4H1HA

Crystal structure of mccf homolog from listeria monocytogenes egd-e
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
327
structure length
327
Chain Sequence
SNAMIPAKLKQGDEIRIIAPSRSIGIMADNQVEIAVNRLTDMGFKVTFGEHVAEMDCMMSSSIRSRVADIHEAFNDSSVKAILTVIGGFNSNQLLPYLDYDLISENPKILCGFSDITALATAIYTQTELITYSGAHFSSFSMEKGLDYVMESFSDCLLQKEPFALKESATWSDDEWYLDQENRNFIPNEGLVVMQPGVAEGIIIGGNLCTLNLLQGTEYMPNLAGTILFIEDDFMTIPETFDRDLESLLSQPGADEIEGMVIGRFQQKTAMTAEKLAYIIETKTALQKIPVISGADFGHTQPIATFPIGGTARIDTNQTDKIQIIRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MccF homolog from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords Lmo1638 protein
total genus 107
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4h1hA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4h1hA02
3GJZA 5F1YA 5K99A 3G23A 3TLEA 3TYXA 1ZL0A 2AUMA 5JYBA 4JVOA 4E5SA 3SR3A 3TLCA 4IIYA 4E94A 5F9MA 1ZRSA 4INJA 4EYSA 3TLBA 3TLZA 3TLGA 4MI1A 4H1HA 5FD8A 3TLGB 5F5XA 4MJXA 2AUNA 4IIXA 3T5MA 3TLAA 3U1BA 3TLYA
chains in the Genus database with same CATH superfamily
1QU3A 3PR2B 3A1CA 3H1TA 4RVOA 4EF6A 4K8RB 5KJ1A 4N41A 4QULA 2WC1A 4XB6B 4BB6A 4UTRA 2H7VA 4LOIA 2PSJA 2C2BA 3DE3X 5C8ZA 3QZUA 4C2TA 3LF1A 2YXDA 2OLJA 1BZYA 2QN2A 3PGKA 2XEJA 4F4JA 1Z56C 2XA1A 3SYKA 3NVMB 4OHMA 3DZHA 1HR0B 4A0RA 4PAMA 3TDKA 5HWSA 5BVHB 4QREA 3ESZA 4I55F 5B6IA 1O6ZA 2JGFA 4XD2A 1AD2A 2ODBA 2IOYA 1G8PA 3QUSA 3IIKA 1FNNA 1USUA 2CJWB 3O9VA 3AR5A 1QX3A 3OESA 3ICQB 4A0QA 1QO0D 4P9NA 3O03A 1C4WA 1GKYA 221PA 1N0UA 3E3LA 3MUOA 2JJ2D 1N2GA 3I8SA 4IVRA 4LBZA 3I42A 4FDLA 4G65A 5EGNA 1E1QA 3MAAC 3KQWA 3MMNA 1ACLA 3ILVA 4RHTA 1R0LA 2H08A 1PZFA 3H4VA 3KT8A 4JVOA 4M76B 3K2BA 4FSXA 3OP1A 2WHQA 4X97A 5LB4A 3A6ZA 2RK4A 1Y6GA 1NXWA 2V4ZA 2FMUA 5CYGA 3KXDA 1WAMA 5JJ5A 3RQSA 1ZRSA 4TKLA 1R3UA 3RBUA 2WAMA 2KSQA 1NQTA 3EPRA 1HI9A 5FV4A 3H4IA 1X15A 4PZUA 1R9JA 2IS2A 1RTTA 3DFZA 3ZTWA 4BU0A 1L5FA 1XMVA 2CKDA 3DZGA 1NYLA 4MCAA 2XNCA 4NFSA 4UBIA 1JPNA 1YZYA 2IPNA 3ZV3A 4I50F 1Z7WA 5H9VA 4TS4A 3TLMA 5T6MA 2Y1GA 3I6MA 4QQNA 4V0OA 1NXOA 2J0UA 1OAAA 3M4JA 3K5WA 3KE8A 3V8PA 1TZCA 5DEIA 3X1XA 1ZL0A 3KYIB 4G5RA 1EWYA 1KRWA 3UAOA 3PC4A 1EM8A 1VG1A 4PRKA 1TZMA 3BIXA 3UH0A 4O3MA 2Y99A 2WYWA 3N2KA 1ODIA 3KZNA 2WIGA 4IIJB 3PU6A 4NJOA 5CW1A 3MTGA 1UKEA 4TKZA 3OQIA 2ORYA 3BBPA 3BN3A 3O8NA 4LOJA 5H81A 1H1LA 2EJWA 1NW8A 1OH5A 3U1TA 2E4YA 4BE9A 4GYWA 1T13A 3FUVA 1V7QA 3HACA 1YZNA 3V8EA 4AB1A 3QTTA 4CHTA 5JR3A 3AJ9A 3L6CA 4MCHA 5BUQA 3RC2A 1ISPA 2DH6A 3BB4A 4R01A 1HFKA 5GOTA 4AJJA 4KFCA 2IYOA 1JILA 3WKDA 3AI7A 1HDGO 5HS6A 3CUYA 4P92A 2R1VA 4RZ2A 2YIVX 4JUCA 1DCKA 2J6HA 2D2VA 4U2FA 1AKWA 1KH2A 1XG5A 4NZ9A 5TC4A 3ZXUB 2Y8EA 1ULZA 2HIMA 1ULBA 3VPHA 4U2GA 3ND8A 1Y6FA 4AG5A 4JR1A 2X14A 1Y5LA 5AVTA 4Y2UA 3TLBA 5E7QA 2O7NA 1NBME 3OEEA 4ZU3A 2G63A 4CEJB 3NR2A 1A7JA 5CDUA 1V9CA 4REOA 3SLKA 5B64A 3MWDB 1J8QA 3DV0B 5KHLB 4BO9A 1NYQA 2JNWA 5JCJD 1G4UR 5H3CA 2O7QA 5BQ5A 4DXHA 1YHZA 2K5UA 3EW9A 3JVDA 2C4KA 4IO0A 4IOJA 4L8GA 4MRMA 4TTRA 3ZGOA 2WVJA 3P8ZA 4AF7A 2EZ4A 1Y89A 4K6KA 4M7PA 4DKJA 3VOAA 3LKZA 3A6EA 5ERGB 1XCMA 3KJGA 4D0NA 3GLSA 2A3RA 1EU1A 1P7VA 2BGKA 3IDQA 5JMOA 4LF8B 1L4FA 3A37A 4W1QA 2AOUA 4QC2A 1QYCA 2B5VA 2L69A 3C8HA 2NPFA 3VNUA 1XZAA 3M5CA 3P9YA 3HA2A 4HH0A 3WHKA 4NS1A 4HNAA 1RXCA 4IIJA 1YASA 3CF4G 1ZIXA 2O2CA 1W5TA 3M83A 4QOIA 1JHZA 3OUTA 1CERA 4JFRA 4JLNA 1KYIA 4WZAA 5I7OA 1SVIA 5B7GA 3UJ8A 3CZCA 5A7HA 2COEA 1NJ2A 3RS4A 3ZCPA 5A4JA 3A7DA 4RTLA 5ITZB 1I6KA 2VDKB 4J6EA 5FH9A 5BSVA 3BL6A 2BSQA 1MMFB 1SCUB 3QY9A 3DKPA 3SQMA 1E3LA 1DHRA 2CL5A 1YI8A 3L6RA 1J2UA 3FWYA 2JBAB 4MHOA 4WLVA 1IBLB 2JIZA 3K8ZA 1RZRD 5AHXA 4Y6LA 3LXMA 3TW8B 3QKRB 4MQ5A 4ZVUA 1UBSB 1AMNA 1ZD9A 5JVDF 3D7MA 4D6YA 1K89A 1SB8A 3GARA 1DOAA 3FRIA 2BSXA 4NOKA 3COSA 1Z36A 2GNAA 3KM0A 2L18A 2AYXA 5BR1A 4GMGA 4BJ5A 1Q57A 2HA0A 3D4PA 1JXAA 3KQTA 4AN4A 1G6Q1 4DR1B 3FBGA 4HVAA 4L51A 5DRYA 1DRKA 4JIMA 4DIOA 3F4BA 3HJHA 4IX1A 3TLEA 2NTJA 8ABPA 3G5MA 4QNMA 1C9KA 4HEA6 3TGPA 1YQXA 3T3NA 1QHEA 3AVOA 1Q1BA 4JS0A 3RKUA 4TMZA 3A8TA 1M34E 2PZMA 3KSZO 4QGHA 4RVFA 3O31A 1OKKA 3WNCA 4DQVA 4ZJUA 3QPDA 3DCJA 4U4AA 3SJGA 3T3IA 1XV5A 4C6TA 2CV1A 4L9SA 8ATCA 2ZUCA 2WM2A 3AUXA 4GOLD 1A04A 2JGAA 3BEDA 3C7KA 1XKQA 3MJVA 4RHEA 3PCTA 3HFSA 1BWSA 1CIPA 1DUVG 3O7MA 4GWKA 4KUGA 4R1TA 1CZOA 4PGMA 1OH6A 4HLUA 2AJBA 2H6EA 1BC5A 2RGWA 3OX1A 1AQIA 2WUGA 4KXFB 5JNRA 4X63A 3T12A 4BTVA 3IHTA 1GT91 2DBRA 2BEVA 1Y4AE 2FSSA 1Z0FA 2UZIR 2XWBF 1EZAA 2GYYA 4KI7A 3ZS9A 3M3DA 4IDQA 4X3PA 1U4NA 1PKEA 2BFWA 2H8KA 4XTCS 3RFTA 2A9QA 3H5AA 4OC2A 5TMDA 1QHYA 2VF7A 2G3YA 1TT5B 1Z74A 2QD1A 2QTGA 2C20A 5DNCA 1I6WA 1AURA 1OIXA 1E3MA 4O5OA 1NP6A 3H2YA 3OY2A 4AYTA 2OE2A 3AW8A 4X6UA 2OXTA 2HJRA 4J76A 4L27A 5IPFA 1DIGA 1NKTA 2XR1A 1DBWA 1QS0A 2OT3B 3NIBA 4LOLA 3OT5A 3KPYA 4ZVSA 4Z49A 1QE5A 4DBVO 3W2FA 1LH0A 1UXJA 3PRHA 5LM3A 5H83A 2BY4A 1LXCA 3H5VA 3FJOA 4EB0A 5DKFA 3P4XA 1ZJWA 4BNYA 4LQGA 2CDNA 2VQDA 2CNOA 2VOJA 4IZIA 3DEKA 3KXIA 4BMXA 5IULC 4I46A 4X7RA 2C94A 5DN9A 3A7EA 3BKWA 1H8ED 2ZJAA 4IXDA 4XGQA 1BH6A 5GWXA 3GUCA 3B7WA 1MBZA 4DJEC 3IBGA 3DLAA 1Z39A 1MAVA 4X3CA 