4H1LB

Tcr interaction with peptide mimics of nickel offers structural insights in nickel contact allergy
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
187
structure length
179
Chain Sequence
RPRFLELLKSECHFFNGTERVRFLERYFHNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGQVDNYCRHNYGVVESFTVQRRVHPQVTVYPAKLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title T-cell receptor (TCR) interaction with peptides that mimic nickel offers insight into nickel contact allergy.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 179
sequence length 187
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h1lB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4h1lB01
4P4RB 1RUPL 1LO0L 3KPQB 2P4AB 1F3RB 3RBSA 2F5BL 3ZDXF 5FYLL 3SN6N 2G5BA 3V6FA 3LSOB 4PJIE 1U8QA 2P48B 4XAKE 2NZIA 3O6FA 1T7YA 3QDGD 2V6HA 1FFOB 2HLAA 5LBSL 4AEHL 2FBOJ 3QNZB 2FLRT 2Q7NA 3KNBB 4J3VA 1OSPH 1G1CA 1QFWI 2H8PB 2DQHH 4L3CB 5K9JL 1NBVH 4HPOL 1FPTL 5DJ2A 1FZKA 2XPGA 4LFHD 4IRZH 3FN0L 1JNHA 5L2KA 4Y8AA 1R3JB 4HGKC 1YJDH 3ZSSA 5E94B 1BBJB 2X4RB 1IQDA 4NGHH 1A2YA 5GGTA 2C4XA 1BFTA 1E4KA 3U48A 5FFLA 2DM2A 1N7ML 3T4YA 1EEZA 1T5XB 4UU9B 2V5TA 2Z31D 5B8CA 5BJTA 5F8RC 3VXTA 2ARJQ 4PG9B 1KNOB 3MRQB 3O6MH 4WUKL 3CPLA 3IYLW 3RWCB 2Z31C 3ULVF 3JV4B 4GAJH 2HN7B 4JRYB 4XPTL 2AJYL 3MLWL 4LIQH 2G2RB 1SMAA 4MX7B 4WW1B 1AKJD 1Q72L 5HI3C 3QWOA 4RFOL 4GMSH 4MXVF 5AG9A 2DRUA 1JI1A 4RNRA 5HYEA 2MKLC 1CD1A 2V7NA 4FMFA 3TESA 1UCBL 2FATL 5GGUB 1OGTA 4ZNEE 4GW5A 2X05A 4MJ4A 3DOSA 5DC4B 3IJHA 4ZUSB 1LEKB 5F70A 1MQKL 2O93L 2ITDA 1OM3H 5JPMA 5T5NF 3BQUA 5DDHB 3B9KA 4L3EE 3OR7B 3BPOB 1WC7A 4HMEA 4Z7QE 4DKEH 5DR5H 4UI2A 2BOCA 4MGXA 5JLZA 5T1LD 4HCRL 5HVFB 4KI1A 3VG9C 1TZHA 1CFTB 2KH2B 1PKQE 1MJJB 1QKZL 3HS0B 5IW1B 4BQ9A 5ENWA 3WMSA 2R0KH 4L8BA 4NQUA 1QPPA 2DQJL 1XF2A 1E4WH 4WV1A 1KC5H 1TZIA 1Q9KB 4U3HA 1RUMH 5C09A 1GRWA 5FKPB 1LDSA 4JFPA 4YHKL 1NFIA 2Z91B 4OFDA 5GHWH 3IJSB 4K71B 4PR5A 4XVJH 5AZ2L 2QQNH 3PP3H 4NZTL 1ED3B 1P4IL 3MRNB 1OCWH 4Z7VB 5DD0L 2EDXA 2VDMH 1CD9B 4LRIC 3BEWA 4RQQA 3D3VB 5IQ7L 1K6QL 2DQIH 1B4JL 1CLZH 4N90E 4G7YH 1OOAA 3RTQD 4Y2DC 5J6HA 1OY3B 1SY6A 3DURB 3ULUH 4N68A 2P7TA 1G6RL 2MHAB 3RTQC 1UH4A 4LHUD 1TCMA 1OGAE 2HKFL 4OGXL 3Q5TA 1IAIH 1TJIH 3I85A 2J6EL 4KK5D 2D03L 5TF0A 4ODHL 5SWSD 4QRPA 1P1ZA 4C57C 3BVNB 4UQ3B 2IALA 4JQIH 2PUQT 3A6BH 3DVIA 1FYHB 4NP4H 4K8RD 4KHTH 4KK5C 4YE4L 3VG0L 1A4KB 1A6AA 3J8F7 2EH7H 2VDNH 1AP2A 1ZVSB 3RA7H 5AZEL 2VZTA 1SBSL 3FHAA 2HFGL 3GBNH 5EH1A 3C60A 1MVUA 5FV1L 5BZWB 1C12B 3IFLL 4KQ4L 5HPOA 2F58H 1WIPA 4PRAA 4UT6H 3RU8H 1NL0L 4I3RL 3HNTL 4C54A 1BFOA 5EU5B 1QACA 1EO8H 3KXFE 5J56B 3PWPB 1WWBX 5D2LB 4NC1C 5DMIL 2VZ3A 3H9YA 4WNQA 1JUFB 2IH3B 1IFHH 4PYHA 1DBJL 4P9MH 5IKCB 2WM0A 3D39E 1I7TA 5I8OL 4NM4H 3FB8A 5I6XB 4WTZG 5K59F 3D0VA 4HT1H 3WIHA 4JM4L 5GGSB 3DNKA 3CFDB 1JL8A 5BXFA 4F37F 5J13C 2A2QT 3KLHD 2RFXA 4XWOD 4PB9L 1WIOA 3GSRA 4LVOC 4QT5B 4JANA 1LO3L 3BE1H 1JYWA 1I8MA 5D7SL 3UZVB 4JY5H 1N4XH 3KLHC 1P5UA 5CKAA 1MWAH 2FD6H 4KI5F 4XWOC 3PHSA 2V5YA 5F96L 4OLXH 1JWMA 1OPGL 2A6IA 1QLEL 4KZDH 3CSPA 2DTML 3RGVD 2KBGA 4RGND 4F9LC 1HXYB 1IGTA 4RRPA 3CDFA 4N5ED 3RGVC 5I0DA 3LKPA 3T0BA 2FR4B 4YQXL 4N5EC 3AREA 1E4XL 4MDIA 4MNQD 4YIQA 1A47A 3MV11 4X6FB 1CF8H 3EOBA 3RWDA 4OCLC 1GH7A 3C08H 3AS2A 4LASL 1U91B 1TVHB 2AK4B 2BVQB 1R5VB 1DL7H 4YXKH 3JUZA 2HJLB 1MJ8H 3WKNA 1HZHH 3T3MF 3EYUH 4HUUA 1BOGA 4LLVB 5GS2D 5IJKA 1ZA3B 4P4KA 1HKLH 3EYOA 2Y7QB 5T3XE 1KJ2B 1U95B 2VYRE 1DQTA 1BD2A 1HILA 1D5XA 2ZSWA 3FO2A 3WNNA 1LEIB 4HUWA 4PJ8D 4XCNA 4X6CB 3RVUC 2BNUA 3QAZC 2I9LA 1NFDA 1VFBA 4PJ8C 4HMCA 3GSVA 1XR8B 2XN9A 1K8DB 4FQLH 1NDMB 4JO3H 4YDJA 5DO2D 4PJCE 3IXAB 1PAMA 4WWKB 4Y5YB 4HD9A 2VLKA 4Q74A 4QRSB 3SE4A 4NKQB 1P4BL 4QHNB 5DO2C 4TNVF 1SM3L 1A7OL 1YEGL 2VZVA 5BCAA 3VCLA 1PQZB 5I76A 1H5BC 5ISZE 1T89A 1Z9MA 4EUPA 4IOSD 3HPJB 5MHSD 2CR3A 1OAYL 4BZYA 5CJ8A 5DURB 1KTRL 4B53A 4X9IA 1WIUA 4YHOL 5FK9B 3G6AB 4FZEL 4ORZC 4M9OA 1KFAH 4Z7WB 4V1DE 3ZDYE 5F9DC 4ELMB 5CWSB 4N0UE 1S9XB 4CU6A 1NUDA 5EIIA 3EFFA 3RVWC 5F89A 2CRZA 1KSRA 1R3LB 4FQCL 1AO7A 4OJFL 3S3SA 4NO3A 5CSZA 4UTAH 5CIPH 4PJAA 4YO0B 1M05A 3GHEH 4G8GE 1K5NB 2W92A 1UM5L 1AR2A 2X4PA 3EO9H 4XHJD 3U6RA 1CLOL 1V3MA 2FECL 5HBBA 1EJ6A 5ECJE 2BFVL 5MENA 4XHJC 4C59B 5I1LA 2X44D 3QZWA 1QSFE 4N8VB 4A2MA 4ZFZB 2YRZA 3ARBB 3QEGL 2QKIB 3FB5B 4Y1AE 5DJXB 4H1LG 2VDRL 3KYMA 5HDLA 4GBXA 5CJQH 5CINH 2CIIA 3CVIL 5CILL 4NRYB 3DIFA 3OSKA 4XCYA 3QULB 5IVZA 5C70A 1IM9A 5D70L 5KVEL 4PJDB 3I2CL 1ACYH 3MUGA 1KBGH 4WRLA 5DGRA 4E42B 5JORA 5IFJA 5HYIA 2BVOA 3PGFL 4U4BA 5FYKE 3OXSA 3QHFH 1Q9WB 5L9DH 1JPGA 2PTTB 2P5EA 4E41E 3IDGB 1QSEB 3H3PL 1DEDA 1RJCA 4E5XA 4J3XA 1TLKA 3W0WA 5FM5M 4PD4J 1KPUA 4DN4L 3BPLC 5LVEA 3DXAB 3DYPA 5K93A 1NC2B 2R2BA 5GRJL 3PL6A 4LCCA 3QO1A 3CVHL 1Z6JT 1WZ1H 3BHBB 4H25A 1WZKA 2AKRA 4I4WA 5HGHB 2VXQL 1AHWC 4P2OB 2A77L 4LCYA 3JV0A 1F90H 1I8KB 4WEUD 2V17H 4H8WH 3CX2A 1CDUA 3QUYD 4GSDL 4G6ML 3S36L 3FFCD 5DVLA 5IG7A 4L8SC 4FQXC 3VW3L 2P8LB 4WHDA 1JVKA 3QUYC 4OD2B 5CHNB 5FF6B 1JYVA 3GI8H 2EYSB 5GPRA 2NNAA 4W68A 4PJ5D 3CCHB 2P44B 1I1FA 