4H1LB

Tcr interaction with peptide mimics of nickel offers structural insights in nickel contact allergy
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
187
structure length
179
Chain Sequence
RPRFLELLKSECHFFNGTERVRFLERYFHNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGQVDNYCRHNYGVVESFTVQRRVHPQVTVYPAKLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cell receptor (TCR) interaction with peptides that mimic nickel offers insight into nickel contact allergy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 34
structure length 179
sequence length 187
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h1lB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4h1lB01
1QSED 4JFXB 1FP5A 3G08A 1RZ7H 3T4AB 3ROLA 3LS4L 1BZ7A 2A0LD 2N7AA 1J5OH 1V7MH 3VWKB 2NY3B 3BHBB 3MZGB 1I8LC 4L3CB 1RUKH 3UJIL 4A6YL 2I60H 4OF6A 1LEGA 4HIJA 4KTDH 4UV7H 1A6AB 2GQHA 2QSVA 4NQDB 1YEDB 3FB6A 2QQNH 1BVKB 1LK3L 3O6KH 4DEPC 4GBXD 2W60A 3WN5A 4XBPA 3J8F7 3VA6A 3HCVB 5ANME 3S3PA 1U3JA 1MRCL 2I27N 4L9LA 3HAEG 3C5ZB 1D5MA 5BW7C 3BIKA 3F62A 3G5ZB 5KS9E 3MUGA 4X7SH 2FATH 1BIIB 3HC0B 1JGUH 3RJQB 1QBBA 5F9DC 1OGAD 1OARL 3L9RB 3VWKA 1P4BL 1F4WH 3VD5A 3BEVA 1HSBA 1NAMB 2XKNA 3CFJB 2VLME 1GPOL 3UTSA 3O0RH 3L7FB 1JMZA 4TUKH 1MI5B 4WFHE 4X9GA 2I9TA 3DHJA 4CJ0A 1I3VA 4FXGB 3HB3C 3Q1SH 2NY3C 2AGJL 4BH8B 3LZFH 4MDJB 4C83B 3O3AA 2NCMA 5AZ2H 1DP0A 2JJWA 2R1WA 1AQKL 1QSFE 3BDXA 2DAVA 3P77B 4Y2DC 3T1WA 2ZUSA 2LE9A 2DLHA 2OSLB 3ECBB 2P43B 2J4WH 3MRMA 2EDEA 2XRAH 5F89B 4BZ1L 3EOAA 4RMWA 1GHFH 4HWUA 4ODXB 3AS3A 5DT1H 5J4MA 1G7JA 4KDWA 1ZLSL 3MJ8B 4FQXC 2AK4D 3QQ9D 2HTLD 3V6FA 2E8ZA 3HMWH 4Z77A 3ULVD 1BVZA 3S5LG 1CS6A 1JPTL 1N59A 1Q72H 4KGLA 3JV6A 4K55A 2F53A 4I18B 1IJ9A 3VGBA 2BFVL 3WCYA 3GMQB 4N5UA 3BZDA 5FO8A 1BFVH 1I85A 3RWEB 3VA2C 2NXZD 5JORA 3IXTB 1QBAA 5IHBA 3NACL 3SPVB 1JPFB 4ZSOB 2X4TB 3RI5K 4A2LA 1MFAH 3EJJX 2VXQH 3DUUB 4XPBL 3D39B 4L4VE 1TPXC 3KVQA 3FFCD 4LVOC 3MGTA 2J88L 2BC4B 3ES6A 5HHXL 4PFEA 4YHNB 1MCHA 4ETYA 3IAQA 4LKXA 1N7ML 4MWFB 3DUSA 5J11B 5KVMC 4YDVB 2XN9E 4F7PA 1DUYA 2FEEI 2MKWA 4EOWL 3JUZA 4CW1B 3LV3A 4XRCB 2WLYA 2FR4A 1NUDA 1KIPA 2XG5A 1FVEA 3SDXB 1DQTA 1U3HD 1JN6B 3BRDA 1S3KL 3QJFA 4QXUH 4YIQA 4R4FL 3UPCA 2X7LB 3VGDA 4HKZA 4P2OB 1FNGA 5KG9A 1KLFA 1QFUH 1MHEA 4HWNA 4D9QD 5D2NA 1BJMA 3EZJB 3D69B 2EXWD 2P44B 4HX1B 4PJEB 1JYVA 1P7QD 2IQAB 1YQ2A 3QIUA 4NRXA 2VQTA 2ESVD 4M62L 3NN8B 4LSPH 3RWDA 5BZWA 1GAFL 1TETL 3D1MC 1Q94A 3B2VL 4ZG1A 3TIEB 2DQEH 1SEBA 3HUJA 4Q0XL 4TSBH 2RCSH 3FO1B 1T7WA 2D7NA 2GJJA 5E4EB 2H1PH 5LAXB 3H9ZA 1BF2A 4OBRA 1JFQH 4WW2C 5DD1H 5GS1A 3DLQR 5EFIB 3SCMD 4TQEH 4IDLA 1EAJA 3L7FA 3ULVH 3MBXH 4IRSA 5K59E 2QSQA 5L6YH 5CP3A 2FIRT 2DJ4A 2FNBA 1HSBB 1NAMA 2XKNB 5EULV 4AEIH 4XCNA 4ELKA 4Y8DC 1XR9A 1YY8A 4QHMA 1CD8A 5I1LA 3QCVH 3X11A 2IQ9L 1CFSB 2NY7L 4OFPA 1YPZB 3NIFF 5IM7A 1FJ1B 2CKNA 4E0RA 4I2XA 4QTIH 4K7PH 2XTJD 4JRXA 4P2YA 2G5BB 2WBJB 3MLTA 3N1FC 4MMXC 4P2OC 2B0SH 3VMNA 3VXRB 3BZFB 5CCKH 5JW5B 1WT5A 4NQEE 1AGCA 12E8H 1VACB 4OFIA 2YA0A 3MYJA 3T2OA 1UWGL 1C16B 3GB7B 4QXGL 1YYLL 4LHUA 2ARJA 2VLRE 3ULUD 4U6XA 4IRSC 1YDPA 2K7QA 5DHYB 3MRHB 4PPTA 4XXDB 1U8HB 5HHOB 4FFYL 1LWRA 5GIRA 4M7LT 4LVHC 4PRIA 2ATKB 1QFWI 1FNLA 5TE7H 5C0EA 3OL2A 1FYTA 4CN4A 4PRDB 1YY9D 4G3YH 2DQFB 3P30L 5DJDA 4HIIB 2JLLA 1K9TA 5A3ID 4NQDE 1S7XA 3QWQB 3UTZA 1DEEA 2VE6B 2XA8L 3W2DL 3Q5YA 1KBGL 4TVPE 5HYJE 4LSVH 3KLSA 4XNQB 3LN4B 3KPOB 5IK3A 4QHLA 3EFDL 1H3PH 4F3FA 5DJ2A 1FFOB 5IF0B 1MNUL 5EBMB 2WWKO 3VMOA 4Z7UF 1QR4A 5EZIL 2DM2A 3P11L 5HVHB 4I0PA 4J12A 4HCRA 2HFEA 2V2WB 2DLFH 4PJEA 1UXWA 4IOIA 3WFCH 1S5HA 2Y6SD 5CP7A 4V1DD 1VHPA 3FO2A 3PHQB 4CMMB 5SWSE 4MAUH 4J3UA 1IT9L 2B1AH 2Z31A 4HC1H 4U1MB 3MRFB 3LEXB 2PO6B 3OKDA 2QSCH 4R4NC 1YEJH 2VWEE 3S6CA 4P2OA 4MX7A 2IGFL 3T3PF 3MV7D 5H94B 4Y1AD 4OB5L 3A67L 4ZYKB 4ZO6A 1LO3H 1E6JH 5TE4H 3D69A 4O2CB 1A6PA 4P4KA 3OF6D 5EUKB 3TGXA 4OD3H 3KPRA 1AC6A 4H88H 5D7LA 1C08A 5J7CC 4NIKB 2JJSC 4G5ZL 4ELKB 3WS6A 4L8SC 4R7DB 1R6VA 2E6QA 4O9HL 4GKSB 4XBGB 1KCSL 4CU7A 4OIIH 1FVDA 4XNZC 1VFOA 5FYJL 1PSKL 1QVOA 5DDHA 3PJSB 3GJFH 3ZDZF 1JN6A 1J0JA 4GLRI 5EOQL 3VFMA 3WFBL 5J12B 5ETUB 2YD5A 4ZNEE 1RULH 3ARRA 4BZ2L 2DKSA 5SV3A 4I4WB 3W11C 2CUHA 1XF1A 3V0WL 3EYFA 3BIAX 1R3LA 4NFCA 3ESUF 2Q7YB 3WUZA 4KMTH 1BAFL 2NMSA 2NY2C 3X12B 2R0WL 4HX1A 4K3JH 3W5NA 4ZD3H 2QBWA 4PJFE 3C5SB 3BP4A 3GIZL 4PJCB 1XGTA 4Q58C 3MRBA 5GIRB 5H35B 5EUOB 1OW0A 3O6KL 1S8DB 4PRHD 2R1YA 1YUHB 3S36L 1MUJA 5CJQH 3SKOA 3SE4A 4L1HA 4H20H 5FGSA 1RZJC 1D6EB 4DGIH 3GSNL 3DV6B 4MA1B 2W65A 4YZFF 2FIKB 4K8RC 2ZCKH 4C83A 2B2XH 2WBJA 5K59F 4RMQA 1MFDL 2MCG1 5F7DB 3OGOE 4HGWA 4ZPVB 3KYMB 3K74B 5EORL 4LPWA 2GSGA 5CSZA 2ZSWB 4PJXA 1JV5A 1JHTB 3WFHB 3VWJB 4JM2A 5AWNL 4HLZH 4PTTA 2HRPH 4GSDL 2BY3A 3P0YH 1MI5D 5CUSH 4XNYH 3MX0A 5B8CA 1L7TH 4B53A 1HYSD 5JHDD 2XIDA 2FWOB 4WHTA 2XN9B 1Q9OA 3VFUA 4MQXD 3MSPA 3G04B 1CXFA 2GW5A 3DUHA 4Y4KA 5FGRA 4XPAH 3DV4A 2HLFD 5DMKA 4OJFL 4OZ4A 3IVKB 2DLGA 2HLAA 4FQXA 1BD2D 1EZVY 2NY5L 1UXWB 4YBLC 3NCFB 1CICC 1RFDL 3GO1L 1W8OA 3BMVA 1ADQH 1K8DB 4PJFA 1N5AA 1QRNA 3ULUL 