4H1HA

Crystal structure of mccf homolog from listeria monocytogenes egd-e
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
327
structure length
327
Chain Sequence
SNAMIPAKLKQGDEIRIIAPSRSIGIMADNQVEIAVNRLTDMGFKVTFGEHVAEMDCMMSSSIRSRVADIHEAFNDSSVKAILTVIGGFNSNQLLPYLDYDLISENPKILCGFSDITALATAIYTQTELITYSGAHFSSFSMEKGLDYVMESFSDCLLQKEPFALKESATWSDDEWYLDQENRNFIPNEGLVVMQPGVAEGIIIGGNLCTLNLLQGTEYMPNLAGTILFIEDDFMTIPETFDRDLESLLSQPGADEIEGMVIGRFQQKTAMTAEKLAYIIETKTALQKIPVISGADFGHTQPIATFPIGGTARIDTNQTDKIQIIRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MccF homolog from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
molecule keywords Lmo1638 protein
total genus 107
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4h1hA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4h1hA02
3TLYA 4E5SA 3TLBA 5F9MA 1ZL0A 3GJZA 3SR3A 5F5XA 5K99A 4INJA 5FD8A 2AUMA 3T5MA 3TYXA 3TLCA 1ZRSA 4EYSA 5F1YA 3TLAA 4JVOA 5JYBA 4IIXA 4MJXA 4H1HA 4IIYA 3G23A 4MI1A 3TLGB 3TLGA 4E94A 3U1BA 3TLZA 3TLEA 2AUNA
chains in the Genus database with same CATH superfamily
4CKEA 3DZKA 3PUXA 2K6GA 4QDOA 3BD7A 2RARA 4UMDA 5AT1A 4LMAA 5DM60 4BLWA 2IS2A 1JKJA 1JKMA 2RK6A 4MLDA 4MLZA 1MXFA 3B3FA 3SR3A 5F5XA 2XSZD 1TAHA 3CXRA 3NPAA 1DXHA 3QI7A 3PQEA 4YC7A 2OHHA 1G7RA 2JCVA 4REQA 3SZ3A 5K3EA 1OFIA 3E53A 3NTRA 1QIFA 3VDMA 4WOPA 4V0NA 2QZZA 5U4QA 1Q1GA 3U44B 5GTDA 4BV3A 1U1FA 3G5LA 4LK2A 4P8RA 4RIGA 2CN1A 4OATA 1H9CA 1MIHA 1DXYA 4WZAA 3OC0A 4TVOA 1BS2A 4YCLA 1DWQA 1KZ1A 1JEYA 4WXEA 1QRUA 4BNWA 1GILA 1KVQA 1MB2A 4PQRA 1F1BA 1GSAA 1PIWA 3EGXA 3IT0A 1DO8A 1AXRA 4MULA 3VDXA 1N6NA 1JI3A 1YVUA 4HGPA 3DEIA 4QREA 1RMQA 4YUYA 1CX9B 3GUZA 3WYCA 4B48A 2XXJA 4B2PA 4PSAA 3A1WA 4Q4LA 5H02A 3IUEA 3R23A 3T12A 3FSGA 5UKDA 3WIOA 2GK3A 5JVDA 3RTBA 4XD2A 1B2LA 2G1AA 1UBEA 1GPAA 4OJMX 4CKBA 2UZ3A 3B6MA 4K3UA 1N5LA 1P2FA 2BFPA 2Z08A 3AF0A 4KQ1A 2YV3A 5FWNA 2GPNA 3R3ZA 2XQJA 1KOJA 4ZOQI 2JANA 3K0AB 2MR6A 1T1SA 3P2KA 3QI2A 4X45A 1EK2A 4NC9A 4DNFA 2AYXA 1V16B 3FYUA 5C52B 1RZRD 1P7VA 1PJ4A 4WBXC 1V6CA 2J33A 1I6WA 3KNZA 3E23A 3KS9A 5CVDA 4EG5A 2UZ1A 1IHUA 3W3AA 6REQB 1QGUA 1TW2A 4MS3B 4UASA 3G85A 4I1SA 3FUWA 3R0QA 4NBTA 5ERXA 4N47A 4BP1A 1GYPA 1Y63A 4KYUA 1YJCA 4MCQA 2IZ6A 5JATA 4PIMA 1TU4A 2UUPA 1QQ7A 3LY9A 4M9UA 3TIGA 3PJEA 3V2GA 1LUAA 1HEUA 1PL8A 4BNXA 5CXUA 4I0WB 5GM2A 2VNJA 1C81A 4ITUA 3H11B 1WVIA 1JQ3A 1ZCAA 3AVPA 4L02A 4UW9A 1KP9A 3LPNA 4TMXA 5D3ZA 2NT4A 5G3ZA 4D9JA 2AN4A 4CN9A 3QMWA 5HIIA 1Y8AA 1ATIA 1CZLA 3P71T 2QTTA 4Z1MD 4TMKA 1Q91A 4XFJA 3HACA 1CR4A 4HDMA 3WOVA 2C7PA 2OK7A 2XA1A 2Q8QA 3OPYB 3OCZA 3B9PA 5IU6A 5AK6A 4I1IA 5AXBA 1UMDB 1DAHA 4XW2A 4EG7A 1QF9A 5FBVB 4D79A 1V1MB 4YP9A 2J0VA 3K9LA 3Q9UA 4N49A 4ZQFA 4AMGA 3ZCTA 2O0JA 3KAJA 3EXEA 1KI3A 3KXDA 4N1AA 4ALMA 1RAIA 1PQUA 2MOKA 2WRZA 2YBDA 3FMFA 2GPSA 3LDHA 3GCGA 1UBKS 3GFSA 4MDEA 3H11A 2D1FA 2VYVD 1B4DA 2YNMD 3NV9A 4Z8YA 4DIMA 3KOMA 3LS2A 1AZLA 3A3KA 3DZHA 3M4ZA 4Q3AA 3M70A 4B7CA 2NXWA 4C6HA 3LXMA 4HSEA 1XN4A 2R8PA 1PNOA 3JZDA 3M1IA 3EVEA 4NZ9A 2UYOA 3Q7TA 4LE1A 5JXJA 1U8UA 2XQKA 1YR8A 3HLYA 1P0IA 3IVXA 3WZLA 5KZMB 2PWBA 2J5QA 2VJMA 4IZIA 4UJ3A 3SJAA 3Q3IA 3BMXA 1LNSA 2Q5JA 3NJ4A 4R1SA 3TVDA 3PHJA 4QLBA 2WJZB 2VYCA 3RJMA 5L3QA 3ECSA 4P4BA 3A26A 1DJPA 2ODTX 1YBFA 2WM3A 4K5QA 1XMIA 4OI4A 1B2RA 3GUYA 3TSCA 2C00A 2PZBA 3FNHA 2QZSA 3PHCA 2OKGA 2WG2A 5IJ9A 3HPQA 4M55A 3WYEA 1G5QA 2FFQA 4FNGA 3RF6A 2HIGA 3G0CA 3KTDA 3RVJA 1I1OA 4QUBA 3P2YA 4HWOA 3W3ZB 2C54A 4CLDA 4REQB 4OC5A 2OL4A 5GPBA 1ZZGA 3SJEA 3ZQKA 4H9GA 3GG9A 1KSJA 1GQOA 3JYNA 3ONWA 5EIHA 4AJKA 1Z12A 1QRDA 4D3DA 7AT1A 4JT2A 4M9SA 1I80A 2O8BB 2F48A 3RIHA 5E9QA 2GN9A 2GKSA 1USKA 2YXDA 4ZV7A 3N0RA 1DIAA 1BEEA 2PBFA 5DMHA 4C0SA 1JDEA 1YS6A 2FP3A 2J8ZA 2YHIB 1RRCA 4G1MB 4MAAA 1PFGA 1YONA 3NCTA 5FPYA 1RYBA 1QE5A 2QD4A 2W6PA 3UTDA 4NJMA 3IV9A 4M7RA 3RS3A 3MSCA 4I55A 1QRTA 1E9BA 4ROSA 4LGVA 4OEHA 2XKAA 3QVJA 3TNYA 1G9TA 1EXMA 1G66A 3GELA 4CQMA 4JV5B 4CIXA 1N6KA 1FYEA 3IS3A 1BQ4A 1MC8A 3M1YA 4C5CA 2D0PA 2GCIA 4K6CA 1WQ3A 2PZEA 5HFNA 5JW6A 5WRFA 4AIIA 2W2PA 3GHYA 4ZOBA 2XAUA 1NBEA 4DDKA 3NDIA 3IAUA 4DCJA 1EZ1A 1DCTA 1VPLA 1GGOA 4XPIA 4DREA 5B1YA 1P62B 3RFCA 1C3EA 2JH3A 2BFDA 1KTVA 3KVOA 4X20B 3G02A 3EOAI 2C98A 1YIDA 4TQ9A 5DM4A 3IPAA 3GFQA 1J97A 1P8AA 3PQ7A 4KX3A 1YB4A 3OIYA 3H19A 2ATIA 1BHJA 1G5PA 1C3LA 3IERA 2C2WA 3SEQA 3LE8A 2HJSA 1YE8A 1SO8A 2C4MA 3T3NA 3ZZ0A 1ABBA 1Z5UA 3OX2A 5ALGA 1YC5A 1WMFA 1YZGA 3KZKA 4MVJM 2O7SA 4P5EA 4QSMA 3ZG6A 3ZY6A 4F9EA 4X94A 2HT1A 3L7CA 4QUKA 4LRWA 2CB0A 3I4LA 4MKIA 2YV2A 3DTTA 4LYJA 1JMKC 1X7HA 1AUOA 1CRLA 2E2WA 3FZEA 4UQOA 3PQ6A 2OCYC 2ES4A 2XECA 4PICA 3BK2A 2RHMA 1U8TA 3AFMA 3DVAA 3JVEA 3LT0A 3D31A 4KKXB 5AVTA 1KJZA 2R85A 3K5PA 1GDHA 3JQ9C 1E1KA 2BL4A 1B1AA 3K8YA 4KQ2A 4EECA 1YMUA 4R0VA 1ZIYA 2JLQA 2QD2A 5ELXA 3L18A 2NAPA 3DDHA 1Q7GA 4C8AA 3C8HA 4LAFA 5DM1A 5IAOA 2AK2A 2OQ2A 3E8MA 1AIPA 2FF7A 1N2SA 1O5TA 1FE8A 1KQFA 6GPBA 3EGOA 4CTNA 4X1OA 3RC2A 1GPUA 3EGIA 1FDTA 1NNUA 2BGTA 3OOJA 1XDBA 1Y1PA 3PR1A 4M1OA 5H68A 2V7EA 5KC9A 2WIGA 4FFWA 3VNRA 4M7PA 1Q6ZA 2VDMB 2XYRA 3DOFA 1PS8A 4KLAA 1C29B 2HMUA 