3JQAB 1ZI9A 2PUWA 2JJMA 3ZJYA 2NPIA 2CFOA 4E46A 4XRRA 4B6PA 2QRJA 1LJUA 3EAFA 4BASA 1VHQA 2O0MA 5AW9A 5K0BA 3ZWDA 3ADCA 1YCGA 3T3MB 5BSFA 1JFTA 2PKRA 3FFXA 4Q7JB 2GD1O 1RYYA 1VL8A 1L5ZA 4HVCA 3F5QA 3ZS8A 2I6GA 5A9SB 4LF5B 3IHWA 4RK5A 5CM8B 1U81A 2DUUA 2VBFA 3DM5A 4MICA 5ENZA 4DQUA 2D2IA 2TMKA 4UTVA 4W6QA 3PQ7A 3TVYA 3EWIA 1U28A 3E4DA 5DM70 3B5EA 4J4TA 1VSTA 3IT3A 1US8B 1T25A 3H7AA 3PNBA 3WK8A 3D7LA 3OO1A 1P0QA 2BTQB 4YHBA 2WOOA 2QZJA 4KKVA 1CZKA 3TNFA 1VBHA 1ZP6A 4IH9A 1F8YA 2SCUA 3A9UA 1AC5A 1NLYA 1NF3A 1BROA 2HZ7A 4WJKB 2EZ8A 2C5HA 1ZAYA 3Q3VA 3ZEIA 3HUUA 1VDMA 3AC0A 4KE8A 1PJCA 4LXYA 1GHTA 3FA2A 1JKMA 5KYXA 1ILEA 1K86A 2X8LA 1T4CA 2AK3A 3NVAA 3MLAA 1EWRA 1NRIA 1R9NA 4HDSB 1N8KA 2IV3A 2AYYA 3O4JA 2AVDA 3QXGA 2MHCA 4QPCA 5I3ZA 1PVDA 1KAHA 2H7YA 2RAPA 3L92A 1TCUA 1ZGGA 2F9FA 1YH3A 4CQMA 4DM7A 2ODTX 1OWLA 4BEBA 2ZRPA 2PM8A 1NX9A 1JHMA 2PD3A 4Z51A 1OOEA 4YO7A 1N5IA 3CM0A 3V8RA 3G0GA 3AWDA 5CP8A 6REQA 1GTVA 1ELOA 2GBIA 1O3YA 4D99A 3OFJA 1R5BA 2N1BA 1MC1A 2Y1DA 3GH3A 3HYRA 3ADPA 4BHTA 1IRXA 4W5QA 1ZVVA 5F09A 3ETDA 2ONKA 3B5JA 5CYPA 4B82A 5HZHA 3A6PC 3U40A 4C0WA 2IUTA 4HNHA 1E2BA 1IOVA 1VYHA 3KS9A 1Z5VA 1N9KA 3PXUA 3IAHA 3D3EA 4BPRA 2WUWE 3SKVA 4CIXA 1WIWA 3SHWA 2R60A 3OZXA 3H19A 3KSUA 4L9WA 4LXHA 2OHXA 5ESDA 2FP4A 3OZCA 2WQ7A 2XUJA 3KB1A 2H48A 1YKFA 1DOZA 4HPJB 3T9CA 1K6IA 1SMKA 2QNBA 1I2CA 3C6MA 3MJSA 4MV3A 4BL5A 2YXNA 4U2KA 1LZLA 2J9RA 2GHQA 1GXSA 4NX2A 1V4VA 3A14A 5CA1B 3Q3JB 2BMDA 3AI1A 3CPEA 4PTLA 3NWOA 4M9UA 2OK8A 4BO4A 5JDIC 5EIOA 1VGRA 4LSMA 2B37A 3FGZA 3O21A 1LJ8A 2TMYA 4PSAA 3WGTA 4C0BA 4C7JA 1DXQA 2ZWIA 1UPXA 1T6XA 3ZDBA 3AEKA 5A4IS 3G5TA 1WXDA 4B4UA 3R5JA 3ELDA 3SK0A 3C7TA 3P9QA 2RAUA 3P0JA 1E5LA 1WEKA 2NV0A 1I1NA 4EW6A 1N5RA 4NBUA 1CLEA 3R3YA 4EUHA 4JYWA 2XQIA 3FHTA 3OZUA 3ZJTA 1IWOA 2QVBA 3A1VA 4NK4A 2Y71A 3TNLA 3GEIA 4AMBA 5K51A 3SEZA 2F4NA 4JLVA 1D2RA 4LRSB 1SXGA 1RRVA 1DJOA 2J0UB 3CFYA 3IEKA 3LCRA 2C7PA 1R6TA 2XADA 4LVCA 2IIQA 4FX5A 4ZXPA 5HEKA 1J23A 1F8UA 3BCUA 4LFBB 4H0FA 2P9YA 2VWGA 4RQUA 5DEOA 3IXLA 3V5NA 4UW9A 4EJFA 1RI1A 2CVHA 1VSVA 3HB5X 4IAOA 2BTEA 1J56A 5FEUA 5K6TA 3C16C 5KWEA 5IYZA 2QVYX 4E33A 3HCAA 3JQ8A 1EFDN 3RG2A 3LNCA 3BD7A 5H4HA 1BDJA 4Q4HB 4CMHA 4CI9A 2XLCA 2QLMA 1IVNA 1UT6A 3PZRA 5JH7F 4C9AA 4ER6A 5IC4A 4YAEA 3PNOA 1W73A 1WOYA 3UJBA 3KP1A 2QRZA 2NN3C 4GI5A 4YT2A 5KTMA 4RA6A 4FHDA 3ZDAA 2OCKA 1PK9A 1FY2A 2ZSEA 3KOYA 1T9KA 3BQ9A 5A3SA 4FOSA 4FGLA 5I8ZA 2D3WA 1OXBB 1HYGA 3WQQA 1GNSA 2FW8A 3U4HA 3RUEA 1WKBA 4AL4A 4K86A 5EEHA 5HQ3A 5KSOA 2XXJA 4KREA 1MQSA 3M2TA 3NORA 1U99A 5TARA 4L02A 4Q4JB 1VBNA 2WJYA 4R9RA 2H1WA 4YEDA 5F7ZA 1QGOA 1QF9A 3A3OA 2FK8A 1MXHA 4QGAA 3H6KA 3MWDA 1WTCA 4BLTA 1NVMB 2X0IA 3FZYA 1CZUA 1KA9H 4NHOA 3FB1A 3E18A 4YQYA 2OAEA 1Z08A 2PGIA 4IQ4A 4BLSA 2ZRLA 1ZD5A 1PEDA 2J9YB 3Q11A 4O4IF 2OZLB 3ZV7A 3C3EA 1RJFA 2EQ5A 2F55A 1PYDA 1ULSA 2ZATA 2EZBA 5E1OA 3T3EA 1F2VA 4EI7A 3CKMA 5DI9A 2P35A 2D0PA 1RXEA 4IIDA 2R7LA 1DRJA 1OBHA 2EZ9A 4WX2B 5FNZA 5FT9A 2ZK7A 3I1IA 2P5UA 3CZAA 3FYUC 3CA8A 3T3GA 4WKPA 5A4AA 5BNTA 4X66B 5ICFA 2CLEB 1FP6A 4CM4A 3CONA 1AHNA 2XMRA 2ZTMA 3BCSA 3GCZA 3T7KA 1VIAA 2VQ3A 2Q1YA 2GZ2A 2G77B 1G21B 2B5WA 5FNVF 1W36B 5FQNA 3TFWA 3ROTA 4I0WB 1E4VA 1EKXA 2JIDA 4RKFA 2OPHA 3DZ8A 1T3TA 3UHFA 3VJMA 2YMMA 2O6HA 4JQSA 5BSKA 2P4EA 5JYCA 4DCJA 1JA9A 1OPXA 2PO5A 3AM1A 4A3SA 2ZVQX 2RIRA 3HRHA 4DDHA 4GL2A 4C4OA 2OZVA 5IM5A 1PU2A 1NC1A 4BNNA 3NATA 3P7MA 1KRXA 1ECFA 3H2IA 3IKLA 3KSMA 3M81A 2R1UA 3IMCA 3K5PA 1SZCA 2P8JA 4GI2A 4XA8A 4LQLA 1KC3A 4L0DA 4Y2PA 4I99A 4AP9A 2RHDA 2PFSA 3V33A 3IAS1 2FE1A 3HCOA 1DQSA 3VR6A 4OQYA 1N1EA 4NMLA 3TBKA 1S2MA 5DYNA 2EZAA 3T61A 2E85A 5J2TA 1CEYA 3HGMA 3MCUA 5DM2A 4C7XA 3E70C 3GP8A 2WJIA 3AU8A 5KOJB 2BJVA 1K68A 1KYVA 2DWUA 2AN9A 4G8CA 1CRZA 2E4AA 5BYJA 1JDNA 1PNTA 1PT6A 2FPUA 3ORFA 2FJUA 2WQZA 3IQFA 3G9XA 1LVGA 3LLMA 2Y2VA 3W1WA 2GZRA 1ZHHA 3GDGA 5H02A 4IFIA 2VUSA 4Q01A 1WPXA 2YQZA 5EJAA 3B1YA 5TJ9A 4R3WA 1M1YB 1WS6A 3DA8A 3M9WA 3W1VA 1RJDA 1YL7A 3P96A 4RZIA 3I5AA 3OTGA 5FULA 4HNVA 1SC4A 4G8DA 4C6SA 3RSSA 1M2KA 4XX1A 4OUDA 3LHFA 5A1JA 4DWWA 5EP4A 3Q0IA 4MUGA 1FUYB 1HRDA 1V9LA 3CLTD 1U3CA 3H97A 1P5HA 1NW7A 1WUJS 1Z5WA 1T4DA 4WE3A 4QM7A 1OFUX 3N2IA 2EW8A 2BUAA 1QGUB 3A11A 3MPOA 5LMZA 3K53A 2DFTA 1U7UA 1SQGA 3OP4A 4M60A 2Z6QA 4AG6A 1AB6A 1P91A 3ZCXA 2O8CB 3GXOA 2XWSA 1A9XB 3IMEA 1KP9A 4KNWA 4L50A 3UT5A 2YUIA 4XPZA 4MCQA 2A5DA 4X20B 5BVGB 3IOCA 4RKEA 1ZD1A 2IHKA 3T6KA 1DWOA 3GLKA 1VHLA 1FFDA 4R0MA 1QGAA 2ZVPX 1KU6A 4JODA 4UE3S 4EUNA 1A97A 3TR0A 1IN8A 1EFKA 1LDBA 1MG0A 2JW5A 1Q21A 3ENQA 2W4QA 3RARA 4LVNA 5AM0A 4M2LA 2GNOA 3L4BC 1QYWA 3D8RA 2WPDA 1RMTA 3PQ5A 1TA4A 2QR3A 1A76A 1WX1A 4PLVA 3BXEA 4QBIA 1RYHA 3AFOA 4MPPA 4D02A 5K7SA 3DZCA 2OV1A 4YP9A 2DQYA 3V6LA 1WKCA 5LMUB 1FFXA 1MU0A 1R0SA 1Y9ZA 3G1UA 3PR3A 4MW7A 1Z0UA 3KVYA 4IOMA 3EAQA 5JD6A 3U5TA 3U39A 2MP0A 2V7PA 3B8EA 1YBHA 4H7FA 1WULS 2F90A 2VA9A 3DPSA 1U2TA 2WU8A 2POQX 3TZLA 5B3JC 3OICA 5IXYA 5EHNA 4Y2GA 5KTTA 3CZ9A 3E6AA 4LNUA 1IG0A 1M6VB 2ZRBA 4MS3A 3SYLA 1IBRA 1R0ZA 4QWWA 3TRFA 2R11A 3JAWB 1SXIA 4BLWA 2XAUA 4NV3A 2Q3FA 1TLTA 4KO1S 