2JCCE 1FZMA 4IEFB 2A73A 4OD1L 5GGQL 3T3PF 2AQ1A 4PRPB 1L0YA 2M2DA 3ARFC 3V8OA 1CTNA 4AQ1B 2QHRL 3VFMA 3LKRA 3IETB 5C0GB 1BFVL 3HMWH 4PJEF 4RDQF 1FNSH 1H15A 1D6EB 2HJKB 1L7TL 4HIXH 3MJGX 4MJ5A 4KTEL 1I3GH 1KLGB 3SOBH 2J88L 3TIEB 1DR9A 1I75A 3GMOB 1M7IB 3VE0B 1FVEB 5FGBA 2I07B 4LSPH 4H26A 4MAYB 1U8OA 4FQQB 1QO3B 4XBEL 1U3ZA 3BI9X 4M7ZB 4M7JL 4Z7NF 2JELL 3U4AA 3S88L 4JFED 1Q0XL 1XGTB 3OXRA 1II4E 3TPUA 4LNRB 4HIJB 5EOTA 5BV7B 5C08D 4EUPG 5JXED 1T83C 2EO1A 3WS6C 3S96B 3N9GL 4HH8A 3VXSA 5EBWB 3SDDD 1DTUA 4HPYH 4NQVB 4WJ5A 3RDTD 1ACZA 5DJAA 4OCXH 4GJTB 1KCSH 5IMLA 1Q9OB 2D31A 3QJFB 3U7AA 3UDWA 1GXEA 4LCWE 2GQHA 3SDDC 1A4JA 4NQEB 1KUMA 2PCPA 3RDTC 2WUCL 3QG7H 1QQDB 3MGTA 3X14A 4XB8A 3HHRB 2GT9A 3DI3B 1K3ZA 3RJDA 3T2NH 2XACC 3V2AR 1F58L 5F3BA 2K9UA 3VH8B 5MEPA 2G9HB 2NY3D 2I9TA 3GK8L 1ORQA 2R0WL 1YMMB 3MLVL 2HKHL 2NY3C 2VITA 1A9BA 1NUGA 1E6JL 1NDGB 1GOFA 1QBLL 1YNTB 2EYTA 4Y19E 4DVRH 2A9NL 4OZFH 1BOYA 3PHQA 1DN0B 4M6OL 5J6GA 1X5JA 2R0ZL 4YXLH 2FO4A 3G6JE 1QVOA 3O3DB 2CGRH 3FZUD 5IVXB 2DWEB 1FNLA 2X2YA 1KYOJ 3QNYA 2F5AL 5C0BE 4XAWL 4BH8B 2WAHA 3KPSD 5IMOA 4PRHA 4HBCL 5DLML 4RMUA 3IDIA 4KK8D 1I9JH 4JVWA 1H8OA 4I0PC 4X5XA 2GSGB 4NJ9L 2BHYA 5GISH 4NSKB 3KJ4C 4Y16D 1GZPB 2OXHA 4KK8C 3ULSB 1T22A 4GS7C 3RY5A 5IV2A 3SGDH 5E7BA 1T20A 5SWZA 5HY9A 4YC2B 1BEYH 1OAKH 4QRTB 1FZOA 1S7WB 4N5UA 3SE8L 2DKUA 2AJ3A 1MFEL 1C5DB 5E95B 3QNXB 1RZKH 3KR3H 1A3LH 1QRNA 5M95B 4HC1L 1A7PH 1B2WL 4RIRA 2DQTH 3QCVL 3V6BR 5KTEL 5FYJD 4K2UH 2H1PH 4ODSH 3ALWA 1NCBL 2FYYA 1GC1C 1ZT4A 3HKFA 4G3YH 3CH8A 1MFNA 4RSVA 4ODWA 3VFNA 3N1QC 4OB5H 5D7IE 3SJVB 3WL9B 5C2BL 4TVPE 3CIQA 3S37L 4XZUB 3REVB 2EEBA 1FG2B 5CBAA 2G5BB 3HC3H 2B5IB 2JB5H 2ORBL 3IS1X 1KJ3H 1AGCA 4RX4A 3O6FB 1SEQH 5ESAA 3ILPB 3NPZB 1JBJA 2A74A 3S3JA 2JB6B 3STLA 2EIZA 3UPRB 5ITBL 2V2XA 4PTTB 1TXKA 1M4KA 3GSNH 3U4BL 3RWEA 1CD0A 4HULB 1HI6A 2FEDD 2CJUH 5TDNB 5L8JB 2AJZB 5IFAH 5GGVH 1TTUA 5DJ2B 3CSYA 2GITB 3QIWD 4LCIL 4NN6B 3MJ7B 2QQKH 2FEDC 4RAVA 1WWAX 3CX5J 4YHML 1ZSDA 4KRMB 3QIWC 1BAFH 2E3VA 4DKFH 5LXGL 3ULVH 1A2YB 4YAQA 2FLBT 2ILLA 2RR3A 3HC0A 2CDEB 2X4OB 4HUKB 3ARPA 2ZUTA 3BKYL 4EN3D 3MRIA 3UC0H 4PJFF 5BJTB 5HSFA 3RBGA 3ARVA 1UM4H 1W0WB 2HAZA 2ZOLB 5KSVA 4EN3C 4ZFGH 2DQGH 1CD8A 3D18A 3VFUB 3UYOD 1AD0A 1A6WL 1VEOA 3UMTA 2IBZY 2EDOA 1CDYA 4CVWA 1A7NH 5C0FB 3HI6L 1MCHA 4YDIH 3LDBC 4OFYA 2X7LA 1MNUH 4RNRB 5CEZD 4WFED 4JFQA 1YPZF 3MCKB 1FP5A 4JFFD 4P2QA 4IHOA 5DQDL 1OGTB 2J12B 2YHGA 4FQIL 3WXWH 5DVOA 4U2ZA 4WEBH 2ADFH 5FHAL 1IC7H 4OM1L 2ITDB 3V5HB 5KZCB 2UWEF 3S35L 2AV7A 2P43B 5JHLL 4ZPVA 3L7EB 3QDHA 3TYGH 1WC7B 2BDNH 4ZS7H 3QJHA 1LK3H 4D0CA 5JLZB 2BOCB 4HDIA 1ADQH 2AXGA 5J57B 3KPRD 3C9NA 4ISVA 3RX7A 1CE1L 2DLIA 2ID5A 3FMGH 2J7LA 4YZFF 3EDJA 5C07A 4FABL 4FG6C 3EJYD 1XF2B 3Q2CA 1C5CL 3V79C 1U3HD 5F7WC 4X9GA 4FTVD 4MCZB 5DJ0A 5I1AA 2HVJB 3L3OB 4M7KH 4PGCB 4ZTOL 1U3HC 1ZKAA 3VGEA 3JV6B 3GRWH 2D4FA 2OL3A 4EDXA 2ICWI 1YEEL 3HUJF 5L8KB 3VRIA 4WFFD 1MFBL 2APTA 1FG9C 4PJXF 5D96C 2FRGP 1QSVA 2F19L 2APVA 5FGSA 4OZHA 1OQOA 4NRXA 4K94H 3O2VL 1ZLWK 1HSAA 1NANI 2NR6D 2HT3D 3N1GC 2B8OT 4JJ5A 1K8IB 4PJHF 5ACLA 3N50A 3DV6A 4LSQH 5IHLB 5FM8A 2P7TB 3LPWA 2NR6C 2HT3C 3KDMA 5GS1C 1JGUH 1MFAL 6FABH 2HVKB 4IIQA 4WHYG 3SPVA 3U2SB 5ICXA 4QRPB 5JMOC 4XNXH 2LU3A 1Y6KR 4DGVL 5KANI 3BKMH 1MWAB 3TZVD 3F8UB 5F9OL 1MLBB 3GSQA 2XKNB 5MI0C 5L2KE 5IVNA 1I3UA 3TZVC 1T3FA 2EDKA 1HHIA 4ZMAT 1A14H 5DD6B 1X4YA 3FOMB 4PRAB 5DQ9A 2DIJA 5E8NB 4CGTA 1K85A 4NQDD 5I1JL 4WUUD 2Q8AL 3UTTE 5IQ9A 4L4TB 3HG1A 2MQCA 2YUZA 5EZJA 1XIWB 2YRLA 5J7CC 4AG4H 1JV5B 3VMPA 3VXNB 3O2DH 2YPVH 1T0MB 1BJ8A 4R90L 3D0VB 5BS0E 3HFML 1GGIH 4K3HA 4A6YA 4HMDA 3X3GL 2Y23A 5IB3B 4G6JL 1OAQH 3VFWA 4NQSB 2OI9B 1TQCC 5TE4H 3QCUL 2NW2A 2NXZB 3C09C 3EBAA 1I8MB 1J8HD 4PS4L 3D25A 4ODXB 3VWKA 3T0EE 3HNSH 3KS0J 2XWBA 2A6IB 4MJIB 3VFTA 4CADA 1RZ8A 1OT2A 1RVFH 2K1MA 1G7MA 4XC3H 3ZE0E 1RV6X 4XPFL 1IGTB 3HRZA 1MREH 2AQ3A 4QOKD 3D5OF 1QFWL 3MO1A 4M48H 4NZUH 3O2WH 4OF3A 2VZOA 5J12B 1DVFC 2OJZH 3WSQH 4MDIB 1KEMH 3WYRA 2NTSP 1LD9A 5C09E 4YR6A 3PDDA 1VB9A 3G6DH 1EV2E 1LNUA 5TFSL 1CQYA 1DQJA 1KXQE 4HWBA 3EYQD 4MZ3A 1GPOL 3IFPA 5IFHL 3MRFB 4CDHA 1BOGB 3A6CH 1X5XA 4KU1A 3NCYS 4DW2H 3EYQC 4HKXA 2V9QA 1AI1H 2VAAA 4OFKA 1Y18A 4MD4B 2Q6WB 4L4VD 2L0DA 5EOCH 2YUWA 3DV4A 3ZKXB 3UAJD 4ZDHB 5TJWK 3P4NA 5A40E 2DYPA 2GTWA 3VXUE 4Y4HD 4NWTL 5KG9B 4HUWB 4XCNB 2ATPA 4X6DF 3UAJC 5CMAB 4JN1H 3BGFB 4Y4HC 3QWRD 1K4CB 1VFBB 1FZJA 4NIKB 3GSVB 5CIPB 1S3KH 2JJTA 3BDYL 2X41A 3RNKA 3LRSA 4R0LA 3K3QA 3HZMA 4KUCD 3VWJD 4KGLA 4U1NA 4DN3L 2EXWD 3NCFB 2ZWLT 1M7DB 5DMGD 2BNRA 3NFNA 3VWJC 3WIFA 2EXWC 5I76B 2B1AL 2R1YA 4X99A 3VXRB 5DMGC 5FYLE 4U1KA 2Q7YA 4R97B 1A6PA 4NT6A 4YBLC 4X7TB 4MA1B 3QXWA 4WIQA 4WO4B 2VXUH 3T65A 1PEZA 4HIHB 1MEXL 1ONQB 2VXSL 4X7EC 4U6XA 4TVPH 4ZOCA 4G6KL 1RK0A 2ADIB 1RIHH 5EIIB 3EFFB 5FM4A 1UZ6E 5EIVA 1T7VA 4L3AA 4NO3B 5CSZB 3G08B 3B8SA 3EFDH 4M61A 1M05B 3CSGA 3MLZL 4ETQA 4WY7L 2VC2L 4J4PA 4GKZB 1JTOA 5I19L 3DPBA 2CK0H 4LEOB 4JFXB 5KSBE 1XGYL 1PFCA 1YEDA 5F21B 2J5LC 1BBDL 2X9WA 3H0TA 3ZTJH 4JFHD 4HKJA 1E27A 3QZWB 5EOQH 1HH9A 