5C31A 4HNTA 3G2HA 2NO9A 1OC4A 3U17A 2ZCUA 2IZZA 2VEOA 4I4TB 4P5DA 3VRHA 4LE0A 4RXTA 4JI3B 4NP6A 3CV3A 3HKCA 4N7JA 3NM6B 1YFKA 5ENDA 2XHZA 1SRQA 2WSSA 3QH4A 5TPWB 4YMUA 1OAOC 1YQUA 3DDNA 5ALTA 1G4HA 2RKWA 1PJZA 2O8DA 4L08A 4Y6OA 2MCFA 1KKMA 3AESA 3NJ8A 1EGVB 2I6TA 3EMDA 3JQ7B 3NEPX 3O8OB 3OZUA 1FU4A 4YK7A 1SCDA 1A27A 3AEXA 2C3MA 1P5FA 4W1QA 3WGUA 3WL6A 2B3DA 4DA6A 1L8LA 1OTHA 2WPNA 4J7CA 4OP3A 2A3NA 1N2JA 4XIJA 4ENSA 1IZ0A 3N8GA 3VPGA 2XGJA 3O94A 2YRWA 2YOGA 3HZOA 1E79D 4KRXA 1V1JA 5AUNB 1V43A 3OT1B 5F23A 4C9RA 1OI3A 4LQGA 1IVYA 2A0KA 3OFKA 3G23A 3VZRA 3GFTA 4HNGA 4JUCA 2HUNA 3HJUA 5DVZA 2R2GA 2ICAA 2ID4A 2I4OA 4IDEA 5FF9A 3RTGA 2RHJA 4IOMA 4LHWA 3HC7A 7GPBA 1TQ6A 4PSVA 3EISA 2Z04A 3SWWA 4KE8A 4RTMA 2RC5A 1RWQA 1MORA 2IDZA 3NIFB 1TTHA 5KYXA 4M1TA 3WG9A 3L1JA 2CSXA 1I2ZA 4YN3A 4DOMA 4J43A 5KMGB 3NDBB 4YMVA 2WJPA 1WCIB 2YJGA 2I55A 3IQEA 4OQPA 4IIGA 4Y98A 3SJFA 1FFXA 2GQ0A 3HR4A 3Q7RA 1RHJA 4ZDWA 4IL5A 4D9HA 4BY9E 1UDBA 1V8FA 5CLFA 4AWAA 3AHGA 3DJYA 1KBLA 2JEYA 1T1RA 3UMRA 1PWHA 1M0WA 1RYFA 4L8FA 4LJAA 1OROA 3IV7A 1KRWA 4NOJA 4UM7A 2VR1A 1E2MA 3RC8A 3HU2A 4X6LA 2JGEA 5FYQA 3N7AA 2IHTA 2Y0DA 3PWZA 3NOJA 3S8YA 1Q6YA 2B9EA 4DV5B 1Z4MA 1QK3A 2E89A 2Z9BA 3AIKA 4O2AF 5CM9C 2YJNA 1ZXBA 2O1WA 2WIJA 5AM0A 1TYBE 3KXLA 3TOXA 4QJ3A 5F7JA 4KV7A 3ZJVA 2EWVA 2R7MA 2IHNA 4B6JA 3I73A 4FCWA 1E6UA 3BORA 3ROKA 2CUZA 5BW6B 4UNRA 2OVFA 4F92B 2O2CA 2C9OA 3F6PA 1RFGE 3WXBA 3KOUA 1VP3A 1NJGA 3AV3A 4XUEA 5HF5A 1KVTA 1HYQA 1U2SA 5B55A 3SQOA 2GWRA 3IEMA 2E28A 1W6UA 3LBNA 5IARA 5K0ZA 3K53A 3O9MA 4ECEA 3FW1A 1QQ6A 1Y1SA 3ZZUA 3PC8C 4JODA 4ESOA 3TECE 3EJ6A 4NX2A 2MYNA 2BV3A 3C45A 4UBLA 4KPFC 4EZIA 5BRJA 821PA 5EMJA 1W49A 4CCWA 2ORIA 1WPXA 1OZHA 4PZUA 1BXRA 4ND6A 3KHUA 3KE8A 4INZA 3NWEA 5F9HA 3PQ5A 2F3PA 2F3SA 3L06A 3RARA 3MCZA 2QMEA 1U28A 2BKAA 5H4HA 1XROA 5BSRA 5LIRA 3ORRA 4C9BA 3SNKA 3N28A 3DHVA 3VAZA 4EO9A 2VG8A 3JAKB 5DNAA 4KP7A 1K6JA 2RBEA 1V3UA 4UEOA 4C30A 4F2GA 1BJTA 3GT0A 2ECPA 2H0RA 2V7VA 3QBVA 4HJRA 3W5VA 3GNLA 3CKLA 1TCUA 2FN8A 2B1RA 3P4XA 2A9QA 4A27A 2HXSA 1FB5A 2QTAA 3LYUA 4BAUA 4GE3A 3PC8A 3JQ7A 3OOYA 2B34A 4OGLA 1YI1A 1ZI8A 3HJAA 1AS0A 1ST3A 1XEFA 1XX6A 2IFTA 3L7OA 2W8BA 2PGIA 3JQRA 3ND6A 4N39A 1XUOA 4FD2A 4LYYA 4NZMA 1RLIA 4QJIA 5BR1A 1M1YE 2GPBA 2OV6A 2HHAA 2V6IA 3LCJA 4IJKA 1EWKA 2HMTA 2ANBA 1G8PA 4FJ0A 1KP3A 1U8FO 3GAMA 5EUMA 3A2MA 2PZLA 1MJGM 2XBMA 4ALJA 1OAAA 4I3HA 3SQMA 4IQ8A 4RANA 5ERGB 2JGMA 1OD6A 2XGMA 3HJRA 3KYDA 4M99A 5G0VA 4PO3X 5GONB 2EZCA 3BHIA 5CP8A 3RK4A 1C50A 3CPEA 3IKTA 2HW8A 3PSHA 2HSEA 1EXWA 3WE7A 5AM1A 1XU7A 2Z56A 1TYZA 2MSEB 2YFYA 3VR1A 4DLNA 3GAFA 5LDHA 2HCFA 1E2HA 2JW5A 1I4LD 3IP8A 2GN8A 3KR0A 3BMNA 3PF9A 3B70A 4DDWA 1N6OA 3LUGA 4MUBA 4RQTA 4RY8A 4OREX 4WCFC 5A7HA 1EM8A 1TTPB 3N9IA 2CCGA 3ZV6A 4ZYZA 3L0ZA 2D4AA 1MQ8B 1KEPA 4C29A 4H3SA 5JALA 1VPWA 4WESB 2PEZA 4PY2A 4ZGGA 4RVUA 1SQGA 1Q7RA 4WV3A 2FOLA 3HN7A 4PLVA 3QUSA 5GJWC 5TMEA 2FUEA 1HDRA 1GRRA 1X38A 1QV6A 3FOAA 4A8JB 5BW4A 3DZBA 3G82C 3K1YA 2HA0A 2AOTA 5GONA 3CA8A 2Y93A 1YNOA 3GIDA 4M1EA 2R8ZA 2V9ZA 3GFGA 1FFYA 2YJZA 4QBIA 3CVJA 3MJVA 4YMTA 2TMGA 3GJ3A 4Q05A 2C94A 3ABQB 1RHUA 1CLEA 3QX7A 4YCCA 2V3VA 5L4LA 4C6TB 5EJMA 3DT6A 2WZQA 2Y4NA 4LPKA 1V7QA 4M6WA 1N5DA 2FK8A 4QNRA 3UWOA 5CVUA 1BEZA 2XPCA 3ZCRA 4QNNA 4DRXA 4Q9DA 1G64A 3WQBA 4CFZA 1J2EA 1H2RS 2VSOA 2B0JA 4GAEA 2H1OA 1MZPA 5JS7A 1MOSA 3FYTA 3KQPA 3TS1A 2AJLI 4IRMA 4P35A 1KOGA 3I23A 2D2XA 3JAKA 1LPAB 1YE5A 1TVCA 2VNSA 1NTRA 1D8TA 2UYCA 3CW8X 4U2GA 1KFKB 1NBOA 1AU9A 5C3UA 5DPMA 2IL1A 4JS0A 1P0QA 4LNHA 4B3RB 2O6LA 4OAPA 1L6IA 3LPDA 2YW9A 1XAGA 1WP9A 5FA5A 3NGLA 5FORA 5L3VA 2C2ZA 2Z5LA 4K40A 4EW6A 5EIEA 3TXXA 4TROA 2BGJA 2D7JA 4MUAA 4WVLA 4YJFB 2DFLA 3Q0EA 4IIJF 4Q7MB 3T5AA 1RC0A 3DLAA 2DM6A 3DJFA 4BKMA 4CKBB 3N8HA 5ES4B 2PQMA 3CWCA 3TSOA 1Z0SA 1NW3A 1T9KA 4ACBA 5IJ0A 2Z2ZA 3KQLA 2Y4OA 2J7PD 3CUVA 3OZSA 4J0CA 3RS5A 3NAGA 4RJIA 4R8LA 1PZMA 4DUGA 2RIRA 1GU0A 2PZAA 1JIVA 2W48A 3HCCA 4KBGA 3HFSA 2F1HA 3EEBA 4YH1A 3ON5A 1CY2A 4QDUA 1SBNE 5BURA 2DWOA 1L5NA 4G1EB 3NKVA 4C1NA 2QN1A 5DNVA 3EZ9A 5KSWB 2X7HA 1UBCA 3D7MA 3ZQUA 3CC8A 2OGWA 3E0QA 4EHHA 3HR8A 5LOVA 3ICOA 4EI8A 5LQUA 3ETLA 3WNBA 2FDCA 4ER5A 3O4FA 4F6LA 2R2AA 2VP5A 3EULA 1R0KA 4FN5A 3DH0A 2V98A 3WP1B 5TXGA 1XC7A 4REMA 1YHNA 4ZAGA 3FZNA 3SM3A 1EB9A 2ZQZA 3KL4A 4OTZA 3U5TA 4LF7B 5JI2E 1CUVA 2DKOA 2XIQA 5BWNA 2O2XA 3LXXA 1R8YA 1F8XA 2WU3A 1VYUA 1M8JA 2LUOA 2ZRJA 3GBSA 2QVXX 4ZCSA 2Y0CA 4JQZA 3LDGA 2SKDA 5CDTA 4X62B 1R9MA 2YL2A 3HJNA 1ZK1A 1P4AA 3DUWA 3C43A 3W9SA 2DBVO 2O2EA 3OZGA 4IR7A 4KX5A 4XVUA 4D56A 1A69A 1UMCB 4BCCA 2FE4A 1EDBA 4M53A 1SVNA 2Q0HA 5HA5A 1LVHA 3GMIA 1HGXA 3Q8KA 1VFPA 4KXNA 5IUJC 3DMDA 1E9DA 3TXAA 1UQRA 3IQFA 1VBKA 3BQNB 4DWWA 3NVDA 2ZIVB 3E9YA 2OAEA 1E2QA 1NVDA 5K1ZA 3CUUA 4Y7CA 1M6VA 1H93A 1THMA 2RJOA 2V6FA 3AT1A 3IYLW 5KJEA 1SKMA 4NAHA 4NBSA 4C8TA 3BQMB 4X1YA 2KHZA 4AKSA 4HMPA 5K7SA 1VPTA 4OX9Y 1DV1A 1D6MA 2O2HA 1SA0B 2WWGA 1Z0FA 2FE1A 1RVDA 5DK6A 2BFFA 4V0LA 2R1UA 16PKA 2IGTA 3A3OA 3KQQA 3WL8A 4EKNB 1DQPA 4BN0A 4RH0A 3E81A 1CZNA 1KBZA 5NLLA 3TDKA 4Y6QA 5IJ0B 5LFAA 1L4FA 5FULA 