4H1HA

Crystal structure of mccf homolog from listeria monocytogenes egd-e
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
327
structure length
327
Chain Sequence
SNAMIPAKLKQGDEIRIIAPSRSIGIMADNQVEIAVNRLTDMGFKVTFGEHVAEMDCMMSSSIRSRVADIHEAFNDSSVKAILTVIGGFNSNQLLPYLDYDLISENPKILCGFSDITALATAIYTQTELITYSGAHFSSFSMEKGLDYVMESFSDCLLQKEPFALKESATWSDDEWYLDQENRNFIPNEGLVVMQPGVAEGIIIGGNLCTLNLLQGTEYMPNLAGTILFIEDDFMTIPETFDRDLESLLSQPGADEIEGMVIGRFQQKTAMTAEKLAYIIETKTALQKIPVISGADFGHTQPIATFPIGGTARIDTNQTDKIQIIRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MccF homolog from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords Lmo1638 protein
total genus 107
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4h1hA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4h1hA02
3TLEA 5F9MA 4E5SA 4INJA 3U1BA 3TLYA 5JYBA 3G23A 4IIXA 5F5XA 5FD8A 4MJXA 3TLBA 3TLCA 3TLAA 5K99A 1ZL0A 3SR3A 5F1YA 2AUNA 4IIYA 4JVOA 4H1HA 4E94A 4EYSA 3TLZA 1ZRSA 3GJZA 2AUMA 3TLGB 3TYXA 3TLGA 4MI1A 3T5MA
chains in the Genus database with same CATH superfamily
2V5AA 1GGFA 1N3IA 2VYND 5HOQA 3PQ6A 4HGNA 2OECA 4KAFA 4BIIA 1D09A 2X14A 3NTVA 4UJ5A 3RANA 4ZO8A 5CDSA 1EVEA 1NDQA 1UDBA 3K5IA 3ND7A 2OAQ1 3FSJX 4ZD6A 2VJOA 1FQKA 1HEIA 4Z1OA 3S8EA 3C5VA 5J47A 1P2BA 3STUA 2FSVA 3IQGX 1JPJA 2D6FA 2D4HA 3AH8A 1WWKA 5CFQA 3ILSA 3T5AA 4YWHA 1CDZA 1JL3A 1C8BA 3AVQA 4HTFA 3MJ4A 4LV5B 2VLBA 4LHEA 4RQUA 3UGKA 1E9SA 4D99A 4AQ7A 4MP8A 1EFRD 1T10A 2EWVA 5KTKA 3A6PC 5AW3A 3LOQA 2GDJA 2NU8B 4PE5B 1QG6A 4MWZA 4HSGA 4F21A 3UG6A 3Q8MA 2BY4A 3EZ2A 2JZOA 3PUHA 2YQZA 2ATXA 1LNZA 3FAZA 2CL5A 1T0IA 1T4DA 3CLRC 3L77A 4QATA 2ZUSA 1RD4A 1TLFA 1TYBE 4AUNA 1H66A 1Z34A 2OFWA 3GJTA 3GVHA 1VRVA 4IEFB 4PHTA 3DMYA 3EVTA 3KR1A 2GAIA 1CLUA 1GR1A 1QYXA 1Z38A 2W9XA 3BCUA 5SY6A 3UCEA 3W5AA 3CZ5A 5DKFA 2PWPA 3AQIA 1NNSA 2PU7A 3OZVA 3WHPA 3E4CA 3T4EA 3DKKA 4U9UA 1HV8A 4XFJA 1G3MA 4O4LB 5L95A 2C2BA 5L4NA 1E9FA 1K7SN 1UQTA 4AO6A 3DFIA 5FOTA 4TZ6A 3CPHA 3GFSA 4HVAA 4MB6A 3MGBA 3T38A 2COEA 2Q9CA 1V3VA 1PRYA 3REGA 4X8MA 4I3HA 1PFYA 3FRHA 4WN9A 3NQ41 3V4LA 4CKWA 3K31A 4KXLA 3COZA 3HU1A 1HWYA 3CBQA 1XALA 3NONA 3KXDA 2AOTA 2D1TA 3SPXA 2ZVQX 3A1SA 5J5CA 2W42A 3U3OA 3PX7A 5TQ0B 2JLXA 3WLRA 4LVCA 3AI3A 3LPMA 3O3NB 2DLNA 4YREA 4QPDA 5FWYB 1YCFA 3HUDA 5B37A 1L8AA 3UFXA 2JAUA 1DARA 3GB9A 2HJWA 3C1TA 4XEUA 5BXYA 5FPSA 1ULUA 4DC0A 4Y1RA 3U1TA 3U60B 1AGPA 2ZI9A 1TMYA 2RC6A 3UC5A 3IUBA 3I64A 1T4BA 3RC1A 1CEQA 3IELA 4CEIA 1A5ZA 1YDMA 2GZRA 3G1TA 4GC9A 4L22A 5A9SA 3V8VA 3VH4A 5KKNB 4FONA 2YRFA 1AIPA 4QXQA 4XR4A 4BCDA 2L82A 4LVNA 5JALA 2FZKA 5D29A 3SBDA 1XGKA 2VRCA 4FGLA 2KB0A 3SEFA 4RJJA 1J25A 3C5HA 4IEEA 4QLAA 4E51A 1JBKA 2C57A 2HF2A 1MRZA 2ZRGA 1U6IA 3EBOA 2JFFA 4KHPB 1SUCA 3QYAA 4JMPA 4RESA 2AGVA 1VL2A 4IZHA 2DWOA 4MLCA 1E7YA 4PFSA 3VKFA 2ZWIA 5K3OA 5KDOA 3AVTA 1XQYA 1UAGA 3TIVA 1CD5A 3AKEA 3H6GA 4EKGA 5CIQA 1Y33E 4TWRA 3TVTA 1WB9A 3H65A 4KSCA 2YRWA 3RS3A 1SIWA 1T8YA 2I99A 4RCZA 4MVJA 5JTTA 5BMVA 2PIAA 4P7JA 4PCUA 4CDGA 3U9TA 1BMFD 4C99A 1MVLA 1VKHA 3R44A 3I1YA 4K9LA 4QUEA 5G0SA 3OZXA 2YNMD 5BSMA 5G3YA 2XNKA 2CCJA 3DGFC 3GRRA 4NGQA 1E62A 3DM9B 2Q3DA 1ACJA 3MWKA 1V1MA 5L6LB 4NLLA 2ZRLA 4OJMX 3BEDA 5EEHA 1FDWA 3TLBA 5KDDA 4RHUA 2NYRA 3EVAA 2JI9A 4LMAA 3UT0A 5K0TA 3KPUA 4F5WA 3AR8A 2PX8A 3CJTA 2PKYX 4KN8A 1DX4A 4I0WB 1E2UA 2O8DB 5AYVA 1PQUA 1TDJA 4GW3A 4KWTA 1CUJA 4F4DA 5J4YA 3KRTA 1X9HA 3EUEA 1QO7A 2VPIA 2O7VA 3FKSA 1JLLB 2AJDA 3HG7A 4PN3A 1MUUA 1VRCA 4N82A 4JBLA 4CKZA 3F3YA 4B80A 3CZPA 4YMWA 4EL0A 5FL7D 3N2KA 1WULS 1XZHA 2OM6A 3BHIA 3CZMA 3IBYA 2RHTA 3BWMA 1W5TA 4H7KA 3AETA 4YO8A 4RA6B 4UM9B 3O73A 4QO8A 1SIBE 3ZGXA 2GLXA 5LCXA 4JWKA 5JATA 1YC5A 2MOKA 3OUTA 4MCSA 5D85A 1TAQA 3I2GA 1E4OA 1T4GA 2R1ZA 2AOUB 1P7ZA 2XCUA 3COVA 3NH6A 3X1ZA 1EUQA 3I62A 2B61A 1QRAA 1U0BB 1KEPA 4OB8A 5FPYA 1FUIA 4G4JA 3L0OA 4LKOA 3I6MA 4P4UA 2WIBA 2ZJFA 1N2HA 1A9ZA 1NLUA 1XRLA 4BEJA 2E48A 3ZY4A 3H1AA 3ZV3A 1XD9A 4DV3B 2W2LD 4TKZA 3AUFA 4W1RA 1CJTC 2VUSA 3A32A 1KNXA 4FD3A 1E6LA 1H5QA 5CAEB 2H65A 5A62A 1Q0RA 2CIJA 5DHPA 2AJLI 4NWIA 5ENDA 5FUQA 1WQ3A 4QBHA 3LPAA 2ODBA 1R3DA 2CHVA 5ALLA 3NBFA 2DY1A 1YKFA 1IYZA 4KMSA 4BQEA 4ARIA 1XTBA 4HWKA 3C1AA 4YCNA 1PW7A 1UDAA 2H59A 4L02A 3OX2A 3VR3A 4ZODA 2Q6LA 3I45A 4JLWA 3ROZA 3QBTA 4DNOA 4JENA 5JMTA 2XVYA 1OJ7A 1U7ZA 3MOGA 4RA6A 1KJYA 1YRBA 3T52A 1K7CA 4HF7A 4CKEA 5CIYA 1YQGA 1QPZA 2CNOA 3PSAA 1T2CA 4HB3A 3VR0A 3GBSA 4FR2A 2XV1A 1JECA 4EVRA 1MEEA 3VO9A 2D5AA 4W99A 3B2NA 1NAIA 3JSXA 3N8GA 3SC3A 3VUEA 2O50A 5HKBA 1NUHA 1PZXA 1ZUD1 2RHHA 2ZTVA 4ZAXA 4AUMA 1KK0A 7MHTA 4G8CA 3ZUGA 3HRHA 2IUSA 3JYLA 4YLGA 3WB0A 4DLWA 1DDOA 4Q00A 5BOVA 2DETA 4X0EA 3B5EA 3CX3A 2W93A 2J3QA 1GU1A 3GPDG 4EATA 4V1CI 1L4KA 2J6HA 3KJIA 1Q1BA 4QPNA 4B47A 1GZ3A 2TYSB 4MKIA 3DXYA 2X7HA 3UB2A 1DRVA 1SOMA 2UUAB 3RRBA 1GDHA 1CFZA 1B0UA 4PLYA 4A3SA 4Y2YA 2R9VA 5CT5A 4LTDA 5JC8A 2DM6A 1VKJA 3MQ2A 4U6SA 4YVFA 1RPZA 5DP1A 3MJCA 3PNVA 5K3AA 3SOZA 4IY1A 2HSJA 2QR2A 1R64A 4MJ7A 5D3MA 5AP9A 5DI3A 4JB0A 4ZO6A 4RF2A 4L0DA 2AG8A 3ZBUA 1XAHA 2R6HA 2YC4C 4R1LA 4C8UA 1NP3A 2PQMA 5ARCA 3OQMA 2VRWA 3RS5A 