNA 3A37A 4D6YA 5KJFA 1OU0A 3S27A 3P9NA 5J1TB 2NOAA 3VKFA 3N76A 3WWYA 2BEKA 2RK3A 4EPVA 1L4GA 3CUUA 1E0AA 2M1ZA 1PVDA 2YBEA 4ER6A 1KQ3A 3ESBA 5DK6A 3OA2A 1CQIA 3BE8A 4OD0A 4TMZA 3S5JA 3JARB 3K1AB 2PZMA 2R6HA 2ZBFA 1NQUA 5DWVA 5HCNA 5BQFA 1QIDA 4YQZA 2OVFA 1CHNA 3IE2A 2J5QA 3PNPA 3VPXA 1HTTA 3U5TA 1DGQA 2GD1O 2ZRKA 3LBAA 3X3HA 2ZEJA 1AM4D 3KSUA 3P9YA 4ZDJA 2JAUA 4X1KA 2NT4A 2GESA 2GOYA 3K0CA 4HRYA 2QV0A 1DOAA 1XKLA 2XE4A 3CNNA 3LRXA 2R00C 3MB5A 3O74A 5IPFA 2I66A 3IR5A 3FUTA 3HC7A 4UE6A 2RGRA 5FTLA 2P27A 5LMCA 4URUR 2VOEA 1YC5A 1TD9A 3CRRA 4HQOA 4BRSA 2XX3A 3UB3A 1Z4OA 3MCTA 4XR9A 3MZ0A 4DT1B 3C6QA 4P54A 4N5LA 4PZZA 5JH7F 5A1TA 1B1CA 1LBIA 1GPUA 3IS3A 1Y37A 3K4PA 3GG9A 5TMPA 1LW6E 1PJQA 3PHJA 4G0UA 1YB2A 3FNQA 4O4JB 3H1TA 3TNYA 5AW7A 2X3FA 2NV2B 1O87A 5G1PA 3HB5X 3W1EA 4DRXB 3UOWA 2XYRA 3UMMA 2VF5X 5AUQA 4KPEC 2K6GA 4DUGD 3GR6A 3RU9A 2BJHA 3DZDA 1PJAA 5BN3B 3L79A 2WYIA 4DIOA 3TNFA 1VJ0A 3C5WP 5BSRA 1N5DA 5LP6A 3ZDFA 3MMSA 1Y7HA 3V8BA 2JASA 2DHRA 5F9FA 1I7PA 3WAKA 5BPFA 3CONA 2PQ6A 3A25A 1T9GS 1W87A 2FW9A 3LF1A 4CKXA 2H2DA 2W6NA 5U4XA 2O2YA 4ZZ3A 1HT2E 5AKGA 2WHQA 1EK0A 2CNKA 2HDOA 3C41J 4NK5A 4BYMA 3OMXA 3L06A 5JVDF 4C2UA 1JNYA 2WZBA 4R2KA 1KRWA 3CZ5A 5FWYA 5DTQA 2JAXA 4OXYA 5BNIA 1Z73A 3OD1A 1Y1LA 1SQSA 3IEPA 4OP1A 4TN5A 1C7FA 1PDVA 4UM9D 3G5AA 3LC7O 4FFDA 3SYLA 5JYDA 2CUKA 3OE4A 4LOLA 4K46A 4RJLA 1S9DA 1MA0A 3BHJA 2Y1GA 1M1YA 1P8AA 2FEXA 2AUMA 2ZYAA 4WJZA 5F7JA 4GI5A 3RD5A 3RROA 4B79A 5D3ZA 2QSZA 3L1VA 2F3QA 1B8OA 1DTSA 1NN3A 1XQWA 1Y3IA 5T4BA 3S28A 4DIEA 4D46A 2HWWA 2IH5A 3V33A 4LYHA 2IEIA 2H17A 4RKWA 2RBKA 3AKZA 1PJ3A 2W4IA 1W88B 2ZSKA 1FX0B 4RBNA 4F96A 4UM5A 3V8QA 4XIJA 1CNEA 1YE5A 1PGNA 2C8LA 2G3YA 2ZSFA 3PVSA 4V0MA 1PWZA 1JSZA 1EA7A 3P2IA 4P3OA 4XJXA 6NULA 1K8YB 2I67A 3C3MA 3H5IA 4BP3A 4EX7A 3GQBB 5TJ9A 1M2OB 4IFEA 3E8SA 3WL3A 1KI6A 