4XWOC 2AQ2A 5F6IB 1DBKL 4QTHB 2WQ8A 3CDFA 4M4PA 2BSED 1AFVL 4V2BA 4FFWD 1K5NA 3AB0C 1ZHNA 4LSRH 2CKBL 4ELMB 3BHBA 4ZOAA 2H26B 2LU4A 2YN3A 5CGMA 4WFGE 3CFEA 4JQIH 3T0AA 1I1YB 4NC0B 1BQSA 2OTUB 1IKNA 1J05A 3EO9H 4JFEE 4JY4B 3QPQD 5CEZL 1KIUA 5DK2A 4ONHA 1HILA 3PWVB 3FQXA 1FQ9C 3WJLA 3BEVB 4JAMA 5KVFH 2GJ6D 4XAWL 3QG6A 5IHUH 2ESVA 5IV2A 1IAIH 1GC1L 1YNKL 4LKXB 5BMFL 4NSKA 2EYRB 2FB4H 4M7ZB 2C1OB 4N8PA 1E6JL 1FYHB 3MLRH 3U7YL 2FBJL 5DFVD 3WLBA 1G7QA 1IEBB 2JJTC 3ZT7A 2FL5B 1Z2KA 3NTCL 4PRAB 5CEZD 1HH6A 2C3XA 1YEKH 5FCUH 2FZ3A 4L29B 3SKMB 5HD8C 1FZMB 4OZHF 1S7VB 4HS8L 4RX4A 1VFMA 3B5TA 1L9NA 3MFGB 3GK8L 2FO4A 5DS8B 4RBPH 3BISA 2LAGB 3TVMC 2D0FA 4NO5A 2D03L 2XI9A 2YWYA 4HGWB 1EHLH 3QDMB 4KZEH 4X6FA 5TJWK 4L8BA 3L3GA 3X11B 4N0YL 3I75B 2LU7A 4Z7UB 3BKJH 4KI1A 3EGSA 1ZTXL 3B9KB 5ETUA 1RJYB 2Z8RA 5ACLA 3ZTJG 1PW3A 4HIEA 3MRJB 4HXBH 5T1MA 5I16B 1D6EA 4POZD 4KMLB 4JFYB 2VKXA 1NGPL 1XF3B 3VXQB 3QCTH 4LDOB 2GI7A 4PY8I 1FNAA 2YD8A 3V7MA 2DI8A 2HT2D 1INEL 1WSST 3SDDA 5SX4H 3U36B 4NNYA 3AREB 1EMTL 1CFVL 3N1PC 1MHPH 3NOIA 1UWXK 4H8WH 3V5HA 5A1AA 4QHUA 2R0ZH 3B2UD 4FFYH 1PY4A 4NZRH 3KXFE 2PCPA 5DZLA 2NXYD 5FGCB 1CD0A 4K9EH 3MRLB 2Z93B 4YDKH 2VWEC 1IAKA 1HHGA 5FYJD 3EO1A 1N3NB 1GXEA 4JPVH 5DSCB 3ARDC 1YQVL 3DIFA 3LEYH 4H5SA 2BCKB 4JHZA 3RBGA 4ODWB 2QQLH 3WXVL 2ORBH 4F37K 4HS6A 1S78C 3CX2A 4I9WE 3QUZA 4YFEA 3LH2H 2E9BA 3IKCA 3V6OE 2O5XH 3VE0A 1FLRL 4LU5L 2D31A 4NQTA 3UTTB 5L0QC 3MTRA 1PVHA 1Q0YL 3U48A 2K1MA 5L2KB 1TJIH 2PTTB 1UQSA 3RDTC 3HMXA 5F3HA 2V2XB 1A1MA 2AW2A 4WUKL 1IEHA 1J1XH 5C08D 3QWRA 1M6OB 4F8TA 1QUNA 3JWOC 5DD6B 2IFFH 4FQJH 3O41A 1V5JA 3DTXB 3NFPA 2Z4QB 4GW4A 4F7CB 3H42L 1ORSA 4G7VL 4Z95H 4JFXA 2GCYB 3Q6FA 1JMXA 1HILB 2O61A 3RY6A 4X6BB 4P57B 4PJ9B 4XB7A 4M6OL 1I1CA 2AXJA 4M6NL 2LV4A 2F74B 2VLLA 1GGIH 3ZKMD 4ZS7L 2YD2A 2H26A 5CBEB 5IGXH 2DTML 2PXYB 1OAXH 3LEVH 4OV5B 5D1XC 3SO3C 2VABA 4WI3A 3QJHA 2VQ1B 4K7PL 2QR0B 4H0HB 4RGMC 2VLJA 4J3VA 2FECI 4Z7OF 4RA0C 5D9SB 4U33A 2DQUL 4I0PC 2IQ9H 2LTQC 4IDJH 3LDBC 1T89A 3ILPA 4X4XA 5F93C 2IPTH 5B21A 2VDPH 1LE5A 4BA8A 4QXGH 4MDJA 4CUCA 3FQNA 3O9WA 4CNIA 1K3ZA 1ETZB 3DVIA 5IFAH 2MJWA 1EFQA 1KLUA 3PXHA 1IRAY 2A74B 2Y72A 4XNXL 4X4YB 5MERA 1MEXL 2I9TB 1T4KB 5IOPB 5IM7B 1PZ5A 3TPKA 1D9KD 3RL1B 3WS6C 3EJZC 4QTIL 4LVEA 2EE9A 4N9OB 1BQUA 1V3JA 3OGCA 2WV3A 4PJDE 1GRWA 3NZ8B 5JZ7D 3U6RA 1EO7A 4EXPX 5IFJA 3H42H 3HMXH 3J7HA 5F7HA 2ZCHH 4Q9RH 1GOHA 4HV8A 1ONQB 4W81A 1HE7A 4AEIL 4FQJL 1S7QA 2IFFL 2X6MA 4MMZC 3TLRA 2AK4B 4R4BB 1MJ8L 2E9IA 1KACB 1YN6B 4ZFFB 5T33H 4JPKH 2FIKA 3MRIA 5GRWA 1TJIL 3ZKSD 1JGLL 2I25N 1T2JA 2DD8L 1AIFB 5D71L 2A77L 5C3LD 5FUCE 4AM0A 1C12B 3I2CL 3PF2A 3K0WA 4OCSL 1RY7B 4PRHB 2ENSA 5JHDA 3QDJE 1B9ZA 4HK0A 2OXGA 3SCMA 2HVKB 5DGQA 4NO0B 4RFEB 1U8MA 1TENA 1QBMH 1MHHA 4W6XB 1WZLA 4RMRA 4L3EA 1M6OA 4CN1A 1U3HC 4XH2B 4RMSA 4DK3A 2PW2A 4ZOEA 1CIUA 1TJGL 4R4FH 2YKLH 3WFDH 3RVUC 1HOCA 2X4SA 3MZTA 2Y6SC 4ZXBC 2YD9A 1KJVA 4ONGH 4PB0H 4FS0A 4PGBA 1IL1B 5IW6A 1PLGH 2VDQH 4JPWL 4ZSOA 4X9BA 4DUVA 3VWJD 4OUUA 4KKCC 4XCEA 4JZOB 3U30B 3RNKA 1CDBA 5HSFA 3PWJA 4LCCA 3RVUD 1R3HB 3IJYA 4WFED 1BQLL 1LO2H 1NANH 5IEHB 5I30L 1HINL 1S9VB 2CRMA 3QJFB 4JEGB 3MRRB 5JHDB 4X6DE 4PP1C 1OPGH 3OKOB 4IRJA 5DUBA 4KKBD 3L3DA 4MXVF 1TJHH 4KQ4H 1M1SA 4X7TB 3FJTA 3MLYL 3D85B 4I18C 3GSNB 1LO0H 5I76B 1UM4H 4GQ9H 2GITA 2NTFB 3ZT6A 4LFHD 3VRJB 4GUPB 5EBLA 1CR9L 1KLUB 5I9QB 1RZFH 5CJOH 3LCYA 1GC1H 5HYSA 3T8XA 4ZFOL 2QQLL 4FP8L 4L4TB 4XVJH 4W68A 4JHAL 3KNBB 2BVOA 2NY1D 4O51A 4LHUG 4RFNB 3RWHB 2J5LB 2YOCA 4HQQL 5IVZA 3OAYK 2IJ0C 5TQ2H 4F58L 5KSAB 3JBG7 1FL5A 4XPTH 4EN3A 4HV8B 1HEZB 1LO4L 1GCFA 1UZ8B 4PTUA 4LCIL 3OV6A 1AI1L 1QYGH 3X17A 4PBWD 3R8QA 1M05A 3NZ8A 5FEBA 1IVLA 4EKXA 3IDUA 5EO9B 3LKOB 3TA3C 2BRRL 3IFLH 3D5OF 1K4CB 3OG6B 4X7SL 2ED9A 1ZA6B 2V7NB 1AGEA 3GO1H 3KPRD 2WBJD 4LASH 1B4JH 5DEZA 4LLQA 2COQA 4ZFOB 4IHOA 3MRGB 4ZUVB 5DK0B 3K4ZA 3CX5K 5T3ZL 3VDAA 3R06B 4AQ1B 3F7VB 5IMMA 1AD9A 1F45A 3ARVA 1ONQA 3CPLA 3G5XB 1IFHH 2R4RL 4MGXA 1XF5A 5J13C 4LGRB 4NHCH 3BE1L 1WBYA 5AZEH 1SEQL 4KDTA 1T22A 5HDQH 2Q86B 1XH3B 1PD6A 1QEWB 2BZDA 3FCTA 2AABL 2R29H 1QLRB 1C16A 3QH3A 5ITFB 1M71A 2ITCB 4XC1H 3IS1X 1VACA 5AWNH 1SJVA 1XGQA 5GGRB 3S35L 2ZUUA 1OWWA 1OAZL 4WTWA 3RA7L 2J8HA 2DBJA 4WY7L 1A4KB 1WVZA 4DOHE 1BD2E 4M6MH 5K9QI 3KYOA 2ZCKL 3QZWG 3SJVA 5D7JC 4CVWA 1IKNC 2V2XA 4L4VD 2AJUL 1JTPA 4PJXF 2J2ZA 3IDMA 1QR1B 1GOGA 3FQUA 1CQKA 1HKLH 3QWOA 3U2SA 4D8PB 2P7TB 3OJVC 2EO1A 4KUZH 3NCJH 1HH9A 5I74C 4HIHB 4HJGB 4PG9B 4RAVB 3U4EB 5DEFB 3X3FL 1T5XB 3ISWA 1P9MA 3AFLA 5AG8A 3ULVE 5C07D 2B2XL 4OF5A 3C5ZD 1YNTB 2AXFA 2C26A 2A6DA 2ZUQB 4Y0GA 4C59B 1UEYA 2R29L 5DGRA 4APQD 4DGIL 4MQXC 3ARDD 4JN1L 1HXYA 5FUOL 4NM8H 5C0AB 4X8XA 2EYTB 2AJVH 4JVWA 4QF1B 5FA3A 3VG0H 1D5XA 3IFNH 5DQJB 2EYSB 3MXVL 1NUGA 1YECH 3TO2B 1LEIB 3QFJA 3SDCD 3SY0A 1NCBL 4ZUUA 1NH6A 3ARFD 4EQ2A 1S9YB 2MQCA 3DX6A 4DZBA 3VFWA 5BVPL 1YN7B 3C6LA 2GIYA 1OTSC 3IDGB 1N64H 3HLAB 5JZ7C 1DQJB 1CGSL 5I73B 1DLFL 2SEBA 5HGDA 3PGCA 4L8SB 4OCWL 1GZPB 1XT5A 3SDCC 1OGAE 2HRPL 3UTQB 1T83A 1DUYB 2VZUA 2K7PA 5I8EB 4LOUC 5A40E 