1AQYA 2HXGA 3GLHE 1XEWY 3L0PA 4QSMA 2P0AA 3ZGVA 4E5VA 1Z25A 3DL7A 2HGSA 3F7TA 3RLIA 2R65A 1KEKA 1QTNA 4FYJA 1JSCA 1OWMA 5EJEA 1YU9A 1RYFA 3KJXA 4YCNA 1YVRA 4LGCA 1H0KA 2D3TA 4ZXFA 4TUYA 2O0KA 2NZXA 3RVMA 1NM5C 4TUYF 3K20A 2PRYA 1E6EA 4G9BA 2JD1A 4TL7A 4DN6A 1ABBA 3KL4A 3OQ6A 1D2HA 1JSXA 1C9EA 3QLUC 1B6SA 3D7HA 5CH8A 2HUPA 2OV8A 2HMVA 1Z6ZA 3NBAA 5FBVB 3C7CB 1X7YA 2I6SA 4XPIB 3QFRA 5BN3B 1G20E 4PLPA 2BUBA 4OHUA 4RX1A 1KETA 1TC1A 1UPAA 4TTAA 5HP4A 3RUDA 4M38A 1XYYA 4F86A 1WCV1 2ZRFA 4UU1A 3E7XA 4EGQA 1LRKA 4JP2A 4EA6A 4URFA 3EBPA 1UOQA 1NG9A 3ZPXA 3PGXA 2PE5A 1UZNA 5CDTA 2RMKA 3CVOA 4PPFA 4EBBA 2EX4A 3G9ZA 1XQXA 2B8JA 2OEPA 5THKA 3ZOZA 5EJ5A 1RM3A 3O9MA 3QENA 2X9QA 2VIIA 4UHEA 4DQDA 1QM5A 1WHSB 3G2KA 3BEOA 3TQHA 5JAUA 3I6SA 3UWKA 1B1CA 3EFOB 2P5TB 2DBVO 1GPJA 3CEPB 5GQSA 3ZXYA 5JV5A 1BQEA 2AV6A 1YULA 1JXQA 1JAIA 3LLVA 4E1BA 1P8JA 3FCUB 1NZFA 4K9OA 4NHEA 3HSKA 1QYVA 5E1BA 3U3ZA 1S8AA 4BFSA 3LKVA 1KZ1A 4R8RA 1HKHA 1UK7A 1VJ0A 1X1QA 3FSJX 4X5OA 1O95C 3H6GA 4LXUA 2XOKA 3A6JA 5ALNA 1AUQA 1ZISA 3CEAA 4G41A 2I1WA 4MWEA 1ACMA 5KYVA 2J0QA 3FOAA 4TTJA 2FP4B 4W9NC 4RD2A 2Q5HA 1RBZA 1A8SA 3O2QB 3W8DA 1ZIDA 1YS6A 2A3NA 2BWJA 4ZZ2A 4D0LB 1H6BA 1V16A 1GSIA 2XD4A 2A94A 1UDBA 2Z8YM 1S3GA 1WMDA 1X2EA 2PZJA 1DCFA 3P0IA 3NBFA 4HB2A 5BSUA 3R75A 2CDAA 2YQ4A 3QF7A 4ZIRA 4DJAA 2CXSA 1CSEE 4MGEA 1R0YA 3ABSB 1M67A 1G21A 1VC2A 3NHYA 4Q9IA 5LQNA 1WLSA 2B92A 5FOUA 3O1LA 5EIXA 5LA6F 3QEBZ 1CQWA 1GD1O 2YJTD 4PW0A 1GQOA 1ZA1A 1ZM3A 1MA0A 2HUNA 3AP2A 3TW0A 2X1MA 5FYDA 2H18A 1PSDA 2B1QA 4DMRA 1G5RA 3Q3EA 1IN7A 1USWA 1M8KA 1QH9A 5THQA 5FUYA 1C7QA 3IIEA 4X6LA 3WRVA 1J0DA 2ZSAA 3AFMA 7REQB 3KUXA 2ANCA 1KOJA 3T9DA 2G17A 2R5WA 3ZY5A 1M2OA 4F91B 3VR4H 2FRDC 4PNEA 1JVSA 1R2QA 1NVVR 3EFHA 3NGXA 1G8GA 3QYFA 4L3WA 4J29A 3V80A 1J42A 3DOIA 2H5LA 2UUPA 4HI0E 3GQVA 3QKSA 1BHJA 4YMIA 2YYAA 3EGXA 4CIYA 3ZBPA 1JPVA 1VYVA 1LW6E 1T6NA 1L5LA 1TYEB 2ICAA 2YJ6A 3KD3A 3EFBA 3FTCA 3NIFB 2Y0CA 4EITA 3NDRA 2H1IA 1HSOA 3FB4A 5D3KA 1ZH0A 2HM7A 3CNLA 1F4PA 1SXJD 3CX8A 3S8MA 4XDYA 4DR3B 5LJLA 5EKSA 2GN0A 1Z6GA 3FDFA 5IBRA 4CZ2A 4AFNA 4DDUA 3H5NA 1A5AB 4DZZA 1UUFA 1W87A 2PL3A 4AJ4A 1FVFA 4AWBA 3LV8A 2I4TA 4UM9D 1RLJA 1Y42X 3V8MA 4QXAA 1BS1A 3WBBA 4CIBA 3F6PA 4XUGB 5HKOA 2A92A 3QNWA 2XLBA 3HKEA 1PR1A 1SUEA 2AC7A 1PUXA 4QSHA 1YFKA 4BMOB 3QBTA 4H3VA 5FFFA 4OB6A 4ABYA 3D4IA 4EMUA 2C7VA 1B0AA 5HQ3B 4LXXA 5E38A 3RU3A 1DV2A 4CL3A 1KJZA 2IY9A 1P31A 1EUCB 5JNUA 4L0MA 4HFMA 3DR5A 3QUBA 4GZLA 3ZY6A 4N39A 3HV0A 5CT5A 5BRAA 3MMZA 1T9DA 3ROQA 4NXMB 5A0VA 2H2IA 5ALQA 1HDIA 3LY9A 4RZUA 4YR7A 4ZICA 3N74A 3LMKA 5LC1A 3MERA 3I9V1 1IPFA 1Z37A 1DE0A 4H6WA 4D9NA 1N3YA 3BK7A 2A58A 1NM5A 5CA1A 2ODNA 2BCJQ 1DXHA 1BE8A 1J49A 3AUTA 4B33A 5C5DA 1NUUA 3VU3A 2CFIA 3OZWA 5IK2D 5C1IA 4ZAXA 1GIAA 2CWWA 5FPHA 2JAUA 1OBCA 5HVNA 1O1YA 4G01B 1EM8B 5B1SA 5I5GA 5K3FB 4A7PA 5KU1A 3UAZA 4M53A 4UD6A 3U3DA 1Q1GA 1WO8A 4URWR 5JW6A 4K9RA 1KEVA 1JYFA 4BWYA 1N2EA 3SM3A 1XXHB 2QSJA 1ZCBA 1T34A 1U98A 2B4RO 4DXDA 3I1JA 3WA6A 1E9VA 1IG3A 3HDVA 4EPXA 4F4IA 2Z30A 5SZIA 3RUHA 1H5QA 4YP5A 1ZJ5A 2JBHA 1ZUNB 4E1AA 4OK5A 1TVEA 2V59A 2R7AA 1MR3F 3UOGA 2NMVA 1ONBA 1QHFA 4N54A 5D5PA 4F21A 4MIKA 5EERA 3LRPA 3W2TA 2NIPA 4QYWA 4KWIA 4QM6A 3M3HA 4N0EA 3NP9A 3GVCA 1MT3A 2X0RA 1E3SA 1B8UA 4PNZA 5ALYA 5JAZA 3DFKA 2X9LA 3NTXA 2F6RA 2FX3A 3D64A 3G59A 5COBA 3PHJA 1E98A 1ZMXA 4XWTA 2AC4A 4I8XA 1NP7A 4YMWA 5EE0A 3DMNA 4DA9A 4QICA 1PWYE 3ZU2A 4R81A 1WSBA 4GD3Q 3KCNA 1YRLA 3FG9A 4NYMQ 3DBRA 3EPPA 4OI2A 4OJYA 4PYRA 1DCTA 2A0XA 1ZHOA 1USGA 1O95A 1XVIA 4WDRA 1VMDA 2WT9A 2BFEB 1Y1TA 3NKVA 4P4EA 4P5DA 4D4LA 1ZESA 3EGOA 2RG7A 4G07A 4LW8A 3RBVA 3WBFA 4C01A 4ZMRA 2APJA 1CIJA 3TTYA 3U3JA 4M83A 3JVUA 3QKIA 4CQLB 3JY6A 3AB8A 4G85A 3DAYA 1EVQA 3IEUA 4YJ3B 4R0VA 1PIWA 1NV9A 3CX4A 1AK9A 3MW8A 1TYAE 4MWGA 4PWZA 1GFSA 4ONEA 5CT9A 4H0NA 4C4XA 5AUNB 1JSLA 2AI3A 5MFZA 5I6DA 4G0YA 2GTHA 3QE0A 1HORA 3OMLA 4H7IA 3AW9A 4CFZA 4JLJA 2EGGA 4G0NA 4Y2TA 3Q15C 2B0CA 2H2AA 1S9HA 1YACA 2A6PA 4FHCA 1USIA 2VF4X 2YC4C 3H3JA 1GLNA 4I4IA 2VDLB 4CN8A 1S1CA 1V3QE 2G5CA 2VZ0A 2EJUA 1ORRA 4UAUA 1Z6QA 1Z2OX 3AM5A 3I6ZA 3ROMA 3UXYA 4F71A 1RVDA 4ZT6A 3VZCA 1E1CA 5JSUA 1SCNE 2P4HX 5CNKA 4BC0A 2IDJA 1Y4UA 4ETMA 2O8CA 2I80A 4LUCA 4ENPA 4PYQA 5E3IA 2EQAA 4DIBA 3MMSA 3O6VA 3OZTA 3NEYA 3AWIA 4G0ZA 4LRWA 4D9JA 2PEZA 2JBJA 1KJNA 2X3UA 1C3OA 2V96A 1CD5A 1HY3A 1H0HA 1QHSA 2OBMA 3LOQA 1SK8A 2R44A 1XRMA 3M6WA 3N3AC 4HWTA 5FF9A 4YRLA 4LAFA 5B3KA 4CEHA 4BJ3A 4RTNA 5IMBA 2V7TA 2Y1WA 4ADSG 1P6UA 2FUCA 3C3KA 3CLRC 2D59A 1VLJA 5KKNB 1RS0A 1V25A 1ICIA 2IVFA 2YHIA 3RUPA 3J80A 1NI3A 2AHOA 1XUOA 1MC5A 2ET6A 1CRQA 5ECDA 3AV3A 3RYCA 1WNFA 4PY2A 4NEGA 3TM5A 4R05A 4PICA 3HXOA 2M32A 1X7WA 1W4BA 2PX8A 4N82A 3DM9B 5ES3A 1QFMA 1JWAB 5TX7A 3SBOA 4GEKA 3VMFA 4KSBA 4YRIA 1CB7A 5HJ5A 1BWPA 3DEHA 1I0LA 3ETGA 5F12A 1JEYA 2G6TA 2A5FA 2QQFA 1I5EA 4KFUA 2QNRA 1YV9A 3FYSA 4D3XA 4F4DA 3BXXA 2AW3A 1SC1A 4GXTA 4Q9KA 2H9YA 2X8BA 2XF2A 1ZO8A 3EA0A 4NDNE 4IUCS 2NAPA 1ZCAA 5DHPA 2AG0A 4EVIA 4J03A 5JQWA 4AN1A 4X3RA 3TCKA 3FDJA 1FFEA 3ZCVA 1VP9A 4H3HB 4UJ5A 1GCOA 5HR5A 1X1RA 2H2GA 