1QNLA 1H4VB 5CYPA 1KWKA 4TTQA 4J75A 4WQMA 1P80A 4GD3Q 3OEWA 1XSEA 1N2CE 2EL9A 1PL6A 4H7HA 4LBWA 4MYHA 5EC8A 3V6LA 4BJHB 1XI2A 2LBPA 4NZMA 4XB6B 3A1FA 3O8BA 1IQRA 2IV3A 4B4DA 2YV2A 1XTTA 3HBJA 5JFTA 5HDBB 4C76A 2FZEA 5DLQC 2VUTA 3QVOA 3STVA 4YNBA 2SKDA 2XDQB 4U2KA 5F77A 3K8QA 2BLLA 3AZOA 1PQWA 4F9TA 2ANBA 4UXJA 1SHTX 4GOLD 3AR6A 1P4JA 4UTPA 3VAAA 3KKZA 1HC7A 4M8NE 1Z2AA 1WPQA 3C7CB 2BCEA 2OAEA 4M9SA 4MGYR 2QYOA 4DSNA 3L6BA 3BMCB 4AY6A 3UFXB 1LLQA 3EGXA 1MFPA 3BRQA 1T9HA 1EK6A 1EVIA 1OBHA 3KKKA 2X6QA 3ONNA 3QY9A 1QO0A 4XVUA 3INYA 1K7YA 1ZZGA 4M38A 5DTEA 4BNVA 5LBUA 1LWOA 4L50A 3RC3A 1B0ZA 1NSYA 4BXOA 3AZPA 2A67A 4NAHA 1UQTA 3JQRA 5EMMA 5BN1A 5SYNA 1L5FA 2ZSEA 4HI0E 2XECA 1Z6TA 2WUFA 2QW1A 1VDMA 2XB9A 4IX1A 5K0ZA 4ZI2A 2BYTA 3MJTA 4IH9A 3ZU3A 2NVUB 2OFOA 2Y3IA 1I14A 1NW7A 1XMSA 4L6AA 3O84A 4ZPJA 1LLCA 1OV6A 2MSCB 2MT9A 1AUVA 2Q9BA 2R11A 2FEPA 3DEYX 3PG5A 1VXOA 3FHLA 2G5PA 2ZJFA 1OXBB 4YGXB 3WLHA 1BU8A 1Z47A 2ILTA 5CNMA 2G70A 2OCXA 2J9FB 1ULAA 2J9ZB 5DIFA 3WJ1A 4AF7A 4BGEA 4EEKA 3U5ZB 4LOIA 2CN1A 1O9BA 3OJ0A 3G1UA 1USKA 2O3QA 1HDIA 2PMCA 1DQZA 2BEVA 4G5YA 4PTZA 1U2SA 3ESRA 3TBFA 2WYUA 1Y9DA 4FGLA 4Y1EA 6LDHA 4HUQB 1WSAA 4FNAA 4N8SA 4Y2GA 4GR9A 4DNXA 4ZODA 2WG0A 4CM8B 2XBLA 3S1SA 3G5LA 2I6SA 1PFUA 2M98A 3GZNB 5I6DA 2HV8A 2W7TA 1GG8A 1RLJA 5BQOA 3MJVA 4A0FA 3C7DB 2WP0A 1VSUA 3TNJA 4L51A 4MGKR 4C3UA 1XZCA 5K7SA 3G82C 4JENA 5JSKA 1J9EA 1V37A 3H5RA 3GGDA 2CF5A 2EJCA 3I6QA 1L5KA 2B4RO 4C6TB 5KQRA 1FJHA 1N0WA 3ZWVA 2Y9MB 1U63A 4U8GA 4K2AA 5L9AA 3NFRA 4F5WA 4ITRC 3WQSB 3TKLA 1AZTA 2V96A 1FDVA 1TQHA 1UMCA 5LQSA 5CA0A 3LYUA 4CBVA 2VQFB 3AVYA 4ZCLA 4E6EA 4POOA 3A9TA 1PJSA 2EFHB 5M34A 3L6EA 4QLAA 3ZY3A 3RSCA 1L5WA 2WSBA 4QT4A 2C0PA 3R6WA 4D9KA 4J1NA 2UYYA 2R86A 2JCBA 4FYIA 4I50A 3DO6A 4B3CA 3F5FA 1WHSB 1ZG3A 4O4IA 1JP7A 2CUNA 3RIXA 3ICVA 4IJ5A 2IYUA 4EYEA 