4H1QA

Crystal structure of mutant mmp-9 catalytic domain in complex with a twin inhibitor.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
160
structure length
160
Chain Sequence
b'FEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGQGYSLFLVAAHQFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix metalloproteinase-9
publication title Crystallization of bi-functional ligand protein complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 46
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 3.4.24.35: Gelatinase B.
pdb deposition date 2012-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4h1qA00
3L0TA 1RM8A 3B92A 1GE5A 1WNIA 1ZTQA 2OW1A 1HFSA 5D1SA 3ZUKA 3KHIA 5L79A 2MLRA 2QPJA 3LILA 4H3XA 830CA 1IADA 4G9LA 1S4BP 2OXUA 3CKIA 2V4BA 1SU3A 2L0RA 3LKAA 5H8XA 2OW0A 5B5PA 2W14A 3LIRA 1KUGA 2WO9A 1XFZA 4R3VA 3EHXA 3KEKA 1GO7P 4WK7A 3B8ZA 1HV5A 3EDHA 3EDGA 3L0VA 4GR0A 1KBCA 2W13A 3MA2A 3P24A 1CAQA 1OS9A 4H76A 1QJJA 1QICA 3TSKA 4EFSA 5BOTA 4H82A 1I76A 2EROA 3F17A 4H1QA 3N2VA 4GUYA 5I3MA 4GWNA 1BQQM 2DW2A 1GE6A 2JNPA 2OXWA 5I43A 3DPEA 4PKUA 4AIGA 1XFWA 2MLSA 4I03A 2XS3A 4DF9A 4DPEA 1KUIA 2CKIA 3V96B 2OVZA 5CXAA 3UVCA 1BUVM 1FM1A 2DW0A 3LMCA 4PKVA 1OM6A 4XBHA 4AYKA 2USNA 3F1AA 3HBVP 1GO8P 5D1TA 2W0DA 3EHYA 1G05A 3DSLA 1BSWA 4JQGA 2I47A 2RJPA 1C7KA 1XFXA 4PKWA 1USNA 1R55A 1G49A 1IABA 1EAKA 2AYKA 3E8RA 4HMAA 1SMPA 3AYKA 4DD8A 1BM6A 1JAQA 1BKCE 1YOUA 1EB6A 2MZIA 2OI0A 3G5CA 3DWBA 4IJOA 1ZXCA 3K7NA 3I7GA 2YIGA 5L7FA 2DW1A 3LUNA 1OO9A 1KUKA 4XM6A 1JK3A 3HY7A 1G9KA 3WV1A 2J83A 3KMCA 1SLNA 2OW9A 4A3WA 3LIKA 1K7GA 2JSDA 5D2BA 1CGFA 4GWMA 1H71P 2E3XA 3OHLA 1XURA 3RTTA 4FU4A 1BZSA 1HFCA 3VTGA 1YP1A 1QIAA 2DDYA 1CGLA 5I2ZA 4WZVA 3LE9A 5B5OA 1JH1A 3EDIA 1AYKA 1GE7A 3DPFA 3ELMA 4AUOA 2CLTA 1HTDA 4PKTA 1ATLA 3WV3A 1EUBA 1XFUA 3F19A 1C3IA 2OVXA 3KMEA 1ZP5A 5BOYA 4G0DA 3LEAA 2AIGP 3OHOA 1I1IP 1IACA 1MMRA 3USNA 1MMBA 4H49A 3P1VA 2X3BA 4QKZA 2X3AA 1XUCA 3B2ZA 1HY7A 1O0TA 1Y0VA 3TS4A 3O64A 4H30A 3VI1A 1YCMA 4XM7A 3F18A 1SATA 1O0QA 3TVCA 1XFYA 2DDFA 4PKSA 1PWVA 2OY2A 1RMZA 2XS4A 4DV8A 1JANA 4H84A 1IAAA 1OM7A 1XFVA 1K7QA 3ZVSA 3LGPA 2Y6CA 3DNGA 3HBUP 1OMJA 4ON1A 1B3DA 2D1NA 3F15A 2ERPA 2X7MA 3KWVC 1DTHA 4A7BA 1CXVA 1BQOA 1AF0A 3LJTA 1JAOA 4L63A 2D1OA 3TT4A 1R1IA 1CIZA 2RJQA 5LABA 1GXDA 1Y93A 1Y8JA 1YQYA 3AYUA 3F16A 4XM8A 1R1JA 4XCTA 3LQ0A 1A86A 4GQLA 3HDAP 5JMYA 1JIWP 1L6JA 3LJGA 2Z2DA 456CA 1G12A 1ASTA 1GKCA 1C8TA 2JT5A 4JPAA 2OXZA 1CQRA 1OM8A 1JJ9A 2O36A 2Y6DA 3ZXHA 3HB2P 1FBLA 3BA0A 4GF1A 4PKRA 5I12A 2TCLA 3LQBA 4L19A 1JKYA 4WKIA 1ROSA 1JIZA 1GKDA 5CZMA 1UMSA 2O3EA 3HYGA 1MMPA 2FV5A 4JA1A 3GBOA 1KUFA 4GR3A 1QIBA 3NX7A 3LK8A 3EWJA 4J4MA 4WF6A 1PWPA 2J0TA 3HY9A 