5IUNC 1OLSA 1BXGA 4R98A 1BQ3A 3ICPA 2E37A 1SCIA 2GKOA 3S6JA 1D03A 2QAGC 4QXPA 4ZEVA 2HWKA 5D86A 4RVHA 4D5GA 1U2TA 1QIFA 1VE6A 2KS6A 3PHIA 5A9SB 4NESA 3E9EA 4XLTA 3WGOA 2WA1A 2G25A 4E32A 1VG0B 1A8HA 1U2SA 3Q7IA 1N2ZA 3FPKA 5DYNA 4HOYA 3HB7A 3VV2A 1H8ED 1P3JA 1RMTA 2PXCA 2P9YA 2PRJA 3BILA 3R40A 1N5DA 5H0IA 2I4IA 2PKXA 2YWJA 4NE7A 4MO9A 1I2CA 1I4WA 4FILA 1G6KA 5BXQC 1Q5PA 2QPTA 4CFYA 4ZYLA 2D2FA 3GRYA 4LGYA 1FTNA 5KSZA 2RIRA 1LNQA 2WG2A 4G1EB 4K1LA 3PD0A 3ICWA 3TD6A 2ES4A 3EQ6A 1CZUA 1NA5A 2UZ1A 3HADA 4AK9A 3FYUC 1XX6A 1BG6A 1VE3A 1CR4A 2GLTA 3E61A 4IGEA 4L6IA 4M9SA 5AKHA 4BB6A 2FSFA 3ET4A 3VU9B 1EE1A 3ORFA 1KJJA 1PR9A 2HPZA 3UOGA 2YWRA 4TTVA 2AN3A 5C1IA 3T1NA 1RXUA 3VMFA 4D25A 2PUJA 2XRFA 2WHEA 4ERNA 2HI6A 2QZSA 3IQIX 1Y7IA 3BGVA 1HE5A 3H75A 4Q1CA 4UHBA 3VC1A 5D7NA 4CW7A 4CT5A 2NAFA 1QNLA 1NQUA 2XD4A 4JYCA 2Q3MA 5F1OA 4Q4JA 3HJHA 3NTOA 4ZOLB 4A2CA 3S9LA 2RC5A 5T4FA 1RWVA 1C5KA 2J9FA 3CSUA 1AUPA 4MVWA 1QYCA 3N6VA 4E21A 1WOYA 5C8XA 1HRDA 4TKLA 3WO1A 3E4DA 4BQSA 1DJMA 2JH8A 4IYJA 2RG7A 5AOAA 3H1FA 4C4RA 4FMPA 1UMDB 2B92A 2BGKA 3RV3A 3TTTA 3G0OA 1Q7BA 2DFNA 1B2LA 2FEMA 2WIGA 2X76A 1EXNA 1GFSA 3P32A 3RABA 1OF1A 1O0CA 4Y6OA 4RY9A 3KJZA 2DBYA 1DBQA 1UEJA 3AERA 4ZT3A 5K0LA 3BHJA 4IJWA 4ZEWA 4BLRA 3FHOA 5DWDA 3PDIA 3TVDA 1OV4A 4DJDC 2F3RA 2PU5A 4GICA 3GLSA 2ZE8A 3BIWA 3WRYA 1NMEA 5JSZA 1S1MA 2EIXA 3HPRA 1PO7A 1W4CA 3GZJA 4L4ZA 5JAIA 2IEIA 1A76A 5DNDA 4EX7A 3FIJA 4BECA 2SBTA 2VDOB 3AEQA 3EDQA 4HFRA 4JBXA 4YN3A 2B7CA 2P90A 5BVHA 2ZB7A 3VTAA 2BN4A 1W52X 5J4VA 1PF7E 2WI8A 3WBJA 3AM1A 3CLSD 3W7AA 4W5TA 1E20A 1WTCA 4K1XA 1DAHA 1X74A 2O19A 2Q49A 1JLSA 1T26A 1LQUA 2W11A 4GKAA 4GSLA 4W5NA 1ORVA 3PT9A 2FWMX 3AHHA 1EGVB 3FVTA 3OHPA 1MENA 3RBZA 5H02A 3V3KA 4YAUA 4EECA 2QJRA 4AZWA 3QQ5A 2AKYA 2ZR7A 4D8UA 3KQKA 2HIAA 1XPUA 3BXMA 3SQWA 4II7A 1W4LA 3OZCA 4RZXA 1GCOA 1NU8A 4N0DA 2VA9A 3EUWA 4E4YA 4MUJA 4P7FA 1WUTA 1T3TA 1G5HA 3FGNA 4GX2A 4O59O 3LDFA 3MPOA 3MIIA 4H59A 4OX9Y 1OU0A 1MHTA 4RF4A 3U7QB 3HFJA 3EIOA 5BPFA 4JYBA 5IJZA 1K75A 1H6AA 3PQ7A 4CZ1A 4UBNA 3KEMA 4C29A 1Y98A 4IOJA 3GRZA 2H8KA 2XTZA 4QUDA 1I6LA 5L3SB 4E2YA 2O3TA 2W6QA 3HVIA 1MOQA 3FWKA 3GFQA 4Y3UA 1FDUA 3K1YA 5AHWA 4O25A 3H1GA 4BB5A 2C07A 2GD2A 3HA5A 3I76A 4KV7A 1O6GA 1GTL1 2IP1A 3B13B 3C8DA 3DEZA 3LQFA 2F3UA 3BD6A 4RSGA 5D87A 3RFTA 3ZV6A 1GGOA 1FSGA 1X0VA 5IKOA 2R0QC 5I3ZA 1NKVA 3A6LA 5A3RA 1X8LA 6GPBA 2CLCX 2HLHA 3PFNA 2Z6QA 5A2GA 2WWHA 1WIWA 2CVZA 3R6WA 4LWQA 4ALNA 3TINA 1GD1O 3PV0A 4OSEA 4FI3C 5U4XA 3SDBA 2HU7A 4BP1A 3D6FA 5A3QA 3H8WA 4TS1A 4ASUA 3KT3A 2Y0BA 4C07A 2GAFA 3IA7A 1G21E 3HYCA 2Q99A 3FFAA 5GJWC 3L06A 4QYMA 2CZGA 3PXCX 4JGGA 3SLKA 5CYPA 1URPA 2R8RA 4LOAA 1RAEA 2TECE 4QGBA 3TFWA 3P2YA 3VKGA 1XL1A 2HK6A 2HO4A 4KIFA 3KBOA 5FLYA 4XXHA 5G4LA 1NVVQ 4BTLA 4CTKA 4OF4A 2OAGA 4Y2TA 3GHHA 3PWSA 3FVRA 3O8NA 4A8TA 4B8WA 3ABIA 2ATEA 4C0KA 1SQ6A 1EGMB 3SEAA 5BT8A 1TM4E 4PZEA 5JVDB 5K3FB 1O87A 1EFLA 2VF4X 1RRVA 1VECA 1XF9A 2PWYA 3IS3A 4G1FA 2JFVA 3LECA 3OSZA 1QKKA 4ED9A 2X5JO 4YPOA 5JH7F 1GNVA 1Y4ZA 2QTVB 3KEQA 2H57A 1JQDA 3A6HA 4PW0A 4ND7A 4DREA 1YB4A 4LK2A 3NIDB 3FNRA 3S8MA 2QEQA 2B0AA 1NRXA 1JLRA 4BUZA 4I2VA 4CM4B 5LMNB 2IEBA 1PWEA 4FFDA 4N3AA 1IK6A 3WLKX 4ROSA 2O57A 1GTJ1 2GYWA 1HO3A 2H07A 4C0AC 3C6YA 1S6YA 2XGOA 3HCFA 3QIAA 4NC9A 4PAQA 2WKWA 2GVDC 3J81A 1U90A 4URHA 2DZDA 2A5FA 2DSNA 1IWOA 2W6ID 4LI3X 3U3DA 1ZD3A 3LY8A 1JDTA 3G0CA 2EZBA 2FAXA 1QS0B 1QX4A 5LZ9A 1M6YA 2CHFA 1RQPA 2AMFA 5IJXA 3EFHA 3O4JA 2AEJA 2G0TA 2QXYA 4I50F 1I5OA 1PVDA 3FRJA 1W581 2P9FA 1TKCA 2GHTA 1EXWA 2W4MA 4LVUA 1NUAA 4TTPA 5CJ2A 1F8YA 3EVZA 4O2AA 5ADVA 3L4SO 1KS9A 1M2GA 3EFOA 4WA7A 3LVFO 4BAUA 2HY7A 2V6FA 3Q2KA 3II6X 2A1IA 2J6BA 3TAXA 4JJZA 4ZGWA 1Y6GA 1RU3A 2MHCA 2ZRKA 1GKYA 4YASA 4CTJA 2CVFA 4TRMA 4CKYA 3DYIA 5TMEA 1G2PA 4D0LB 4B0PA 5HJ7A 1H0HA 4RSHA 3CTPA 2HFJA 5IZ4A 4LPSA 4DJFC 4N40A 3PHLA 1KZ6A 1M6VB 2VFAA 3V4PB 5IR2A 2I5PO 2EYQA 4ZJPA 3KKLA 4TWJA 1ZCZA 3E84A 4MV1A 2IBSA 1UBTS 4JEUA 4R1TA 3ZCQA 3OURA 1P44A 3H99A 3IH5A 1IZ7A 4GRAA 4QQRA 4ZAGA 4H0CA 4E15A 2A5JA 3WBKA 1T0UA 4MVJG 2OOKA 3M5DA 5DU2A 2GNPA 1WP4A 4DUGD 5FEMA 4FYXA 5CX1B 2ZWOA 1P4SA 3CUUA 1CYEA 3HKBB 1M8GA 3CCBA 3RGGA 3SC2B 5LQAA 3T8YA 2W6IA 3AZPA 2WF5A 1MH9A 3CF0A 3HWX1 3NAZA 1AB6A 2IU0A 3T1VA 4EB6B 2AWNA 4L4YA 3QH4A 3O84A 4MV7A 1T2EA 5JCZA 4EI7A 4M88A 1JVBA 4WBNF 2DFVA 1XHEA 4ZQFA 2ZQZA 4ZJZA 1DMSA 3UJHA 2JGNA 3O91A 2ZJ0A 1JXAA 3LFUA 2I2XB 4UD6A 5B7PA 4NBNA 4QTXA 2HREA 1EP2B 1TX4B 3QUCA 2B2CA 2J5RA 3RRXA 1P31A 4D4GA 1BMQA 3B78A 2NV6A 4M86A 5LD2C 1L8XA 1LX7A 3WAGA 4B4WA 2GKGA 4D8WA 4JLVA 1G98A 2OBFA 5LLDA 4O5OA 2D0OB 2XCSB 4A4DA 5MN5A 1CLEA 1CIVA 4JQSA 4DBVO 5A1TA 3P71T 1SU6A 3UK2A 1H6BA 1M6WA 5BYKA 2MP0A 1BGWA 2Y6VA 4I14A 3WNDA 4HG2A 4BO5A 1GRQA 3U3XA 1IM8A 4MS1A 4KZPA 2PUDA 4DRXA 1OH7A 4RWZA 2J4DA 1BDIA 3D7GA 2D13A 5C46F 1GDTA 1IZYA 4FJ1A 1MW8X 1T5DX 3SXUA 2JI6A 2P9BA 1PL0A 2R82A 2VUHB 5UKDA 4Q4AA 4E1BA 3DLBA 4I1VA 4KR0A 2WIFA 3VOAA 3QKTA 3TR5A 5A04A 1FFCA 1PX0A 2IPXA 4HJRA 5KB3A 5KJFA 1VSQA 1KJNA 1QFJA 1RRGA 4WJLA 4YMHA 2VP3A 1XZCA 2OZEA 4MTLA 4RXTA 3WNQA 1XDWA 2WAAA 1VIMA 