3PDOB 2A9ML 4MJIE 1GH7A 4M9OA 3SKOB 4EI6A 3D3VA 2EDBA 4PLKC 1BBJA 4JFFA 4DW2L 1FYTE 32C2B 4O02H 5C6WH 5CIPB 3IRZA 2DQCH 4JQVC 3BDBA 1U8IB 3B9VA 3IGAB 1U41A 3BI9X 4JANA 5D1ZA 5E8DL 5E94B 4MDIB 2APWA 1G6RB 1UWEH 3N0PB 3HE7B 5ESQA 3KYKH 4DQOL 2KQMA 5IR1B 2A9NH 4NJAH 3U4BL 3GDBA 4HKJB 4G6JH 1T66D 5K93A 4MVBC 4OCRH 3IAGC 3PHOB 3SE3A 2VAAA 1A7NL 1PJ9A 5E08H 3QUZD 4I2XE 1IGIL 1KUMA 3QIBC 1NMCB 4OI8A 1OD7A 3GNML 1CGXA 1YEHH 4GKOA 4Q2ZB 1T3FA 2VSDA 3TO4C 5J6GB 3K1DA 1YEGH 3KYKL 3VFRA 3TH4T 2BJML 1ZLVH 1EHXA 4FTVD 1RZGB 1MPAH 4R97C 5FDWB 2DQHH 5DMIH 3IJHA 3SE4C 3NPZB 5D5MA 1R3KB 4TNVK 4LF3B 3MR9A 5LCVH 4GKZB 5B8CB 5HDBE 4FNLL 5JA8B 4G6KH 4Y5VB 4G3YL 4ALAH 1CDIA 3FN0H 4C54A 1RUQH 3LRSA 4Q9BA 4WV1C 1AR1D 1H3XA 4O02L 2DQTH 1U3YA 2C7UB 2FJFB 2IAND 4K8RH 2EDLA 1F3DH 1UJ3B 3E2HB 3PHOA 4I3SL 4NC1E 1J1OH 5I8OL 2MSPA 3REVB 3FT2A 3VXUA 4OCMC 2VDML 1E4XI 1PZUB 5B4MC 2VMFA 1JZ7A 5DVOA 3UPAA 4F9LA 1ZA3A 3DWTA 4GRLC 4V1DA 1KB5H 1MJUH 4RAHA 4K94L 4UOW1 3LQAC 4GAGH 4WRLA 1UH3A 1MSPA 3AREC 3RX7A 5TH2B 3VFOB 4NO0D 1LO5B 2ZCHL 1J88A 4Q0XH 4PRPB 1ZGLP 4WVRA 3ULSB 5F8RC 4GMTL 1M7IA 3QDJD 2ZSVB 4U31A 3RWCA 3ZKNC 3CH1A 2R9HD 4LSPL 1JGDB 4R97B 1KSRA 1JZ3A 3FFCA 3W9DA 5E99H 5AAWA 3G04A 5GHWL 1KTLB 5AAMA 2W92A 3OAUH 5DJCA 1A6WH 3HI5H 3PIQA 4OLXH 5T5FL 4JO2H 4TSAL 3T0VA 2WP3O 1K6QH 5ENWA 1HHIB 3LKQB 1TVHA 5IMOB 1RUPL 1IEAA 2H32A 1CXLA 4TSBL 2D0GA 3C8KB 1TTUA 3V6OA 3T0DA 1J1PH 3M1BA 2DQUH 2VIRA 4MQSB 2X89D 3N9GL 1BBJB 3DXAD 4KQ3H 4LCWE 3EHBC 4M93C 3QDMD 5E5MA 4E0RB 3QNXB 5FYKL 3EO0A 3KLHD 2UWEF 1SBSH 2MPAH 3WKNA 4M61A 2YWZA 1FNEB 3THMH 3MROB 1F3RB 3NA4A 4LLVA 1RZJH 1T0MB 5JUEH 1U8LB 4U0RB 1ZGLM 4N1EA 1MREL 1HI6B 5EOTB 1UJ3C 2B0SL 1C1EH 1DBMH 1AKJB 4HWEL 4RGNE 1A9BB 3INUL 4DGVL 4OZIE 3O3BB 1CWVA 4JZJB 3LPFA 1RMFL 5ID1B 2VDLL 2NY1B 1RK1A 4Q9CA 2YMXL 3PGFH 3S3JA 3VFVB 1MIEH 3GRWH 2OR7A 4UT6H 3VFMB 3V7AG 1W72H 1PEZA 3TIEA 3QFJE 3BPCA 4QHKJ 1PYWA 2I9LB 3CZJA 5SWZB 3RWIB 3NAAL 2AEQL 3O6MH 5A2IH 4XPGH 3VXNA 1G7HA 1W0VB 4TQEL 3T77B 4F33B 4WW1B 3EKCA 1KJMA 4S10A 5KZCB 2J88H 1PKOA 4NNXB 1ZVSA 4XT1C 3BH9B 3CK0L 2A6IB 2D7TH 3MV7B 3B6SB 5D1XA 4Z6AT 1KIQB 2BVEA 5B4MD 1KFAH 2GJ6E 4XPBH 4K2UH 4YZFE 1U6AH 3MOAL 2O5XL 5JXEC 1RD6A 5D4QA 5D1QD 3F7YA 3A6BL 3NACH 5IVXF 1WWAX 1MFCH 4GW5B 1AQDB 4U1MA 5AYUL 4WW2B 3GSRA 2BFVH 3QULB 2ATKA 2X4PA 4DVBB 1U91B 2XT1B 3CU1A 3C2SA 4ZQKA 4PRBB 2F9BT 1YQVH 5GPRA 2FX7H 3T1FA 1HHKA 1U2HA 4PLNC 3SDXF 5JA9A 5CJ8A 5DFWH 3WO4C 1TVBA 4LGPB 4LSDA 1MLBA 4PJGA 1UB6A 3AM8A 3P4OB 2FJHA 3NPSB 3KPOA 3KJ6H 1IM9B 1IQWL 4OQ1A 4BZYA 5JW4M 1BX2B 3T3PE 1CZ8L 3MA7A 1N0LA 4HUNB 1R0AH 1B6DA 1YJDL 4OM0H 3O6FA 5DEGA 5DC0A 3O6LL 4OZFB 1IEAB 2IMMA 5MEPB 1TDQA 5IMOA 4GH7B 3JV0A 5AYUH 1ZOXA 2Q3AA 4GKNA 4MA1C 1AD0B 3TH3T 4CBPA 5D6DA 2AKRB 3MLYH 5ANMA 5ICXB 1DE4B 2CDEB 1QA9B 3GUTB 5D72H 5JW4N 1AO7E 3PIQB 5C07B 5ALCL 5DJ8A 6CGTA 1A1NA 5JW3L 2VLMD 3RVWC 4ODUA 1OCWH 5ALCH 1DBAH 1JGDA 1IC7L 1ZLVK 4KI5D 3GFUA 3QHFL 2OYPA 1CFSA 4PJFF 4LNVA 1KB5B 5E00A 4XZUB 2EXYD 2XWBA 1SJHB 1RIVH 2YMXH 1JUFA 2P5EB 4P2OD 3G6JF 1D5IH 2DL9A 4DGVH 4YHZL 5KSAC 5SX4I 4UOW0 4PJAB 4G43A 5AZ2L 1J8HA 5F70A 1XF2B 4XCNB 4LSQH 5LAXA 2CO6B 5INCA 5IQ7L 3KR3H 4PRID 5IVOA 4IOSD 2JE8A 1AHWA 4P2QD 3ZDZE 1RUAL 4AQOA 4N5EC 3O3BA 3U0WL 3PWLB 4NZJA 4HUMB 3MRDB 3F7YB 5C6TL 4U1GB 3OPZH 5TDOA 5LG1A 1HHHA 3AAZB 3B6SA 5D1XB 3SO3B 1YPZA 1T04B 1JNHA 3LKSA 1J11A 4LCUA 4S1RH 5CS7A 2H6PB 1AR2A 2JB5H 2EE3A 3LKRA 4KWUA 3DO7A 2OP4L 3S4SA 1W0VA 3ZKXC 1F4HA 1CFQB 5D5MF 3W82A 3D2UB 2V17H 2X7LA 3JWOH 5E6ZA 4PJEE 2J8UB 3AS2A 1WBXA 2L7UA 5D2LF 2VDRL 4OJFH 1TQBC 3E3QE 4L9LC 1VEPA 1T3FB 1NGXB 1T0NA 3O8XC 4JDVB 4UZGA 2OL3H 4MJ2A 1CN4A 5GQBA 3LN5B 3MNVB 3TNNA 3VXRD 4P9HH 4BYHA 4OLWL 4Y7MA 3DXAE 3LOWA 5DA0B 5I74B 3P0YL 2YRLA 3RIAK 5HGAA 3WE6B 3TVMA 5T3XE 1CFNB 1NBQA 1LO5A 4F2MB 1QKZH 3M17A 4JFZL 4LLMA 3KG5A 3NPSC 1WCBA 4JN2B 5ERWB 5B22A 5B39G 1ZS8A 1ZLWH 1QSZA 7FABL 3SHSA 1V7NL 2DICA 4U0QB 3RVXC 2IC2A 3SBWA 3BAEH 4NJ9H 4QRTB 1JK8A 3TWCH 4OGYL 3TJEH 3QRGL 1XAUA 5GSVA 3ARGB 2NW3B 5HDLA 4QXWA 4XTRC 4UIMA 5TE6H 4KK5C 3PL6A 3ME0A 4HBCL 5E6ID 5F1NA 5GZOD 1JIBA 4M5YL 4PJ7B 2CRYA 2IANB 4MHHI 5GGUA 1T1ZA 2X1QA 1CE6B 4HT1L 3T2NL 4QYOA 2XZQH 2GSIB 3QG6B 2QQKL 2Y4SA 4E41B 4P5TD 3BWAB 3EYSH 4LKCA 1QFWL 3BIKB 4IJ3B 5D7IA 1K6QL 5ACZB 3C5ZA 2ADFL 1QG3A 1R3JB 3UROR 1KTKE 3I02A 3QIUD 4BFBD 3UX9B 2HKHH 4OFYA 4JQXA 3GZKA 4FXKB 4V1DB 4MA3B 1EO5A 5JHLL 4HUKB 3CFJA 4PRNB 2UYLB 4JFDB 2BXZA 1EXUB 3QG7L 4MS8D 4X7EC 2WM0A 5J6HA 2XNAA 2V5TA 1Q0YH 4XVTL 1HNGA 1G9MC 3BUTA 4U1HB 5L7XH 5SX5H 4M03A 3UTSB 1BQHB 1B0GB 4IRSD 4LLDB 4K8RL 4FQHA 5EUOF 4OGAD 5GGSB 4JLRB 3MRPA 4N8VG 1R5WA 1F97A 5JLZB 4ALAL 2XQBL 5FKAA 2R1WB 4PJCF 2BOCB 4X98A 5ABDE 5FGCE 1I3GL 5TQ0H 3G5ZA 4Y5XA 3L6FA 5KJRH 2ILLA 3GHEH 1Z0MA 3AB0B 5BJTB 4YDKL 3AUVA 2Q8AL 3TT3H 5BOZG 4BQ8A 5T1LA 1UQSB 2DRUA 4HDIA 2ATPB 3IU4H 1IT9H 1DN0B 3MACH 1URLA 4KROC 5DR5L 3X13B 2ICEB 2J5LC 2FD6L 2H3NB 2DQGL 4DKFH 2ITCA 1DVFD 3O41B 3V9FA 2YEZA 3ARBD 3H9YA 2VAAB 5K9QG 5IQ9B 1ED3B 1R24A 3MLUH 2AV7B 4HXBL 5JIPA 4QGYA 3S98A 1IQDB 1TQBB 4NQCD 5F3HB 