1JL3A 1PFKA 1XELA 2SHKA 4I3FA 5HNKA 3SXPA 2EJWA 5THQA 4HT3B 1P61B 3FHLA 1K88A 3I9OA 3ZU2A 1GDDA 4RK4A 5BUCA 1SJ9A 3AHJA 3KYBA 4YJFA 5JU6A 3QGMA 4QT0A 1XU9A 3BD6A 4M9XA 3C6KA 4JEHA 1MOZA 1HORA 1JVBA 3LRXA 2RH9B 3LXUX 4KCGA 4Q4AB 5DI3B 3Q88A 2JI9A 3GZ4A 2AR7A 3CMMA 1E2FA 4UM9D 3EGEA 3ZXIA 1TQDA 4PW0A 1NWHA 4GOJA 4DADA 2PX0A 2XJ9A 2ZJ0A 1V16A 5AOVA 2M6SA 3UXHA 4BU0A 4PSKA 2YY5A 2I03A 1VKJA 4RL6A 4Z54A 2R5FA 3NHYA 5IMSA 1IQRA 1DAKA 4FW8A 1E9FA 3CLVA 4RVHA 4ZWNA 4YRJA 4UUQA 1RM5A 4DPKA 3NFRA 4QRIA 4MMXB 4TVSA 5LLDA 1SVUA 4GDFA 3IEXA 3NC0C 4HTFA 3AUFA 3DL2A 3HY4A 3FI9A 3PDIA 1P4RA 3I9NA 2HWYA 5KMGA 3ONEA 4AJHA 4E5UA 4E30A 5CH3A 2EBUA 3G0OA 2ZB8A 1GZ5A 3NBYC 4NDZA 5BNTA 5JH7A 4KQIA 1NIJA 3THYA 2ZR7A 4IO0A 1KC1A 4N54A 3EYAA 1Z68A 4QUEA 3OM0A 3OIUA 1GQYA 1QIEA 5BN5A 3UHFA 2YVAA 5JVDF 4CCYB 4EZEA 1VJTA 2XMRA 3G9ZA 2VUTA 4BUJA 1FXWA 4RMIA 3EN0A 3R5FA 1XVLA 4MAFA 1XCJA 2B98A 1AGXA 2OBYA 4JEUA 4LRYA 5CHYA 3LVBA 3T7AA 4HDMB 3H5NA 4CT0A 1R74A 2HQRA 4Y2UA 4UVHA 4KI0A 1Z2CA 2ESRA 1XRJA 1CJUC 1U2DC 1YUMA 5KTKA 3VAAA 4N48A 4GGPA 3IKVA 2BPOA 4EPTA 4EKYA 4QDXA 4B9AA 2FP4A 4J7XA 4D9KA 2WF8A 2ZRKA 1JQJC 3ITEA 3UGQA 4RXUA 4B3HA 1OB2A 1L5OA 2HEGA 4RO0A 1CE8A 2OD7A 5AJYA 3LI2A 2WVHA 3GP3A 1LI7A 4AP9A 1DX4A 1IULA 2B6HA 3FHOA 4PINA 4AW9A 1OH8A 2DWPA 3B78A 2P0AA 3Q3CA 4L6IA 1V7PC 2AG0A 2ZUEA 3JWIA 1Y3BE 2ZI7A 3U3MA 3I5XA 5GY7A 1II0A 4HXEB 5B4VA 4LVUA 3EZBA 2Q7DA 5AJTA 4TMZA 3KQUA 3TLBA 2VJYA 1LBHA 2ZTMA 5ECYA 3SY8A 4CNBA 4LWQA 1NX6A 2Z6VA 4JJ4A 4K05A 1WVMA 5DKFA 2CF5A 3MCVA 2FHPA 4OQMA 4TSFA 1O6FA 1I3LA 1VCMA 2FZKA 3K1AA 3RT9A 2G63A 4JP2A 2BGUA 4IX9A 4M8KA 1KH3A 2W43A 3SNHA 1G20A 2VYQA 1F1JA 3JU3A 3SE7A 1EG7A 2WWXA 3AR7A 4UCXA 3FY4A 3ABSB 1EFTA 1P6XA 1O94D 2RGCA 4GZ6A 5KJ1A 1XMOB 3CZPA 4N3GA 5C1OA 1KHHA 1XFDA 3G7NA 3PG5A 1ZM2A 2JLRA 3DMNA 1M5UA 3I2KA 5LBTA 4C3UA 2BI4A 3DFZA 5IVPA 4FFDA 4R1UA 4AP6A 2WQ7A 4NCAA 3ZLUA 5DOVA 5I9LA 3RVNA 3BG5A 3ONFA 1G291 1EE2A 3STYA 5JBQA 4WZAB 2A0WA 2VDQB 4DNPA 1JSXA 5L9AA 4UUOA 4BRUA 4QATA 3NXSA 5L8VA 4DXDA 2YY7A 4GZMA 4FOOA 2YJVA 4HDRB 4XOIA 3ASYA 1U7XA 4KSYA 3NIGB 4KREA 4PZEA 2OA0A 3TQFA 1G3IA 2QLJA 3CZ9A 3GUHA 3IKLA 4K9LA 5KHOC 1JX6A 1VHQA 1SNYA 1ZD1A 1SK9A 1Y8QA 5EINA 1PQ4A 2BZ0A 1U1EA 4F8EA 1CZHA 1D6NA 2CEAA 2PVSA 4ZGBA 3TLGA 3H8JA 2FRXA 1DVRA 4L5IA 3SZOA 5B3AA 4MA5A 1UCFA 2QNRA 4PCAA 4BO8A 5JISA 1TAUA 3E9DA 2FKAA 2X22A 1JDZA 1SUPA 3EDMA 5CDUA 4Y2JA 5TQ2B 2KPOA 1L4HA 4YMHA 2GFIA 2X5XA 2XEDA 4Y6SA 5SV2A 3RTCA 2XUOA 3ADCA 2XVYA 3LO5A 4BQRA 1E1CB 1F51E 1WXHA 3MEQA 4HP8A 4I4CA 2IV7A 2RDMA 5ARDA 4AY5A 1GCIA 2BMVA 5JO9A 1OHHD 3T5PA 1Y3CE 1P5RA 3OO0A 4J3FA 1LSSA 3OAAD 5KTPA 2P3LA 4E33A 4TLDA 5CK4A 3OPYA 4YREA 4G1UC 2E18A 4FBLA 3QSGA 3F4LA 3U4GA 3KKKA 4JLJA 3THOA 1FFWA 1YDMA 5KYYA 3OU6A 3AG5A 5CA0F 1U99A 1VM6A 1S8AA 3HNPA 1GTRA 8MHTA 4QTUB 4UNIA 3OIGA 2WTMA 3U80A 2CVFA 4GQAA 5I9SA 1N5MA 2FSHA 4X91A 3H8WA 2P4QA 5DHRA 1T9ZA 4J3NA 3S44A 2AEEA 4UNQA 1YJ5A 3KUCA 1T9DA 3L0BA 4JLPA 4M1MA 4BFVA 1F8UA 3VO1A 1N3YA 1GOTA 4FFRA 4DUYB 4P22A 5TARA 4QXOA 4LXTA 4AZ3A 3ET4A 4MVJG 4UTOA 3SJCA 1O9GA 2ZTLA 4MJLA 3ZNOA 3GRRA 4X93A 1JLHA 4F93B 4IIDA 1GT91 4BKUA 2YFHA 3ZD8A 4A0GA 2WVJA 1GQSA 5GVRA 1NYRA 4NBVA 2N46A 4ZCPA 4BOYA 2J41A 3NONA 2XDQA 4FWTA 4ZVVA 5KYYB 3TF5A 4XWKA 5HBGA 1JEQA 2H08A 3D8NA 4G23A 2VRBA 4JKYA 1PI3A 3EC2A 4OFBA 4WLNA 1CZRA 4K2HA 3EE6A 1L1EA 3FSEA 2Z58A 4E2YA 3H2JA 1WY5A 2F9MA 5E3HA 1YQQA 3JVVA 4FCVA 4MPDA 4JELA 4Q12A 3WK7A 1PX2A 1WVGA 5JDCA 3IEUA 1X13A 4KC0A 2MSKA 2BM0A 4OD0A 3VPDA 2AZXA 4NYJQ 1JLRA 4QOGA 3EJWA 4M37A 3ROGA 3QP9A 3SIRA 3WBJA 1QLWA 1T13A 4OOEA 4B4UA 3T1YB 5AKKA 1NPYA 2IXTA 2BUBA 3AKEA 2EHDA 5CDFE 1Q7TA 2BHTA 2GAJA 4FCTA 3CO0S 1J0EA 4PAOA 1NIPA 2P9TA 4OB6A 4D3XA 1E3WA 1N2CA 3RH0A 4P3OA 2BEJA 1XMXA 1M1NB 1PTKA 1P17A 1KY2A 1B42A 2NV0A 4II7A 3T7TA 5IBQA 3UCFA 2CLSA 1YR3A 3DAPA 3AWIA 4L95C 3ZDRA 3IC5A 1XQ9A 4TTIA 1J2RA 1YKSA 2YQ4A 4LJ6A 1QFSA 4QARA 4CMKA 4EY8A 4ARZB 3LZCA 4BMOB 3BIJA 5CB6A 2MMGA 4KW7A 4HFMA 1UWKA 2PE5A 4RAQA 5G40A 2VTKA 4TWBA 2HLDD 3FGZA 5DASA 4ZVLA 2OOKA 4DV4B 1KEUA 1I4EB 4HVCA 3AUTA 3D3NA 4PM4A 4PSUA 1WUIS 3W6ZA 3HO1A 1QP4A 1J39A 3AL3A 3JYQA 3OLXA 3RFFA 4CQMD 3CEMA 3DOIA 3I2GA 2ETXA 4D9FA 5F35A 4AXBA 3G9XA 3T0IA 1KK0A 1M3SA 1A5SB 2VLIA 1RAFA 1S2DA 3LVFO 4CLRB 3MFQA 4B9EA 4EVSA 4OHOA 5I9NA 2ABWA 1DL5A 5BO5A 1E60A 3IMGA 3Q7IA 3JD3A 3MJDA 4I2VA 2XOEA 2OOTA 3LQYA 4BX0A 5A9SA 3OLZA 1NXQA 2JFQA 2UYQA 2FEPA 4W5TA 1FEZA 2FPIA 1R61A 3AM5A 3EZ2A 2HRCA 3BXEA 4HUQB 3LUCA 3ZD9A 3H2IA 3DCYA 2WAAA 1T8UA 3FLEA 2UUAB 2H0QA 1CP2A 1XN1A 4AY2A 4J0GA 4TM7A 4ZJYA 5DDIP 2VRNA 3R4VA 5IJZA 1A7AA 2CYBA 2IDKA 4S3MA 3WHIA 3PC4A 2XYGA 3KWLA 5MDHA 3KASA 1PR9A 3LWBA 2ZSIA 4JWTA 8ATCA 1UT5A 2YRXA 2XWSA 4O0LA 3FVRA 2DCMA 2QBYB 4QYMA 3OPYI 3C7TA 3LA8A 5EUCA 1OR8A 2Z6UA 4S05A 2WKWA 4J0JA 2NP6A 3AESB 3DC2A 3O8OA 5LD2B 3VJRA 2H5JA 5FOXA 2IV2X 1FW8A 2VJPA 3NG1A 4UC0A 1YVRA 4B4KA 3QPDA 5KDOA 1ZW6A 1DRKA 2QM3A 1X87A 2RGYA 1DAEA 3BDIA 1YRHA 3HNRA 1E4EB 4NATA 4UZFA 2ZRGA 3BZWA 1E7MA 4CO9A 1B7GO 1NUUA 2Y05A 3PCTA 1IMOA 1K8ZB 4P4UA 4Z0TA 4A0RA 3BI1A 2Q6VA 2QQGA 2IYRA 1FZTA 