4MR7A 4UNIA 2JZNA 3DBHA 3R7WA 1Q22A 4QOHA 3AZOA 3KYBA 2VYVA 5ELMA 5IUKC 3ZCXA 2VHTA 5HW0A 4CMJA 3DVAB 3O8LA 3UKDA 5KYXA 1KYQA 1W73A 2Y1FA 3WISA 1R61A 4LZLA 4DSOA 4ZHQF 4TYNA 2C31A 4OC4A 4Y2QA 1CEEA 1JNXX 4HRYA 1QVVA 3QOWA 2MWMA 1FSPA 3T1OA 1DC6A 2GJ9A 1MOZA 3I58A 1QUFA 1J99A 3SKVA 3FWHA 2IYTA 1FMLA 3MCZA 5NULA 3T4UA 1GVHA 3T95A 1NFFA 2YVLA 1P4GA 2QY9A 2FEKA 4P54A 4DR3B 5JQGB 3I9JA 1HURA 1PJ2A 4CG2A 5F98A 4RY8A 1L4UA 1WUHS 1GUAA 4DFDA 3VYTB 1JMVA 5C8YF 2EKLA 5ESXA 4EA6A 4IKEA 2VJMB 1VL8A 1L3CA 1WKVA 1M1YE 1Z07A 4HNVA 2C20A 1UBNA 2XITA 2ISSD 5FF9A 4KXWA 4MMXB 1LB1B 4BNYA 2D5LA 2L18A 4DCUA 1XYVA 4DR5B 1A7UA 2QRVB 3DE4X 4LSGA 1M2JA 3K8OE 3NWOA 2WMYA 4IIJB 5FUXA 4M9CA 1EPUA 1I32A 3GPCA 5F7XA 3G6WA 3ORHA 1KQNA 2H7YA 3VNSA 2WT8A 5TQ2B 2FZGA 1A2KC 1QCDA 4EUSA 4C2TA 4WNCA 4E94A 2CBXA 1GPYA 4D02A 2NIPA 4NJEB 4J76A 4IEIA 4LZWA 5EE9A 5HRAA 5K0CA 4C7BA 1KXJA 1V4BA 1CS0B 1M1XB 1RCTE 3BHXA 1GTVA 1VA5A 1G55A 2OV6A 1P2VA 4YT5A 2AYZA 4M49A 2J9GA 1FNNA 2AMJA 2Y2VA 2YQ4A 1DKLA 1NXPA 5GV8A 4LRYA 1U3DA 1CWUA 3Q3EA 2A58A 4Q01A 1UK9A 3C8UA 3TPZA 4EYQA 1JJBA 3EGIA 4CKCA 4FGSA 3PE4A 3WZ2A 1FYEA 5GONB 1QJ4A 1JA1A 2F48A 3NNDA 2R2GA 3WG9A 1A5TA 4M89A 2OMEA 4D9IA 4IDBA 1JQ3A 1K7XB 2BGNA 3HKDA 1WCWA 4IUYA 3V42A 1UANA 1FNBA 1OWMA 3FPLA 3DD5A 1IFXA 1QQBA 2ZSJA 4K28A 3KJHA 3P20A 5D2CA 1HTBA 1G8MA 1SHJA 2G9NA 4M1QA 5B12A 3TNFA 5KUTA 4LYHA 4B2LA 1AXGA 1U8XX 4JT2A 1M2OA 3LWZA 3BA6A 5DCUA 1HT3A 5ALTA 4A5OA 4BU1A 1LI5A 3NC1C 1EFVB 1C2TA 2BZGA 4KL8S 1MNQA 2E4VA 3VZPA 1JNYA 3DTYA 4RTLA 4S05A 5JCXA 4BZZA 1O58A 3GMIA 3GYGA 3S28A 4W5JA 1JIXA 5F21A 4GYWA 1B00A 3I32A 2EX0A 4YMVA 2PYIA 4KXFB 5AUQA 1YJ8A 5AIBA 1CY1A 1EHYA 3ASYA 2WIJA 3IULA 1DI0A 3NHAA 2AFIA 3JR7A 2I6TA 1O2DA 3QV2A 1O5OA 5F5NA 1F12A 1OKKA 4NOMA 4V0MA 3GLFA 2V5UA 3OQ1A 1XYYA 4IKPA 2LGJA 1XZDA 2JCBA 3IJPA 3L18A 3N2LA 2WE8A 4AMUA 1T91A 3LZ6A 5CG2A 4BY9E 5TIIA 2XEJA 3CUYA 3IAM6 1HETA 3RVJA 1P0CA 3ZVKA 3M81A 4RJLA 4DV7B 2P65A 1QF9A 3R3HA 4ITVA 1GEEA 3PLNA 1CJCA 4BLOA 4KXVA 5ADWA 2R7AA 2GEFA 1FU4A 4OO3A 4R54A 4QEKA 4HY3A 1JTFA 3AVPA 3FD8A 2VQEB 2BMVA 4PZDA 3AMVA 2CBGA 3LS2A 2VS1A 4IGKA 1DOHA 4BC1A 2UZ3A 1WF3A 2ZT8A 3H2HA 7REQB 4Z53A 4DW8A 1X87A 2Y92A 3OU6A 4JFAA 4UTNA 3DKRA 2FXVA 2CHGA 4EMTA 2RHWA 1V7ZA 4HYYA 5KAPA 4E5KA 2WJYA 2I7DA 1G59A 5HILA 5T3UA 4M0MA 4ZEXA 1N8KA 4EYEA 5BWOA 5GM2A 5HJEA 1FP6A 1LPMA 4KR2A 1EHIA 2Z2XA 2XYVA 1CIPA 4REOA 1BD3A 4KQXA 1AJEA 1GILA 5DASA 1XUOA 1CSEE 4Q66C 5AO9A 4UTZA 2P9ZA 2NU7A 3BGDA 3QVTA 5HYVA 1XTZA 4V0SA 4ZV9A 1NJFA 2RGCA 3IOBA 1DHRA 3C14C 4GPZA 5JWRA 4CG0A 2G4LA 4ND4A 4XCVA 3PDWA 2IT1A 3PXAA 4KQ1A 4B1FA 4NYJQ 3S1LA 4YFVA 3LW8A 2VHXA 4N76A 2I2WA 2VXYA 1FUKA 1YDHA 2BM1A 1BE6A 1XVIA 1FFDA 2P4UA 3LY9A 4O2BF 3AFHA 1NX6A 4QG7A 2JLZA 3U7GA 3R4VA 1YFKA 3H97A 3U44A 3OE5A 1C3VA 1GPKA 4XWOA 3CVYA 2CC2A 4MMYB 3BMQB 1Q83A 2YHIA 1E58A 1Z7BA 4K9KA 5BR7A 1M2VB 1ZM2A 4E13A 1E0SA 1M7GA 4JI8B 1SBZA 1GTMA 2IW1A 2XYPA 4CL3A 1DP4A 3FI9A 2W2TA 4WKPA 3C7TA 3AONB 3DMTC 2M2IA 4EKIA 3H8SA 2OCLA 4JYAB 3PNLA 4XWGA 2P7IA 4O08A 1C9KA 2O7RA 1HDCA 1M1YB 4NBTA 2H5LA 4PFQA 4X8OA 4CEHA 3N87A 4TMZA 2Z30A 2Y1LA 1ZUIA 1RLTA 2IDMA 4IV8A 3SJCA 3Q1KA 5J2UA 4NYIQ 1Y3FE 1LV8A 3A9SA 4DZTA 1E1MA 3SHOA 4WMLA 4MYHA 4RC9A 1Z6XA 1ECFA 1NJSA 3AXSA 4D8TA 2NNWB 2NSYA 2OCAA 2XMSA 3QU9A 3WK9A 1NT4A 2Z58A 3ND9A 4CE6A 3L82B 4YYZA 4LF8B 3NVKI 3WJ1A 2XB6A 2I8AA 1TEZA 1Y1RA 4Y6PA 4CL8A 2ARKA 3N2YA 1ZWKA 2FFQA 4L07A 4JU9A 2VDWA 4DJJA 4HNTA 3OSUA 5HDQA 3M0EA 3CX6A 1RCFA 1I2MA 5E2IA 4DGSA 3HZHA 5KC8A 1XA3A 1HOXA 1DTWA 2QQGA 2W6CX 2ZCVA 3PPIA 3QVMA 4MO2A 4NNPA 4RTRA 1P5HA 1YBHA 3GCGA 4GBJA 1YTLA 4C6RA 3BZBA 3S2IA 4OQLA 1XHLA 1U3TA 4H31A 5KU1A 2HCFA 4XUGB 3QF7A 1SHLA 4L72A 3ZK8A 1JIVA 1MV8A 3K92A 4OJQA 3AU9A 4DLPA 1KI9A 2BZ0A 2NXWA 4FCTA 1J1ZA 3GLRA 4S2UA 4PV7A 1NJGA 3LX8A 2H1OA 4L4SA 4XDZA 1YJXA 3VPGA 2FPKA 1P7PA 1P7CA 3BWBA 1SG0A 1BJKA 1S2OA 3H5NA 3K0AA 4HQ6A 3UXEA 5LL6P 1Q5XA 4M0PA 4FYMA 5HOEA 1AZTA 1PJ4A 3B85A 3KKMA 5DP2A 5AXBA 3RG2A 1CRQA 1NJ5A 1WSBA 3F67A 3O7MA 4QHSA 2VNIA 1H2FA 2PLAA 2YXNA 2QLFA 4G26A 2HCRA 1EWQA 4IS3A 2FKNA 4R3NA 2GHQA 3TG8A 3LCUA 3PUJA 4B32A 4EA7A 1PE0A 1ZG3A 1Q57A 3GT0A 4LHVA 1K6EA 1CJVC 3O2SB 4TUYA 3LDUA 5HGXA 2R4UA 1VCMA 4HXGA 3UXHA 1H93A 1OGIA 2DC1A 5G2OA 5ITVA 2PGNA 1POWA 1FLDA 2YL2A 3DQQA 1O96B 3DFKA 3WXBA 3AWIA 4ESVA 1TRHA 1GZVA 4S1VA 3A27A 1RZRD 4EPTA 1OW3B 3LZCA 4EGAA 5JJLA 5D5HA 3LHKA 1JHOA 2Z9DA 4NHOA 4U63A 2JNWA 5K4AA 2EL9A 2CLOB 2ZSIA 1BKDR 3OWHA 4PTYA 5K2OA 3OU7A 4W63A 1SCJA 4BMOB 4E6EA 3JVVA 1KDTA 1NONA 4XGRA 2X8LA 4LXXA 4MJXA 1S4MA 5AI5A 5DEIA 3SSMA 5KC9A 2XSZA 3EF3A 4EG4A 1FYXA 1Z8LA 3BF8A 2LE0A 2A0WA 2ADOA 1NBIA 2BAGA 3A11A 3AFGA 2H29A 3BL5A 4JT9A 5JMPA 1TL7C 4C0QC 4RFSA 5KEIA 2J0EA 1Z0AA 4D4KA 3HKCB 3WGKA 1N1GA 1Z6QA 2JJ8A 1IOWA 2NVWA 4PIPA 3A2NA 1JEQA 2J67A 2HK9A 4BX9A 4C7OB 4BWGA 1RYBA 1Y9AA 2J32A 5BO5A 3RASA 3W6UA 3ZWDA 3AG5A 4OMUA 3IEUA 4RPGA 4KREA 1PQPA 3B1YA 3BIFA 2XEIA 4K88A 2WU0A 3B6ZA 2H31A 1NZJA 5DNYB 4HPJB 4N5IX 1Y6FA 1N7IA 2KWIA 3L1UA 4Q3AA 3DE0X 4NOKA 4R8RA 4X54A 5ETJA 5G02A 3WHKA 2WF6A 2OC9A 3AIKA 3V4ZA 1BDHA 