4H1HA

Crystal structure of mccf homolog from listeria monocytogenes egd-e
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
327
structure length
327
Chain Sequence
SNAMIPAKLKQGDEIRIIAPSRSIGIMADNQVEIAVNRLTDMGFKVTFGEHVAEMDCMMSSSIRSRVADIHEAFNDSSVKAILTVIGGFNSNQLLPYLDYDLISENPKILCGFSDITALATAIYTQTELITYSGAHFSSFSMEKGLDYVMESFSDCLLQKEPFALKESATWSDDEWYLDQENRNFIPNEGLVVMQPGVAEGIIIGGNLCTLNLLQGTEYMPNLAGTILFIEDDFMTIPETFDRDLESLLSQPGADEIEGMVIGRFQQKTAMTAEKLAYIIETKTALQKIPVISGADFGHTQPIATFPIGGTARIDTNQTDKIQIIRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo1638 protein
publication title Crystal structure of MccF homolog from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Hydrolase
total genus 107
structure length 327
sequence length 327
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 4h1hA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 4h1hA02
4IIYA 3TLYA 1ZL0A 3G23A 4IIXA 3SR3A 5F5XA 1ZRSA 5F9MA 5FD8A 4E5SA 4E94A 3TLGB 2AUNA 5JYBA 3TLEA 4MJXA 5K99A 3TLCA 4H1HA 2AUMA 4INJA 3T5MA 3TLAA 3TLBA 4EYSA 4MI1A 3TLZA 5F1YA 4JVOA 3U1BA 3GJZA 3TLGA 3TYXA
chains in the Genus database with same CATH superfamily
4ZYVA 1NUSA 1PAUA 4LZLA 1DV1A 3HRIA 3WNZA 1R9MA 3ZJ4A 3Q40A 3BILA 3CLHA 4YAIA 4K6MA 1XRLA 4IJVA 2QZ4A 1IXSB 3C3KA 1L1EA 2PD4A 4P7JA 1UXGA 2QUAA 4MMZB 1UWCA 2JFFA 3SHFA 4DA7A 4D1YA 2NVUA 4E2XA 1O94D 3VR2D 4F1WA 4ECEA 2ZE8A 2ZJ7A 5IJWA 2FU5C 5T64A 2C7PA 2O5RA 4R5HA 2CNOA 2DJ5A 3LFTA 3WO1A 2YVKA 5FBWB 3E2MA 3IQEA 4IWYA 2QAJA 3ZUGA 1KI4A 1Y3AA 3I9FA 3RFVA 4DQVA 1XMPA 4PSDA 4FR0A 1NMYA 3VH4A 1FQWA 2FZ4A 1RT9A 1W0KA 4K6CA 2BM0A 4G2NA 1CRPA 1E4OA 4I36A 5KNCA 1W4AA 5DXFA 2OBNA 4AYXA 4RLQA 4OLJA 1BG6A 5CDYA 3JU3A 3WDMA 4XGRA 4GR4A 3K2IA 5J40A 4BQNA 2AI2A 2VOJA 1M66A 1NMSA 5D8DA 4ATNA 4ER0A 4EW6A 4CTNA 3C2QA 1JBQA 4OBBA 5GM1A 2BFNA 3G0IA 2XUZA 3F67A 1KDRA 4IH4A 4II3A 4ED9A 3KKKA 1WD7A 1X94A 2QDXA 4UBKA 1ZH0A 3HL0A 2IS2A 3C39A 1Z5OA 5ESXA 4JENA 5JLJA 3LECA 3R7DA 4KRFA 3SSMA 1ODJA 1Q11A 3N5CA 4MIYA 4H3KB 1OXXK 3GDFA 3VYRB 5CFRA 4CDJA 1D1SA 1ODFA 2V7WA 1GG8A 3JASA 2XV1A 3MERA 1USUA 1EYZA 4ESHA 1MKYA 4IUYA 4QBHA 2JH3A 1EFKA 4IMIB 4P7GA 3CH6A 3VR1A 3T4PA 1I2AA 4QQ8A 4CKZA 3B6EA 3ZK9A 4OQNA 4AMGA 3NORA 4W6ZA 2Z8ZA 4XD7A 5LBUA 4WI1A 3D7NA 3VPBA 1L7DA 3L4KA 1JDBB 1K8ZB 1A9XA 1XO1A 2EEZA 2A9FA 3EFBA 4XYMA 5DHSA 4UULA 821PA 4ESVA 3VU9B 3X0DA 4AN4A 2H2GA 2REBA 3HJAA 3CCCA 3ELYA 3IIEA 3QFTA 4QLBA 5B7GA 4LYFA 1BX0A 1FW8A 1IEXA 1V48A 1FYWA 3LUKA 1DEHA 4ZVVA 5FX2A 5B3JC 3AHIA 3G2JA 5E6SB 5IUNC 4FYVA 7ADHA 1QIHA 4QUAA 5EJ4A 1L5SA 3V1UA 3DNMA 3Q15C 3U48A 4TWRA 2CV1A 3ZGZA 4A6EA 1AK1A 2H9YA 1LC3A 2R5NA 1TMOA 1NHWA 3R7AA 3WRYA 1OIVA 2AC2A 1TEXA 1ECJA 1PQPA 4KACA 3GFFA 2VFAA 2W58A 3R7LA 1NT4A 2P7IA 2Q0XA 3NVDA 4PLFA 2XVMA 1AHIA 4QYIA 3S2SA 3S29A 3AF0A 5B37A 1T36B 4ZQGA 1T8PA 5GV7A 1Y4ZA 3MUEA 5CT9A 2X42A 1H2BA 4CTOA 1I3CA 1N5JA 5GVSA 1BVRA 2JIQA 1XKXA 3OZSA 1WBBA 4ETMA 1MGPA 4IS3A 2BUCA 2XMZA 2QV7A 1AF7A 4KN6A 4QUJA 1ULZA 4IYRA 1Y48E 2JH8A 8ABPA 4BRSA 5JV5A 1KZ9A 5KQPA 1B6TA 1G0OA 2Q3BA 1TA0A 2FK7A 3PA6A 4QOSA 5GJVC 2Q9BA 3QVGB 4XGKA 3EAQA 3B2NA 1TDJA 1GNTA 3WKCA 1DXOA 3UMJA 1QQBA 3GVXA 4PINA 4E5PA 3MYRA 5AICA 1Y6JA 3D6JA 5C5CA 3ICVA 3TAHA 2BRUC 2CCKA 4TWIA 1R4NA 4MNTA 4NYMR 1VL0A 2NU8B 5IZCC 5A6VA 2JBJA 5DBFA 3T3HA 1FRQA 1EWRA 3BDIA 4L95C 3S1AA 4MVJA 3ZWYA 1XYGA 4D0NA 5E9WA 2VZ8A 2PK3A 4WFKA 2Y66A 4BKRA 3GDGA 3R9KA 1A04A 5C7IO 2OFFA 1TB4A 3C5VA 1P4HA 3ODGA 3DMFA 4RF2A 3RHZA 4C30A 2IGBA 1U28C 4X7MA 4H1WA 2YZMA 5EJIA 4ZT2A 2GPWA 3QLUC 5C1PA 5FFNA 3QHAA 3HUTA 1FX0A 1AGNA 1VI6A 2B4AA 2B61A 2FPRA 2LVBA 2O7QA 2WBLC 4UHCA 1G42A 2NXEA 2EFJA 2A6PA 3B36A 1TIPA 2A1UA 3HCCA 1CRWG 3TD6A 3MS2A 2GTPA 3L43A 2R85A 1MTOA 1L7RA 5BWLA 5SZJA 2XWJI 3BWVA 5HMLA 4ALMA 4DA4A 2HN9A 2FXVA 4BP1A 1BU8A 4Q9KA 2H11A 4AB1A 3W8RA 4TVOA 1Y98A 3IIJA 4IIBA 3GZNB 5DBOA 4CG1A 1SZCA 5KS2A 4BGVA 4YJFA 5B7QA 5IAKA 1PGQA 3SF8B 3WGZA 1VFPA 3CLRD 3H5LA 3K6SA 4CM1A 2ID9A 4UREA 2I7DA 4LRSB 1PFVA 3AV0B 2XCRB 1KI6A 3TSCA 4MA0A 3G23A 2BKUA 1XPJA 1JTFA 4X1OA 5EZSA 4HAZA 4NHOA 3M5PA 5TQ2A 1NNSA 2BKVA 5IWCA 3L8FA 4NZ9A 3HGQA 1C8LA 3GA0A 1RTTA 3VNRA 4UU8A 4YCAA 2XEJA 1L7XA 3K70C 1U9YA 2VQSA 2IIPA 2Y4OA 3L49A 5C32A 3DXXA 3EVNA 2BMWA 3MPUA 3OAAA 4FFRA 3SYKA 3A0UA 3D1JA 2Q9UA 3R7WB 1P3JA 1T6BY 5TPWA 3WNBA 3PHGA 4RK1A 1WZUA 5KPDA 4PQEA 1XJWA 1LQTA 3T5AA 3MB8A 2WWGA 1YZNA 3MJ4A 4Q02A 1F9EA 4ECAA 1F6DA 1RAGA 3IKMB 3M89A 1ZJZA 4HQ6A 2FZGA 1JQBA 4MS4A 4OLHA 1ZS9A 3L7LA 1A2OA 2AZTA 2FDXA 2YRXA 4M87A 3S2IA 2VDNB 1NVXQ 3N7UA 4K05A 4B47A 1C1YA 2PLAA 4X60A 2D7JA 4ZVLA 4B6SA 1ABFA 1E1RA 4BKOA 3HBLA 2W6IA 3A8TA 3O2NA 2DU8A 4OC2A 3U3DA 5K0CA 4K9SA 3TJRA 2C2XA 4MULA 4DMFA 5KYWB 2JJ2D 4DB4A 1YDGA 2K5UA 1LPBB 1W4CA 2C59A 3CC8A 4Q34A 1VZ2A 2GQ0A 2VJNA 2C9ZA 2VVTA 2GZ3A 2BYTA 3FPJA 3EAGA 3EJWA 4DBVO 4I5EA 2GJ4A 2TMKA 3AJ9A 1ESNA 2G70A 2ZI6A 4IHJB 2HI6A 2HC9A 3E18A 2R47A 3DOUA 1SC3A 3E0XA 1U3UA 4TTTS 3K09A 4JI6B 3OZRA 1CZUA 1W5AA 4O4JB 2PGIA 2Q1XA 2PZBA 1FP2A 3U81A 3WP0A 4YALA 5DF1A 5E1DA 1GA6A 2FPXA 1C4WA 2QGZA 4MJLA 3AMVA 3TEMA 1TE2A 1W85A 1M34B 2BP7A 4RSHA 4BGEA 1PVOA 