5J4HA 4Q66C 1VE9A 3PWTA 3QITA 1WU8A 2Z1NA 2H63A 4QFMA 3RROA 2QRMA 4RKRA 1M1NA 4NS1A 3IGFA 1KFJB 3UJ6A 1TCVA 1AKVA 4KFSA 3L4KA 3B3AA 5SY9A 3RRBA 4ER0A 1KI7A 4Z8XA 4B81A 4N3BA 4LJ5A 3E70C 4A2PA 1XKTA 3H2SA 3MWEA 5FDFA 5KYVA 1WCV1 2ZJZA 1FS5A 2RHGB 3E3OA 5M3BA 2FWIA 1LI4A 5CVEA 3WSVA 4DSNA 4UBKA 3EZ6A 1NSYA 2OMKA 3K05A 1P2TA 4CKCB 1SN7A 1KFCB 3M1AA 4XB6B 2O8DB 2FQWA 5B4UA 3KKPA 2LRHA 1EI9A 1L0BA 1CW2B 1OY1A 1RJEA 4C22A 1PD0A 2QRZA 3HL0A 2AD5A 2AS0A 5E2BA 2FR1A 2I6FA 4KNVA 2W6ZA 1QS0A 2MINB 2W2QA 3FHCB 3AEYA 4I9GA 2QG6A 4PTZA 4C85A 4U6NA 2VTBB 5CG2A 4P9NA 2ZQ5A 1N4AA 1K3FA 4TMYA 2F6RA 1ZINA 2AG8A 1YR9A 2EDAA 4RA6A 3CF6R 2ORWA 4KRYA 4LDZA 5A9RA 2G9RA 1E0SA 3QSYA 2W4MA 1YU6A 1KJ8A 2WWWA 3CWQA 4IIFA 3E18A 1MAVA 4PNEA 2QX7A 3CF0A 4ZXPA 4RHEA 3GL9A 5IDXA 3NS7A 1RVV1 2ST1A 4X84A 3OQVA 1CY8A 2QBYA 5IXYA 5HZMA 1CUXA 2VF2A 5EFOA 4PWZA 3NPMA 2GAOA 3X1MA 1OH6A 1R15A 5JECA 4PZ9A 1E6LA 4J7UA 4LRQA 1PE0A 4P44A 3R7AA 2LZ0A 4IOKA 4B3TB 2CSUA 2OTCA 2G0AA 2G80A 5GMOA 1Y9AA 3HGMA 1A8QA 3TNLA 3KJEA 4EGCB 1WTCA 2I6UA 2V5UA 3CTMA 2GZDA 1I01A 2OV2A 5BSVA 1JR3E 3V4SA 5CFMA 1PU2A 2QJOA 2Z3VA 2WMYA 3GEGA 3QZUA 1FOEB 3QTLA 1Y6FA 5EC8A 1W5TA 1YOBA 1K3UB 2ZJYA 4XWGA 3EIXA 1OF1A 1QCDA 2Z9DA 1YCGA 5JYDA 5KINB 1FJHA 1HSOA 4L1KA 1QZTA 2MIIA 3AFGA 3B36A 3CURA 4IXMA 4CYMA 2P75A 3NBFA 4D4GA 2PTHA 3TNJA 4BE7B 1R8XA 1ECPA 1T2NA 4LI3X 4D9CA 2CXQA 3V1UA 5F77A 4JUBA 2G71A 4M1WA 2XRMA 4B4DA 3RRXA 2REQB 3FGOA 3AKZA 3AHDA 1DARA 4BGDA 1P2UA 4FOPA 3ZDQA 1SG0A 1UC5B 3K15A 1IXKA 4G3XA 4OXNA 4M54A 1SZDA 1IMJA 4IGFA 3QLVC 3ASUA 4TS9A 4X3PA 4ZIRB 4RQBA 4M4SA 1HY3A 5F1OA 5KYXB 2PVCA 1KEKA 2Y92A 1Q7EA 3BICA 4MVJP 1VIMA 2GILA 2QP3A 3R4CA 3FYSA 1AMOA 2GF0A 2HUPA 1K3TA 3R5JA 5E38A 1CPYA 4MW5A 3PFCA 3WLJA 3THWA 2DFPA 3VKGA 2FPUA 2Q1TA 2VTEA 1WMSA 1UBUS 2ZRBA 1KR2A 3SSAA 5KREA 5HTKA 2RAVA 4GP6A 2RGXA 1OYYA 4L7VA 1F0KA 1GY8A 1V9LA 2PIAA 4QG7A 4MGYR 1QUFA 5FL3A 3AUKA 3BGWA 2IZ5A 1G59A 1J7KA 1S3IA 1E2UA 1VB3A 2FSVC 4X3OA 4ZU6X 2WJWA 3HDVA 4FGJA 3AI1A 4GVPA 1HDIA 2XGSA 2FN4A 4FFOA 4LYDA 4PGGA 3URMA 1Y6QA 4NARA 3TZHA 6CHYA 1N8SA 2QJRA 2YIVX 2RI0A 4MINA 3PCXA 4XD7A 1AV6A 5J59A 2NTNA 4KMOA 4BO4A 3NDPA 2PSFA 3R3UA 1X70A 3X43A 1PAUA 5FOQA 2XUHA 1ZM4A 1VSBA 2DY0A 4JJAA 2BSQA 3ILXA 1MLDA 4FSXA 4TYNA 2OENG 4RPIA 2RGBA 1RLTA 4MV8A 4PX9A 4WERA 1EP1B 4EY5A 1V5GA 2W2MA 1FNMA 3IQXA 4EPWA 5AJUA 4JI5B 3R0ZA 3AUUA 5C35A 1E1DA 4GT1A 3JX9A 1ZD5A 4EUHA 1JG6A 2ACEA 3JVDA 2ODBA 3D6HA 1WV0A 3KT0A 2OPHA 1ARZA 1MPTA 5IVHA 4IDHA 2CF6A 3AJAA 3NRBA 1MC5A 3GFOA 3K96A 5LBUA 5D29A 1NC1A 1G55A 3ZHCA 2BGNA 2RGAA 4F5ZA 5I7HA 2IF0A 3EGWA 4PFKA 4L4YA 4RPCA 2PA0A 2OYCA 3G88A 2WLTA 1I51A 3A4TA 4BNMA 1R6BX 4C07A 5ESDA 4L27A 4KQ6A 2JLXA 1TQ8A 2NPFA 4G56A 4HAXA 5A03A 4UEQA 4E2FA 3H16A 4WUTA 3UW3A 4HH0A 3HVHA 2G5PA 3QVMA 2QTVB 1J0DA 3KB1A 2G4VA 2JGDB 3QXJA 4PGHA 2A9PA 4S1NA 3OU2A 2ZSDA 3RAJA 5IULC 5MN6A 3BCRA 1O95C 5CLLA 2VAMA 3U9LA 1GFSA 4QXMA 5CEEA 3R5SA 1DC4A 3ZY4A 1XT6A 3F73A 5FFNA 2QUBA 2VPWA 1H8HD 4J6FA 1FP7A 4JZKA 2ZSBA 1QO7A 2P6PA 1RADA 3A6DA 4Q48A 4RJKA 3TUJC 3EFOB 1L3IA 3K70B 3HBFA 3KWFA 2WJJA 1W0JD 4Z2AA 4XCXA 1DQRA 2C78A 4FGLA 4ZN6A 2J46A 3N74A 3B51X 4E3ZA 2VWHA 2FZWA 3V1TC 1VE6A 4FDVA 3HGQA 3T7SA 4X64B 2ZRPA 2P5SA 1QDLB 3LSTA 4KR3A 4LXYA 3HWX1 1W25A 2OC4A 1QU3A 1TF7A 1Z2AA 2X0NA 4IRUB 2G5GX 2IZ7A 3FUUA 4LMBA 3FEDA 4JYZA 3FMOB 4N0EA 4K6KA 4JL6A 1E77A 4JYBA 4WKPA 1LSOA 1NUTA 5TS3A 2RH5A 4BUZA 1UK6A 2EZTA 3S7TA 2AXNA 1ZR4A 1Z8HA 1HE8B 2PX3A 4B87A 4G1BA 5E6RA 2VK4A 3TX2A 4AECA 3IJPA 5FO1A 4FFSA 4LNUB 3EZYA 3F7TA 1BE0A 2GPAA 3WGQA 2G8LA 2VH1A 4LYFA 4R6XA 3VFDA 5IKMA 1Z8DA 5JD4A 3IJRA 1IPHA 2IQ5A 3I72A 5TF4A 1DKOA 2XCRB 1NYTA 2IX9A 2O4UX 1H6AA 2P67A 2V6JA 1L7QA 2GS9A 3ABZA 2ZGVA 4KN6A 1GD1O 1G4AE 5ED4A 1SCNE 4G0NA 2Q3LA 5AQEA 1Z56C 3HY6A 1LI5A 4RACA 1U5BA 1NONA 2OO3A 4AUNA 4CKEB 3TGPA 1KARA 1JLSA 3DPSA 5LCXA 2O3UA 5JCXA 4TLBA 1JNXX 2F3UA 4FBGA 2HMAA 3MPOA 3QU2A 1I8TA 4KQHA 1V1RB 3GMDA 2D62A 3AW9A 3F6BX 2E4VA 2R6CA 5E9WA 4X92A 3DDOA 3N58A 3JQEA 1KIFA 1NL3A 2PXHA 3DFUA 4R2IA 4ARBA 1ECFA 2I2DA 2JVIA 3PRKE 1NP6A 2HMVA 4MEBA 4CEJB 1E1CA 4FZ5A 2RCYA 5B37A 1MA0A 5KPJA 3HFRA 1J20A 3OJ0A 2I65A 5HKBA 5HK9A 4BLSA 2BM1A 4MEAA 2OBLA 3LECA 1JYFA 4EM6A 5JDIC 2IDMA 3AKDA 1Y3DE 5J58A 2PAAA 4AO6A 5F9MA 5BN1A 4BEWA 2QTNA 3OLQA 1A9ZA 1RHKA 3NBMA 5A3QA 3LX4A 3KPVA 2YOFA 1P9WA 4U8GA 1TT5B 4I55F 1G5HA 1PJCA 2CLOB 4K87A 4DCMA 3COZA 4W6QA 4YT8A 2WU8A 5EJ5A 1CZKA 1MIOB 3C3PA 4BO1A 4ZMRA 4L5CA 2WUEA 1M34B 3TBKA 1BN7A 3UGJA 1W6RA 4V02A 1NQUA 5B58T 2X1MA 3DNPA 2QRLA 5GVSA 4N01A 1N2BA 1R64A 2A7XA 4Z99A 4Z3KA 1A95A 4PX3A 3UG7A 1DQYA 2B1QA 4PHHA 4WY8A 3FOZA 3AR9A 2WUDA 4JWKA 2PD6A 2RGGA 3ADPA 2RHBA 2WLSA 3HSKA 3R3SA 4G5FA 5SY6A 1FXUA 4HC4A 5T64A 1Z17A 3NAMA 4NZPA 3HJFA 2BUAA 2H5LA 2PUTA 5AKIA 1X7DA 3IBTA 4U5XA 1SOVA 3LHDA 5BPFA 3OEED 1JHYA 5JSZB 4K9MA 1YQEA 2P4SA 2CBZA 2ECQA 3H1PA 2EFGA 3EGXB 5FR1A 1TFRA 5FAKA 1O97D 4V0OA 4DY6A 2G88A 2J45A 4J16C 2GYYA 3D4BA 4MYHA 4QU0A 4XDZA 1N36B 2W2LD 1MW8X 3R0VA 1TECE 1NZDA 1G3QA 1LSJA 1QG4A 4Z4IA 1UPAA 5AW4A 2B82A 4GMHA 4MVJF 1XKQA 3OM8A 3ZS8A 3MJEA 