3AIGA 1CK7A 3HDBA 1BKCI 4PKQA 2JT6A 1BIWA 1UMTA 5I4OA 2POJA 2W15A 2OW2A 1Q3AA 3Q2GA 3KEJA 3LJZA 1OS2A 1ZVXA 1D8FA 1DMTA 1B8YA 5I0LA 2A8HA 1I73A 1ND1A 3K7LA 1ZS0A 4WKEA 5D1UA 4AXQA 2WOAA 1BKCA 2E2DA 2KRJA 1PWQA 1MMQA 1KUHA 5CUHA 3RTSA 1D5JA 4Q1LA 1AKLA 4GR8A 2OY4A 5D3CA 2N8RA 1R1HA 1QJIA 1PWWA 5BPAA 2MZEA 2MZHA 2PJTA 3KRYA 4IUWA 1UTZA 4H2EA 4JP4A 1UTTA 3KECA 1QUAA 2YB9A 5D7WA 3U1RA 1JAPA 1CGEA 3DL1A 3Q2HA 2SRTA 2HU6A 2X3CA 1K7IA 1HOVA 1XUDA 2K9CA 4FXQA 2JIHA 3N2UA 4CTHA 4I35A 1R54A 1SRPA 1UEAA 3O2XA 2OZRA 1D7XA 3WV2A 1SLMA 1Z3JA 966CA 4IN9A 2WO8A 1ZXVA 2ERQA 2W12A 1D8MA 1BUDA 1IAGA 2FV9A 4ZR5A 1G4KA 4L6TA 4JIJA 1IAEA 4FXYP 4ILWD 2K2GA 3SHIA 1KAPP 1A85A 3I7IA 1J7NA 1PWUA 3EDZA 3LUMA 3G42A 4HX3A 1FLSA 4FVLA 1MNCA
chains in the Genus database with same CATH superfamily
3L0TA 1RM8A 3B92A 1GE5A 1WNIA 1ZTQA 2OW1A 1HFSA 5D1SA 3ZUKA 3KHIA 5L79A 2MLRA 2QPJA 3LILA 4H3XA 830CA 1IADA 4G9LA 1S4BP 2OXUA 3CKIA 2V4BA 1SU3A 2L0RA 3LKAA 5H8XA 2OW0A 5B5PA 2W14A 3LIRA 1KUGA 2WO9A 1XFZA 4R3VA 3EHXA 3KEKA 1GO7P 4WK7A 3B8ZA 1HV5A 3EDHA 3EDGA 3L0VA 4GR0A 1KBCA 2W13A 3MA2A 3P24A 1CAQA 1OS9A 4H76A 3DTKA 1QJJA 1QICA 3TSKA 4EFSA 5BOTA 4H82A 1I76A 2EROA 3F17A 4H1QA 3N2VA 4GUYA 5I3MA 4GWNA 1BQQM 2DW2A 1GE6A 2JNPA 2OXWA 5I43A 3DPEA 4PKUA 4AIGA 1XFWA 2MLSA 4I03A 2XS3A 4DF9A 4DPEA 1KUIA 2CKIA 3V96B 2OVZA 5CXAA 3UVCA 1BUVM 1FM1A 2DW0A 3LMCA 4PKVA 1OM6A 4XBHA 4AYKA 2USNA 3F1AA 3HBVP 1GO8P 5D1TA 2W0DA 4L7AA 3EHYA 1G05A 3DSLA 1BSWA 4JQGA 2I47A 2RJPA 1C7KA 1XFXA 2YUFA 4PKWA 1USNA 1R55A 1G49A 1IABA 1EAKA 2AYKA 3E8RA 4HMAA 1SMPA 3AYKA 4DD8A 1BM6A 1JAQA 1BKCE 1YOUA 1EB6A 2MZIA 2OI0A 3G5CA 3DTEA 3DWBA 4IJOA 1ZXCA 3K7NA 3I7GA 2YIGA 5L7FA 2DW1A 3LUNA 1OO9A 1KUKA 4XM6A 1JK3A 3HY7A 1G9KA 3WV1A 2J83A 3KMCA 1SLNA 2OW9A 4A3WA 3LIKA 1K7GA 2JSDA 1XAXA 5D2BA 1CGFA 4GWMA 1H71P 2E3XA 3OHLA 1XURA 3RTTA 4FU4A 1BZSA 1HFCA 1TVIA 3VTGA 1YP1A 1QIAA 2DDYA 1CGLA 5I2ZA 4WZVA 3LE9A 5B5OA 1JH1A 3EDIA 1AYKA 1GE7A 3DPFA 3ELMA 4AUOA 2CLTA 1HTDA 4PKTA 1ATLA 3WV3A 1EUBA 1XFUA 3F19A 1C3IA 2OVXA 3KMEA 1ZP5A 5BOYA 4G0DA 3LEAA 2AIGP 3OHOA 1I1IP 1IACA 1MMRA 3USNA 1MMBA 4H49A 3P1VA 2X3BA 4QKZA 2X3AA 1XUCA 3B2ZA 1HY7A 1O0TA 1Y0VA 3TS4A 3O64A 4H30A 3VI1A 1YCMA 4XM7A 1XM5A 3F18A 1SATA 1O0QA 3TVCA 1XFYA 2DDFA 4PKSA 1PWVA 2OY2A 1RMZA 2XS4A 4DV8A 1JANA 4H84A 1IAAA 1OM7A 1XFVA 1K7QA 3ZVSA 3LGPA 2Y6CA 3DNGA 3HBUP 1OMJA 4ON1A 1B3DA 2D1NA 3F15A 2ERPA 2X7MA 3KWVC 1DTHA 4A7BA 1CXVA 1BQOA 1AF0A 3LJTA 1JAOA 4L63A 2D1OA 3TT4A 1R1IA 1CIZA 2RJQA 5LABA 1GXDA 1Y93A 1Y8JA 1YQYA 3AYUA 3F16A 4XM8A 1R1JA 4XCTA 3LQ0A 1A86A 4GQLA 3HDAP 5JMYA 1JIWP 1L6JA 3LJGA 2Z2DA 456CA 1G12A 1ASTA 1GKCA 1C8TA 2JT5A 4JPAA 2OXZA 1CQRA 1OM8A 1JJ9A 2O36A 2Y6DA 3ZXHA 