1Q92A 4KPFC 1WPRA 4JI3B 5DTJA 5EHIA 2V65A 1QGED 1WXXA 1LCIA 1QQTA 2IZOA 5HZKA 4WESA 1QRRA 2VTBA 1JDPA 4NCBA 1A9TA 3EIEA 2DSTA 3PPWA 4LXYA 2DPYA 5JBIA 1I80A 2H92A 3LM8A 2BW0A 1G41A 4HDQB 1Q0UA 3SF8A 1EFDN 3D7DA 3IR6A 2H8GA 2NG1A 4F93B 1IN5A 1QZ3A 1L5SA 1NTOA 2I03A 2NPOA 4YAWA 4DDVA 5CA0F 4E2ZA 1W25A 3DE6X 1FVOA 3F4BA 5FAKA 4FBLA 1GITA 2B83A 1TRKA 2N9UA 1PJAA 5ICSA 3EMVA 1BE1A 4BOYA 5KQSA 1DADA 4OH1A 4OP2A 3EQ8A 3IVXA 1YCHA 1YB5A 1PGPA 2Z2KA 3MCTA 2FG5A 1UMBA 1ZCAA 221PA 3AJRA 4QYWA 2H85A 2HMUA 3K73O 5EGNA 5E38A 1C50A 3A3PA 3EIQA 3W5VA 3AR5A 3G49A 2R97A 5CW1A 4OB7A 4WFKA 1ADFA 3C3EA 2K6GA 3F7OA 3L01A 1K7EB 3BXEA 4H08A 4TV9F 5A05A 5LZ2A 1XCBA 2OHJA 1L5OA 1KMCA 1DC5A 4L85A 1XC7A 2HSGA 3FUTA 1TCVA 3VR4D 2DFPA 1UQRA 1BH2A 1PR2A 1LSUA 1FE8A 1VKZA 2DKFA 2CE7A 2IBMA 3HEBA 2BR4A 4WBXC 3KR0A 5EZSA 3VPAA 13PKA 3ENWA 3W3ZB 2O14A 2NYAA 2AZXA 1NC1A 3WJ7A 1IBCA 1CZKA 4JLAA 1OPRA 4NQZA 4GXQA 4OHUA 1N92A 2GYYA 2WSLA 3NFYA 2Y66A 4WCVA 2Q7XA 3ANTA 3RSLA 5FB3A 2QRKA 1G21A 2H06A 2V0CA 4ME6A 1IJBA 1L1QA 1ULBA 4TMKA 1EUDA 1RJGA 4AKSA 2EKBA 2O0HA 4YRAA 4DEXA 3Q9LA 1O6BA 2G1UA 3I8SA 1L7XA 1QHXA 2RK6A 4WA8A 2EATA 2NTYC 4ZC8A 3KU4A 1HOTA 1MAWA 2E4XA 2XMQA 4X1OA 5CTJA 4KR6A 1W2WB 3PC8A 4WNIA 3N0RA 5EMMA 1E2LA 1KETA 5JVDA 1IRXA 1PEDA 4BFCA 4CEJA 2CWWA 5IK2D 3GLIB 1NJ2A 4KQIA 1EFPB 4LYYA 4K9QA 5L40A 1KJIA 1XLUA 3K2IA 2YHSA 2BGWA 3IKLA 4PONA 4U0KA 3KT0A 3G79A 3NLLA 4RSMA 2PHZA 3JPYA 3OFVA 2W58A 4MW6A 5I9SA 3V8RA 3VU8A 3W8RA 3I5XA 3HGTA 5I4BA 3E22B 3LOUA 1KIFA 2ZJBA 4AG3A 4Z7OB 1IXYA 2ZULA 1QBGA 4BFZA 5L3RA 4CIXA 4CBVA 2NTEA 4KGZA 3ANSA 3U40A 2QUJA 2BKAA 4NU5A 2V8OA 1PWXA 4FHGA 3SQDA 4L57A 4AYTA 4AUEA 2FSSA 3WGTA 1JT9A 3FG9A 3HYNA 4TQAA 3RVKA 4CMBA 4CMIA 1K86A 2D0DA 4KR7A 5I01A 2HW8A 1FSZA 1PYDA 3F2IA 1AQJA 4C9VA 4AMZA 4W5OA 1YIDA 5BNTA 2CZQA 3FPFA 1YE5A 2O4UX 3N07A 5ILGA 1FQOA 1QHHA 2VJKA 4P7GA 3UQYS 2SECE 4F3RA 4G84A 5JT1A 4BKMA 1L5LA 4O3MA 2GPJA 2EJVA 3PICA 2IX9A 1E8DA 1SJ9A 4OHOA 5AK4A 1GT6A 3QFTA 4FE3A 4X6YA 3ILXA 4C22A 2QJFA 1M1ZA 1QCCA 3MUNA 3RGWS 4WGGA 1LK0A 3TQFA 3ZDZB 3L8EA 4EFNA 1E98A 3GLGE 2AZDA 5K7SA 1PDVA 1J6UA 1TMGE 1NSYA 3L8ZA 3ZJYA 4AWAA 2H1RA 4H6WA 4F2DA 3DE7X 3HCBA 3QI2A 2ISCA 5AK5A 5ALOA 1GG5A 1R0KA 3QBVA 1IH8A 4M1EA 4AECA 3ONNA 4DKJA 2G83A 1YB2A 3LO8A 2QTNA 2YY5A 3GG9A 4OM7A 3DBRA 3IMCA 3OVMA 3RT1A 3DC7A 2AW3A 4IIFA 2VRCD 2RHRA 3PQ4A 3ESDA 1R8SA 1VL1A 2EP5A 2VP4A 5E7IA 1D2RA 2R86A 4S1NA 1O89A 4ESHA 2VEDA 1QB7A 4R9RA 2ENUA 4S1PA 3T94A 3ZGLA 1MF7A 3EA0A 4G25A 4L08A 1EINA 1LQ2A 4IIXA 3MINA 4ZYZA 4RTMA 1K68A 1PWZA 3AL0C 4I7EA 1OLSB 3M82A 4A6XA 3CZ9A 2A5GA 1TVMA 3ZU4A 4AD8A 5CNJA 5LB4A 5B4VA 3LQQA 2R65A 2FN8A 3OMLA 2W2OA 2H0AA 4PNZA 5L7WA 2FKAA 4JI6B 4YECA 3QLUC 4DLUA 2LTAA 3N75A 3SS7X 4CMEA 5CDUA 4ZT6A 1QIEA 2NTVA 5EMLA 1DTWB 1SU8A 4DIUA 2PZ8A 4XFDA 2PX4A 1PSWA 4XSGA 2BELA 4YQZA 4C4SA 3AF0A 3IPAA 1LBEA 3IIMA 1BC5A 3C2QA 4Y98A 1KQOA 2BBWA 4ZQCB 4MYUA 2ZITA 3MHPA 1MJFA 1QVWA 1YRHA 1O0BA 2DCMA 3ZIAA 1Q0ZA 4K6KA 4RE6A 5I9NA 3MTBA 4LDZA 2FK8A 3DB1A 4QPJC 3HU5A 1UBCA 1GLGA 4MKRA 4LV8B 2HPVA 3ANXA 4WQMA 3SBXA 2XCRB 4BVGA 2JI4A 3FRIA 3KSDO 5FWXA 4ZDIA 5HKLA 2DPLA 3V7WA 4KQ6A 4NMLA 1TW3A 2QG6A 3D8SA 1CX8A 4AXBA 1IAQA 4CMCA 2YVQA 5F2NA 1RE1A 3CISA 4GGOA 3TNJA 4KPEC 1QRUA 3I2KA 2JFWA 3A9RA 2QTFA 4MVJI 2ECFA 4CI0B 3G02A 5HF6A 1JEYB 3QWBA 1DZIA 3C8HA 2FPSA 2BGLA 4QQFA 4BFLA 1UP4A 4Z99A 3TKYA 5DHUA 2UZ1B 2WSMA 3LYLA 1RWQA 1QP0A 3T3MB 4AP5A 3L0SA 3W7BA 5FOXA 4EY4A 4ZXFA 1DELA 1WO8A 5HCUA 3L9XA 5JXGA 5DOZA 3GJ4A 1MC4A 3NHSA 1S2DA 4PSAA 3NHYA 2YV1A 4LJRA 1VMEA 5K03A 2EBFX 2UZIR 1XJQA 5LP6C 3DZDA 3SIRA 1JU4A 3BIXA 5E8JA 3QLUA 5EYPB 1C0LA 2W2LA 3TOZA 2Z1NA 3TOVA 2IIVA 1Y1PA 4CMEC 1RXSA 1S4QA 1E77A 4I2NA 1IU9A 2ZETA 4K40A 5JCOA 4DL9A 3PE6A 4RGVA 5DT9A 4DIEA 1I6WA 3IQHX 3WIUA 2RGYA 1YGPA 3AX6A 4MUHA 3RUFA 4J1TC 4JLKA 4BWYA 4TVBA 5A3JA 4XIIA 3CR7A 4H7EA 3HR7A 2I2BA 2XNJA 4NAVA 2F8SA 3H4MA 2XBLA 3DOOA 3LX4A 3L6UA 1EA5A 4KIWA 2QSJA 3INYA 3TJMA 3T5TA 5LA6B 1B74A 4K6GA 3D6AA 4PO8A 2VPTA 1S8OA 3AEXA 5CYFA 4CM8A 4DV2B 5DNEA 3G5TA 4DUPA 3HBLA 1P73A 3KHUA 2QTHA 2JEYA 3ZVRA 2B78A 4MWCA 2NYUA 4JLMA 1WEKA 3SX4A 3WLOA 1FXWF 3EVGA 4O4IA 2H5IA 4MR8B 1NM5A 2QLNA 3R77A 4BIMA 4WUTA 3MT0A 1JJ7A 2PS0A 1G1AA 3K9LA 1J20A 3LW7A 2OL4A 3KOMA 5AKJA 5IVIA 3R9IA 2OM2A 3RD5A 5F9MA 3TRFA 3BX1A 4H1VA 3NCTA 4AMVA 3H18A 3REQA 3JQAA 1AMUA 2OQIA 1C3XA 3HDYA 3C74A 4MW9A 5FA5A 1T8SA 1Y3HA 3WWZA 1QGUB 5JNTA 2VL7A 2IVFA 1D0IA 2ZJ1A 2BHRA 3QWAA 4RY0A 3ZWXA 3ONFA 4MWOA 1C7IA 4QE3A 2N1MA 5AVTA 4MPTA 4CMKA 1FP1D 4BMDA 1H4SA 1G3RA 3BS4A 4MV8A 4MINA 3GHYA 3PEUA 10MHA 4YGYA 5J2UB 5CYGA 3AFIA 4Z2YA 4PPFA 1Y63A 2MJLA 3IUSA 5BVHB 1JSLA 3SOPA 3FMIA 5LZ5A 3WWEA 3W1VA 3LPLA 2IYNA 3EPKA 4KUHA 4KUEA 1OWPA 4EW2A 1RC1A 2L2QA 1Z74A 2IHJA 1H9BA 5GTDA 4KZKA 3ZQUA 2I6XA 4JNCA 3QW4B 3RSZA 4YRKA 1YMQA 2HNBA 3AHEA 4BMSA 1R5NA 2EV9A 3L7IA 4D9BA 4AY6A 1FUUA 2OSVA 4NS1A 3ZD6A 5CVCA 3TOCA 1VJTA 3GDFA 4ZT7A 1ZD4A 2FEPA 3QUBA 5ALNA 1VJRA 3H19A 1EG7A 2OXTA 3MWGA 3AHJA 3I0ZA 4BVEA 5I45A 3HLKA 2H9IA 2V1UA 1V7CA 1BROA 2ZPUA 1MD9A 2IK8A 1ZIXA 3BMXA 4JJ6A 4DCPA 2FRXA 