4PXYA 4U2DA 3TH5A 1J22A 1IN4A 5LVAA 3HEAA 3K2BA 1YRAA 3ND9A 4JEMA 3O75A 4UE3S 4UHEA 3RVKA 4ES6A 5J63A 1R4MA 2GZHA 2W4QA 2ZT8A 3MRTA 4Q7JB 2MSNA 4F7WA 5KQLA 5FP0A 3W6OA 1K4MA 2VP9A 2B4YA 5HR5A 4BJ6A 1BCSB 1QLHA 1SBTA 1U5BB 5IN5A 5JXGA 3PUVA 3RBUA 3K6JA 2O3TA 1SKQA 3A6EA 4RFLA 2VNAA 2PKWA 2IHKA 1E3MA 4M0MA 1L7EA 1XU4A 2XCTB 2PLFA 3IE0A 2GVZC 1GUDA 1VE5A 4RZQA 1NR7A 1IAVA 2C8VA 3CHYA 3DEJA 3IR6A 4B6QA 4AWBA 1E2EA 1MAAA 5JS1A 3N3BC 5ENVA 3PHHA 3N5CA 1E5DA 2VKQA 1YZVA 5E3IA 1V6AA 4HN9A 3W2EA 2P2GA 5I7AA 3F46A 4DABA 3AY0A 3ITKA 2GD1O 2XVAA 4J9UE 1E2PA 3B8HA 1MGOA 2BBWA 4CEJA 1G8MA 2D0IA 3ZE6A 4IIBA 4R3UC 4IM7A 1G6HA 4P6VF 2HSZA 2F64A 3CW9A 3GN2A 3L43A 1OFTA 5CBKA 5E0OA 3O4HA 2DBQA 3DHYA 1SU8A 5E8JA 4P0QB 2Q1SA 3FRIA 1NQXA 1TQHA 3EY4A 3K7EA 2EFDB 3RDPA 3RSQA 4W9MC 1T4GA 3PUZA 3A1FA 4HH4A 5LZ4A 3KO8A 2BFEA 4NPHA 3VBEA 1JYSA 4X7RA 5DGXA 1BJRE 1ZI6A 4LSMA 1N33B 3O8BA 1C9KA 4HADA 2VPXA 2WTNA 1DJNA 4CT4B 3ZGNA 4BGIA 2C96A 2I1WA 3NEAA 1PLKA 3TRJA 3FFXA 4DM7A 1YBAA 3RSHA 3HP4A 3WLTA 3QVVA 3VR4A 1PWYE 2O3RA 3U1BA 3E5MA 3E8SA 3Q0TA 4IEIA 4EELA 4LZPA 3P0JA 1ENZA 3GA7A 3IL2A 3ERCA 3FIJA 4A15A 1K1EA 1POWA 1TGYA 2BHNA 3CF4A 2W98A 5ADVA 2CKMA 3N2GA 3MGBA 3IEPA 2YYZA 4XLLA 2JHFA 2Q4BA 1Y4SA 3B12A 5F73A 3SS8A 2XITA 4NDAA 1GDTA 2OZVA 1C0IA 4R1NA 4KO1S 3RRYA 3N0TA 3DWIA 2QRHA 3PB3A 4J0EA 5IUKC 3RYHA 3W2TA 4ZI7F 1CERA 2BJHA 5EKTA 5A04A 5M2QA 2VVTA 3QXGA 2HHHB 2C2OA 3UICA 1T4DA 4UFOA 5DXAA 3M9WA 1T5HX 2R25B 3HA5A 3E0XA 4EX6A 4E03A 1K6XA 3P5BA 3W1WA 4KFRA 2W2LA 1BKDR 4BJ5A 1I6LA 4E12A 1TPYA 4ZT2A 1QKIA 1NASA 1I0LA 4PZ0A 1WUTA 2PG3A 2XKBA 2ZANA 1B3RA 1P7CA 5C34B 1FU7A 4RSHA 5KU1A 1PJBA 3TDMA 4FW9A 1TMOA 4EOGA 5DCYA 1E18A 3L77A 2JGLA 3CNNA 1RCFA 3N5KA 5IXJA 5HUJA 4FPXA 1E3IA 4M0LA 2OFOA 4WACA 3RT1A 3CNLA 3UWSA 4HLUA 1J2TA 4UUPA 2JIPA 1WSWA 2O4CA 4JA2A 3VXKA 3NHJA 4B6EA 1O1YA 2VJDA 3TOCA 2WI8A 3ANYB 4PCLA 5ALEA 4H3VA 2D2EA 1FJ2A 1NYLA 2V97A 4F97A 4DV1B 4L57A 4PPGA 1DG9A 1T0BA 1SU7A 3Q98A 4B73A 1NVUQ 2C4KA 2WD7B 4DLKA 5K9ZA 5AI0A 4LWZA 4QLOA 1QONA 3SZGA 4YYZA 3ZUGA 1Q95A 2OV1A 4I6JA 2JPDA 4IV0A 4UE6A 1ZW1A 2JIQA 3PC7A 4GH5A 5CU7A 2I4IA 4KTTE 2XNDA 3BMOA 4NYMQ 2D5LA 4PAMA 2B20A 2QSUA 4O2BA 4XUCA 2OILA 4LOAA 3NNDA 3V8QA 3VR3D 1ISGA 1VBNA 3I4FA 4AF6A 4CQNA 4Z9FA 4R0NA 2DTEA 2C2GA 2RHWA 4CL2A 1NVEA 2FSFA 2NSJA 2D1RA 3R5KA 4U9UA 4KLRA 1WKBA 3GNQA 1G3RA 2HA7A 4RZ2A 3VOTA 1F8GA 1SVSA 4TTQA 1U3CA 5FQOA 3H87A 5MGBA 3MOGA 4NCKA 1F60A 4CG1A 3HG7A 4AT1A 2AJBA 3K8QA 2KI5A 1MN6A 3GEDA 4BVEA 5AIBA 3U60B 1NOJA 5KNBH 2XZDA 3T06B 2R62A 2WYIA 2QLMA 3SXUA 2X77A 1WNTA 2IXAA 4KL8S 3ZHTA 4L85A 3SDBA 3EDRA 4KQJA 1UKEA 1PGNA 4R8RA 2X3YA 3K70C 1IEWA 5FA8A 4XLZA 2XTMA 1O6GA 1UMBA 2CXUA 3CEJA 1XNQB 1FYFA 2VN8A 1CVIA 1VCOA 3AEKB 4DSTA 1MEOA 3AUAA 1S2OA 4MUEA 4G9BA 4JR0A 4PCVA 4U9IS 4NZZA 4B3DA 3T1TA 4KUGA 2J3HA 3QIVA 4BVFA 1AG9A 4QO8A 4L50A 2WFMA 4EG0A 2PRIA 4MV9A 4BVAA 2DHRA 3F8SA 1AH2A 1YA6A 1J0XO 1GG8A 2HIHA 4GKBA 3GEEA 3C5EA 4QA9A 3WS7A 1L9XA 2PUVA 3LP8A 1OB5A 2I3DA 1KYWA 4LG1A 1SUAA 1AUVA 2ENUA 1VCIA 4FFVA 4AXXA 1Q2XA 1F7VA 1ZC3A 2HGSA 3KAKA 3OX3A 1P4HA 1QK4A 3WRWA 1QANA 1YK0A 1DIKA 2GN4A 3T52A 1PNRA 1C9NA 1HKUA 5F7ZA 1BMQA 5CW1A 1GPYA 4LF4B 1IWPB 3T1OA 8ABPA 3PE6A 4A23A 1N7HA 3V1LA 3QE2A 2J85A 4LX0A 4YRNA 1A82A 4XD7D 2XKJE 5K5EA 3CR7A 5CX4A 3T4PA 3HU1A 5BV0A 3MS2A 4IKOA 3KSBC 2ZSKA 3TAXA 4NS4A 3FNFA 1G8HA 3NO4A 4HO1X 1XAHA 2DE0X 2BYTA 1W93A 1RJ9B 2I2CA 3FTNA 2NTJA 3KL2A 5ULLA 3J7AC 4GHWA 3PD1A 2FW1A 2OD9A 4XCQA 1LX6A 1N2CE 4MRRA 4XI9A 1SZCA 3JR7A 2FG5A 3B1ZA 4DA9A 2B4KA 5C5CA 4GPAA 1ESMA 1IEXA 1KKUA 4NYJR 2JNWA 3ELWA 2EGGA 2W6QA 5A9SB 1W581 3ESCA 1YHYA 2QRGA 3T9DA 3CGWA 4ND3A 3VUEA 3IE1A 4MGKR 3C15C 1G8SA 3GGCA 2VJCA 3VU9B 1JE0A 3PWKA 4BNNA 1NBWB 3ZWVA 1OCEA 2YWEA 3OCVA 1G21E 3CJQA 4L7QA 4IINA 1F0YA 1ZNWA 4K9NA 4KUEA 1ECGA 5B1EA 3ISJA 4IWYA 1NW4A 1SG6A 4DQLA 1B74A 3MJSA 5GINE 1IJEA 1WHSA 3QBTA 4BLRA 4C0HA 3FMGA 1ZLXA 2Y71A 1F6BA 2RB5A 3UKOA 1JIKA 3D7LA 2GK4A 3ZWBA 3OZEA 5EG5A 1S4MA 2UXBB 4DLWA 3OKAA 4HQFA 4ZRMA 1ORIA 1IOVA 2VDKB 3LZDA 1D0VA 4OJKA 5AW1A 4KVZA 3UUGA 2WJ3A 4RTSA 4CBVA 3AB7A 3RU9A 4COOA 1P9OA 1H2ZA 3FROA 5HKAA 1VA4A 5JC8A 3IB3A 2O1SA 3B3GA 3AR2A 3RC1A 5AJVB 4WD3A 3UK7A 3U6KA 2FSGA 3L4SO 1UXKA 2ZUTA 4Q4JA 2HD4A 3CRMA 5CFZA 2BMFA 2NZXA 3GGJA 1AKRA 3PQ4A 1ZHOA 1XK6A 1Q5XA 1KYZA 3L7AA 3V4VB 2BTOA 1EFLA 3MWGA 4GSYA 5LMCA 3C6YA 2A86A 2PLAA 4UU0A 4AUEA 7REQA 1HLGA 1XR3A 4E5SA 3OHSX 2WABA 3QY0A 3SHWA 4MW7A 5THKA 1VJ5A 4TQGA 3WK5A 3ZHRA 4NOMA 1VC2A 4B84A 4C2BA 2N3ZA 2X9VA 3E9NA 4ZK6A 1GA4A 5HHTA 5JRZA 3EXHC 4QFBA 1WDWB 1E3SA 5IBPA 5ALJA 1Z6GA 4Z3OA 1PWZA 5FH9A 3S81A 2PMWB 1CIPA 4R6WA 5AOCA 2BVNA 2DQZA 2JGRA 2NQTA 4K6GA 5FUQA 1MO6A 3C3BA 3C41J 5C81A 3HJHA 4QO7A 3RHTA 421PA 4CI9A 3R6TA 4A03A 3QELA 3V55A 1EDDA 4IMJB 2CUKA 2G1UA 1CUFA 1COWD 3NHKA 3PNYA 2QMHA 5G4KA 4BB6A 3V7FA 1HBJA 1MEJA 1Z15A 2WKQA 3P27A 1OC2A 2YWCA 4WRRA 1Z7BA 4IH9A 4F12A 1TXGA 1JDTA 1E4OA 1EVIA 4JN6B 4ZXFA 2QIOA 3SFZA 1KEEA 2OSBA 3TQRA 1DIOB 4OGKA 3WHKA 1Q20A 1PWEA 3TVTA 5BWLA 5BVHB 1N8TA 3A6PC 4I5FA 2YS6A 1SVOA 3E9EA 4IDAA 4R69A 1OIXA 