3ZYOA 4Z7WA 3CXDH 4QEGA 5IW1B 1XGQB 3FL7A 4WNQA 3KPNB 4N0YH 3G5XA 1QLRA 4MJ5A 1U36A 3E0GA 3RGVD 1ZWIA 3BYTA 5HGGS 4HBCH 3MV9D 5I1DB 4GAYB 4R8WL 1BFSA 2DQCL 2VR4A 5IBUG 3MLPA 4RGOH 4NO2B 3LRHA 3PWPB 1G1CA 1FGVH 2V9QA 3VXTB 4DW2H 4G6JL 4ODWA 2EIZA 1F58H 3KPTA 5C0AD 5M7QA 3RBSA 2F54A 3MNWA 3FHAA 4KJQD 1BF8A 4IM8A 4YHIA 5CKAA 3CMOH 5ADPH 4KUZL 3RWFB 3G5VB 4PJBE 3EOTL 5JXED 4FTVA 3SE3C 2OL3A 1JNJA 3U7YH 1JRHL 2VZ1A 3HNVH 5I71B 4GG6F 3ARGA 1YEEH 2X09A 3F7RA 1JI2A 3UDWC 4AYFA 5IIEB 2W59A 2QSTA 2MNUA 3DX7B 3EYQD 5CBAA 4W70A 1M7DA 4B7IA 1DANT 3FB8B 2R2CA 3SGDH 1DQDH 2D7QA 2AEIT 3ZSTA 4MNQD 4OLVL 3VFWB 4HF5L 4JDZB 4WU7A 3HZKA 4JQIL 4XVTH 3T2PA 2CUMA 3OBAA 1D5BB 5GZND 4MD4A 1MJJA 1VKXB 3GHBL 1MHCA 1F11A 1NAML 2QV2A 4P23C 4PJGE 1IGFH 3VFTA 1MHEB 4NM8L 2XWTB 5I1GH 1E28A 1FNGB 5KG9B 3MODH 3SKNA 4FHBD 5FB8A 3UMTA 4YHML 3U46B 1KGCD 1V3KA 3VXUE 2X9XA 5C70A 1FO0L 3I6GA 4PJHB 5CJXA 1JYXA 1I8KB 1NKOA 3KPMA 1PDKA 3D3VE 3TFKD 4JPIA 4P46D 4E41E 2V7HB 4MJIA 4YX2H 4O58H 1S7SB 5BRZD 1G7QB 5TGBA 4Q97A 3P0GB 3LDBB 5CHNB 2ICEA 3QFDA 5ICYB 1MHHB 2B1HH 5MEOA 3NFSH 4LSSL 2RHEA 3X14B 3LS5H 5HYFA 5I18H 2C3VB 5FF6A 2VUYA 1MAML 2BVQA 1V05A 4FQ2L 4XCFL 4POUB 4QXUL 5CD3A 4MNQA 4U1NB 1UG9A 1FC1A 3BVNA 2DQFA 4G8GB 1LD9A 4BFEA 4C56E 2X4QA 5E1AB 3NFNB 5I6XC 1RUML 2EIDA 2QHRL 1HIML 1IC7H 1A47A 1MCIA 2YPLE 4RBPK 1OP3K 2M8XA 4LQFL 4WHTB 1DUZB 3MRHA 3T3ME 1EV2E 5H2BA 2NX5E 1XR8B 4PGCB 2Y23A 1LDPL 5CJOL 5FECB 3BQUD 4U6XB 1JGEB 3QQ3B 3S4SB 4O4YL 3QXAA 4P2QB 4XGZA 4HJJH 4NKOB 3GB7A 4GQ9L 3B9KD 3CUPB 1P7HL 3LKNA 1JP5A 1CBVH 4Z78A 5IEKA 4GRWE 4XNUL 1OPGL 4TVSa 2M1KA 2GUOB 4UIKL 4YC2C 3T8XB 2GTWA 4LCWA 3VG9B 3WJJC 1FGNH 2Y25A 4ELMF 4E9LA 3MGOB 1GL4B 5D7SL 1SVZA 5ISZD 2NW3A 4LEOA 1KB9K 3RX5A 4DK6A 2OM5A 1NDGB 2A38A 1FAKT 2BVPB 1I3RA 3VFGH 1NCAL 5E0QA 4OGXL 4OF8A 3ZYZA 1XIWD 2YPKB 3SJVD 5EOQH 5IVNA 1P7QA 3VXSB 2XRAL 4LCCB 4Y2DD 3JV4A 5DVKA 2JCCB 1UCTA 4G9FE 4HEPG 1YEFH 1QBML 1T21A 1G6VK 4OSUH 3L3HB 3T4YB 1OM3L 5DVNA 4H88L 1FZKA 4MZ3A 4YDLC 3HPJB 4P9ML 4AIXA 5B38A 1JWSB 4PBXA 1XZ0A 2G9HA 4QRRD 2VLKB 3I2CH 5C0BB 5C0DB 5GS0L 2VITA 1UC6A 1A1NB 1NCTA 3MOAH 3MUHL 3FB7B 1CFNA 3ARZA 3OKEB 1YC8A 5GRUL 4U6VH 1NCAH 3OKYA 4M43H 2DD8H 1NGYA 4F58H 4NOBA 4MA7L 1QRNE 4R9HA 3IB4A 3L3DB 4P3CL 4Y8AA 3Q5TA 3QHFH 1BOGB 2B1AL 2C9AA 4JFHD 4MAUL 4X6CF 1A6UL 1JNLL 1G6RL 2EE6A 3S5LB 5I30H 1BQLH 1LO2L 1EAPB 4OZGF 3BPNC 5C08B 1B0RB 2CIIB 3FT3A 2DLFL 1UA6L 3O11B 4OT1L 4KUCD 1MJ8H 4XPFH 4G42B 2AJXH 1MFCL 2D4FA 4GRWH 5D72L 3P4MB 3UZEA 1JNHB 5A2LH 1ZHKB 4U1IA 4Y19B 1F6LL 2VR5A 4K2UL 3RIAF 5J1TC 1OAUH 4MAYB 2DDQL 4JDTH 3PHSA 1J86A 4MX7B 2VXUH 1DSFL 2DWDA 1J9CT 1G7HB 4OGZA 3NIGE 4XNXH 1IILE 1CVRA 3BPCB 2Q1EA 5I2IA 1R0AL 4YHYB 3ZE2F 1BZ9A 3DX8B 4Y5YA 3DETD 1OP5H 2R56H 2ZG1A 3BSZH 7CGTA 3CVHB 3DMMA 2OJEB 4TUJB 3V0VB 2P42B 1HHGB 3WFDL 2A77H 2YKLL 3MV8D 4JZJA 1ZSDB 2VDLH 3MXWH 1CGTA 3HS0B 5T1DH 1MLCB 4EN3D 1BFOA 4P2RB 1P5VA 2EH8H 5KN5B 1UACL 2P5WD 1F00I 4P3WA 3MROA 3MRIB 1JHLH 4JHWH 4XWOD 3IETA 3PGDA 4FQLL 1Y6KR 5CIPH 3V52L 4MXVE 4RAUB 3C08H 3U83A 1ERNA 4R3SB 5KOMC 4OLZL 1XMWA 3HUJF 4R0LC 3OR7A 5DJAB 3SDCB 3V4UL 5GGQL 4ZUWB 3HI1A 1IAIM 4FZ8H 1FCCA 4JFFE 4MCYB 3QCVL 1OGTB 1X44A 4BQ6A 2RBLA 4BFIA 4MNGA 1C7TA 2AV1B 5IG7B 1J10A 1YDPB 1U92A 4X6EB 1BGXL 2EEDA 4JZJC 1MEXH 2AP2A 4I48A 1KPUA 5D5ME 4RISL 2YZ8A 2OR9L 3QEQB 3VWKD 4XNMA 3ARBB 4HKXB 1OF2A 1FZKB 4FMFA 2FX8H 5KANG 4ZFZB 1WBZB 1H5BB 4NT6A 2F58H 4KDVA 2FZ3B 3QI9B 1HXMA 4PY7A 3VJ6A 5FIEA 3TBSB 2PTUA 4YXLH 4OZFA 1TZGH 2O93L 3JWDC 4XP6L 5HGHA 4PRBA 5T1KA 1I9JH 3B9AA 4E42A 1FIGL 4M3JA 5EIQA 4PRAA 3QUYB 3FB6B 3P4LA 5J1AB 3NCEB 3FQXB 1EJOL 4RWYL 4XMPL 3HE7D 4M00A 4BSWB 1J18A 4NYLA 1TTFA 5H37G 1Y18B 1HHKB 4OZGB 3O2DH 4MVBD 3CFEB 3LPWA 4NQUA 5J57B 3Q3GB 1HQRB 1T6VN 3DGGA 3G6DH 3M07A 5AEAA 5GRZA 4DKEL 5JOPE 3AY4C 4GAFB 1KB9J 4H25A 1EUUA 4PGDB 4DGYH 2R2EA 3TH2T 2JB6A 4OCRL 2ZWLT 3IFPA 1RK0B 1X4XA 3L3IB 4ZUSA 4K23L 2HP4A 1A7OH 2ZUQC 3MLVH 4MNGE 3CXDL 3W39A 3BEWA 5FKAB 4NP4H 1S5IH 1EHLL 4YHOL 1MY5A 2P8MA 4X5XB 4JZNB 2NY2B 5FO7B 1HI6A 1RJYA 5BVJA 2YA2A 3BW9B 3VXPA 1S7RA 2VISB 5SWSB 5MEOB 3EO1B 5KOVC 2VLKE 1UH4A 2VQUA 4MDIA 1VESA 4U6VL 1SYSA 2HFTA 4JRXD 3WIHL 4EEEA 2P48B 4HZLA 4WHYG 4NQEA 1OSPL 1F8TL 2VIRB 3IJHB 4KXZH 3OHXB 3U7AA 4P46B 1JNNH 5F9JA 4IIQC 3VFRB 4QY8B 3VH8B 1JPSL 1D9KC 4L8DB 3WYRA 4DZ8A 5FO8B 1XF3A 3VXQA 5AG9A 4AENA 3WD5L 4GO6B 1L4IA 4ZDHB 4YQXL 1UJTA 4JVUA 2XG4A 4M8QA 4WIQA 3MCKB 2R9HC 1B90A 2ZG2A 3QQ4A 2WBWB 2NW2B 3HHRB 4DTGH 4NUGL 1AJ7H 4MD5B 3I75A 4CKVX 3AMKA 2OJZL 3RZCA 1RHHB 4H8WL 5F44A 2ADGB 2EEBA 3GSVA 3MRBB 1FL6A 3KHOA 4D9RE 2BSSA 5EU5A 4OLYH 4TTDC 1DLFH 5MENA 2CLVB 4TRPL 3O3AB 3GMQA 3W5MA 5BVPH 1MRCH 3VH8G 3HE7C 5JOFB 2NY4C 2B8OT 4DQOH 3SY0B 1ZTXH 5H8DA 4E5XA 4ERSH 1BVLA 4UU9A 1YECL 3KLAA 2NY1C 4N0UE 4KZEL 4EIGB 3O4OB 1FV1A 5T3ZD 5HPOA 4KJWD 3OXRA 4E41D 5C0NC 4X6DA 4JN1H 1YPZE 3SOBH 2CDGA 5E8OA 1PG7W 4GG6A 2QHLA 3TBYB 4LSTL 5D7LB 4PJ5E 5D8JL 1NCUA 3PGCB 3BP7A 4L8SA 3UAJD 5CEZH 3S34L 1ZHBA 1J0KA 2XPGB 5KVDH 3X3FH 4FFVC 1RK0A 4KPHH 2NX5A 4DFIA 2CLRB 2ADJB 2YZ1A 3MRKA 5FYKU 