4H18A

Three dimensional structure of corynomycoloyl tranferase c
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
335
structure length
311
Chain Sequence
b'AEVTPADVAGDTALSTISDSAPADEASAPRWRAHVNAADERVKEMWAYSPSMDRNVPLVVITADESAGPRPVIYLLNGGDGGEGAANWVMQTDVLDFYLEKNVNVVIPMEGKFSYYTDWVEENASLGGKQMWETFLVKELPGPLEEKLNTDGQRAIAGMSMSATTSLLFPQHFPGFYDAAASFSGCAATSSLLPWEYLKLTLDRGNATPEQMWGPRGGEYNIYNDALINSDKLRGTELYVSNASGLAGEWETGGIIEAATNKCTHDLKAKLDSAGIPADWNLRPTGTHSWGWWQDDLRGSWTTFARAFELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cmt1
molecule tags Transferase
source organism Corynebacterium glutamicum
publication title Identification of a mycoloyl transferase selectively involved in o-acylation of polypeptides in corynebacteriales.
pubmed doi rcsb
total genus 119
structure length 311
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h18A00
5DTJA 4IH4A 2OCGA 1XRQA 2WUFA 5A62A 5LZ9A 3WKDA 3C6XA 4OB8A 2XQGA 1IZ8A 4PF1A 4E14A 4N5HX 5HF6A 3O9MA 1VXRA 2JGLA 4B6GA 1P0QA 5JADA 4TGLA 3V1LA 3VVLA 1ZI6A 2BGRA 3WWEA 2WJ4A 2YXPX 1QLWA 2XI4A 3I2FA 1XKTA 4QEKA 4EY8A 5IH7A 2WHPA 5FKJA 2VF2A 3PE6A 4WY8A 1ETHA 3DDUA 3QM1A 2YH2A 1W6RA 4LYEA 5AIBA 1DTEA 5DYWA 5AIAA 1FJ2A 3STTA 3PF8A 4BBZA 1MNAA 1DX6A 4K6KA 1K6EA 1DWPA 1E66A 1JJBA 1CUGA 4JNCA 1A8UA 5AKZA 5K3BA 2OAGA 1CV2A 2JGIA 1DU4A 2VQ6A 4Y2PA 3KD2A 2HM7A 3WA6A 1LBSA 1M33A 5DLPA 1OILA 2B9VA 4B84A 3DYVA 1EB8A 4KE7A 1A88A 3QITA 1P0IA 2I03A 1BN7A 1K63A 1TCBA 5CH3A 3JYHA 2AJ8A 2ACEA 1X70A 2XLBA 1PJAA 3NWOA 1IUOA 3HRHA 2DR0A 1QIGA 2HIHA 2I3ZA 4MXDA 4Q34A 4ARAA 5CXXA 1CRLA 5HKAA 1QOZA 1LPPA 4RE5A 2C0QA 3DCNA 5DWDA 1ZD2P 4W1SA 2HA6A 5JARA 5T4FA 5HKBA 4GWLA 5ALNA 4GDMA 1CUIA 2VSQA 1GPLA 1UKCA 1IMJA 4X94A 1GKLA 3UMJA 2BUCA 1H22A 1R9NA 2O2GA 4KRYA 2O2HA 3O4HA 3IIIA 3BE8A 3T52A 3R3UA 3O4IA 5D6OA 3PFCA 2QM0A 2XMSA 5FV4A 5K3EA 4ZGBA 5ALEA 3EBLA 2QKYA 2X5XA 2PUJA 3AZPA 3ESDA 5CT5A 5IKXA 2EDCA 2XUFA 1H23A 1BS9A 3D5EA 3WLAA 3D2BA 2WIFA 1XRPA 3WKAA 5ALWA 1XZEA 2O7RA 3ESCA 2PUHA 4LXGA 4FBLA 2DFPA 5JD6A 4KRXA 5FXMA 5HF5A 1XQWA 4INZA 1Q84A 4XVCA 4E15A 1J1IA 4UBOA 4HRXA 1UKAA 4Q1VA 1LPBB 2BCEA 4Y7DA 4OCZA 5A7FA 2WIGA 4N8EA 4GBGA 4IO0A 4FLMA 5LIPA 3FCYA 3KDAA 3RLIA 4Y2TA 2PBLA 5HK9A 1HLGA 1LZLA 2JGFA 5LKRA 1W4LA 2HADA 1IVYA 1CIJA 2XQKA 3H0CA 3ILSA 3EQ7A 2XMRA 3WWOA 3GELA 4HVTA 1BCSA 3H04A 1KU6A 2PKYX 3FVRA 1VZ2A 4M0EA 5LKAA 4C87A 3Q0TA 1UXOA 3W9UA 2RIPA 1VXOA 1ZI9A 3JW8A 5EGNA 3OOSA 1KU0A 2PSDA 4FHZA 4C01A 4C89A 3D7RA 3N2ZB 1K4YA 4I19A 2IIVA 3AUKA 3AILA 2PX6A 3PICA 5CMLA 5I9IA 1ZD5A 1XZKA 5J3JA 4MWSA 2WU3A 4M0FA 2P8SA 1EXWA 4OSEA 5ALFA 4ZRDA 2PSEA 2JEZA 1QONA 1VOTA 5JAHA 5ALJA 3R3XA 2I78A 5AK4A 5AH0A 3OPMA 2XT0A 3PFBA 2JEYA 2ACKA 3MGAA 2UZ0A 2XB6A 2XUJA 1R50A 3AINA 1E8MA 5CRIA 3G0CA 3SX4A 1VLQA 4MJ3A 1JU3A 2HA3A 3U1TA 1CEXA 2AXEA 3H19A 3IB3A 2GZRA 5HCUA 2LIPA 5K3AA 1UFOA 1RWQA 3I6MA 2XMCA 4G9GA 3ZI7A 2YYSA 5AI8A 1E8DA 4X95A 3W04A 5E4YA 5I8PA 2GBFA 2R8BA 4FDMA 4PSDA 2RGUA 1F6WA 1XZMA 1G66A 4G1FA 5ALQA 5CW2A 1R3DA 3I6YA 1JT2A 3SC2A 5CH5A 1MNQA 1MT3A 1G42A 2QXUA 2WUDA 1N5RA 4QLOA 4H18A 2ZVDA 3G0GA 1SC9A 1X2BA 3ICVA 4RE6A 2VT6A 3I2JA 5AKYA 3MVEA 4YPVA 2QUAA 2IX9A 2OCKA 2HA7A 1XQXA 5BOVA 1JU4A 4KJXA 2OGSA 4OB7A 1WHSA 3IDAA 4X6XA 4W1PA 2B61A 3ANTA 5EIAA 3F97A 4PSUA 4DM7A 1CQWA 4JH0A 2YASA 4MYDA 4XJVA 4J0JA 4ARBA 3GBSA 3A2NA 1QIKA 4J0KA 4JYMA 4K6GA 4C88A 1H2WA 4BDSA 2VJCA 3TGLA 2OLEA 4P92A 1QIHA 1CUJA 1ODSA 1W76A 3D2AA 1E8NA 5ALMA 3QMVA 5AM2A 4J0GA 3BF7A 3K9BA 5FLKA 3ED1A 5BV7A 4DNQA 4WFJA 5E4TA 3KXPA 3H2IA 3BJRA 4WFIA 1Y7HA 1VA4A 3DKKA 4BAGA 5DYTA 1T2NA 5ALTA 5DJ5A 2E3JA 5ALIA 2D0DA 4HZGA 1F0NA 5AJHA 3QVMA 3G7NA 5AHXA 4AN0A 2DQZA 5AKXA 1MO2A 1DWOA 5AI9A 5C7YA 3TRDA 5EHXA 2QT9A 2HU7A 4PNZA 4TVKA 3QH4A 2WHRA 3SWWA 5CXUA 1J07A 2EEPA 3C6YA 7YASA 3AIOA 5HFNA 2ZYHA 4GHWA 3G0IA 1LGYA 2XMBA 3WIBA 3R3WA 3JWEA 1ZI8A 1XRMA 2WU4A 3RM3A 4Z49A 1WHTA 1WPRA 4K5QA 3OTQA 5ALZA 2G63A 3E0XA 2CMFA 1G5FA 5LZ8A 5F4ZA 5AM1A 4FOLA 3PDCA 3HSSA 4YK7A 5CURA 3B12A 4UHFA 1DX4A 2HA2A 5ESRA 4LXIA 5T4BA 3AIKA 1XZDA 1U2EA 2HFJA 4QLAA 3WA7A 1PV1A 4BE9A 4AO7A 1UT6A 1NU8A 5T4EA 2C0PA 2HRQA 4B9AA 2PPLA 4I4CA 3R3ZA 3FCXA 3I2IA 2ZYIA 4P9NA 4QDTA 1AC5A 2HA5A 3LCRA 4DLNA 4E46A 2W6CX 4G8DA 4Q3OA 5C8ZA 3E1GA 3G0BA 4U2BA 1HDEA 1EK2A 3PF9A 1HL7A 5LZ2A 3D3NA 1EDEA 2QOEA 4ZV7A 3FBWA 1J2EA 5AP9A 3WWCA 2WKWA 3W9BA 3H2HA 4AO8A 5JAUA 4CIBA 1FFAA 4YX9A 1B6GA 1MPXA 3CXUA 3Q8WA 4WDRA 2HA0A 5LLSA 1EVQA 4QDXA 1U4NA 4BYMA 1FFDA 2ZJ7A 1TRHA 4C6HA 5K3FA 2OG1A 5C81A 5JANA 3F96A 5KBYA 4FFVA 4UBKA 4BDTA 1XQVA 5AK3A 3D4LA 2QJWA 2GYUA 4GI1A 4X91A 3ZWQA 3EQ8A 3ICWA 3C87A 1GQRA 1QIJA 1NU6A 1CUHA 3WK8A 4EHBA 3C6BA 2QZPA 5HK8A 3VISA 1FFEA 1TCCA 2XUKA 4OU5A 5ALKA 1Q83A 1HBJA 2ZSIA 4M0MA 1UK7A 4Y2JA 3A6ZA 1EINA 1EK1A 3H1AA 4OD0A 3I28A 1ZIYA 2BFNA 1DQYA 1CLEA 3HLKA 3KSRA 1LPNA 3DJYA 2WSLA 1S8OA 1O6GA 2AJCA 4MEBA 3WMRA 1CQZA 3ZLTA 4EB0A 4QWMA 4G8CA 2QMQA 2DHDA 2ZSHA 4BZWA 4DMFA 5E2IA 4L72A 4P93A 5H3HA 1WM1A 3CN9A 2WILA 4ZV9A 1XQYA 1EVEA 3M82A 6YASA 5EI5A 3FLAA 4UBLA 4CI9A 1CUZA 4B83A 1ODTC 5BWCA 5K5EA 1AGYA 1NX9A 5I7UA 3HABA 1B41A 2Z3ZA 