4MRRA 1V8FA 2I4NA 1Y4UA 1YZFA 1V3TA 3N86A 5EIBC 1GGVA 3X43A 1RHRA 3DMTA 3ZK7A 4DQ0A 3URKA 2YN0A 4C87A 4CT0A 3LHDA 3P1JA 4W6QA 3HJAA 3WMGA 2ZJ3A 4J03A 4PSDA 2DHQA 5H7XA 5HKKA 1L5HB 2A9RA 4MKZA 1USKA 1MN6A 3M6VA 1RP1A 4QJIA 5ALHA 3SJFA 1V6SA 1HE8B 2ZI7A 2BEUA 3ET5A 3O82A 1BS1A 4AG6A 2ISQA 5EWJA 3V8EA 4YCMA 4UPVA 3PVCA 4JLPA 3EEBA 2IDJA 4GNKA 5D3KA 3VV3A 3WGYA 2TMKA 3L7KA 4HGRA 4MIEA 4DBLC 2X40A 3G5LA 2WICA 3UJNA 3N8DA 2W90A 4U7GA 3K0SA 4Y30A 2NUBA 1MA0A 1N8NA 1MPXA 4U5QA 2P4QA 4TL8A 3SP1A 5FO0A 3ACBA 4II3A 1OA0A 5COAA 4LBYA 1KVTA 1X7WA 4K8OA 1ZM9A 4DCMA 5IJ9B 2VATA 4G1CA 4WCFB 1ULZA 1T43A 4RKWA 1ZRSA 2GBLC 2XHEA 2RJ3A 4GPAA 5H16A 2C42A 3ZU6A 5GZ3A 3CNLA 4L2IB 4WECA 1YULA 3AW9A 4L8WB 4L8FA 4FJ0A 4BX3A 6ABPA 3IUQA 5JLJA 1DRWA 1Z73A 4FGJA 4JKOA 3CLTC 3S9MA 2VLIA 5FORA 4AY4A 1JWAB 3IX7A 3R5XA 1FEZA 4KVZA 4LE0A 4LXTA 4OD0A 4BWFB 1LRLA 2P2GA 5MFPA 4JVSB 2Y93A 2WZQA 3NWJA 4UUNA 2XBMA 2FRDC 2VSOA 1K7YA 1MAAA 1ZGCA 3Q3CA 1WF6A 1PGJA 2G5PA 4IMIB 1QP4A 4CF6A 2GYVA 1K27A 3VOTA 3VVCA 2XB8A 1L5HA 1XNRB 3JD1A 3ACDA 3MLBA 1QF7A 1DXOA 4NTZA 1AGYA 2CFRA 1P9OA 1ZO8A 2Z5GA 3AY6A 2QF7A 5E6SA 3ZIUA 4EPRA 3H13A 4K3UA 4Z4IA 1YACA 5BN3B 5CUQA 3Q4GA 3VPXA 1UFKA 1SCKA 5LQUA 3VYRB 4PZUA 1G7TA 3JVIA 2P1RA 2P4HX 2UYOA 2ZB3A 4QUJA 2C03A 3A4VA 2ZBUA 3UBMA 3K4IA 2P77A 4W5HA 4BO6A 4AQYB 3N3BC 1KVUA 4CFZA 4NEHB 4V02A 2O0JA 1FPMA 5IARA 5K51A 5C5IA 3IVCA 1R0WA 3SMQA 3UHPA 1NWCA 2LVBA 3A9TA 5AK3A 1QGOA 1TT5A 3PUWA 4U39A 2X6TA 1I4DD 2E6KA 3CIFA 3IHTA 4P81A 1C0PA 5CIWA 3NMUF 3D0OA 1XQ1A 4P45A 4ZVPA 2OORA 5CH3A 3U48A 4TSKA 1X8JA 1LKZA 1MJ5A 3CT4A 1KQ3A 3SM3A 4MDHA 1D1TA 2I4LA 4HQRA 1GQRA 2H11A 3D6MA 2FFBA 4P33A 2GMWA 1NP7A 1UP7A 1UAAA 3SXJA 1N1EA 4PHGA 1N5OX 3SYNA 3T7DA 2BTQB 4RCVA 3IB3A 1JHPA 4QAQA 4I9UA 5FLKA 5CITA 2WWXA 1AKRA 3TTVA 2O8FB 1J3LA 5KYUB 5DYIA 5FIUA 5H4HA 4UBJA 2PGJA 2ZYVX 4YMTA 4MLPA 2NZVG 3PNKA 4U00A 2QP3A 3OCZA 1PK8A 2EZ8A 3SKXA 3DL0A 3AVYA 2NU6B 3T3NA 1JHXA 3DMRA 1QHNA 2WYIA 3L1VA 2JRCA 4CDRA 3U37A 3CNNA 1PN3A 3TLZA 5IJ9A 1D6NA 4LWPA 2UYQA 3QHQA 2VUIB 3UG7A 3KP1A 3PBKA 3MYRA 4MI1A 4H2DA 4GRIA 4H17A 2JGMA 5KQGA 1A8IA 4ESEA 4IDCA 3FYSA 2P2LA 4F9TA 3B12A 2ZZMA 4WN9B 3FDZB 3E9MA 3N1UA 1YJAA 5IMBA 4A8JC 2FFHA 3GLHE 3R3WA 1LPOA 4BZQA 1NY5A 1IY8A 5EE5B 1IK4A 3THWB 1L7AA 1A88A 2VJDA 2PD4A 2ZBRA 3R7NA 2R6GA 4RM3A 2C92A 1S2MA 1J8YF 3E9NA 4RO0A 3UVEA 4H16A 4OP3A 5EKUA 2ZYDA 2VDNB 5LQSA 1S3FA 3VYWA 3WGHA 3PEYA 4MYCA 5IEBA 1V47A 2WJ6A 3GEIA 3OO1A 1OZFA 4RETA 3TE6A 4C88A 4OHYA 5LQNA 3HNOA 4U2GA 4HDMA 4I4TA 2YFHA 4BB0A 1TUBA 1DFHA 1OZHA 3LPNA 4FS3A 3ZLVA 4OQQA 2C7QA 4CIVA 2PUGA 1H69A 4XWWA 2HMVA 1YR6A 4XASA 1HLFA 3V7FA 1D2AA 4WKOA 1B73A 1SUBA 3IXMA 3GJ5A 2PTHA 3N3AC 1E6WA 1JXMA 2JFGA 2OHGA 3AETB 2EW2A 2GTPA 2ORWA 3QOXA 5DRYA 4JR1A 3IAUA 4YB8A 5CNIA 5JS1A 3IP1A 3L5OA 4HEQA 3OCCA 3QWHA 4XI9A 1OH8A 2VA8A 2ZIXB 4DQKA 1G7SA 1U3GA 5C37A 2Q2NA 1Y6JA 4BDSA 1K5GA 1N7HA 3JASB 1Z33A 2DBVO 2JBHA 1PJCA 1G6Q1 3COPA 4BNMA 4ARZB 1XZLA 3EN0A 5F78A 3GXOA 1G66A 4MW0A 1E3JA 2AT1A 2VK8A 3TOSA 1KDRA 1L4LA 3RRJA 2IH2A 4IQGA 4ZT4A 1GUYA 5FWXB 4N5NA 3RJTA 4TXLA 4UFNA 1CUXA 4INAA 4XSVA 4GSYA 3ENQA 1JFTA 3EJWA 1G8SA 1GXSA 1H8EA 2PSFA 4TXMA 3KQHA 3HB5X 4RLFA 4FZVA 3KHTA 4B3JA 2PJDA 4QTZA 4V0QA 5AJWA 1TJ3A 2WD7B 2I87A 3RVSA 1KFKB 4QJ5A 1BNCA 3UWPA 1PGOA 3OIGA 2JKVA 2VTVA 3EUFA 1JR4A 2ZDGA 1HFKA 4HDRA 5GJVC 3GN1A 3IHLA 3EIFA 3LLVA 4ZAYA 1F17A 1R2QA 4B43A 1Z7GA 3GOHA 3KJNA 3P4UA 4U7JA 5TQVA 1T1IA 3RFVA 2QTVA 4CPDA 1TF2A 3O8RA 2J45A 1RQLA 5DN9A 1J70A 3UB4A 1BRMA 4RJTA 3N53A 3PNBA 4YRPA 1J5PA 1N34B 3PRYA 3DB2A 1ZGGA 1TIKA 3Q2IA 3OUUA 1B7GO 1P9NA 4CXMA 2WKPA 4Y6SA 4XX0B 1YVEI 2XSZD 3O93A 3U4QB 4PSCA 3WLIA 3PQ8A 2JJ2A 2QX8A 1X15A 4RZ3A 4D6XA 5B7NA 2R6AA 1SG9A 3A3KA 4G67A 4PANA 1DT5A 4ETNA 2ODWA 5IX8A 4PNPA 1JLKA 4TUYF 5GONA 3EQ9A 4ITUA 2FPIB 4KN9S 2FQQA 2V7VA 5H70A 3GUUA 4B8ZA 1G8JA 3FR7A 4PO1A 1COWA 4G0XA 3H5AA 3I61A 4F96A 2C29D 2R8OA 5KCMA 3DT6A 1D04A 1J7JA 1ADGA 1MO3A 1NF3A 1NUPA 1P1FA 2NVUB 3TB4A 2ZE6A 4JITA 3ZK9A 1WMDA 4KB5A 4LOHA 3G2MA 3PFGA 3GFOA 2GPSA 4MGYR 4OYYA 5JH7B 4YONB 2XE6A 4HDKA 4A92A 1JQ5A 1TIBA 4LRQA 3PLAE 4EY7A 3IKMB 3OE7A 5ALEA 3K0HA 5EE0A 3DF7A 1ES9A 4PLPA 5LQRA 1SBCA 3O92A 3EIXA 4OK5A 3OLZA 4G0MA 4N49A 4PINA 4TWBA 4E3ZA 4MIYA 5LA6F 1TM1E 4MR9A 3EE6A 4E31A 5CVTA 2OCDA 3L0DA 4ZANA 3KQNA 4KKVA 2AD5A 3AEUB 1TO6A 5K3EA 2Q28A 1QOQB 1ZH2A 4ML3A 3BBLA 3GMSA 3NWEA 1Y7PA 2H7XA 2R4QA 4RD1A 3GJRA 4FYYA 5I9TA 3QKWA 1K66A 3FKSD 2CZCA 4PSKA 4AZ0A 5JJBA 5F23A 2A4MA 1GSOA 3LCJA 2XT9A 1FOEB 1U8CB 2AS0A 2NXJA 2VWPA 1Z6GA 4J75A 1YSCA 2J07A 5DBHX 2ZK7A 1MR3F 1T2AA 5ALMA 2QRUA 3GY0A 1KHHA 1M3SA 2IWHA 2C59A 1N0IA 3GH1A 1V5GA 4KC0A 3IP7A 1CHNA 3L05A 4Q18A 5E9QA 2ORIA 3FYCA 3WTBA 1E79A 3HJNA 4Z4EA 3NBXX 4MPDA 5C8VA 2E55A 3HVKA 2YZKA 2YMPA 1TKBA 1ZXLA 2BFEA 4G65A 2O8CA 1PL6A 5FV7A 3R7FA 2QY6A 3IDAA 2WWRA 3CG4A 3HB1A 1JU9A 3N7AA 1RWBA 4UOQA 4OQEA 2XDQA 2JARA 1KBLA 4FQ5A 4X6UA 4XQ0A 3UJPA 2JCXA 4A73A 5KOJA 4M54A 1HNZB 3DWEX 3D6HA 5H59A 3ZD8A 3NTQA 5CA0A 3B70A 5H3HA 3LPDA 1KC7A 1G8YA 5EP3A 2QGNA 2AX3A 1HNNA 3BK2A 5IVPA 4LF4B 2Y77A 