3HB2P 1FBLA 3BA0A 4GF1A 4PKRA 5I12A 2TCLA 3LQBA 4L19A 1JKYA 4WKIA 1ROSA 1JIZA 1GKDA 5CZMA 1UMSA 2O3EA 3HYGA 1MMPA 2FV5A 4JA1A 3GBOA 1KUFA 4GR3A 1QIBA 3NX7A 3LK8A 3EWJA 4J4MA 4WF6A 1PWPA 2J0TA 3HY9A 3AIGA 1CK7A 3HDBA 1BKCI 4PKQA 2JT6A 1BIWA 1UMTA 5I4OA 2POJA 2W15A 2OW2A 1Q3AA 3Q2GA 3KEJA 3LJZA 1OS2A 1ZVXA 1D8FA 1DMTA 1B8YA 5I0LA 2A8HA 1I73A 1ND1A 3K7LA 1ZS0A 4WKEA 5D1UA 4AXQA 2WOAA 1BKCA 2E2DA 2KRJA 1PWQA 1MMQA 1KUHA 5CUHA 3RTSA 1D5JA 4Q1LA 1AKLA 4GR8A 2OY4A 5D3CA 2N8RA 1R1HA 1QJIA 1PWWA 5BPAA 2MZEA 2MZHA 2PJTA 3KRYA 4IUWA 1UTZA 4H2EA 4JP4A 1UTTA 3KECA 1QUAA 2YB9A 5D7WA 3U1RA 1JAPA 1CGEA 3DL1A 3Q2HA 2SRTA 2HU6A 2X3CA 1K7IA 1HOVA 1XUDA 2K9CA 4FXQA 2JIHA 3N2UA 4CTHA 4I35A 1R54A 1SRPA 1UEAA 3O2XA 2OZRA 1D7XA 3WV2A 1SLMA 1Z3JA 966CA 4IN9A 2WO8A 1ZXVA 2ERQA 2W12A 1D8MA 1BUDA 1IAGA 2FV9A 4ZR5A 1G4KA 4L6TA 4JIJA 1IAEA 4FXYP 4ILWD 2K2GA 3SHIA 1KAPP 1A85A 3I7IA 1J7NA 1PWUA 3EDZA 3LUMA 3G42A 1OZ9A 3DTIA 4HX3A 1FLSA 4FVLA 1MNCA
chains in the Genus database with same CATH topology
3L0TA 1RM8A 3B92A 1GE5A 1WNIA 1ZTQA 2OW1A 1HFSA 5D1SA 3ZUKA 3KHIA 5L79A 2MLRA 2QPJA 3LILA 4H3XA 830CA 1IADA 4G9LA 1S4BP 2OXUA 3CKIA 2V4BA 1SU3A 2L0RA 3LKAA 5H8XA 2OW0A 5B5PA 2W14A 3LIRA 1KUGA 2WO9A 1XFZA 4R3VA 3EHXA 3KEKA 1GO7P 4WK7A 3B8ZA 1HV5A 3EDHA 3EDGA 3L0VA 4GR0A 1KBCA 2W13A 3MA2A 3P24A 1CAQA 1OS9A 4H76A 3DTKA 1QJJA 1QICA 3TSKA 4EFSA 5BOTA 4H82A 1I76A 2EROA 3F17A 4H1QA 3N2VA 4GUYA 5I3MA 4GWNA 1BQQM 2DW2A 1GE6A 2JNPA 2OXWA 5I43A 3DPEA 4PKUA 4AIGA 1XFWA 2MLSA 4I03A 2XS3A 4DF9A 4DPEA 1KUIA 2CKIA 3V96B 2OVZA 5CXAA 3UVCA 1BUVM 1FM1A 2DW0A 3LMCA 4PKVA 1OM6A 4XBHA 4AYKA 2USNA 3F1AA 3HBVP 1GO8P 5D1TA 2W0DA 4L7AA 3EHYA 1G05A 3DSLA 1BSWA 4JQGA 2I47A 2RJPA 1C7KA 1XFXA 2YUFA 4PKWA 1USNA 1R55A 1G49A 1IABA 1EAKA 2AYKA 3E8RA 4HMAA 1SMPA 3AYKA 4DD8A 1BM6A 1JAQA 1BKCE 1YOUA 1EB6A 2MZIA 2OI0A 3G5CA 3DTEA 3DWBA 4IJOA 1ZXCA 3K7NA 3I7GA 2YIGA 5L7FA 2DW1A 3LUNA 1OO9A 1KUKA 4XM6A 1JK3A 3HY7A 1G9KA 3WV1A 2J83A 3KMCA 1SLNA 2OW9A 4A3WA 3LIKA 1K7GA 2JSDA 5D2BA 1CGFA 4GWMA 1H71P 2E3XA 3OHLA 1XURA 3RTTA 4FU4A 1BZSA 1HFCA 3VTGA 1YP1A 1QIAA 2DDYA 1CGLA 5I2ZA 4WZVA 3LE9A 5B5OA 1JH1A 3EDIA 1AYKA 1GE7A 3DPFA 3ELMA 4AUOA 2CLTA 1HTDA 4PKTA 1ATLA 3WV3A 1EUBA 1XFUA 3F19A 1C3IA 2OVXA 3KMEA 1ZP5A 5BOYA 4G0DA 3LEAA 2AIGP 3OHOA 1I1IP 1IACA 1MMRA 3USNA 1MMBA 4H49A 3P1VA 2X3BA 4QKZA 2X3AA 1XUCA 3B2ZA 1HY7A 1O0TA 1Y0VA 3TS4A 3O64A 4H30A 3VI1A 1YCMA 4XM7A 3F18A 1SATA 1O0QA 3TVCA 1XFYA 2DDFA 4PKSA 1PWVA 2OY2A 1RMZA 2XS4A 4DV8A 1JANA 4H84A 1IAAA 1OM7A 1XFVA 1K7QA 3ZVSA 3LGPA 2Y6CA 3DNGA 3HBUP 1OMJA 4ON1A 1B3DA 2D1NA 3F15A 2ERPA 2X7MA 3KWVC 1DTHA 4A7BA 1CXVA 1BQOA 1AF0A 3LJTA 1JAOA 4L63A 2D1OA 3TT4A 1R1IA 1CIZA 2RJQA 5LABA 1GXDA 