4HAFA 2X5PA 3EO1A 4GBXB 4X6EA 5FDYA 2VDLL 1EZVY 3TBWB 5BRZA 4BQ6A 3C8HA 4L3EB 3E8UL 5IVZB 3VXOB 1TJGL 2PN5A 5SX5K 3D69B 4PJEA 5DRWB 2AK1H 3EZJB 5F7FA 2F8OA 4JFYA 1A6ZA 5IFJB 1OARH 2WMPA 5JOPE 1IAOA 1YQVL 2E27H 2H26A 4OLUL 3GBMH 4RMSA 2W38A 1JPGB 4P3WA 5I75B 1MPAH 4XWGH 3SGJC 4BZ1H 4AJ0A 1A3QA 3WV0A 2ADGA 1MCQA 3X3FL 4NN5B 4LHQB 1IKFH 4E5XB 3W0WB 4EXKA 4DZBA 3WKMH 1BLNB 4HG4K 4Q97A 1DBMH 2GCYB 3RL2B 1Q38A 4MNHB 3ZHKA 1GGBL 1KELH 4LCCB 3O3UN 3DBXB 3NGBC 4PYGA 4G9FE 3EYFA 4O51A 3BH9A 1DQLL 2YS4A 2IQ9H 5HVGB 3PP3K 3DGGA 4M1CD 4MJ6A 3CFJB 4OKVB 5GZOD 1T4KA 4HJ0D 1EFXB 1BGXL 4M1CC 5IG7B 2JK5A 2KQNA 5GZOC 5IB2A 1NCAH 3DVNA 4HJ0C 2XN9E 5D2NC 1OP5K 4R96B 4HEPG 1LE9A 3N1MC 1REIA 1I1FB 5KBNC 1A6UL 1N64L 5GS0D 1NCDH 4GRLD 2VLKE 1VSCA 2VO5A 5IOPA 4OZGF 5F88A 5JHDA 2ATKB 1NKRA 5IP4A 5GS0C 4GRLC 1H15B 1HDMA 3QHZL 3MV8D 1MRDH 4MJ5B 2VQTA 4XCEA 1BREA 1KTKE 2XY2A 5I1CL 2R4RL 2YD7A 3IAQA 2GJ6E 4UV4H 4CVXB 4H26B 3I3BA 1T04B 2GHWB 4D9LL 5IB1B 2JIXA 3O11A 4RWYH 2WLZA 3OXRB 3TPUB 5C6PB 2R0LL 1PVHA 3KXFB 4FRWA 1P53A 5F7MC 5JXAL 4K7FB 4QXGH 4XMKL 1F02I 1CGYA 2VLRE 5CZXD 2W9DH 4I5BB 3VXSB 4WJ5B 3QUZD 2YPLA 1R24B 5EA0L 5CJOL 1GGUA 5DJAB 1CDHA 5CZXC 2D31B 3JVGA 3UYRL 4DFIA 1KULA 1A4JB 3QUZC 2PCPB 4PJAE 1V5JA 4S10A 4ELKA 1UJ3B 4LFHG 3MACL 2Z8WC 2O5ZL 2VKXA 1ITCA 2OR7A 1KTLA 3MSPA 5MENE 5F3BB 3F7RA 2H32A 4ODVH 1T0PB 5MEPB 4UUJB 1IEBB 2BVPB 2QR0A 2B0SH 4Z95L 4BSVA 3M17A 25C8H 2EECA 5ALBH 3FOLB 2ZP0T 1MCWW 3PXHA 1A9BB 4WFHD 2BSRB 1IC4H 2QSCH 3ARWA 1S7VA 3FCTA 1PYWA 5DS8B 3CLEL 3BIBX 3MJ9A 1ZLUH 5AEAA 2CUMA 2R9HD 5CAYB 1MVFA 3F6IA 1OAUL 3MLUH 2FO4B 2FHCA 4QRQA 1CGSL 2P5EE 2PW2A 3GM0A 1JNLH 2R9HC 1VFUA 3MREA 4LLUA 1P7HL 2MQ3A 4LPCA 4MVBD 2XG5A 1EMTL 1G0DA 1KLUA 2VKWA 4PLJD 1CXHA 3WXVL 2DF3A 4MVBC 3OV6A 3U0TA 2OSLB 5IF0B 5EZIL 3QO0B 4K3JH 1NUNB 3D39D 4PLJC 5DD3H 3GJFH 5KVDL 3IDXH 2FJGA 1MH5B 3PWUB 1MCRA 1FFPA 1T20B 1JP5A 3BP7A 5SWZB 3GSNB 5HY9B 5J89A 5IHBA 3U82B 2ITCB 1FZOB 3AY4C 3KPOA 4FOMA 5E99H 1CBVL 3MLSL 4CAGA 4DGIL 2AJ3B 2WWMD 4CNIA 4LNVA 5HDQL 5A3IC 1E6OH 2HRPH 1OB1A 1HQ4B 1QRNB 5INCB 4RIRB 4PJFA 2WWMC 2D7QA 2F53E 4Q6IA 4P9HH 5LWYL 1MCKA 2FYYB 3W39B 1IBGL 4J8RA 2X4UB 4NUGH 2YOCA 3NIGE 4EEEA 3KYOA 5CP3H 3RWHB 3VXQB 3HI5H 3OKMB 1AY1L 3BGAA 2WUBH 1U42A 1T1ZA 4JQVA 1J0JA 3GMLA 1YPZA 4KPHL 3UBXA 2GW5A 2I24N 4U31A 1M1SA 3VD9A 3KPNA 5DVNA 2A74B 2AP2A 2UWEA 4UDUB 3STLB 4DFHA 4D0DA 4FFYH 2V2XB 5IT2L 2FX8H 4N0UB 4LHUG 3N85L 1HHJA 3RWEB 1HI6B 5FUZH 1DQQA 4PV8A 3CSYB 3JBG7 4NKOA 4M7LL 2VLJE 3PIQA 5T3XD 4HUVA 3RP1A 3V0VB 4NBZB 3VXMA 2GFBB 3ARYA 3B5TA 1A3RL 1ZSDB 2XZAL 3FRUA 4F58H 5F1OB 4QY8B 4YHNB 5F44A 4KROB 3HC0B 3P30H 3LN4B 4OZ4A 3U1SH 1DBAL 5HHOA 2XQYK 4AEFA 3MRIB 3K4DA 3MRDB 1RUPH 4KTDL 1MI5A 2XG4A 2F5BH 5FYLH 1H3VA 5K9OB 4U6YB 1RZJC 1J8KA 3L3GA 4HZLA 5HYQB 4LKCA 2DQCL 3UYPA 3TBVA 5DZNA 1A7QH 3ZKSD 2J8UF 2XFXA 1F3DJ 1KACB 3DX9B 2K7PA 3LQZB 3EO0A 1VADA 4AEHH 4JFQB 3SE3C 5E9DD 1OAXL 4PJHA 2VUYA 2Y6SD 5K9JH 5T1MA 4HPOH 1FPTH 2ZUUA 1I1YB 2XY1A 5D72H 3FN0H 4V1DD 2Y6SC 1MCCA 2APXA 1KN4L 3BMVA 1SJVA 4H1LH 2WBJD 4LHJB 5BOPA 4UV7L 5IR1B 4M02A 5GGRA 2HLFC 1HOCB 1OAZH 1JPST 2OZ4A 1OF2A 1NQBA 1AR1C 3WHE1 1U92B 3QJHB 4D0CB 2WBJC 5F6HJ 3EYVB 1N7MH 4HDIB 1PZUB 4QTHA 3DI2B 4FQ1L 4JM2F 4JRXB 3TM6A 1N5YL 3C9NB 4ISVB 2EDQA 4G8GD 3ROLA 3RVXD 5I6XC 3STZA 4WUKH 4LEXL 1KB9J 4XPTH 1GC1L 1GGCL 3NCCB 4ZAKA 3RVXC 2AJYH 5FYJL 3MLWH 3RIAK 2PTUA 1R3KB 3OJVC 1KGCD 4X98A 1QSFD 5I8EB 5DJ0B 1N6VA 1Q72H 5DYOB 4MQ7B 4MLSA 4RFOH 3RAJL 1V3KA 4ONGL 4EQ3A 2PYFA 4Q58C 2FATH 1G9EA 5ADOH 3DWTA 5ILTL 3VRIB 3LEYH 4RA3A 3P4OA 4PREA 3MV9A 3VGDA 3GSUB 1MQKH 2EDEA 5I71B 4NRXB 3O6LL 4S2SB 5FYKD 4PJBE 1HSAB 3QEHA 4FXLA 4OLZL 5HGAA 1T6WA 1PW3A 4JJ5B 1S7RA 1B0RA 3DV6B 3HAEG 3MRLB 4HCRH 4CUCA 3OGCB 1QKZH 2J6EA 3L95A 4OF5A 1CVSC 1MLCB 1YNKL 4X7FC 3O4LE 1LQSR 4PGBA 1X5GA 5BMFH 5DEGB 4ZO6A 35C8H 3BZEA 4OFPA 3VRLF 4YHKH 4PLKD 2A6DB 2NMSA 1HXMA 3GSQB 1OSPL 3H7BA 5AZ2H 4YXHL 2OP4H 4C55A 1G7IA 4NZTH 4PLKC 1T3FB 1MCSA 4IRZL 2J1KA 4IOIB 2FJHA 3S9DB 5DD0H 4UTBL 3VJ6A 5MERA 1VGEL 32C2A 5IQ7H 1K6QH 1FNHA 1B4JH 4RGMB 1LWRA 3O9WA 3QXUA 1UB5A 5D93B 3T8XA 1ZGLB 4D2NA 1T80A 3K74B 3MOQA 1ULVA 5D1XB 1G6RH 4GAJL 5CEZL 4A6YB 4BK4A 4OGXH 1X5LA 3L3HA 4Y5VA 3ARGB 1T03H 2VWEC 1P9MC 2D03H 4ODHH 5ABDE 4RFNC 3OGOE 1EGJA 3BIKA 3QDJE 5FGCB 4YE4H 3VG0H 3S4SA 3E1F1 3D25B 3VWKB 1LVEA 1Z0MA 1E28A 5AZEH 3T1FA 4HAGA 1SBSH 3W11D 2HFGH 2ZSVB 4CADB 1YY8A 5C0RH 1RZ8B 1F4YH 1OHQA 3IFLH 4KQ4H 3W11C 3QUXD 3BZDA 1G7MB 1NL0H 2NYYD 4I3RH 5E56A 2IH1B 4LCWD 4XRCA 5EUOE 3QUXC 4OIIL 2D0HA 3NA9L 2NYYC 1XGPA 5DMIH 3SDCB 5IMKA 3UPCA 3GB7A 1BZQK 4YFLF 3MO1B 4EIGB 5C07E 1DBJH 3Q5YA 5C0EB 5I8OH 3DX7A 1S9KC 1NMCB 1NEUA 4YR6B 2Y06L 5F7DA 3MGAA 4TSAL 3T09A 2A38A 4C56B 3X12B 1E4WL 2AEPL 1NGWA 3ARBD 2ENSA 4JM4H 1RUML 2W1NA 1DQJB 5AYQA 4R4BB 2EE2A 1PSKL 3GUTB 4H88H 3ARBC 1JF1A 4KDWA 4PB9H 4WFGE 3QEQA 4HKXB 4GLRH 1LO3H 1NPUA 4GG6F 2CLVB 4LSRL 1Y18B 4APQA 1VFOA 1FL3A 4X7DC 4K7PY 5D7IB 4Y19D 3IDYC 3DV4B 3MJ8B 4W6YB 3P4NB 5F96H 5DRXA 4OZHE 2DYPB 3SDXE 1OPGH 1QLEH 2ESVA 1IL1A 2ATPB 3O3EA 