4EZBA 1TJ5A 4KTTE 4HPWA 3GRFA 3CVVA 4EMTA 2VSYA 2JBAA 3A3NA 4PTZA 3NHPA 3D4NA 4FWBA 1M7GA 1ZM4A 5G1NA 2FX5A 5H1YA 1FSSA 1FF9A 2G4LA 4YUAA 221PA 4DGQA 1UMCB 4C8AA 4OXXA 4XLLA 1A1VA 4BQPA 4LG1A 3AR9A 3WWDA 4PC7A 3L7NA 1RR6A 1Y4UA 2VLIA 2L42A 1B0ZA 3DL7A 1JJIA 1YZFA 3RJMA 4DYHA 4J4TA 4M38A 2NSLA 4KE7A 1OWOA 5JI2E 4TX1A 5JLAA 3GAMA 1MB4A 1U65A 3L1JA 1ESCA 1XZQA 2B30A 1SXJD 2COEA 4C4SA 5BWBA 1R6TA 2RD2A 2HDWA 1NXVA 3QELA 1VRVA 1F0KA 1FTSA 2GJSA 2XB8A 4YV1A 4G5SA 5B3AA 5CAEB 4RULA 1VI4A 3Q1LA 1K6XA 3AI1A 3FMPB 5I9IA 4LWOA 1DC7A 1AQJA 1GQRA 2B8EA 3WAJA 1D6MA 2O8CB 4IKPA 3SFZA 4LF4B 4D0SA 2ZRLA 1L4FA 2GZ2A 2H2FA 1CD5A 5A3VA 4NCBA 1YHYA 3L8YA 1E5TA 3K9HA 1YZHA 1FPMA 3DDNA 3R0JA 3H5TA 1C3LA 4CTKA 2JIMA 1HT0A 4JXXA 3PQ6A 5L4NA 2JLXA 1MH1A 2CNBA 2W8BB 3KHSA 3WK7A 1M74A 3AHEA 4L0DA 1K9VF 4DDVA 4C9RA 1V3VA 2K6GA 2HPVA 2PGOA 2VH1A 4IRXA 2BFCB 1F0PA 2RDMA 4KB5A 3AIOA 4LBZA 3U44A 1RYYA 4DGSA 3KZVA 5L3VA 1P77A 1IB0A 1QP8A 2CMDA 3CF4A 4MUMA 1J09A 2GNAA 3DT8A 3OHSX 4I6EA 2WOOA 2FSUA 4J0KA 1Z15A 2V5VA 3RUAA 4DA8A 1THGA 3BXHA 4CNQA 3F71A 3OURA 4EBFA 1J2JA 5IMSA 3WV4A 2ZAMA 3O2QB 2YV1A 1MJHA 2FSIA 3BE8A 3E1GA 1PKXA 3EZ9A 1Z25A 4MROA 3U3OA 2KBFA 3PYLA 2M1ZA 3E3MA 1WLSA 1YR6A 2IX9A 1O03A 1OSNA 2HJGA 4OGFA 1KZ6A 4B4DA 3MOIA 5KNCD 5CPFA 3C3PA 5GZ1A 2QN1A 3TSYA 5CB8A 1M5UA 5EIBD 1XNQB 5EJ7A 1PD0A 3P19A 3I6QA 1I14A 1US8A 4QELA 3LA6A 1F3OA 1JECA 4QGBA 1H4TA 3K9WA 5CH3A 2QUKA 4FFPA 4FNAA 4ZQBA 3V4VB 3H2IA 1JZSA 4D41A 4F71A 5C52B 1MAHA 3DMGA 5IWAB 3NATA 2WSIA 1ORHA 3LK7A 1SY7A 2ZAYA 2OAQ1 3KOXA 3LOQA 2IXBA 2AEEA 3QVXA 4WBNB 1WBJB 5IKPA 3H2ZA 5BXYA 1EGMB 3FNGA 1XRPA 4KN8A 3ITKA 4YROA 4DG9A 2GI4A 1OJLA 3D7MA 1HSZA 1FDUA 3DHEA 3N7TA 2OFOA 3OOEA 4GF5A 1H0HA 1KMIY 4GI1A 4WVFA 2O07A 4LI3X 1DFHA 2OY0A 4P8RA 1X9HA 2JRLA 4KWTA 3KL4A 3AM3A 3OZGA 4NICA 4X1KB 4F85A 4WADA 3BJIC 1IXZA 1GU7A 1NJ2A 3FMFA 4TLMB 4ZO9A 4KITB 1MW9X 2FRXA 2YCBA 3OU7A 4YQEA 1OH7A 2VRBA 3KEOA 2J7PD 1ZL0A 3KQSA 2Z57A 4OL0A 1QPGA 4MR9B 4TT3D 1F1JA 1QHHA 1RWVA 1XQ6A 2PZJA 4XD7D 2R8YA 4OHMA 5FD8A 4AUEA 4E1BA 5BUZA 5CD9A 4UJ3A 3C45A 3FSRA 5B53A 4E33A 2NXWA 3QZUA 1JFLA 2AL7A 5AKEA 3C7TA 3I5YA 3IP5A 1TK3A 3S8YA 1YFJA 5C46F 3OUUA 1P5RA 2F3SA 3T6KA 2CD9A 3K0AA 4Q18A 5KSPA 3EGVA 4I1VA 3MRSA 4A6DA 3U61B 4AJIA 1E1QA 3DQZA 3TOVA 3CZPA 1HM5A 4UEOA 2R7NA 4LI0A 3IDQA 2XNKA 4M1YA 4IX1A 1UQUA 1NDUA 1VBNA 3CSSA 4CLOB 1ZR2A 1UFRA 4F12A 1SCUB 3SKYA 3VX4A 1WIWA 2OZVA 1WTCA 1FU4A 2ONCA 3GNQA 2WP0A 5B4VA 1K4KA 2P0EA 5T4BA 2JFUA 3OE7A 4RD1A 4I66A 1ZUD1 4PY2A 2Q7DA 5KUTA 2QAGA 3HH8A 3CLSD 3M6MD 4W4TA 6Q21A 1E9CA 1KJIA 1WX1A 2ETVA 4RKWA 4DLBA 4AZSA 3ODPA 4Y9RA 2EL7A 3P9SA 1PF7E 1W2GA 3K8QA 1DC6A 2G04A 1L4HA 2CB0A 2KW5A 3G0GA 4YFVA 1NW7A 5DBIA 1RI4A 3O47A 5TR9A 1Z4OA 4B7UA 3ECAA 5IXSA 2BH2A 2NX2A 1C3OA 3C3JA 2R8OA 1U0FA 2WM3A 3DMYA 4R54A 2C0CA 3L7JA 3JWPA 4RHTA 2WF9A 4R4JA 3TIXB 4DXAA 4YCBA 4J9UE 4K6FA 4BLUA 2F1RA 1LGYA 5DFAA 4YAOA 1IHOA 1GGKA 2VJPA 3C74A 5IKOA 3V8BA 2QD1A 2ZDQA 3IT0A 3WI7A 1SUFA 4Q5IA 5K0LA 2R8BA 5D1NA 3U5TA 1QQ6A 1PTJC 1DO8A 2PRJA 2WTMA 2P2YA 4WLOA 4Q37A 4WXEA 1NSYA 1SVLA 4RFSB 4BNDB 4C04A 1A72A 2C82A 1TJ3A 4OKNA 2DT8A 4KN5A 1KTVA 3NBZC 4LJ8A 2BKEA 3TTVA 3WMXA 2C9DA 1OLSB 1FJGB 1YZQA 5HGXA 5IS2A 1J0CA 3OWHA 1OFTA 2IVFA 2WF6A 1R0XA 1HKUA 2C57A 2LRHA 3TI7A 2H7CA 1E2MA 2LIVA 4ZAYA 4MV4A 4Q47A 3ASYA 4MUEA 4D9BA 2A1TR 1L5OA 2UZAA 1N8KA 3U3RA 4BMPB 2C2MA 4GLJA 3PXGA 4PPYA 1Z39A 3N8GA 3VGJA 3RLIA 5CFLA 4LC0A 2D54A 4P08A 1DEXA 4DMLA 2QYSA 5KTRA 1DHRA 2X19A 3E4CA 4ZQIA 2BDTA 3DO6A 1TAHA 5IF9A 2G72A 1LDYA 1E5LA 2OSVA 4WZZA 2Q3MA 1UBEA 1VIAA 1ETUA 1TEHA 2I6SA 3OICA 2D7DA 4O4HF 5JVDF 3BYZA 2CJFA 4ZI7A 3W5HA 2JGDB 2JFHA 1EPUA 2OPBA 3GY0A 4DA0A 1MEEA 4R2WA 3TW8B 5BRJA 2FCRA 2GM5A 3ICWA 2JATA 4KDCA 2IQ5A 5DYTA 1L5MA 5E2IA 2VYQA 1II8B 2OV2A 5AK5A 3QPVA 3BA6A 3KVRA 1YK1A 2F8TA 3PEFA 1G3IA 1GEGA 3IP7A 3AP2A 3FUUA 4D9MA 2W71A 3EF1A 2Y0EA 4GOND 4YJGB 2JGKA 4AF6A 4TXJA 1QZ3A 3JWIA 1A8UA 1NJ1A 1YOVA 3LDGA 3LQQA 3UJ8A 4F91B 2YQZA 4P2GA 4DJDC 5J9FA 3H3XA 2EBHX 2QUBA 5TGTA 2ZTLA 3CQ9A 2NO1A 1R16A 3LCMA 4MDYA 2ZPTX 1E6UA 3EC2A 3TLEA 4K6GA 2EFGA 3OAAD 3H75A 3UC5A 3W5CA 3UMMA 3U17A 1IPHA 2Q2QA 4KBYA 4TWBA 1U2TA 5HXAA 3DL4A 4KV7A 2C4UA 2BZ1A 1L7EA 1JS1X 3I12A 4QOIA 2HTEA 2O8FB 2PVVA 5HIIA 2JARA 1GCAA 1IAQA 2ZJOA 4OGGA 2C98A 1X92A 4M9QA 5DASA 2JAQA 3FTFA 1BN7A 1J23A 1VHDA 3KRTA 1O54A 1PWZA 3NWPA 4RLFA 1ZUHA 3LLUA 5GY7A 4HRVA 2D06A 3I92A 2Q21A 4FP9A 4WESA 3PDIA 2O6HA 2EP8A 4OFZA 4W9NA 1PUIA 1WTAA 4CI0B 2PZEA 4K1XA 4EUHA 1NG1A 4LV6A 4UHKA 5TQ0B 4OU5A 2XMDA 4LPKA 3CNNA 4K9PA 4HYYA 3UC9A 3VM6A 2QY9A 2UVDA 1J21A 3PQ8A 1XEXB 4PX2A 4C5CA 2YBEA 2YQ4A 1DUIA 1UIRA 2AUMA 2GPBA 3HNRA 4JA0A 4M1OA 5E6RA 1WMFA 3E7FA 3LYAA 2UYYA 4EATA 3U6BA 1RPNA 4CM4A 1CEQA 2HW8A 1C7IA 1VPTA 3KJEA 3RUCA 5TMPA 3I76A 2P62A 4V02A 1HEUA 2OO5A 2VK8A 1LY1A 3K05A 1TYAE 1Y3FE 2P6PA 2YDXA 1J8YF 4BCBA 3IVRA 1NXTA 4HDOB 3NHWA 3LQ1A 5L6MB 1ZD5A 4KODA 4TS9A 1JKMA 4XJXA 5I7EA 2NU9B 5C1OA 3T9EA 4NYIQ 2VQDA 3AVWA 2IODA 3TDMA 1G5QA 3T41A 4G1VA 4CDKA 3SBOA 1WWKA 4C03A 1DCTA 2VDMB 3V7UA 4W1RA 3SLRA 1OBCA 1D03A 1UP4A 2O0KA 