1Y93A 1Y8JA 1YQYA 3AYUA 3F16A 4XM8A 1R1JA 4XCTA 3LQ0A 1A86A 4GQLA 3HDAP 5JMYA 1JIWP 1L6JA 3LJGA 2Z2DA 456CA 1G12A 1ASTA 1GKCA 1C8TA 2JT5A 4JPAA 2OXZA 1CQRA 1OM8A 1JJ9A 2O36A 2Y6DA 3ZXHA 3HB2P 1FBLA 3BA0A 4GF1A 4PKRA 5I12A 2TCLA 3LQBA 4L19A 1JKYA 4WKIA 1ROSA 1JIZA 1GKDA 5CZMA 1UMSA 2O3EA 3HYGA 1MMPA 2FV5A 4JA1A 3GBOA 1KUFA 4GR3A 1QIBA 3NX7A 3LK8A 3EWJA 4J4MA 4WF6A 1PWPA 2J0TA 3HY9A 3AIGA 1CK7A 3HDBA 1BKCI 4PKQA 2JT6A 1BIWA 1UMTA 5I4OA 2POJA 2W15A 2OW2A 1Q3AA 3Q2GA 3KEJA 3LJZA 1OS2A 1ZVXA 1D8FA 1DMTA 1B8YA 5I0LA 2A8HA 1I73A 1ND1A 3K7LA 1ZS0A 4WKEA 5D1UA 4AXQA 2WOAA 1BKCA 2E2DA 2KRJA 1PWQA 1MMQA 1KUHA 5CUHA 3RTSA 1D5JA 4Q1LA 1AKLA 4GR8A 2OY4A 5D3CA 2N8RA 1R1HA 1QJIA 1PWWA 5BPAA 2MZEA 2MZHA 2PJTA 3KRYA 4IUWA 1UTZA 4H2EA 4JP4A 1UTTA 3KECA 1QUAA 2YB9A 5D7WA 3U1RA 1JAPA 1CGEA 3DL1A 3Q2HA 2SRTA 2HU6A 2X3CA 1K7IA 1HOVA 1XUDA 2K9CA 4FXQA 2JIHA 3N2UA 4CTHA 4I35A 1R54A 1SRPA 1UEAA 3O2XA 2OZRA 1D7XA 3WV2A 1SLMA 1Z3JA 966CA 4IN9A 2WO8A 1ZXVA 2ERQA 2W12A 1D8MA 1BUDA 1IAGA 2FV9A 4ZR5A 1G4KA 4L6TA 4JIJA 1IAEA 4FXYP 4ILWD 2K2GA 3SHIA 1KAPP 1A85A 3I7IA 1J7NA 1PWUA 3EDZA 3LUMA 3G42A 4HX3A 3DTIA 1FLSA 4FVLA 1MNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0T A;  1RM8 A;  3B92 A;  1GE5 A;  1WNI A;  1ZTQ A;  2OW1 A;  1HFS A;  5D1S A;  3ZUK A;  3KHI A;  5L79 A;  2MLR A;  2QPJ A;  3LIL A;  4H3X A;  830C A;  1IAD A;  4G9L A;  1S4B P;  2OXU A;  3CKI A;  2V4B A;  1SU3 A;  2L0R A;  3LKA A;  5H8X A;  2OW0 A;  5B5P A;  2W14 A;  3LIR A;  1KUG A;  2WO9 A;  1XFZ A;  4R3V A;  3EHX A;  3KEK A;  1GO7 P;  4WK7 A;  3B8Z A;  1HV5 A;  3EDH A;  3EDG A;  3L0V A;  4GR0 A;  1KBC A;  2W13 A;  3MA2 A;  3P24 A;  1CAQ A;  1OS9 A;  4H76 A;  1QJJ A;  1QIC A;  3TSK A;  4EFS A;  5BOT A;  4H82 A;  1I76 A;  2ERO A;  3F17 A;  4H1Q A;  3N2V A;  4GUY A;  5I3M A;  4GWN A;  1BQQ M;  2DW2 A;  1GE6 A;  2JNP A;  2OXW A;  5I43 A;  3DPE A;  4PKU A;  4AIG A;  1XFW A;  2MLS A;  4I03 A;  2XS3 A;  4DF9 A;  4DPE A;  1KUI A;  2CKI A;  3V96 B;  2OVZ A;  5CXA A;  3UVC A;  1BUV M;  1FM1 A;  2DW0 A;  3LMC A;  4PKV A;  1OM6 A;  4XBH A;  4AYK A;  2USN A;  3F1A A;  3HBV P;  1GO8 P;  5D1T A;  2W0D A;  3EHY A;  1G05 A;  3DSL A;  1BSW A;  4JQG A;  2I47 A;  2RJP A;  1C7K A;  1XFX A;  4PKW A;  1USN A;  1R55 A;  1G49 A;  1IAB A;  1EAK A;  2AYK A;  3E8R A;  4HMA A;  1SMP A;  3AYK A;  4DD8 A;  1BM6 A;  1JAQ A;  1BKC E;  1YOU A;  1EB6 A;  2MZI A;  2OI0 A;  3G5C A;  3DWB A;  4IJO A;  1ZXC A;  3K7N A;  3I7G A;  2YIG A;  5L7F A;  2DW1 A;  3LUN A;  1OO9 A;  1KUK A;  4XM6 A;  1JK3 A;  3HY7 A;  1G9K A;  3WV1 A;  2J83 A;  3KMC A;  1SLN A;  2OW9 A;  4A3W A;  3LIK A;  1K7G A;  2JSD A;  5D2B A;  1CGF A;  4GWM A;  1H71 P;  2E3X A;  3OHL A;  