1GRNA 2ZB3A 3HS3A 1GPBA 5DIFA 4AKIA 4LY3A 1TM3E 1BVUA 1GKKA 1FRQA 1XLTA 3G9TA 3AVUA 4V1CB 3A1EA 3PA6A 1CYEA 4PC2A 1MEEA 1UK9A 3HBJA 2OECA 3LT5A 3GRKA 1UZUA 3MG9A 1NN0A 4IWYA 4WUTA 1E1RA 1DC6A 5EP1A 2QZZA 3O4VA 4Q66C 4Z1MA 3WSTA 1XZEA 3RFVA 5FKJA 1NJFA 3JTEA 5A02A 4OMFG 1B15A 2YVLA 4HDMA 1M3SA 4LX0A 5KVSA 1VPEA 1GITA 1W88A 2BEKA 1T0JB 3TN7A 3ZQUA 4DDWA 3I64A 4QBGB 1HLFA 2PH7A 2W6JD 5DGHA 3FNHA 2HREA 4A27A 2CJPA 4D6PA 4FHGA 5E6UB 5LU9A 3M8KA 4TRJA 4YP1A 2YV4A 1T5BA 1KQGA 4GEGA 1AZSC 1CX9B 4MDHA 4PHCA 2CHGA 4JHLA 2OQIA 3WJ7A 3TJMA 4C85A 2ZYRA 5L3QB 2QM7A 2DPYA 1XAHA 2Y1EA 3GGOA 2CUKA 2LPMA 5BT8A 1WBBA 3K4PA 3E82A 3JQ7A 2HWGA 2GCOA 1OC2A 1TEHA 1J6UA 3CH4B 4NJMB 2XW6A 4TMWA 4UXHA 3S1AB 4ZGBA 2D1FA 4A23A 1VJ5A 3T07A 2EZTA 2AR9A 4IHKA 2Z2IA 3W2EA 3G8BA 3KTOA 3PXBA 3WSWA 3CGWA 3ZH2A 3TZQA 2GRUA 4CU5A 2YIDA 5LQMA 3O8RA 4XIYA 4UD2A 3PDIA 4PWYA 2VJQA 2YFHA 3D9QX 4WW0A 4GR5A 4BVFA 2WIAA 3PVCA 2IHTA 1GGEA 2JHCA 3OQBA 3GZTB 2FN3A 1TAHA 3R7LA 1GTJ1 1M6WA 3QUCA 2FN4A 2OO5A 3AFGA 3TTVA 4Q39A 4A36A 5CNIA 4R7GA 4MKGA 4HAWA 3FY4A 1GR1A 4NP6A 5I9LA 1OHHA 5JLJA 3IUJA 2DTEA 4IY1A 1CP2A 2C83A 1GNLA 1W1UA 2OOSA 5JG7A 1VKOA 1M2WA 4CLDA 1NMSA 2I76A 2OWEA 3WLPA 4CFSA 5GPBA 2HNBA 1V48A 4B7XA 4OC3A 5AKZA 3VTZA 1Y9DA 4BLRA 1IBKB 3PC2A 1YOBA 4L75A 2JASA 3ZLTA 3BIWA 3QOXA 2FQWA 3VVMA 3TM4A 2E0IA 1R0RE 3VDNB 3V7UA 3D2LA 1SD5A 1LDMA 1FFWA 4G63A 2O2XA 4OSOA 4WXYB 5LNK6 1JEEA 5GOZA 5B6PA 1I2BA 4LJ5A 2VZLA 4NPCA 5B58T 3AILA 2WWGA 2Q50A 1FPMA 5K0LA 1PTJA 4LOAA 5GTDA 5K8IA 5E3HA 1T5SA 4J3NA 3SC3A 5F33A 4JU9A 2C5AA 1NNSA 5JJKA 4P86A 3ABRB 2AH5A 1F0PA 3HGQA 4EPRA 1SGWA 4J2OA 1Z29A 4OP2A 3RVJA 3TRJA 5C2JB 1PR3A 1T6BY 1YQQA 5TGZA 1FW6A 3I5UA 3BMOB 2J59A 4PPGA 4QUHA 4TQAA 4ETIA 1GGMA 3KX2A 3HNPA 1JKFA 4GOXA 1EQ2A 1M1XB 3HWSA 1X9GA 1JSZA 3MM4A 1I2MA 3CLTC 4MWSA 3CUVA 4IEFB 5DXJA 4CG0A 3DONA 3L0DA 3MN1A 3RAPR 1M6EX 2I3DA 2I1QA 2JZOA 3CRVA 3VO8A 3M4YA 4ND8B 4OMDA 3TXAA 2DE0X 4CTKA 5BV1A 4KQMA 2X22A 3HJTA 5AIAA 2JGDA 1R5JA 5IC6A 4Q24A 5JVDA 3D8HA 3B3FA 5DM0A 4EO7A 1QYXA 3INTA 1C50A 4MZDA 1AMUA 2O06A 4RVCA 2WHPB 5FD8A 4C0XA 2C31A 4ZI7B 4RCVA 5KJ6A 2F1HA 4G8BA 4OP1A 4UCFA 5TLSA 1JMVA 2OGWA 1RI5A 2ZIZA 2IWRA 2PLFA 4LKOA 3HR7A 4U6SA 4UM8B 3WDKA 2EYUA 2NLOA 4M99A 5HFNA 2EWVA 3WIUA 1IY8A 1B93A 2EEZA 2LKCA 3M1IA 1TADA 5LFAA 1G6OA 4CUZA 5I01A 1ZU4A 3ZD9A 3RS3A 4KAFA 4B3JA 5KYYB 2AIRA 3Q88A 4GW3A 2E1RA 2OAP1 3N6VA 1UC5B 1E2PA 3NV9A 4H1UA 3D3NA 4JP1A 2ILTA 4H35A 1CY1A 4NOMA 4W99A 4DJJA 4L08A 5J2UF 1NUQA 3EMVA 3OEYA 4LQDA 2VUHB 2QXUA 3IEIA 2QX9A 3I8OA 3JYQA 2GLUA 2I6XA 3MA0A 5EOVA 4DB4A 2NW6A 3ZQKA 4ARIA 2YWRA 1XMIA 2NV2B 3F1LA 2ISCA 1BX3A 4JX9A 4YRZA 1V11B 3C45A 1CE8A 1T4CB 4EEKA 1W30A 1JXMA 1Z45A 2A0YA 2ZTSA 3QKRA 4TS1A 4BQSA 1Q5XA 1Y98A 3ABOB 3VJKA 4OL0A 2RJNA 4XYBA 1E9RA 2PN1A 3K31A 1ZONA 2QUJA 2VCYA 4FBMA 4KMRA 3AL2A 3N2NA 4FCVA 5H59A 4DRYA 3R5KA 4UOZA 5LWHA 3TRIA 2C6CA 2AFIB 5AK0A 5EP3A 5LZ7A 2JBKA 2ZUBA 1NFQA 3IV7A 3LY7A 2ZZKA 3AJDA 5T4EA 4LWOA 3QW4B 5JDCA 1A2BA 4XAQA 2ZJ1A 3PIDA 4AQYB 2VP3A 4HCJA 1OILA 1TX4B 1V5FA 1SBCA 1X70A 4QYTA 1CQZA 3O0DA 3ZWXA 1J0AA 3L2OB 3U4DA 2ASVA 4ZYUA 5JHHB 1ZXXA 3I61A 2B4AA 4QELA 5CFRA 1SH7A 2Z0MA 4KYIB 3WOVA 1KTVA 1SQFA 4KGVA 4Q3OA 1QCDA 1THMA 3LO5A 2IOFK 1ZD3A 1BMTA 2FFAA 1FMJA 2REQA 3DEYX 3GBPA 3UXHA 4AJKA 4CI0B 1L4GA 1XP5A 4KN6A 4N47A 2BEWA 3AU9A 4DE5A 3KPVA 1D1QA 2C92A 4CIAA 3S9MA 2BBWA 2NSJA 3C0KA 3FDIA 4XH9B 3FMFA 4LOKA 5A2QA 1K6JA 2IK8A 3K2IA 3P0HA 3T1QA 3VBCA 1Y33E 1UFOA 1MA3A 3ENNA 2B61A 4I5DA 2FVYA 1N5MA 3FW1A 2EG5A 4DLNA 4C2UA 4CGZA 4L6IA 2BMFA 5IJ9A 3PCRB 3D0KA 4K9QA 4TSKA 1Q2XA 1NW6A 2BMVA 3TL3A 1G8YA 1RPJA 1IUKA 3A36A 3O2NA 2GZDA 2VNHA 5E7MA 1LKZA 4BOYA 2FEOA 3T7CA 1FJXA 4BJ1A 2WNHA 3LCUA 5T64A 5ITSA 5DXFA 2CB0A 5IUKC 1I24A 4CEJA 1G3MA 5ALDA 2QMYA 2A0FA 4MDEA 3PPYA 2Q49A 2FWRA 1UFQA 3OJEA 2H29A 2Z3WA 4FJ1A 4D0RA 4D9CA 4RTQA 5KZMB 4MJLA 2AZXA 1DG9A 4TKUB 1NXQA 4DUPA 1A5BB 4NGMA 3EOAI 4M9SA 1KY5A 4DDVA 1H0SA 1IBMB 4P0PB 3QOFA 2FOLA 3EXEA 4LJLA 2B2XA 2Q4BA 2Y1KA 1AH2A 1UP7A 5K3SA 4MH0R 2O23A 3L7KA 3BAFA 1RQPA 5GMOA 3MWFA 3KQSA 5G0VA 2HHAA 4Y7CA 5FBZA 821PA 5K05A 1S6YA 1YZTA 1IPHA 2V58A 2NO0A 4ZO9A 2HNAA 4QOSA 4LRXA 2HQBA 4E30A 5IDYA 2HRRA 1O54A 4X84A 3SZMA 4JXJA 5F3DA 1YB7A 4X1OA 3VDQA 4ZODA 1JG6A 3EHDA 4BVKA 4ZDJA 2IX9A 3TSYA 1S2OA 1PS0A 2VVTA 1KJ9A 1ECGA 2I4MA 1L3IA 3ZE0B 4Q5IA 1JSRA 1GZ5A 1Y48E 2QIPA 3VR5D 3GMSA 3FLEA 3IUBA 4C22A 2PBFA 4FHZA 1V7CA 1BHSA 4WEOA 3OPMA 4L85A 1E3WA 2PS1A 4WSOA 5DBEX 4OFXA 3T5DA 2BYTA 1ZZEA 1WW8A 3GD5A 1ZIYA 1YE5A 1PUJA 1SRRA 2GPNA 1CJBA 1IE3A 3HWWA 4FN5A 4HDAA 4QEKA 2FF7A 3H86A 3VNRA 4QJ3A 1F12A 2X7JA 5LQCA 2HA3A 1R8XA 3JAKB 2XVXA 2MR5A 3L1JA 4MROA 4O8ZA 2VYQA 2QMOA 2V7BA 1UEJA 2FZGA 5F35A 1QRTA 3SDBA 4F3CA 4UBKA 2OHVA 3PVZA 1RXYA 5A03A 5CFZA 5J4YA 3OFND 4MI1A 2WV9A 3IP3A 4NI5A 1OQAA 2E18A 1VKZA 2QN9A 4ZMBA 4CMJA 1T1IA 1NQWA 5LMNB 2ZYTX 1CP3A 4H31A 4S1OA 2B0AA 3R8FA 1T35A 3ZDYB 4IJWA 2H5JA 2YCBA 3BHIA 3WYEA 1VZ3A 3KJFA 2Y68A 3LCVB 1ABEA 4R8MA 3ZK8A 1EFRA 2IE0A 4TL6A 5F1KA 1TJ3A 1NR7A 3PQ8A 1VPVA 4CT5A 2RSLA 3EJWA 2ZKIA 4L2IB 3U09A 3LZCA 