3V46A 4GWGA 1L4BA 1T5BA 1HURA 2IT1A 3MB5A 3AR4A 4J8PA 1NT2A 3QLUA 2EYUA 1B16A 1H85A 2FWRA 3ZWOA 4C88A 2G77B 2GJ9A 3STTA 1SUFA 4JP5A 4UQPA 1N34B 1T0IA 3ZTTA 2R65A 1JSLA 5DNUA 2VP4A 1ZD9A 4TMTA 5F2KA 4LZLA 3ZUPA 3MC1A 5BMOA 621PA 3FGNA 4R41A 3CKYA 4NGSA 1UPTA 3EAQA 4DXHA 2B94A 5CNIA 3AHEA 1E99A 2AG5A 1GUFA 2JFYA 4YDSA 4BDTA 4PHTA 4TXMA 3UJPA 4MNTA 4MCAA 3EFHA 4WZBB 1E9CA 1L5VA 1VL1A 2AN1A 4PX5A 2FSIA 1FIUA 2QZ9A 1KP2A 3V32A 4M1KA 1ZA2A 4JQOA 2QM7A 6AT1A 3OKPA 1SBIA 4OBXA 4BS9A 5JT1A 1EZZA 1R0CA 1JR6A 1GFZA 3I37X 1Q1BA 1WXXA 4JLUA 4M38A 4RBNA 1PLLA 3CLHA 2EARA 3L9WA 5BNIA 4H7IA 1I5EA 4FMCB 4TN1A 1Y9ZA 5ILOA 2BGWA 4Q4JB 4MP6A 1YQGA 2V7QA 4OUDA 4BFLA 2XZPA 2R00C 1QV9A 2JCYA 2J7KA 1FRZA 1S3SA 3GJYA 3NMUF 3CCCA 4YJ2F 2IUFA 3CX7A 1NV9A 3DYIA 3Q87B 4IJMA 3VNBA 4E5DA 2QZ4A 3IULA 4IIJB 2XWPA 5HJ7A 1M8GA 4I36A 2NNWB 1EFAA 2MHCA 1C7ZA 3TR5A 3NTLA 1RJDA 5EYPB 2B8NA 3EDCA 1XJWA 2C42A 3BBLA 2J4FA 4MI6A 4UDXX 4XOUA 2AFRA 4WNAA 2YY6A 5DXJA 5DLYA 3S1AB 3UC9A 3B9BA 3P52A 1UIRA 3KR2A 4S1OA 2IYWA 4ESEA 1K06A 3LPAA 2XEGA 1D4FA 4YJ3F 4FMBB 1G2IA 2EJVA 2JA2A 2YYYA 3IKMB 3M6FA 6LDHA 3HU5A 4WNYA 1DLIA 4OH1A 2OYSA 2B0AA 3LUKA 1TX4B 1F4PA 3A6ZA 4OC4A 1DC3A 2DP4E 5I4KA 3BI0A 2AR9A 2CXXA 1M8PA 2VNHA 1REQB 2ECFA 4HGZA 4R8VA 1P91A 1VXRA 1BXKA 2J3DA 2Z43A 3MJ4A 3OJEA 3U4HA 1MX1A 1R5BA 1XEWY 5EYPA 4G8DA 1EBBA 3ZU3A 1GA1A 3UMVA 3W90A 1GRQA 2I4TA 4PLFA 1OJLA 1OBCA 1UDXA 2C5SA 5CFQA 1W0KD 2G08A 2DF8A 4QGAA 5FXMA 1DZ3A 1V4BA 4IGIA 1MHTA 2ZB4A 1VI6A 4Y2YA 4N4AA 5B1SA 1LWNA 3WB9A 3BZBA 4YCSA 3KJQA 3P19A 3D3WA 1E1NA 1HKHA 1YH3A 3OVMA 2XMPA 4GF5A 4QYTA 3QUQA 4G5HA 4Y8VA 3KSMA 4CLEA 4UBMA 1JQBA 1GZVA 1R0BA 1ZSVA 2DTXA 3BE4A 4N18A 4RZUA 4AI6A 4D6XA 4D0NA 4G07A 4LUCA 1PT7A 2QD3A 5K8CA 2ZOSA 4S04A 4G1FA 5DT9A 3G8DA 3T99A 4I4LA 1ADFA 1Z82A 1E5XA 3VZDA 5DNEA 3GLIB 4J0DA 4O5OA 1SIBE 1Q50A 3IDQA 3ZY5A 4X6XA 4F2HA 2EFJA 1IK6A 5TPZD 3PT5A 5F1YA 1G0NA 2JKZA 3O21A 1EX7A 4WKBA 3R7WB 5JFOA 2H4ZA 9LDTA 4GOXA 5A3VA 5KYUB 1G9XA 3LKBA 1P7WA 1T8RA 2MTBA 3B20A 3E7XA 1N0HA 1L5HB 2CDAA 3MTQA 1IC6A 3VR6D 2X19A 3QYPA 3TJZA 4WESA 3A9RA 1SKBA 2R6AA 3ESAA 1NXOA 1AOXA 5FIUA 4XRGA 5T67A 2AX3A 5A4IS 2IVZA 2W6ID 2B69A 3E61A 1B76A 2C61A 4QELA 2A58A 4YONB 5SZJA 4F8YA 2JATA 4G9GA 5AK4A 4IBOA 2EZ8A 4LV5B 1V3QE 3MUOA 2ZM6B 1RXIA 1KXJA 1J4AA 2ZUWA 2QDXA 4XWOA 5IDYA 3WHLA 5TNXA 4V3CA 3T5MA 1XV5A 3SVLA 1ATZA 1JIJA 2JFHA 1NGSA 5FKJA 2J6HA 2Q62A 4KPUA 3BB1A 4D5GA 2CJFA 2CLLB 2AVDA 2XE8A 5JSQA 3RC7A 4ZJZA 1I3MA 2X5OA 4QXAA 5I7UA 1TF2A 4IOLA 1Z4JA 2HMYB 4XX1A 2QIPA 3F6YA 3G0GA 3LF1A 4GGOA 3U16A 3G8YA 3EY9A 2J32A 4NEHB 1PJ3A 3O90A 4HDSB 3QF4B 1DS6A 2IYUA 1OVGA 4NCNA 2H8GA 4YP6A 1U9CA 5FPSA 1A3CA 3I2IA 4E5MA 5IABA 4MQ6A 5FOUA 1V0JA 2CFRA 1SOUA 5AW0A 5FWXB 2WU0A 2D2VA 3H1BA 3D64A 2ZJ7A 1P7YA 1UPBA 1JBQA 1A1SA 3BIFA 4IUYA 4F2WA 1ZGZA 3UHOA 4DS3A 1NDUA 3QLJA 1LJUA 2YWFA 3PRYA 3B1VA 1M6EX 4J1NA 2G82A 2DPHA 3CX3A 1WZUA 4KXMA 4PG4A 5FA6A 4E22A 1TIKA 2BFFB 3EBOA 1CQJA 2H4YA 4CVNA 3LRPA 1V8PA 2WWVD 1MMFB 5JNLA 2GSWA 4IV5A 1NT4A 4ZVKA 4X95A 2D8AA 2DVMA 1N0WA 1ZH0A 5ECDA 3ZBTA 1GPKA 3VPAA 4MROA 4DCUA 1D2NA 2QUAA 3RIEA 4EHDA 1UWLA 2JCBA 2RFLA 2R79A 3LUBA 1NMXA 3TLMA 1ESZA 1UWCA 1QZ3A 2OHGA 1HQYE 4UNPA 3R6DA 3CEPB 3MXOA 1TZJA 3WL5A 4IRXA 2IHZA 3DZJA 5FO0A 1UJCA 4LTNA 3FJYA 1Z63A 3ACBA 3K30A 4LXHA 4F04A 5BWCA 1I2AA 4HYEA 2TMYA 3A31A 4CQJA 2J08A 1XNHA 1QIJA 3LHSA 1O95D 2FCAA 5GP1A 4AS2A 2XD9A 5DRTA 3ZCPA 5LWHA 4ICIA 1NDQA 3TQCA 1HT0A 3R7LA 3VI4B 2LIVA 2AMJA 1DG3A 2AFHB 5LA6A 3V1YA 3WLFA 5TLSA 4DN6A 1F2TA 1ZICA 2FVXA 2FV8A 2O7RA 3DAHA 3ELUA 3SC4A 5HJEA 1E58A 3RUIA 5LZ9A 4YX9A 4QU9A 2Y1XA 1N32B 1LLDA 1U1CA 2OV8A 4ATNA 3H8SA 3IQGX 3DKRA 3ROEA 1QH1B 2Q6TA 2BKXA 4X41A 3NHRA 3IPXA 1V39A 3E27A 1DPGA 4DQXA 1I3CA 4B46A 1UBHS 4AICA 4NU8X 4OJNA 1U1IA 1DAOA 1E2DA 1ISPA 4NU6A 3BXPA 1R0RE 4D9GA 3OLVA 4D0LB 4EW3A 3A7DA 3U4AA 3CLTD 2GN0A 3GPCA 1K4YA 4X0EA 3JZAA 4BNIA 4CMHA 3V8EA 1TEZA 3TAHA 2NG1A 1KAQA 2ILVA 3BERA 4JCOA 2Q6KA 5BSWA 3A6HA 5A4DA 2YC2C 3QVXA 1GCAA 2DQYA 1AHPA 1PZHA 1T2VA 3I53A 3E58A 1QRRA 4B2LA 2PLRA 3LC1O 2A1UA 1EWQA 4BRWA 4Q18A 1ZBQA 1SUSA 2P6OA 3K6RA 3KJGA 1K7SN 3Q5EA 2PCJA 4PO1A 2LR0A 5ARCA 4Y6PA 5C37A 5KTNA 3PUIA 3LK7A 1ISSA 4LNUA 3HHEA 3VR2D 1XA0A 2IYAA 1QIMA 2ZUUA 3CLKA 1CKEA 3II6X 3W2FA 4MVXA 4OB8A 3H3FA 5JZBA 5FUXA 2QUJA 1NBAA 1LRKA 2P90A 3ZWWA 2YIMA 2RGUA 1L7XA 2Q4DA 4KSCA 3SYKA 1Y9DA 3BIOA 1R4NA 1XZ8A 4CMJA 5BSTA 2QZJA 3FVTA 2HK9A 4B80A 4IEFB 1E9EA 3NEJA 1MX3A 1TOAA 4G0ZA 2ODNA 1IZZA 3WP0A 1V8BA 1W4CA 2GYUA 2XWJI 3MWFA 2GJAA 4ME6A 3ZVKA 5CB4F 4DR4B 4FU0A 4GO1A 2AC4A 4O33A 1KFBB 1JU9A 1YT5A 3WLEA 2AFHA 2NMVA 2D5AA 4EO4A 1Z6TA 1SXPA 2YR0A 1AQIA 2H92A 3R09A 4BN4A 3BL8A 1MOPA 1XE3A 4GPZA 3RU3A 5E9AA 1O2DA 1Z0KA 3I05A 2DFTA 1KPGA 3KDSE 3L8FA 1Y80A 2FQXA 4RPLA 4F4CA 4PGMA 2Z57A 1FNBA 2A30A 4H17A 4P38A 4CI0B 2ZAOA 4AJ4A 5DCUA 2EZAA 3TIFA 1GTG1 3WB1A 2QR2A 4WFIA 2EF1A 3DTYA 3WIUA 2C5HA 4RSRA 4X85A 5HXAA 3KYIB 4Y0NA 1F2UB 3QVUA 1NX9A 3UFBA 3LW8A 3ODGA 1FU8A 4QU5A 5LLSA 3GJ0A 1EFDN 2XE4A 3UMGA 1ZL0A 3DFIA 8ADHA 2IKSA 1YR7A 1C3JA 4LQDA 1PGPA 1U8AA 1C4KA 5EVCA 