1XUR A;  3RTT A;  4FU4 A;  1BZS A;  1HFC A;  3VTG A;  1YP1 A;  1QIA A;  2DDY A;  1CGL A;  5I2Z A;  4WZV A;  3LE9 A;  5B5O A;  1JH1 A;  3EDI A;  1AYK A;  1GE7 A;  3DPF A;  3ELM A;  4AUO A;  2CLT A;  1HTD A;  4PKT A;  1ATL A;  3WV3 A;  1EUB A;  1XFU A;  3F19 A;  1C3I A;  2OVX A;  3KME A;  1ZP5 A;  5BOY A;  4G0D A;  3LEA A;  2AIG P;  3OHO A;  1I1I P;  1IAC A;  1MMR A;  3USN A;  1MMB A;  4H49 A;  3P1V A;  2X3B A;  4QKZ A;  2X3A A;  1XUC A;  3B2Z A;  1HY7 A;  1O0T A;  1Y0V A;  3TS4 A;  3O64 A;  4H30 A;  3VI1 A;  1YCM A;  4XM7 A;  3F18 A;  1SAT A;  1O0Q A;  3TVC A;  1XFY A;  2DDF A;  4PKS A;  1PWV A;  2OY2 A;  1RMZ A;  2XS4 A;  4DV8 A;  1JAN A;  4H84 A;  1IAA A;  1OM7 A;  1XFV A;  1K7Q A;  3ZVS A;  3LGP A;  2Y6C A;  3DNG A;  3HBU P;  1OMJ A;  4ON1 A;  1B3D A;  2D1N A;  3F15 A;  2ERP A;  2X7M A;  3KWV C;  1DTH A;  4A7B A;  1CXV A;  1BQO A;  1AF0 A;  3LJT A;  1JAO A;  4L63 A;  2D1O A;  3TT4 A;  1R1I A;  1CIZ A;  2RJQ A;  5LAB A;  1GXD A;  1Y93 A;  1Y8J A;  1YQY A;  3AYU A;  3F16 A;  4XM8 A;  1R1J A;  4XCT A;  3LQ0 A;  1A86 A;  4GQL A;  3HDA P;  5JMY A;  1JIW P;  1L6J A;  3LJG A;  2Z2D A;  456C A;  1G12 A;  1AST A;  1GKC A;  1C8T A;  2JT5 A;  4JPA A;  2OXZ A;  1CQR A;  1OM8 A;  1JJ9 A;  2O36 A;  2Y6D A;  3ZXH A;  3HB2 P;  1FBL A;  3BA0 A;  4GF1 A;  4PKR A;  5I12 A;  2TCL A;  3LQB A;  4L19 A;  1JKY A;  4WKI A;  1ROS A;  1JIZ A;  1GKD A;  5CZM A;  1UMS A;  2O3E A;  3HYG A;  1MMP A;  2FV5 A;  4JA1 A;  3GBO A;  1KUF A;  4GR3 A;  1QIB A;  3NX7 A;  3LK8 A;  3EWJ A;  4J4M A;  4WF6 A;  1PWP A;  2J0T A;  3HY9 A;  3AIG A;  1CK7 A;  3HDB A;  1BKC I;  4PKQ A;  2JT6 A;  1BIW A;  1UMT A;  5I4O A;  2POJ A;  2W15 A;  2OW2 A;  1Q3A A;  3Q2G A;  3KEJ A;  3LJZ A;  1OS2 A;  1ZVX A;  1D8F A;  1DMT A;  1B8Y A;  5I0L A;  2A8H A;  1I73 A;  1ND1 A;  3K7L A;  1ZS0 A;  4WKE A;  5D1U A;  4AXQ A;  2WOA A;  1BKC A;  2E2D A;  2KRJ A;  1PWQ A;  1MMQ A;  1KUH A;  5CUH A;  3RTS A;  1D5J A;  4Q1L A;  1AKL A;  4GR8 A;  2OY4 A;  5D3C A;  2N8R A;  1R1H A;  1QJI A;  1PWW A;  5BPA A;  2MZE A;  2MZH A;  2PJT A;  3KRY A;  4IUW A;  1UTZ A;  4H2E A;  4JP4 A;  1UTT A;  3KEC A;  1QUA A;  2YB9 A;  5D7W A;  3U1R A;  1JAP A;  1CGE A;  3DL1 A;  3Q2H A;  2SRT A;  2HU6 A;  2X3C A;  1K7I A;  1HOV A;  1XUD A;  2K9C A;  4FXQ A;  2JIH A;  3N2U A;  4CTH A;  4I35 A;  1R54 A;  1SRP A;  1UEA A;  3O2X A;  2OZR A;  1D7X A;  3WV2 A;  1SLM A;  1Z3J A;  966C A;  4IN9 A;  2WO8 A;  1ZXV A;  2ERQ A;  2W12 A;  1D8M A;  1BUD A;  1IAG A;  2FV9 A;  4ZR5 A;  1G4K A;  4L6T A;  4JIJ A;  1IAE A;  4FXY P;  4ILW D;  2K2G A;  3SHI A;  1KAP P;  1A85 A;  3I7I A;  1J7N A;  1PWU A;  3EDZ A;  3LUM A;  3G42 A;  4HX3 A;  1FLS A;  4FVL A;  1MNC A; 