3JQ6A 5ERXA 3RREA 4UCXA 4B46A 1NT2A 4Z9XA 4CM6A 5KX5F 1DQYA 3D8NA 2KI5A 2ZRKA 4MQFA 4HMQA 3AF5A 2F8MA 3N6XA 3RUFA 3ICEA 4EGJA 2O2HA 3HL0A 1UMBB 5AJWA 4P7GA 1CNEA 5T5QA 1X1BA 1L5KA 2BKVA 2CLSA 3KYCB 4TZKA 3S2GA 1BU5A 1IDOA 4KQJA 1GN8A 2DUJA 2B30A 4HBZA 1PJRA 1M1NB 2YRXA 4LHSA 1DAKA 4PSKA 5EXXA 1YDGA 2XY4A 5T3YA 4CMIB 4D4GA 2P6RA 3OLZA 1QK3A 1ZY2A 4D0GA 4H7PA 3HSYA 2CMHA 2G9RA 4RACA 2BL4A 4I14A 1J8YF 3U7JA 2CNWD 1YJXA 4PO8A 3U4GA 2J32A 4XWKA 4HFNA 1WL8A 2FK7A 4BFZA 1ZGCA 1L3BA 1NHGA 2I2CA 2OXCA 4PQYA 1MEJA 3BH0A 4R69A 5F9MA 5CX1B 1TD9A 1OBOA 5CCBA 2CVPA 2WWXA 1A4XA 2ERCA 3PP8A 2NUAB 3GF4A 5ER9A 4Q16A 5AUQA 4DIFA 5CLHA 1U8CB 3IGFA 2XUAA 3LPCA 3HDTA 4HXEB 4LRTB 1E2EA 4MYHA 3V4LA 1JI0A 3VYTB 4TVKA 3V2IA 2RC5A 1D04A 3UJ9A 2QMHA 3AEKB 1XBTA 5JYEA 3RYIB 1AGYA 1KEWA 4G0PA 1F8FA 1GCGA 3INNA 4GU5A 1R6UA 3S68A 4M89A 2CB9A 3DQQA 1OR8A 2PXXA 3PUJA 3RRFA 2C78A 2A5GA 1BFKA 3C39A 4W82A 3Q7PA 4GBED 4BKMA 1IQPA 1Y3DE 1YK1A 1RAFA 1IAQA 2P3QA 3PWZA 2FPIA 4X60A 3ZDZB 5LJIA 4HS4A 1TUEA 3PD7A 2OO7A 1E59A 2VN8A 3BWVA 3HA5A 1SBTA 1K7XB 1L7BA 2C5FA 2E7ZA 5BQPA 1FU7A 2QTRA 4YA6A 1DRUA 1I2DA 1N9GA 4ZHQA 5IR2A 3OSUA 1YS9A 1HWYA 3LBYA 4J0KA 4N4AA 3TECE 2GKGA 2Z04A 4GX5A 4DFDA 3NYQA 3LY5A 1WSDA 4AMZA 3NJ8A 3OU2A 2LCFA 4KR9A 4HN2A 4KQXA 4OC4A 3ADKA 1TCBA 3OJWA 3V1TC 2IYYA 3F3YA 2R0QC 3OO0A 3DE7X 1TOAA 3BD6A 1Z17A 2CKMA 3FSEA 3ZWKA 2BEWB 2VDPB 1JALA 3ZV5A 5HTOA 4YJFA 1ZN9A 1Y7PA 2P6PA 1I33A 1ZRMA 3OF2A 1UL1X 3IL2A 4PE5B 1CBUA 2C2ZA 3C8UA 2Q3JA 3HCCA 1MAWA 1A8UA 5FTJA 4JIGA 3PEWA 1N2XA 2IP4A 3NX4A 2JEOA 2CFTA 2XDAA 4ALLA 3ONFA 2NUAA 5L40A 1B6GA 1G42A 2PWPA 3FPEA 3IV6A 3PHCA 1JAHA 4C2BA 1QX4A 2VPPA 2Z4RA 4J16A 1SCAA 3B13B 3PK0A 2BM8A 3BRSA 4J3FA 4KXMA 5F21A 5C1PA 3QF4A 4U2DA 4QHTA 3WL4A 4GBJA 1ZI8A 3PNQA 1RRFA 2IV7A 3OCJA 1BDMA 5DXAA 4EPTA 4Y0NA 4A03A 1SG6A 4UJ3A 5AKJA 4NH0A 5J9FA 4KVGA 2KPOA 1W5FA 1LRJA 3C1AA 1FK8A 3L4EA 4MV5A 4BKPA 2XAAA 3AF4A 5DTEA 4F7DA 4UEQA 2AE1A 4I4TA 1R16A 3S2UA 3EIHA 3SYTA 4EYEA 4EY4A 2O2SA 1K5PA 3EXEB 3DYBA 2JGLA 3R8XA 3M6FA 3VZBA 2GPJA 2OFPA 1LWOA 2VK8A 3RUAA 4COGA 1PHPA 2Q0HA 1XDSA 5ILQA 3LK7A 5FL7A 2JJ2A 2JGRA 4G0VA 3OKCA 1XTTA 1XRJA 3I74A 1HT1E 3WBKA 5GM1A 1XZNA 4BNGA 1EWKA 5K0ZA 5CB4A 1OFVA 3DF7A 1WMFA 5AK6A 1LRLA 3DVLA 5EJ6A 1JLSA 1Z7GA 1Q0ZA 1COWA 1EWTA 1SELA 3A1SA 3UGJA 1B2RA 5J23A 4CKEB 2XRYA 1SEVA 4H27A 1FVOA 3NHPA 2O8VA 3LOUA 5KYWA 4YJKA 2LIPA 3DE5X 5CAEA 2XIQA 4MVJA 5FV7A 4OQDA 4KE6A 4YJFB 3S8EA 3EWNA 3DXZA 3O73A 4L7VA 1ONSA 4OQNA 4CE6A 1TK3A 1EZBA 4NZYA 1XPRA 4CMEA 3IAAA 1UPTA 5HGXA 2NO1A 5AKIA 4OHKA 3ZOKA 3CB2A 3RO7A 2ZT6A 3CURA 5B1HA 1R4MB 3L6UA 1VE7A 1ZH4A 3QSYA 3AG5A 4NBWA 3FGPA 3P45A 3PFHA 3NRCA 3RKRA 1ZC4A 3LP5A 3KWMA 2H4YA 3ZV6A 4OGLA 3N9IA 2VDRB 4LJ6A 3V55A 4FYIA 4NBVA 3TIVA 2C8KA 2HHHB 4YUVA 3QWHA 3RJMA 4H1VA 4JQCA 1I7LA 1FP4A 3MFQA 2O6LA 4BE7B 1J97A 4RF3A 1J24A 3B6KA 3JZDA 1IC6A 4BNDB 1EUQA 1CJSA 4REMA 2JH9A 1IM5A 4FCCA 1H66A 3NHUA 5CIQA 4DYVA 3BA1A 2WK1A 4LJ8A 2E9SA 3KFVA 1RKBA 3TQSA 1IOZA 2CHVA 1SN7A 1JIXA 2OG1A 4NYJR 5ALHA 1LFAA 3UPTA 1XDBA 4WUVA 3ICUA 1P1FA 2ZJFA 4YDRA 4EELA 1Z8LA 4PHTA 3RC7A 3KQUA 4IDPA 1AE1A 1Z73A 2I87A 3R4CA 3C87A 3G8DA 4J0CA 2OM6A 3O95A 2D8MA 4PZCA 5LD2B 2I33A 4Q4AB 2Y0PA 3OFKA 5LBIA 2V0GA 4M1EA 1J1IA 1CUSA 2ORED 3KJHA 1FJ2A 2X8AA 4MUKA 2DJ5A 2L17A 1VB3A 2R5NA 4NNOA 2AMJA 2QD5A 3GHYA 2WKRA 1TLFA 3ESRA 3I32A 3L93A 1PGPA 3NDJA 3U7HB 2Z2XA 2OXIA 1JHVA 2TS1A 4JB0A 2ZTVA 3QG5A 1O96B 4ZOQI 2Z2YA 1F8GA 1W25A 1CUFA 1N6IA 1DMRA 3I4LA 4B31A 2FI1A 3NU1A 3GEEA 2WJ4A 3GC6A 3MGGA 5CHEA 2B1RA 2RGXA 2OV4A 1SNYA 3MF4A 3P71T 4JLDA 3VR1A 1EK2A 4ZJZA 3OU6A 1GFIA 4V2IA 4BATA 2JIMA 1QDUA 2JIRA 4ND3A 4I1VA 4XSHA 3TGLA 2QTMA 1L7DA 3EH1A 1KYYA 5U4QA 2AFVA 3JWPA 3MD9A 1D0IA 2B34A 3I6IA 2QTNA 4NYJQ 3KLMX 3C74A 3ZWQA 4WXHA 2DJIA 1O0BA 1TA0A 2AG6A 2GEUA 1SKYB 2WYHA 4G0MA 4N8SA 4PYIA 4TTSA 4D96A 5LKRA 4C8FA 5IJAA 1P72A 4BKQA 2G5GX 5DGCA 4YQEA 4CM1A 1ENYA 3UM9A 5BSEA 3VR5H 5FPQA 3W9SA 5FLEX 4X9XA 4P4GA 2D5AA 3ZKAA 5B37A 4YCMA 5JSQA 4QDUA 2RC6A 1RQ2A 3E9MA 4G36A 3ZE9A 2UYYA 2D1QA 3QTBA 2VP0A 4U7FA 2FLWA 3EMDA 1NWHA 3CR8A 2QWXA 2PA0A 1IM8A 1DAGA 1M2EA 2O50A 2VJCA 3NIDB 3OLWA 4I3FA 1D5WA 1AN9A 1CUIA 2DSTA 5T8KA 4YUZA 2OVBA 3MWEA 3RS7A 1V39A 2IXEA 1PD0A 2P4SA 2H2WA 3B7PA 2YFQA 4TS3A 1JHYA 3ZE8A 1NYTA 1GARA 1N3LA 2VXOA 5AXAA 4YUWA 3AO0B 1E0AA 4I9HA 3A3YA 1C7FA 2I5PO 5CVUA 4ZO7A 5FBLB 5ILGA 5BSWA 4V1CI 3GWGA 3N70A 1YKSA 1VBKA 3QHPA 4L73A 3FHLA 4Q47A 1ITZA 4BMZA 2XB6A 2XE4A 3NH9A 4JEUA 3ZLUA 3EEQA 2CD7A 4N48A 3AETB 3AUKA 3G0CA 2WSLA 2RI1A 4OAPA 3TRDA 2FMHA 4K87A 3OZFA 1KJ8A 3VV3A 5M7EA 4K26A 3RUIA 4MQUA 1HDYA 2AVNA 1M2GA 4PM4A 4FNMA 1HZZC 2IBMA 1KVSA 1ZJYA 3PDCA 1Y1QA 1A9OA 3PX2A 4D9EA 3QBEA 5I7HA 4UUOA 3GFOA 1OLUA 4DIEA 3Q9LA 4KAJA 4NNPA 1ULUA 2CL7X 3PQ3A 1FU8A 2NM0A 2Q6IA 2X1HA 3TQFA 4YT4A 5BR8B 2PVPA 5L45A 3PITA 4ZQGA 4RHYA 4B6JA 1U7PA 1V37A 1IOWA 3A10A 3CLRD 2ODPA 1CV2A 3AYZB 3L6OO 4MUAA 2HWKA 4DW8A 5H82A 1QIKA 4WK2B 3WR5A 1EFAA 1BCRB 3GGJA 3NH6A 5H4GA 1MHTA 2G88A 1J33A 2GTIA 3CU5A 4ETNA 1JAZA 1COZA 4AM8A 4Y6QA 4E70A 3QLUA 4HWOA 5I7SA 5KTRA 1PNRA 