4AL4A 3NCHA 1ZJ6A 3N0RA 3RBAA 3TG2A 4R54A 3FDJA 3LUCA 3R3JA 1AHPA 3B6KA 1QE0A 5MN4A 3FUXA 4CIBA 4YP7A 2WNIA 3TW8B 1H3NA 3V1KA 1RQ2A 5K8LA 3CT6A 3ZHVA 3HO1A 2IYXA 1E4EB 4FLMA 3F4KA 5A5GA 4AW9A 3K71B 1Q0ZA 2H18A 2GZSA 4FFMA 3E8MA 1JKXA 5LZ5A 4RY8A 4KO2S 5FO0A 4US2R 4LF8B 3OQHA 3AW8A 4QBTA 4A4DA 1Z26A 4HL6A 3GAMA 2CUZA 1W36C 4OUDA 1DAIA 2PL9A 2ZDQA 4CYMA 5TC4A 2O3SA 3MK31 3VU0A 3QEMB 1ZVJA 2GH1A 2GHIA 2OPBA 3FDZA 4FQ8A 3SBEA 3VPSA 1D2HA 2VYQA 3R77A 3IILA 5EKUA 2X86A 1MVOA 1S8AA 2H59A 2IKSA 2J0EA 2P7HA 5BWBA 5KX5B 1ECBA 2BZ1A 2DF8A 3DP9A 3LLMA 4MULA 4LXUA 4DE5A 5JHHB 2YXEA 2ORIA 5H5JA 4IGEA 4PHFA 4CKEB 3UAZA 3S2YA 3RSLA 2BGIA 3QUTA 4XVHA 1USVA 1ZBDA 4KYTA 4ZT2A 3I5XA 1QAOA 2OYSA 5K99A 1N0HA 1P9OA 4WJLA 1CVLA 2YDYA 2PPVA 3E22A 4PHHA 2ATVA 4PR3A 3AVVA 4A0GA 2CJYA 2I03A 3GH3A 3FYUC 4YO7A 3T7JA 2Z6QA 3HXQA 1J7JA 5A02A 3PVZA 3ZV6A 5LIPA 4LHYA 1WUKS 3DYIA 8AT1A 1H0HA 5L3QA 1GV0A 2OBNA 3UTDA 4GOXA 5EJMA 2R6JA 1EQUA 5IK2A 5EZSA 4W5QA 1TD1A 4XDGA 2WUGA 4MVJE 2O8FB 5T6MA 4CF7A 3PQEA 4RPCA 3EK2A 3U9LA 5FTWA 4TYMA 3UQZA 4B2LA 5LDGA 5BR1A 1NOKA 2FN3A 4CMIA 1OX6A 4JBNA 1V1JA 2BP7A 4EZBA 1JFLA 4PLYA 4WVLA 5LQKA 2R2GA 1R9GA 2PXHA 5B4TA 2C9CA 3KUUA 5CT6A 1PW7A 2I4IA 2CVOA 3OETA 3QENA 1BN7A 4IZIA 4Q1VA 3E9NA 4DFDA 4B1FA 1OT5A 4OFZA 3P9SA 4Q5IA 2FPIA 3ZCUA 2I3ZA 4DDUA 1JEAA 3TQQA 2BR4A 4MMYB 4AJEA 4JXZA 1WCWA 1JV2B 1L7VC 2V4ZA 1JIVA 2ZROA 4LC0A 4NJMA 4PFSA 4OH7A 5ER6A 2JGMA 2ZI5A 4K88A 5AQEA 3WRXC 2OFPA 5ISMA 3B6JA 4Y2QA 4IIUA 2RHWA 3LX8A 4DCMA 5KYXA 4H18A 1E9CA 3WB2A 3WQQA 1VG1A 3MCZA 2ZREA 1E6KA 4IDHA 1AG9A 2D1RA 2VAVA 1QB8A 4YAKA 5AK0A 3ZS9A 3OICA 1MX3A 4G97A 1BJTA 4A0HA 3HNPA 4YRBA 1IWBB 4EGFA 2JLZA 1V9CA 4YUVA 1XPRA 2HLHA 3A27A 1TCBA 4YASA 3A3OA 3DQQA 3JU3A 5TQVA 4LVCA 2Q4RA 5IX8A 1J39A 1JAZA 2O05A 4HH3C 4KXLA 4U02A 4N9QA 3TNDA 2XZLA 1I1QB 4V2IA 1E79A 1V8DA 