1QFMA 5EFZA 5K3CA 3WJ1A 3HI4A 3FSGD 4DSAA 4I3FA 1QFSA 2H9YA 4BC1A 2QTBA 5JD4A 1QIFA 3I1YA 4Y2UA 1EI9A 3WKBA 1YSCA 1QIEA 4AXBA 1JJFA 3IUQA 1YCDA 4L0CA 2C5FA 5C8XA 3WK7A 3ANSA 5ALSA 4IQ4A 3IURA 4HXEB 4MEAA 4UBNA 4X90A 5AKKA 4QDOA 4AZ0A 2C5GA 1CUXA 2XUOA 1RYYA 3BF8A 3HC7A 3WKCA 4FLFA 3HXKA 3H2GA 5CT9A 1QO7A 2CUTA 1LBTA 1SCIA 5ALXA 2BKLA 2ONCA 1FSSA 4PQEA 1YA4A 4FWBA 2PU5A 3H2JA 1XZBA 3WWDA 2ZJFA 1R1DA 4LKOA 4AB1A 2DSNA 4H7KA 5JATA 1G4HA 1XKLA 2XUGA 3R3VA 1OXMA 2JIDA 4H7EA 3QBJA 1BCRA 4H7DA 1CUEA 3H17A 3STUA 2FJPA 4G4JA 4BCCA 4CCYB 3G8YA 2D5LA 5AKGA 2QRUA 3STWA 3WYDA 3S2ZA 4UHCA 1TQHA 5ALVA 5JIBA 5DNVA 1QJ4A 1VE6A 1UZAA 1N8SA 5ALLA 5IVDA 1X2EA 2AJDA 2V9ZA 3O95A 3DS8A 3L1IA 3DQZA 3TJMA 1BRTA 2VJBA 1QIDA 1P0MA 3AFIA 4UHEA 3KWFA 4CCYA 4LIPD 1Y37A 1EX9A 3R3YA 3W06A 1ACJA 2HU5A 2WUGA 4EY5A 1TIBA 4ZI5A 1VJ5A 2OGZA 3GFFA 1ISPA 1WPXA 3DNMA 3PI6A 4XWGA 2NW6A 2Z8XA 1AZWA 4ETWA 4OYYA 1BEEA 5AM5A 4S0XA 1DT5A 4QE3A 1YR2A 4H7FA 3QPAA 1SFRA 2WTMA 2C7BA 4BCBA 2QXTA 3FYUA 3IA2A 1UOQA 5IVIA 4OU4A 2V97A 2GYWA 3M81A 1K5PA 2OCLA 4KE6A 3DD5A 1HKHA 1CUUA 3H1BA 1WOMA 4K2AA 2AJLI 2XUAA 1ZGBA 1LPAB 4JEIA 1AKNA 4MQMA 1CUYA 4B82A 1XZGA 1UOPA 4U2GA 3IBTA 4EY4A 2OQIA 1GZ7A 4GLBA 5AOBA 3WL6A 3HACA 2Y6VA 4EZIA 4C4YA 2QJRA 2VJDA 5LP1A 1ORWA 1I6WA 2FJ0A 5YASA 4CG3A 1RP1A 5A7HA 4X6YA 2H7XA 3SK0A 1TAHA 3D2CA 5DTIA 2O2IA 3VJMA 1R9MA 4YASA 1R4ZA 5JZBA 1ZD4A 1C7JA 2CEKA 5JD5A 1MTZA 4JUIA 4NS4A 2ECFA 5CT8A 3VXKA 3CN7A 3EIOA 2X76A 1MX1A 4DTCA 3IUMA 2HA4A 3MUOA 4ITVA 2CBGA 3O4JA 4Q05A 3G02A 4FMPA 5FPPA 4H77A 4OYLA 4D9JA 2DCMA 1XZJA 3OM8A 1UKBA 3LS2A 5IVKA 1DQZA 5AKHA 4B9EA 3WZMA 3FNBA 1J06A 4O08A 5LZ4A 3F98A 1SCQA 1DWQA 2HL6A 4E11A 2FX5A 4F5ZA 3QPDA 5CBKA 1MAHA 1QIMA 4BATA 2XE4A 1CVLA 3I6ZA 3AIMA 4BP8A 3C8HA 3PUIA 3G9XA 1XLVA 2VEOA 2V98A 2K2QB 4Q82A 1UK8A 3N0TA 1FFCA 4HS9A 5JAPA 3P2MA 4FKBA 3WIOA 4BVJA 4CG2A 1BU8A 2WJ6A 3AZOA 4QWWA 4HXGA 1CUVA 1SOMA 1XRLA 3A2MA 1ORVA 1GQSA 1QGED 1XZLA 3ZPXA 4BAZA 1THTA 2CJPA 4N8DA 4FNMA 5E4JA 2XUHA 2OAEA 1FFBA 4Y2RA 4H0CA 5AO9A 1UK6A 4WCVA 4WDQA 4UFOA 4Y2VA 4DMKA 3DL4A 3BIXA 4J0CA 2ES4A 1Y7IA 2ZYSA 4X7BA 3AJAA 4KACA 5ALHA 5AI4A 5AM0A 4GEGA 4AMZA 3L1HA 4UFNA 4EY7A 3VJKA 5HFAA 1GGVA 5KWJA 2RAUA 4UHBA 4TPKA 1MX9A 1ZJ5A 3K6KA 4FFWA 1L7AA 3OURA 4KE8A 5AOCA 3BWXA 5FPQA 2WJ3A 2WG0A 3BL8A 2RI6A 1XZFA 4FNGA 1TCAA 1YS2X 5AKJA 4OPMA 4B85A 4A5SA 3VKFA 2Y6UA 4EY6A 4K6HA 2H1IA 4PV7A 4UHDA 3GROA 1CUSA 1JI3A 3ESBA 4CFSA 4X6UA 4C4XA 1CUBA 2WFLA 2Y2UA 5DYYA 3BIWA 4X71A 4C4ZA 5SYNA 1YASA 1CFJA 4G9EA 4KYVA 4QDUA 4H7IA 2RONA 2CB9A 3C43A 2XUIA 3BXPA 2VA9A 1XRRA 3C5WP 3WL5A 3X3HA 2WTNA 3KOOA 3GUUA 4PW0A 2JGMA 5CTAA 1XZCA 1ZD3A 5A6VA 3QMWA 2VT7A 1AQLA 4LXHA 4NZZA 1YB6A 1QO9A 4Y2SA 3DEAA 5ALOA 4P08A 2XUDA 5K3FB 4FTWA 4AN1A 1GPNA 1BE0A 3FSGA 3WI7A 1QTIA 2GZSA 2OQVA 4BZZA 1O6FA 4GW3A 4AO6A 5ALDA 3WZLA 1GKKA 3WK4A 4Q3LA 1P0PA 1N1MA 2Q0XA 5SYMA 3E3AA 3CCCA 2QS9A 3CCBA 1DINA 3IULA 5AICA 5AI0A 5DNUA 1BN6A 2ZYRA 4RPCA 3GZJA 3EQ9A 2WFZA 5IVHA 3U0VA 1IUNA 4ZREA 3V1KA 1D07A 5ALYA 1A8SA 3E4DA 4W1RA 1F8UA 3BJMA 2C58A 4U2CA 5FP0A 3FYUB 2XMGA 2PM8A 4G8BA 5JASA 4L3WA 1JKMA 3FAKA 3WK9A 4DSZA 5HQ3A 2RHTA 4BCDA 3D0KA 1YS1X 3QZUA 5AK5A 4UFPA 2XDWA 2HU8A 4KEAA 3ZV7A 5HQ3B 3QPCA 4QA9A 3WL8A 2ROQA 3HJUA 4UBMA 3W2TA 5KREA 1LZKA 4F21A 1LNSA 5AI5A 2PL5A 5T4HA 1LPSA 4BP9A 3WL7A 4N8SA 3UUEA 3FLBA 4H35A 1Q0RA 1E89A 1E3QA 2WQZA 2H7YA 3DLTA 3LP5A 3DOIA 4ROTA 1VZ3A 2XMZA 2AJBA 2BAGA 1CPYA 2GBCA 3DL7A 1Q0ZA 4OB6A 4L9AA 4X3CA 4IH1A 1BROA 5LYYA 4X92A 1XFDA 5FUMA 3HEAA 3WK5A 3FOBA 3WWPA 5LZ7A 1W1IA 3PUHA 4DNFA 4ZXFA 2BUBA 1WCYA 4BTVA 4G4IA 4H7JA 4QZVA 4J03A 5EHNA 1EDBA 1XZIA 3R40A 3RARA 5C8VA 2BUAA 5HF9A 2RHWA 4JYPA 1EDDA 3KWJA 2BGNA 3R41A 3NOXA 2PSJA 2VAXA 1ODCA 1XRNA 3DYIA 4DMHA 5HF8A 4BRSA 1ZGCA 4W1QA 3V1NA 3C8DA 4HAIA 2ZJ6A 2XUQA 1OCEA 1QE3A 1TK3A 4OUKX 4X97A 2JGEA 3G0DA 2G5TA 5AKEA 4U2EA 4V2IA 1USWA 5FDFA 2FUKA 3ZLUA 1YAHA 3I2GA 3ZLVA 5D7BA 4N5IX 4DNPA 4UUQA 4XX1A 1CUDA 1SCKA 3STXA 1AURA 1U8EA 4A16A 3T4UA 1CUAA 1C7IA 1JMYA 2Z8ZA 4A23A 2PVSA 2JGKA 1LPOA 1VA5A 2IITA 2WIJA 5CT6A 2O7VA 4MQLA 2DHEA 3M3DA 1XZHA 2WLSA 4X93A 4UHHA 3V9AA 2DQYA 4B81A 2VAVA 3H2KA 4BVLA 4QNNA 3WYNA 2VJAA 3UUFA 1ZOIA 1W75A 4PO3X 1CUFA 2VTVA 3ESAA 3RKSA 3WKEA 3G9UA 3DKRA 1YB7A 3OC0A 2XMQA 1A7UA 5AI6A 4LHEA 1N5MA 1WB6A 4W63A 1MJ5A 1THGA 2XQIA 5AM3A 1MN6A 2PSHA 3D59A 3TEJA 1H2YA 1VKHA 4XIIA 2PSFA 4DMCA 4EBBA 4F0JA 4X85A 4FBMA 3WJ2A 2W22A 4KR0A 4HXFB 3GA7A 4J0HA 2V96A 3F67A 3A70A 4MWTA 1MX5A 2Y2VA 3G9ZA 1XZAA 2WIDA 5JALA 4WY5A 3C45A 3V1MA 1GPKA 1F0PA 4BB0A 4J0DA 5D3KA 2HFKA 4J3JA 2EDAA 3M83A 2HHAA 3F8SA 2OPHA 3B3QA 1C4XA 3I2KA 3LLCA 2GBGA 4NMWA 5ALPA 4DGQA 2XQFA 5LZ5A 3STYA 5EIEA 1GT6A 3C70A 5DNWA 3BDIA 2Z5GA 3FVTA 2J4CA 4Y2QA 2WUEA 4CCWA 3VVMA 3FYUC 4W9RA 3EF3A 4EUSA 1R88A 3WK6A 2OXEA 2R11A 5BWBA 2JBWA 1QTRA 3STVA 1HPLA 1XROA 1L7QA 1YA8A 3QMMA 4AMYA 1JMKC 4HRYA 2PU7A 4H7HA 1T4MA 1L7RA 4U2FA 3LIPA 1AMNA 5FRDA 2WG2A 3C6ZA 1HQDA 4BAUA 5AOAA 1MU0A 1CUWA 2VATA 5JZ9A 1WB5A 3FWHA 2OCIA 5D3ZA 3VJLA 5A2GA 2XQJA 4QDZA 4B80A 2BJHA 4G5XA 2XMDA 3NGMA 1LLFA 3YASA 4DYHA 2WIKA 