3PF8A 1GGFA 1YR1A 3M9XA 2HOQA 4LKOA 1MRSA 5ALXA 1AGXA 5A4DA 1NW6A 3V3TA 2ZOSA 4RE5A 4N7BA 4RIGA 1Z6GA 1NN1A 1Q14A 5C81A 3F3SA 4BX3A 3STUA 1CIJA 3KKPA 1FUEA 3CLKA 4BQIA 3JQAB 5FUQA 4RWZA 4EENA 4R9SA 2AEMA 1LPMA 2G9VA 1CU1A 4POOA 4TL8A 3ZYCA 1DBWA 4PLYA 4XARA 3L05A 4II2A 1HE1C 1EFDN 2CLMB 4YV2A 2FSPA 1NSFA 1YQEA 3K4PA 4QPNA 1R61A 2XA9A 3A1FA 3JW8A 5EJ9A 4F97A 2WF8A 3AIMA 2IYLD 2JLBA 2H18A 1M1YA 2AX3A 2IXDA 3QJ5A 4AVYA 3BGDA 4OV6B 5HA5A 1UDRA 4A0RA 4BP8A 2WEKA 3H83A 3WYBA 1CUCA 1BXGB 1NUPA 1T43A 5FTMA 4I19A 1G6Q1 3KQWA 1A9YA 1ETHA 5FO0A 1P7CA 1OBHA 2XLBA 3V55A 2CCGA 4UPEA 2R6HA 3C6KA 1XTIA 5FT9A 1Q21A 1X1AA 2EDAA 4PANA 1FYDA 4IV0A 3T8YA 2P2CA 1ADBA 2VXYA 2JAHA 3WLEA 5KWJA 5BYJA 3OT5A 1X1RA 4O2AB 4I9GA 2R96A 2OTCA 2O1XA 2PV0A 1SHKA 1XHLA 4XJTA 3R9XB 1APBA 1W96A 4IJQA 2Z8YM 4UUOA 2I2CA 2ECKA 2WF7A 4BKUA 3T3EA 3EVDA 4Z7NB 3MGAA 5AUOB 1HX7A 5CXSA 3CA8A 5A04A 4TJXA 3LKZA 1ZJJA 2E55A 2CEAA 4LX8A 5DMXA 1EDDA 3ICOA 2GF9A 3K73O 3PUXA 3BN3A 2OKCA 5I9NA 2ZTVA 4RTKA 5GIPE 2TYSB 4E03A 1O3YA 2FGKA 3AI7A 4X6LA 3KKQA 4H0CA 4ENTA 3PJRA 1Z13A 2QRNA 4OC4A 4FYHA 2QVYX 8GPBA 2P6NA 3QUQA 2O8NA 2I5PO 2R8ZA 4PNPA 3BQNB 5ARDA 4A1FA 4ON9A 4WAUA 4JS0A 3I3SR 4Z0TA 5I5EA 4E1AA 3DF7A 2OORA 3E9ZA 4MHTA 2NV2B 4GP6A 1ZP6A 4GKBA 5B57C 2MP0A 1Z5NA 3UO8B 1UBJS 1ZWLA 4F45A 3KE8A 4NATA 4EJ2A 1J2UA 1P0PA 2X41A 3D3WB 1B6RA 1BQEA 5AKIA 2DPGA 3E6AA 2IPXA 3EFOA 1R0KA 1NM5A 3A6GA 1CG6A 4WUTA 1E32A 3H1TA 3TXYA 4QBIA 4X6YA 3NJ8A 1A9PA 2BN4A 2HLPA 5FKJA 5HF6A 3KYCA 4MPJA 2M98A 1Y8AA 4MWDA 2K2WA 5EP2A 5JC1A 3HJRA 4Z9AA 3VSDA 1R6UA 1UM9B 4DAOA 3M1LA 2FWBA 5NULA 4H4CA 2J5KA 1QYVA 5C80A 2D1TA 2WWHA 4HB4A 2HMUA 4WJKB 1U3DA 2IP2A 2JJYA 2H5LA 4QTTB 4HQOA 5SYMA 2JJ1D 1DWUA 1KYWA 3GXOA 1J07A 3U3ZA 2VTKA 3DOIA 1JAZA 3JS5A 2BM9A 2IW3A 1E1QD 2BE9A 4TXNA 1W581 3T1OA 2BM1A 1KDOA 4FGZA 4GOXA 4CBVA 4HF7A 3LYHA 4AZ0B 2W2XA 4EP1A 3LTEA 3NEAA 4IIHA 2ZUFA 3QJYA 1Y37A 1ZMBA 3I39X 3R5TA 4WE3A 1ZIXA 1R0BA 1SEPA 1C0PA 1STOA 1L4MA 1ODKA 1C80A 2A9QA 1VIVA 2NP6A 5IDYA 1Z45A 2RAPA 3HZZA 4CGYA 4DLRA 2MYTA 2ADMA 3FSGA 3K1JA 1FIUA 1DJLA 3CF2A 1U7ZA 2CF6A 2HV8A 2WT8A 1WDKA 2A5FA 3ED5A 3DD1A 2RHDA 2I62A 5DZSA 1DAHA 5WRFA 5CX1A 3RYHA 5K6AC 2RGEA 1M2OA 5HIAA 4Z2AA 4LVUA 3C98A 2YVLA 4QQRA 2O2IA 1N2EA 5K3FB 1IN5A 5A9SA 1EFUA 2J59A 4HNHA 2WT4A 1EQ2A 1EZAA 1DKMA 1KJZA 2AS0A 3OQIA 2GFQA 4DA6A 2FUEA 2WSSA 1O2DA 1AQUA 3DAYA 4HS9A 1BEEA 4GPBA 4P54A 4ZT3A 7ABPA 1NBME 4FYXA 4C01A 5LP6A 1N92A 4KYIB 3OZIA 4TV8B 3RS9A 3FKSA 4V0ME 4DOMA 3EMKA 3JQQA 3DR3A 2DJIA 5AR1A 2GZMA 4ZFNA 5JSHA 3OWXA 1M2VB 5CA0A 2J5RA 3IO5A 2OCKA 3O4FA 5LXTA 4H1VA 5DM70 2QR5A 4QJ3A 1QMPA 2PUCA 3AT1A 1Y4DE 2O48X 2I34A 2PAFA 4HKTA 5D6NA 4KAJA 5LP1A 4AKSA 1YUBA 3SQMA 3L0SA 2C8VA 4PFKA 2WD7A 2PSEA 3KEGA 4BDTA 4DR7B 1E59A 1XEWY 4BMVA 1CX9B 4AMYA 1E2GA 2I22A 1ECCA 1L7QA 1XTBA 2HQSA 3O95A 2C00A 1JP7A 2X9QA 2FMUA 1T9CA 3ECSA 1XD9A 4L07A 1EUCA 1PG2A 3FYTA 1Y7HA 4HMOA 2WMDA 1G6OA 2GASA 2O3TA 2D0OA 5K8LA 4D9KA 2DQ4A 3O7MA 3B9BA 1YNSA 1Z4NA 2M6KA 1X7XB 2XUQA 4FLFA 2R00A 3AFOA 1S1MA 3VHLB 2BGWA 2YIVX 4QU5A 4TTRA 3SM3A 1Z0JA 4TTPA 3PRYA 1FSZA 4ONEA 3WLAA 3JPYA 1SIBE 3N0VA 6YASA 2FP4B 1HYBA 2CWWA 3A36A 4P4TA 4XVCA 2FEWB 4JLWA 1GPYA 2WFZA 1A9SA 3B9RA 3KKLA 1PIWA 1Z74A 3PS9A 4DSNA 3OFNA 3LQFA 4RA9B 1YCDA 4BDSA 4B3IA 1XFDA 4BYMA 1LXCA 1U0SY 4KO8A 4PN3A 5J4HA 2AXPA 2ZWMA 3TTXA 3PC4A 4XX0B 4D4KA 4OMCA 4PTLA 4A91A 3A3PA 1NBAA 3D5QA 4J4HA 3WMWA 2VP3A 4AJEA 1AQLA 1HC7A 3F5DA 4N39A 4P82A 3KQHA 2C7OA 3DDSA 1K7CA 1FFHA 1PL8A 4G0ZA 5CJ2A 2XDAA 1I3NA 1I4LD 5AHWA 5DYGA 5ICEA 1UKBA 1SGWA 1VHJA 4JOBA 2PUDA 3H1PA 2RB5A 2F43A 1L7OA 3G0HA 3UMBA 1H6DA 4NU5A 3A2LA 2OXCA 1B73A 2YHUA 4TTSA 1GRQA 1L0BA 4XGNA 1J8DA 1U8YA 5JADA 2J87A 3GQBA 5IC5A 3IIMA 4TYQA 3T9DA 1LS6A 3CPSA 2PH5A 4HAOA 1N4AA 2OZKA 1JQLB 2C03A 2E4XA 3EZ2A 3T7IA 2A0KA 2J41A 2L69A 1YR8A 3E22B 2V4ZA 3G2KA 3JQ7A 3T3MB 3LDAA 3UWKA 2XRFA 1A71A 3MQFA 4G25A 5IR2A 4P33A 3ADBA 5HFAA 1ZRMA 2ATIA 4BXOA 1K6EA 1J4AA 1Z2AA 1ADFA 3N58A 4R83A 1YC2A 2KS6A 4W7SA 5BVHA 1TUEA 4KZPA 3KT0A 1XMOB 2CLKB 4ASUA 3EXHC 3C5CA 4L9WA 2A5LA 2QUIA 3HWWA 5THKA 1FU7A 5TXGA 4EI2A 1V16A 3R3YA 1PGOA 5I4CA 5IAOA 5LA6A 4O4JF 4DEYA 1ZVQA 3DLAA 1XZMA 2VSNA 1RQ7A 1HTTA 5J43A 1KK0A 3MF4A 3AI3A 2VH5R 3IRVA 3H04A 3PIDA 4RPCA 4X95A 5GP1A 3RU9A 3TB4A 3ZWDA 2QQ0A 1DTWB 1QLWA 2MYPA 2CUTA 4M86A 1KAGA 3CZQA 4FOOA 3DZHA 3ZVRA 3DLTA 1KXZA 3SXPA 4EPWA 4AN1A 5KC8A 1O95D 1QP7A 2C83A 4ZDJA 1YZKA 1AKYA 5K6RA 3GJ5A 1SQFA 3HUDA 4MS1A 3STWA 2HF2A 1F2TB 3VR4D 1Y80A 3KAJA 3R75A 2HCRA 3VO9A 2A0XA 3NVAA 4H1TA 4AW9A 1EUYA 3D54D 3SJZA 2KQUA 3G7UA 3NHYA 2B9EA 3O1JC 4IWXA 1YHNA 1WU7A 3HDVA 2VF8A 1BA3A 1R0WA 2QYTA 3D0RA 2VAVA 4ZCLA 1LLUA 4D9JA 4ZI2A 4BB9A 1U8CB 3EASA 2QA5A 2V8OA 4LXQA 4H59A 4MW7A 2O7VA 2VBIA 4TM8A 2V55B 5IP5A 4ZKDA 1M2FA 2GPJA 2PRYA 1VRCA 1Y1RA 3JYPA 4KFUA 4M46A 4RTOA 4FR5A 1PQ4A 4CMBA 4CQMD 2EZAA 1KNXA 4C87A 2DMRA 1NQWA 4OXQA 1LDNA 1TKCA 4FI3F 1SVIA 5EHQA 4ZVTA 1LNQA 3NBMA 3AVXA 2CJYA 2GK6A 4X64B 3RV3A 3QA9A 5DI9A 1WPQA 2C3OA 4GW3A 4ZCIA 3FEEA 2ZIZA 1FTWA 5DLEA 2FRDC 5EZQA 5CEFA 3VJRA 4FMCF 1PV1A 2AQIA 5GONA 4PVDA 