2DQIL 2YKLL 3HN3A 2DTMH 4ZUVB 4G7YL 5JW5A 5FCUL 1RQ5A 1JN6B 3H9SE 1DFBL 4IDLA 5C0BD 2DDQL 1F00I 4KDTC 3QIBB 2W0FB 3ARDD 3LRSB 1JPFA 4HWUA 4R0LB 4Y4KB 4ZSOE 4YQXH 1VKXA 1NC2D 3MGOA 1XCTA 5INDA 1E4XH 3ARDC 1TJIL 5ADPL 2GK0A 5L7XL 2BNRB 4KRPD 1IC1A 2ERJB 3I3DA 2ZKHL 2DI9A 2MWCA 3GFUA 4P2OD 4X99B 1RULH 4KRPC 4U1KB 2Q7YB 3IDUA 1ZLVK 3V5DA 1YEHL 4NT6B 3PDOA 3GBNL 2X4TA 2MQ0A 2C3WA 2X9XA 3QT2A 3SDAA 4EDWL 2H2PD 1JCKA 5EU6B 1NBZB 4LGRB 5E2VH 5KSUB 2VDKL 2H2PC 3LD8C 4KJPD 4RMQA 5GJSL 3T04D 4Q9BA 5L6YL 1RK0B 2YN3A 1QR1A 4L5FL 3UO1H 5JW4R 4KJPC 1FORL 4HKBB 1EEUA 5DUBB 4XP1H 5I1KL 2GYSA 4O2EB 2IAMA 4JZOA 4ZYKA 2FSEB 3OKDB 2BMKA 1NC4A 3WDIA 4WGVB 4F9PC 2K3TA 3QHTC 1P4BH 1BQHA 1MAML 4X9BA 1MCOH 1SM3H 5GS3A 1CCZA 3EIFA 1YMHB 5CFHA 1E27B 4Z76A 1X4XA 4M7ZC 1HH9B 2Z35A 1D5MB 3EO1B 4L9LA 4LLQA 3L9RB 4X6EB 4LKXB 4Q9CA 3K8KA 1OAYH 5BRZB 3TN0D 2FIRT 2CQVA 1CFVL 3L3JB 1CS6A 3BUYB 4YHOH 4XPGL 5E1AB 4FZEH 1BZ9B 4KFZC 3TN0C 4KZDL 1JE6A 3H8NA 1D7FA 1U58A 4JFYB 2C26A 4KKBD 4ZODA 4UIKL 3WJLC 2B20A 4LLYB 3B9AA 3H2WA 3U30B 1MIML 2D7OA 2DWDB 4KKBC 2PO6A 3I6KA 1UC6A 1BIHA 5FECB 2ADGB 3D2UA 3WFDL 1UWXK 4FQCH 3OKEB 4OJFH 4IMKA 5HXMA 4GRMB 4G9DA 2HG5A 3B83A 4OLVL 1IGIH 4XP5H 1UM5H 2ZCKL 5K9QG 2APWA 5IEKB 4Z77A 3P4MB 5I16B 2BC4A 4LPYA 1S5HB 3RWFA 3TO4A 1D9KA 1UYWL 4JDTL 4X4MA 3EYUL 3UP1A 3QUMA 4OCMC 2WLYA 3QEGH 2VDRH 1NAML 1H3UA 1ZTXH 4HXBL 5CILH 2N4IA 4X8JB 1AE6L 2VXVL 5DT1L 4PJ9A 4NO2A 2F54D 1CLCA 5B38A 5CD5D 2WZPD 1QG3A 4NN7B 4Y4FD 5D70H 2JK5B 4F2MA 4IJ3B 3BPNB 3MRJB 5KSAD 5KVEH 5IB2B 1CG9A 3I2CH 3DVNB 1IVLA 5CD5C 5DD5L 4DVBA 4Y4FC 1N6QL 1LE9B 4JE4B 3PGFH 1SYSA 5DJDA 5KSAC 4ZPTA 1FIGH 4M93C 1MCLA 1YN7A 4MAUL 4JO3L 4ZQKB 4DTGH 5F88B 5JHDB 1D3CA 2QADB 4GAGL 1IAKB 4AYFA 5SV3A 1I8LA 5EORH 1KJMB 2D2OA 5EZOH 2G60H 3KWWA 3P77A 3U9UB 1OD7A 1XF5A 4DN4H 3NOIA 4YJZL 1HSBA 4TSCH 5GRJH 1FH5L 3CVHH 2JIXB 3O11B 5D2LF 1NKOA 3EDEA 4YC2C 4F7MB 2W0LA 4ONHA 3EJZD 2VH5L 2VXQH 2BOBA 2A77H 4GAFB 3FAWA 1PG7X 3MNVA 1QSZA 2AVGA 2Z92A 3F6LA 3EJZC 1KFAL 3UTSB 3MLXL 1H3WM 3CNKA 1JGLL 3O45B 4GSDH 4G6MH 3S36H 1N0XL 1XF4A 3VW3H 4Q0XL 1JF6A 3Q6GL 1X44A 3LZFH 4YHLL 3SJVD 4OV5B 5BS0B 3R4DA 4KKNA 2WWKT 4OD1H 1HE7A 5GGQH 2BVUA 4OGYL 1KB5L 4UTAL 4PRBA 1BFVH 4RZCA 1KTLB 1S7UB 4MA3A 2H32B 3EO9L 1L7TH 5DJCB 3O6FD 1IAMA 4KTEH 4BSVB 3VA2C 2PF6A 3T3PE 1UQSA 5EPMA 1F4WL 4XBEH 2GEEA 4M7JH 2JELH 2P8MB 4TPRL 1J1OL 2AAVA 3S88H 3BZFA 1Q0XH 1LILA 1NMAH 1S7VB 3FCTB 1G7HA 1PYWB 1XH3A 3AAZB 4GQPH 4JKMA 4XB7A 3RWIA 4I8DA 3C6SB 5L2KD 3BESR 3PWJB 2CKBA 1BQUA 3N9GH 3CGTA 5GRYA 3BXNB 4U3XA 4LLUB 5EG6C 4JG0H 3NN8B 3QIUA 2WUCH 1KLUB 1E4KC 1XFPA 2XWTB 1EA9C 2IANA 3F5WB 1M71A 5TDPB 3U0TB 2VZUA 4GRWF 5B8CC 1U0QA 2B4CC 4OZIA 5FGRA 1F58H 5TE7L 4JY6B 5K33A 3VRJA 1RD6A 2O5XH 4HWEL 3TVMA 5F6IB 2V5MA 3MLVH 4IOFD 1S9WB 1PBYA 2HKHH 4UILH 4OBSA 4ZUWA 4AIZA 1QNZL 4G5ZH 1I8IA 4CNIB 1E6JH 3IS0X 1QBLH 5IWLA 4IOFC 4X0KB 5GS0L 4KV5E 4PJFB 2A9NH 4HJGA 3BQUD 4M6OH 4O9HL 5KZCD 5BOZG 3GKWL 4HUNB 3T0EC 2R0ZH 3B9KD 5GSRA 4HUXB 2RBLA 5B38G 1KJVA 1UEMA 2NY6B 4J8RB 3BQUC 4M5YL 2VXTL 3KYOB 2XZCL 3TH4T 1LDPL 5I15H 3B9KC 3ECBA 5F7EL 4K55A 4XAWH 4S1QL 1KT2B 3HMWL 1FNSL 5DLMH 5JNYB 4PJGA 3AB0B 2C5DC 5HJ3A 5T1KA 3QI9A 5LJYH 1DSFH 4NJ9H 5DXWA 1I3GL 3TH3T 1RZGA 3UBXB 4HS3A 5C09D 4ELMF 4X83A 2UUDK 3NIFE 2XA8L 4LSPL 2CLRA 4WV1C 1W72L 3MV7A 1FAIL 5E6IA 3SE8H 5I9QC 4Z9KB 1RIVL 3PGCA 2YPLE 2VDPL 5EDXA 3MFFB 2OLDA 4XH2B 1ZWIA 4HC1H 3TNMA 1B2WH 4JM2A 4NKOB 3QCVH 4HUVB 1UACL 5KTEH 1VERA 4OUOA 4NC1E 2WINA 4TSBL 4OCXL 1NCBH 4G8IB 4JFDA 5EO1A 1NGQL 3ISWA 5KSBB 1P7QA 3DROB 4OI7A 5I1HH 4QCIA 5IHUL 3MV01 4DJMA 4OZ4B 1TNMA 4U49A 4MCYB 5IB5A 5HHOB 2DAVA 2BHZA 3S37H 2ADJA 3T2NL 3BGMB 1MI5B 4FNLL 3HLAB 3AM8C 4LGPB 4QRPD 3ZYOA 3HUJB 5J9PA 3G5VA 2HA1A 2HJFB 3LKQA 4PJXB 2ORBH 1L0XA 3L3GB 5FKAA 4LKCB 1T2QL 1IEHA 3VGHA 3PV6A 5EU4A 1DLHB 5HDOA 4M8QA 1HCVA 12E8L 4EI6B 1R0AL 4ZXBA 3QSKB 3C60D 4J6RH 2BVEA 4K3GA 5JIIA 4XNZB 5HGDA 4PJHB 2CDGA 4ZUTA 3QPQC 2AERT 2EE9A 3C60C 4UOW1 4F3FA 4YXLL 1HHGA 3MOAL 3DUSB 1QLRA 4LCIH 3T0AA 1JWUB 3EUUA 1EXUA 3IU3A 4RGNE 4YHMH 1S8DA 4U05A 4G9FB 1WJ3A 2BSTA 1AXSB 3B3IA 3CZJA 5D7LA 1FJ1A 1QOKA 4MNQE 1L6XA 3GMMB 2XNAA 3ROLB 1V3LA 4G7VL 1JFQL 4NQCA 3ZE1F 4DEPB 4K23H 4G6FB 1ETZB 15C8L 1A6WH 2R2EA 2FNBA 4XX1G 1FLRL 2OI9C 2YD3A 4X98B 2VSDA 3HI6H 5F9JB 5F8QC 5KANG 4QHUA 1P4LA 1A3LL 4FS0A 3M8OL 2DQTL 3FO9B 2PYFB 1JK8A 5DQDH 4AM0B 4EJ1C 2P5WB 2H1PL 2VR4A 5E8OB 4KVCH 4FQIH 1EERB 4UINL 3P4OB 4G3YL 2GAZA 2OQJA 3HPLB 3RPIB 5FHAH 4JN2A 4OM1H 4I9WD 5TH2A 3HMXA 2DMBA 3S35H 1MELA 3DRTA 5JHLH 4I18A 3QEHB 5IMMB 1I3RA 2VL5A 3ZT5A 5TE6L 3ARED 1DANT 1N6UA 3H3BC 1URLA 1B0RB 3LS5L 1G6RB 4KRLB 5J12C 1FRGL 3AREC 3MMEB 2L4OA 1YZZA 5C0CA 1CE1H 2UWEE 4R9HA 3PNWB 4P23A 4NFCA 1VFAB 2VLRB 1ZGLP 1CL7H 1DUYA 4FABH 5D7JA 1EAPA 1GL4B 5MHSE 5T3XL 1T7WA 1C5CH 1EBPA 4PY7A 4P4KD 4R7NB 4M5ZH 5F7LB 4F7TA 3FQWA 2BRRL 4CMMA 2QEJA 3H7BB 5IJKC 4P4KC 4ZTOH 1BD2D 4I0KA 2F9BT 1UFUA 4RGOH 5DRNA 1Q9LA 1YEEH 2FJHB 1XGUA 1RZJL 2YXMA 3IFOA 3OX8A 4MMZC 4WGWB 5MERB 3RWJA 3UEZA 2I5YH 2XN9D 4WI6A 2F19H 32C2B 3RI5K 