3WQHA 1ZICA 5FOQA 1QZ3A 4AZ3A 2QR5A 4IHAA 2Z3WA 3RK4A 2H7CA 1MAAA 1VE7A 4PSCA 2WHQA 3R0VA 3IUJA 1PFQA 4J0IA 4WJLA 1XLWA 4DNOA 1EH5A 3S8YA 4BC0A 1U65A 3QYJA 5ALUA 3L1JA 5EIHA 5EHQA 2CZQA 2WFLB 3C5VA 4CIAA 4EA6A 5JAOA 3FYTA 4WFKA 1ACLA 2B20A 4KAAA 5JZSA 4MYSA 3HZOA 2Y1KA 1XLUA 3VDXA 4F60A 4G4GA 3MUNA 5EHZA 1ZIXA 2WG1A 4IH9A 4UBJA 1LPMA 2C4HA 1IUPA 3LIIA 1EHYA 2G5PA 3OG9A 4J7AA 3O4GA 1JFRA 1IZ7A 1E5TA 2HRRA 3O0DA 3HYSA 1UWCA 3B5EA 3G9TA 4Q3KA 1CR6A 5ALRA 2G4LA 2X8BA 1AX9A 3O9VA 5JYCA 3K2IA 4AX4A 1H2XA 4Y9SA 2XLCA 3IUNA 3NUZA 2ORYA 3V48A 1W52X 5AK6A 2B4KA 5CT4A 1TKRA 2GBIA 2HDWA 4HTAA 4ZWNA 1DT3A 1EB9A 2DHCA 5ALGA 3F9CA 5AKIA 4U2DA 4CG1A 1JJIA 4FLEA 5A7GA 4BTLA 4BVKA 1K8QA 4UPDA 5HZGA 1A8QA 2JGJA 1WB4A 2J3QA 4KE9A 3H18A 1EA5A 5A71A 2GYVA 4KAJA 1KEZA 1Z68A 2QUBA 3A2LA 4X00A 2WHPB 4BRZA 5CH8A 1AUOA 3I1IA 1BEZA 2CKMA 2J3DA 1QIIA 1ZJ4A 3I2HA 2JF0A 3IVMA 5AM4A 1YAJA 4B7ZA 4RNCA 3AZQA 1UK9A 4KAFA 4Y2XA 3FLEA 4GXNA 1UOOA 1GXSA 2I3DA 5AKLA 4Y2YA 4B0OA 4B0PA 2XUPA 4AQDA 1CUCA 2WFMA 4RGYA 4BE4A 3BDVA 2OGTA 2WM2A 3DOHA 4UBIA 4GECA 4DIUA 2J4FA 5KWIA 5K3DA 5ISMA 4NVRA 1H2ZA 2QVBA 4LYDA 3W05A
chains in the Genus database with same CATH superfamily
2H63A 5B37A 1Z5VA 3LOPA 2HSWA 1T0UA 2QUIA 5DTJA 4IWNA 4CIWA 5JJIA 4RZHA 3DYBA 3PHBE 4KMSA 4BUZA 4MP3A 3UCFA 3C6XA 4PN7A 3VOTA 1AZLA 1FE8A 2QIOA 3PITA 5L9AA 2DBRA 4E14A 4N5HX 3RADC 5HF6A 1QYDA 2I6SA 3C5HA 5K0SA 5FTMA 3LQYA 4FI3F 4RF5A 1OI7A 2ZOSA 2ATXA 3NTVA 4N3CA 5L4SA 1N5IA 3C6KA 1T36A 2QL9A 3BB4A 3D7MA 1CZNA 2R7AA 1IAQA 2W11A 1Y4DE 3CX7A 3FHTA 1B7GO 2G0AA 2YXPX 5KTRA 1W4AA 5EWJB 2R1ZA 2XI4A 2PVPA 2YIVX 1KGDA 1PK8A 5H1YA 1XKTA 4NHOA 3TW6A 3ZU5A 5IULC 4ZTUB 3HU5A 5CFQA 1BMFA 5FKJA 5EJ8A 4PZLA 4GUDA 3ONWA 1MW8X 1EVJA 1TE2A 2Y0PA 1YVEI 5FA6A 2DTXA 1ZHFA 2C8JA 1K6XA 1DVRA 2UUBB 3BXHA 4P33A 5A9RA 3U4QB 3BD6A 3AVYA 2RGGA 3ZKWB 3ISJA 5AIBA 3E8XA 3OETA 1DTEA 2PEYA 3ENZA 2FEPA 5DWQA 3PF8A 3TD2A 2PEZA 1MNAA 3Q2KA 2QN1A 4BBZA 4ZVPA 1PVOA 1S8AA 1Z06A 3ESYA 3Q4GA 1F48A 3ODPA 3VO8A 1LNZA 4DMMA 3PPWA 4KP7A 1JHAA 1DWPA 1E66A 1ORDA 1R8XA 1Y9AA 4RD6A 3FZEA 1MO6A 1NVAA 1QHNA 3NBZC 2QLTA 2WC1A 1QKJA 3OD1A 2EFEB 1IZ9A 4YAJA 5JSZB 3OLVA 4MWOA 1XZ8A 5COAA 1E64A 3ACCA 3NVKI 1A8UA 1L5VA 5JAZA 5AKZA 5K3BA 4D9FA 3G6WA 1ENOA 2OAGA 2P67A 4IXDA 4Z3KA 1XFAA 3U37A 1NY5A 3HGTA 5IYZF 3RSHA 1PWEA 2QAJA 2YJTD 4LCJA 4AFNA 4ZYYA 1M33A 4K3UA 1F3OA 3OH8A 1OILA 2HBQA 2EZ8A 3PGLA 4XE5A 3CNLA 3ZE9A 4CJXA 4B84A 4F8JA 4DIBA 2D54A 2I87A 1J99A 3ZGYA 4KE7A 5KVSA 2P75A 3DV0A 3PQDA 4YNBA 3GJ4A 2I22A 5EZSA 1BN7A 4KDFA 1Y33E 3CB2A 3W7BA 1PZMA 3ZCXA 3HSKA 4M7PA 3OO1A 1VE9A 4V24A 4RD2A 2AJ8A 4R6XA 4IIJA 2ACEA 2GERA 2Q5OA 3I5MA 2F8LA 3UWMA 2XLBA 1ULZA 3L82B 1PJAA 1Q19A 3KQHA 2H18A 3MMPA 2DTEA 1OBCA 2P5YA 5E9AA 4RKFA 3CRNA 1D7OA 1ESZA 1ISHA 3F2IA 4FK8A 1HFWA 4NZNA 5CLJA 1XTUA 1L5HB 4AICA 1Y0BA 5IT9A 3WO1A 4YP1A 3PSHA 2W98A 1FTYA 2X8JA 3L7OA 1D2RA 3QSGA 1EX6A 3OFKA 4Q34A 2FLVA 3HYLA 3IKVA 4V38A 1NKSA 2F59A 5HQTA 1NZDA 4Q4JA 1V4VA 1XWIA 3HADA 5A4JA 4TKMA 1JSXA 3AOEC 4RE5A 4HLQB 4PWYA 4RK5A 3ITNA 5DTMA 2X3YA 1SC4A 2FZVA 3P2EA 4UUPA 4W1SA 4B2PA 2H54A 4IDBA 1WUTA 2ZUSA 2XWPA 4EPTA 5B58C 5SY6A 2YWFA 1EXNA 4GDMA 1A2QA 4IYRA 3WGKA 3EG9A 3OJFA 4LPKA 1BQEA 4ZODA 1UIRA 1QPZA 3UQZA 2ZSKA 1U0FA 3DW3X 4P6VF 3OT4A 1PQPA 1WVGA 3C7AA 4OXRA 1H22A 1R9NA 3Q8MA 2O2GA 2BBSA 4BKQA 3JZAA 2O2HA 3O4HA 1HI9A 3IIIA 1TUBB 4CQMB 3QP9A 4INPA 4JJZA 3EPPA 2YX1A 1SQ6A 5DW3A 5CYGA 3T52A 2PZ8A 1PJLA 4EMSA 5D6OA 4E5YA 1ZOPA 1PR4A 1TT5B 2QAGA 1JV2B 2R5WA 1QH8A 2H17A 3IVRA 3M5CA 4O33A 4OHMA 4ZGBA 2IOQA 3E8MA 3RVQA 1PLLA 4QU0A 3I9V1 4H16A 4S1OA 3EBLA 3SJCA 2I34A 1W88B 1L4EA 2FR0A 3GPDG 3D3QA 3IFSA 2X5XA 2PUJA 4C7OA 1WCXA 3FVQA 4J91A 3DHNA 5EE3A 4DLXA 1EESA 1KO7A 3OTIA 4HGZA 3OFSA 3K2QA 5A3JA 1LX7A 2EWWA 4ZOLA 2QDXA 3KTAA 3PUWA 3D5EA 4X8OA 5JSHA 4KR2A 3BSSA 3D2BA 1CEEA 4ITUA 2WIFA 1BD4A 3K72B 3O1LA 4DV4B 2WPNA 4WZZA 2HLNA 1U0JA 4CTJA 4K9SA 3WKAA 2O8FB 3HA7A 1MZVA 5BMOA 5F5LA 4CLDA 4KKXB 4TZTA 3ZLJA 2J9YB 3F5DA 3F90A 3AX6A 5HZKA 2J48A 2GJ4A 3TFQA 5BW4A 4AJJA 5DXFA 1ABBA 4PLZA 5F2EA 4KRXA 1OBOA 5HWSA 4AC9A 3EBPA 2B0CA 5JXWA 2XYVA 5HYVA 2JJ2D 1J1IA 1F51E 3SX2A 3LNTA 5GONF 3JVDA 2RBGA 1XQ9A 2BCEA 1Q1EA 3IQXA 4JMPA 3VR6A 3PXAA 3ZDRA 2RHBA 4FS8A 3ZIAA 3E22A 1YR9A 3GU3A 3LKVA 3PXCX 2NV0A 4KU4A 3M5PA 3MWJA 4KUGA 5IKPA 4N8EA 5ECYA 2WINI 1N6KA 1K88A 1V43A 4MRSA 1VGQA 3HP4A 1RXSA 1WDKA 2LCFA 1MA3A 2ON6A 3EIWA 2JJ1A 4GLJA 1X1SA 1E3WB 3DE5X 3N2IA 2I67A 2PBLA 5HK9A 1HLGA 4MVJG 5TLSA 3RJ9A 2WYOA 3GO4A 3GVIA 3H8SA 5AUPB 4PSAA 5IYZB 4MVJE 2RIRA 2HADA 4WQMA 1WU7A 4Z86A 2X19A 4HADA 4NLLA 1JHUA 1Y3HA 4D99A 3D4NA 3H0CA 4Q21A 4ME6A 2DEUA 1U1DA 1TFUA 4GP6A 2GM4A 1TVKA 2JBHA 2VPQA 4G85A 3U4AA 4NCJA 1N25A 2FSIA 3ABOB 2XVMA 3IHTA 1O58A 3PLNA 1PGOA 5H16A 3GELA 5KTSA 3LPAA 4OK6A 5KX5B 1XCBA 1BCSA 3N2KA 4WK6A 3D8NA 3SPXA 3PXGA 3R9IA 2PKYX 2P65A 1I9CA 3IOYA 1NQWA 4LWPA 4NESA 1QAOA 2GO1A 1LRKA 4C87A 4UHKA 1LSSA 3TDNA 2VPWA 1B16A 1PNTA 4CKXA 2A9QA 3SSAA 3N2LA 4F4JA 3NANA 3LCUA 3AW8A 3P4UA 3CM0A 3OM1A 1DRJA 4OBBA 5DLQC 4YUYA 3W9UA 4O4HB 3F73A 3ICEA 4CM7A 2BDUA 