3HYSA 4RAQA 3PDIB 3BH7A 4P4DA 1QV9A 2JL1A 2Y9MB 2VG8A 1VZ2A 2IYWA 4TN5A 2E1RA 4F46A 5EY5B 2BHNA 3EYAA 3FFTA 1DQNA 3TNLA 1EE2A 2IUYA 2MMGA 4MQ6A 4EPWA 5KYNA 1V16B 4V3BA 4E70A 3FLEA 3FPEA 1M2WA 4WK4B 4UUMA 2HGSA 2FEXA 1GPNA 1MT3A 3RADC 4S04A 3PK0A 3MF4A 4RDXA 4DYHA 1D2CA 2Z4TA 3HYTA 4MWDA 3WX0A 2GBIA 1VI4A 3ZW8A 4XB2A 1Y8ZA 1X86B 3Q8WA 1VIYA 3LXMA 3P9QA 2Q3FA 3AKZA 4YO7A 2QB5A 4R16A 3RKSA 3EEOA 1B93A 1FYFA 1AURA 4RF5A 1KDOA 3CRZA 3H0CA 5JVDF 1UJ5A 2G9RA 4JC8A 4CUKA 3EXFB 1E1DA 4LSZA 3FZGA 3RUEA 2Z6VA 2NZYA 2BMJA 5EXPA 2HSDA 1J2UA 1RI3A 2CF5A 2W2PA 2YWCA 3A25A 3CN7A 5TJHA 4V1CB 5K5EA 1PQYA 3DCNA 4WOPA 2L69A 5E1OA 3U7QA 5JANA 4XPIB 1XZQA 1XAGA 2DQ4A 3Q3IA 4OJNA 4URWR 4V2UA 2V7QA 4ZO9A 2VZEA 3KV1A 1D7AA 4AKIA 1O1YA 5FR2A 5BV2P 1BX1A 3OEEA 1N2JA 1RLIA 3LKVA 1X7XB 3TPFA 2R68A 4P3PA 3ZI4A 1KARA 4DLTA 3BKXA 4YJDA 2BLNA 3R0VA 1WKCA 4RPKA 5AVXA 2BRUA 1R3UA 3BCHA 4IKOA 4EDFA 1Z83A 4E30A 4Y9SA 2IHTA 5CCDA 3A1NA 3GEGA 2Z3VA 1JLMA 4DNPA 1WY7A 2IPMA 1Z56C 4UHHA 1AF7A 3B1XA 3V34A 3J81k 3LLCA 3I2JA 3BXHA 2WM2A 4C85A 4L78A 1CRZA 1YASA 3RS8A 5H1YA 5JD3A 3JQRA 4PF1A 4AKGA 2GVNA 2DX7A 3FTEA 1EESA 2QTBA 4B6OA 1WY5A 3T9FA 4C89A 3H6HA 4WAUA 1U8FO 2XDQB 3D3QA 3K1AB 4OXQA 2CLDX 2F7SA 3Q3JB 3OOSA 4EFMA 1SXHA 4FDUA 5DK6A 3MRSA 3VGPA 2EJCA 4LQ4A 5L3QA 2Q0QA 1P29A 4Z0PA 2WP8J 4KVAA 1KOGA 3AVWA 1TJ4A 1QLWA 2PMBA 3FOEC 1JV2B 1KWKA 4YBRA 4Z49A 4MRNA 1JN0A 1A9OA 1SXJC 5DW0A 4H0FA 4UASA 5JDCA 5LKRA 5CD1A 2W4IA 3DC2A 1VXOA 4OV6B 2EWMA 2XVMA 4FWIB 4MWSA 4W8HA 5F1PA 3EGXA 4U7FA 2P0EA 1O6ZA 2NGRA 1GTSA 1A5SB 4JC5A 3D7LA 2PRZA 4BNHA 3ONWA 4IUBS 3E27A 3X1YA 3HNPA 4FNGA 1F48A 4WOJA 2XQKA 5JD6A 3MAGA 3GD7A 1NR5A 2HSWA 2Q27A 3LYHA 1V39A 4Q4JB 3VTFA 3O8DA 2XX3A 1U1FA 2XF2A 2PJRA 3KWFA 4X91A 3U1BA 1L9KA 1X2EA 1ZL2A 3BFVA 2C0CA 2WQZA 3AV3A 2HA3A 4Y9DA 4UQPA 5CURA 4AG5A 2PX0A 4U0JA 1LUAA 4RIHA 2X0NA 3OE7D 1TM5E 2QN7A 3QY0A 4Q5IA 5BPHA 4LOIA 4NFLA 4KR3A 1RP7A 4RIEA 5FOVA 3HY3A 3BB4A 4GYKA 2O0LA 1Q0TA 5CA1F 2SHKA 1U8UA 1MT0A 2HDHA 4PX2A 3RU9A 3KKPA 3MJTA 4R2IA 1K0UA 3QHPA 1XF1A 2I71A 3BDAA 1A97A 3H2ZA 4KLNA 4NCNA 4A5SA 1E2DA 3E8XA 1R9NA 1L6RA 3EC1A 4DSUA 1V1RB 2ORVA 3TLGA 1HMYA 1LLFA 2BEVA 1BRTA 2IYXA 3HP1A 3WRXC 4AMYA 6AT1A 1LK7A 3GT4A 2CMGA 3T05A 1YRWA 4Q9IA 4M55A 4Q9JA 2FWJA 5AI8A 5JO9A 5JYBA 3VZSA 4R2KA 1WD7A 1M54A 2FWIA 3V1LA 4KYVA 1H3FA 1JHDA 2BHLA 2O2YA 1IG0A 1U2EA 4HDMB 4JYMA 1SURA 3LK6A 5EZ5A 4D43A 4GPIB 4QHYA 5P8WA 3FPJA 1DJLA 3QNMA 3K0FB 2OBBA 4X7MA 2RFLA 4NRDA 1YNSA 2VYFA 4WZBB 5JCJA 2GA9A 4NBKA 4NU6A 2QL6A 1JKXA 1O0SA 3QTBA 4DTCA 3MD9A 3NDRA 4XRGA 1RWWA 4F5YA 1NU6A 2Y1EA 2VHQA 2ZLBA 5B4UA 4QNMA 3RYCA 3I5YA 2X4GA 1F38A 3AEKA 1HBJA 4GXNA 4PC2A 5KWJA 1GNLA 4FOOA 2CNNA 2VSXA 3L04A 4LNUA 2VCHA 2JIQA 1ZISA 4RWEA 3ZHTA 4PLHA 3VR2D 3HPQA 5CA0B 4KRGA 1RQGA 4FPXA 1CNMA 2KM1A 4GWLA 3REOA 4IWYA 1SUPA 5A6SB 4IX9A 5JAUA 3T0IA 3ED1A 4LG1A 1ST3A 2GCOA 3EUAA 2YYZA 1CULC 3KQSA 2GESA 1EK6A 1TMKA 1NJ1A 3PC8C 2YN2A 3KKEA 3IVRA 1DQSA 3MUEA 4QSHA 5FFFA 4YX9A 2CVHA 4JB2A 1YZHA 4X00A 3H9UA 4DKXA 4FDLA 2ZRPA 3W0LB 3TECE 3PQEA 3I6ZA 1E18A 1LY1A 1ORDA 2PANA 3LL4A 2ZGVA 4OQPA 4YLYA 3ZR4B 5JYCA 1J8MF 2C3YA 1DAGA 2JAPA 4MKFA 2Z8XA 2FU5C 3W06A 1FNMA 3F8WA 4GOND 4AL4A 4CQMD 9LDBA 3CH4B 3QBJA 4QEZA 4RNDB 4UAUA 2EWWA 2I2DA 3ZUPA 1E5XA 1JU3A 3BWXA 1M6HA 4UUQA 4TL6A 3OP4A 2DIKA 4TMXA 2QGFA 2NZ8A 3OTGA 3NATA 4FSHA 4NH4A 5I7WA 3TG2A 1KMHA 1P2UA 1T0HB 2I1LA 3GAMA 3Q10A 4EO7A 1B2RA 1CU1A 5EKTA 1QMGA 2P5YA 5KJEA 2I7VA 3FWNA 4D4JA 1R5OA 4HZGA 2GPYA 4BQOA 3UWDA 4YMGA 4PHCA 2JG3A 4KAAA 4F2GA 1OYWA 1FZTA 4IOMA 2H54A 1JA0A 1FXWA 3HCEA 4CNBA 5SZJA 2CFIA 3EGCA 2JCSA 1XXLA 4BJHB 1GG8A 4C6HA 3B9BA 2Q5EA 2FSIA 3RAEC 4F9EA 2D5IA 1U7HA 2IYSA 3DAOA 1U63A 3ELDA 3GYBA 4JBYA 4P80A 5IXYA 4OJYA 1PNOA 3PCTA 1KSJA 3KVNA 3E81A 1GQQA 3NEYA 4CL2A 2H3HA 4Y2PA 4KOEC 5JU6A 3RLIA 2R1TA 4D3SA 1JDNA 2ZU6A 4CI9A 1V16A 1XYGA 1EEXB 3CR3C 1LW6E 1NMYA 3E9DA 1XK7A 3I30X 4EGQA 5AVVA 3WSWA 5K2MA 4J3NA 2ZYRA 4KE8A 2J3MA 2DOKA 1ZMBA 5DYTA 1WEHA 4Q3NA 1C7QA 4IIHA 3RS0A 4TMWA 2QUKA 1JS1X 1F8XA 3KYCB 4GLOA 4HAUA 1FX0B 1OBFO 4PZYA 1ZUNB 7YASA 2HH9A 3HBMA 3D0RA 1I2ZA 2DR0A 3H4TA 4US0R 5HCIA 1RM4A 1QX3A 2CEKA 2M98A 3O95A 4OKIA 5FPPA 2FN7A 2J8ZA 5J40A 1PJTA 2AK3A 3RVLA 3IT3A 4EJSA 5ESWA 2FSUA 4J7CA 2VF5X 3MT8A 4GI2A 4EW1A 4G0VA 1REQA 3KVVA 4NP6A 4R1QA 1S9DA 3V5NA 3ZE8A 2Y1OA 5ITZB 5LZ7A 1KJ9A 4REQA 1QVAA 1YRQA 1N3LA 1Q21A 2XYQA 2JDID 3FCEA 2VYQA 2YV4A 3LBNA 1BZYA 3SHTA 2A7XA 3FM9A 4KE6A 4BBAA 1I2AA 3O26A 1KPIA 1JLLA 4L0QA 4QUAA 3C6QA 4G8JA 4ETMA 5MF6A 5DMXA 1RC8A 5KTSA 4ND3A 1TO1E 2VF7A 1M6EX 4RGBA 1NUUA 4YP9A 1LI4A 3D3WA 4TTQA 3ZHCA 3IV7A 1AH2A 2X0IA 3UYKA 3ZI0A 3BHNA 4BKOA 1EH5A 5C7LO 3F8TA 2EERA 3L92A 3GLFE 3U5ZB 2JJQA 3L4BC 2HRBA 2HROA 3K5WA 2I2FA 3BL6A 4EF6A 5T6BA 5CD9A 3EOAI 3MRXA 4NDZA 4QODA 3SVTA 4AS1A 5BUQA 4LPKA 1LDMA 1EX7A 4JN6B 3VM6A 1QOPB 1HFJA 2HA0A 5HZMA 3AI1A 5TPWA 2C00A 3B7WA 1SXJB 2FMIA 2GD6A 2ZE5A 1M83A 1Y5NA 3L8DA 1ECJA 3QU7A 1F9EA 2JJ2D 3AESB 4MVJD 3ZVLA 3F0TA 4G23A 5HUJA 1W49A 2FQ1A 1Q6ZA 3WYCA 1EUZA 5FP0A 5GVSA 2XAAA 2IHNA 5DHFA 1Q1EA 1VE1A 4PTLA 5E6SB 