4MB5A 3I75B 1EJOH 5JA9A 2PYEA 2D4DA 4G42A 4OAWB 2VLKD 5TPWL 4GLRI 4P4RA 3KPQA 3HR6A 4UNTA 3V6OA 4AT6A 1N3NB 1FO0H 3TT3L 3C5ZC 4ZFGL 1YEKH 2P8PA 5D1ZB 3LSOA 3QPXL 2NY0D 4UBDD 4B41A 5IVXF 1KOAA 1MFAH 3L3HB 2YXFA 2C1OB 1TZGL 2DMCA 4K7PL 1NGYB 4X6DB 2NY0C 4UBDC 5HDBE 4J2XA 1T89C 3PWLB 5FCSH 3BIKB 1FFOA 1FDLL 5H94A 1AXTL 3S4SB 4QNPE 1ZLUK 5F9OH 5EO9A 4NOFA 2H8PA 4L3CA 8CGTA 1ZHLB 5CGTA 3CFBB 2F15A 2CK2A 4GKSB 3V7AG 2ADFL 5A1AA 1IC7L 1FL5B 3AROA 2NLJB 2X4RA 1AO7D 3UJJH 5I1JH 2FH6A 3DRQB 1FBIL 4MD5A 4NKMA 4CRPA 1ADQL 1T5XA 3INUH 3QISA 3GJFK 3L5XL 3FMGL 3VGAB 1DZBA 3FRPA 5B3JE 1KNOA 5MEND 3RWCA 5D7KD 3HFMH 2HN7A 4JRYA 2D7NA 4CN6A 2AJVL 3PE9A 3X3GH 4GBXD 4G6JH 2G2RA 2F53B 3GO1H 4ZFOL 5C71A 3S7GA 4WW1A 1AH1A 4DUXA 3QCUH 1U8HA 1IM9D 2LTQC 4PS4H 1AQDB 4Y2DA 4APQB 3GRWL 5FYKL 2IFGA 2VSCA 3BYTA 3L5HA 3FFCE 5JZ7D 2H2SD 5DRXB 4ZUSA 2ESVB 1IL1B 3KPPB 1J87A 2ZPKL 3O3EB 4PJ5E 2H2SC 4YDLB 4PP2A 5JZ7C 2P5ED 5ID0A 1ZANL 4GO6B 4XPFH 3MLYL 2X89A 2Z4QB 3W0WD 2B1HL 1D5BB 3QB7C 1JPFB 1QFWH 3CXDH 3RX8A 3MRGB 3MGOB 1XCTB 2VE6A 3PL6D 2N7AA 3L1OL 1NCTA 4QHMB 2BK8A 2NX5B 1T1WA 3OAZK 3PL6C 4LCCC 5TFSH 2VLJB 5JW3L 1Q9KA 3BKML 5FKPA 1BM3L 1Z3GL 4LVHB 3ZDZE 3BWAA 4FQHB 1I1AA 1GPOH 2Z91A 5IFHH 3IJSA 3FQRA 5T1DL 4WHCA 4M4PA 4P57B 2CDFA 2X1PA 4LSDA 4O5LL 1ED3A 3MRNA 4UAOC 3MLTA 4N1HB 5EBLB 4RBPH 4PY8J 5DZOA 3OZ9L 2A6JB 3WBDA 3D3VA 3OKKA 3KYKL 1QR1B 4GXUN 4NZDA 4YH6A 3W9DA 2PW1B 1QZ1A 3BDYH 4PRIB 2IAMB 4UT9L 2BMKB 4Z78B 4K8RH 1G7PB 1NC4B 2MHAA 4DN3H 1AIFB 1UKTA 3NCMA 4UT7L 1MJ7L 3EHBD 3P0VL 3CFEB 3BVNA 5FGBC 3ARSA 2Z35B 5L88L 1S7XB 3EHBC 1QR4A 1YY9D 1ZVSA 3QDMA 4XMPL 5E5UB 5F1NB 3VXSD 4OZGB 1T21A 2CIKA 4KK6D 5BZWA 1YY9C 1C12A 2Z8SA 4OCSH 3EZ8A 5I17B 1W2KT 4XC3L 4KK6C 5EU5A 1OP3H 4UQ2A 4G6KH 3UDWC 1CICB 4G8EB 3NZHL 3PWPA 5D5MF 2PO6B 3KPSE 3I6KB 5D2LA 1ZEAL 2NQCA 1JZ4A 5J1TC 1CGUA 3ZE2E 2I25N 3D2UB 4M48L 3O2WL 4NC2B 1JUFA 3QFJB 5IKCA 1DUZB 2OJZL 5JR1H 4G9DB 3MLZH 3NTCL 4WY7H 2VC2H 2P42B 3HE6A 3U36B 5I19H 3CVHB 5KOVC 4Z77B 1XGYH 5GGSA 3ZKMD 5IESH 3CFDA 3D0LB 5HVWA 1WTGT 4C58B 2YPKB 3E2HC 3RWFB 3QWQB 3DLQR 1BBDH 4Z18A 5TQ2H 3LMJH 3ZKMC 4P5TB 3QUMB 3KAAA 3SCMA 2IMNA 4QT5A 1LP9F 2DS4A 1AI1L 4KGJA 2VDLH 1IZKA 4UZGA 5EC2B 3E8UH 2DQDL 5FYJE 5GRWA 2QSVA 3F7VB 4DOHE 2UVFA 4TTDC 2E8ZA 3O8XC 4F2MB 5ANMB 1YC7A 2NY2D 4JGMA 2R2CA 4OLUH 3GIZL 2EE6A 4PRHD 3QH3B 2NY2C 1NGXB 2FEEI 3L6FB 4P2RB 1EEYA 2FR4A 3X3FH 4TNWF 4ESKA 4BUGA 2ARJB 4NFBA 4X6BB 5DFTA 5IW3A 5IHZB 4HFWB 2X1XR 3P9LB 5GS2H 4LVNC 1XF5B 2RB8A 4LK4A 2W59A 1GGBH 4XVUD 1HSBB 3N0PB 1TVHA 2AK4A 2BVQA 1R5VA 4HLZG 4X7CC 2EDFA 2HJLA 1DQLH 4ONHB 4LLVA 1QRND 3HAEH 2BOBB 5KS9F 4QRRA 1ZA3A 1BMGA 2VISB 2Z92B 1T7ZA 2Y9RT 4OCNC 2H3NB 1OW0A 2Y7QA 1KJ2A 4TVPL 1XF4B 1N5AB 3RWGB 3O0RL 1ZHKB 4ODTL 1A0QL 1YUHA 1A6UH 1N64H 1XR8A 2AS5M 1K8DA 2BNQB 5I73C 4PRBB 2EC8A 3BDXA 3QDJB 4XHQA 4WWKA 5IBTL 3OAUL 4RZCB 3WN5B 4Y5YA 4QRSA 3QHZH 3LOWA 4RX4D 4QHNA 3TFKD 2BVYA 3CFKA 3C2SA 3CXHJ 5I1CH 2Y5EA 5DMKB 1UQSB 1PQZA 3B2VL 3TFKC 5AWNL 4D9LH 2R15A 4QF1B 4HQQL 4JPVH 1CTOA 4HF5L 4QTIH 5DF0A 4WFEE 2R0LH 5CEZE 4JFFE 3JWNC 1XH3B 3O41A 5JXAH 1DLFL 3LIZH 1JJUA 4S0SD 1QFWM 4O2CA 4PJ7F 5IEHB 1ZMYA 1J88A 1OARL 1V7ML 1IJ9A 3PQYA 1OLLA 5D1QB 4KROD 4U1IB 4ELMA 5CWSA 5EA0H 5CJOH 4ZOAA 5C8JB 2Z8RA 2C3VA 4JPIA 4Q2ZB 1JGDA 1MPAL 1WTLA 4HKZB 4XWGL 5HHME 3UYRH 5HHPA 4KROC 1EDQA 1AD9B 3V4VH 3PGDB 3MACH 1CN4A 4Y5XB 5LGHL 3KPRE 2O5ZH 1QHOA 3I6LE 1ZHBB 4K9EC 2NPLX 2LABA 1DBML 2GUOB 3K80A 1I4FB 4FQXA 2R8SL 1B0GA 3WIIL 3VRJB 4PJIF 4Z95H 3V0WL 4P46A 3TVMB 3DX6B 4IRJB 4OFYD 2IQ9L 3ARFA 4FTVE 4MA8L 5JDSB 4P2QD 1RHHB 4ZUWB 1I8IB 3OBAA 4NRYA 3QULA 4PV9B 1MF2L 2GI7A 3CLEH 2BSSB 1MHEB 4HJGB 2WP3O 1NCAL 4ZSOB 3OB8A 4R3SB 5GSRB 1CGSH 3DHMA 4JPKL 1VDGA 1Q9WA 2PTTA 1WITA 1K3IA 3ECBB 5E5MA 2J8UB 5KAQG 3WXVH 1QSEA 3WS6A 1U8LA 3N06B 5HJ3B 1LK2B 3E3QE 5C07D 5EZIH 3NFPB 2A0LC 3DXAA 5KVDH 2L7UA 5EIQA 3RUGE 3MV7B 1L9NA 2Q76A 2IEPA 1JGEA 4WTXA 1W0YT 4NYLB 1IRAY 1RHFA 1CBVH 1KCUL 3MLSH 5E6ZA 3LY6A 4XC1H 4OM0L 4DGIH 3HE7C 1J1XL 5HDQH 2IJ0C 1CGTA 4D9RD 4KTYA 3T77B 1WAAE 1AQKH 5LQBL 4JM2B 2A83B 2P8LA 5MEOA 2NXYD 4OD2A 4NQDE 5FF6A 5LWYH 3RIAF 4YFDB 4WUUE 3CCHA 1IBGH 1IM3B 2W91A 4QCIB 4AZ8A 1FVDA 2NXYC 4PRPA 4EVNB 3V52L 4O2FA 4KI5D 1AY1H 1QFHA 3IETA 2RGSA 2EDDA 5C0GA 1ZLWH 2MTPA 2ADJB 1A7RL 4Z7QF 1D6EA 2HJKA 3OMZA 4ODVL 1KXTB 4KI5C 3CC5A 1SBBA 3IKCB 4KPHH 1KLGA 4OQTH 3G5VB 4ORGA 3TIEA 4IIQC 25C8L 4U1GC 3GMOA 2I07A 4MAYA 3PV6B 3C5JB 4M8QB 1T2XA 2GIYA 2XQBL 1J8HE 4N9GA 5C0AA 5IT2H 5GGTL 1KCRH 4LNRA 3TPKA 3KG5A 4HIJA 4HS6B 5B4MC 3N85H 4I0PA 3G9AB 1WK0A 3CMOL 4MNGE 1NUFA 1T66D 3MFGB 1DEEB 2B4CL 2FB4L 5EBWA 1HHGB 4F3FB 4M7LH 4NQVA 3AS1A 1NEZG 1VENA 1Q9OA 3HG1D 1CL7I 1A3RH 4NQEA 4DCQB 5TQ0L 4QOKE 1XGQA 3HTLX 4RGMC 4OZIE 3DYOA 4XX1E 3TA3B 1DBAH 1I1RA 2BSTB 5D93C 3BWUC 1WBXA 5AD0A 3ZSTA 5D7LB 2BJML 4KTDH 4YX2H 5EU3A 3BKCL 3IDXL 3P2TA 3TO2A 4WW2B 2G9HA 5HVHC 3MCLL 3OB0H 4R7DB 1YMMA 2E7CA 3VD7A 2C7UA 4NWUL 2DQCH 1IC5L 4WHTA 3VWKD 1PG7W 5EZLB 5IBUG 1W0VB 1CQKA 1A9EB 1X5FA 4I77L 1NDGA 4QHUB 4UDTA 1YNTA 1P4LB 2PKDA 2I26N 3VWKC 