2GKGA 2VDKB 1ZI9A 4KAXA 3JW8A 2ZIUB 3K53A 3OOSA 4JD5A 2ZSEA 1HL3A 3AHJA 2A35A 2E7ZA 3PNBA 4I66A 4NSNA 1BDBA 5EJFA 3BDAA 1JFFA 3EF0A 3WRXA 1U2PA 4OG2A 3SBDA 3PNOA 3CPHA 2O6LA 1E2MA 2HIMA 4ES6A 2FEKA 3PKIA 4UEWA 4ZAWA 4CMBA 2ZZMA 1RJEA 2WP8J 3DW1X 2J41A 3GFTA 2ZYVX 3AILA 5CMLA 1SVIA 6CHYA 4QTUB 1CY4A 4TL8A 2ZCJA 1QWOA 2CVQA 2EYUA 3HNPA 2J9ZB 3PEEA 4TTJA 5DYNA 2H59A 2XZLA 3FMGA 4NBSA 4YP7A 2ZCUA 4MWSA 2Y3IA 1FTQA 3OU2A 3A58B 4EJSB 1YF3A 2TS1A 4YLEA 3KQTA 3V8PA 4PG8A 2CLFB 1G20B 2G77B 2F9MA 3GJ6A 3N58A 4J16A 3K8ZA 4KUHA 3OZBA 4OFXA 1L1EA 1MVLA 3AKZA 2Y4OA 1VOTA 1U4SA 2O0MA 3Q9SA 3FPEA 3T4EA 4OYRA 5CCXA 5CYPA 1TT7A 1U0SY 2I78A 4KYTA 3MJRA 2VDLB 3U3XA 2P2LA 1FUKA 1W5AA 3BL5A 4FNAA 1T5OA 1CJUC 2F90A 4OAQA 3V2GA 1XDSA 3OPMA 5B30A 4LOJA 3S2YA 2PZBA 2XT0A 5I5EA 2RBKA 3W5VA 1SUBA 4DDVA 1A9TA 4DMRA 1W2HA 2ACKA 5K4GA 3MGAA 1JR2A 1QFXA 2VNJA 6AT1A 3OZGA 3F3YA 2Q5EA 3G0CA 1VLQA 5E6UA 4FKMA 3QSYA 2B6HA 3USZA 5A2QA 2HA3A 5ELXA 3U1TA 1JEYB 3SMVA 5JSZA 1S4MA 1YKSA 2AXEA 5BWLA 3IB3A 5EXXA 1WSWA 1UUFA 3KIPA 1XDDA 4ZCTA 4D56A 1ODKA 4DUZB 2GXAA 1B23P 4FJ2A 3K8QA 2P9YA 4LZZA 3PT5A 2H1OA 2JW5A 1VJ1A 4DV7B 1ADBA 1RKVA 1T15A 2O3JA 2OV1A 1HETA 2B8JA 1JG3A 2DGDA 4HWTA 4DWOA 3CO5A 4MP6A 4QUEA 4G9GA 5JNUA 1RMYA 2OP1A 5K2MA 5M34A 4NABA 5LP6A 3DO6A 1Q0SA 4DC0A 3U7EB 2Q3HA 3W04A 3PCTA 4CUJA 3IE1A 3EGDB 1SVWA 4N9QA 5E1OA 3N05A 4OHXA 1X87A 1M34B 4DJ5X 1NG9A 3TTWA 3LLVA 5CUQA 3R9XA 5DLEA 3UPTA 5ALQA 2QP3A 1G5HA 2FHPA 5BRJA 5IF3A 1HR0B 3V8QA 5I3ZA 2NO9A 3ZR4B 3GWGA 4IKPA 3OTGA 1Z6YA 1RQ2A 3TQIA 5CH5A 5BQFA 4X54A 1MNQA 2V54A 2X8LA 4MWDA 3UT5A 4EA7A 1G4AE 1PZXA 2QG9A 2Q6VA 3A7EA 2APJA 2PA3A 2YZKA 3UAYA 3CEJA 4YYEA 1ESDA 2I3GA 3EFOB 3TQCA 1MDFA 4BIMA 1Z07A 2DERA 4D42A 3QW4B 4H18A 4D9NA 3G0GA 1SC9A 2VK1A 4CE6A 1QRAA 5MN6A 1UINA 1LSOA 1R0SA 3ZTYA 3ICVA 3VZSA 1KI7A 3M4XA 4QOSA 1ONOA 1M8KA 4QPPA 1ICIA 4RE6A 3EEBA 4OMUA 1FFHA 3SMQA 3EX7C 4IJUA 1K75A 2QUAA 1S1MA 1RTTA 2VKQA 2ZJ4A 1TU0A 4IXNA 1R4NB 1M0WA 4KITB 5JXIA 2CB0A 4ED9A 1B8UA 5DXJA 4B8YA 2HA7A 2EJWA 3OZFA 3UWKA 4Y3UA 5CBPB 4MUKA 1GM5A 4EG5A 3WLKX 1L8AA 3RFFA 3MWYW 2JLRA 4N0EA 4TTRA 4Q5IA 4KJXA 1P5FA 1Z2EA 3JATB 4LYHA 4UMDA 3OQMA 3IDAA 1WHTB 3N07A 4ZYVA 3FLMA 4G1UC 4LE0A 2B61A 3ANTA 3ETEA 1B74A 1HURA 3JQ6A 3MJHA 4MS3B 4OBWA 1FDSA 3BWCA 5DPMA 1Z2DA 5EIAA 2VR1A 2ZJ2A 1QHEA 3IVXA 4OLHA 4PSUA 4WOCA 1DCKA 2CLIB 2XR1A 3AO0B 1A27A 1WWKA 1CQWA 1KA9H 1W85B 2VWHA 3O7WA 4UQPA 4DDTA 4GBJA 3RKRA 4GX1A 1D0SA 1R6DA 4J0JA 4XJVA 4ARBA 3GCZA 2PGJA 2P6UA 3GBSA 4ZO7A 1QIKA 4IG9A 3ZY6A 4JI3B 4P7BA 4C88A 2VJCA 3SIRA 4QLBA 3HYCA 4P92A 4XJXA 4F3RA 3FR8A 1AKQA 3QTTA 3D2AA 4DEXA 1E8NA 4P80A 2X0DA 4F2GA 5JZOA 3EMKA 4MWGA 4HDKB 1VIAA 4ZOLB 3SZUA 2GJAA 1JR3D 4CETA 5AM2A 3EGXB 4YMTA 3R7LA 3ACBA 4R1QA 5IHXA 4XQCA 1L8LA 4PYKA 4HC4A 4U9UA 2FSUA 2R0QC 3H9GA 4R3UC 5M7EA 2YWHA 2A3NA 1GKYA 3TAUA 4EQZA 1P4AA 5IFKA 2PX4A 3KXPA 3UK0A 4CM9D 3THXB 4WKNA 4XYGA 5JU6A 3A1WA 2BZSA 1Z4NA 4L2IA 4B17A 5CB6A 3M3HA 3NBYC 4UTRA 4CCSA 1Y7HA 2MT9A 4HEA6 4L9RA 2QX4A 1IC6A 3D5TA 1CZKA 2OB2A 4R68A 3HNRA 3WYAA 3Q98A 4CQMA 4IV0A 1NKVA 4W99A 4A26A 1S4QA 1BE8A 5ALIA 2ETVA 4EFNA 4HAXA 1NDHA 4LV6A 1J70A 4HZGA 4TLDA 5JFGA 6ABPA 1F0NA 5AJHA 5F1YA 4V1CI 1QG2A 2GCGA 4JL8A 1U1EA 3WSTA 5FBRB 3N74A 3T3DA 3MOSA 4MAAA 2C9YA 3VPXA 4RUKA 3U5ZB 2BGMA 1KJYA 1JHMA 1MO2A 1FRZA 1DWOA 3AGPA 3CVOA 3L01A 1X7DA 4HEQA 5C7YA 3G1WA 4B6RA 4D9GA 3TRDA 2YV5A 4G3XA 5IG2A 1W7AA 1A4XA 3BRWA 5HIIA 2HU7A 1E60A 4TVKA 6Q21A 3QH4A 4WL0A 2WHRA 4E51A 2YS7A 1M10A 2EEPA 4R41A 1BOFA 2ZPTX 4UDNA 3B9PA 1YIDA 1PF7E 2R86A 3I0ZA 5K3OA 2CXXA 1ODLA 4G26A 2G82A 4GHWA 1UQUA 2C5LA 3H13A 4RPGA 3JAWA 2VXOA 2XMBA 4CF3A 3T3MB 3R3WA 1EUDB 2ZWOA 3EVAA 3KQMA 4A0RA 3ESRA 3MM4A 1IY8A 3TIXB 3RH0A 4GI7A 2CGEA 1H6AA 1QYRA 2FK7A 2WU4A 3A10A 1ZEJA 2QN3A 3C7DB 2O57A 2ZIAA 2EQ5A 2UZIR 3RSZA 3TI9A 2HCFA 4I14A 1EVKA 3D7SA 4B8ZA 5CA1B 4HWGA 1LK0A 2GK4A 4JLVA 2DWUA 2FAXA 5ALZA 2G63A 4RMIA 3B36A 2QENA 2J1LA 4XFKA 3SSMA 3E6AA 4MYTA 2FB9A 3CY6A 5F2KA 1ELOA 1WP4A 3QFCA 4LSGA 4U6QA 1WTAA 3LCMA 2JDIA 2P5UA 3K70C 5AM1A 1UP7A 1Z4IA 4FOLA 4LI3X 4JS0A 1Z22A 1V45E 4NONA 5EINA 1JEAA 4Z0TA 1OROA 3GPIA 3HSSA 4YAOA 5DRYA 3C24A 4YK7A 4EUFA 2ATIA 3OOEA 3GJ3A 5ESRA 4DA0A 1CZLA 1L5MA 1OLSA 4KSYA 1ZAKA 2ZJAA 3FYDA 1GEEA 4DOMA 1E2PA 2OBXA 4OIFA 1N2HA 4LHZA 1E0AA 4C7BA 2P7IA 3ABZA 5FUVA 2IH2A 1Z6TA 3DF9A 1VPLA 1E20A 1Z4LA 3NMUF 1J8QA 2BFCA 2QSZA 3Q12A 3L7MA 1SUEA 4QTTB 4AO7A 4DR6B 4AJLA 4YAGA 5T4EA 1EBFA 2C0PA 3K16A 1NW8A 1KMMA 1PJRA 3NDJA 3PFNA 1TEVA 3QHAA 4GLLA 4IBOA 4MPJA 5LDHA 1QQ6A 4KFCA 4BX3A 2YYYA 2FPXA 3CR3C 3KYJB 5GJVC 5I9SA 5JBIA 3C4VA 2BFBA 4AY4A 2X9QA 2R6GA 3D0RA 4F96A 4QDTA 3F1KA 3LCRA 4DLNA 4MKZA 3HTXA 1PKXA 4F5DA 1XUOA 4O2AB 4UM8B 1MO3A 1SG0A 4I46A 3C1AA 5J4YA 3EYAA 4PC2A 1Z3IX 3D6FA 3IBYA 1V6SA 2I2WA 4MCJA 4NCNA 4Q24A 5DN9A 1G38A 5GTDA 2G1PA 5EXPA 3DDNA 4Q3OA 3JATA 4DT1A 4E1AA 2W6MA 4PNEA 1Y42X 4NR0A 4DBLE 1K3TA 3DV9A 3AESB 2I99A 4X1KA 4ZOLF 3AJDA 1SWVA 5KKNB 1ZM2A 1CRZA 1V48A 2GGSA 1EFPB 2NU6B 1HDEA 1QPBA 1M5RA 4NCAA 1A4UA 2Q7XA 3O7MA 1HL7A 2YCBA 3AR3A 5DGHA 3KETA 5LZ2A 1OB2A 3D3NA 2E4ZA 