3C8OA 1UKAA 4FEYA 2C4HA 3AEXA 1JKJB 4XCVA 1GRRA 4ZV9A 3CLHA 4EY8A 4C5CA 5FOXA 1F4LA 4JELA 4ZQCB 4WK6A 4DCGA 2VH5R 3JSAA 3DMDA 4RH3A 4DA4A 1NQOA 5LZ4A 2X41A 4CKYA 3PBKA 4ECEA 3BX1A 4ON9A 2E4WA 2O1WA 4GNRA 5JADA 2NVOA 4DJFC 2DG2A 1NMEA 1Z75A 4HH4A 2GKOA 2OM2A 1M8JA 1XZHA 5KINB 4KO3S 1WZCA 3K0EA 2SNIE 3UJ6A 5FPKA 3K70C 3BF7A 5EIBD 4GKKB 4BCDA 1RP1A 1DQNA 2JAPA 1T36B 1QBGA 4V24A 4LFAB 4QFBA 1S2NA 1ZM4A 4LQCA 2NTEA 3G3EA 3GPBA 2G9UA 1GYPA 3BE4A 3LXXA 3UNXA 4EAQA 4YMGA 1TTPB 1PS8A 1NATA 2GWHA 1OXUA 1BG6A 1J06A 4WTOA 1TAQA 2FNAA 3R77A 4J07A 5BRNA 2FSPA 4PC3A 2JCXA 1JQ5A 3ZI4A 4OLJA 1U65A 2IW3A 1HE1C 3HBNA 2LCQA 3FN4A 4FI3F 2OV3A 2QRMA 2VBCA 4M49A 1AQJA 4D6XA 1ULTA 5E6SA 1Z0SA 4FMCF 4P2BA 1SBZA 2NUTA 3OX4A 4UHDA 4CDGA 4KV7A 1HDCA 4RM2A 5P21A 1Z68A 1JIIA 2C7BA 5EXSA 4EY7A 3C3CA 4QL3A 3CNHA 4HEQA 3ECSA 1L4NA 1XJ5A 5CFMA 4EVQA 4XTRA 1SU6A 3IEMA 3LZ6A 3LX4A 4MQ6A 2PPLA 4UZEA 3N53A 3JSXA 3R09A 5F73A 4UNNA 4OGGA 1XD9A 1SKQA 2WYVA 4I8DA 5CJ2A 3I5YA 5HF9A 2VP9A 1DBQA 1JT9A 3P0RA 3PICA 2NG1A 2G67A 1YZKA 1ADCA 2X9NA 2PKQO 3BWCA 3Q7TA 1E66A 2ZCVA 2ZT5A 3QVWA 1N8TA 4RS4A 2OP0A 3LCCA 3DZIA 1RMQA 1PNQA 3J7TA 2DKOA 3TKAA 3V00A 1RABA 4MGIR 1RM4A 4QT0A 1C0KA 3W04A 3WLIA 4IOKA 1JZTA 2DIKA 3F9RA 4QYXA 2TMGA 4QU0A 1EUDB 4WN9A 3W6PA 1Z7YA 2FZVA 1HQKA 2I7VA 5FORA 3GFFA 1JFSA 4OGKA 1JDBB 4FS8A 2HCRA 4MWOA 5DBHX 1K75A 1KPHA 1SKBA 2JEYA 3P4UA 3HU2A 4QNNA 1PDVA 4BMPB 4P08A 3SJEA 3L8HA 4OMUA 5CTJA 3SXPA 3WGLA 3I62A 1RD4A 3WP0A 1NSTA 1DEOA 1EA5A 3PTZA 4WI1A 2Z57A 1I13A 2F48A 3PUWA 4I5FA 1P44A 1PT9A 1XALA 3BVPA 3QX8A 4O3FA 4A92A 3WI7A 3E7PA 1SUAA 2R6CA 1NW4A 3OCXA 4DR5B 1M74A 2FRDA 2E6KA 3NHJA 4LIPD 4PZLA 1X7WB 3PZBA 4EJSA 2HJVA 3D8SA 3U4IA 2QRLA 1T2EA 5YASA 1XEWX 2GEFA 1J5PA 3P9SA 4UZSA 3UUWA 2OBYA 3FCEA 2A8YA 3AV0B 4GIBA 4XVHA 1DDOA 2PGNA 3W9UA 3WC4A 3EFOA 3NUGA 4C3ZA 4F3TA 1N0HA 1XLWA 3W1EA 1C1YA 1JUDA 1BHQ1 3UKDA 5DM60 4EP1A 1Y6ZA 4PCLA 3QPVA 1XJQA 2NGRA 1Y8RB 3T3PB 3PYMA 1VKJA 1YQDA 4NCJA 1Z0JA 3U49A 4HDRB 3VTFA 2W2QA 2P9FA 3CF6R 3TW4A 4KX5A 3WK6A 1XZLA 1U9YA 4Z4CA 1Y7TA 2JDIA 4DDTA 4EZIA 1R37A 1H2AS 4RJJA 2VDNB 4I1RA 1G1MA 1X1CA 4OQZA 3AY3A 2ZM5A 3P2IA 4FDAA 2GJSA 3OHPA 4P4IA 2HF2A 1F3OA 4NGSA 1U3TA 4PINA 5EMJA 2GAFA 3K6RA 5IAOA 1U1EA 3IBSA 1FIUA 5FTLA 2HA6A 3T94A 2FE4A 5KTYA 5ALGA 4FTWA 2VSQA 3FCOA 3REQA 3SZUA 1JIQA 4MUXA 1UZLA 1IY9A 2J08A 2FZ4A 3QQPA 3K0BA 1MENA 3KTAA 1G4HA 3BL8A 1KQOA 2O3QA 2R7NA 3COZA 3K94A 3MUEA 4MVJF 4NE9A 1H5UA 4X91A 4Z9YA 1VLVA 2A78A 4NBNA 2HJWA 3GY0A 3LGSA 3X2FA 1JR6A 3TSOA 5KNDH 1ORHA 5INTA 3DVAA 2DVMA 2BONA 1AF4A 2WTXA 3HLTA 1Z2NX 3JWHA 2H17A 1F8XA 2EGHA 4YLEA 4I4LA 1KFKB 1Y34E 4O08A 1M2OB 1OYWA 2FCAA 3HKCB 4HDNA 1U0BB 2DQZA 1XQVA 4GRDA 2KYRA 4RTJA 4AJHA 2AOXA 2OY0A 1NYRA 1I7SB 2GK6A 1DLJA 1DBIA 3S2EA 3SKXA 3GCGA 3NM5A 1XZPA 1KK0A 3I2GA 3JQGB 3SNKA 4D8YA 3RNOA 5HYVA 3D6FA 3E84A 4C3UA 3AR2A 2I66A 2BV3A 1S1MA 2I8LA 3NYIA 1RXVA 2V0NA 1PZMA 2ZJ6A 2Z9BA 3EULA 3JARA 4WLFA 3WKEA 4C3VA 3H1GA 4KPFC 4ZJYA 4Y7DA 2F8TA 5EXPA 3VZSA 1LF5A 3LP8A 3ECCA 1E4OA 4WXRA 4D3YA 4QLBA 4PAOA 3B1WA 3B5IA 5K0JA 4C8UA 3LP6A 4F38A 2IPAB 4JQOA 4LNAA 3CBQA 4BJ6A 4FIDA 1K7FB 1E62A 1EEXB 3GRRA 4MR9B 4ZAWA 1ONOA 1L5NA 4C8AA 4X8LA 1JBQA 4F56A 4EY6A 1E3TA 1G2IA 1NSFA 1PGQA 1LJLA 1QAMA 5EMKA 1EVJA 3TAHA 1IXZA 1G5QA 3SJ7A 4BBJA 4TLEA 5B2ZA 5HIJA 1S3FA 3TB4A 3KOWA 4QO8A 2BDEA 3USES 5LOVB 1A5ZA 2ATXA 3FPLA 5KUTA 3ZVMA 2W4MA 4UBOA 1FBTA 2GETA 1DKUA 5F64A 1VG0B 1QORA 2C4NA 4YREA 5C1OA 4M46A 3F6YA 3FIUA 5AD1A 4XGIA 3PUHA 5TGTA 1Z4QA 3FOZA 1TPYA 1AGXA 4N12A 1FRFS 1U0JA 2E4XA 1O97D 5IT0A 1I3NA 5EIHA 5SZJA 4LEIA 2ECQA 1NVAA 4I9NA 4AW9A 3ID6C 4FBGA 5H16A 3OPXA 2GR9A 4OK3A 4QUIA 1A50B 2PR7A 4YAOA 1FTGA 2AWOA 2IUEA 4RTOA 3BXHA 4F92B 2IZZA 2HI6A 3LLCA 1W6UA 2E4VA 4ND1A 3SEQA 1WDTA 4K9MA 3RFXA 2H59A 3RWBA 5ITVA 4IGEA 3C5WP 3DC2A 3MZ0A 1TC2A 2AX4A 1WB5A 2DT5A 4U7JA 1QIJA 2EARA 4IDCA 4OHXA 3GA5A 4NV0A 5IVIA 4HQNA 3ZWMA 4LK2A 1IYZA 2NYAA 3GDHA 2C1EA 4WLNA 2XMQA 2GUGA 1J99A 1QIMA 3EN0A 4DMCA 4C9UA 2WUDA 4RJKA 1D6MA 1XFDA 2AXPA 2R25B 2X77A 2Q4EA 4LPKA 5KAPA 2BMWA 1H4TA 3EMBA 2BJWA 3F97A 4MRVA 1XTJA 1KK2A 2P77A 4ESEA 3ETLA 1JR2A 3BUSA 3Q6NA 2CNBA 4HB0A 1Z47A 4TTPA 5DGIA 4O2BF 1DWUA 1JDTA 1NIPA 1I5OA 3LU1A 4EGAA 2Y2UA 4JLBA 3B1FA 3D7RA 1G20A 4MRNA 1EFVA 1U11A 2ST1A 1HDOA 4EB6B 1NQUA 1NF2A 4YRJA 1BYIA 4MQBA 1TYZA 2P3OA 3CX6A 3E1SA 3N8HA 4GZ6A 3Q8XB 4RY0A 3QTLA 5DFAA 3CLVA 3SG0A 3R0IA 1D1TA 4UPVA 1Y8AA 4K1XA 4YCCA 5EJ8A 3G5AA 4TV8F 2B78A 1QH8B 2GF0A 4BP3A 2IP2A 2CLHB 3KJQA 4MP8A 1BFUA 1TQ6A 2J33A 5ECWA 3JASA 4FZ5A 4WBSA 3MT0A 1T9GR 2OCPA 1DTSA 4HVTA 3K2EA 1OI4A 3EXG1 3LNTA 2E89A 4Q02A 1ZOSA 2JFYA 2WJ3A 2XNJA 3MTDA 2YV1A 1VSQA 3EARA 3GGPA 3BZBA 1KE2A 3RU9A 4KN9S 4Y30A 1KPIA 3PD1A 1XLTC 4UFNA 5LB2A 3STHA 1KE1A 5CEEA 2ZCJA 3EUFA 5I8PA 1BJKA 4IQFA 4QGBA 4CQLA 2QJTA 2HPZA 1YAJA 1MJFA 3F8TA 4R8LA 5FI0B 4NOLA 3OQMA 3O90A 1P4GA 2IEDA 3F8WA 2J4DA 3T4PA 2P6NA 2WVHA 2G04A 1GAEO 2D7CA 1BRTA 3HDYA 1UBKS 4NJMA 2NXEA 1LS1A 4WRRA 5AJHA 1KJJA 2XCUA 4XSGA 2CF5A 2R9VA 4Q4LA 4DV1B 2VH1A 4A2QA 1PHRA 1IY2A 4DLKA 4DUGA 1D2NA 4NJEB 2NZJA 