2HQBA 3SX2A 1VIMA 1TRKA 2A5JA 4YK7A 2C99A 5JNSA 3K70B 2PJRA 5DNWA 3DDNA 3I6ZA 2I4LA 2G9NA 1KQOA 5KX5F 2JLVA 1TW2A 5H4HA 1CJMA 1P9RA 3RLIA 2KM1A 3CSDA 3DPIA 4ER3A 3L41A 4I1RA 2PUCA 1P1HA 2WINI 5F73A 1BEEA 4RTRA 4C78A 1VHLA 3VOAA 4BEBA 2QUAA 2YJZA 3G7NA 3GUZA 1MG0A 1EB8A 4YJDA 3ZE8A 1XCGB 4M76B 2QP4A 2OLJA 4G07A 4Y2XA 3O7MA 2FH5B 1KKMA 1ZM4A 4P58A 5E1BA 1IATA 5C8ZA 1MW8X 2OAQ1 1CRZA 2WF8A 3WLPA 2ZSUA 2JAWA 3ZGLA 5HKKA 5IK2D 3BUSA 3BSSA 5BT8A 4WGGA 4ZYYA 2V3VA 3AR9A 3HYTA 221PA 1QK3A 4LV6A 4HWSA 2ATCA 1Y4SA 3DKIA 4LJYA 1E1QA 1KEPA 3QPCA 3G2MA 1YE3A 4TMTA 3C1AA 5C5IA 2EJWA 3HA5A 5JDCC 1LQ2A 2GRAA 2GZHA 4X8HA 1QONA 2X13A 4QFDA 5AOAA 2P2GA 4L8VA 3AUUA 1E2HA 5IJ9A 2XBMA 3GW8A 2WU8A 2YJ4A 2X19A 3KJIA 3H2BA 4U2BA 4ZU3A 3UB4A 2ZVJA 5CX1B 1YVRA 2FI1A 4YCAA 2EW8A 1OC2A 5IDXA 5ALQA 3DZCA 2QG9A 3SHOA 2GYWA 5IS2A 4HGPA 1K3FA 1TVEA 1BQ4A 4CIVA 2A94A 1Z6PA 2XNHA 1RXIA 3OLWA 4L08A 5EZQA 1GSIA 1T5TA 2F43B 2B1IA 3SD7A 3SE7A 3ISJA 2VDOB 2ZJ4A 3ENQA 2JLSA 4KLRA 2VH5R 2FGKA 2ZCVA 3TVTA 4HNHA 2IP1A 3ZCPA 3GMTA 3QVTA 1I4DD 1CUXA 3PTZA 1BN6A 3E3MA 1AQUA 2R6CA 5AI8A 4EGQA 1TO1E 5FAXA 2J48A 5LBTA 1FFDA 2I6UA 1TJPB 4EHBA 1QQ5A 4MYSA 3QUCA 4HEQA 1U5CA 2AMVA 2DH5A 4FN5A 4K8OA 1KI9A 5KYGA 4DR2B 2I7TA 3GY0A 2FX5A 1NY6A 3H4MA 3IAXA 4LWQA 1E79D 2FQYA 3KLNA 2G88A 3GLGA 4D57A 1MH1A 9LDBA 1SIOA 4MUNA 2DFKB 4YT4A 5GPBA 2W2PA 4N49A 4LS3A 3GLIA 3OKAA 3RLFA 1KETA 1PQ4A 4HVLA 3LRTA 1GGHA 1K3UB 1NNSA 1FA9A 4CM3A 1I94B 2Q4BA 2RAFA 3ITNA 3KJXA 4TWZA 3OU6A 1JBQA 2PYZA 4TTPA 5F7OA 5JWRA 1AQ6A 1YBMA 2BSAA 2JRLA 3EMKA 4GVXA 1Z39A 1D0SA 4MWSA 2FFBA 3ZGYA 4L27A 2XTNA 3H5NA 3WDKA 2XBUA 1W8DA 3KUKA 4DAEA 2B20A 3MTJA 3W6ZA 1DJNA 4BE7B 2O54A 4C06A 3RTBA 1QSGA 1TIKA 2PMWB 2HEGA 3A14A 1M2HA 1SHJA 1XZEA 5KOHB 5HKKD 2IYQA 1OI2A 1TJNA 4WXMA 2C29D 4AMVA 3I0NA 1ULTA 1YFZA 4MUAA 4O8CA 4URXR 5EE5B 1IN4A 