4I4TA 5KB3A 3PB3A 2R6R1 2NPIA 3JALB 5KTMA 2DWQA 1ZW6A 1Z4PX 1EINA 2O59A 4RZ2A 4Y2TA 5C8XA 4F3NA 2TECE 3A10A 4CIYA 2VCHA 3OPYB 3ZU4A 1PT6A 2FUKA 1NXOA 3G68A 4GPIB 2WZDA 3E4DA 1GNLA 3G85A 2ID4A 1P2TA 4Q9IA 4R2LA 1WZEA 3C8MA 4CEHB 2ZPAA 3MMNA 2Z3VA 3ROKA 3TQCA 3Q8LA 2PWAA 1P1RA 1D5CA 4Z7JA 4N6OA 1T3GA 4JDPA 4HH4A 1BEZA 1NN5A 3TQOA 1L4KA 3ZBUA 4C1NA 3IODA 5F5NA 2SCUA 2JFXA 4NBWA 2VWGA 4LIPD 2GBIA 3SC6A 3WYEA 2DKFA 1TCUA 4GOOD 3MWDA 5DW3A 4EG0A 3IAM6 5KDDA 2ACKA 1TJNA 1ZKMA 3ETJA 2ZYHA 3G6WA 5EHIA 2F3QA 3DW3X 5EIWA 3SJAA 4IIJB 1N32B 2HWWA 1JR3A 3W6UA 4WBNF 2ZBEA 1NV9A 1T0JB 4EGJA 1PK8A 1VMDA 4PN7A 2GKOA 1T24A 1IXRC 3QQPA 4F1KA 4ZAWA 1JJ7A 4ZQEA 3UWOA 4QQKA 3IDAA 1CR0A 5FFMA 4TKLA 3LXUX 5IEBA 1UJCA 2HMYB 1Z6ZA 3A70A 4TYYA 2C78A 1E0DA 4DDTA 1JB9A 1A5BB 1K89A 2ODTX 1RLIA 1O5OA 2ZS7A 4LRYA 5AKLA 1D04A 2WZBA 1F6BA 5IG2A 3HYNA 1KHHA 1LBHA 1DU4A 4OI4A 4UPVA 3LI2A 1CFJA 4H2DA 4G56A 3TLGB 1GGEA 3F74A 1WLYA 2XUJA 4U02A 3TS1A 1GN8A 3LSYA 2Q1WA 3MEQA 3PICA 1UK7A 4IO0A 3BKWA 1IE3A 1V5WA 4KX5A 5AI4A 4CEJB 4O4LB 2BEWB 2PEZA 2GYUA 2HRQA 4CIAA 4FUQA 2AFVA 2Z58A 4RD6A 3PT5A 2CYBA 4Y7CA 3P2IA 4WJLA 3QBTA 3AH8A 2IS4A 4L4RA 1GTMA 2DGDA 4KIFA 1RVV1 3IP1A 3VZRA 2ERYA 2B2CA 4WIAA 2ZRIA 1L7NA 3KALA 4JT9A 3RGWS 3CZ4A 4HC4A 1VYHA 3VZCA 2FSVA 1T8RA 1XZGA 4BV2A 2F3UA 3WTBA 2CNKA 1EUDB 2MSEB 1SURA 3EARA 4A8JA 3DCYA 3Q5DA 4BQEA 2F8SA 2XTJA 4B87A 1V37A 1QG6A 1YIAA 4GT1A 2C92A 1K5GA 4EFMA 4HATA 2C5AA 1JHMA 1DTSA 4FHEA 4O1MA 4MUXA 2O2CA 2ZCJA 4ZZ3A 1XTKA 2X58A 2GERA 1EJ0A 3IAS1 3NTXA 2HEIA 3OQMA 4C7XA 4ZVSA 1OXSC 3ZVMA 5AXBA 2C20A 2R7AA 4QXPA 1P7WA 1EDEA 1SZPA 3FSGD 3UV6A 1G7TA 3JZMA 4RHEA 1ULBA 3LC1O 4MPDA 1VA4A 3V1LA 1X80B 4EB6B 3CVOA 3NTVA 4G0OA 5EVJA 5TVGA 5JR3A 1X1DA 1GKUB 1N3IA 2I6TA 1GSOA 1T2VA 4TTJA 3AVYA 4FN4A 3SM9A 5DMHA 4QRHA 2WUFA 3G9TA 4MVJM 1CW2B 1XA4A 1XNJA 3QVOA 4BO5A 2HO5A 5G40A 1J9EA 3GZTB 3UWMA 3KJGA 1NPDA 4CR7A 2JVJA 4L1KA 1T0HB 3KPWA 2VP9A 5HF5A 3RK0A 1FDRA 3D7LA 1AD2A 1ZLYA 5ALLA 5C1BA 1NBWA 2OB2A 4MUFA 5B30A 2A9OA 1S5PA 4HQLA 5HKKD 2BONA 1MORA 3JQFC 3RTCA 2JL1A 1JR4A 2D59A 3A9CA 5EIOA 4INZA 4ZOCA 6CHYA 4X6UA 4EWLA 8OHMA 1NDHA 3TL2A 1TADA 1AMOA 4JBXA 1P1HA 2ZATA 3EIQA 3OLZA 3HFRA 2C2OA 1TQHA 1ZU4A 5EHNA 3UVEA 1F48A 4RJ2A 5TPZA 1I5EA 1KYZA 3HEMA 5KHOC 4KO3S 3F2VA 2F1HA 2MIIA 2OHOA 2XGSA 5D01A 3OE1A 1H42A 1TD1A 3EVAA 1OWPA 3INNA 4YUXA 4JBIA 4M1WA 1Z75A 1SR8A 1KKUA 2VK1A 4UD6A 3F6RA 2ZUEA 4RKYA 4BVFA 3HJCA 2QMQA 2H7XA 4CUZA 5AESA 2I55A 2AW3A 2WAXA 2RGXA 4DLKA 1XDDA 4TKUA 4ND8B 5FPHA 1SXJE 2WM9B 3QNMA 4NJOA 1P3Y1 2LTAA 3GF4A 5IJZA 1AC5A 3TGWA 1W4ZA 4I4NA 4OXRA 4B45A 3HDHA 1IUNA 3ZGYA 1KO8A 1WEKA 2HMAA 3E48A 1T1SA 3FDXA 1NONA 3KJXA 3UV3A 5AM2A 1Z2CA 3DDUA 3WYDA 2DG2A 4R2IA 3BORA 1CV2A 4UEJA 1XKTA 4C2UA 5FLKA 5CDFA 1W73A 1IY2A 1E77A 3DM9B 2VOEA 5E0KB 2QN2A 3DPIA 4HYQA 4L6CA 4N0DA 2OBXA 2F3RA 3RWMB 5IT9A 2G83A 3RU3A 5I4IA 4ER7A 5AVWA 2LDXA 4C8FA 3ZD9A 4CFYA 3BJMA 3M7IA 4K9LA 5ITWA 3A2NA 4YNBA 4OMFG 4C78A 4W5OA 4KUGA 1HLPA 3ABQB 1HE5A 1VECA 5JJ5A 3OQOA 2ECOA 4C6SA 3X43A 4JYWA 1SG0A 3HHEA 2BUBA 4MUJA 2HA7A 1R8SA 4EA7A 1YMVA 3R8XA 3B6JA 3GFPA 3NG1A 2PMFA 4MV5A 5F2NA 3U7QB 4G2TA 3WWPA 3RTAA 4WOCA 4BO8A 5TIIA 4G4SO 4KTVE 1PWEA 1THTA 1TVCA 4O0MA 1L1FA 4E22A 3H11A 4UAJA 3RSLA 2Y1OA 3BXGA 3HKCB 3JV7A 1W0CA 2A57A 2FW1A 3Q0TA 1G98A 2WJZB 1C0LA 4W6QA 4C0XA 2XOXA 3ZE8A 2PJRA 2QQEA 3AR4A 3PUYA 4MQBA 1QHYA 1Z5WA 5H68A 5TC4A 3S2FA 1R8QA 5HZKA 4MX8A 2YWRA 1IM2A 3SS7X 3EVZA 1RWBA 4Q1VA 4N54A 2HGZA 10MHA 3PFKA 2Z9DA 2E4AA 2GAJA 3CVJA 4NOLA 5JYCA 5EI5A 1EJBA 2ST1A 3B38A 3U31A 2OBMA 4D8UA 4OKIA 2LCQA 3O7WA 1Z38A 2FJ0A 1T1JA 2PZAA 4J76A 3I9V6 3FX2A 3HQ4O 1RBMA 1HUQA 3H0KA 3JQ8A 2GYVA 1GOTA 2ZLBA 4G89A 3UB4A 5JATA 3ZVKA 4IDOA 1SUDA 5D7NA 4LQCA 2P2SA 3QFHA 2ZCUA 5MFPA 5EXSA 4ZK6A 2W6QA 1WKVA 5HE9A 2WHYA 1GTSA 3EIOA 5AKJA 1PBNA 3KUUA 1LV8A 1P0FA 3W2TA 2WYWA 4YGYA 3WAGA 3FN4A 3I2KA 1O94C 2XOKD 2CFCA 4GIBA 4RM2A 4E30A 3V4SA 3NEPX 5JJIA 1XCLA 3RAJA 3UGTA 4JLDA 4QC2A 5DM4A 4BECA 1IL0A 1JPJA 2EJCA 3ZCTA 1FFXB 1ECPA 1NIJA 2G9QA 5YASA 3PC7A 3U7EB 3GRCA 2NU7B 3WL8A 2ZSHA 2GN2A 4LXIA 1Z4JA 3NYRA 4I5FA 1E7QA 2JPDA 3C4VA 1IZYA 3GRRA 4U2GA 3Q8WA 5FEMA 4TKVB 2UXCB 2ZRFA 2A7XA 4TXMA 1CIVA 4XWYA 5REQA 4DTIA 3VO2A 5E7JA 5L4LA 3F49S 3KK0A 2YDYA 1I3KA 5LQRA 3LIIA 3FYUA 3PWSA 1HRDA 5DGTA 4ZDWA 2GT1A 5LUBA 4KIUA 4R0MA 1FNMA 3SIPA 2QBYA 2QRZA 4S1PA 3WIUA 3MMPA 4FMPA 4XWGA 2P5TB 2O2ZA 2PH3A 3C1TA 3SYLA 1Z29A 4CF4A 2Y2VA 3KOMA 2B7CA 4L3OA 4D0LB 4YN3A 3HBJA 1QO9A 2O57A 3CIOA 3NT2A 4O2AF 3GB9A 4AY3A 2QMOA 4Q6BA 4EGSA 4PXYA 1JLLB 1V6SA 1Y9EA 4HEA1 5I01A 2M6RA 1NU6A 1SHLA 2C2KA 4JN6B 4OYYA 5L7YA 4RC9A 1I32A 5A7GA 1W25A 3AEUA 3CWZA 4BLQA 2PUEA 4R1UA 1PHRA 1JIVA 3I6IA 4YH1A 3REFA 4KXMA 3MJRA 4DLWA 4TJVA 4XASA 4G26A 1AZWA 1I3MA 1T15A 1ZVVA 1A2BA 3L8DA 4IWNA 1G64A 3AHCA 1DP4A 1VLLA 1NRWA 1WW2A 2FX3A 2I80A 3FAZA 1YA8A 3N28A 4KAAA 5F7JA 4AS2A 4FINA 2AG8A 4EZIA 1CUWA 1XXLA 4K9RA 1P4GA 3AEKB 3EH2A 4UC0A 2IOFA 2ZE7A 3WHPA 5BRAA 2B5OA 3LQ4A 4DPMA 2YJVA 3KJIA 2ACVA 1I4EB 1VMKA 1WUYA 4WOKA 4UCXA 5K3DA 2XNCA 2NUAA 2EX1A 3MZ0A 2PSFA 3VOAA 5IJ9A 4LWQA 