5EKSA 2OZLA 1Y1SA 3IAAA 3LWZA 3MINA 3QLUA 4NYMQ 4GQAA 2QGNA 2C31A 2Z4SA 1GCIA 2ZRQA 4FW8A 3WR5A 3TLGB 2C5SA 2HEGA 4JR1A 3UJ9A 4IIBA 1VRCA 4QBGB 4EOGA 3FBWA 5JY1A 2OPBA 2WKWA 1QM5A 5K8UA 2BMDA 4IINA 5JJKA 5JAUA 1R27A 2H0QA 1QQ7A 4O4IB 4UDOA 1BNCA 5JD3A 1B6GA 1SQ5A 1ZONA 2C96A 3NRBA 5JUWA 4YONB 3RFUA 5J23A 4QHTA 5LLSA 4YCAA 2WJAA 3K30A 3WV5A 2ZREA 5U1PA 4MSUA 3KKQA 1URPA 3AXTA 4F84A 4DR4B 5KVAA 4U0KA 2ZE5A 4IICA 2IWRA 4PNPA 3MCTA 3WS7A 1OPXA 4WWHA 1B8OA 3BSWA 6REQA 4QVIA 4MQ5A 1SXPA 3A3YA 3QG5A 3MRTA 3R9XB 2CUNA 4LJ8A 2CC2A 1TM7E 2XZDA 2Y77A 1GOTA 1CQJB 2WZCA 3GGJA 3REGA 1KPIA 5C81A 1T91A 2AZTA 3FROA 3ZHXA 5TIIA 4Q02A 4BDTA 1DXQA 3HJGA 5ADWA 5AK3A 4YDQA 4C21A 2X9VA 4Q9LA 2TYSB 2V7UA 2AMVA 3D4LA 3A3NA 4E5VA 2A7XA 1A98A 2QJWA 5J5VA 4JLPA 4CLEA 3D43A 1NYQA 1VJTA 3PUKA 5JRDS 3TNYA 3QLJA 4WN3A 5A5FA 3ICWA 4M87A 3L6RA 3R77A 1IG0A 1U0RA 5JQWA 2PFSA 3CH7A 2GWHA 2V7WA 1GQRA 2H51A 2YJ4A 2YRFA 1KS2A 3C87A 3IT0A 1NU6A 1KTVA 4DS3A 5G3ZA 2IRWA 2OR3A 3MPOA 1KKMA 1VMIA 2V6BA 3T12A 5F52A 5HK8A 1W30A 4X45A 2VHEA 4MV3A 3SDSA 5CVDA 5IANA 1WOYA 1HLFA 1Z2NX 4V3BA 1EWKA 1TCCA 3CONA 4M1MA 3W9YA 4EQ6B 2A5JA 3BJZA 4XVQA 5J2TA 2EKLA 1ONNA 1Q83A 1GCAA 2FFHA 2MSLA 5ALKA 1QR6A 1BDIA 3H2YA 1EUDA 1MJFA 1RYDA 1VBMA 2QM3A 2ZSIA 1HOXA 1T6NA 3VR2A 4YJGB 2XTNA 2QGFA 4A0SA 4KN8A 4Y2JA 1UANA 4UEJA 4OD0A 5B2ZA 2VUTA 3P8ZA 4K9LA 3AERB 1PNOA 3JASB 1OV6A 4G5YA 4JB3A 4QOGA 2R6AA 4XVHA 1NLFA 1CLEA 3K5WA 3KVRA 1LBEA 3VBCA 1KY4A 1C9JA 1LPNA 1MORA 4S1WA 1LI5A 1YE5A 2HK7A 2R97A 3F4BA 4GM0A 4GXTA 4H1VA 2Y1EA 4JBNA 3SCZA 4A92A 2XY4A 1WZUA 5C7OO 2ATCA 3JQFC 3NKFA 5AVQA 3JPWA 1Y6QA 1CQZA 2BBOA 3MFYA 2RE8A 2JRLA 4WGGA 3WGTA 1ZRMA 2UYHA 1DPFA 1QFZA 2LV8A 4O29A 1FU7A 5I7FA 1F7VA 2B5VA 1JG7A 1AUQA 3UOWA 1KJQA 2B1RA 1B93A 1K86A 3IJPA 1ZBQA 3N2GB 4JC5A 5ARCA 2DHDA 5B5SA 4R1SA 5LWHA 4PAMA 4PFKA 1XHLA 5ECGC 4EG7A 3M9XA 2VWGA 2V7QD 2CNWD 4JC0A 4JLSA 4ZKDA 4CDMA 4TL7A 1EHCA 4BB5A 5FNVA 2B3TA 4A15A 3BMOB 4R1OA 2OY0A 1WM1A 4HNHA 5D86A 5HILA 1JIJA 1XALA 3N3BC 1EFTA 2FPKA 2IUFA 3AVOA 3BXOA 1QDEA 3MCZA 3N8IA 5DCUA 1AY0A 1XNHA 3TVTA 5DIZA 2UXDB 3PKJA 1U99A 2W6NA 3D5QA 3M82A 2MMGA 4KXMA 3IEVA 2C8VA 1IQRA 5EI5A 2IYXA 5EGSA 5AVTA 4O5OA 3MOIA 3DA8A 5FOUA 3ZHVA 1P7CA 3SQWA 1RI3A 2WWTA 4RVCA 2PJUA 5BWCA 1CJKC 3N9IA 2IYWA 4DM4A 1IY0A 1KZ7B 2P2DA 3PXUA 3G6KA 4ID3A 5CP8A 2QRZA 3LBNA 4PYLA 4DAOA 5LQRA 1P31A 3KYDB 2AKEA 1FBTA 3EVNA 5A4AA 1U28A 1OBHA 1UH5A 3O3MB 1S1CA 2WPDA 2RI1A 4G0XA 2YXEA 5KC8A 3MA0A 3N87A 1I3MA 3F2VA 1A5BB 1TVKB 5G1NA 4LRYA 1RJFA 3KR9A 4HEA1 9LDTA 2Z3VA 1WRBA 4AKHA 3CINA 4CMKA 1ZNYA 2C7OA 1C8BA 2P4QA 3OVMA 2GR9A 4MINA 4DSAA 2QLBA 5KHAA 4I3FA 4L16A 5JO9A 2QTBA 1QP4A 1POXA 4GMXA 2YJNA 1QIFA 1SBNE 2OGUA 2V0GA 5CDGA 5DGTA 4ISBA 3H3JA 2ZBRA 2QX6A 4Q66C 1NJ1A 4P4SA 1QRSA 3G9QA 1Y98A 5ICFA 1QIEA 3TUJC 1KSGA 1P7YA 3B1KA 2GCOB 3E7PA 2J30A 2GNAA 4L0CA 1KPHA 3L5OA 3HPQA 2C5FA 9LDBA 5ALSA 3NRJA 1C0IA 4QJBA 3S0JA 4B2YA 10MHA 1JTFA 3WRXC 1XTKA 3ITDA 2MYUA 2GSWA 4X90A 1SU4A 4L5JA 1GUYA 1GZDA 2DY0A 3KEQA 4Q7KA 3A25A 4QDOA 2C5GA 4YPFA 3WLSA 4AZ0A 1CUXA 2IELA 4JT2A 4DPKA 1W36B 3W5BA 3Q85A 5IMSA 4TLEA 2HLDA 4BQEA 4DVGA 5F3WB 1E0JA 2JHAA 2NVBA 3BIFA 1IH8A 3IMFA 3NHJA 4FE4A 4HQKA 4IV5A 4JY7A 5EEHA 3D0OA 3L9WA 5EMKA 2Y1FA 4OHYA 3SZGA 3UUGA 1ZL0A 1AS3A 5DEOA 3MW8A 1P44A 1W4CA 2QNRA 3A4NA 5IZCC 5B4UA 2LWIA 1J33A 2IQ5A 2NN3C 2VTEA 2W83A 4R5HA 2G7ZA 1G20A 2H29A 2BKLA 5ALXA 1M67A 3Q5GA 1I14A 4ZEWA 4BEBA 3G82C 2GPWA 3N0WA 4PQEA 1JPJA 4FWBA 4EI9A 4YV2A 1PR6A 5EQFA 1X8JA 3V33A 2A9RA 3MUEA 1R1DA 4M1WA 4JR2A 4YRDA 1E5DA 4O0LA 4UAUA 1VFNA 4XZ3A 3H87A 1ZMTA 5GJWC 4TMVA 4CHGA 1G4HA 5SY9A 3IKLA 3R3VA 1H5QA 1RC0A 2IYVA 3DBLA 3NEAA 1XTJA 3CLSC 1VSTA 2EERA 2WM9B 1DG9A 4KWEA 1NVBA 4ZAYA 2EWMA 1FNSA 2W8ZA 4H7EA 4TXNA 5EMJA 3JRXA 1PU2A 3LHDA 2K5UA 4ZQCB 3VOBA 3H17A 1KO4A 3U49A 1NRJB 1FTNA 4MOWA 4L8LA 3VSCA 1E99A 4JLDA 3ZCQA 1JXQA 4G4JA 4U7PB 3EIXA 2MINA 4PSVA 5J63A 4R1NA 4CZ2A 2PUCA 4B5LA 3HKDA 1EQAA 5AKGA 3WYEA 4ACAA 3OI7A 1IYZA 4H4CA 3STWA 3WYDA 2CF5A 3AR2A 1KFCB 4HDMB 1ZIDA 2HMSA 3I8OA 4JYBA 5JEEA 3E9YA 1TQHA 2YVLA 5ALVA 5JIBA 1PL8A 1S0UA 5K0JA 3AF2A 3MBKA 3U5TA 1PUXA 2KQUA 3OOWA 2ZB3A 3PX7A 5F9FA 3M6UA 4LRSB 4OTZA 4DQKA 3B1VA 3HYRA 3ZYZA 3S68A 1P3Y1 1VE6A 4O5AA 4LJLA 1GPDG 4OQXA 3VA7A 1N8SA 3FNGA 3RAFC 1XU7A 3OQ1A 4ZHQB 5G0TA 4ML3A 1NLMA 5GM1A 1BX1A 3FBGA 2GPAA 3IBGA 4RD1A 4EHAA 3DQZA 2I3BA 1DJPA 3PDHA 1HRKA 4M8LA 3U4DA 4TV8A 1NVUQ 2PQ0A 1JBQA 3AFIA 3BZWA 4INJA 3FAZA 5GGXA 5B55A 2W6JD 5BSKA 2HJHA 1Z26A 2C3OA 3ZHTA 5F9HA 2YZNA 3P2JA 1KK0A 2HXGA 2EV9A 4MDYA 3FSRA 4CCYA 1XWWA 4FC6A 3R3YA 1L4KA 3PNQA 3O82A 3QVJA 4KREA 5EZ6B 2Q5LA 1MKYA 4ZD6A 3UHOA 3T1NA 4QUBA 2PANA 4OGKA 2WUGA 3DDSA 4QFMA 1J1ZA 1UZNA 2ZU0C 3L7AA 3NWBA 1JJVA 4QJ4A 2OGZA 1DE0A 4I55B 5SV2A 1TDJA 4AMGA 5F2NA 1G19A 1T3SA 3GFFA 4ADSG 1QK3A 1LC0A 1NYLA 4US1R 3CNEA 1U28C 1Z0AA 3R0XA 3I64A 5REQA 3AVQA 4M54A 2BMJA 1RYHA 3K8YA 3BBLA 3PI6A 4LF8B 1E4EB 3FDFA 3HPRA 2F64A 2WKPA 3OZAA 3COPA 1KNXA 3L8GA 4OYYA 3QVVA 2B1GA 5AM5A 2O0LA 3KOXA 4DXDA 3R5SA 5LMNB 4YI5A 4QE3A 4FDAA 4P83A 4H7FA 1O57A 1RKBA 1FL9A 3GFBA 1SFRA 