2GZ3A 1N9KA 4ARVA 2PS0A 5EJ6A 3BTOA 3DZGA 1D9XA 3MZ0A 4Q9KA 4C4ZA 2W2KA 3GY0A 2DHDA 3EG5A 1MNAA 1H2BA 3O4RA 4YRTA 5FNZA 4G5QA 1L3CA 1QZXA 2R3SA 3G5TA 3SOZA 5JZOA 1QYWA 5KAMA 1CHNA 3GVHA 1RXUA 1NG1A 2ZJ8A 4K46A 2FGJA 4UOQA 4PTLA 2FLVA 3IP9A 1M6WA 4TSRA 4B79A 4C8PA 1UEJA 3BL5A 3TRFA 4D4IA 3CLRD 2LWIA 2VAWA 1JFFA 3TAUA 5LB2A 3UK2A 3V48A 2JJ1D 3IJ5A 3WNCA 3ZXYA 1Z7EA 3OY7A 1AD2A 4PGFA 1TIPA 2VAVA 3PXCX 5HGXA 1BDMA 4GI7A 5CGQB 5AW2A 3RVPA 1MBZA 4MS4A 2A6PA 1LY1A 3M4XA 2IA5A 3NOQA 2FSPA 2VUSA 3LM8A 4FR2A 2XBUA 4KIJA 3TSYA 4AC9A 3VX4A 5I3ZA 3BXMA 3SGLA 1VHWA 3HA7A 2MJLA 2GNPA 4WZAE 4OLAA 2YJ3A 4HNAA 3RVMA 4DT1B 5I7EA 2H7YA 1BGWA 3W7VA 1ZONA 2IELA 4GZ3A 4KQFA 5C1PA 1NM5C 2QOEA 2VHCA 4RF4A 5L6MB 2PXCA 3PJFA 4PBRA 3S55A 3AF1A 4H2DA 1GLVA 2OZLB 3ZR4B 1Y42X 2HU8A 4UOEA 1A8UA 3BH0A 4JL8A 2PSHA 1TMKA 1Q3TA 2JLCA 3EUWA 1ZEMA 1ZCBA 5DTEA 2ZWAA 5LXTF 4E31A 2ATXA 3I01A 4R2JA 5HUHA 2UYYA 4N76A 1OLSB 3DL7A 3OZRA 3UB3A 1Q3KA 1XEAA 1DZIA 4PE5B 2H9AA 5GAJA 4ASUD 4CF7A 5EHXA 3AUSA 3CISA 4XPZA 4R31A 2JLVA 2DBRA 4MKFA 4UD6A 2YXEA 3D7KA 3GNTA 5EXTA 4ZDJA 4R2XA 1YA8A 4XA8A 3VOBA 4A91A 5CT4A 3TLAA 4CL3A 1QYCA 3A3PA 3KLMX 5DI9A 4BP9A 5C7YA 4TT3A 4OPMA 3ZIUA 4URYR 3A4LA 3D3KA 4M89A 4OQZA 3K0FB 4YMIA 2SNIE 1LWOA 1IZ9A 4G01B 3GGSA 4PFJA 4EO7A 2VZ8A 3OZVA 1BHO1 1P8JA 4L6AA 4HV4A 2BDUA 1XD9A 4XSVA 2B2XA 1J56A 2QAGC 4Q3NA 4XPIB 3RYHB 2J48A 4GKJB 1O77A 3T34A 4RX1A 2GARA 1BX1A 1QNFA 3DD1A 3O7WA 1I3NA 5CLJA 2HPVA 1APBA 1YZNA 3IBGA 2V3WA 3DP9A 1WF3A 1X7GA 1EWTA 2IPMA 3B3JA 3FAZA 3O8QB 3VHRA 1YO6A 3VH3A 3PJRA 1AXEA 1GGEA 4MIYA 3FDZA 3OCJA 1K8QA 4HEHA 4UU1A 2EQ5A 4CIWA 1R0SA 2FX2A 4IS2A 1QPBA 4RU1A 1VHJA 1NAHA 3ADDA 4I9FA 2B21A 2P2CA 4R2HA 5FOVA 3WGJA 3K4HA 3I74A 5FBRB 1ECCA 3EVGA 4OHMA 2CJYA 3NTVA 4JYPA 3IP5A 2DFKB 1AHHA 1MO4A 2CNKA 3ILSA 2IUTA 3MA0A 3N53A 4HAYA 2VZ9A 1Z4QA 2NZUG 5JNVA 2LKCA 4LBZA 1LW6E 2A0UA 4OXKA 4PQFA 2JLZA 1INLA 1EZ4A 2EC5A 3U9TA 4B3JA 3RYCB 2CDRA 3KYCB 1PZFA 5ABPA 1SC9A 3A11A 1AQLA 1JLLB 2FEKA 5JVLA 3CH4B 1CRWG 2VO1A 3ZXSA 4D9EA 1NHWA 1MH1A 1K7YA 2BWJA 1BXGA 2VWPA 1N9GA 1NNLA 2R1ZA 1R9JA 3B53X 4TWZA 2AI1A 1PR0A 2EFCB 3IILA 2C8JA 3RLFA 3W9UA 4IDCA 3TQSA 3GFVA 1CUAA 3ZV3A 1PN3A 4J3JA 3I9MA 4PZAA 4DDMA 5HRUA 3FOEC 2ZZNA 1CD5A 2A1TR 5JAOA 3K72B 1NQVA 5J4KA 1UKBA 3WIVA 2VHXA 5GOZA 1G98A 4I2NA 3S2SA 3UXMA 3ZWDA 3HABA 2QVCA 4U7FA 4JGIA 1OASA 1V95A 4X8MA 5EI5A 4AZ3B 3PENA 3U13A 2I2AA 5G0UA 4ADSG 3V2IA 3L93A 4WOCA 1DOAA 1FBTA 3A6JA 3B1KA 3OJFA 3Q1LA 3Q15C 3UT0A 4DQDA 1CBUA 3ESYA 1WPGA 3OPQA 3L41A 2EJUA 1TYCA 2LE0A 1QPGA 4ILEA 3QWFA 1QFXA 3GLSA 1I2MA 4LNAA 1ZKDA 4IAOA 5ALKA 4URHA 1D5CA 3A37A 2IS4A 1KJJA 1JAHA 2C0QA 3UXEA 4HQ0A 5DOZA 3FFAA 1X7WA 1P4GA 3B7GA 3GZNA 2FY8A 3KUUA 4UTZA 1U7OA 1ICEA 2Q7XA 2A0YA 3RVQA 2HDHA 1P1CA 4KQCA 4FB4A 1PFVA 3JASB 4I9NA 1FVXA 3GJXC 1PT9A 4D8YA 4QL3A 2RH8A 1ADCA 1SKYE 3AI3A 5JV5A 4FT4A 1FW6A 5A5EA 4HQRA 1XSEA 1QFYA 1C4WA 4KOAA 5B53A 2W6MA 5KTYA 3RWOA 1AK2A 4RABA 4M21A 4RJ2A 2BLLA 2HNKA 3TTWA 4F85A 2CDBA 3TTSA 4BNDB 2W2TA 4Q93A 3RS0A 5ALLA 4U1RA 1T2AA 1SIWA 4ND7A 4EA6A 1VP9A 2X9GA 4B3FX 1UK8A 1GNLA 3MIZA 1XCMA 4GNKA 3USCS 4JY7A 5P8WA 4BIMA 3GLKA 1KEEB 4AL4A 3LH5A 3WLKX 3UBTA 4YJHA 4HEA6 3NHMA 1Q12A 3VNSA 2F8LA 3I2HA 1EP2B 1EPUA 1VKRA 5YASA 4DBZA 3SBXA 5CNMA 3K9HA 2C2BA 2HA3A 1HDZA 2IDJA 4JOSA 4C4PA 1TM1E 4G25A 4M0KA 4A1FA 3G5AA 3B7WA 1R5NA 2FHSA 3INGA 3ADOA 2ZYDA 1M7HA 4P3PA 4PBTA 4XLTA 2P9QA 3D6NB 3BH7A 1LFAA 4OX9B 2I1QA 2PL9A 2H1HA 1FUKA 1NY6A 1U2QA 3HE3A 4L9RA 4IXDA 1MUUA 2W6OA 3LOQA 5EWJA 4GPBA 5LKRA 4RF2A 4FMPA 2C7GA 5ESXA 3WV5A 3VC7A 2RKBA 1PFWA 1F20A 2ZI5A 2WSLA 1DRWA 1I1NA 1PR6A 3N2EA 1Q1ZA 3MUNA 2IZ0A 2YFQA 3PNLA 2HDNB 5E8RA 2HRDA 5TIIA 3GYBA 1GQQA 3RM3A 4ABYA 5JHGB 2OXCA 1D1PA 3GWZA 3OMLA 3ZLVA 4NL4H 4B09A 2ZAMA 2RG7A 4BNTA 4BV8A 4RQAA 4EY3A 3ILVA 2IBMA 3KJNA 3I83A 4IHJF 3UH0A 4YXWA 4BO3A 2PLNA 5K8VA 1NURA 2BJWA 2Q8PA 1RWNA 3E5NA 4RVFA 3CVUA 2R5WA 1A96A 2FDRA 3GDGA 3RYTC 5JC1A 3QE4A 1YUBA 4DRYA 5KTMA 4LF6B 1W36D 2FZGA 4QFDA 3ORHA 4OMFG 2GKGA 3V8PA 1JHAA 3BGOS 2GWHA 3E9QA 3PPXA 1UFKA 4XGIA 4X00A 3WQQA 4E08A 1VE3A 4G1CA 2K7FA 4FJ2A 2PVVA 2W8ZA 2DR0A 3ZWQA 4YAJA 1UT8A 1G5TA 3FUVA 1SWVA 1LX7A 2OCXA 3JZFA 4LYHA 3UXYA 5J43A 4AO8A 3TLXA 3TSWA 1R10A 3D5QA 1CJKC 1XL0A 3K8ZA 4NYIR 5D01A 7ADHA 3CMCO 3TFWA 5K20A 4FHGA 5JJCA 1M83A 2IW1A 3QPAA 1E9AA 2H2WA 5EZ6B 4JLVA 5K05A 2HX1A 1NJ5A 1GVNB 1XPUA 3CN7A 1DI0A 2XUGA 3HM2A 3M0EA 4CCAA 1UOQA 3UF0A 3GJQA 3JAWB 4QASA 1XZHA 2HJRA 4BO5A 2FPXA 1GQ2A 3UUEA 2BT4A 2V1UA 4JI8B 1M7BA 2A5GA 2QUIA 1M1YA 1XGKA 4UU8A 5H0IA 1GEGA 1E6MA 2AOVA 4Y2RA 4Q9HA 3UN1A 2AMYA 1YJ8A 1H4VB 3DC7A 2NXNA 3NTXA 4FMCF 3HDHA 4MWOA 4YRQA 4DLAA 3OT4A 1JR3A 2BBSA 1DBRA 1SCKA 4R01A 2ZB3A 4YGYA 2PBLA 4Q9IA 1SWWA 2VDNB 3R6GA 3DD5A 2HEIA 1NMYA 4QGBA 2PWZA 2BZGA 4BLTA 3DKPA 2H17A 1WX1A 4KPGA 5HF9A 2HFJA 2X14A 4CMBA 2WM8A 4WBNA 2DUUA 2WOOA 1B6SA 2C3OA 3IPLA 4Z0HO 3HJBA 1U3TA 2BHRA 1SM4A 3RQSA 1U7HA 1U0GA 4F4DA 1P1HA 5LQCA 2V5AA 2JLSA 3ND7A 4P7GA 3L8MA 1GXSA 3BDAA 4E6PA 3CINA 1ORHA 2K2WA 1XHEA 3AUJB 2GEBA 1Z47A 1DCKA 2N9UA 5K6RA 3UJ7A 3IOCA 4O25A 3SN6A 