3FSGA 5HBRA 4NCKA 2VZ8A 4MO9A 4QXRA 1ZSVA 5H3LA 3U0BA 3HL4A 1TIKA 4XYGA 5CVTA 2EAUA 3WWOA 5I51A 4UE6A 3IAM6 2ODEA 2CL0X 1FRZA 3U0VA 2BFBB 4JQZA 3KQMA 5K4AA 1EWQA 4QRHA 1XLUA 1DIKA 3I01A 1PQWA 3AUJB 4RH1A 2FKNA 1T36A 2DWQA 5BR4A 1MH1A 2NYUA 1VBFA 3K15A 3NBQA 3PSAA 4O4LA 3RCBA 1AUVA 2BZ1A 2GAAA 4DY6A 1JJVA 2BMEA 1U4OA 2Z3VA 4D4HA 4F45A 1UOPA 1ZKDA 1W85A 1QH8A 1W5SA 2ZW9A 3CNNA 3ONEA 3OIVA 4EY5A 2PJZA 3O3CA 4A4DA 4HQ6A 2MOKA 1FDSA 3VYSB 3HJBA 2DB3A 4C7VA 1Y9JA 3EY4A 2UYGA 4QX6A 2AOTB 5JNLA 1NBAA 1GA1A 3PWTA 3V3TA 2WB4A 5IEBA 2XGMA 3OT4A 4S12A 4WL0A 2RK3A 1TIPA 4RMJA 3DMRA 4E6PA 5KOJA 3GLIE 5K3DA 3W6NA 5CA0F 5CK5A 1AN0A 2GJ8A 2WD8A 4RPGA 5A0FA 3VGPA 3RSFA 2JCVA 3E2MA 3NYRA 5ELXA 1KPGA 4IMIB 4FYXA 1SOAA 2VDQB 3G2LA 4IGFA 4OV6B 4M1MA 4BYMA 3GMTA 4KRGA 3R20A 4RV4A 1UBJS 4DWJA 5JWRA 2GN2A 1GTZA 4NBLA 3T0IA 4OO3A 1TEVA 2O4UX 5DYTA 4GFDA 1ZJJA 2MDTA 1RBQA 2ZYUX 3HNOA 3JYHA 1EFHA 1KZYC 1M2NA 1XF9A 2BPOA 2Q2VA 4XOUA 3CW8X 5AHRA 4QDZA 1RQGA 3LRTA 1GRQA 3HB9A 4MQFB 3E5NA 1L2TA 3GJ6A 3KUKA 4GXRA 3HKDB 2ZRCA 2Q7DA 3MJRA 3UJNA 1VXOA 4ZZIA 1XC7A 2YUTA 4JT8A 1EA7A 2Q8NA 3WNBA 1QUFA 2V7GA 1QGUA 1I80A 5AW4A 3J81k 4EUEA 3JARB 1P73A 5I48A 1YBAA 3I1FA 4Z9FA 1KMHA 1U0NA 4MVJE 4YFVA 1K8ZB 2WRZA 5ES4B 5KBYA 3EZ7A 3GB9A 1E1MA 5EZYF 2E55A 2TECE 4JLMA 1E79A 1I7NA 1A9XA 3OLVA 4JXKA 1WLYA 1Z4LA 3KQLA 2Q8QA 4DCVA 3P9RA 4AY4A 1JI3A 1P17A 4E2ZA 4HRVA 3AXSA 3ZX5A 2D5CA 4ZI2A 4OM8A 1YK0A 4F9GA 1R6VA 4QTZA 3RI3A 4KR2A 4LDZA 1PVVA 3MCAA 3F6RA 4D4IA 2R00A 2WMNB 3I30X 2QL6A 4PZ0A 3AUYA 3S4YA 5JC1A 4C7OA 4JMLA 1WZ2A 2PUVA 3VI3B 4H2DA 4IRMA 5J43A 2FDRA 5LUAA 4LXGA 5GAJA 2VXYA 3DSRA 1WZNA 1T3HA 4IKPA 3CW2A 3UCEA 3WE7A 3IIIA 4TMFA 2JARA 3MQ2A 2XZLA 2BBTA 4W5NA 4K88A 4BMNA 2GJAA 3UK7A 3U9SA 3D3JA 4WVFA 3GJQA 1PO7A 3SR0A 5C8YA 5AXDA 4ZOLA 3T9AA 1PJBA 3V4ZA 3WGKA 4F2GA 1HYEA 3IVMA 4F4CA 3H8WA 4QGFA 3WGHA 3WWPA 1BE6A 1EJ0A 1Z22A 4GX2A 1Y7LA 3CYFA 5I4KA 2DT8A 2FMXA 3NUZA 5JNVA 2A9VA 4IF6A 4KYUA 1VL2A 3IUMA 2OCGA 3NYWA 4LHYA 1NKVA 4IMPA 1E3DA 1E2DA 4KH0A 1P18A 4BAZA 1OWNA 2HCJB 3H0EA 3R9KA 1GNTA 3CLUC 3R5XA 4JNCA 5CGQB 2AJDA 5C7LO 1PV4A 4IG9A 2CDRA 5EL0A 5LQSA 1BNCA 1EAMA 2FPPA 4JROA 2IUUA 4XFDA 1TKAA 4R4JA 4R98A 5IUNC 1GYQA 4JCOA 3RGWS 2EFCB 3HVJA 3TWOA 2ZIWB 4OLBA 1QYDA 3BGVA 1H2XA 1ZJ4A 4F6RB 5IAEA 3BH6A 4XW2A 4B40A 2Y1LA 3QVJA 1U8FO 4C6HA 2I99A 1NMZA 4G6ZA 2Y1OA 3VHQA 3UA4A 2W42A 2UZ0A 5LBTA 1INLA 2B1IA 4IMJB 1B6TA 4QYSA 4LGMA 4RF4A 1K4YA 3KCQA 4DCSA 3I5XA 1QHHB 4R6WA 4YRTA 5G02A 1IATA 3ANMA 2YHIB 1W6RA 2BFDB 3EE6A 2W9XA 3W4JA 3VI4B 2HD4A 3RW9A 3RAJA 2JJ8A 3PENA 4OIMA 3RRXA 2IU4A 4F9TA 2Q28A 4GICA 4TS9A 2V74B 4BIIA 4BV9A 2WJPA 2WG0A 1D6SA 1CJUC 1R7RA 5JPIA 4NF2A 1FEZA 1TVMA 3FH0A 3WDMA 4YALA 1WQ3A 4D74A 4TMYA 3UC9A 4E5UA 4DSTA 5B4TA 4C89A 2WWRA 4J4BA 5C7OO 5IFKA 4TYNA 3JVEA 4FWIB 3D8UA 4HWKA 4Y2QA 4JLPA 3CG4A 3S2ZA 2V8OA 2WVGA 3GCDA 3QIVA 4MITA 2JAWA 2BW0A 3R0XA 2DH5A 5K45A 2EIHA 2X42A 1C14A 4N01A 4Q21A 5C81A 4FDTA 5LIPA 4BTEA 4INAA 3KR1A 1B8OA 3TRKA 1LPPA 5JVDB 1FMFA 1PQYA 2CVFA 3DH0A 2OBLA 1JLHA 5FFNA 1WW3A 3ZD6A 3Q7QA 4YAWA 3SBEA 1T5LA 2JFBA 2ZAOA 4Q3AA 5CNJA 5L8VA 4CMBA 2Q3HA 2EKBA 4I8IA 4JC0A 3AFHA 5FPYA 3BH7A 3I9NA 1C7RA 2VHEA 5EKDA 2GDZA 3LA6A 3PFKA 2OV2A 4CKEA 4Y6SA 3T7RA 2I1VB 3ASUA 4JZYA 4FGWA 2HAEA 5EFOA 3RDPA 1ID8A 3TI9A 1QFYA 2ISSD 4DUZB 4J1NA 3MUNA 4PLZA 3FFAA 3SM9A 3H1EA 3S2IA 3HM9A 3KUUA 4RGQA 1Q50A 3I9MA 4HQFA 4XIJA 3R7NA 5K4HA 5KOIA 2ABWA 1VYUA 1J8VA 1QPBA 2DWPA 2KBEA 3D8TA 2WTMA 4WMLA 3T9EA 4DF3A 5ETJA 1L1EA 1UBOS 1ZN2A 2YRFA 4JZKA 3ADOA 1TKRA 3SIPA 4X6XA 5JYDA 3SYNA 5KMGA 3EEYA 3RADC 2O9JA 1EP9A 1KI1A 1D6NA 1E1RD 1MNAA 3F9CA 3OE4A 1EIZA 2FN7A 5JDIA 1KU0A 1NF8A 1OIVA 2XNKA 3QRWA 1CR4A 1D1PA 1SU4A 1UWVA 3ORRA 3VO1A 5IJWA 2IHVA 3ANTA 2DQSA 3PL1A 5EQFA 4YAKA 1XTUA 2OYSA 1ZGJA 3H9GA 4MKRA 4P33A 1F0NA 4BNWA 4LYGA 3P26A 4IV5A 1PUIA 4S0ZA 1XTZA 1XZ8A 3IPXA 4WNCA 3R6LA 5EP2A 2FV8A 1U8UA 3G8AA 4C78A 4Z7QB 1ESEA 1CLUA 5D3MB 5I9IA 3JYOA 2B1JA 3SI7A 2C03A 2EKQA 1NDQA 4PU0A 4F5YA 2Y4OA 1OB2A 2D1SA 1T1EA 3EQ8A 4MS1A 3JR7A 4KMSA 2EDAA 4Q12A 3PX3A 4R8SA 3SSOA 2VSNA 3S0JA 1QV7A 4AYWA 4R1NA 3U16A 2ZFUA 3EPKA 2A57A 1AF7A 4G5QA 1UZAA 1EG7A 3AF3A 5H3HA 5TE9A 2WJHA 4YJHB 3WTCA 2FSGA 2C4UA 1V5IA 1RZRA 1TJYA 1C7JA 1X42A 2XUHA 4WCFA 2GN4A 2OQVA 2BEVB 4IXNA 3UMSA 4PGGA 4MDFA 1T9HA 3VDXA 1U2DA 3JASB 4DA7A 4MHTA 3DCIA 1QRAA 4Y1GA 4DWOA 4NFYA 3VHRA 2QYTA 3CLSC 4Z86A 3WIVA 4CLXA 2Q3LA 4KTVE 5A7GA 3ON5A 2OUKA 4FYYA 4O6VA 3RS8A 2JCGA 1JMYA 1I4OA 4NQRA 3VH2A 8MHTA 1V8OA 2YYZA 3CWCA 5B6JA 3LYUA 1IHOA 3GELA 1WF3A 4UASA 1D2EA 5ENVA 3G68A 1I8TA 3LD9A 3UJHA 3BILA 3ZWNA 4HGOA 2ZI4A 3DWIA 2QPLA 3RFFA 2EVWX 1P1BA 5A0TA 1XSEA 1HETA 4FLMA 4PZPA 3ZUPA 1ZITA 2C5EA 4DZTA 4BGDA 1DQPA 4JBXA 2QVCA 2C9YA 4MW1A 2GGSA 1QKIA 2J31A 1EZZA 2QD3A 4KAAA 4WASA 4C7MA 3L8CA 1YRHA 1GZDA 2POCA 2XOEA 1QGZA 3TPCA 4N76A 4AURA 1SIOA 1TTTA 1XD2A 2VK1A 1YAHA 3ZNNA 1B26A 4AZ3B 2XCOA 1YQGA 3KZKA 3KJEA 5JI3E 2NAFA 4GUDA 2JAHA 3JD3A 3W7VA 2NVUA 4EENA 2PX4A 4HAVA 4WLUA 3E3NA 4P3XA 2ZRQA 3G85A 4LDRA 5I9SA 5JE8A 3TFQA 3WXMA 1RKVA 4D4KA 4JWTA 1E58A 2P9HA 2JKVA 