2VOTA 5TF1H 1UXSB 2J6EA 4OFKA 4ZS6D 2EC8A 3ARDB 1IAOB 4TNWK 3CC5B 2HJFA 3IFPB 5IROA 3U9UB 1MWAA 4PGDA 5L0QB 1Q9WA 3NZHH 4UUJA 1U95A 2ZPKH 3ZTJH 3IT8D 3DBXA 5JHDE 1FAIL 2IH3B 1MCFA 3BP5A 4EXKA 4ZS6C 1JF1B 5C0BD 3WFEL 3SGDI 2EC9U 1I9IL 2BNQA 4OAWA 1TITA 5F8QC 1LD9B 3ARGC 2Q7NA 4PGZA 2DS4A 4HCRH 3MLXL 1Z3GH 4LQ1A 1U8IA 1YUHA 5GISH 5KVGL 3ALPA 6FABL 1BBDH 4K7PY 1I8IA 2Z35B 5CIPA 3PV6A 4DAGL 4AZ8A 5CHNA 5ICYA 3ZYJA 4Y5XC 3NBNA 4K3DL 2DYPA 5GGSA 3REWB 3FKUS 4AEHH 3RUGB 4GT7A 1CU4L 4BM7A 4NN5C 2BK8A 4KJPD 5FCSH 5HHOA 3BQUC 4GMSH 1B0GA 1RPQA 1WITA 4ONFH 1Y0LA 1A7QL 4GBXC 3FQTA 3GMRA 2HLFC 2Y36L 2P4AB 2XXMB 3FTGA 1F4XL 3BDYH 4ORGB 3SGJC 1YEEL 1CICD 3CSYA 1QYGL 3QEQE 3UYRH 2R2HB 2CKBB 5TFSH 5KVDL 4X6CE 5BXFB 2IADB 4JG1H 3O4LE 4S1SL 1FZJB 4KUCF 3QI9A 3BO8A 3CSPA 3H2WA 1OTTD 3L3OB 1GYAA 4GRWF 1K2DA 4C56D 4NN6C 5ID0B 3QDJA 4P46A 4Z0BH 5FKPB 1WAAE 1AGBA 1OCWL 4YPJA 5JMRA 3RDTB 5JPMB 2V5SA 3BGMB 4FP8H 1IAII 2OX5A 1DLHB 1A64A 1T5WA 4RWHA 4I48B 1EO8L 2YXMA 1BPVA 5C0CA 1TVBB 2H2PD 4R2GD 4HK3J 3FRPA 4LIQE 1ZVSB 4PJ7E 4FTVB 4OCXL 3HI6H 3DPBA 4IOIB 4P3DB 4ODTL 1NCWH 2QLVB 4HH8A 1QHPA 4U1GC 1G7IB 1JL8A 4LOUD 4HKBB 5I6XB 2DI7A 5EC1B 4WFGD 3RNKB 1WC7A 1YMHB 3RAJL 3WLWD 5B3JF 3CAFA 1MCSA 1S7TB 3KPSB 1GGUA 1ZEAH 4PB9L 4P4RA 4MAYA 2PXYC 1MIML 2DWEA 2AXGB 3KJ6L 4V1DE 5EBWA 1WEJL 4MB5A 1U8NB 2AJ3A 4OZIA 5C92A 4R0LB 3FQRA 2YA1A 4ACPA 4NKIL 1OL0A 2H9GB 2PO6A 2IH1B 4K3GA 1JGLH 3UBXA 1XGRB 3MRFA 3QI9D 3GSNA 4PJ8D 1U58A 3Q3GA 4QXTA 1JBJA 1I9JL 5BO1H 3IDIA 3D2UD 5CCKL 4JJHA 1VADB 2HFEB 1OB1A 1I4FA 3T3MF 3A6BH 4D3CL 2J12B 4KKLD 3WNNA 3BKCH 4L3ED 3EYQC 1L6ZA 3RL2A 5DA4A 3FMGL 2D2OA 5HVHC 4RZCB 4KRNA 4CW1A 3CVHH 1HHHB 2Q86A 4ELME 4G8GD 4JPKL 2E3VA 3M8OH 4PJIF 4DN4H 4W4OA 3V6ZB 1ZA6A 2V7NA 5HHOE 1ACZA 2J3SA 1PLGL 3RU8L 3ULUE 3B9EA 5D7LE 4HUXB 3BZEB 3O2DL 4P23B 1W0WA 3HMXL 4PB0L 1MVUA 4X8JB 2QQKH 5BQ7B 2EXWC 4GG6E 5BS0D 4QRSB 4WEUD 5JORB 4YLQT 2Z91A 2VDOH 1FIGH 3VRLE 4X9FA 1FHGA 1E27A 3VCLB 2AJZA 1RZJL 4FTVE 3HUJB 5IFAL 4XCCH 1K8IA 3G6DL 3BGFB 5DQ9A 5FUZL 3LIZL 3QDGD 5FYKH 4JFOB 5J12C 4CADB 3VXUB 3L5WA 2IPTL 4YXLL 4YJZL 3DX9B 4X0KB 3S4SG 4QGTA 2ZOLB 3OKLA 4JREC 1ZVHA 4LKCB 5E2WL 3F5WA 3LQMA 1LHZA 1QKZL 4JFZH 3BOVA 4UINL 2YPKA 2HVJB 3A0OA 4X8JA 1EERB 4XGZB 2IANA 2NY6D 3MOQA 3O8XB 3ZDYF 1MFBL 5DRNA 1H5BC 4YIQB 1XR8A 4PGCA 4RDQG 4LBEB 4N0FB 3OB8A 5KZCD 4JZOA 3OQ3B 3T04D 2YS4A 3U0PA 4YHYC 1A22B 3ARWA 3BUYB 4Q9RL 3QR2A 2OK0H 2ZNWA 5IJVB 5JW4Q 1IMHC 3HN3A 4PGBB 3UTSD 5C09B 5LGJB 3SQOL 3DURB 4FZ8L 3UC0H 3ORJA 4PRIE 4J1UB 1UT9A 5C0IA 5I1AA 3LH2L 3VI3F 4H1LB 4NRXB 4LLWA 3MUGB 3P9MB 3JWOL 4G6AC 3WUWA 4XPFL 5IW6B 3OAZH 2DWEB 5GRJH 4BK5A 1U8JB 5E8NA 5EC2A 4OKVA 3FT4A 3FN9A 4U1IB 3G5YA 4Y19A 4P5MB 5IBUB 4O2FA 4OV5A 1A7BA 4KI5E 2DQEL 1GSMA 2Y9RT 1ZXQA 35C8H 4O5LL 5JXAH 3TESA 4WTZG 5HJ3B 1XGRA 5C6TH 4JFQA 1HZHH 3BSZL 5C08A 1BLNB 2KUTA 3LIZH 4YNYA 2R15A 2XWTA 4FQLH 4S0TD 4LSQL 1WWCA 3B2UC 3EOAB 1I1AA 3TM6A 3DXAA 2VO5A 5DMIL 1DL7H 1AXTL 3I3BA 3HI6L 1HSAB 3IKKA 2Y7QB 1TNNA 4TTGA 4G8FA 3CVIH 2K9UA 2R56L 4U6YA 1MY7A 1YEHL 2X4RB 3ZE0F 4KK6D 5DF0A 32C2A 5DRZA 3VFSA 1EJ6A 3MQIA 5IB1A 2LAAA 3RL1A 1BM3H 1ZGLA 4DN4L 1A7NH 1EGJH 3HZMB 4YPGA 1WAAF 5KSBB 4KVNL 1P1ZB 3B3IB 3TBTA 1P84K 2YSSA 2VLRB 2PETA 5T3XD 2R2BB 5IFJB 3H9HB 3WIFA 2B5IB 1MCWM 4WW2F 3BW9A 4LVHB 3BFOA 1JWUA 4KKNA 3RIFK 1BIIA 3HC0A 4X6FB 4N8VA 1G7JB 5EA0L 1KCRH 4B0MM 3PWPA 1Q0XL 4WFHD 4XZUA 1XIWC 2GT9B 3RDTA 5E2TH 1FE8H 4PJBB 4YBHA 1R3IL 5IB4A 1V7ML 4NDMA 5DYOA 1UCBL 5JO5A 4FXGA 3QUXD 5FCUL 1A7PH 2FYYA 3T0WA 3E6FB 3MJ9H 2D0HA 4NBYB 3QO0A 3CMGA 4NZRL 2O5ZL 2FEDD 3OAYH 4YHIB 4TSCH 1FDLH 5I8KL 3SKJL 4ODSL 1YNKH 3QFJD 4G9DB 2E6JA 2HFFA 4FQQB 2NXYC 4TN9A 1FRGL 2N1KA 3NFSL 3LZFL 4PRPA 3SE9H 3S36X 2CD0A 4GKNB 1ADQL 3WIHA 1DCLA 5JW4R 5DRXB 4OFVA 4UAOB 3QXTA 5HJ3A 4CDHA 5F6IC 5J13B 4GW4B 4B50A 3HCVA 1I8MA 4XPAL 1SVCP 3ET9F 4O2FB 4K8RD 3IFNL 3C5JA 4C4KO 5KSVA 1TTGA 2RB8A 4F9LC 2D03H 4P2RE 3QIBB 5FAAA 3BPOC 1U8KA 3MRCA 4KTDL 3TBSA 3WUWB 2E7BA 4XNZB 1K4DA 1LEKB 3GK8H 1YMMB 2OZ4H 3TO4B 3RDTD 5FK9A 3TPUA 3PG2A 3CPLB 1WISA 2NY5H 1G1YA 2EH7L 3GRWL 4GXVH 4BSVA 4K71B 4MCZB 5D7JB 3IKCB 4RIRA 5GRXG 2UZXB 3JTTB 4JG0H 1ZV5A 4OLVH 4Y89A 2XN9A 4Y4FD 2F54D 5LJYH 2FB4L 5D93B 4LDEB 2W9DL 4PBVC 1JK8B 2Y1VA 4X4ME 1CGVA 5KVFL 3ARGD 3SOBL 5I15L 1DQQB 4FXLA 1N8ZA 1LK2B 1FFNA 3RVVC 3IYLW 5TF1L 1R5WB 4M9PA 1AD9B 4H0GA 3ZKMC 4ZAKD 5IVXA 3AU1A 3EOTH 4KHTH 5GGUB 4I5BA 1EEYB 1WLHA 4WFEE 5EORH 1KEML 3O4OC 4LAQH 4RQQA 4YGVB 4U7KA 3P0VH 4GXUN 1F3JB 1BP3B 1UYWL 4WEMB 5ISZB 1TZIB 2E7HA 4RMTA 4KK8D 5E9DB 3MNZA 4JO3L 3HZMA 2A1WH 4FXKA 3RPIA 1HWHB 1VENA 1P4IH 2FO4B 3TFKC 4HCRL 5GS0D 3VH8A 1Z9MA 5EUOA 4D0CB 3LN9A 3WFEH 4Y2DB 5F1OB 1XCQA 4PJEF 5C2BH 4G8FB 4HUXA 2BERA 4HZLB 2YXFA 4HXAH 2Y5TB 3CLFL 2XZAL 1IGMH 4OF7A 4NBXB 1ND0B 4MJ5B 5HI4D 1QLEL 4TPRH 3GSVB 5AUMB 1H8NA 4U4BA 2DMCA 4UT9L 3L5XL 3QEGH 5LQBH 2X1XR 4HH9A 5DK2B 1E4WL 4XH2A 4C57C 2GFBB 4QRUB 1LO4H 1H3UA 5IQ9A 4ZODA 4XP5L 5J56B 1G7MA 3ALXA 4M48L 3UEZA 4ZNCD 4RFEA 1J1OL 5IV2B 2P47B 3GHEL 4JJ5B 5HGBB 4XHJD 4EDWH 1C08B 3OKMB 1XCQB 