3JZDA 1E9DA 5DGIA 4M9RA 4XWAA 2YWXA 1E1QD 4RX1A 5CNKA 4UHCA 1JDTA 1A7KA 3AHEA 3ICOA 4LNHA 4X65B 3SZLA 5ESDA 1NXXA 4WK4B 3VJRA 4F2WA 1OJLA 2VFAA 3A1NA 3OT5A 4BJ3A 4L5YA 3VU9A 2YMMA 1RRFA 4Z8YA 3HVRA 4FKBA 2GNOA 5E7JA 5A5DA 1V35A 3T5DA 4ZVOA 4DLPA 3EFEA 1T35A 3ZQ6A 1E7MA 1YDWA 1PQUA 1U8CB 3ZCVA 1NONA 4OLHA 3VZRA 3EVBA 4QZVA 1WCV1 3V1TC 3DW1X 3MBKA 4Y18A 4HDRB 4XQGA 3G5UA 4YROA 4GS5A 4YXWA 5IDQA 1H3FA 2FX2A 4TUYB 4H7JA 2QPAA 2P4QA 2HTEA 4BN0A 3BWYA 3QU7A 1CCWA 1NT4A 2QT9A 1E58A 3RAPR 2ACVA 2B99A 3QKTA 4B4KA 2BFCB 1HYEA 4ZD6A 1FSPA 1WP9A 4KE8A 3T5AA 3B53X 1Z0ZA 2CHVA 4DBLE 4I1OA 2LE0A 3L7JA 1JPNA 3JVUA 1P2TA 3KHUA 2V45A 4I1VA 3HKCA 4GYKA 2G6TA 2OUIA 1A7UA 1MT0A 1VBNA 2O8NA 3L0IB 1DP4A 3L7CA 2EERA 4JNCA 2NMVA 3OEHA 1EBFA 3KHSA 3LCJA 3V42A 5HIAA 3CPSA 3P19A 4Q4HA 4HV4A 4LJ9A 1RPTA 3EEYA 3TCKA 3L18A 1XTPA 2R6FA 3N53A 3ZV5A 1EZ1A 1GVNB 1VL5A 1BJRE 4MAAA 2XUAA 1JJBA 2AG8A 2YFYA 1FYEA 4P2GA 2N47A 2SKEA 3JALA 2OQRA 1XL0A 2PT7A 3QV1A 4QBKA 4A16A 1JJ7A 1HE4A 3RU3A 1BYIA 3ZBPA 3ELYA 5KYWB 1RWKA 1L6RA 4X97A 3RSFA 3ER9A 2NXEA 1M2VA 3VNVA 2QD1A 3O0TA 4Y9RA 4ZYWA 3ADPA 4EFKA 1OPRA 2XD9A 3EUWA 2V8OA 1Z36A 3CR7A 3GAAA 1NVEA 3OE5A 3ZK8A 6AT1A 4NRDA 5K05A 2J9XB 4PRYA 4LCEA 3P8ZA 1WKCA 2PMKA 2QKYA 3EF1A 1P4GA 1JWBB 2APJA 2VKQA 4JN6B 3USES 1QG4A 3BXFA 5LVAA 4UPVA 3FPGA 3AEQA 3PD7A 5THKA 5TLSA 2G82A 1CZHA 2BGRA 1OAOA 3PX2A 1XZDA 4KRFA 5EESA 2Q49A 1EB9A 5JI3E 2BELA 1BKYA 4LQLA 1I9CA 2I54A 1XQ6A 3QBTA 4IXMA 5EINA 1V16B 1T3SA 3A26A 3SFZA 1BHQ1 4BNLA 1OAKA 5K3SA 3PQFA 4N0QA 5E3HA 4CM9A 4FZRA 3MMNA 3ULKA 4RVNA 1E5LA 2OEPA 4HQ6A 2JJ1A 4PLZA 1CNMA 3BXHA 3GXOA 4K6OA 1IHUA 4TTVA 4OX9B 1TYZA 1HT1E 3DHNA 5BSGA 4HR7A 1ZONA 3P0JA 1PN3A 4YXWD 2EQBA 4ZOLB 3RFCA 5CDFE 4U2GA 1S8FA 2C1XA 2JBWA 3B38A 4HNGA 4DDTA 4OL9A 1M6NA 1J4AA 3U48A 4DQVA 5KSPA 1KSJA 4CU5A 1ZNWA 2NSHA 1P2DA 1YZUA 