#chains in the Genus database with same CATH topology
 3L0T A;  1RM8 A;  3B92 A;  1GE5 A;  1WNI A;  1ZTQ A;  2OW1 A;  1HFS A;  5D1S A;  3ZUK A;  3KHI A;  5L79 A;  2MLR A;  2QPJ A;  3LIL A;  4H3X A;  830C A;  1IAD A;  4G9L A;  1S4B P;  2OXU A;  3CKI A;  2V4B A;  1SU3 A;  2L0R A;  3LKA A;  5H8X A;  2OW0 A;  5B5P A;  2W14 A;  3LIR A;  1KUG A;  2WO9 A;  1XFZ A;  4R3V A;  3EHX A;  3KEK A;  1GO7 P;  4WK7 A;  3B8Z A;  1HV5 A;  3EDH A;  3EDG A;  3L0V A;  4GR0 A;  1KBC A;  2W13 A;  3MA2 A;  3P24 A;  1CAQ A;  1OS9 A;  4H76 A;  3DTK A;  1QJJ A;  1QIC A;  3TSK A;  4EFS A;  5BOT A;  4H82 A;  1I76 A;  2ERO A;  3F17 A;  4H1Q A;  3N2V A;  4GUY A;  5I3M A;  4GWN A;  1BQQ M;  2DW2 A;  1GE6 A;  2JNP A;  2OXW A;  5I43 A;  3DPE A;  4PKU A;  4AIG A;  1XFW A;  2MLS A;  4I03 A;  2XS3 A;  4DF9 A;  4DPE A;  1KUI A;  2CKI A;  3V96 B;  2OVZ A;  5CXA A;  3UVC A;  1BUV M;  1FM1 A;  2DW0 A;  3LMC A;  4PKV A;  1OM6 A;  4XBH A;  4AYK A;  2USN A;  3F1A A;  3HBV P;  1GO8 P;  5D1T A;  2W0D A;  4L7A A;  3EHY A;  1G05 A;  3DSL A;  1BSW A;  4JQG A;  2I47 A;  2RJP A;  1C7K A;  1XFX A;  2YUF A;  4PKW A;  1USN A;  1R55 A;  1G49 A;  1IAB A;  1EAK A;  2AYK A;  3E8R A;  4HMA A;  1SMP A;  3AYK A;  4DD8 A;  1BM6 A;  1JAQ A;  1BKC E;  1YOU A;  1EB6 A;  2MZI A;  2OI0 A;  3G5C A;  3DTE A;  3DWB A;  4IJO A;  1ZXC A;  3K7N A;  3I7G A;  2YIG A;  5L7F A;  2DW1 A;  3LUN A;  1OO9 A;  1KUK A;  4XM6 A;  1JK3 A;  3HY7 A;  1G9K A;  3WV1 A;  2J83 A;  3KMC A;  1SLN A;  2OW9 A;  4A3W A;  3LIK A;  1K7G A;  2JSD A;  1XAX A;  5D2B A;  1CGF A;  4GWM A;  1H71 P;  2E3X A;  3OHL A;  1XUR A;  3RTT A;  4FU4 A;  1BZS A;  1HFC A;  1TVI A;  3VTG A;  1YP1 A;  1QIA A;  2DDY A;  1CGL A;  5I2Z A;  4WZV A;  3LE9 A;  5B5O A;  1JH1 A;  3EDI A;  1AYK A;  1GE7 A;  3DPF A;  3ELM A;  4AUO A;  2CLT A;  1HTD A;  4PKT A;  1ATL A;  3WV3 A;  1EUB A;  1XFU A;  3F19 A;  1C3I A;  2OVX A;  3KME A;  1ZP5 A;  5BOY A;  4G0D A;  3LEA A;  2AIG P;  3OHO A;  1I1I P;  1IAC A;  1MMR A;  3USN A;  1MMB A;  4H49 A;  3P1V A;  2X3B A;  4QKZ A;  2X3A A;  1XUC A;  3B2Z A;  1HY7 A;  1O0T A;  1Y0V A;  3TS4 A;  3O64 A;  4H30 A;  3VI1 A;  1YCM A;  4XM7 A;  1XM5 A;  3F18 A;  1SAT A;  1O0Q A;  3TVC A;  1XFY A;  2DDF A;  4PKS A;  1PWV A;  2OY2 A;  1RMZ A;  2XS4 A;  4DV8 A;  1JAN A;  4H84 A;  1IAA A;  1OM7 A;  1XFV A;  1K7Q A;  3ZVS A;  3LGP A;  2Y6C A;  3DNG A;  3HBU P;  1OMJ A;  4ON1 A;  1B3D A;  2D1N A;  3F15 A;  2ERP A;  2X7M A;  3KWV C;  1DTH A;  4A7B A;  1CXV A;  1BQO A;  1AF0 A;  3LJT A;  1JAO A;  4L63 A;  2D1O A;  3TT4 A;  1R1I A;  1CIZ A;  2RJQ A;  5LAB A;  1GXD A;  1Y93 A;  1Y8J A;  1YQY A;  3AYU A;  3F16 A;  4XM8 A;  1R1J A;  4XCT A;  3LQ0 A;  1A86 A;  