3TV3H 4H26A 5K9JL 2WQRA 2Y07L 1C5CH 4NZUL 5AD0A 3CDGA 4HDIB 1A14H 4N0UA 1C12A 3B9KC 3OHXA 2MQ0A 4ZMAT 4AEEA 2P24A 4RCAA 2R4SH 1NEZA 4UT7H 1UM4L 2DQHL 3ZZ1A 4YHKL 4CADA 5EBWB 2DL2A 1Q9LB 1BEYH 4GBXB 1CIDA 1FL3A 2HJKA 1KT2A 1MQ8A 4NPYB 4NRYB 5KSAD 4P4RB 3B9DA 3G9VA 4XVUD 3ARQA 3GNMH 3TZVA 4YHPB 2V5MA 2X4OB 2HT4C 1NFDB 3FFDB 3P30H 1NLBL 4GS7B 1DE4A 2CDEA 5HYIA 3GUTA 5IF0A 3NA9H 5HTSA 3HZVA 5KAQF 3TBWA 2Q3ZA 1OGAB 3U4BH 4Y5VA 5FA4A 2HG5A 3U1SH 3KPRB 5GJTH 2ICWB 3MRKB 3P2TA 1UWXH 2UWEE 3V4VL 1VPOL 2MTPA 4LLAA 2W9EH 4S1DC 4CDGC 4J7RA 4GQPH 4OIIL 3OJDA 3PABB 4U2YA 1WQVT 4I77L 4PREA 5D2LB 3VXMA 3OKDB 4MB4A 4BK4A 3NCYS 4C4KT 1J0YA 5K9KB 3QCUL 3QDHA 5ITBH 5CEYA 3HE6A 5TE7L 1A21A 4IBLT 5C71A 4OF0A 3GSXA 1S5HB 4F7MB 1TNMA 1V7NH 4Q6YA 1T80A 2VLJE 1YEJL 2VQ1A 2R0LL 3S37H 1ZT1B 3OG4B 3MO1B 3BX7C 3JTSB 4OTXH 1K8IB 3QUXC 1DDHA 4I3RL 1DBBL 2FBOJ 2LVCA 3VGGA 1F90L 1NGQH 4UT9H 2UY6A 2IAMD 4DKAA 1Z9LA 5D96C 4NWTL 5IMLB 2GJZB 5GZNC 1BIHA 2GEEA 5ECJE 4HUWA 4XC3H 2BVYA 3T0EC 1J8KA 4LLQB 1KG0A 4JGJA 2F5AL 3Q6GL 5EU4A 2XZAH 5IFHL 4A2MA 3MV01 2Q8BL 2E27L 3MMEB 1IKFL 1TFHA 1JZ2A 4NNXA 2BHZA 4JFPA 3D39D 3IDYC 5FYLE 5EO1A 3BPNB 3PV6B 4WCYL 3IDNB 3PDDA 3DETC 4L1DA 4PV8A 3UJJL 4XTRD 4KTYA 3WNLA 4JPIB 3QXDB 3QRGH 2C3GA 1NGXA 5B3NA 3UPRB 4GJTB 2WLZA 2O61B 2E7LA 1M4KA 3FRUA 1U8PA 4PJ5B 3HNTL 2MFNA 5E8PB 1G84A 2RCSL 4I0CC 1BHGA 1P84J 5T1DL 4IDJL 3P0VL 4UOJA 4U1KB 3BGFC 1S3KH 1U3HB 8FABB 3TA3B 3NCMA 1AY1H 3UBXG 4PJGB 4N0UB 5FKPA 3C08L 3V52H 1CD1B 3GJEA 3ARFB 1LNUB 3KR3L 1V8HA 2UUDK 1N0XH 4JFEB 4RGNC 4JJ5A 1WC7B 1YMHA 2NYYC 1VEMA 3BQUB 1U8NA 2AJ3B 4OZIB 5HVGB 1EFXA 1AQDA 2ZUVA 1MFEL 2WW8A 1MAJA 2XTLA 1KPVB 4LCCC 1KTDA 4ORGA 2FR4B 2GTZB 4O2EA 3MRQA 4PJ8C 3BKML 1A7RH 1H3GA 1N6QL 4Z7WF 5DJCB 3MV7A 3O2VH 2GK0A 5SWZE 2AK1L 2FX9L 3EHBD 1KCLA 5ILTL 2G9HB 1XZ0B 5B38G 4YHNA 5EU6A 4H25B 5CILL 4LCYA 1A9EB 3MCG1 2P24B 4AMKL 2EZ0C 4ZTPH 2B4CH 3WDIA 4Z7VB 1RI8A 2NR6D 5HDBF 2WWMC 4JKMA 3VFPA 3V4UH 4MQ7A 1CDUA 2P8LB 5HHPA 5DJXB 1DFBL 2GJZA 3QPXH 5IMLA 3NMEA 3QUMH 1FORL 5ID1A 2VXTL 1FN4B 2VTFA 1UA6H 3MA9H 4OT1H 4JHWL 3ARFC 3DVNA 4GRMB 4NFBA 2X4UA 4TUOA 1U8HA 1DZBA 3V5KB 4JR9L 3D0LA 1IQDA 3TCLA 1ZT1A 1RVFH 4MYWB 1FDLL 5I8KH 1SJXA 5JQHC 2F8XC 3WIIL 4NKIH 1KTRL 3WLBB 1OTUD 2AK4A 4I2XB 1FG9C 4KV5E 2OLDA 3CCHB 3RTQC 5BZDA 1RJCA 3HE6B 1JF6A 4P23D 4HUVA 4MSWA 1UCBH 3CGTA 5CD5C 1CCZA 3ULUF 2AK4E 4Y4FB 4EUPB 1I1FB 3CFBA 2CRZA 3C2AL 5BS0B 4U7SA 1F2XK 4WTZA 3GEWB 5FECA 2WK2A 3P4OA 2VXTH 5HHXH 3GM8A 1MI5A 5DQDH 4NQEB 5EZOL 4L5FL 4WUUE 4M1CC 1T20A 1TMCB 1MWAL 1FBIL 5EIIB 2HVJA 1T7XA 5FYJE 3NCCB 1YNLL 4WW2A 5EZOH 4LLDA 2ENYA 4ODVH 5CFHA 3D18A 5EU3B 5JIKA 2NTSP 2PR4L 1B2WL 1HQ4B 5ILTH 2RGSA 1NC2B 2LFGA 4YXKH 5FDWA 4MAYC 3Q0HA 1KIQA 5CSBA 5F7UA 3GGWA 4IIQB 1O7SA 5JOFA 5ISZE 3QUZC 4XX1G 3PP4H 1NCCL 2CO7B 5TDPB 5D70H 3TYFB 3VW3H 5DTFB 2EDKA 1CLZH 2NTFA 4P2RD 1ACYH 5T3ZE 3CVHA 3DMMB 1FL6B 5DQDL 1A3RH 3OKOA 4P9MH 4FQCH 3HRZA 1S9VA 1GVIA 1NL0H 3C2AH 3NFPB 3OZ9H 4TVPH 3PWJB 2OR8A 1FV1B 3KPRE 3V4PL 1HZHL 3QYCA 5KTEL 3VGAB 2QQQA 4P46C 5CAYB 2HJKB 4N1CA 3GSWA 2CKBH 4MD4B 4NPYA 4TNWF 3TYGL 4E5XB 3GSQA 5L2JA 1P4LB 3P4NB 3WDHA 4N0RA 3SDXE 4WI6A 3K8LA 4LLYA 4Z9KB 3A6CL 1EIBA 2FGWL 4QRRA 1WZ1L 3OWEA 1KJ3H 5DHVB 3O4LA 1GGCH 5CBAB 5FB8B 1DVFA 3SGJA 3GI9L 4YX2L 1LVEA 2YD7A 3PDGA 4GRLD 1B4RA 4QHKI 1U6AL 1S9WA 4M7ZC 3E8UH 4OBSA 2DTSA 4KK9D 4QF1A 3TN0D 3QZWB 3I84A 3TCLB 5C0ND 3EDJA 3QPQC 2P45B 4LCYB 4Z7VF 4NQSB 1MJJB 2Q7YA 3K46A 2X4NA 1OT2A 2P5EE 1PKQA 3UJIH 4A6YH 1RUKL 2YBRB 2VNCA 4XNYL 2MCPL 4OIBA 2J6EL 1TXKA 2MMXA 2HJLB 3ZE1E 1RZ7L 1OGTA 4DN3H 3GJFA 4LPTA 4U1JA 4XHQA 4D0CA 2HMIC 3VI4F 5KSUB 3EW3B 1AO7D 5GRVL 4NZTL 5GRVK 3MRJA 4BH8A 1T1YA 4F7TB 5C0BE 3BPOB 3D0VB 4XP9L 1FGVL 3AAZA 5D1QB 3LEVL 3CLEL 2EDWA 1PZ5B 2EDRA 3QEUB 1A4KA 2QADC 1OAKH 3TBTB 1JRHH 3HNVL 1SYSB 3C87A 4YPGB 2NY6C 5LCVL 1WJ3A 1MCOL 1RJLA 4I1NB 1G7PB 3BP6B 5SWSA 2CUIA 4YR6A 4ERSL 2BJMH 3W39B 3RRQA 4GMTH 5GJTL 2HYMA 2FJGB 1JPGB 3NA9L 3WNMA 1BD2B 2VZSA 1D5XB 1T1XB 4K94C 2BDNL 1IGIH 3VXSE 5E08L 1ED3A 2IAMB 3OAUL 3DJ9A 4P0DA 3NGBB 4NWTH 2FD6H 3V7AE 1VGKA 1ULVA 1I8MB 3VRIA 3GGWB 4WNQB 2OXHA 5F6HI 3ZE2E 5JIIA 1UWEL 3GM0A 1XGUA 2VDMH 3CFDB 3O3UN 3V79C 3AROA 2KBGA 1K4DB 1LEKA 2AJSH 3K1KC 1FYTB 5CZKA 3BH8A 3IDNA 4E42B 2ITDB 4LPUA 1NBYA 1QO3B 4PJBA 4LPVA 3SGEH 3GJFK 5DD6A 3RI5F 3X13A 3O3DA 4H8WC 4QTHA 4WI5A 2C1PB 1JTTA 1N5AB 4M8VA 1HN1A 4G80B 4FQHB 5DFVC 1CG9A 3ILQD 3I9GH 2E9WA 4NN5B 2XY1A 5B38B 5D7JD 4UDTB 4X98B 1CFVH 4M5ZL 3VXMB 4YE4L 4YXHH 4CMHB 3L3HA 4ISVA 3GMLB 3EJYD 4UDUB 3H9SB 3QCTL 1OW0C 4R8WH 2FLRT 4HS3B 2NY0B 1AP2A 5B39B 5EO0B 3JTSA 4RGND 4TUJA 2W9EL 2G75A 3D25A 1NCWL 4X6DF 1WFTA 2XICA 4LIQH 4KRPB 3D85D 2BVPA 2WINB 4JFDA 3C5ZC 4PTUB 5CEYB 2CIKA 1X3DA 2R4SL 4M1CD 4MSWB 4JREB 3F65A 3VXRA 3QRFM 5BS0E 5KSAA 5GS1B 5HYSB 1F13A 4QHUB 2XPGA 5DJXA 5EUOE 3MV8E 1CQYA 4IHOB 3GJFB 3MOBL 4L9DA 1VFBB 4YE4H 1OHQA 2MKLC 4M5ZH 3WDJA 1AGEB 4FFWC 1UYWH 1CFTA 5D7LD 4EDWL 5MEQA 4GRMA 1X5XA 1VFUA 3RWDB 5JNYA 1FPTH 5I71C 3H3PL 1G7LB 1BEYL 5E2UL 3MRRA 4J3WA 3LN5A 1CICA 3MC0A 1NGZA 