4LQFL 4N8VG 1C7SA 5F72S 1OAXH 1MCWM 4TUJB 1DN0A 4GUPB 5C3LD 3MCG1 2DB8A 1WFNA 5IVXA 3OJDB 2DWEA 1J18A 5TH2B 1KN4H 4BFIB 2IBGA 2OMBA 3KVQA 4PJGE 3DRTB 4UV7H 5E2TH 2EDBA 3IDMB 1H8SA 4BH8A 1I3RB 3QDGB 3PWNB 1N5YH 5J8OA 4M6AA 5HGGS 5C0CB 1A8JH 1IEAA 1U8KA 5CSGA 1WFTA 2XV6B 3R0MA 2VIRB 3R8QA 4DWHA 2R4SH 4U1MB 3L3IB 4V2BA 2W07A 4LEXH 1DUYB 1U8MB 1GC1H 1GGCH 4FFYL 5FYJH 3H3KA 2FX8L 4PY7B 1RJLB 1S7WA 5CCKL 3X17A 3DARA 3BPCB 1F13A 1C5DA 1Q0YL 3QNXA 5DJZA 2DYPD 3BD4A 3RAJH 43CAA 5F9AC 4ONGH 5DRNB 1SY6L 2Z31B 5ILTH 2KUTA 1YYML 3IFOB 3L5WB 1KG0B 3WLWD 2GY5A 4L1DA 4F58L 3I02B 4QKXB 1ZA6B 2LAGB 5C9KA 3U1SL 4POUB 1MHPH 4G42B 3WLWC 4JZJC 3WL9A 2ZUXA 2JJTC 5HYSB 1JZ6A 4OLZH 1AKJB 2MCPL 4XZUA 3REVA 4K3DL 1SJHB 4GG6B 1FG2A 2BNRD 1ZXQA 4AT6B 2P8PB 4NZJA 5TDOB 5DMJB 1YNKH 1O7VA 4D94A 4JFHE 3DSNA 3ILPA 3D87B 3SBWA 1A7QL 2JB6A 3UPRA 2OM5A 4PTTA 5H94B 4B7IA 2ZUQC 5EO9B 3VG9B 5ID1B 4G80A 3WS3A 4AQOA 2CR6A 5FO9B 2JF1A 4YXHH 5TDNA 2AJZA 1MUJA 2IPTL 5T1LB 3DO7B 2GITA 5D72L 3MJ7A 3QG6A 4RWHA 5F9WC 1O0VA 4UTBH 3WIHL 2X4SB 1VGEH 1P84K 4WI3A 1QYGH 3VD5A 1OAZL 3CFIC 5E0QA 3IGAB 2CDEA 2X4OA 2DJ4A 3TT1L 4MD5B 3JWOC 3IB4A 4NKMB 3ARUA 4J4PD 4NQCE 3RL1B 1AGEA 1WWWX 4YHZL 3BAEL 5CD3B 4QXUL 3OR6B 1W0WA 2ZOLA 2PETA 4PJCF 4J4PC 1DBKL 3VFUA 4M9PA 1VGKA 5CEZH 1U2HA 4HV8A 5JO5B 3G5XB 1FYTA 3VH8G 5BRZD 5C0FA 5DJ8B 1RK1B 3AS3A 3RHWK 1U8HB 3VMNA 4C83B 1Z0NA 2YZ8A 4Y2DB 3MCKA 5D2NE 1C16B 2DKMA 3RTQB 5ADOL 3LEYL 3LN9A 3EOYG 5SX5H 5C6TL 3QXAA 4OT1L 1F4XL 3FONB 3OKOA 3JSSA 3ALPA 4PP2B 3V5HA 8FABA 2ZCHL 5ID0B 3ZDYF 2FX7H 2VRAA 1SYVA 4H0IA 5SWSB 1C1EL 5LGJB 3L7EA 1TVBB 2EDYA 1UT9A 4JREC 4ALAL 4OIIH 1F4HA 3NA9H 4PGEA 1U8PB 1XCQB 1QA9B 3MV8E 2VABB 4YNYB 3TNNA 4YK4C 4RMVA 2VE6B 3QCTL 4Z7OE 1EHAA 3FN9A 4YGAB 4Z0XB 1GOHA 1T1WB 2Y06H 4TSAH 1CDCA 2AEPH 5BMFL 3KPMB 35C8L 3BWAB 1LO5B 1I1AB 1MAKA 1PSKH 4MCZA 2HVJA 3L3OA 3FQRB 4S1RL 3QQ4A 2OP4L 2BY3A 4R2GD 1G1YA 4PGCA 3WUWB 4P3CL 4JFOA 4JB9L 3GI9L 2CDFB 4LSRH 3JV6A 3T0WA 2G5RA 3MLTB 2C1PB 1OT1A 2SEBA 4R2GC 4NN7C 5LAXB 2PYEE 3BPNC 5J13B 3VFRB 2YKLH 3OKKB 3WNLA 5JHDD 5BQ7B 2W60B 2QADD 3BP4A 3P0YL 4ZO8A 5FCUH 1OP5H 3W9DB 5C7XL 1DFBH 3V6OE 1HWHB 1HK6A 3D9AL 1F6AB 2DDQH 1K8IA 1CLYH 4TOYL 3B9DA 3P4LA 1H3TA 5FB8A 2HVKA 3O6KL 3TP4A 2JIXD 5ADPH 1T03L 3U2SA 5L7XH 4NCDA 4YWGH 2HT4D 2ZKHH 4WFHE 3RGVB 1Z5LA 4M6ML 3B5GA 3DYMA 1Z9LA 1MWAA 3DMMA 2HT4C 1JZ5A 1MLBA 3QDMB 1YEHH 2XKNA 1HHHB 4K8RC 2GTZA 1DVFA 1T21B 2CIKB 2O61B 2YPLD 5HYJA 4XBGB 4EDWH 5F7KC 3TYFA 5C0RL 1CXIA 1F4YL 5DD6A 3FOMA 1KCLA 3LEXA 2ZUWA 4MNQB 5EULV 3RX5A 5E8NA 3HZKB 4R8WL 5EC1A 2VDKH 4UQ2B 3SE9L 3JVGC 1J1PL 5GJSH 3BW9B 5L6YH 4JJHA 2XXCB 4L4TA 4L5FH 1KIUA 3LCYA 3RY6C 2JCCF 1FORH 3PJSA 3V6ZB 1VA9A 1XIWA 5KS9A 2VN7A 5DTFA 2HFEA 5I1KH 1FNFA 3IKKA 2F74A 4RAUA 1JV5A 3VXNA 5E24E 2DIBA 1T0MA 1XF3A 3HE6B 4BQBA 3T08A 3X11A 5BW7A 3QAZB 1AJ7H 4TNVK 4WTWA 1MAMH 1QD0A 5IB3A 3UBXI 2OS7A 2YBRB 1DCLA 4PJ8B 4NQSA 4H88L 4IS6A 5SWQB 3SCMB 1NANH 2XXMB 4Z7UE 2C3XA 4JFZL 3IJYA 4M1DL 4ODXA 2IGFH 1CFVH 1ZT1A 1CVRA 1BIIB 1G9NC 5SX4I 3RJQB 4AIOA 5B21A 4XPGH 2Z0BA 1FL6A 2RQ8A 4MJIA 4L9DA 1UADC 1D5ZA 1H5BB 4UIKH 4BSWB 1GSMA 1MIMH 3OKNA 4OF8A 1EEYB 2DI8A 4RGNC 3WFDH 5FDWB 5HPMA 4NCC1 5IROC 1W8NA 3MOBL 1RUKL 5CLTA 5J1SC 4OLVH 4NRZB 3HR5A 2ZCKH 4JKWA 3AGVA 1RULL 3NPSC 4CN4A 5T3ZD 5AG8A 1UYWH 2YMXL 3MRFA 4JDTH 3DHJA 1I7RB 4HK3J 3OKLB 4Z7VE 4X4YA 3THML 4QRRB 1NAMH 4HXBH 5I2IA 4MD4A 2Q6WA 1AE6H 2KZ1B 2VXVH 5DT1H 3L3KA 1R3HA 4ZDHA 4GRWB 1RSFA 4HEME 5E2VL 5I74B 4Q6IC 5KG9A 3LEVL 5A2KH 3KPTA 4E9LA 1G6VK 5DD5H 3G6JF 4PJIA 5CMAA 1N6QH 1K4CA 1TJHL 1YUHB 3UO1L 5CIPA 4N0YL 2RHEA 4HIIA 5GZND 4MAUH 4XP1L 1CDBA 4JQVC 3VDAA 5MEQB 4GAGH 4N8CL 3BIAX 2YUXA 5GZNC 3ZHDA 3O3AB 2BCKB 4YFEA 4I2XB 5BVJB 1M7DA 4WDIA 1MCOL 1P6AB 3CFKB 2J3SA 3ESUF 5A2LH 2YEZB 3VXRA 1FH5H 3MJ6A 3V9FA 2FHFA 2VH5H 1JPSL 5E9DE 4JO4H 4X7TA 3O41B 1EHXA 4WO4A 4HIHA 3VXMD 3BPLB 4O2CB 4LP5A 3MLXH 1ONQA 1JGLH 3PQYB 1N0XH 1UA6L 1VFMA 4Q0XH 3Q6GH 2V2WA 2C3VB 3WE6B 4JPIB 4YHLH 3VI3E 1JGDB 2ADIA 5JQ6H 5HHOD 5HHPB 3VFPB 1KCVL 1AHWB 5F7UA 3PP4L 1HN1A 1FNGB 4FP8L 4OGYH 1MI5D 1KB5H 4WWID 5D7IF 2APFA 3G08A 2QLVB 2MJWA 1BVZA 4XP5L 1IGIL 4L8SB 4FQXB 5F1IB 4GKZA 3MBXL 4LEOA 4JFXA 5DD1H 1B0GB 1ZVYA 4P46B 3KS0H 1KGCE 4K07A 3ARFB 3MNZA 1F4WH 4LARL 5FO7A 4TPRH 1J1OH 1ZTXL 4NNYA 3UZQA 3C8KB 1QBBA 3TBWA 2ED7A 4L3EA 3VXOA 1VPOL 2VQUA 1B6DA 2DLEA 5DC9B 1LO4L 3D69A 5B39B 5DRWA 2MPAH 5EBMB 3LRGA 1S9VA 5FOJA 1YYLL 3VMOA 2E7MA 1TITA 1FIGL 1DQDL 1RZFL 4OF7A 5DHVH 3FQUA 4DTGL 5E5MB 4W4OA 2OBGA 4JFEB 5L0QB 2YD6A 4S0TD 3RKDD 1U8LB 5EORL 4ZFFB 4RRPG 1HHKA 3LQMA 5C08B 1BLNA 5EZOL 2G60L 2GCYA 3RL2A 4ZAKD 4MNHA 3RKDC 1Q1JL 1FGVL 5TE7H 1ND0B 4TSCL 5CJBA 2RJMA 4XP6L 3DBXA 4HWEH 2Q76B 4ZAKC 2AI0L 5BVPL 1JGEB 5JOFA 2EXYD 4F33B 4QHLA 3WUZA 1QNZH 5IIEB 3CFJA 2EXYC 3K4ZA 4RBPK 4P99A 4OKVA 4X6CE 2R29L 3B4NA 5GS0H 1EFXA 3MV9D 2X1OA 3TBSB 1DANU 5J4MA 5MEOB 2EKJA 4O9HH 3LZFL 3GKWH 3GMRA 4R96A 1OGAA 2NY3B 1YNLL 4FZ8L 1FVDB 2P1YA 4M5YH 2VXTH 2XZCH 1LDPH 3VFOA 4O2FB 5F7EH 1H0DB 3O4OC 4S1QH 2ATKA 2VWEE 2CUIA 1N26A 1K9TA 3CC5B 