2WT4A 3OZ7A 2OENG 2FPLA 2JFYA 1PT8A 3SYRA 4DEYA 5IZ4A 1G7CA 4RHXA 4RVNA 4UDXX 3TSWA 4C43A 2C7BA 1KWKA 1P2UA 2VUUA 2I7DA 3NHWA 4DIKA 3C3PA 3E9NA 2QXTA 3U80A 1NLZA 4I5EA 5JR3A 1CDOA 3IA2A 3N6RA 5IVIA 5FYQA 5DHAA 3KOMA 3F6YA 3PUJA 1RLTA 2E89A 4MARA 1T2CA 3RO7A 4RTRA 4KE6A 4RF3A 3UYLA 2J33A 1EWVA 4QYMA 1FXSA 1OAKA 1YR6A 3H7IA 4EI2A 4Y18A 3EGIA 3E35A 2JIPA 3PL5A 2Y1CA 3QKRA 1NF9A 3IXLA 1WOMA 3NHFA 3B6JA 3UXHA 2O8CA 3FPJA 3DMFA 2PJZA 4M9ZA 4ALNA 1ZGBA 4CLOA 3EWAA 4JEIA 2FLWA 3D4OA 8ATCA 1VL1A 5JS6A 2FY8A 3D8SA 4O2AA 3I12A 1R0KA 1J8YF 1JDVA 3DEKA 5CLGA 1KGSA 3OCCA 1LDGA 3OPNA 1AKNA 2ZAGA 3EMDA 4HQFA 4MQMA 1GLVA 5HFJA 5A5VA 2EFGA 1CUYA 4NJOA 1T1EA 2L17A 2BSAA 4Q1EA 4LMAA 2G9ZA 4B6EA 3ICOA 1SKMA 3ITEA 1E9CA 3WJAA 3CA8A 5BRNA 3TJZA 3NHZA 3TIIA 4FHCA 2WAAA 4FFPA 4O2BA 4R7TA 1YE8A 4EVRA 1XCOA 1CY0A 4QUGA 2ZTMA 1GZ7A 2D0IA 4HV4A 1PN3A 1DAMA 1JKJB 1R8YA 2AYXA 2Q6OA 1L4BA 2NXEA 3SP1A 4C0WA 3I73A 4E4RA 2HWYA 3L0SA 5DI3A 1UM9B 3FBTA 1CP3A 2YOFA 3JQAD 3GDWA 4DLAA 1O97D 3N1UA 1L4LA 2PMBA 4CFZA 1E3LA 1PIWA 1Y8RB 3IV9A 1J5XA 5YASA 4WVFA 1NMYA 1S02A 4KOAA 1EP1B 1RP1A 4GX2A 2IV3A 2H7XA 1GY8A 3DPSA 4IIVA 4JELA 3MJSA 2RH5A 3OLWA 4XIYA 2BHRA 1QGOA 3D2CA 4FGWA 4NPAA 2WJIA 4M0DA 4RLHA 4RSMA 1XDGA 4UULA 1H2RS 1UDBA 1KYIA 2Q6TA 4OM8A 2CLSA 4OQFA 4ZHQF 3P9ZA 5DFAA 2CEKA 3WFIA 2Q1UA 5JD5A 5HIJA 1KVQA 3K9CA 1SK8A 2JK0A 4CN8A 2L69A 5CT8A 1XEWY 2AMYA 1GILA 1M72A 3EIOA 2QSJA 2BM0A 3MUOA 3P9SA 4ZCLA 3FETA 3TLKA 5K20A 2CBGA 2QN9A 3TW8A 1VG9B 3HKEB 3KTFA 3RF7A 2PMWB 4IIUA 3PNKA 4RPJA 2NVUA 3TNFA 4ZALA 4YRGA 5I01A 2AV6A 1U7TA 2H9IA 2HK6A 4Q05A 1WLSA 2F4NA 3OQPA 4FOOA 1RPZA 3EWSA 1CXZA 3R74A 4OOFA 3WBJA 2KB0A 2R1UA 1QGZA 3B3GA 3T0GA 5FPPA 2P8JA 3IHLA 4WXEA 3RS0A 4CLHA 1PWYE 1E4OA 2C82A 2OA0A 4AZ0B 5JSQA 3T41A 4I55F 3RTDA 2YHAA 3H5IA 2AD5A 4LRWA 4NXNB 1T9CA 5EYPA 4REQB 5FFMA 1FCJA 2KX7A 4AY5A 4EGFA 1XXHB 4MRVA 1X8KA 5E9WA 4JB2A 4O25A 1OTXA 1IXSB 4OHKA 1V7CA 1ZCJA 1GQ2A 3E58A 4MW2A 4Q9HA 4BGEA 4O08A 4BLUA 2X3FA 4JT8A 1NQOA 1XRSB 1YU6A 2NNLD 2G4VA 4Z0PA 4M53A 4XPIA 1MC4A 2ZPUA 4O4JA 4IS3A 3QKIA 4JT9A 3RSLA 4YJGA 4LE2A 1GDDA 2HJRA 2BFBB 2P68A 1MB0A 2AMFA 2FR1A 3H5TA 3HCRA 4R31A 3UGKA 3A6EA 3FGPA 1YL5A 3NBUA 2Q50A 3QPDA 2NUPB 2FE4A 2HYIC 2DFDA 3NHBA 4PQGA 3GJTA 4BNGA 5CBKA 5IF9A 4RZIA 3DMHA 3UAOA 3EVGA 3R5TA 4PANA 3FA2A 3SU8A 4ASUA 4JI7B 2CNNA 3I6ZA 1T9ZA 3MB5A 4OVKA 2BFPA 2ZE6A 4P2BA 4JR0A 3TLYA 3BA6A 3KFVA 3MJVA 2GEBA 4I1RA 3AIMA 2NUBA 3FMPB 5AW7A 4FYPA 2A0KA 3D8BA 3C8HA 5AW8A 3ZJVA 4FZVA 1CZOA 1EZZA 1VHJA 5E2BA 1PFKA 3AQIA 4CM4A 4MYHA 1ZIOA 4FEGA 4PEVA 1N7IA 1XLVA 2H4ZA 4WE3A 1ZSYA 3Q3VA 1PW5A 3SG0A 1RI4A 3DZCA 4C7XA 5B1EA 1UF9A 3GXBA 3I3OA 5HCIA 3N0TA 3S55A 2IHTA 1P9OA 3B1YA 3O2NA 3WIOA 1NXVA 1V8ZA 4H59A 3PNPA 1IN1A 1C9NA 3CWCA 4JCOA 2VHTA 3NUGA 3ROXA 4CG2A 3RKUA 1RVDA 3RDPA 3ZVLA 3LUPA 3AZOA 3VGJA 3DV2A 2D2FA 1AKEA 1FRFS 2YWJA 3B5JA 4EMUA 4HQ6A 4HXGA 2ADFA 2HXYA 5F51A 4Z1MD 5GIOE 2AEMA 1RWVA 1Z29A 3A2MA 4CDRA 3RC1A 1B8VA 1GQSA 4TMTA 1OJLA 3KJEA 1XZPA 4GEKA 4L27A 4ETNA 3FFWA 2D1QA 2IWHA 2I2AA 3ME5A 4TWJA 4V1CA 1QVAA 3T3HA 2J9FB 1G21B 1F4VA 3GRCA 4HX5A 3KQNA 2JATA 3OOJA 4AJ9A 4QUIA 2YXNA 3CV3A 1AN0A 3LMKA 4NK5A 4S35A 2YNMC 1FYWA 3K8OE 3L8YA 4N8DA 5ARDA 2QBYB 4G09A 1II9A 1EGQA 4G63A 5FX2A 2V7XA 3LZDA 3PXXA 1FFBA 1UMCB 4BQPA 4Y2RA 2GA8A 3GMTA 5EPOA 1J97A 4FYKA 4AY3A 2VHZA 1QYCA 3WQSB 1JA0A 3H5VA 4Q15A 3JQAB 1I1HA 1LWOA 1V26A 2NO5A 4R81A 4UFOA 5FF9A 1KEWA 1HDOA 2EIXA 4Y2VA 4B34A 2P69A 4HNGA 4NAUA 1O0BA 3CZ5A 1FUIA 2DQSA 3UGJA 2O52A 1YFLA 5DCYA 5EQJB 4QFCA 5BN3B 1ZQ1A 4UXJA 2ES4A 1Z0JA 3IBCA 3OX1A 1NR7A 1Y7IA 1V35A 1YQUA 2YN2A 4K81B 4X7BA 4G24A 3CRVA 2VVTA 2C1XA 4EX7A 5AI4A 4CF6A 4RLFA 4BGVA 4EGSA 2FEMA 4AMZA 5JLAA 1N5JA 1WW2A 2CE7A 4KI0A 4M83A 3RS5A 3LO5A 3V5NA 3DMTA 3RHTA 4UFNA 4EY7A 1ILWA 2Q07A 3N0RA 3U3RA 2QN8A 4E33A 3IT2A 5J2TB 1KPGA 1WUHS 2VF8A 2GN2A 3TGWA 1VIMA 3C1TA 4NHEA 1P80A 4NH0A 1P2FA 3NP9A 4MW0A 3ZZ1A 3HDJA 1H9BA 1RHJA 1ULSA 2RAUA 1E7MA 1T26A 1RKQA 1F4LA 1V7PC 3QEAZ 4KPEC 3KR2A 4TPKA 1KF0A 3KXKA 4EG4A 2JFQA 5H7XA 1GU0A 2P41A 3GA5A 4HDSA 1GSOA 3EXEB 3KJZA 3KPJA 3OHSX 1L5GB 1FXWA 1UWLA 3A36A 3B1ZA 4BQOA 1XDWA 2Z6QA 4LXTA 1PX0A 4CEIA 2EGUA 5AOCA 3BWXA 3K5PA 1GXSB 1W4BA 4LDAA 4MV0A 2II6A 4DJFC 3GFOA 4EI8A 1J09A 3P4XA 2VFAA 3K6RA 5CPFA 5DK6A 4I36A 4BN5A 4LRUA 1A71A 1RE0A 4MA4A 1E61A 4YROA 1AB5A 1CDDA 1ZJJA 2B5OA 2HSEA 1GR0A 2VH1A 4FNGA 4I55A 3FPKA 3NLLA 1TCAA 3ZCUA 1YS2X 3NV7A 1SUPA 1QYVA 3P26A 1E96A 4XWAA 1T8PA 5J43A 3L0CA 1XTIA 1I10A 3VI4B 821PA 2QUKA 2NO7A 3C16C 2RSLA 1MABA 8GPBA 5I4IA 2Y6UA 3DAPA 2VZ9A 2EJBA 5SZJA 1MRSA 5JS2A 1AMUA 4OXNA 1X9GA 2RGYA 1MAVA 2V5VA 4WA8A 1KFJB 5BSWA 4UHDA 1FDIA 2OM2A 4ZDWA 3K1TA 2QM8A 1U8ZA 4YRKA 1IOZA 2CWDA 4YS6A 5FTJA 1WS6A 4X7RA 2QD1A 3ZHBA 4XDYA 5EIOA 3FVVA 2QTWB 6NULA 2JLZA 3KSAC 2R7MA 1OV4A 2X41A 1YB1A 3CLRC 4I6GA 4WUVA 4B31A 1RM5A 5ELMA 3TKAA 2D59A 5TB5A 3QVXA 1YASA 4G9EA 2WZBA 2J6CA 4N0QA 4EA9A 2W42A 2D1YA 4H7IA 4LVUA 3PQCA 2BTQB 2RONA 4FYMA 2WSSA 2OB1A 1KFKB 2BKEA 1USKA 2NZYA 3D4PA 3NM5A 3PWZA 4G0OA 4JQCA 4WNAA 2PS3A 4KWTA 4JXKA 1YQDA 1PJCA 4WESB 4ZCQA 2WY2D 