3UHFA 3UHJA 4P3NA 2XXAA 5KI6A 5IPFA 3ADCA 4KXYA 4QTUB 1DUSA 1ISJA 4HAZA 4Z54A 3RC8A 2G3YA 3MCWA 1MBZA 2OV2A 2D0PB 1MC8A 1UBEA 4MRPA 2D8MA 3LYAA 5HDBB 2QV0A 3B6MA 3F90A 3KQOA 1I4LD 3GJ8A 1SBNE 3WE7A 4TT3D 1A7JA 4EUHA 1RTTA 1NTRA 1WV0A 1LK5A 1PAUA 3GPIA 3QVOA 5D7BA 2HQ1A 4O1MA 3UF0A 4Y2GA 2ZUFA 1IJEA 4LXQA 2RG1A 3PJGA 5ALPA 3W3AD 1PT7A 1ESNA 4F4UA 3I2IA 3SQLA 3UQZA 4F97A 1WBJB 3VI3B 3ZWAA 1V5EA 2QZPA 2R1VA 3DPUA 2E6UX 4MV0A 3BGSA 4UW9A 3QKUA 4CIYA 5LMCA 4F2PA 2N1BA 1PKXA 5DPMA 2W5UA 4NX2A 5MDHA 1LQTA 1MU0A 1QGYA 2FOIA 1NX9A 2ZWPA 1DXHA 4B83A 3KAQA 4YCCA 3DDWA 1LDYA 5DE3A 4EZIA 2JIBA 3OHSX 2W71A 4BRUA 2F59A 2QENA 2XWJI 4IR7A 5L6MB 4CM8B 3S55A 1D9XA 3SJBA 4LYAA 4UPDA 1UZMA 3HCWA 3EQZA 4C43A 2HX1A 4FE4A 2XNDD 4J0EA 1CF4A 2IHKA 5HJ2A 3KKZA 3TZCA 2TS1A 2Z5FA 2GK7A 3QUSA 1MB2A 3UNXA 4EMBA 1W1WA 1KMMA 1GL7A 1P72A 1SVWA 3HWSA 4N8SA 4TMVA 1E9DA 3NHWA 4BV8A 1B42A 3GIWA 1G2OA 1I2DA 2W2VA 1PSZA 3NGMA 1E9RA 4RVCA 2JLUA 2A9OA 2RARA 3A58B 1LPPA 4UJ3A 3TFQA 3LK7A 2IQIA 1AQ6A 4R9SA 2OO5A 3ZLJA 2OILA 3DHEA 2B0JA 3FX2A 4BFXA 3L49A 4P44A 1CY2A 1IM2A 2M1XA 1P6QA 3P9YA 4G5XA 2XXAB 2H1HA 1FS6A 2PEZA 3AR9A 3OZ7A 1KAMA 4R6XA 4KLCA 2ECQA 2IU3A 4D74A 5THQA 2OG2A 4G85A 3ZX4A 4JJAA 1FXSA 3VAZA 2I1VB 1ZPDA 1ZM3A 4MDEA 2AG0A 3LNCA 3N2KB 1EJ2A 1P33A 3QUQA 4M83A 1ML3A 1PNQA 1U31A 2GPTA 4G56A 4NBWA 3TYXA 3GD5A 1SXJA 4DG8A 5IN4A 4JL6A 3ZGOA 4DAOA 5BR8B 1TYEB 4B31A 4FT4A 2BFMA 4LY9A 4CTMA 5EIEA 3LIIA 5DHQA 4Y9RA 5KNBA 3KFVA 4XRRA 1UKCA 4BO0A 4HWGA 2FRVA 4R8SA 1ISPA 3A6GA 5AKEA 5BQ5A 1T9DA 2A4KA 4FFPA 3H87A 2NTJA 2OFXA 4WK6A 3TXXA 1MW9X 2NZJA 2OV8A 4XM2A 5LKAA 3HU3A 3EA5A 2ADFA 2P9GA 4I4TF 4EI2A 2MR6A 5B7GA 4MULA 2PUEA 2PBFA 3OOYA 1KO4A 4X45A 2O06A 2R3SA 3C3WA 3COWA 4A2QA 1MEOA 2FUNB 1E59A 1PT6A 1QK5A 2I66A 2P6PA 2V03A 3HFGA 4NJMA 1M1NA 4OLJA 5HVNA 3T6KA 1HSOA 3OQIB 1Z5UA 2IKSA 3QE4A 3ZCPA 2Q5IA 1H0SA 3DBVO 3VC2A 3KM0A 5T41A 4QPCA 1U94A 2FWPA 2L17A 2GM5A 3KAPA 3QY9A 4M1TA 2J4CA 4N01A 5IUJC 1ESEA 3C6XA 3R6TA 5K8TA 1USVA 2XXBA 3JARB 3M9WA 1HL3A 1IBSA 2GFHA 1NUQA 3EHDA 4UEJA 1HNXB 2WM8A 4M1KA 4NBRA 5GP1A 1KPHA 2XGSA 5HF5A 3HUEA 3WL3A 3AVUA 4CDKA 4BVAA 2GCNA 3FIUA 1TQ2A 1HA3A 2HADA 1PFGA 3D2AA 3O4RA 4IDDA 1GCUA 3IP9A 2Z43A 1SHUX 1RJWA 3DL2A 1PQWA 1TZKA 2JFPA 2OZPA 3A6DA 3GJ7A 3IUYA 2A9KA 2NZXA 4FEAA 4X44A 5E1DA 3K35A 4RA9B 5EXDA 3JQGA 3G2QA 4OLHA 5IC6A 3WTCA 1Z45A 3B3FA 3OAAD 4NBLA 4Z7QB 4JJFA 2PT5A 2WIDA 3P9ZA 5KJ6A 5BNFA 2NO6A 3LP8A 3OZTA 4NZMA 2AXPA 4L8YA 4R2HA 3M5CA 4GLBA 3K9WA 4AIIA 4UMFA 3I9OA 1IHYA 2IY9A 3PC2A 3VX4A 4F3CA 1RWKA 4NYMQ 3RAGA 1Z63A 1DC7A 1E3QA 5CX4A 3ZDEA 1X9IA 3ABSB 4DTIA 1QV6A 3UFXB 3FHCB 3MCVA 4RQBA 1ZM7A 4UAGA 3QFFA 4XQCA 5IN5A 1A3CA 4RTJA 4MCRA 2HK7A 2JHCA 1GKLA 4CM6A 1U2GA 2W0MA 1XIVA 3GJSA 4KDRA 5CJPA 1EWRA 4K0RA 1U9JA 1ZA1A 4TRNA 1BE8A 1OAAA 1PFQA 2CEAA 2DJ5A 3B9RA 3QX7A 1T5OA 3DCYA 4O2LA 5BV7A 2ONYA 4KE9A 3GJXC 3IHKA 2BR5A 3UJ8A 4UUAA 1U1IA 1QUEA 1Z2PX 2Y4NA 3NPAA 4YRJA 4X8HA 5JNUA 2IEAA 3WLMA 5FNVB 3ZGNA 3ZWOA 5DM4A 4OHBA 4IO1A 4DMHA 1XTUA 2W43A 3DTTA 5B64A 2A9PA 2ZYTX 1V9LA 4PEVA 4QDUA 3W5UA 4E33A 3QSYA 2EU8A 2HUNA 4F9FA 3NB0A 3KUDA 1S02A 1SPXA 2BFDB 3A1FA 4YNBA 1O3YA 3WJAA 2J48A 1QKIA 4ISBA 4NMXB 4LZZA 2GN2A 1FRFS 3UC9A 3LYUA 4FB5A 1ONSA 4ZREA 3HCRA 3BJEA 2WZDA 3DZKA 3KAJA 4ENUA 4KV9A 4P8RA 3HXTA 4FFWA 3ZS8A 4BAZA 2YJ5A 4C8CA 4RPCA 4OA5A 1HUQA 2QW8A 2ZI5A 2PBLA 2ZUUA 3WLHA 3JQAB 4QT4A 2WG0A 4FYWA 4UEOA 3ZE0B 4F8YA 3ESQA 1RMYA 3FYUB 3HJRA 3HABA 3WK4A 1LJ8A 1IBKB 2O5CA 1JLHA 2AIRA 5HS4A 4JB8A 1I13A 2VH5R 5KTPA 2ZYSA 1SCNE 4UAJA 2QJWA 4MVJH 5AM1A 4BNKA 5C1PA 4R84A 4D2IA 4MRMA 3IKTA 1EFUA 3NYQA 4UMVA 5AKLA 4BNVA 1Y5LA 3R3YA 4CQLA 1S2LA 1U4NA 1DIBA 3A6EA 2R5WA 1YI1A 3SFZA 1DU4A 2WP0A 2WJ4A 3IUMA 3PRJA 4ZYTA 4OHMA 1WQ1R 1VCHA 1LFAA 2W37A 2WUGA 3PFFA 4L28A 1IONA 4LRXA 3VNVA 2D8AA 2PJUA 2IIQA 3WQHA 2DPGA 1E5DA 5LA6A 2ZYGA 2QSYA 3RIYA 3TL2A 2EXXA 5SICE 1F4VA 1XPJA 5DGIA 1QTRA 4ZJYA 4YAIA 4DDMA 3KJEA 3C39A 1JFVA 2JGIA 2GARA 3QXXA 5REQB 2FOXA 2QG9A 2F00A 3NHPA 4HK4A 1FFXB 2ZVPX 3I34X 2FZCA 4LYFA 4NBUA 2NP7A 3EG9B 3P26A 4CLHA 4B3HA 4PRYA 5KVCA 4GR5A 3W6OA 2CFOA 4X66B 2BFFB 4IFBA 4HLDA 5E3HA 1UFVA 3R0XA 1IBRA 1WW3A 3LT5A 3S1SA 2C9MA 2ONZA 5IBQA 4EY5A 1X1AA 3RT7A 3MWEB 2BTOA 2RGEA 5INTA 3UT6A 4BFWA 2KQUA 4LC9A 2ICAA 5CXUA 2O5RA 3HR8A 3ORSA 3JQFC 1ENZA 2W6MA 3HVHA 2XNSA 1H23A 2X13A 3HO6A 1CJMA 1K8YB 1USWA 1YRLA 1KGSA 4N5LA 1AUQA 1KDYA 1XD8A 2IYQA 2ZSFA 4PG7A 5JRZA 3TRDA 1IY2A 4E3WA 2BMDA 2VXOA 1F2VA 1HMPA 5A7GA 3M6WA 1K4MA 4WESB 2VTBB 3T1TA 2WVAA 1MIOB 1M73E 1GPWB 1WCXA 2P2ZA 4ARAA 5IS2A 1J2RA 4BVBA 1T9GR 3H1PA 1VYUA 1Z0KA 5EPEA 2QMHA 1I36A 2MCFA 2E9SA 5GWXA 3TXYA 1Z4MA 3V1TC 1QTNA 3LCMA 3NORA 1KGDA 4G0ZA 1NBEA 3GEBA 1DTSA 4PGAA 3TQIA 4C0WA 3DFUA 1LC0A 1WZEA 1XVVA 1DZ3A 1GTG1 5K8IA 2AYXA 2ZXEA 2O23A 4FZJA 4S35A 3ZE7A 3L1JA 4NV0A 4E1VA 3NKFA 2CLKB 1PG5A 1AD2A 2VJPA 1VLHA 3FUCA 2CNBA 2IBTA 1KMIY 3G7UA 3JZIA 4JT8A 3RYIA 4G3XA 3KTDA 3UBTA 1JMYA 3MFQA 1M72A 1UBKS 3KB2A 1ZX1A 3FBWA 3L7CA 3OZGA 2M6SA 4ZI3A 4W5RA 5M7EA 3E23A 1C4KA 2WPDD 1PLLA 5IHXA 1F4PA 4G4SO 4TWZA 2HCTA 4ESOA 3GUHA 4CDMA 