3BRWD 1YV9A 4O3MA 4C8TA 1VOTA 3OZEA 4YPOA 1U5BB 4P0TA 2BGKA 1EK6A 3GVIA 1O97C 4CIVA 2GCNA 4AMVA 1VHTA 3EPHA 4TS4A 1N2IA 1L7VC 2EW1A 3MD0A 1UZLA 1JEQA 3IAXA 2YS6A 2X0EA 3VPXA 2K87A 5IULC 4Q4JB 2ZTMA 4G85A 3ZD8A 4EI9A 1NVWQ 2V7BA 3TQIA 2WPNA 2GARA 4AKHA 1Q0RA 3F5MA 2QF7A 1W8DA 2A94A 3PR3A 3ZI7A 4Q4AB 2RGBA 4QFCA 2O2EA 4PLGA 4NXNB 3EVCA 4PZUA 1P9NA 1RE1A 1H4VB 5DTJA 1SCIA 3AEYA 3I28A 4R1NA 2P41A 3T5MA 3H9BA 4BWGA 4NMWA 3GP5A 5ALRA 1A9XB 1HWYA 2H1VA 2HLDD 2WQZA 3FFAA 3JQCA 1P1JA 2BIFA 3LDFA 3PIIA 5I7AA 1C1XB 2EDCA 1QHNA 2GAFA 2IQIA 4ZWNA 1ZNWA 3QEKA 5A0VA 2ZRHA 3Q11A 1M6HA 1DC4A 1Z73A 1FFBA 1ZU5A 2FUG6 2XYVA 4TROA 1B3BA 5TRTA 2PX0A 2QPTA 2WWTA 3PUWA 2YS7A 2NXCA 3OLQA 1MNAA 2B5WA 3JYLA 1M5TA 4S24A 4X8HA 4BUZA 1IY9A 1AA6A 4RH3A 1JIJA 1QUFA 1A7AA 2V96A 2KJQA 5DK6A 1IOLA 2IY8A 2J8ZA 1VMIA 5K4AA 3RODA 2HA2A 1C9NA 1U94A 3DKVA 2H1SA 4LVNA 4L8LA 5ITZA 1WZ2A 4UZSA 1JDEA 3SJEA 4HPXB 4J3FA 3QXSA 1D0IA 4E5UA 4Z51A 4NK5A 3IHKA 4NABA 1YMUA 3TOSA 4B2IA 3LLSA 5TQVA 4S3MA 4ZKEA 4DAEA 3O8CA 3ZJUA 1I0IA 3C7DB 3IDFA 4QJ5A 1C7ZA 3DL2A 3GK3A 3ANLA 5G41A 3VR6H 4PRLA 1DG3A 2NU6A 3F6SA 3M49A 1R9NA 3EPPA 2J46A 1IOZA 4KDRA 1VBGA 1WVMA 16PKA 3KQPA 3Q7PA 1A76A 3SE0A 4ZI3A 3FUXA 4US2R 3ZE1B 4WZBA 3ZIAA 4QM6A 2ZYAA 3W5VA 4YRMA 4OC5A 1BOOA 1DLJA 1E5DA 2OG2A 4TN5A 4B75A 2FE1A 4N03A 1CFZA 3CLRC 2Y0CA 2OB1A 4CNBA 4Z53A 1A50B 2QP4A 3BL5A 3AONB 3SDZA 2B92A 4QYTA 1LA2A 3VNSA 1U4SA 1VGRA 2AQHA 1RSZA 1EFTA 4PHGA 3V9PA 4DLAA 5CEEA 2ZETA 1ZCAA 5DO9A 5JU6A 1F7UA 3JATB 1B76A 1Z4KA 3O1LA 1NAIA 1TKRA 4XCXA 3BRQA 1TO6A 3KUXA 4I1SA 4NFHA 3EIEA 3M6VA 2A30A 4KVGA 2HADA 1TF2A 1RXIA 3N2GB 3QE0A 4LMPA 1JHVA 3ROPA 5CA1A 1OB5A 1A4UA 1ICEA 2Z0MA 1RI5A 2IDKA 4NZNA 3U4QB 3LW7A 2I65A 5T3YA 1KJNA 3PWZA 4MV3A 1OTXA 5BQ5A 4BFXA 4JODA 4ODIA 2IIBA 1PZEA 2A1UB 3TLJA 2ZTSA 4EPRA 4F3TA 2FWNA 4HK4A 1GA4A 1SO8A 2JK0A 4RZXA 3A1DA 1H1TA 2D74A 3MFQA 2I91A 2HD4A 5JNTA 5KYNA 3QMVA 2BMAA 5KTTA 3CVXA 5D6OA 5JBIA 3HK2A 2J31A 3GDWA 4NJMA 4XUGB 1AUPA 1G8JA 2HJHA 2OAGA 1OXMA 4C0LA 3H6KA 2I0FA 4FFVA 2HJWA 3AINA 1AGYA 4GBGA 5EG5A 3N8DA 4ZP1A 4MV1A 1KI6B 3GCZA 1C3VA 1QH0A 5KJFA 2A84A 1BJTA 3PV0A 1QRAA 1TLFA 5JBNA 3HCBA 3H4IA 1ENYA 1YRQA 2VF4X 2IC5A 3GLIA 3LU1A 3BBLA 3UHAA 2R7MA 5G1OA 5CCDA 1PVDA 3C8DA 2G1KA 3ISVA 4BY9E 4C4ZA 2FAXA 1E4YA 3D31A 2C8KA 4YQYA 2OHHA 1BDBA 4NH4A 4F86A 4RJJA 1WA5A 1LPAB 3TBKA 1SXPA 5ALOA 2D4HA 1MX1A 1T5IA 3ANSA 2Y1WA 3BFJA 3RC9A 1EK5A 2V0CA 3OLWA 2GUGA 3GLFA 4RZ3A 2Q0QA 1WXDA 1KDTA 4JC5A 3LG2A 3SJ7A 4LW8A 1E3QA 1WXFA 2VAWA 3URKA 2GCIA 1ZG3A 2RGCA 4R2JA 4XFDA 1IZ0A 2PD3A 5BT9A 1BROA 1O5TA 5AKHA 1DWQA 3BSSA 1WQ4A 2XTNA 1UEIA 3DD5A 4JB8A 5F21A 2DQSA 2HIGA 5HZGA 5JXWA 3OZUA 1NXSA 2A5JA 2HU5A 4KC0A 4LDRA 4EKNB 3LT1A 3AUAA 1CYDA 3FFWA 4LOLA 2JGRA 1KH1A 5DHPA 4MIEA 2C0QA 1SXJC 2H17A 3ZVLA 2XDQA 4R71A 5BSEA 4BVLA 2JW5A 3GELA 2OC9A 1TAUA 2CV0A 5CCEA 2PJDA 3FH0A 1O08A 4I3FA 4YS6A 2BGMA 4KFTA 2V74B 4ZOBA 1G21A 1MMFB 1HE3A 1IHDA 1O96A 5HKAA 4YYZA 1N7JA 1HH4A 3RU7A 4G23A 4DR3B 4PRKA 3RSZA 2QD5A 1KYQA 4D81A 1NI4B 2P9CA 4ZEMA 3BBPA 1IG3A 2BP7B 1W85B 2Z09A 1JVNA 1XLTA 2QNIA 3CNHA 3DB1A 3HJBA 2OFXA 1NJ8A 1DC8A 4KYTA 1AY0A 1ADJA 4Y6GB 3R9WA 4TYWA 4W1PA 1W49A 1BD3A 2R65A 2AH5A 2G9RA 2GXUA 3OM0A 5E4JA 2GBPA 4CXMA 1RADA 2Z2KA 1CY7A 2X9NA 1Y8CA 3U7HB 2UYOA 1TYDE 1PNQA 1MX9A 5I7UA 3EEQA 1RRMA 3V6MA 3AR2A 4XOUA 3DLIA 3GW8A 3CRMA 3D6HA 4PE5B 3W5IA 2N1MA 2HXSA 1KI9A 3GJ7A 1WMAA 3U4DA 4ZA2A 2R6GA 4EW3A 1Z7EA 4JELA 2F9LA 4PPFA 1AO3A 3PDUA 5BXQC 3HE3A 4M0LA 3EIFA 4CKYA 1ZMTA 3HJNA 1VCNA 2CNNA 4ZGGA 3MWGA 4LBYA 1RRPA 3KZKA 3E1KA 2VHVA 1ZYMA 4MGHA 3VQTA 4E5VA 4UHJA 1BH6A 1JHUA 4TLCA 4BV3A 4DCMA 4LQGA 4FB4A 5FBLB 5FWYA 4HAXA 3DULA 2HDNB 3R77A 2A0FA 2ZYVX 3GEDA 3VJMA 3KSBC 3S2EA 2V1UA 3VVCA 1UOPA 1ZNYA 2QLLA 3BRSA 3AUYA 2QG6A 4N0EA 4J94A 4NU8X 1SC4A 1E3JA 4C89A 1THMA 3U2QA 2OYRA 4D3FA 4F4IA 1P2VA 4GPEA 3A1SA 4MB6A 4RTRA 4NQRA 1TZKA 1XX6A 2ZIXA 3KRVA 3HBMA 3MM4A 4OQYA 3NC4A 3PF9A 4HCJA 1CUZA 3T3NA 3NC1C 1J9GA 2OOSA 1UT8A 1KMNA 1XDSA 3HC7A 4BC1A 2HK8A 3LBIA 1KMCA 1WSAA 4J2HA 3U44B 1SXIA 3UJHA 5L95A 3CLUD 2IP1A 3H1GA 1P4JA 3KXIA 1UJMA 3IILA 2ZQ5A 5JCZA 2GRUA 5BO5A 2GZAA 1W7AA 4X65B 3LOPA 4WPGA 1TJYA 2OO7A 3DAGA 3P7MA 5BQFA 1T3HA 1XZJA 2GN8A 1EFCA 1NDQA 2JLSA 4JP2A 4QBGB 2IPMA 2H1LA 4N82A 3VHRA 5F12A 1MJFA 1ZGHA 2RG1A 4MW6A 3ED1A 1GPJA 1QGAA 3PFGA 1XVUA 2W42A 4YCNA 1DRWA 1ECBA 1EAMA 2W7TA 4CV3A 3LGAA 1PRYA 3P0EA 1US8B 1IJBA 2QRUA 1G18A 1KYYA 4UARA 1SUPA 2DCUA 2C8LA 3ZGXA 3KWJA 4ERXA 3P4XA 4LN1A 3SVZA 3K2EA 4RTLA 2ECPA 3HZHA 3IOEA 1N2BA 2HO4A 2AI1A 2FG6C 3R6TA 5IFKA 1AQNA 3OZFA 1D9ZA 4C9UA 4MUIA 1UH5A 3WRYC 1XWFA 1DBIA 2OGUA 3HACA 4HPJB 2P1DA 3E1SA 2AG6A 1PLJA 3HY6A 5EMHA 1JN0A 3CLSC 3RS4A 1FRFS 1O9BA 1ZXXA 2C96A 5T4EA 1ABEA 1R0YA 4AF7A 1YR3A 3RGGA 1K68A 4JLAA 5EE0A 4DPLA 1QJCA 4EJFA 4EARA 4NFSA 3DL0A 5JSZA 4YA6A 1Z0ZA 5TLSA 1KL7A 3B51X 3D0OA 1RRCA 1NTOA 1CHNA 4O1HA 4PO8A 3RABA 2CGEA 4B5KA 4V0LA 2GLUA 2GBFA 1QRRA 5I7OA 4MKXA 1FS6A 4L0MA 3FPGA 2BHTA 3AJEA 1DJOA 3DYBA 2VEDA 2BEUB 1SH7A 2CLLB 2LPMA 3PHLA 4QPPA 4B9EA 1L3IA 2MINB 4FFSA 1XTRA 1L4LA 3H2BA 4H7PA 3VISA 