2VA9A 1LFAA 3JYPA 5CIQA 4Q93A 3GFGA 3X3HA 3S5UA 4JBXA 5HP4A 1P19A 2IIBA 3GQBB 2BZ1A 4IJWA 4QUKA 4UVGA 3RJMA 2OD9A 3U17A 4BJ1A 3S40A 4QHSA 4CLOB 4AP6A 3GUUA 4RS3A 1YCGA 4MDEA 2KLHA 4QJ3A 3L92A 4KO3S 1N2ZA 3JY6A 2CCJA 1EUQA 3VHRA 3V2IA 4DEVA 1POWA 3TAXA 1EP9A 1G6KA 1Q44A 1QE5A 1FTSA 1WO8A 4AKTA 2R4QA 2VT7A 2IDZA 4RIEA 5FJIA 4JHLA 5EXSA 4P5PA 4FU0A 3EVZA 1QO9A 4QTXA 2JHCA 4Y2SA 4M9SA 1GPMA 3JZDA 2YQ4A 4JVLA 2NZVG 2QL6A 2VDUE 3K9HA 4HJXA 1HT2E 4L5YA 5LQUA 1K5HA 3P27A 4HB3A 3SHTA 3IIMA 4L50A 3T9AA 1SHTX 4F9FA 4NPCA 3LZ6A 4MV5A 1C0PA 5J1SB 1AM4D 3A8TA 5HMMA 4BVHA 4FTWA 4BRUA 1GPNA 1ZP6A 1Y8QB 2CDBA 1TUGA 3WI7A 4UNIA 2CMGA 4RV9A 1X80B 3IKTA 2GZSA 1C4KA 4YUAA 4IV8A 2NSHA 1ZD8A 2QQGA 4MGEA 4C06A 4GW3A 4TYPA 3FZYA 4RTKA 1P9RA 3KQWA 2IA5A 3AB7A 4FYWA 4REQA 3VNBA 2Q8NA 3NFRA 3VU1A 1H3EA 3T3OA 1QF9A 2HQOA 3TIFA 2C9ZA 3NORA 5ERXA 3LK7A 5F77A 5T6MA 3RQIA 4D96A 2X13A 3C8MA 3PX3A 1DEHA 1E1YA 4CI9A 2Y71A 1GU7A 3D6UA 5JSYA 7REQA 3G5MA 5I9LA 3ZVNA 1Z4MA 1ADGA 4HBGA 2HSDA 2QS9A 5LXTB 1MC8A 1TO1E 5JS1A 1M1YA 3AF6A 4AKIA 1V8FA 4B6FA 4IIEA 4N6NA 4PCUA 3QE9Y 3KP1A 2O59A 3VSDA 3I01M 1R0CA 4LSZA 4CDGA 1M73E 2XMPA 3AXSA 2Y0BA 1VBFA 3QX8A 4ZC8A 1O4VA 3L7KA 4G5OA 1M6EX 3IJRA 1VIDA 1BN6A 3ABRB 3UMVA 3GZJA 4CMAA 4YT2A 3EQ9A 5F1OA 2QJTA 3K2BA 1W93A 1XNRB 1O97C 3J7AC 1KRXA 4ZREA 5L6LB 4IY1A 2LP4Y 3KOWA 4PO9A 4ZO9A 4ECEA 1ST3A 2GEKA 2REBA 4INOA 1Y9DA 1NMXA 2I6UA 2A58A 3MF4A 2AB0A 4WINA 1UDCA 2CLDX 2VDMB 2WBLC 3AOGA 1PJTA 1PVDA 3BCUA 1L0BA 4COOA 5FD8A 1SQSA 1T0BA 2Y0CA 3FG9A 4Q3CA 1KJWA 4YFVA 1GRCA 3DP7A 1FXWF 2QYTA 2DOKA 2YZ7A 4R9SA 4D7AA 3EJWA 1KVUA 1A97A 2EYQA 2NUAA 2XMGA 5CDTA 2IUYA 2GCNA 4G8BA 4OJMX 2IDMA 4DLRA 1D0IA 3CZPA 5HSGA 2YDXA 1YOBA 3UOAB 4YO7A 3QFSA 2H07A 1DOZA 3WK9A 3SYNA 1ZO8A 3IQIX 4ZZ1A 2O2YA 3HS3A 4K9OA 3SN6A 5B3JC 1YS1X 2F3SA 1ZCAA 3PC6A 1ZH0A 4D3FA 1PD1A 2HU8A 5BNZA 4DC1A 2XEXA 1Z12A 3NTLA 4WBNA 3MTEA 4M89A 2VP4A 2A9KA 4DSTA 2Z9CA 1ZBDA 1GT91 3FOAA 4Q1BA 3VNVA 3U1VA 5FBVB 3JSAA 4F21A 5KOJA 1LNSA 3DAHA 2W2VA 1BMQA 1UJCA 3QU9A 4TTSA 1M83A 3V7FA 1CQPA 1NXTA 4I1YA 2IBTA 2PNFA 4YDRA 3WL7A 5CLQA 4AURA 4PX9A 2EFCB 3QU5A 3TZKA 3UUEA 2QLMA 3FLBA 3JZMA 4I6EA 2IW1A 3CE9A 4RAQA 1E3QA 1I2DA 5TGTA 2X0RA 5BVGB 3FWZA 3ET4A 3DLTA 2H7YA 1BHO1 4KMOA 1CX9B 3WLHA 2YW9A 2RG7A 3K1AB 5EL0A 2NZJA 3A6KA 1PP4A 3CVVA 2AJBA 2ZI7A 4RJJA 5CFNA 1CPYA 2EZ9A 2GBCA 3DBIA 3GZ4A 3H6GA 1KE2A 1Q0ZA 3X1XA 3GLKA 3PGKA 4ZGWA 3B60A 1QKIA 4RPHA 4F4CA 1V1MB 3GPLA 4ZANA 4QGHA 1SO8A 2VBFA 4TQUS 4HP8A 4Z4FA 4X3CA 5CDSA 4CKCA 3P2YA 2AYYA 1KYWA 1ZVQA 3AUSA 4X92A 3FOEC 4JVSB 3LBAA 4JSTA 4FR5A 4ZAFA 5ADUS 3B9RA 4XQ0A 4CGZA 1PV4A 5F1PA 4TTPA 3DC7A 4X24A 2Z2IA 5CFRA 1PS0A 1T6YA 3K70D 3W78A 1TQ8A 2G07A 5LB2A 3E15A 4D9EA 1Y3AA 1LDBA 1X9IA 3E81A 2IF0A 1KIFA 1RACA 1I1OA 1T35A 2FZLA 1P45A 3FOBA 2HLPA 5HNKA 1W1IA 1R4AA 3HSYA 4LQDA 1OE0A 4G4IA 1G16A 5JAMA 1AQUA 3P5SA 1PRYA 2XE7A 3DZFA 4E09A 4G37A 4FSDA 3JZIA 4LKRA 4HNUA 1JNXX 5C8VA 1ESMA 1TPYA 2ZUTA 4JYPA 1DTSA 1EDDA 4I4TB 4KLZA 4GPAA 1PS8A 4OY3A 5JARA 1XPOA 2COKA 2PSJA 2UUPA 4UZEA 221PA 1P6UA 4LJRA 5LNK6 2YCLA 1TM4E 1PGPA 1Z82A 4AKGA 3DSRA 3QVGB 1NATA 1XRNA 4KPUB 1WUKS 4ZO4A 2JCXA 5AJYA 3P9IA 4DMHA 2B25A 4RWZA 3VC3A 5JS7A 1P3DA 3RYCA 3RAGA 2VTBB 1HNWB 5B53A 4B6JA 4PGFA 4DE5A 2JJ2A 3PV0A 3HM2A 4QAQA 4WBSA 4X7MA 1Y4SA 4ZDIA 3FYSA 3AFMA 3NALA 1XCPA 4BLOA 3EPKA 5AJWA 1ZGCA 2BFCB 2PA0A 3ANMA 4F4HA 3T7RA 4D44A 2ZSFA 1SKBA 2JI4A 4ZT5A 5FTWA 4XDHA 3TMKA 1SA0A 4J7XA 1JIVA 4R54A 5TJHA 3CEPB 1UEJA 4GI5A 3UAZA 1OCEA 3MWEA 4P36A 3X1KA 3RK1A 2H8KA 5A6SB 4X97A 5KYVA 1YJ5A 4TYMA 4F6LA 3G0DA 2DQ4A 3WWYA 3WQBA 3DVAA 5AKEA 1S8NA 4OQZA 1IE3A 3EW9A 4E1VA 4WKBA 4O2BB 2Q1YA 1DAHA 1H8HA 3VR4H 3CF2A 1NI4A 1L7OA 4IUDS 3OQHA 2BF4A 1I6MA 3BFXA 4EKDA 1ZN8A 1USWA 4GIBA 4L08A 3VPCA 3ZLUA 2PO7A 1L6RA 2B4QA 1WKBA 4JHXA 2J07A 5D7BA 4EB6B 4N5IX 5KNCH 1DRKA 2A5YB 1FJHA 1RT9A 1J2JA 3JQAA 4UM9B 1RI2A 3L6CA 4B1FA 5FUQA 4DPMA 4RM3A 1N34B 2G9VA 2IYFA 4XX0A 3V4OA 3G23A 2C98A 1G3IA 2GCPA 4OJNA 3NEYA 3V2UA 3SIWA 3W90A 5BY2A 1AURA 5C2JB 3K32A 2XXAA 3GLQA 4MYCA 4UASA 4A16A 4EHJA 5K0EA 2AG5A 4CPDA 1KJZA 3T4UA 4D9BA 3F6EX 1M76A 2MSEB 2ZIGA 4NYIQ 1OX4B 2SKCA 2ZYWX 2C92A 5SYAA 1A7JA 4QNMA 4LJYA 3FFXA 4Q7LA 1D7AA 3LVFO 4EHHA 3KM0A 3CT4A 8ABPA 1Q77A 1GN8A 1U0LA 3GFVA 5DRTA 2JGKA 5LWQA 4P54A 4RL4A 2C7VA 4PPYA 1VA5A 4LFAB 2D7JA 2ZIZA 1XKQA 4BEJA 2F43A 1DJQA 1V8DA 2F17A 5FOSA 1XU4A 4EF6A 4MQLA 2G70A 3T5DA 3VC2A 1IQ0A 1BWRA 1NP3A 1C0LA 3JQBC 4QG7A 3UB3A 3V9AA 4AS1A 2H1FA 2VAVA 3MLAA 3H2KA 4RLSA 2PLRA 4M3NA 1YRLA 1TMGE 4QNNA 5FBQB 1X7WB 1VJ0A 1R6VA 2YS6A 3WYNA 3EH1A 1AKRA 2NSYA 2XKAA 3SZLA 4G41A 2X5NA 3TUZC 3H83A 4A6EA 4MI1A 2HQBA 2OOKA 5KU7A 5IMBA 3UXEA 2CHFA 4PO3X 3M6AA 4GBED 3CUKA 5JCXA 1DC3A 1FBNA 1JLLB 1JHYA 5L3QA 4ARZA 4HB0A 1QQ5A 1U2QA 4BKMA 2IYNA 1IHOA 5F7ZA 3CLRD 4IDGA 4LQCA 1PLKA 3V6MA 2ZYAA 2PLWA 3TZHA 4D57A 1KI8A 1F4PA 4F4IA 2FUG6 1I36A 5KYGA 4YPOA 3OEEA 1DAIA 4EO4A 4ZI7B 3K6SA 4FGKA 4RXUA 3RRYA 3NPMA 5AI6A 2Z1DA 3L1VA 5IBPA 1N5MA 4NFHA 3DBOB 4L3VA 5CB4B 1DZIA 1YR7A 1THGA 2FSVC 2XQIA 3QUBA 3ZDFA 1Y8AA 1UBLS 2FPMA 5FPHA 3V8MA 4C3VA 