4GQL A;  3HDA P;  5JMY A;  1JIW P;  1L6J A;  3LJG A;  2Z2D A;  456C A;  1G12 A;  1AST A;  1GKC A;  1C8T A;  2JT5 A;  4JPA A;  2OXZ A;  1CQR A;  1OM8 A;  1JJ9 A;  2O36 A;  2Y6D A;  3ZXH A;  3HB2 P;  1FBL A;  3BA0 A;  4GF1 A;  4PKR A;  5I12 A;  2TCL A;  3LQB A;  4L19 A;  1JKY A;  4WKI A;  1ROS A;  1JIZ A;  1GKD A;  5CZM A;  1UMS A;  2O3E A;  3HYG A;  1MMP A;  2FV5 A;  4JA1 A;  3GBO A;  1KUF A;  4GR3 A;  1QIB A;  3NX7 A;  3LK8 A;  3EWJ A;  4J4M A;  4WF6 A;  1PWP A;  2J0T A;  3HY9 A;  3AIG A;  1CK7 A;  3HDB A;  1BKC I;  4PKQ A;  2JT6 A;  1BIW A;  1UMT A;  5I4O A;  2POJ A;  2W15 A;  2OW2 A;  1Q3A A;  3Q2G A;  3KEJ A;  3LJZ A;  1OS2 A;  1ZVX A;  1D8F A;  1DMT A;  1B8Y A;  5I0L A;  2A8H A;  1I73 A;  1ND1 A;  3K7L A;  1ZS0 A;  4WKE A;  5D1U A;  4AXQ A;  2WOA A;  1BKC A;  2E2D A;  2KRJ A;  1PWQ A;  1MMQ A;  1KUH A;  5CUH A;  3RTS A;  1D5J A;  4Q1L A;  1AKL A;  4GR8 A;  2OY4 A;  5D3C A;  2N8R A;  1R1H A;  1QJI A;  1PWW A;  5BPA A;  2MZE A;  2MZH A;  2PJT A;  3KRY A;  4IUW A;  1UTZ A;  4H2E A;  4JP4 A;  1UTT A;  3KEC A;  1QUA A;  2YB9 A;  5D7W A;  3U1R A;  1JAP A;  1CGE A;  3DL1 A;  3Q2H A;  2SRT A;  2HU6 A;  2X3C A;  1K7I A;  1HOV A;  1XUD A;  2K9C A;  4FXQ A;  2JIH A;  3N2U A;  4CTH A;  4I35 A;  1R54 A;  1SRP A;  1UEA A;  3O2X A;  2OZR A;  1D7X A;  3WV2 A;  1SLM A;  1Z3J A;  966C A;  4IN9 A;  2WO8 A;  1ZXV A;  2ERQ A;  2W12 A;  1D8M A;  1BUD A;  1IAG A;  2FV9 A;  4ZR5 A;  1G4K A;  4L6T A;  4JIJ A;  1IAE A;  4FXY P;  4ILW D;  2K2G A;  3SHI A;  1KAP P;  1A85 A;  3I7I A;  1J7N A;  1PWU A;  3EDZ A;  3LUM A;  3G42 A;  1OZ9 A;  3DTI A;  4HX3 A;  1FLS A;  4FVL A;  1MNC A; 
#chains in the Genus database with same CATH homology
 3L0T A;  1RM8 A;  3B92 A;  1GE5 A;  1WNI A;  1ZTQ A;  2OW1 A;  1HFS A;  5D1S A;  3ZUK A;  3KHI A;  5L79 A;  2MLR A;  2QPJ A;  3LIL A;  4H3X A;  830C A;  1IAD A;  4G9L A;  1S4B P;  2OXU A;  3CKI A;  2V4B A;  1SU3 A;  2L0R A;  3LKA A;  5H8X A;  2OW0 A;  5B5P A;  2W14 A;  3LIR A;  1KUG A;  2WO9 A;  1XFZ A;  4R3V A;  3EHX A;  3KEK A;  1GO7 P;  4WK7 A;  3B8Z A;  1HV5 A;  3EDH A;  3EDG A;  3L0V A;  4GR0 A;  1KBC A;  2W13 A;  3MA2 A;  3P24 A;  1CAQ A;  1OS9 A;  4H76 A;  3DTK A;  1QJJ A;  1QIC A;  3TSK A;  4EFS A;  5BOT A;  4H82 A;  1I76 A;  2ERO A;  3F17 A;  4H1Q A;  3N2V A;  4GUY A;  5I3M A;  4GWN A;  1BQQ M;  2DW2 A;  1GE6 A;  2JNP A;  2OXW A;  5I43 A;  3DPE A;  4PKU A;  4AIG A;  1XFW A;  2MLS A;  4I03 A;  2XS3 A;  4DF9 A;  4DPE A;  1KUI A;  2CKI A;  3V96 B;  2OVZ A;  5CXA A;  3UVC A;  1BUV M;  1FM1 A;  2DW0 A;  3LMC A;  4PKV A;  1OM6 A;  4XBH A;  4AYK A;  2USN A;  3F1A A;  3HBV P;  1GO8 P;  5D1T A;  2W0D A;  4L7A A;  3EHY A;  1G05 A;  3DSL A;  1BSW