1EGHA 5JNLA 5MF6A 2IYOA 3IP9A 2FFAA 3TRIA 4Z4HA 5JAHA 1N0IA 2IGTA 3CHYA 1IRIA 2KM1A 1UPAA 5ECGC 1W59A 5EQFA 2QRJA 1FCJA 3W1EA 3SZGA 3X44A 4WRRA 2Q3EA 1JJVA 3D3QA 1BD4A 3JQGA 2Y4NA 4RH0A 5LP6C 1T5OA 4BRUA 1MC4A 3NTUA 2BFBB 3FCOA 2COUA 1KSJA 2FOIA 1S3FA 4B3RB 1L4GA 2QAGB 3UH0A 4XD2A 1J06A 4FB5A 2VSOA 2JHCA 4N6GA 3N53A 2XEIA 4AJJA 1SAYA 1COZA 3G3EA 1N2JA 1WV0A 3DB2A 1XNGA 2JI8A 3AB7A 4IFEA 2D1FA 3RRNA 3J81A 1WZIA 1C3OB 5AP9A 3UMGA 2V65A 2ZRPA 1P7ZA 2J6BA 3I1YA 4EVIA 1E7WA 3BK7A 4KQKA 1VP9A 4Q7JB 1KOJA 2MWMA 4JIGA 4B7CA 2HNKA 5P8WA 2X5JO 4NULA 5DWVA 5I6DA 3M5CA 5JCXA 4CDNA 1P80A 3LCCA 1OTYA 2RJOA 2BR3A 4GYJA 4QOHA 4ER6A 4AJ2A 4DSZA 2F9MA 3F6BX 3MWLA 1CRZA 3V4PB 1WHTA 4GX0A 4KLCA 2X8BA 1FNCA 4GU5A 3LLCA 3W1WA 3Q2IA 1NE7A 1GCOA 1V5IA 2RHRA 2JFWA 4F8YA 4BMSA 1YA6A 1WO8A 5JJBA 4X91A 1F2DA 3UJPA 3EIHA 2C4KA 3O83A 4NLLA 1TFUA 5HMMA 4RELA 1DEAA 3THXB 3PL1A 2PUBA 3I2GA 5FNVB 4GZMA 5C7YA 4US1R 3O92A 1JWAB 3PJEA 3GG2A 3K20A 4R1LA 2EP5A 1Y9AA 3RQIA 1J39A 7AT1A 2P77A 3E8XA 3SGLA 1PO7A 2C2HA 3G5TA 1DBQA 3ILSA 9GPBA 3DV2A 3FFBA 1OZ0A 1T5LA 2EF0A 2Y99A 2IBTA 1IDOA 4OQLA 4DWJA 4WVLA 1Z6XA 4RCZA 1CJTC 2VDRB 4HEHA 4RJIA 2EW8A 1CUVA 4RSRA 1T1EA 4I55B 4D02A 5MFZA 2QJFA 3I8OA 1AKNA 1II0A 4LJKA 1MU0A 1DG9A 3IE0A 1E2LA 3EXFB 1P7YA 4EYQA 4CO9A 1SKBA 3Q7IA 2ZDGA 1GV1A 1Z18A 3PXUA 1TU0A 4ENSA 1N3BA 5F2OA 1RJWA 3U39A 1V1MB 1E3IA 4W7IA 4EHBA 5TSDA 3S68A 5BPHA 2WSMA 4LK2A 3D8SA 1IJFA 4DKXA 3JQ6A 3A4VA 2FETA 3MSXA 3AKYA 4UU7A 2B69A 5LZ4A 3ON5A 5KWEA 3A4NA 3RFUA 1QORA 1WL8A 4NCJA 1MAAA 3M8KA 3RK4A 5LOVB 1C7FA 1KPHA 3K09C 3ZHCA 2ARKA 1YZGA 2G0AA 3E9DA 1DBPA 1H85A 2CL5A 3N7AA 2OE2A 4FJ1A 2P4HX 4JLBA 4IDFA 1ML4A 1FBTA 2C61A 3Q85A 3WWYA 2AWOA 4OK3A 4H0NA 2UUPA 3M81A 5CNKA 5ALWA 1G3QA 1RYFA 2VHCA 5JNSA 1XNHA 1R5JA 1OLUA 1PW5A 3KQVA 2A4KA 1XMVA 3HUEA 3WDSA 2GKGA 1Q84A 1JG6A 4BVEA 2HUNA 4IDNA 4QASA 3V4LA 3K1AB 2DKOA 2IPOA 1X1EA 4FZVA 3D4PA 5I9SA 5M29A 5ICSA 3LHFA 3TL6A 4DBLE 1C0IA 4DM4A 2OCIA 1D3AA 3DLPX 1RZRD 1BN6A 4BQQA 3G79A 4LRTB 1WXHA 4U2DA 1Z6AA 1ENPA 4AX4A 2PZ8A 1F5NA 2ROQA 2ZI7A 1TYCA 5KHAA 9LDTA 2HI0A 4JC0A 1E7RA 3B53X 2L0XA 2Y1EA 3GA5A 1B8VA 3NHAA 5KJEA 1C50A 1Z56C 1NE2A 3HWX1 3Q3HA 4IZIA 4R1PA 5JYDA 1UBOS 4JVOA 1A0OA 3O8DA 1EXNA 4L5IA 4RGYA 2X0FA 4X3PA 3TNJA 5FPYA 1QONA 4LJ4A 4EKGA 1OI4A 5KDOA 1T4CA 3ORSA 4ZVNA 2YMQA 3O3NB 2G40A 1H2FA 3DOHA 3BEOA 2PCLA 4C1BA 5ICCA 1GKIA 4JEUA 3II6X 4C88A 2GXSA 1W87A 3BMOB 3FPLA 1Q1AA 3DBRA 3P9IA 1H3EA 5EESA 1D1PA 2GCPA 3ZD7A 1EGQA 4HFJA 4HWGA 1UMBA 4DCJA 3T3OA 2C07A 4H7DA 4HUQA 1B0AA 2I1QA 2XGMA 1DX6A 3A9RA 5AXDA 1DAPA 1S8OA 1K0FA 3C6ZA 4CR8A 4EF6A 2DR2A 1ZEMA 3DTVA 3OPMA 1ZN2A 4N3BA 3GNSA 3VZDA 2CNLA 3DBLB 4LRWA 2AFIE 1SXQA 1U99A 1CVLA 3NU1A 1FUUA 3ELUA 2IYNA 5K3CA 5DYYA 4ND2A 1B4DA 1Z9BA 3AXSA 1J0BA 1V7QA 3B82A 1MO4A 1XTTA 1QH1A 3K53A 3RKRA 4D56A 4RMGA 2ONJA 4OHBA 4LA4A 4WKPA 1ZDMA 4EW2A 1BO6A 2Q5IA 3AF3A 2HB6A 4DLZA 3I72A 4DCGA 1C7JA 5DI3A 5AJYA 1C7QA 3FYSA 3MSCA 3CEAA 1Q12A 1QP0A 4EHLA 3F98A 4HB2A 1FTYA 4OX9Y 4YI3A 1P33A 1SVNA 3DP9A 3D4BA 1M1YB 1R74A 3FMGA 3K8ZA 3ELDA 3H5VA 4AJKA 1IDN1 1T2CA 3O8BA 4LF9B 2OBLA 4G8DA 4GGMX 4RHCA 3DZBA 5EXDA 4L2IB 3DHYA 1JMKC 4FT4A 4CODB 1YSCA 2XPCA 3I45A 1LD3A 4MH0R 3T7TA 3IURA 1SCJA 3L2OB 4L74A 4EUKA 1Y1LA 4P98A 1JDNA 3EPLA 5K5EA 1TOAA 4M99A 1JWLA 4OK5A 2CYAA 2AKYA 3ROTA 1DKLA 2HV9A 2ZWAA 3F0TA 4H6WA 4A27A 5HILA 5JEEA 2G3YA 3NFRA 3QPBA 5JWRA 2Q0SA 2QR2A 3TFQA 3EG9A 2RGNA 4PX9A 2VDQB 5E8RA 2DQZA 3AESA 4D6XA 5HPYB 3N86A 5BYKA 2C7RA 1ZN9A 2FFBA 2C1EA 4ZYTA 1WDWB 2BBSA 1QYIA 2R9VA 4ALIA 5IHXA 4AMBA 1Q77A 1VDMA 1J8VA 1QFYA 1RJEA 1P6XA 4HDKB 4NZOA 3R09A 3EF3A 1E2QA 2BEVA 2QU8A 3EHDA 3TZCA 3P2YA 2O54A 3R7BA 2ZJ5A 3HGMA 5M34A 4B40A 3PDCA 4UM9D 4IIGA 1Y7LA 3TMAA 3UKDA 1ZESA 1SB9A 1NJFA 1FFGA 4IOKA 2ZREA 1GFIA 1ND5A 1WCV1 3CLTD 3QE3A 1HV8A 4RKEA 3CW9A 3QUAA 4DM3A 1D5WA 1JR6A 1F17A 2DSNA 2VWHA 3QMWA 4F5WA 4EG3A 2FQWA 1MPTA 4XTCS 4TTAA 2J9ZB 3EY4A 4REOA 5KYYA 4OHZA 2Q49A 3BH7A 5G4KA 3CKLA 3H05A 2Q4RA 1LFAA 1U3GA 3CURA 5EE5B 3A1WA 4A0SA 3MJSA 3QIVA 1DIAA 3NDPA 4R2HA 4AG5A 4S35A 1LW6E 3FZQA 1H2AS 3HYSA 1E3WB 1T2DA 2OHJA 3EFOB 2BPOA 3K0CA 4GLBA 2CKDA 3D6MA 4REQA 4ZEVA 2R1VB 4Q21A 1KEZA 2VUTA 3OPNA 4MOWA 5IYZF 3KYCB 3HDJA 1YJAA 4XPZA 2GR9A 2EHDA 3T9AA 5BNWA 1PR6A 4PX5A 4XR4A 4DR4B 3B5JA 5AVZA 5JVLA 1HGXA 1S4MA 3AY7A 2C31A 3DTNA 1NJSA 4QD3A 1NLYA 2PPVA 2LR0A 4TLAA 4Q4HA 3TLAA 4HUJA 1RE0A 1W29A 3QBDA 4LZZA 4R69A 4DCCA 4BNKA 3JYQA 1YVDA 1CY1A 4D4GA 1B26A 4OM7A 1VB3A 2H5IA 4IG4A 1F8FA 1SCQA 1GYQA 2X6TA 4CL8A 1XZCA 4X24A 2ZIAA 4IW3B 2YWJA 1JMVA 2B3DA 2OZEA 1J1UA 5D3KA 1MHPA 1M2NA 3EYAA 4KIWA 4BQRA 2UYGA 5E3HA 3Q7EA 2G0TA 1RHKA 3WZLA 1JKJA 2P1ZA 3N2LA 1W47A 4AAYA 1G8HA 1GGVA 2Q4OA 4G0NA 4OQ4A 1I8TA 1I1HA 1DINA 2DF8A 1JVSA 3EOBI 2JIDA 3K35A 4L75A 3W77A 2HFKA 1LSJA 2QTRA 3ORQA 4UQOA 1NUUA 2DHRA 3MGGA 2YHAA 2D1RA 3RYHB 5JW6A 1FJXA 2G5TA 2Z5GA 3RRXA 4OI2A 5C2JB 3R0VA 4G67A 3Q9UA 4B80A 5E9AA 5H02A 2IBSA 5B4UA 5FLXA 1VBKA 2XGOA 4MW0A 2YHIB 2YYYA 3CBQA 4Q3OA 4YFYA 4HEQA 5CW2A 2CYCA 1ZHHA 4H17A 2VPQA 1GZDA 4U5QA 4F6LA 2IEGA 3VMFA 3L8HA 5JUWA 4NAHA 3ZWQA 