2O8DB 4TUYF 1RC1A 4Q48A 1N6RA 4FC7A 3I39X 4IRMA 4GOJA 4M8KA 1J09A 5EPOA 1R9MA 1H05A 1WZNA 2VHJA 4G0NA 2AFRA 1Z2CA 2HD4A 1R74A 3TW4A 4ZVRA 4CT0A 4C4SA 2FFAA 3OJWA 1D1TA 1KEEA 1WL8A 2QA5A 4OJTA 1UMBB 4QAQA 2FHSA 1LWNA 4BRWA 4E13A 1EFRA 1ZIYA 1H2ZA 4OHCA 2XGMA 1DAGA 1X80A 2IHUA 3NBQA 3OEHD 5C8YB 3ADCA 1YDGA 3MJEA 2A6PA 2I7XA 5BOSB 3EGOA 4X1YA 4PYIA 3UO8B 1K86A 3LCUA 1EFAA 3EXHB 1OLSB 1RMTA 3D0RA 4MITA 3BH6A 2OBLA 4MB0A 1YA6A 2NO1A 1F20A 3AB7A 3CBGA 3ZCSA 1FRQA 1TCUA 3EXG1 3BGWA 1W76A 4M0CA 1SRQA 1T9BA 4UNPA 5AM4A 4YT8A 5JZSA 3F46A 3FB4A 1N3YA 3VR3A 2WTBA 3COSA 3I8XA 2MWMA 3L7LA 3MM4A 4UEJA 4H7EA 1W5BA 3WHLA 3KT0A 4BFLA 3IKTA 2DPHA 3NJ4A 3ESZA 5I9TA 4PZLA 3F2IA 5ICSA 2GM4A 1Z2OX 3R0QA 2G1AA 4CM4B 3KHKA 4AP9A 5HZKA 3SDZA 4FNGA 1X7ZA 3ME5A 4LFBB 4FFBB 2B9EA 4CF5A 5LQJA 1Y6FA 3MHTA 1NQAO 1J7KA 1GY8A 1OU4A 4LHXA 4O1MA 4MKXA 3W5UA 3QRWA 4B7CA 2G28A 4JQYA 4WESA 4B31A 2WA1A 1F8YA 4TROA 4CIYA 5LM3A 4B2YA 1K4KA 3IPYA 4C6HA 1WXHA 3C7KA 3CX6A 4JHXA 5ALJA 1I4LD 3RIMA 3E4DA 3DTTA 3QE0A 3T7TA 1T5LA 1CQJB 2NO0A 2QIOA 5FXMA 1XUOA 1UBMS 3SZ3A 1XHEA 2VDVE 4MB2A 2DY0A 4B3HA 4CM9D 1B23P 4E5YA 4OHXA 1T9CA 2JJ1D 4FTWA 1Z06A 4GL4A 4KEAA 5E9WA 5LDHA 1HLPA 2F8TA 1WOMA 1KS2A 4RHTA 3QITA 1Q74A 1VE6A 4EMUA 2A5DA 1FFEA 1QIFA 3L4SO 4ETWA 1K6MA 1II8A 2GS9A 1FW6A 2EP7A 1UINA 3LQYA 4WKCA 5CFOA 2W6OA 4RXMA 5ADHA 3I92A 1X70A 3DZJA 2CJPA 1QMPA 1T3ZA 1Z3IX 2DQYA 2I1QA 4L0DA 5I47A 4S05A 2OBXA 1HR0B 3A04A 3A4TA 1U2GA 1QVWA 4KXFB 1K2VN 5H70A 2W71A 2AMLA 2ZJ8A 3BFKA 4BVJA 3V4ZA 4WZBB 4XW2A 1YO6A 1GTZA 2VDRB 4G86A 1TM2A 2HA4A 4LOHA 1OBFO 1EFRD 1RM5A 2P9CA 3ZDQA 3TQRA 4DJJA 2G5GX 4UQOA 4YCSA 1PEAA 5G2OA 2EHJA 3OPMA 3SS7X 5KBYA 4BECA 5JTTA 5CDUA 5C8YF 3LBNA 3VZCA 5LLDA 3WGZA 1SY7A 4LCBA 3TZCA 2HMTA 4FX5A 1EWTA 1DPGA 4OOFA 2XMPA 4MPDA 4PVDA 1QVZA 1UDCA 2IU4A 1GU7A 2P65A 4WLNA 2PZLA 4LUCA 