4B3TB 4UATA 1DO0A 1FVXA 3BSFA 4AJPA 5TEWA 1KP3A 1S02A 2F8LA 3MGCA 4L07A 4W8OA 5E4YA 3EOZA 4RDIA 4BKOA 1P2SA 2ECFA 3HXTA 2PLWA 1FNBA 2ARKA 4YRAA 2W22A 2B3DA 3LUFA 5A6SA 5D2CA 4J1TA 4UHKA 1L7PA 3NC1C 4C06A 4C99A 4HGQA 3WGMA 2WPDD 1P2FA 1D4FA 1U4SA 2UYOA 3KZXA 1U0EA 4ZVQA 1HEUA 4GI1A 3X1ZA 3CGGA 2HMWA 4TRNA 1NVVQ 5AM2A 1DJQA 1LBSA 3HHPA 2CN1A 2NU8A 2JA2A 5BQXA 5TT1A 3N0WA 3ZYCA 1NL3A 1GUBA 2R4UA 4MR7B 3UAXA 5K3CA 3PNKA 4JYZA 1TM4E 4KO2S 3ZW8A 3GDWA 4TTQA 2W6NA 3QLVA 1ZUHA 4LJYA 4LN1A 2RHLA 5IDWA 2BI7A 4CMCA 1GG2A 4IHAA 4JBYA 4DLRA 3JAKA 2AUMA 4IQ0A 4P7FA 1X0VA 3MC1A 4H4EA 5TF4A 3TDNA 4K2AA 3D7FA 1W1IA 2BMAA 2DC1A 1TT5A 2IHYA 2QPOA 3IAEA 4GLLA 2CXHA 1DEHA 4HLDA 2ZROA 4ILKA 1E5TA 2DTDA 3SQDA 3RNLA 3WY9A 3ITNA 1U1GA 1E1CB 3JD4A 2XCLA 1ULAA 1X13A 3DOJA 4L9AA 3RHZA 2VAMA 4NZMA 4OC1A 2HLNA 3M7IA 3SZ3A 1JQEA 4P84A 4PIVA 2I4NA 3K1AA 1QSGA 2FPMA 4HTFB 2QRUA 4HZGA 1YFZA 1VRWA 2MJLA 3VC2A 2Q41A 2R68A 3QSGA 4WBNB 4ZVNA 2QOEA 2V1XA 3L1KA 3MWJA 4RIIA 2PBLA 1EFCA 2H63A 1QHGA 1I0ZA 3C1TA 3UMVA 3MHTA 4KQHA 1L4KA 4ALMA 1KMHB 4MTLA 2B4KA 1A27A 3GLIB 4CVNA 4M0PA 2FSIA 2P7IA 5EJ9A 4HLUC 1L4BA 4B2IA 1IY0A 1FX1A 3COYA 3THRA 4LK3A 5KTPA 2O1SA 2Y0EA 1OZHA 1KAMA 3HBLA 1NLMA 2A1UB 4MA0A 4NZOA 4J0HA 4W6ZA 1OFUA 1USKA 2V97A 2O0LA 1M7GA 3WFIA 2CYBA 3D31A 1GKUB 1VJ1A 2PPVA 4V0SA 2X2FA 2QI9C 3L7AA 1BQ3A 4P2GA 2J3LA 3EGDB 3AM4A 5IX8A 3TE7A 4ZC8A 3C3AA 3LBHA 4V0KA 5ANRB 2KLBA 3EXIB 1AX9A 3UMGA 4EQ6A 2XRZA 1AG9A 1X7ZB 3C5EA 5DISB 4XPIA 1VLMA 3I2KA 1FDWA 3RYCB 3AHFA 3HU1A 4XE5A 1JG2A 4US1R 5HM6A 1DFHA 5C3MA 1F5NA 2CSXA 2CNLA 1TVCA 3LT2A 3UGKA 3ICPA 3ZHQA 3EXFA 2JFUA 2F3SA 1JEYB 4JJ8A 1C8VB 1KZ4A 4DIKA 4IUYA 2F3PA 4CLEA 2XZPA 1MO6A 1US8A 1P9LA 5BPFA 1CWUA 1DB3A 1GL6A 4YWHA 1ECJA 1OY1A 3Q72A 4B6RA 3C2QA 3G88A 4IF4A 4M98A 3BGOS 4FGZA 4FHEA 4BLQA 3BK2A 1R64A 1KY2A 1YDMA 2P40A 1VSBA 3GLQA 4GAEA 4R51A 4A8JC 3BMOA 3OZIA 1QE3A 4P80A 1ECLA 4J91A 3K6KA 1Y8QB 1HBJA 2OBNA 3O4GA 3W8RA 2P6UA 3CN9A 2QLLA 1YA6A 1KIFA 3A4TA 3G2MA 1E8NA 4BMDA 4UM9B 1C1HA 5DGXA 2OHJA 1APBA 2YFYA 4P54A 5KNBA 1KVTA 2EDCA 2WA2A 3E58A 1ZKMA 2G5PA 3DE0X 2QN8A 4HGPA 2W5UA 2F1OA 2GXUA 5AHWA 1UT8A 3IKMB 3L0BA 3SIWA 5I7WA 1MFPA 1IUNA 2ZR8A 4EFKA 2ZUWA 2XGSA 2AQHA 4GKBA 1UM8A 3MWGA 4XJVA 3FR7A 2IZ0A 4NG5A 3H11A 3WK4A 1PF7E 2VRNA 4KN5A 5EKTA 1T1SA 3PE3A 4IZHA 4OHCA 4DLTA 2OXEA 5IJ0B 1WUTA 1GSAA 4BGIA 2DCUA 5DX0A 1R15A 1W8DA 3VKVA 5JRJA 3G2NA 3Q5EA 5IT4A 2Q9UA 2ETVA 1QHIA 4WK4B 1XT6A 2VOEA 5L3QA 1RFLA 2VNSA 3RAEC 4JAVC 4QDJA 4FFPA 4U9HS 2H4ZA 4ZQHA 3W7AA 3UHAA 3T9FA 2B7BA 3LIIA 4TSRA 2DPHA 3NAGA 4IXMA 3GT7A 1IQUA 1DBPA 1JBKA 1R00A 1M75A 2XEXA 2ZPTX 2X23A 2EOAA 4LY0A 1ZCJA 3QE4A 1B43A 1VDZA 3H8SA 4MUHA 2HF8A 4YBZA 4E0BA 3N2GB 5IZCA 2OHFA 3LCMA 3SD7A 3A4IA 5L4SA 1K7YA 4LE1A 1UOOA 3HCFA 2GI4A 5I4CA 3AESB 2I1LA 1MORA 3FJYA 2VT7A 3HBAA 1NE2A 2CNWA 2IZ1A 1M0EA 2ZEJA 4R9VA 2J5XA 2WJWA 1MQ8B 5F5XA 3W3AH 3ZQ4A 4BKUA 2IWHA 4A91A 1XJ0A 2ZBQA 1LLCA 2HQOA 13PKA 1E6UA 1V11A 3TQRA 5CG1A 1NIJA 2C95A 2O8NA 3OHMA 2IYRA 1SVUA 3RVOA 4QBFA 1U8XX 2FSUA 1H2EA 1NUAA 1FC0A 1YD7A 2ZJZA 4PSUA 1CUUA 4I7EA 4KSCA 1DS6A 5F5NA 1N2OA 2WTAA 5FFMA 1FS5A 4JN6B 5FUXA 1K3UB 4JP8A 3EZGA 4S24A 4BLPA 4BDTA 3B12A 3R76A 1T3SA 1AUXA 1ZLYA 5EPEA 4C2AA 4C87A 4ZN6A 3DD1A 3ITDA 4Z4FA 3WYGA 2GEBA 5GONB 5A3JA 1KXZA 2BD0A 3SJFA 1YJCA 2C82A 1CHDA 5CRIA 3LXRA 3NKFA 1QIGA 1JHAA 2IUSA 1Q5PA 2PAFA 2QRVA 3B3AA 3QNMA 3GN2A 3KSDO 3IV9A 3RVKA 1VCMA 1ZR4A 5D5HA 2FPSA 2O7SA 3BDIA 3EGIA 3HLKA 3L49A 4J0GA 4RKYA 5BV7A 5IYZB 1LU9A 3HI6A 3TOSA 1K3FA 4BKRA 2J9GA 4XWOA 3KOXA 1WUKS 3DEJA 2ZIXB 5EMMA 2XMSA 1HYBA 1Y5MA 1A96A 3RT9A 4C8PA 4AZSA 1H93A 1IUOA 3VVBA 4MUEA 1J90A 5FOWA 1JTEA 2C5LA 3D3QA 4PG6A 1SVNA 5KVCA 1FTYA 1IVSA 1VIDA 3DL0A 1ORDA 5KNDD 3JATA 4QDKA 3NIWA 4G67A 4R0NA 2W00A 3FCXA 3M89A 4RPIA 4LHZA 1SHUX 4FGUA 4M54A 3CO0S 3W7BA 2N1MA 5J4HA 4ND8A 4XZ3A 1WXWA 3L6EA 4FZJA 5J5VA 4I1IA 1C29B 4C4TA 5EYPA 2GXAA 5HKKA 3NTOA 2OYCA 3QEMA 1M1UA 2BLNA 3NP7A 5KU7A 5HUQA 3DVQX 1PKXA 1LUAA 3DW1X 2RGNC 5ELLA 1O87A 4Q3EA 3G13A 1KDRA 2CFCA 3KHUA 5FTWA 1XWWA 2EEPA 3D0QA 4BX8A 1XN1A 1HV8A 2J09A 4ZI3A 2YDYA 3W06A 1B0PA 3OJ0A 1EYZA 2W6ID 2ZR9A 3HKBB 5K03A 1JL3A 3I2HA 1ZN7A 1JJBA 2NXCA 3GJXC 1TCAA 2FVXA 1W48A 2JLRA 2NU9A 1P80A 3GUYA 1Y1KE 2A4KA 3AMVA 3H2ZA 4H77A 4GOOD 4JHXA 4B74A 4CTNA 5ABPA 3ANNA 1SXQA 1P5FA 2AG5A 3EOBI 5K8CA 2DTXA 1N6RA 4Q1BA 1OX5A 3DV2A 4FYKA 2KQUA 3R2JA 2HLDA 5T3UA 3AVYA 3JZIA 4XLTA 2OBXA 1V96A 2F3QA 2OZEA 3NBYC 4BQOA 3UWPA 2GJ4A 2V6IA 4FGSA 5JANA 1RXSA 4I6EA 2HX1A 1KSJA 2QTFA 2ZBVA 4MVJG 2W2VA 4PSVA 1B8PA 5JEEA 4NCAA 3SLGA 1T2AA 1DIOB 3GP5A 3NMUF 1XL0A 2A0UA 4AICA 5C9ZA 1V8BA 5LLDA 3AZQA 2Z2KA 5HQTA 4RY2A 2MYUA 3AX6A 4H4DA 5KNLA 2Z6UA 4JA0A 1W96A 1WHTB 3CVYA 2VJMB 4NU6A 4U0JA 1L1FA 3GT3A 4N9QA 1MRNA 1Z5NA 4BXOA 4C03A 3K5IA 3KDSE 4C14A 4O4JB 1IONA 3CLUD 1SVOA 3GD7A 5BSTA 4YCSA 1CFZA 4R8KA 1SHJA 4M9QA 1KI9A 3JVVA 4P4FA 3RC8A 3B8HA 1Y1RA 4KXUA 3Q10A 1TCCA 3FE2A 4PLHA 4S1VA 2N47A 4BQPA 1XTRA 4ZYVA 2PMBA 1RZ3A 2BEJA 5JTTA 1Z4JA 4RPCA 2WG2A 5KOYA 3RRZA 4IJUA 2RG1A 1Q7CA 4HC4A 4OLFA 2ZLBA 2V9PA 3AGQA 2X9GA