4FN0A 4HIEB 3QUKB 4OZGE 1F6AB 1YYLH 2FBJH 1U93A 3MBEB 2L7JA 3RWGA 1BOGA 3ULVC 1A14L 1LP9F 4LEXH 4NKMB 4U7MA 5IHUL 2X5PA 4MNHA 4QXTB 2WMPA 5KSBA 3D2UA 3UTPD 4LAJH 1NJ9A 2HN7A 3LHPL 1B6UA 5F88B 4A6YB 5D93C 2OJEA 4MB3A 5ERWA 3UYPA 2H6PA 4HXAL 5I1DA 2OL3L 3FO0L 5EZJB 1IGTA 2P1YA 2NY7H 3EYOB 1IL1A 2X1WL 3TNNB 3GBMH 2G5RA 4UTBH 3UTTD 3QA3A 2ADGA 1E4WH 5FV2A 4JDVA 3KJ4B 4NCC2 2Y7QA 5CINL 1NBZB 3N1MC 2PN5A 2V17L 4TYUA 4PJ8A 1NMBH 2DWDB 5L6YL 5GISL 3JVGC 3NGBC 3U9PL 3QUKA 3WBDA 1G0DA 2AEWA 5FGBA 1VA9A 2H1PL 2H2PC 4QRRE 3MFFA 1QLFB 4NRZA 5DURB 4NQED 3B2VH 4D9LH 1H15A 3FRUB 4AL8L 3ARFA 1I9IH 4XMLH 3F5WB 5C0CB 1KEMH 2LVEA 4M62H 3GSWB 1U8JA 5E8NB 5EC2B 5J3HC 3MGOA 1SYVA 4OLZH 3MLSH 1CDGA 1BJ1H 3TA3A 1RUAH 2KL6A 3CLEH 3PQYD 1KIRB 4P5TB 4Z77B 3QUXA 2KKQA 4Y4FC 2Z31B 5F3BB 2PXYD 5CUSL 2RFXB 4NJ9L 3ILPB 1UACH 3MCLH 2Z8WC 4WGWB 5CGYD 4HG4K 1D5IL 3MREA 5HVFB 4HBQA 5HHNA 1EVTC 3L5WB 1BQHA 5GS3A 4KY1H 3BUYA 1QNZL 1MCBA 3F58H 4YFLF 1H8SA 1FFOA 1LQSR 4D9RD 2EDHA 3DURA 3CDYA 5DTFA 3I50H 4KAQH 4QRPB 1ZLWK 2P5WA 4FFZH 4YUEL 2XQYK 4OFDA 4P9HL 3L3IA 4PJXE 4POYA 5IOPA 4X4XB 1U3ZA 5AZEL 4NHCL 4MXWL 5F7NC 5MEPA 1D9KB 5I0DA 3S36H 4AIZB 5D7IB 2DDQH 4JDTL 4R90H 3BGMA 3SDAC 2JTDA 4Y4FA 4EUPA 1RIVL 4YFDB 1EEQA 5HPMA 2VXQL 5HHMD 3QISA 4B41A 5GS0C 5CZXC 4KFZC 5GGTH 2EIBA 2ZUTA 4L5FH 4WHYH 1VFBA 4TRPH 2AJXL 5C9JB 1KJ3L 2EZ0D 1I4FB 2VC2L 4MJIB 4L3AA 2PR4H 3SDAD 1BAFH 3A6CH 3RKPA 1SEQH 3IFLL 5GSVB 4QWWD 2PXYA 3RL2B 1YNLH 2E7LC 2OJZH 1KXTB 1I1FA 3CFBB 3GKWH 3F12A 5BV7B 4UILL 1A6AA 1L0XA 1UVQB 1S8DA 1AXTH 5CD3B 1CT8B 1DANU 4PJ8B 4YEEA 1RVFL 2F15A 1QSEA 5DRWA 4EIZC 5F1IB 3VGFA 4YO0B 3RTQB 4BUHA 2BMKB 4WJ5B 1U2CA 1AXIB 2H9GA 1KJVB 2AQ3A 2DYPD 2CSPA 5LGHH 5A2JH 1IGTB 3OKNB 4YHZH 5EZJA 1JWMB 3QPXL 3WFZA 1ACYL 1AI1H 4A6YA 1KCUH 2EKJA 1W2KT 5D70L 3WIHH 3Q5OA 1V3MA 1TJHL 3TVMD 2R1XB 4U6TA 2DIBA 2MOVA 4R7NA 1P2CA 1H15B 1P4BH 4R2GC 2LU3A 4D94A 1CTNA 4KVNH 5CILH 4JM2D 5T33L 3QUZB 4MLIA 3BQUA 3WO4B 4D0BB 4GW5A 2A83A 5L2KE 4N0CC 5I1KH 3LKRB 3IU3B 1AIFA 2ZUYA 4HPOH 5GGTL 1KCRL 2FYYB 5CLTA 1ZANL 1VKXA 1QD0A 5JO5B 3ARBC 3BRFA 4W6YB 2BP3A 3QA3B 2B20A 5EWIH 4ZTPL 3WO3B 1KPVA 5TF0A 1NANI 4IMKC 4NGHH 4WEBH 4G9FB 2BNRA 4HSQA 1XCTA 1EHAA 1FFPA 3SJVE 4DGYL 4ZSOE 3RY5A 1ZHBB 5F21B 4FQXD 3VXOA 1BD2A 1MFBH 5L9DH 3IDJA 2XZCH 1JGVL 2P46B 2FEDC 2V2WA 4WU7B 1FNHA 4J3TA 3ZDXF 2FL5A 4W6WB 5HI5D 4H5SB 3GJEB 5DZOA 4BUGA 1ZKAA 5D6CA 5I9QC 4O5LH 5DD5L 2CDFB 1WFOA 3DX7A 4RWYH 3WIIH 3O4LB 5JPNA 1OAQH 4GAJH 5IB3B 3HAEH 3LAFA 4XMKL 2UUDH 3WUWG 4P9HC 5I1IH 1LDSA 4OCYL 3O8XD 2OL3B 2Z35A 1L7IL 4JFFD 5K9OA 3RWFA 4LPXA 1AGFA 4U3HA 3NCBB 5MENB 2Q6WA 2PKDA 2ZKHL 2VL5A 5C09D 2VXVH 1TZIA 5ADOL 1FZMA 4Z7QE 3UJTH 5JXAL 3HG1B 2BNQB 1A4JA 1IBGH 1HH6B 5HGAB 5EU6E 3ZDXE 3QZWA 4PP2B 1KNOA 2BSRB 1DTUA 1VEOA 2IBZY 3ULSA 5JR1H 1FG2A 3JWDH 3MV7E 4CGTA 2CK2A 2X40A 3TT1L 4JRXE 1O7VA 5KBNC 3BXNB 4PV9B 4NC2B 5I1EH 2OSLA 1EK3A 2H2SD 1NSNL 3TT1H 2F8VA 4UDUA 2WUBL 3CC5A 15C8L 5ALBL 1DQML 1DQLH 5DD0H 4PS4H 3FQTB 1UENA 3PQYE 4XI5C 1MCRA 1N2RB 2IAMA 3TP4A 1KC5H 1T22B 1MRFH 2H2SC 1HQ4A 3DO7B 1IM3B 3BJLA 1UXSA 3JV5A 4E41A 1HCFX 1I8IB 4ZS7H 1TCRB 1S7UB 2PTVA 4PJXB 5C0IB 1NDMB 1NAKH 1PGRB 5K9KA 3MV8A 3ETBF 4YBQC 4L4JA 4EI5A 5E2WH 4ZFOA 1MPAL 4OZHB 3PWUA 3QNZA 4H1LG 1F58L 2D4DA 3H3PH 2O5YH 2HAZA 4GXUM 4KU1A 2PYFB 1E6OL 1JF1A 5D2NE 3ZL4H 5KW9L 1EXUA 4S0SD 3GBLA 3VRIB 3HRZB 3WNOA 2CXGA 3KPLB 5I66A 4PTTB 4QRQA 4BKLA 4WW1A 4M6AA 1I75A 2QJDA 5E99L 3E6FA 5EU5B 4F8QA 5TPWH 2ARJQ 1MCDA 2A9NL 4X9IA 2JIXD 4DUWA 4NN7C 4LHUD 1OAUL 1T7ZA 4HKZB 2NY4B 4G7VH 4IIQA 1OF2B 4EI5D 4G9DA 1NMAL 1S9XB 1QFHA 2YUVA 4WWKA 1KT2B 4NRYA 4YHKH 3S97C 1LE9B 3KYMA 2EICA 1EO8H 4HPOL 4WO4D 3B4NA 2HH0H 4PJ7A 1A3QA 2ADIA 4V2CB 3MNVA 2B5IC 4XRCA 3LV3B 5F71A 1Q72L 4MD5A 4NDMB 5DYOB 4Z5RB 1F90H 1CE6A 4NJAL 1ZK9A 4PLJD 1TZHA 3HG1A 1YY9C 4B7LA 2ICWJ 3SE8L 3WXWH 1O0VA 2Q6WB 2DLTA 1VADA 5GS0H 5KJRL 3X12A 4KV5F 1G7MB 3QFJB 4EDXB 4N90D 5F1SA 5K9OB 3QNYB 3VU2A 5ITBL 5I8EA 1BOYA 5DEGB 2IPUG 4EBQL 3GSQB 1F4XH 1MAKA 2Z8VC 4ZPTB 1K3IA 2AGJH 3C60D 4WI8A 1BX2A 3TF7C 4RZCA 2UWEA 1PKQB 3ZO0A 4WUUB 3I3EA 1UZ6E 3LSOB 1I7UB 2ADIB 3BXNA 5DD3H 2R23B 2EYRA 3VG9C 3WNPA 1YN7A 3C6LB 2BSRA 5ICZA 5JDSA 1WWBX 3LPGA 4S1QH 3DRTA 4ZUUB 1MIMH 4APQB 4JZNA 2IPKB 4L4VA 1DBKH 1W72B 5T3XL 3HB3D 2FATL 5EOCJ 4EZMA 4P4KD 3MLXH 3VGAC 4Z0BL 4NCC1 3CFKB 4HJ0C 4Y4KC 3CLFH 3RQ3A 1I1AC 5EUKA 4WI4A 4RNRB 5E5RB 1YEKL 1P69B 3BD3A 4JG1L 4HHAB 2PYFA 4LAQL 4NM4L 1ORQB 2YC1B 2CLZB 1MCPL 3UPRA 5E03A 4R4BA 1XF4A 2VZ3A 3PWUB 3QNZB 3QUMB 5SV4A 4YGVA 3PP3K 4WFFE 4JGMA 1S7QB 4MCZA 5D7JA 4JFED 2BVUA 3RP1A 3BDYL 3V0VA 1I1AD 3TZVD 5A2FA 1NUFA 1S7RB 4PRIB 5K9JH 1JF5A 3TV3L 3STLB 5DMGD 3DV4B 3DRTB 5IHLB 5EO1B 4YWGH 5JDJA 3GBNL 4M7LL 3BIBX 4X6CA 1J5OL 4MS8C 2EECA 3BPLB 4GMSL 4JY5H 2VAJA 5DZNA 3P9LB 5D5MB 5B8CC 3KYOB 3UTZB 5DJ2B 43CAB 5L88L 1N2RA 1SJHA 1CLOL 4PG2A 2F53D 1MAMH 5EU7C 3FQUB 3CZFB 1B88A 5E9DD 4BSVB 5I15H 3UO1H 1QLEH 1QBLL 3EDFA 2I24N 3IDYB 3E2HC 1NC2A 4EN3C 1Z3GL 5IW3A 5IP4A 3IU3A 5GGVH 4MNQE 4JY6B 4D0BA 2ED7A 2WBKA 2BOBB 4P59H 4N68A 5EBMA 2I5YL 