2RHMA 4RM2A 3VR3D 2VUUA 3DWFA 2N9UA 4Z4CA 3U7EB 3JD2A 4MQMA 1ZUWA 3ZBTA 5K3CA 4FDUA 3PUHA 1X7YB 4N6OA 1YULA 3A3PA 4TM7A 4ESVA 3BK2A 1NFQA 3CLVA 4Q9KA 3TJMA 1W85A 3KOXA 4PPGA 3MT9A 1KR2A 4DABA 1OF1A 3VISA 4D9EA 1M10A 2CHGA 4RLQA 5K51A 3C6KA 3TJZA 3NPAA 4XQCA 4MYUA 3GVHA 3GCWA 3WZLA 4QUEA 4ZYLA 1YT5A 4DG5A 2NLOA 3LSYA 1Y5LA 4CN8A 3FBTA 2WYOA 2MHCA 4INZA 4JR0A 4JHLA 1N8KA 3TSZA 3OZSA 4AKEA 4MIKA 1MOQA 2KQUA 5JZ9A 5IT5A 3IESA 2WWTA 3HU3A 1WSDA 1L9KA 2PKQP 4DPMA 3BPSA 1R88A 3AIMA 3OPYI 5ITZA 1ODJA 3F6PA 1SKUA 1V5FA 2VYFA 3BL6A 2ZJYA 3LKBA 5H3LA 1SCQA 1WKBA 2O0LA 3AIKA 1ZS9A 2XWSA 2Z4SA 4WOCA 4KQIA 1RT9A 4C2BA 3U7QA 3QYAA 4NPCA 2D74A 5ARBA 3HFSA 3PC8C 4LXIA 4Q3CA 2AR9A 3PGVA 3PNBA 5ARDA 1LBQA 5EFOA 1IC6A 2PKEA 2ODAA 1TM3E 4INJA 3MWFA 1ZGAA 4P38A 1GPYA 2EFCB 2X9QA 4OXRA 1E1RA 2ZSJA 3FZEA 5EEHA 5F52A 1ORIA 2B2NA 3I58A 1ADYA 1AGRA 4N82A 3KZMA 1RADA 1PAUA 4UMVA 4L75A 4ZU1X 1G2IA 1MPTA 1KAGA 4LKRA 5IU6A 4WCFC 4IR7A 4Z7JA 1X19A 2JK0A 3N7AA 3R8FA 3SN6A 3VC1A 5E2AA 3ZQ4A 1ZJ5A 3AY6A 1FRNA 4HXEB 1JFFB 3HRHA 5BSMA 5K8IA 1G20A 4LXYA 4F12A 2DB3A 2Z8ZA 2AOWA 2ET6A 2FVYA 5JNRA 2OBFA 1QTNA 4EDHA 3O8OB 4DIDA 3HLTA 5AW0A 1CRLA 4M88A 4H6PA 4HDOB 1AH2A 3WIEA 2GXAA 1RQRA 3HU5A 4JVSB 4RK4A 4UBNA 1SC6A 2PWPA 4BFTA 4DG8A 5FR2A 2GXQA 4YAGA 5JBNA 1ZLXA 2D3TA 4EF4A 2Y76A 4I14A 1YA4A 3LUGA 1QQBA 3V1NA 4J4TA 1HLDA 4E5KA 1L5HA 2CKDA 1P2BA 1DKMA 4NOJA 1UBKS 5DHFA 3GZTB 2B25A 1QOPB 3W2IA 1B6RA 1P72A 4YIKA 1PGOA 3TUIC 5BW6B 3UMRA 2IYPA 1QH9A 2ZWVA 5KTYA 2OVBA 2B8JA 3G02A 2A5GA 5CGZA 3T7CA 3ZBUA 1G59A 1K5GA 3OZWA 4FW8A 1IN1A 2JS7A 3I0ZA 4L4UA 3GBPA 5ENDA 1JFRA 2JAHA 3RQIA 2GNAA 2XQIA 1MV8A 5HNKA 3MJCA 4CQJA 3KWJA 1N78A 3PRYA 3KD2A 2ECFA 2O2IA 3SJZA 3TMKA 1KAHA 4UCXA 2B4QA 2ZAGA 4DS3A 1QFYA 2EZUA 4CLXA 3IOBA 2Z2XA 3IMCA 4X7RA 3IO5A 5AW4A 4O59O 1AKEA 1LJLA 2EKDA 4P3NA 5ALVA 1J97A 