5K9QI 1Q94A 4ORGB 5IGXL 2XA8H 4CVXA 1T04A 4WEMB 5TGBB 5IB1A 1W72H 2FEEL 3SQOL 1NMAL 1MCPL 4N9GB 1IGMH 4OZFA 1NMBL 5C0AB 3KXFA 1FAIH 4Z7WE 1C7TA 4K7FA 3MXVL 4I0PB 3KPSB 3OJ2C 1RIVH 3NFSL 5I30L 1J86A 2VDPH 3KJ4B 4K9EL 4I5BA 1T1XB 2QQLL 4GS7B 4XP9L 5JXEC 3F58L 1UACH 5E4EC 1OP3K 4FXKA 1R24A 4TSBH 1KCKA 3O9WD 4MQSB 2R1WB 4JG0L 2AEWA 1NGQH 2J8OA 1HINL 3MTRA 1XGQB 4U6VL 2FCBA 2XZQL 5IHUH 2E7HA 1UJ3A 3O9WC 5DA4A 1WBXB 5AD0B 1K2DA 4R4FL 5BZDA 4LOUD 5EU3B 4FNLH 4L8DB 3TO2B 4UUJA 1IEBA 5HHVL 5AUMA 4U1JB 2BVPA 2O5XL 4LOUC 4MS8D 4Y5VC 5E2JA 5I1IL 4P5MB 3FOLA 1T2QH 2C7UB 1NAKL 3RNQB 4WHTB 4UILL 12E8H 4MS8C 1R0AH 4G5ZL 2BSRA 5C92A 2WWKO 4IDJL 4UDTB 4M43L 5FUOL 4PJDE 3QZWG 1NFKA 5DS8A 2ZOKB 1UH2A 4W6WB 4JG1L 3BT2H 1MRCL 1VHPA 3MOAH 3NZ8B 1CXFA 2H6PB 3T2OA 1XZ0B 2MOVA 2RIKA 5DVMA 1QSEE 1O5DT 5I15L 2XTJD 4MQXD 3F12B 3FZUC 3LKOB 4HH9B 2EYRB 4MWFB 1T1YB 3WHE0 3U9PL 1A1OB 2XTJC 4MQXC 3VGBA 3ZO0A 2VUOA 2OSLA 5IF0A 3VFGH 1DSFL 3QO0A 2WK2A 4NHCH 1RU9L 2OL3L 4LL9A 2BY0A 1IEAB 1U8KB 1MH5A 2XI9A 4G7VH 1JFQH 3PWUA 1KPRB 2WIIA 3QIWB 3R1GL 3QXDA 5F1SA 15C8H 4IM8A 4Y16C 1BHGA 3QEQD 1NGZB 3GSNA 1FLRH 2ITCA 3CJJA 4APQD 5ACZA 1I7ZB 2IMMA 4FFVD 5DJZB 2IPUG 1A1NB 1HQ4A 3O3BB 43CAB 3FQNB 3M8OH 2ESVD 5INCA 4EN3B 4X9FA 3K2UH 4FFVC 5D6DA 1MCJA 4PJCA 5GGRY 1NCWH 4OIAA 4PRPE 4MXWL 2MNUA 4UINH 1EVTC 3W39A 2Q86A 2X4UA 5I1HL 2R23B 3P9WB 4O00A 4F15C 3ZE0F 3LDBB 3RWHA 3VXQA 3OKMA 3B5HA 5ISZA 3H9ZA 2EICA 5TE6H 4HBQA 3LS5H 4WU7A 5D9SA 2E6JA 5FOBB 1FRGH 3H9HB 2DQFA 3FB6A 2JE8A 1PZ5B 3DX8B 2AABL 2DI7A 1IKNA 4F7PA 5EUKB 3D48R 5AYUH 4UDUA 5T3XH 5I1GH 1NJ9B 4J6RL 4N0UA 3SDAD 2VERN 3I3EA 1MCFA 4PRDB 1ES0B 4G80B 5GQBA 1ZLVH 3WS3B 2BRRH 4FQ2H 2HRLA 4M7LT 3MBEA 3SDAC 1MUJB 3MLRL 1UXSB 3DUUA 5ETUA 3S6CA 4HGWA 3QG6B 3V0VA 4KMTL 2GFBA 4UMGA 1RZJH 2COQA 2CRMA 5CJXC 4QY8A 4GKNB 4YHNA 2BHUA 1I7UA 2IAMD 3LN4A 1ADQA 1JRHI 2C3GA 1FE8L 3G5ZB 1CDIA 3EGSB 1NC4D 1CT8A 4FTVB 1AGEB 5J3HD 5TPWH 3MRDA 4Y1AA 4P0DA 2IAMC 3K0WA 1YMME 5D96B 3TT3H 4BK5A 3BD5A 5K9OA 4K23L 3QPXH 4U6YA 3VDCA 2E8YA 1VGKB 4ZFOA 5FAAA 4HV8B 1LO2L 3VDBA 1TZGH 5HYQA 1FYTB 2JJWA 4DQOH 4K7PH 2YRPA 4BJLA 2V2TB 1BJMA 2O5YH 4L9LC 3DX9A 1FDLH 3GRWA 1AXTH 4H5SB 3LQZA 2F54E 5D71H 4E41A 4KVCL 4G43B 5GS1B 1WZLA 3S97C 2R2HB 2B2XL 3MRRA 4LPXA 1I1YA 3QXAB 4KRNA 4DZ8A 1WBYB 3FQXB 3MROA 3OKOB 5E8DL 2PO6D 8FABB 3ZHLA 1W8OA 3D2UD 1SYVB 5IR1A 1NH6A 1HOCA 2KL6A 5GIRA 2CO7B 5HHMD 3RUGB 1P69B 1U92A 1FBIH 4PGEB 3EYVA 1UZ6F 3TZVB 5I1EH 4KJYB 4IMKC 1F8TH 3LKSA 3TNNB 3QEUB 3JWDC 4LLDB 4JRXA 1UWXH 4GW4A 1HYRC 3I6LD 3L5XH 3HC4L 4ODUA 3TO4D 4RMRA 3NMEA 3VGGA 1D9KD 2JKXA 1CL7L 3QA3B 4J23A 5E2WL 5KSBF 2AJVH 1TENA 3TO4C 3BO8A 1TCRB 1D9KC 1R3KA 4M5ZL 1FHGA 4NQDB 5D5MB 3EJYC 5I8EA 1MCIA 4PJ9D 5DYOA 4MQ7A 3QQ4B 1U93A 3QQ3A 2JCCA 3MYJB 4JFOB 5FYKH 1ERNA 4RGOL 4PJ9C 2GY7B 4NQTA 4ZO7A 2SEBB 3QP3A 1P9MA 2GK2A 2I5YL 3SJVE 1YA5A 3GSUA 4J3OC 2ZPKH 4OD3L 1EJOL 1WFOA 4HUMB 4S2SA 2OR9L 4DUVA 1TFHA 2JJSA 4QLRA 1ZANH 3BP4B 3C09B 4URTB 3MLYH 4RISL 4FQPA 2ICWB 3KYNB 1LP9B 1F11A 5FIEA 3O2DA 2B1HH 3CU7A 3EDKA 1FO0L 3MRLA 1YEKL 2WQ8A 3OGCA 1MLCA 3L1OH 4MNGB 5FB8B 4X80L 4BH7B 3E3QC 2ZCLL 1INQB 4KKCD 2DD8L 3PABA 5E1HB 2EDJA 5DEGA 5KVFH 4Y2OA 1Z5LB 5JW3H 1FNEB 5EFIA 1BM3H 1Z3GH 3DMMB 1RURH 1F6LL 4KKCC 2A6DA 1O7SA 4PRNA 2DKSA 5T1DH 5T5NG 4QOKB 2GTZB 1I85A 1DVFB 3ES6A 3T0DA 3WFZA 2OCFD 4O5LH 4OUUA 5HYJB 3TYFB 4IOIA 4TULL 3SGKA 3LEXB 4HK0B 1QFOA 2E9JA 3OZ9H 4MJ2A 5EC1B 3UJJL 4OV6F 4JY4B 5JW4N 3KYKH 5ALCH 1IGJB 3PWVA 3IRPX 1A6VH 3PJSB 3INUL 1YQ2A 1ZGLA 5KS9B 3ARQA 2HFEB 5DTFB 3FT4B 2YR3A 2F74B 4RAUB 4UT9H 2CLZB 3RVVD 4GXUM 5D1XA 4L4VB 1HCFX 1XF3B 1F42A 3OB0K 3X11B 4P49A 3ARGA 1CGXA 3K46A 5ESQA 4UT7H 1MJ7H 1V8HA 3GO1L 3P0VH 4LSUH 1R5WA 4IS6B 4DUWA 4X5LA 4KDTA 4PFEA 5L88H 1V7NH 3CZFB 3IJYB 2YD2A 3SQBA 4UIMB 4CBPA 4XMPH 1ZT1B 3BDBA 3VFVA 2ZSVA 1FL6B 3VWJB 4X4ZA 4HZAA 2NY1D 3P9MB 1D5ZB 3P73A 4ONFL 4PD4K 2YWZA 4H20L 2IBBA 3QIUD 4EZMA 3ULUE 2IAND 2IH1A 2NY1C 4X5WA 3OKNB 3NZHH 1DE4A 4TN9A 3OF6A 1MIEL 3U7WH 3QIUC 3G9VA 4MA7L 4YBLB 3S37X 4PJAF 3SDCA 4TQEL 1ZEAH 3B43A 1ORSB 4QYOB 3CXDL 3DVFA 2FDBP 4LLAA 5C0EA 5HPMB 4JHBA 2CH8A 2E9WA 1B0WA 3NTCH 3TVMD 3CLFL 4PJ7B 3SKMB 3UJTL 1WGOA 3HR5B 4IRSA 4KUZL 3X12A 4C56A 3TCLB 2ZUYA 2N1KA 3GJEA 4EBQL 4R4BA 5FHBL 4JR9L 1I9IL 3GUTA 3BEVB 2QV2A 4X4YB 2X6MA 4WI7A 5I2IB 2CLVA 6CGTA 3BH8B 7FABL 5D7IA 5IWLC 3E0GA 3L3KB 2DQDH 3MJ8A 1R3HB 4KY1L 4W4NA 4XVSH 2KQMA 4AH2A 1BWMA 2J5LB 2YUVA 4PBXA 1UKSA 4ZUVA 4PJIB 4FFWD 4NBXB 3BZ4A 1JPTL 1JN6A 1K4DB 3GIZH 3F7YB 4FA8A 4GAYB 4HIIB 2DL2A 5T1KD 3QI9D 2DN7A 3QIBA 2W0FA 3H42L 2Q3ZA 3P40A 3CU1A 1X7QB 4K8RL 4Y4KA 5A43C 1A21A 1TVDA 3QI9C 4QRPE 4MSWA 1RMFH 3WO4B 3MV7D 4WDIB 1G9MC 4BSJA 3K1DA 2DMKA 4MLIA 2UUDH 2P45B 4Q9QH 5E6ID 2D7PA 5J06A 1QLFA 1IILE 5E6IC 4JM2D 3UTZA 3K8LA 5F93C 5EU6A 1NBZA 2CRIA 1E0OB 4OCSL 4JFDD 1P7QD 1TPXC 3NGBB 5KSUA 3GSOB 2IQAA 4PIRF 3S35X 4MHHG 5DHVB 2V2WB 3O0RH 5IW6B 4ODTH 1A0QH 5E5RB 3NIGF 4HKBA 4KMLB 3FO1B 4U1HB 5DUBA 1QEWB 2YD4A 4O2EA 5JR1L 2NY4D 4LPUA 2FSEA 2AEQL 3OKDA 1G9NL 5IBTH 3OAUH 5BV7H 3MJ9L 1WT5A 4E0RA 