3LQZB 4UNTA 1U9KA 4MCYA 2IALA 4K3DH 4P59L 1M71B 1T66C 3OB0H 3HI1B 4WU5A 1HHIA 3LKQA 5J11C 5CZVH 4DAGH 3T0EB 1JTOA 4X6EA 3GMMA 1EA9C 3BD4A 2IG2H 1D5ZB 4G6MH 3I6LE 1MRDL 1KCVH 4XCYA 3RWHA 4BFIB 5GGSY 5DUMH 3VFPB 4LGSB 1S9KC 3U30C 4OAWB 3H8NA 3VXMD 3E3QC 5IESH 3KJ4C 5I19H 3HE6D 3GI8H 2YK1H 3JVGA 1M05B 2CDFA 5EU6B 1IARB 4JY5L 1MWAB 4KJYB 5D6CB 4HQQH 3ARTA 5JQ6L 4M7LH 2CGRH 5EFIA 2PTTA 5IQ7H 2PNDA 4MXQC 5CZXD 1ZA3B 2UYLA 3DVNB 4HJ0D 4Z0XB 3H7LA 1N5YL 2FH8A 3T0XA 3VXOB 4H20L 1J8HD 2A6JA 2J8UE 4ZUTB 1CLOH 1UZ8A 4U1LB 5KS9F 4OB5H 1CDYA 5E1HB 1U95B 4XPTL 2IQAA 2W91A 4MQ7B 1D3CA 3PWPE 3S35X 4DOHB 3HKFA 4M1GH 3BWAA 1E4KC 2BHYA 2WIIA 2VDKH 1I7TB 2ZOKA 4O2CA 1R3IH 3EO0B 1DBAL 3O4LD 3TZVC 2EKSA 1MCJA 3QNXA 3DMMC 3K8KA 4JRYE 4XVJL 1VSCA 5HDQL 2R2BA 4PREB 5D2LA 3FQRB 4OLEA 2Q76A 1RZFL 3M1BB 1Z5LA 2VDQL 4JPWH 1Q0XH 1ZT4B 3S9DB 3P9LA 2OTPA 1PAMA 1H3PL 1RULL 4LMQE 1MCNA 1XGPB 3QIUC 2ICWA 1X6LA 1PFCA 4ONGL 4AH2B 4PJHA 4LSVL 2DOCA 1T1WB 2R1XA 1AXSB 3U0TA 3DMMD 4U6YB 4YAQA 4YDLB 3N1QC 3OX8A 4KMQA 5C0DA 1IGJA 4HIXH 4YH6A 1KCSH 4Q9QL 3D3VD 1NEZB 3QDME 1AKJA 1NJ9B 2K3TA 1ZHLB 4Y4HB 4FG6C 2YR3A 4NO0A 1JNNL 1CYGA 3TIDB 1GGBH 1KGCE 1YN6A 3MCKA 5I75B 4F7EB 2Z0BA 1INQB 1K85A 2X70A 2Q20A 4LPYA 3I6KA 1A9BA 5EC1A 3VD7A 4AM0B 3IGAA 4Y16A 3RWEA 4LLYB 4PLJC 4O9HH 3CDGB 5F9JB 1CDHA 1T21B 2VKWA 12E8L 2EDJA 4XAKD 1QLFA 4NRZB 4OD3L 1X5AA 1F6AA 1NGYB 1KOAA 4RSVA 3WV0A 1WWWX 4ZFFA 3EDDA 1U8OA 5K33A 5MHSD 3MNWB 4NQDD 5HYQA 4Z8FL 5EN2A 1TZHB 5C0BA 2DMKA 2GUOA 2EIZB 2VDNL 2QSCL 5E9DE 4CVZA 2JCCE 1INDL 5A16A 5T5NG 5E24E 5ELIA 3QG7H 4KKAC 3SGKA 3OKLB 5FM4A 4AMKH 3MV9B 5F6HJ 15C8H 3AGVA 4HWZB 4R96A 5JIHA 4PJ5D 2ZUWA 1JFQL 5DD1L 1A7RL 4BJLA 5HYJA 1E6OH 3L95B 2HKFL 3NIDF 3MLVL 4NQDA 1A7OL 5ADOH 1TJGH 4QHNA 4LRNL 4ZTOH 3OF6A 5EOCH 4K3EL 4KJYA 1MCOH 2P5ED 3L5HA 1EEUA 2M26A 4CN6A 5IVXB 5L8LB 3ROLB 1F02I 1Q94B 5DJZA 4FOMA 4F9PA 1RZKC 5E94A 4LRIA 1MRFL 4MNQB 4UINH 1A0QH 1KXVC 5T1LB 3FOMB 4NOFA 4ZTOL 2I26N 1I85C 3VRJA 2V7HA 4HG4J 1YEDA 1QP1A 1YC7A 2ZJSH 3H3BC 4P5TC 3U9UA 2RIKA 2XZZA 3H7BB 3LKPA 2HKFH 1FCGA 2A0LC 2W60B 1OWRM 1NAKL 5ANMB 1T03L 2BMKA 1RQ5A 1NFDF 1W0WB 3BP5B 4RISH 1T7VA 2PF6A 1G0XA 4ZOCA 1RU9L 4LNRA 1RURL 2P8PA 3U7WL 1YMMA 3TO4A 5EOCL 2X10A 4Q6IB 3EDEA 3DRQA 3NFNA 4GRLA 1NEUA 4PLKD 4G8GA 5DK3A 2FJGA 1P53A 1FYTD 5HYEA 1RURH 3U7WH 3QXWA 2ORBL 1T1XA 1I9RH 1I7ZA 3V5HB 4PJHF 3SDDB 4S2SA 5GGVY 4X6CB 1YZZA 4KKLC 3HMWL 4GS7C 1HYSC 5SX5K 3BP6A 5DD5H 2UZIH 5ACMA 1G7IA 4J3OC 3SDDC 4DCQB 1KCUL 4R2GB 3JV6B 4UIMB 2DBLL 2QADD 1LP9E 1ORQA 4HH9B 4TVPL 4KTEH 1EMTH 3LD8B 3HAEA 4ETQA 5L9DL 1L7IH 5KN5A 4F57H 3FN0L 3DSFL 5FOBA 5AUMA 2X42A 1F4AA 1T5XA 3MJ8A 5HYJB 4HMCA 3AREA 3LEYL 3K7UA 5MHSE 1IAKB 3V0AC 4K3EH 3MRMB 1I3UA 3RUGF 5IB1B 2GT9A 4ODTH 1E4XL 5KSBF 4LLMB 3C8HA 1GPOH 2XOTA 3GKWL 3BO8B 1DEDA 5E70A 3VGEA 3C09B 1BZQK 4LFHG 2BNRB 3HLAA 1T1ZB 4MJ6A 4ZO9A 1NGPH 2A83B 1DLHA 3MYZA 1WCQA 3SKUD 3QO1B 5I1HH 3EZ8A 5F7LB 5EWIL 2EYSA 4BQBA 1MQKH 4UTAH 2AQ1A 1XIWB 1ZLSH 1W0YT 2EYTA 4P5MA 1FLRH 1HYRC 4OLUL 2BXYA 3IDJB 4JY4A 4D3CH 1WICA 4WHDA 2DQJL 2YUZA 5MI0B 1LK3H 4KDTC 2IAMC 3MLRL 1MFNA 1XGYL 5BV7L 2YPLB 3L6FB 2BNQD 3S5LA 1SJEA 5IKCB 2PW1B 1AO7A 2A6DB 3G5YB 3QDGA 2Y36H 4U1JB 3OR6A 2ITDA 4FQIH 1FNSH 1JZ5A 2F74A 2VLLB 1IQWH 3EYOA 2N7BA 2C3HA 4M48H 4G8IB 5GRUH 1GZQB 3W0WD 4AEHL 1F42A 2ZNXA 1DN2A 5F9OH 1WV7T 4FQPA 1MCWW 3CNKA 3KHQA 4PB9H 1MF2L 1EAPA 1X6NA 1BECA 1S9WB 4XAWH 5FYKE 3RWGB 1OM3H 3FOLB 5C09E 3PWVA 3MO1A 2ICWI 1IGML 5DURD 2V5YA 3LMJH 4NQXB 4G6FD 2ZOLA 3WHE0 4KXZI 4PY8J 5DMGC 5SWQB 4Y5XB 4GFTB 3QIWD 3LKSB 5I19L 1RHFA 3U82B 1ITCA 4HJJL 4LSRL 1BJ8A 1G7PA 5JOEA 2ZPKL 1JGUL 2A1WL 1L0QA 3TN0C 3ULUH 2DI9A 2D9CA 4UI2A 2Z9TA 3W0WE 1QSFA 4LNRB 5DXWA 3ZE1F 2XYCA 5JLZA 2C7UA 2FJFA 2NY6B 5GS2H 3S3SA 1XR9B 1YY8B 4QHMB 1NAMH 3MJGX 4P2QA 3PL6C 1CBVL 1WK0A 1IM3A 5IWLC 3I6LD 1EEZB 3PGFL 4HF5H 3C6LC 1E4KA 1MFDH 2A6KB 1KELL 2JIXB 3GKZA 4OD1H 2XTJB 5GGVL 4OUUB 4XCEB 1CGUA 5DRNB 1MVUB 4X0KA 2FDBP 4TULL 3RKDC 4UQ3B 4C56A 2X1OA 3GIVA 2ARWA 1HDMA 5C0FA 4GG6B 4ONFL 1R5IB 3DYMA 4KK8C 5FHBH 3QT2A 4LHQB 3MJ6A 3F58L 5HHMB 2VN7A 1CU4H 1INQA 3FZUD 5E2UH 2UVEA 3G9AB 1V3LA 4H26B 3FQWB 3NABH 3BYYA 4PRHA 3LS5L 5I18L 1MH5B 4F15C 1RIUL 6FABH 3GSRB 5KVGH 3OB0K 4NKDA 1DVFB 2P49B 2NPLX 3T08A 3L5IA 1AD0A 3RHWF 2QEJA 5T3XH 5IHZB 5MENE 4XP1H 4X7TA 2GAZB 4HWZA 3Q48A 4G8IA 4Y4HC 4PRPE 4QRTA 4ZOBA 1L6XA 2X2YA 3I6GB 2GK0B 4NM4H 4FA8A 3C60B 4NO3A 4MD0A 3QXUA 4D9LL 3WKMH 3SKNB 3MRQB 1VGKB 5DD3L 2E27H 5IB3A 2HRLA 3EIFA 3P9MA 2YN5A 2EEAA 3M17B 3OKKB 4KKAD 4LLWB 4HFUH 4XI5D 5IUSA 1AHWB 1FVDB 1NMBL 4DFHA 4LEXL 4Y5YB 4R7DA 1P7KB 4MZ2A 4TUOB 3HZKB 1QZ1A 1I8KA 3KPMB 5CJBA 4NQCA 4FABL 3MRDA 4YNYB 1MCEA 4I0PB 1NC4A 4P4KB 5F7YC 1XGPA 5L88H 1FNFA 4F9PC 5DDHB 5TQ2L 4J8RA 3EFFA 3BEWB 2Q76B 1R5VB 1G7LA 4IEFB 1DQDL 4J3SA 1WIPA 4PJIB 4NKMA 5GS1C 4IRZL 5LXGL 4HZAA 2HWZH 3V6BR 1LEIA 3N1GC 1FNEA 1CFTB 1JJUA 3H9SD 3MOBH 4M02A 4EBQH 3DI3B 2JB6B 2EDDA 4HAFA 5BVJB 5DJYA 4AT6A 5CJQL 3ECBA 3IJSA 1KB5A 5E00B 1CDJA 1VDGA 3QJHB 5EH1A 2NZIA 1Q9KA 3C60C 3C8KA 4X99B 4UBDD 3C9NA