1YJ8A 3DA8A 1FDIA 3ENKA 4HR7A 4LYEA 5HE8A 3ZY5A 5BUSA 1LPPA 3GZJA 3Q1KA 4XQGA 1DIKA 2C5EA 4BEJA 2CE7A 1RKVA 2JFBA 4C07A 1CCWA 2P3SA 4DTCA 2QGFA 3EFHA 4YMGA 1GPKA 3DGFC 2OHFA 3BREA 4H7HA 5CA0B 1Q17A 3VKGA 1DFIA 2Y93A 2H63A 5IZ4A 4K0RA 1QPZA 1ZN7A 3ZJYA 3LS2A 3C5EA 3O82A 1U0EA 3R0XA 2G6BA 4EJ0A 2MTBA 2NGRA 2QSUA 3CPEA 5KKNB 1SCDA 4ZRNA 5JVDA 1RIIA 3ENWA 3DTTA 3L6BA 4PC2A 1EB9A 5JRJA 3AF5A 4C7VA 2Q50A 4AP6A 1E2KA 1NFFA 2P35A 3CR8A 3NONA 5FPPA 1X7ZA 2LKCA 5L51A 4QL3A 4CLRB 5LZ2A 3FVQA 4DRXA 3C85A 3Q3IA 4IIFA 5BW4A 1CUFA 2HA5A 3I05A 3STHA 2AR0A 2D0OB 4N8DA 1VMEA 5LD2C 1GO2A 1WD5A 1E94E 4KQJA 1FK8A 3NDBB 2EERA 5TEWA 2Q4TA 1COWD 1F1BA 1Y33E 4PBRA 5GZ3A 2GSWA 2O50A 3ZZ1A 4LMRA 3ESRA 1SKAA 4G86A 1JG2A 4W9NC 1P5HA 3OUZA 3DOCA 5KOJA 4HQNA 1JIQA 2A67A 1UC4B 3A7EA 2GF2A 4FWIB 4CMJA 4ZGWA 1NY5A 4AO6A 1Y81A 1SA0B 4L8WB 1JSCA 1TI7A 2ILTA 3I2IA 4U63A 5D2CA 1DQRA 5GQSA 3UMVA 2NPOA 3ABRB 2QMEA 5EP1A 2QTVB 1YOBA 1YVPA 5TVKA 4L5JA 5K0NA 4CV1A 1JE1A 5EOVA 2HL6A 3D6NB 1GNQA 2CHEA 4GRDA 3ONFA 4M0UA 5IUJC 4NOMA 2HWKA 3VI3B 2Q6TA 4P93A 4UQLA 3AIIA 1O95C 2F43B 2QVLA 2IZZA 2VLBA 4D9GA 4DIDA 5F52A 4XE5A 2RGDA 4B6JA 1CR6A 2PTHA 2VSQA 3GQBB 1CEXA 1G9XA 4RK7A 1KWGA 2ONZA 3DEYX 3GMTA 5HIMA 4BFTA 4D57A 3X1XA 2I54A 3WGTA 1WF3A 2Z5VA 4XIJA 2BSXA 2CXOA 3RUFA 4XJSA 3JQ7B 2IUEA 3BXMA 3TD9A 4Q82A 1GTZA 1CY8A 4BZPA 5KWVA 2Z9CA 3MBIA 2PGDA 3DKIA 3T5BA 4C2BA 4KVFA 5LNK6 1TQ8A 1I36A 2GJ9A 4BXOB 2AWNA 2VWPA 5AKYA 1T3LA 4O63O 1UT6A 3T3PB 4H15A 2ATEA 3N8KA 5SICE 4ZJPA 1V16B 1KMQA 1MOPA 4DWOA 5A4JA 5LA6B 4KK3A 2W70A 3UOWA 1K8QA 4M8DA 1EZZA 5LZ7A 3UIEA 3VKVA 1CUAA 3SSOA 3FECA 2XGGA 3L6RA 2J45A 3GVHA 2IE0A 2QTTA 3FTCA 4HVCA 3O8RA 5LYJF 1SM4A 1FNNA 2Z2JA 4XYEA 1A9TA 3THWA 1E9AA 4DMKA 2P40A 1K3FA 2AK3A 4OREX 1EG7A 3QJGA 1C41A 3L8CA 4PPGA 3G59A 2GOYA 1QGUB 5DLYA 1EFAA 3JR7A 1E4VA 1GZ3A 5AW3A 1JJAA 4HDRA 5J47A 2I99A 4IX9A 1LPOA 1T10A 3OX2A 4YO8A 4UCWA 3ZWNA 1OX4B 1XXHA 1L6IA 2XVYA 2PBLA 3H2KA 3I9JA 3T5CA 2BHRA 2VPXA 3GP3A 5AVRA 2DUJA 4B6GA 4IEEA 4BNFA 3MQ2A 3IOYA 4F46A 4H1HA 5ALZA 3N6RA 3WGGA 4Q0MA 1B8PA 1QWOA 4GMGA 3E27A 3UYLA 1JTEA 3FWZA 1MA3A 3NBQA 4UJ5A 1PJZA 2JLRA 2ABWA 1FDVA 3DZKA 4FU0A 5JT1A 1D8TA 4R2KA 3OD5A 1LDEA 4DBLC 3N6VA 4GXNA 1T5DX 4L5AA 4Q01A 4RNDB 3B1YA 1NNI1 4OQZA 4X44A 2GN1A 2X4IA 1NXXA 5I9TA 4Z4CA 1MVLA 4FJ2A 5ALSA 2IYEA 3DP7A 4IS2A 1K6JA 1Z4IA 2B1RA 2ZRBA 4BVJA 2WA1A 4N7RA 4A8PA 3KZMA 3QEAZ 2GTIA 2AN1A 5FBZA 4WBXC 3E9RA 3MS7A 4I4TB 2B82A 4QHTA 1SOVA 1E6WA 4FNOA 5H81A 1L5VA 1LJ8A 1X15A 2GA9A 2KSQA 4N47A 5LDDC 1JIXA 2ZROA 4N76A 3J7AC 1ZR4A 5J23A 3QYAA 4HGZA 1M75A 2EIHA 2E3JA 3WIOA 4BMYA 4P3OA 4GP7A 1JH9A 4FCTA 4TL6A 4FEYA 5IDQA 3LUDA 1UZNA 5DCLA 1C7RA 3UA4A 3HCFA 4PQYA 2QVGA 1L7BA 1IQPA 1DXHA 1JPVA 1NC1A 1PJSA 1Q22A 3B7PA 4LQLA 2ENUA 5SY6A 4IDQA 1RD4A 1RTKA 1R4MA 4PQFA 1K7EB 2DM6A 2OBYA 2V9ZA 1XR3A 2YXEA 1BS9A 2I2XB 1SHJA 1MBZA 2H48A 3OJCA 1IZZA 3QHQA 1S2DA 1Y8RB 4JKYA 4Y9SA 5IK2A 4GDFA 2P3OA 1ZIPA 5JTTA 1GPMA 4MB2A 3PVCA 4RK5A 5JQGF 3NAQA 3H5OA 4KQ9A 1NM5C 4GBMA 3PPWA 4X5OA 1P2SA 2SCUB 3SC4A 4NEQA 3HPQA 3MINB 2HCJB 1BKYA 2YZNA 5EIAA 2A0YA 1YE8A 1XTUA 5KDLA 3OEWA 2ZJFA 2EBUA 5T4HA 1IBKB 5K8VA 4KCGA 1L4NA 2WIAA 1N75A 1XMIA 4ZQCB 5C0OE 5TJHA 1BE1A 3ER6A 3JR3A 1A7UA 1RYMA 1Q16A 2VRCD 3BHIA 3H3JA 3PIRA 4E6PA 4YJDA 4I5GA 1MIOA 1YH3A 3E03A 1XL1A 2YYAA 2BMVA 3E9CA 4ZOLB 1KOLA 1GPNA 1PDWA 3IIKA 3JAMA 1YHZA 5CLGA 4ZZ0A 4N12A 5TT1A 1ZRSA 3OCXA 3OX1A 2J3IA 4P86A 2HMWA 4BMCA 2Q2WA 3FCYA 2NYVA 2WV7A 2CMKA 2XEDA 5K3BA 3TGPA 4YYEA 4RZQA 2QDKA 4QOJA 2J0SA 1DXYA 1LX6A 1T0IA 3CMCO 1ISFA 3QTLA 2D00A 6ABPA 3P26A 2VXOA 4FFOA 4P38A 2PT7A 4MV6A 3MUNA 5E6SA 3TJMA 5AIBA 3C3WA 1UKYA 3EPJA 2QM7A 3FOWA 1X2BA 2B7BA 1JEEA 3B3GA 1VRWA 4IICA 1HO3A 2WMYA 1HDRA 1R9JA 4GQIA 3RD5A 4L4SA 2IHUA 1T6ZA 3Q7SA 3AF2A 3L8EA 4B09A 2GCOB 2QE7A 4HDSB 3VUFA 1Q7CA 1UK9A 4H0FA 4JLOA 1ODLA 2OUIA 3AZPA 1XQYA 3RJTA 2J3MA 4UBOA 2JLUA 4N41A 4RTJA 4LSGA 4FEAA 4RQTA 1QQAA 4D25A 3IT1A 1KDPA 2QJTA 4BBJA 2C97A 3BWEA 4X84A 1KQGA 2Z43A 1C1DA 3KZOA 3N8IA 4YWHA 5HF9A 4RJTA 2NZYA 2OK8A 3HR8A 2DUMA 3E3LA 3MVEA 2CUZA 1E9EA 4MWGA 4L27A 1O6CA 1W1WA 1TKBA 3R5SA 2BKXA 4QYXA 4U2EA 2XNHA 4II7A 4WK2B 2CVQA 3R5JA 1NT2A 4QDTA 4YCCA 4XDGA 3STVA 1QS0A 5IM5A 2XUFA 1ZGJA 2FR0A 3JTEA 3TTSA 2V03A 4HGQA 4WLVA 1ADYA 2FTKE 2QPAA 2W2VA 4ND5A 2JBWA 2PTGA 3AKZA 3P0RA 2OLEA 1UXJA 4YX9A 4LCEA 3PE3A 1NW3A 5FV7A 1B74A 3OE4A 2ISQA 3FCAA 4FS8A 3W5AA 4DDUA 3I61A 1U0TA 3ZW7A 4A2PA 5B5SA 2YJ4A 3FGNA 4BBAA 2G77B 4CIWA 5KMGA 2BELA 4MUYA 1G8KA 3TG2A 3LZ6A 1GPWB 4HP8A 5B6JA 1P4RA 2ZR9A 3OVMA 4J3JA 4ZRDA 4Z7QB 1QTRA 4GVXA 3VTAA 4BB6A 2WF5A 3AR6A 3JPWA 2DVMA 2Q4EA 4PLWA 2UZ0A 3BB3A 4NBTA 5DISB 1SC1A 5A7HA 3RUPA 1VXOA 4QIHA 2X8JA 1GVHA 1KK3A 2E87A 3G9QA 3JAWB 4QRDA 4MVYA 2Q41A 5K0BA 2QJOA 3TFWA 2ZR7A 2G06A 2R00C 2LV8A 4XUCA 3REGA 3LX8A 5KVAA 2VJBA 3M6WA 3PC6A 3UAZA 5LU8A 1XEAA 3F6PA 4JR0A 5IJ0B 1Q50A 2J32A 4QGHA 5E7IA 5FNVF 1AO0A 4BWFB 1RPJA 4B4KA 1I2ZA 4TZ0A 2RBGA 1PE0A 2VNJA 4LTDA 1NF8A 2BFAA 2EOAA 3IIIA 3WZ2A 1UADA 2Z6UA 3GZNA 2PKRA 2FN8A 4DCPA 3KJZA 1EX9A 1LFDB 3KD3A 3OCCA 3SF8A 2HA4A 4PG5A 1EFVB 