5JV5A 4IOJA 2UZ1A 1NW9B 5LQMA 3U7IA 2F1HA 4R1TA 2QQEA 4P7FA 1L5KA 3JALA 5H3LA 4DARA 1CSEE 4XIIA 4EBBA 2IZ7A 4M7RA 4JLJA 2VXYA 4KX3A 3WJ2A 3V7WA 2B83A 2W22A 3EXIA 4B3DA 4DHEA 5LQAA 4RCZA 1Q0LA 2CE2X 3L1KA 2DFLA 2FFJA 3H5LA 4JI1B 3SZOA 2QN2A 1I7PA 4JP3A 1EGHA 4EATA 5LJIA 5EIBC 1GRQA 3HVRA 2PMKA 4RCYA 2VZLA 3B7WA 4YB8A 2Z83A 1F14A 4YAIA 5C46F 2HN9A 4JLWA 4WN9B 1JHXA 3LDFA 2XGSA 4M88A 5TC4A 4PR3A 2ZRFA 3BTSA 5BSFA 3HB7A 1XXLA 5JALA 3IT3A 2LRHA 2RGNC 4I5GA 2Z56A 3C45A 4EPWA 3V1MA 2EAUA 1NBOA 1GPKA 4QUDA 1F0PA 1E79D 4BB0A 2H1VA 1QG4A 2ASVA 1KYTA 2FX3A 2P11A 1VE3A 2HFKA 3SF8B 4DBVO 1P9WA 3PHGA 2JA1A 3H42B 2VSOA 4UTPA 3NVMB 4PLGA 2EDAA 3W5JA 4UTOA 1DBWA 4P82A 3T95A 1IHUA 2HPHA 1JHOA 1ZOLA 1Z4KA 2PGNA 1KO8A 2HD4A 4REOA 3V7NA 4PGMA 2ZRNA 1NN5A 4I9NA 2BW0A 4NF2A 4QQFA 2P4HX 5GP1A 3LLCA 3TL6A 4ER7A 3TR5A 2VIIA 5CEEA 4FYYA 4PRLA 3O47A 4PAWA 1ZK1A 4KO1S 1O94A 4DGQA 4YHHB 4XUEA 3IERA 3STYA 3OT1B 5KOHA 1GT6A 3JQ9A 2NUAB 4R16A 4PBTA 2GI4A 2JDID 3HCBA 3OZDA 4W7HA 4BFZA 2W7TA 1AG9A 1JQ3A 3I4FA 1XL1A 4L9WA 1P81A 5IAJA 2AUMA 3V4VB 3IT1A 5C8YB 2PXCA 2AWOA 4DKJA 2QD3A 3DQPA 3D2LA 3QV1A 1DX9A 8LDHA 1PJ4A 3CS3A 4KXVA 1M34A 3IDOA 1ZOSA 3SZ3A 3ZLBA 4Y2QA 4CCWA 4PHCA 2A1TS 2BH9A 2H2GA 3CPEA 4NMHA 4RU1A 3VVMA 3ZGNA 5JBQA 2IHVA 3DBRB 4I4IA 4AWXA 4RPLA 3QXJA 5A4FS 3OEHD 4RZXA 1HDCA 2VNAA 3GRKA 2O8NA 3G2JA 1EP3B 4PRKA 1R88A 4AK9A 3L8FA 5LYJB 3BWYA 1GLNA 1KYXA 2C84A 1GN9A 3BQ9A 2VKTA 2ZIWB 3I30X 1DARA 2GQ0A 4R7GA 1AA9A 1BX0A 5LIRA 3GGSA 5AYVA 1L7QA 4NENB 1XP5A 3BRWD 3BEDA 5DTRA 2ZE8A 4PCAA 1SCBA 3FTCA 1WIWA 1JMKC 4D4KA 4LOHA 4LV8B 2GD2A 4H7HA 1ONSA 1Z36A 4LXQA 2A59A 2QQ5A 1KMNA 3A37A 4JXJA 3VYWA 1UC5B 3LIPA 3WGYA 4AU1A 2GXSA 4GX0A 1ES9A 4KO2S 3OF5A 3EPJA 3C6ZA 4B3TB 2E21A 3RS2A 5B7NA 4UU8A 4WZBA 3LT1A 4P81A 4DWJA 5IVPA 3DE3X 4NTZA 5AOAA 2BGWA 1CNEA 1GRNA 1R8SA 1R8QA 1U6JA 2AFRA 4J1QA 2IJGX 4OXQA 4DG5A 1CUWA 3GP3A 1JJAA 3CJRA 3KQLA 2PL1A 5H80A 2DKOA 1LK7A 3T7DA 4NU6A 3PFFA 3UY4A 1MOSA 3IH5A 3VTKA 2ZT8A 4R2HA 3FWHA 4RK1A 5D3ZA 3FOWA 3VJLA 5A2GA 3CE6A 1EIWA 3I9V6 4QDZA 3U7QB 2XMDA 4E2XA 4BUJA 4WZBB 4WKOA 1JYFA 1K3FA 1LRJA 1F8YA 1LVGA 2WWGA 3GLSA 4PLTA 3PEVA 3LI2A 2BVNA 5F1KA 1IZYA 2BMAA 1KAHA 2RHGB 3E8SA 4L5IA 4DYHA 2QVGA 1QAMA 3AUFA 3D54D 3GLVA 5JVDB 5JWRA 1ZICA 1JBKA 4BO6A 2AJTA 5FEMA 4YDSA 1YZHA 3PFIA 4HDNA 4XM0A 2QR5A 1T2EA 1GYPA 1ULUA 4AG5A 4RJTA 5IBQA 5JDCA 4KI7A 5DF1A 3OWXA 4OFZA 1Y82A 1JF8A 2PAAA 2H7CA 2WIAA 4GC9A 4OI2A 4B7AA 2OXFA 1DELA 4FD2A 3BRSA 4W8HA 2ZAIA 3BRCA 4IGEA 5A04A 3VYSB 2XRMA 2BRUC 3TLXA 3SQDA 1RZVA 3B70A 4GYJA 1KEEB 1O6CA 4BE7B 3TINA 2E37A 3IUJA 2VAPA 4FZRA 1XLWA 1N6NA 5KPDA 1DP4A 3AUAA 4C05A 1C1DB 1EH5A 3DTTA 2C88A 2EG9A 4FC7A 1D4FA 1U7ZA 3IODA 1Q0UA 3FNFA 5PGMA 1IRXA 3GJ5A 3R9WA 5T6BA 2CMHA 1T0IA 4ZCIA 4EEXA 2OHVA 1FX0A 3K0KA 3L1JA 2J67A 1OX4A 1NJ5A 3ABQB 2QRVB 2VDJA 4G0QA 5EHQA 4GKKB 3QQ5A 1VCOA 1LTKA 3GEDA 1U02A 4J9UE 3FYTA 1TQ4A 2BBTA 4RDIA 1ACLA 2H4XA 4NOKA 1JVSA 4J4TA 1JFSA 1S3IA 2PR7A 2AD1A 4PZUA 3IAS6 4EJMA 3HZOA 1EFVA 4ZVSA 3VDXA 2GN6A 1XVAA 3MBOA 1W2WB 1U4OA 2BE7A 3FTPA 5EHZA 1ZIXA 2QGZA 4WZBE 3UICA 3FI0A 4KR3A 1RPTA 1CYEA 2W6QA 5JYEA 3LIIA 3F6BX 3KLMX 1J90A 2XRYA 1CETA 1LS1A 4GBMA 5JCPA 1EM8B 5C8YF 1SIWA 4K88A 3PXDA 4UOZA 1BCRB 4FYVA 4XLLA 1WVMA 4XYLA 1IJEA 2B37A 2YXLA 3EEYA 1JFRA 1N36B 2Y99A 3HYSA 4REMA 4A0HA 1ZVMA 1UWCA 5ERYA 4YRNA 3G2KA 1A5SB 5B4VA 3G9TA 1CR6A 1Y5IA 4YXWA 1QMPA 2DY1A 2G4LA 2HMUA 3O9VA 1JLRA 2XVYA 3UAGA 2ODBA 3K9NA 5H4GA 1GRVA 1UZLA 3ADBA 4AQ7A 2K7FA 1JDUA 3P96A 3PYXA 2FFAA 3B2EA 3QVGA 4KPUA 4LS3A 4MPPA 4AX4A 4DDUA 1TJ5A 3Q8LA 1UKVY 3G5LA 4MKHA 4B3JA 1II0A 1DL5A 2XLCA 1GQYA 3QE0A 1HE8B 3NUZA 3V48A 1X8LA 2GD0A 1EAYA 4EDFA 4B4UA 2JA2A 4J16C 1P8JA 4ZZ3A 1VHLA 3EZXA 4UE3S 1P60A 4G0PA 5LQKA 4ND8A 1CDEA 2IHUA 1EFCA 3HLTA 4BXOA 3IV7A 5TY0A 3L7DA 3H1EA 4RXTA 3QF7A 4ZWNA 1EB9A 3ZVMA 1RJ9B 3G7UA 5ALGA 2XCSB 1XZQA 1Z6ZA 2G76A 2ZR0A 1VI6A 1BKDR 5AKIA 2ZAMA 3QHPA 2GLUA 4DJTA 4DLYA 1Z2CA 2BHSA 1O95D 3BH6A 4BMDA 1XQ6A 1OXTA 1V9CA 4GXRA 4LZPA 1P9NA 1E3JA 3RABA 1QVZA 2Z0MA 3BTUA 4RH3A 1EFRA 4RFSB 1CQIB 2J7PA 4W5OA 3P32A 1O2DA 4BVKA 2WJZB 1K8QA 4CMCA 3EH2A 5HZGA 1A8QA 3R3JA 2VP0A 3RANA 1DKLA 1SEVA 1UAYA 1O89A 4U7DA 2VJMA 1FS5A 2JI9A 2YHIA 3ONVA 4RA9B 4AJ2A 1WB4A 1RAIA 1SH7A 1XN4A 2FYTA 2QTVB 2QF7A 1CVRA 3ICPA 5IAKA 4DGSA 4G86A 4URWR 3DEHA 1OGIA 1NLYA 4WI1A 1N0IA 5B4TA 3GLFB 1O08A 2NU9A 1WXWA 5A71A 3ZI0A 1W5TA 4BQNA 2GYVA 1P1HA 3UG7A 4EB3A 1CEQA 3IDFA 1EXDA 1EUCB 3E53A 4YMLA 1AKMA 2WNSA 1U7DA 2PH1A 3BAZA 3IP6A 4L0QA 4MYUA 2OXTA 1AUOA 3GVCA 1U0HC 3DDWA 5CLLA 1YWGO 3DOUA 4AW9A 3PE4A 1BEZA 4MUXA 1K0UA 5JVDF 3D1JA 1ENYA 3LUFA 4KFRA 3ZCPA 3GH3A 1ZJ4A 3PHCA 3I5XA 2A0XA 3DHYA 4JN6B 2NU9B 4B87A 5CCBA 1UT5A 2IYUA 2QMOA 2A4KA 3Q6NA 5E6SA 1YAJA 4LY9A 2GZ3A 4KLAA 1O6ZA 2E4XA 1KDZA 4DXHA 3DH0A 3ULKA 3WTCA 4B7ZA 4IHJA 5EJ2A 2B8EA 3OU6A 4OQYA 1AGNA 4URZR 2JAUA 3AZQA 2OUIA 1G3RA 2OFFA 3CG0A 3T5GA 1SC1A 1ZY2A 4Y2XA 2GUWA 1N6LA 1O5IA 1UOOA 2I3DA 2ZWIA 2RBEA 1WD7A 3HGQA 5TS2A 2MOKA 4HAZA 5AKLA 2B4AA 4BN0A 1Q16A 2GF9A 2HIAA 1UJ2A 5DOVA 3BSFA 1RQGA 2QPTA 3WADA 3A6PC 3EEOA 4B0OA 4B0PA