1LMKA 2NY4C 5D2NB 5IESL 5C0IB 2DQUL 4ZXBD 3U4EA 1YMHA 5TQ2L 1L7IL 1IQWL 3LMJL 3B2VH 3MNZB 4U0RC 5AWNH 5DHYA 5FO7B 1EO7A 4ZXBC 1D5MA 3L9RA 4HQQH 1KYOK 4LKXA 4NNYB 2XWJA 4KHXL 4DGYL 4HF5H 2LV4A 4LP4A 4MJIE 3L3JA 3AFLA 3K7UA 4GMTH 1WEJL 4ODBD 3BUYA 1DLFH 5E1AA 2DOCA 1BZ9A 2EKSB 1N8ZB 1S9VB 1YC8A 4YFLI 3ZL4L 1INEL 3GBLA 1PKQB 4XXCC 1V7MH 4I9WE 4F57L 1ZVHA 3MRBB 2MCG1 2W9LA 4LLYA 5LKNA 3SKNB 3WD5H 2DWDA 2P24A 1PY9A 5D7LD 3FQUB 5FECA 5EN2B 1NLBH 2YC1A 5A16B 3AMKA 3OKEA 3AMLA 5I66A 4NQCD 1HHKB 4XNUL 1U9KA 5LGHH 1BF2A 4GRMA 4MDJB 3LKNA 1KIRB 5IEKA 2R8SH 1W72B 3P4MA 5I16A 1S5HA 3WIIH 4TRPL 3QUZB 2ICES 3V0WH 3KGRA 1BVLB 1NBQA 3VI4E 5JOFB 4XPHL 1B9ZA 1YEIH 1P2CA 4QHLB 4MA8H 2AV1A 5DGQA 4LMQI 1BD2E 3P0GB 4X8JA 1PX3A 4J1UB 3ROOA 1MF2H 4GH7B 5JIKA 1CXLA 5EO0A 1NFDE 3MRJA 1MHHB 3NCJL 1XAUA 3WDJA 1JGVL 3R06B 2CKNA 1MAJA 3GMRB 1OGAB 4JPKH 3ZT6A 1R3IL 4YHYC 4I18C 3VFOB 4ZQKA 1OWWA 2E7LA 2QTEA 4KJQD 1IAKA 4U1SB 5C0CD 3WNMA 2BP3A 3OPZL 4JHAL 1CFNA 1KJMA 4P23D 4LSSL 4C4KT 1Q94B 3VXRE 1GYAA 4KJQC 5D7JD 4IMLB 2ARWA 5C0DA 3U9UA 1A7BA 5SV4A 4P23C 3IU4L 2IPKA 4NCC2 2YA2A 3U79A 2XTLA 1JMZA 1QP1A 5D7JC 2FWOB 4XNQA 3ZTJG 3C6LA 3CX5K 4JPVL 4F7MA 4QXTB 4QTIL 4OZFB 4O58L 4WTZA 1KCUH 1UG9A 3LIZL 3UTTA 4OM0H 5KVGH 4NDMA 1J1XH 3L3DB 3CD4A 5ERWA 4NHUB 3UJIL 3PV7A 3UTSA 2AJUL 5C0JA 3O45A 2CMRH 5LQBH 3D39B 2VDOL 4FXKB 3W2DL 2PYED 4NZRH 1TTFA 2QSQA 3D85A 1AO7E 1UWGH 5HI3D 2HTKD 4OV5A 2ZNWA 5BS0A 1JZ8A 2M26A 3EAKA 1HIMH 3V4VL 3AC0A 2HTKC 4PJBF 3V52H 3GIVA 1K2DB 4HJJL 3GJFA 5LCVL 4LDLB 1PG7H 4Z7UB 3QBTB 5BZDB 1A7RH 3V6OC 1S7UA 4YGVB 5D8JL 5DJCA 3T0EA 5D7KE 5AUMB 1EH9A 2H9GA 5GJTL 3TWCL 4M03A 3S8WA 2P8MA 4WCYH 2XQBH 43C9B 3WEXB 2OZ4L 4WI4A 4WI8A 5GGTH 3F65A 3AAZA 3G04B 1BF8A 3C6SA 5T33L 3CMOH 2RCSL 5I8CA 4UOW0 3T2QA 3PWJA 5JQHC 5DC0A 3MODL 2B4CH 2E9BA 2FB4H 1EFQA 3QRGL 3BXNA 3TH2T 3IDNA 4RDQG 1IGFH 5CP3A 1OSZB 1ZLSH 1KN2L 2VLME 3NN8A 4QHKJ 2R69L 5TQ0H 3W0WE 4B50A 2XWTA 1JNJA 3F5WA 3K2MC 4FMKA 4Y88A 5JUEH 5ICYB 5TDPA 4B0MM 4KZEL 2BJMH 4JRYD 4RFEB 3W9EB 3BKCH 3DUHA 1Z9SA 4JY6A 2WIIB 3QXDB 3MCLH 5K9KB 3WFHB 3VXUA 4NWUH 4G6AD 1A6TB 4Y2DD 1S9WA 5ACZB 1IC5H 4XC1L 2NY5C 4MD0A 1CIDA 1UB6B 4QGTA 4I77H 3MUZ1 4G6AC 4X0KA 4LQFH 3AM8A 3DTXA 1AQKL 1UEYA 1OP9A 4PJCB 2F8XC 1A5FL 1MY5A 3TIDA 4CW1B 1FC1A 4HUXA 2X89D 2Q86B 3RHWF 2FL5B 3LS4H 4JAMA 1SJEA 4POZD 4X7SL 2NW3A 5ESVB 3Q48A 4PUBL 5EUOF 3BPOC 5ISZB 1KT2A 4POZC 4DAGL 5JNYA 4WU7B 5D9SB 1BQLL 1MHCA 5E9DB 4QHKI 4OQTL 2DQFB 3FB6B 3EYSL 1U8NA 4F7PB 1I1AD 1PLGL 4V1DB 4U7KA 4BZ2L 3OAZH 4D3CH 4M62L 2WBJB 1KCRL 1I1AC 5CCKH 3CUPA 4K71C 3VXSE 1WVZA 1Y6NR 2EC9T 3NBNA 1Q0YH 2DQEH 3MFFA 4XH2A 3MBEB 3ZTNL 1YEFL 3D3VD 3DUUB 3P11L 5ETUB 4HGWB 5DK2A 1SY6H 4O4YH 4MMXC 4H1LA 3NIDE 4G8GB 4OZHF 5CEXB 1YYMH 3SDXF 4G8IA 4LLMA 4MB3A 5KSBA 1D5IL 3DROA 1ZV5A 4Y0GA 5E70A 1I7UB 1ZHNB 1EGJL 2XRAL 4MCYA 1CT8B 1QSFB 4Y1AB 2MCPH 2PXYA 4YX2L 4K3DH 2FX9L 3BGMA 2GKIA 4YHPB 3HLAA 2XT1B 4IBLT 4D8PA 5J0BA 4D9QE 3HUJA 1UZ8B 3CDGB 2HJFA 4PJXA 4ZFOB 3LH2L 1T7XA 4KAQL 2O26U 1DLHA 4LU5L 2UY7A 3QDMD 5H37G 4EI6A 4PLOB 2KPNA 4AENB 3MRCB 3ZDXE 2EDLA 4JDVA 2ICEA 3KLAB 2E7BA 4N1EA 2UVEA 4E41B 3MRRB 2IPTH 5I1DB 2X4NA 3DUSA 4DZ8B 1JWUA 3PWPD 3LQAC 3MROB 2FIKB 3WCYA 4PRHE 3WIHH 1WQVT 4NNPL 5CBEB 4TUOB 5E2TL 5GIRB 1P5VA 1Z2KA 3RFZC 4HCRA 4G9FA 5CJ5A 3TT1H 3SO3B 1AXSA 3HE6D 1CGWA 2CXKA 3LKSB 3BAEH 4YHZH 3RVUD 1IGCL 1TETL 4GW4B 4NUJA 4P59L 3GMMA 4QXUH 4Y7MA 4ODUB 3JTTB 3G5YA 5SWZE 3MNWB 3HE6C 1DBKH 3I6GB 4XGZA 2R4SL 5EU7C 1F6FB 1TTGA 1ETZA 1JNNL 3QUKB 1RY7B 3SCMD 2V9TA 5IVOA 3BO8B 1X9QA 2GJZB 4DK6A 1QRNE 5F9JA 5CGYD 5E7FA 3SCMC 1U93B 3QQ3B 2JCCB 3B6SB 1EIBA 4CVZA 2VNCA 3C5ZA 5CGYC 3ULVE 3FO9A 4M3KB 4JKLA 4AM0A 2P5WA 1M6OB 5E8OA 3AUVA 3FB7A 5C6TH 1SEBA 3H6JA 4OT1H 1F4XH 2EEAA 3C87A 3HPLA 3AXLB 3RPIA 4LCUB 4RFNB 2ZCHH 3MRKB 1N2RA 4MXVE 5CKGA 1MHPL 1B90A 2GJ6A 2X1QA 5DMYA 2FO1A 1C1EH 5IMMA 4ALAH 3OHXA 2OK0L 4QGYA 1F11B 2OJEA 4GG8A 1G6RA 1NEZB 4BYHA 1H9VA 2Z93B 3MMEA 1CDJA 2AK4D 3QCTH 3RZCA 1T2JA 1X5AA 2DBLL 4N9OB 2X09A 3PNWA 3RVWD 5F6HI 3B9EA 1VFAA 4XCFL 2VLRA 1DQMH 3S5LB 3PABB 3UBXG 3QUXB 4KKAD 1UXWB 4QRRD 5EFIB 3X13B 4GT7A 4R7NA 1RZIB 4LCWB 4PGJA 3TBTA 4PRNB 1IT9L 1MCNA 1N0LA 4HK3N 2WANA 4S1RH 4KKAC 5GRVK 3QXTA 3VFSA 3ES6B 4PTUB 1QBAA 4JB9H 4KXZI 3GI9H 4P3CH 4OUUB 4PG2C 1OW0C 3BP6B 4WW2F 3GNML 4DK3A 5IBUB 5I74C 1S5IL 1UKQA 5H35B 2MSPA 1QYGL 4EI5A 3I75A 3U46B 5C7XH 3P0YH 4WWKD 4HFUL 4OAWA 3WLBB 4EUPH 3PWVB 2DLGA 3D9AH 4JO1H 3KJ6L 4KC3B 3IDYB 1FCGA 4WWKC 2GSIB 1N3NA 4Y5YC 4TOYH 5D1ZA 3PHOB 2IADB 1D6VL 4Y19B 1RIUL 1CE6A 3O6KH 1IAIM 5ESQB 2C1OA 1F2QA 2Y72A 1NGYA 4X6DA 5DURD 1R5WB 4P2QE 3G6JB 3TC9A 3F62A 3PWLA 5HHNB 5AAWA 5FXCH 4M6MH 1LEGB 1GCFA 4Y89A 5C0BB 1T0NA 2EZ0D 1CFQA 2HH0H 5DK0B 3VFVB 4JHWL 3BSZL 5KVMC 1ZHLA 2XOTA 3PQYD 3ARDB 3JWDL 3CFBA 1UWEL 4GKSA 3MRMB 3MUHL 2EZ0C 1FL5A 3P73B 2LVEA 4YHIB 4W70A 2NLJA 2FX7L 5DSCA 4R8WH 4KRPB 3SE9H 4OQ1A 1J1PH 4X5WB 4ZTPL 1GHFH 1DE4B 4JRXE 3DRQA 2CPCA 3QUML 2IBZX 2YD1A 1U8JB 3SDYH 4FQXD 2FJFB 1U3JA 5F7HA 1J0ZA 4LLWB 4P46D 4D0BA 5KN5B 4IRSB 3ARFD 3LD8B 4EQ2A