1ZJ4A 3HP1A 4CHGA 4W5RA 3PHHA 1IOVA 3E23A 5CLLA 5CYOA 3ICQB 5CJPA 1ZGBA 2XKBA 1CC1S 3K7EA 3B5IA 2O5EA 4GYKA 4GZ6A 1BQ4A 1GTL1 1QOPB 5FOTA 3ICEA 4DV6B 2PMBA 4DLVA 2G6TA 3LXMA 4OF4A 4ZAFA 4C6RA 4AFNA 5CP8A 5K7SA 3DVSX 4L9SA 2YV2A 2OVFA 2Q8PA 2Z4SA 3FB4A 3PNMA 3U37A 3ESQA 2GO1A 4NF2A 1XD2A 3AM4A 5ECYA 1DDGA 3RJ9A 3H5NA 4EKYA 2GHTA 3R7WA 3TIIA 2MR6A 4CG0A 3H8VA 2PM8A 3NP7A 3DVQX 4RD2A 3AZQA 2AMFA 3FCCA 1ISPA 2C54A 3QPCA 4NJEB 1J5XA 3HN6A 3ZNOA 1XAJA 3D0QA 2QN7A 4MI3A 4TKUB 2NPFA 3ZTYA 3VSAA 1DX4A 5EIFA 2O8BA 1EM8B 1HDEA 1Q1NA 1OH8A 3X1JA 5LOVF 1ODIA 3KKNA 4TXHA 3TPCA 4ZMSA 3T1TA 2R84A 4GE0A 2E4UA 4GI3A 4ND6A 3VX3A 1VDZA 4BTEA 5BVGA 3VTFA 4EHAA 2Q07A 4H3SA 1M7BA 2P6OA 1JU4A 3ZDRA 2JHAA 1TM5E 3TM5A 1NGSA 3KEFA 3GP8A 4IVNA 3P94A 5DCUA 1IN8A 4WFIA 4E4RA 3W5JA 2E9SA 1IG0A 2OV6A 5HWSA 5ESRA 1X70A 4RPJA 5JS7A 4TMVA 2LDBA 3MD9A 4IHJA 4RHXA 2CXXA 3V4ZA 4C9AA 3CZMA 2NADA 1V2HE 5G3YA 1C5KA 4EGQA 4CM8A 3LUBA 4AS3A 5L8VA 4TV9F 4O4JA 3I62A 3QBJA 2YKGA 5B3LA 4DZZA 3A14A 1C7EA 5DB4A 5M5BA 2CFSA 1M34A 3DONA 3SEAA 1ZK1A 3CUVA 2ZIVB 3GEPA 4WKBA 5AOAA 1E62A 3RRJA 2ZULA 4JVNA 5H16A 3J80A 1RYBA 1YKFA 3L6UA 4MVWA 4C4YA 2ESRA 3U4AA 3ROZA 2Y1DA 4HD8A 4NL4H 1SVWA 5IAEA 4B4OA 4EHNA 5JCJD 2O5CA 2ZVJA 3C8ZA 2IL1A 1U04A 2FMIA 2I4TA 1PEDA 2GPSA 1ESDA 1E6CA 2WJGA 4G4IA 4MO9A 5AVSA 1UMCA 1DBRA 2O7SA 4DV7B 3BJRA 3HSSA 3FKJA 1C9MA 4G5RA 1N5DA 2CLIB 4UUBA 2PCNA 2O23A 1R6DA 2GD6A 1T8TA 2C84A 2NTNA 3BXOA 4ZT6A 1PYDA 2FW6A 2IZ6A 4JUFA 4PAQA 3WA6A 3BD7A 2QX6A 5IEJA 4UNQA 1V25A 4H77A 3B52X 4TRMA 2PBFA 1XVLA 2GPNA 1U3FA 1FMTA 2QKYA 3BCUA 3GMDA 3P96A 4B7XA 4CKBB 3ZQJA 3JQ8B 5CAEA 2RONA 5DM2A 3FNQA 1FMLA 3A6LA 4UHHA 3HY4A 5JD3A 4ARCA 4O4IB 1XZNA 5HTKA 1O9HA 2Y6VA 4XTRA 4F60A 2O8CA 4BAZA 2R8EA 1LSSA 5HS4A 1EWTA 1SQSA 5EZ6B 3KWLA 3QX8A 5J58A 4HOYA 1OT5A 2TMDA 1Z2PX 1Z34A 4XX1A 2YJ5A 3C8HA 3T9BA 4X85A 2UUBB 5IVDA 4M1TA 3Q9SA 1M0WA 2W8BA 1E1KA 2Z30A 4IJWA 1PL6A 1WXWA 5ISMA 3R3UA 2EFHB 3NKVA 3UZUA 1VZ3A 4NE7A 5TMEA 5A71A 1CETA 1QYRA 3JTMA 4ND7A 1J8QA 4BJ6A 2FQQA 2PS9A 2PZFA 4RIIA 4IOMA 3V7YA 4NHEA 1RXWA 3TMKA 3T95A 1E2EA 2IFTA 4ZANA 5HUQA 3K9LA 4FGUA 1ADGA 2HF8A 2OHIA 4PGMA 1ZIOA 1QXSA 1AGPA 2NZ2A 3BQ9A 3RAEC 2EATA 5REQB 3WK6A 1QU2A 3P9NA 3DO8A 1Z8DA 1H6BA 2GHQA 3W3AD 3G8YA 1TK9A 4LRUA 3EDMA 4OK6A 5JTUA 4EY4A 1PI3A 1JL3A 1XP8A 1ZI8A 3VNUA 3FTQA 2BOVA 4R98A 5LMNB 1FXSA 4B73A 4EZEA 3UJNA 5ECDA 1GRNA 3FMOB 4F3KA 4M54A 4XIYA 2HQ1A 5M7EA 1WZNA 1B6GA 5BN3B 5MGNA 4UUPA 4Y2JA 4KQEA 3PTLA 1OTHA 3BS4A 4PO3X 3RSHA 4PYNA 1GNRA 2BAGA 3JRXA 3BXFA 1E5XA 1VL5A 4YP7A 4ZVQA 3OF2A 1Q1QA 4RK6A 4GWKA 1QLJA 3COPA 2WUVA 1U2SA 1CZLA 4GLFA 4TS3A 1K75A 3AZOA 1DRJA 4NZPA 4WHMA 4WBNA 4J0NA 4Z1OA 4IH9A 2EFDB 5E9QA 4C7BA 5BN5A 2V7TA 2P4QA 1Q44A 1PFYA 3SOZA 1WKBA 3I6BA 3N2ZB 2O8VA 4PNEA 3V4RA 1KE2A 5BUCA 3PTZA 2IJGX 4MGIR 1JBEA 4X1KA 3DE0X 3QWBA 3IGFA 2VJMB 4MMYB 1Y82A 4CKWA 4RM3A 3DFUA 1CHDA 3O0TA 3L0YA 3PPIA 5IJ9B 1T4MA 1U8XX 4MR9A 3AVUA 721PA 5TQJA 3K4IA 1RJ9B 4EA6A 1QQ5A 4UVIA 4A8JC 4IYJA 4PPNA 1MIHA 4XJVA 2H1IA 1Q2XA 3O5AA 5ALDA 3LX4A 3LXXA 4WUVA 5DX8A 3W2IA 5IKXA 2FZLA 1QDLB 2H1FA 3GLUA 4X00A 3UBTA 2DBRA 4KR3A 4J1QA 2WIKA 4KSCA 1T4BA 2IWRA 4FOLA 2MSKA 4FX2A 1TL7C 3EVFA 4KGZA 3LFUA 4DMUB 1ODCA 4EG7A 2P1RA 3VC2A 1UEXC 1WMBA 3WRXA 1XPUA 5CB0A 2FMXA 1J2EA 3CW8X 1EK2A 4L6IA 1BTOA 3L6DA 3KOOA 5DM60 1CSEE 5FO1A 4CLOA 5LJLA 4QJ4A 2VDKB 2IXAA 2NZVG 3C6XA 4PSKA 4F4HA 4PGGA 2XCTB 2YWFA 521PA 4OC1A 2HREA 3C3AA 3D7KA 1GPLA 2QE7D 4H7IA 3V2UA 1OPXA 3HCOA 4KLZA 4X7PA 2J4CA 2YJ6A 4H1UA 3AU8A 1XRRA 4ARZB 2ZG6A 1YB1A 2X5NA 4FZRA 2EQAA 3C6QA 3FVVA 4GAEA 4D4HA 3WGJA 4ES6A 2Q3LA 3HVRA 1FJHA 2TRSB 1X13A 1QP4A 2ZIWB 1Y6ZA 4I50B 2W6NA 5ALFA 4BNJA 3NVKI 3R3JA 2XVXA 4JI1B 2WK1A 2QD2A 4KMRA 2CE2X 3NJRA 5ABPA 4Q24A 3BHXA 3NYWA 1HG0A 1ZK2A 1PLLA 2HK7A 3D7RA 3IA2A 1YXMA 3L9XA 3PP8A 1I0LA 2SBTA 3P9RA 3FHTA 2HQRA 1BWPA 4EF5A 3KOZA 621PA 2XKKA 2I2WA 1NXJA 4MICA 1M33A 4BNDA 1E18A 4RFSA 1NI5A 1J24A 1HLDA 3N70A 1GDTA 3U9TA 2OC4A 4GC5A 2X8LA 1OLSA 5LMCA 2ZT5A 4OQXA 4S04A 1JFSA 5JARA 3H2GA 3BFPA 2CHFA 1GKKA 4Z1MD 1Y5MA 1X1QA 2F2TA 3EJ6A 5JZMA 3HB5X 4INPA 2BHSA 1GL3A 3S6JA 5IVKA 1VKNA 4OMDA 1SELA 1FP1D 3L0IB 1CF9A 1Y1KE 3KUCA 1R5OA 4KO4S 3AUJB 5DULA 3Q3JB 4WZBB 2BV3A 3SQOA 4KE9A 5DHTA 2VPTA 5FPTA 3SDSA 3K0KA 2GDJA 2NZXA 1ML3A 2KI5A 2AJ8A 4QSHA 4ZC8A 3W9YA 3GCDA 1PR9A 1FDTA 4KO1S 3R8CA 3TAXA 1PJ2A 5AK3A 3ZE6A 4YMVA 1PG0A 1P9OA 3IXMA 1CQWA 3TEJA 1JNXX 4ACAA 1TCBA 1CR4A 3I23A 3R5KA 1RC8A 1I7DA 2J3QA 1SFRA 1U8FO 1V9CA 3TW8A 1KRWA 5IKMA 4DCOA 1DUVG 1Z5UA 2OGZA 4B3JA 3VUEA 5LZ8A 5KHLB 2BWJA 3TG8A 1HYEA 1II8A 3N2KA 4LBWA 4EL5A 5CA1B 3SN6A 5K4HA 2WFLA 2WPDA 3BUSA 1SOAA 5AVKA 3O3OB 2PPLA 4B7AA 5JDIA 3FRIA 4GGPA 1KO5A 3G7SA 4YJGA 3EA4A 2YINC 4A92A 1A8SA 3JY6A 4FEGA 4TYNA 1E8MA 4C4RA 1WDMA 5JIBA 3BKXA 1Z22A 2ZB4A 5DGCA 3NVMB 1OVMA 1L8QA 3LCJA 1WP9A 2BI8A 4O29A 3IT3A 3L7BA 3MOSA 3GRYA 4OYLA 3I42A 4FX5A 4G97A 4RMJA 2B8TA 4LC1A 2Z04A 4RZIA 4RY2A 5DCWA 1HORA 4NKRA 4ZZIA 2ZRJA 4I4IA 1I2MA 2PN1A 4X94A 3KQLA 2YR0A 2WVJA 3AWDA 2FOLA 4I2NA 4G0VA 3RYIB 4BKPA 1V0JA 1X7YB 2XNSA 3EDOA 3HZOA 2QP3A 3KB8A