3C3KA 4OK6A 3PP8A 4P3YA 5KVVA 4OCZA 5CCDA 4A8JC 2FH5B 2D59A 1O6BA 5L45A 1SXJC 1NM5A 2A9JA 4K81B 3IQWA 1M6HA 1Y3HA 1E59A 3IOBA 4US1R 4AJ1A 1RQXA 5HIAA 4LCJA 5HOQA 1KI6A 1XTJA 1M2HA 1QGOA 4D7AA 4L15A 4ZT7A 2HK8A 3HYCA 2Q5FA 1XL1A 4KH1A 4YIKA 1H8HA 1XAJA 4H3KB 4XQGA 2ZSJA 3ZHSA 1E3LA 2YJ5A 3CZAA 1P2BA 2PY6A 2P79A 1AT1A 4BAGA 4TWEA 5ADUS 3MFYA 3K09C 2F4VB 2X7XA 2WYHA 2VYFA 1NA5A 2OGSA 1E7YA 2R1VA 4CV3A 4G5OA 1GYQA 4C03A 1N1MA 4C0JA 3ITNA 5CIQA 2ROQA 1I13A 1WOYA 4ND1A 3EZ7A 1RM4A 5D3KA 1QR2A 1ZAYA 1ISFA 4UZEA 2R00A 3LVRE 4C2UA 3TLKA 3ZK7A 1ZVKA 3MWDB 2IHJA 1ZM9A 2YDXA 1KZ6A 3KHTA 1ZP6A 5D1HA 4A6EA 1LB1B 2ZJAA 4MHSA 3GLTA 1FF9A 1YQ9A 3MD0A 3Q9LA 4C0QC 2Q5HA 1PZXA 4EP1A 1C1XB 3FWYA 3MRXA 3W6PA 5JSYA 5DX0A 4BB0A 3OTHA 4AKIA 4AMVA 3DHNA 3WI7A 1QWOA 4PSCA 4XJVA 4ALIA 4AY4A 1B6RA 1EXVA 2Q4EA 2ZRAA 2M6LA 1IXYA 1ENPA 3O2QB 1Q1NA 4MVJA 2ACWA 1X14A 3N8KA 1RPTA 1JR3D 1DP4A 4US0R 5KWVA 3GO4A 1U7UA 1N2GA 1GKYA 2ISSD 1I2CA 2YMMA 3O6VA 4KK3A 4C78A 4EUKA 2DSNA 4YEDA 4CV0A 4E70A 2KBFA 2QJFA 3N2YA 3RNLA 4HPXB 3QKRB 5CYOA 2C8LA 5CLHA 4HFRA 4TYYA 1J1UA 1RBQA 5EQFA 3D7GA 5AW3A 3UHPA 3IVCA 3X1DA 1XMQB 4AURA 2E0IA 2QTCA 2ZYRA 4NFYA 1WW3A 3GLIA 1T9GS 3RVOA 4BRZA 3JV7A 4NWIA 8AT1A 1GPBA 2P9ZA 5A2QA 3HXOA 3IH5A 1QIKA 1FXSA 5K0CA 3JWJA 4WUVA 1EX9A 4FUTA 1SC1A 1SIUA 2CVPA 1XQXA 4YPFA 3UMCA 3VAYA 3ZDBA 1JHXA 1YASA 1G9SA 3MBKA 3H75A 4ZO4A 3TW8A 1KDTA 4MWSA 1W87A 1LJ8A 2CLFB 3A6FA 2JIDA 4PZDA 2I87A 4F72A 2VQ6A 3X1JA 1LRLA 1AA9A 1D8AA 4QT4A 5LUAA 3OQJA 4M9ZA 2FQ1A 2W6CX 1U80A 2A5YB 3M6LA 2ORED 3L6EA 4P08A 4D26A 2GKOA 4C2TA 2IYOA 2RGNA 4OFZA 1BN6A 3LUAA 2H52A 3AI2A 4HWTA 4G2NA 4KQKA 5AVXA 1AGNA 3EXG2 1GL9B 5JRJA 3ZGVA 3A04A 4F5YA 2PNJA 2QT0A 5DLEA 5CIYA 4LCEA 2EKQA 4CHGA 4IPTA 1UJMA 1PNVA 1B23P 4FYWA 1RWWA 2QTGA 1ZYUA 3HUTA 1PL0A 1CUHA 4GKAA 1PNQA 4RMGA 2PMKA 3RSZA 1UC4B 2DLNA 3LBIA 4AS1A 3ICEA 3DLCA 1JH9A 3PZBA 5DCWA 5DZSA 1N6LA 2C20A 3ICVA 3EC1A 4FOTA 4GZ5A 4IF4A 4TGLA 5PGMA 4YCMA 1U98A 3RWMB 4RDXA 1JDUA 1Z2DA 3PNKA 4W5NA 4HDQB 4ZCTA 1VL5A 2V6GA 2I80A 4OJYA 4UXJA 4JMLA 4YYEA 2QAGB 3QXCA 4MCSA 4DCNA 1C4OA 5KNDA 2Q3DA 3KU1A 2HSDA 4URWR 4EUSA 4YUZA 4ZDKA 3VR6A 3TR6A 5B7NA 4WDQA 3I2FA 4I50F 4G5GA 1YFZA 2QE7D 3MQ2A 1G5IA 5ARBA 1ETHA 2HO4A 2QROA 4AMUA 1Q2UA 2Z4RA 1T26A 3X1ZA 4YP0A 1WMBA 4JENA 1GTMA 2PGOA 2ZZKA 3BRWD 2B4QA 1U65A 2GN1A 4IDFA 2VYVA 3AQIA 5G02A 1ZUNB 2R7AA 2CHEA 2WFZA 2QV0A 1EK1A 3ETDA 4BFCA 3QV2A 1JQDA 3AH8A 4RKQA 1J8VA 1LRJA 1MT3A 4B8WA 4ZO6A 4BKPA 1L5SA 1A4UA 4MK4A 4XQ0A 1Y7HA 1M67A 4EHBA 2B5VA 1E92A 4ZI3A 3N7TA 3UK6A 3LX8A 5J23A 3A1CA 1ESDA 5JZVA 2ZJFA 2P68A 3V8BA 4N7BA 4DUZB 4FJ1A 5H9WA 1O9HA 4R1MA 5ES3A 3AU9A 3CGGA 2Q9BA 2EP8A 1NWCA 3MOSA 3PYMA 4Q6WA 2WIFA 3S2UA 1AKQA 1KPHA 2PEYA 4AULA 2B7LA 2CLEB 2IZOA 1W2GA 2QVLA 3TOZA 3RFTA 3EXEB 1RM0A 4MXDA 4PRLA 4BHTA 4PPYA 4BQQA 4O59O 1ZUNA 1DV2A 1LC3A 1NTOA 1OLSA 1OYOA 1VPEA 2Y0EA 3H5TA 4CUZA 1WBDA 3UYKA 1J9GA 3RK1A 1NRXA 1IXRC 4TTPA 2WTBA 1PZNA 4O4IA 5C4MA 4UCWA 1ZJZA 2NO1A 1VLZA 1OX6A 4HWKA 1KY3A 2NXEA 1N1DA 1P44A 4H1UA 3T9CA 2ZJOA 3TOSA 4MPTA 3BBPA 2V54A 4Q7LA 2Q6LA 4KWIA 3QX3A 2AE2A 4JQCA 5JI3E 1SXGA 3M8KA 3EWAA 2YC4C 3SF8A 1ZITA 3RPEA 4Q7QA 2AEJA 2PT9A 4KO2S 1FRNA 2I62A 3VR5H 4AJ2A 4XUGB 3INNA 3OZWA 3NHWA 4HNUA 1Z28A 2CMDA 3L02A 4J2HA 3RLIA 5JSUA 2OD2A 5CA0A 2XY4A 1JQEA 2P9YA 3I58A 4ZALA 3NP7A 3NHPA 1JDBB 1VG8A 2BTEA 3HYSA 3ZQJA 4B4OA 3PQCA 3HDGA 3H5IA 3PQ8A 5GV8A 4Y2TA 5TVGA 4TKVA 3QF4A 4CG2A 1AUPA 2CJWB 3ST7A 2V96A 2FZ5A 1N75A 3C14C 5G3YA 1ZFNA 3Q3JB 1U2GA 3SQLA 3HXPA 3QEMB 4Q4CA 4PQEA 4TZTA 2AW5A 4FQ7A 4I5GA 1KZYC 2HYIC 1USIA 1GPLA 2GNAA 3NR2A 4OHPA 4EJSB 4YRMA 4I1YA 1NQ5A 1QHEA 1TYEB 3D02A 5EJEA 1Q0ZA 1YR6A 4TMVA 3C3CA 5FPKA 5CCEA 1GN9A 1ZAKA 5IXSA 1BGXT 1TU0A 1AKUA 3WAKA 1ONBA 4WECA 2ZXEA 3KB8A 5DLQC 2JAPA 1TT7A 1A98A 3PFWO 2WDZA 3LMKA 1T43A 1E2IA 2ZI9A 5ESWA 2Q9UA 4ACAA 3ZX5A 1T3ZA 4FQ8A 4LW8A 1FQWA 1N2HA 1RXYA 2YQZA 4LDRA 4QYXA 5JJKA 4Y3UA 3GYGA 2P6MA 5LB4A 4TV8B 1AO0A 3I9KA 3EZLA 3EAGA 3F7MA 4QHYA 4OGGA 4OO3A 2CLKB 5CTAA 1L3BA 2QK4A 4FI3C 3DCIA 4H7FA 3TI7A 1BAPA 3B5EA 2QTHA 3VU8A 1J25A 3B1YA 2DQ4A 2I2BA 1MB0A 3IIEA 2YV4A 4GWKA 2E1RA 4MYUA 1FYVA 3D1JA 3L1UA 1X39A 4MITA 2OBXA 4OV6B 4OHUA 4R2MA 4V0QA 2PO7A 4NJMB 3DBHB 3T7RA 3R75A 4UBIA 2F1JA 2QT1A 3SF0A 5JY1A 3EQ2A 1VGVA 1BVUA 3F4KA 2NVBA 5C5EA 2WIBA 5EXXA 1MPXA 1IJFA 3JQAA 3EFEA 3SPXA 1EFCA 3PNOA 3CXUA 1HDYA 1U2DA 1CS0A 2E6KA 2XVMA 1X8KA 2GO1A 4FFPA 3K2QA 3QHAA 3OHPA 2HKIA 2P30A 4FGSA 1EXDA 5AJWA 2FR8A 2X3FA 2I78A 3V2HA 4MP3A 1F12A 3K32A 4H18A 4CDGA 1FFGA 3AEUB 3C70A 1XMPA 3FF4A 1GG5A 5KWEA 4DMHA 1G60A 2PJRA 1NP3A 1HYGA 2ID7A 3D4PA 3RC3A 2ATVA 3HBJA 4IGAA 3K9TA 1FS4A 1ZCJA 3ANTA 3DE0X 1FMLA 1JTEA 1SCBA 4ND5A 4O4HB 3RG2A 1ILEA 2RKOA 1ISIA 4LZJA 1JDSA 1GTL1 5B2ZA 2ZT7A 3PICA 1N0IA 1Q22A 2PUWA 2WTUA 2R6DA 4RCZA 3OAAA 5E2IA 4IY1A 3HK2A 1SCJA 3DXYA 3SF8B 2ON6A 1ZSNA 3OLCX 5F21A 2Z4TA 4CXMA 3VPFA 3ICWA 1NUSA 3LSYA 4HWRA 2O2YA 3HKCB 3GI1A 1EHYA 4CT5A 1AMNA 1I1HA 1OFUA 3H4MA 1MO2A 5GWXA 4PZYA 3SDSA 2YQ5A 1N5KA 4J29A 4BZPA 3A2KA 2EEZA 3I0MA 4IMIB 4X8HA 2W71A 4G2TA 4BNHA 1HRDA 1RHQA 3FPKA