5AW5A 3H5AA 1UKYA 2FK8A 1F6BA 3LGAA 1WHTB 1I24A 3VO1A 3L40A 5KPJA 1W94A 3D6HA 3RW9A 4A36A 2B8WA 2QOEA 3ZZ0A 2Z04A 2R6ZA 5EWLA 1DOHA 2P62A 3FMPB 1QIJA 3UMJA 3GNTA 2C4HA 3LUFA 4WLOA 3IKJA 4X61A 4G37A 3KBOA 2QORA 1MW9X 2BKVA 4AP5A 1E1RD 3RG8A 2VDJA 5ELXA 3FAZA 3NC4A 1IN6A 4GZ6A 3SWWA 3WLNA 2Q8NA 4Y6SA 5CH3A 3EPRA 1GITA 4UJ3A 4D5GA 1QUEA 3AOEA 3P20A 4FB4A 5KVCA 4IZHA 2BV3A 3W5DA 1ZD5A 5FUMA 1AKVA 4I3FA 5EG5A 4YCNA 2EJVA 3IQHX 1TZJA 4JLKA 2K7ZA 4HH0A 3BZBA 4EUSA 3TRHA 2AFIA 5FPPA 5KZMB 1A0OA 3B6IA 1XKTA 5JAHA 1X0VA 2OMKA 4YLEA 2NZVG 2F4NA 1J0EA 4QL3A 5DW0A 4MQ5A 2Y0BA 1U9JA 5IAOA 4D45A 3ACCA 1HXHA 2CVQA 4MPPA 3ZLJA 3I45A 3PB3A 4AG5A 4NPHA 2BZSA 3K1YA 4EH1A 1R7RA 2VAWA 3I9KA 4JKIA 2HY7A 1H5NA 1U1FA 2WAXA 3KPYA 3O82A 4GBED 3IDFA 4NMWA 1DNPA 1OLUB 1NXSA 4WADA 5HKBA 5LQNA 2O8CB 2I3GA 3M2TA 5JS1A 3GFVA 3UK0A 3U4MA 1Y0BA 1ZH0A 1EESA 1I5RA 2AQHA 2PD3A 3BWBA 1KJWA 3G2IA 3O4GA 4H3HB 2DWPA 4QD3A 1O94C 3W4JA 1MC8A 2LRHA 3PCTA 4YJ2A 1RXWA 5DN6D 1LQTA 4G01B 2OCKA 4BO1A 5FUQA 1OVMA 3P9IA 2HIGA 2HNBA 4G5RA 1UQUA 4BDSA 1O89A 3OQ1A 3FVVA 3WXMA 1ZJYA 2PTHA 3PDJA 4UU1A 4EHJA 4F5DA 2QEQA 2JCVA 3QVGB 3ZV3A 5C7OO 4KMSA 2HJVA 4FDAA 2RONA 3KSBC 1SBIA 3AYZB 1MOSA 1IU9A 3D02A 3U1TA 1ESCA 5IZCC 1SA0B 5HJEA 4MRMA 3UV7A 5BSWA 2JIQA 3HSKA 1BWRA 5L6MB 4B09A 2C57A 4B8YA 1CY1A 3QWIA 3GLVA 4HZUA 1SG9A 3VZDA 4F0JA 4N1AA 2WAAA 3V7NA 4MJ7A 4ANFA 4YCMA 4ZMSA 3T35A 2BONA 2FDXA 1Q1GA 4JI1B 1LEHA 3EOBI 3G0CA 4NS1A 2YN4A 4QYIB 621PA 3FMOB 4TYPA 1G9TA 3GRUA 5DNYB 2QJRA 1LC0A 3GP5A 1Q0QA 3A1WA 2B37A 2G5TA 3AR5A 3L93A 4FKMA 5DNVA 4ZVQA 4DJ5X 1UDRA 4DCNA 1TVKB 2F90A 2IOFA 4H60A 2VSFA 2PSSA 4ICIA 4WERA 1OH8A 5HM6A 2ONJA 1I0LA 2OK7A 3O93A 1F60A 4ZRMA 1XPOA 4R8RA 1TU3A 2QYHA 3ADBA 3IUEA 4QU0A 1M72A 4OATA 5G1NA 4A0QA 4DJEC 6REQB 4KR3A 2JHCA 3EYWA 4PCAA 1YR8A 4GNRA 1QHHA 4EJSB 5K6TA 3MUOA 1EGAA 2HR