5BVGB 2OCGA 5AWFC 3WK7A 1UJ6A 5HGJA 4YUAA 4NGNA 2BM0A 3DFFA 1F9AA 5KMGB 3OH8A 3RYCB 3MGCA 2EX4A 2G9QA 3WYGA 5E0OA 2PLRA 5K6TA 3VSAA 4XSHA 1C4OA 3OJWA 2BI8A 3DWFA 1LTQA 3FPSA 4JSYA 4YEDA 2PWZA 1KZ4A 3DUWA 2J0VA 4B7XA 2TMGA 4HH4A 4EELA 5IBPA 2OKGA 1PNRA 2PXXA 2NSHA 4X60A 1T5TA 3LC7O 3OJCA 4FW8A 1V96A 3PR2B 5TVGA 4DLNA 1SVOA 4YRCA 1TM7E 3C7KA 1TLTA 5T4EA 3RJZA 5KWEA 1OTXA 2JBKA 1YOBA 4QGGA 2GAAA 1CZHA 5AW8A 5DWVA 2X15A 3GCXA 5EINA 5H3CA 3PYLA 2XVZA 3CFYA 1M5TA 3KALA 1GZHB 3KPWA 1NATA 4KSBA 1E2IA 1X8KA 3GDOA 2O20A 3TLGB 1Q2XA 2NXCA 4P84A 3UXYA 1M1UA 2QWXA 4J7XA 1BX3A 4OY3A 4Y2XA 1SUIA 2HQOA 3L8YA 4AF8A 3QE2A 3ZNOA 1VKOA 4Y7CA 2IX3A 3ROMA 5FWAA 1GA1A 1L1EA 1GVNB 1EFKA 2I0FA 5F33A 1ECLA 4LNAA 1L5KA 1E61A 3T9DA 2C54A 3K0CA 1FTGA 3G9TA 1X14A 2BKXA 3HO8A 3KDSE 1E7MA 2YMMA 4FMDB 4PYRA 2NXEA 2OUIA 4J16A 4L7QA 2QL5A 3F7MA 3HCAA 2QMEA 4OBXA 2BISA 4Q6BA 3ZZ0A 4E46A 2G28A 2YDYA 3ZQ4A 3GOQA 5HBGA 2AE2A 2J9XB 3J80A 3DE2X 1Y81A 3ZU5A 3W8EA 2YW2A 3ES9A 3COSA 3GGPA 4I55B 1J0BA 1DMRA 1TB4A 2R7NA 2RSLA 1JALA 1K5PA 4E0BA 2ORYA 2ZQYA 4J3FA 3KETA 1WJGA 1I5EA 1E1CB 3QKSA 1TK2A 2ACKA 2BKUA 2NUAA 2VT3A 4TM8A 5FI1B 1SXIA 1OI3A 4XVHA 1PT5A 1SC3A 3K5HA 2PM8A 3TGPA 2DFDA 5A7FA 4LCEA 2CFTA 3UJCA 1KAHA 1VLQA 1T3HA 1WHTB 1ZLYA 3IIEA 3L1IA 1F0KA 4WFQA 4BNIA 5T4HA 4F71A 1MVNA 1IB0A 3C24A 5HG0A 3DMHA 3C5WP 1ZDMA 1X6VA 3ONVA 3VU3A 1JVNA 1KTVA 4KSYA 1KC3A 1LWOA 3Q88A 4E5DA 1HF3A 5DCWA 3G68A 4N0EA 3GBVA 2XECA 4D3FA 1KDPA 3K6SA 3QX8A 1IUNA 1EP9A 1G5PA 2REQB 2X1HA 3C4JA 2R8EA 3E7XA 1ZMTA 2D1YA 3RBXA 3RF7A 1SFRA 1N4AA 1DQRA 5J43A 3T1YB 4GNRA 2WMDA 3WA7A 1P3DA 3PYXA 2OGUA 4HCJA 4HKTA 1PZGA 1D6SA 2FPMA 1PS0A 2OHOA 4HZIA 1RZUA 1SCUB 4MCQA 3IDSA 1VG1A 3QXSA 1MABA 3GLTA 4PLCA 1Z06A 3T1QA 4JJ8A 1CQIA 2ZJ8A 5DM1A 3MWFA 4B7ZA 5HRCA 3TDKA 2FX5A 4C03A 1ONNA 3NIBA 1QZUA 1BYIA 3DOEA 2YNMC 4MJ3A 4PGHA 3HBJA 1ZR4A 4NGTA 1BXZA 3SX2A 1KKUA 1NG9A 1N6NA 1ZRMA 3MWEA 5C1OA 4EF4A 1YQXA 3KV3O 2QR5A 4OU5A 1EJ0A 4R01A 3FROA 1HDYA 2FR8C 5CK4A 4BBZA 3L4KA 4RYDA 3UMYA 4D8VA 1ESMA 2QE6A 4BN4A 5DF1A 1UKVY 2CJPA 3FDXA 4D9JA 4DZRA 5E7MA 5B7QA 1U11A 5EP4A 3BJZA 2H48A 2H2IA 3I83A 4U2KA 5EI5A 4MPPA 1Z25A 4J1NA 1MIHA 3GO4A 4P3YA 1E3TA 4AKHA 2LZ0A 4C8PA 2OD2A 3HVRA 1ZD8A 2BGRA 1ZJWA 4C7MA 1PBTA 3MEQA 1UP6A 5EAIA 4EYOA 3OPYI 2G82A 3IWWA 3PF8A 2EHDA 1ISGA 2HF8A 3WGZA 3OT1B 5JG7A 2Z6AA 2J4FA 3I37X 2D1QA 2PUHA 1XTVA 5DHRA 2VT2A 4Q48A 4FOTA 3PKIA 1N5LA 3HC7A 2VYNA 4EY3A 1MXHA 1MZVA 2B94A 2QROA 2C5BA 3AF1A 3OF2A 1HEUA 2P62A 1F3OA 5D1NA 1K3UB 4GWKA 3KZNA 4JD5A 2GETA 1Z8HA 2VP9A 3NTLA 4C3OB 1RYFA 3G82C 3RS7A 3F5MA 1M8FA 4A36A 4G6ZA 1MZPA 2HSEA 3IO5A 5CA1B 5DVZA 1R00A 3SQMA 2H0RA 1KY5A 2QJTA 2WYOA 4L8GA 1QJCA 2QM3A 1FVXA 3JQ7A 4QZVA 1A2BA 3J7AC 521PA 3NC0C 5DM70 1OI2A 3I9MA 4GBED 4XZ3A 2PQ2A 2ZWVA 3FYTA 1E9CA 5CR9A 4X85A 3CV3A 4U3JB 4JJEA 3R5SA 3RK0A 3KQLA 2IZ1A 3GLGB 1JQLB 4NNJA 2B8WA 1FRNA 5TC4A 4DMKA 3GN2A 2W2NA 2GJ8A 1RYNA 3CRNA 4ZTZB 1AQIA 4HNSA 4IZOA 3N0WA 1V5FA 3CN9A 4L95C 3RREA 5FWNA 4TYPA 5C4GB 1CQXA 3F46A 2XEGA 3G1UA 1SMKA 4G0UA 2WV9A 2PUVA 3ND8A 4HDRB 2BFDA 4ZQHA 3ZDYB 3UEOA 1R5BA 2Q4BA 2QJOA 3RSGA 3ZHZA 4RCYA 2COUA 1A71A 2FJUA 3NM6B 3RRZA 1G3QA 4NCAA 1YRAA 2Y71A 2AFIB 4FCVA 3IAAA 4NAUA 2Q41A 2V59A 3SD7A 2X9QA 2EP7A 1OAOA 3KD2A 5CLGA 1J2JA 1ZSVA 3SY8A 1TFUA 1B4DA 5G41A 3NAGA 4FDVA 4ITRC 2NUTA 5KHOC 1S89A 3NIGB 4YJGA 4DDKA 1GP2A 1OHHA 1G18A 4K2HA 2WK1A 3DT8A 3UK0A 1NF9A 4FLEA 2IKQA 2A5YB 3OJOA 4M0DA 3PPYA 5JYDA 1RYHA 4URVR 1CZNA 4M22A 1QIIA 2WTBA 421PA 1GUDA 2FW8A 1NDHA 3PB3A 4N9QA 5ALWA 4MW7A 1XWFA 2A0UA 2HLNA 5AI9A 1FXUA 1GPJA 3U0VA 1BU5A 3ZPXA 4BNWA 4C2BA 4M8DA 2G06A 3KSMA 5AJXA 2E87A 1NXXA 2JVJA 2QUHA 3LQRA 3MB5A 1RW4A 3SJGA 3USCS 1Q0HA 3GV0A 3QVGA 1V6AA 4C4TA 1B8NA 8OHMA 3Q7QA 2B4TO 1N2EA 1Z39A 1M8KA 3HYLA 3LI2A 2RD2A 2JLWA 5K4GA 4MHSA 4MYDA 3N8HA 4ARCA 3OAAA 4I08A 3ND6A 4GP9A 4YRFA 2HFKA 3W2TA 5E0KB 1WMBA 2GSWA 3B6JA 3EF0A 5CP8A 2P2DA 1YTUA 4I3FA 1NBOA 4KPUB 1XP8A 5AVWA 4DNFA 2J31A 3D31A 4IJQA 5I48A 1KKMA 1A8QA 3ZZMA 2N75A 1PVVA 3B5JA 1DPGA 3RFUA 4INZA 1UDWA 4DCCA 4H6XA 1VJCA 2Y4OA 2YWDA 2IXEA 4MW1A 3W9BA 2OVBA 3IODA 4IRXA 1P81A 3OHMA 2DHDA 1LRJA 5J5AA 4L5CA 1NURA 1XAJA 3QNUA 4AP9A 4BJ3A 1E32A 3EJ6A 4KDCA 2EFJA 4M60A 2LR0A 3OPMA 2RHBA 4MAMA 4OI0A 2WM3A 4MZDA 4DR2B 4N7BA 2AEMA 5C1DA 1JEQB 3FCYA 4PU0A 5ADHA 3TRJA 1ESZA 4QAJA 5MN4A 1UT5A 2GERA 2OENG 4NHEA 1DQYA 4RS4A 3FHTA 1PKEA 1YL6A 1SCBA 1PIWA 2NV2B 4ZAWA 3I53A 4A23A 1H8HD 1SZJG 2VDWB 3CZCA 1NVDA 3S2YA 4BNFA 4BP8A 4UTRA 2YKGA 1JWLA 1M5UA 4DUYB 3SEZA 2EEPA 3UAGA 4P5EA 3DM5A 4DA4A 2Q3HA 1DO8A 3P2KA 4TZKA 2LNDA 1PZHA 5B1SA 3JCZA 1FA9A 2OCXA 3MJSA 2OHXA 3NYIA 2I78A 2X0JA 5BUZA 2H51A 2I1WA 3IVMA 1Y89A 2OFPA 1WZ2A 3HL4A 4JZ0A 3C3YA 1V2GA 4IGIA 2B9EA 3L07A 4RIGA 3MUOA 3OOJA 4EBBA 1ODCA 5CRIA 5JHGB 3MELA 2RGGA 1GZSA 3GJQA 3P9CA 4L76A 4MRAA 2XCLA 1OIVA 4NQRA 5FD8A 5DOVA 3UT5B 1O9HA 4HRXA 1NW7A 1S9HA 1MQSA 1XZPA 3L0ZA 1QF6A 4LQDA 3JR3A 4J7AA 1F2UB 1I3NA 2VNJA 5EE1A 2RGRA 1FJHA 4LTNA 1IN7A 1KAEA 1N0HA 1PUXA 3PHJA 3WDMA 3ZWMA 1RTKA 3STHA 4FP9A 1GAJA 2FGJA 2CUZA 5IDXA 4NFYA 4MUIA 3BXOA