A;  4JQG A;  2I47 A;  2RJP A;  1C7K A;  1XFX A;  2YUF A;  4PKW A;  1USN A;  1R55 A;  1G49 A;  1IAB A;  1EAK A;  2AYK A;  3E8R A;  4HMA A;  1SMP A;  3AYK A;  4DD8 A;  1BM6 A;  1JAQ A;  1BKC E;  1YOU A;  1EB6 A;  2MZI A;  2OI0 A;  3G5C A;  3DTE A;  3DWB A;  4IJO A;  1ZXC A;  3K7N A;  3I7G A;  2YIG A;  5L7F A;  2DW1 A;  3LUN A;  1OO9 A;  1KUK A;  4XM6 A;  1JK3 A;  3HY7 A;  1G9K A;  3WV1 A;  2J83 A;  3KMC A;  1SLN A;  2OW9 A;  4A3W A;  3LIK A;  1K7G A;  2JSD A;  5D2B A;  1CGF A;  4GWM A;  1H71 P;  2E3X A;  3OHL A;  1XUR A;  3RTT A;  4FU4 A;  1BZS A;  1HFC A;  3VTG A;  1YP1 A;  1QIA A;  2DDY A;  1CGL A;  5I2Z A;  4WZV A;  3LE9 A;  5B5O A;  1JH1 A;  3EDI A;  1AYK A;  1GE7 A;  3DPF A;  3ELM A;  4AUO A;  2CLT A;  1HTD A;  4PKT A;  1ATL A;  3WV3 A;  1EUB A;  1XFU A;  3F19 A;  1C3I A;  2OVX A;  3KME A;  1ZP5 A;  5BOY A;  4G0D A;  3LEA A;  2AIG P;  3OHO A;  1I1I P;  1IAC A;  1MMR A;  3USN A;  1MMB A;  4H49 A;  3P1V A;  2X3B A;  4QKZ A;  2X3A A;  1XUC A;  3B2Z A;  1HY7 A;  1O0T A;  1Y0V A;  3TS4 A;  3O64 A;  4H30 A;  3VI1 A;  1YCM A;  4XM7 A;  3F18 A;  1SAT A;  1O0Q A;  3TVC A;  1XFY A;  2DDF A;  4PKS A;  1PWV A;  2OY2 A;  1RMZ A;  2XS4 A;  4DV8 A;  1JAN A;  4H84 A;  1IAA A;  1OM7 A;  1XFV A;  1K7Q A;  3ZVS A;  3LGP A;  2Y6C A;  3DNG A;  3HBU P;  1OMJ A;  4ON1 A;  1B3D A;  2D1N A;  3F15 A;  2ERP A;  2X7M A;  3KWV C;  1DTH A;  4A7B A;  1CXV A;  1BQO A;  1AF0 A;  3LJT A;  1JAO A;  4L63 A;  2D1O A;  3TT4 A;  1R1I A;  1CIZ A;  2RJQ A;  5LAB A;  1GXD A;  1Y93 A;  1Y8J A;  1YQY A;  3AYU A;  3F16 A;  4XM8 A;  1R1J A;  4XCT A;  3LQ0 A;  1A86 A;  4GQL A;  3HDA P;  5JMY A;  1JIW P;  1L6J A;  3LJG A;  2Z2D A;  456C A;  1G12 A;  1AST A;  1GKC A;  1C8T A;  2JT5 A;  4JPA A;  2OXZ A;  1CQR A;  1OM8 A;  1JJ9 A;  2O36 A;  2Y6D A;  3ZXH A;  3HB2 P;  1FBL A;  3BA0 A;  4GF1 A;  4PKR A;  5I12 A;  2TCL A;  3LQB A;  4L19 A;  1JKY A;  4WKI A;  1ROS A;  1JIZ A;  1GKD A;  5CZM A;  1UMS A;  2O3E A;  3HYG A;  1MMP A;  2FV5 A;  4JA1 A;  3GBO A;  1KUF A;  4GR3 A;  1QIB A;  3NX7 A;  3LK8 A;  3EWJ A;  4J4M A;  4WF6 A;  1PWP A;  2J0T A;  3HY9 A;  3AIG A;  1CK7 A;  3HDB A;  1BKC I;  4PKQ A;  2JT6 A;  1BIW A;  1UMT A;  5I4O A;  2POJ A;  2W15 A;  2OW2 A;  1Q3A A;  3Q2G A;  3KEJ A;  3LJZ A;  1OS2 A;  1ZVX A;  1D8F A;  1DMT A;  1B8Y A;  5I0L A;  2A8H A;  1I73 A;  1ND1 A;  3K7L A;  1ZS0 A;  4WKE A;  5D1U A;  4AXQ A;  2WOA A;  1BKC A;  2E2D A;  2KRJ A;  1PWQ A;  1MMQ A;  1KUH A;  5CUH A;  3RTS A;  1D5J A;  4Q1L A;  1AKL A;  4GR8 A;  2OY4 A;  5D3C A;  2N8R A;  1R1H A;  1QJI A;  1PWW A;  5BPA A;  2MZE A;  2MZH A;  2PJT A;  3KRY A;  4IUW A;  1UTZ A;  4H2E A;  4JP4 A;  1UTT A;  3KEC A;  1QUA A;  2YB9 A;  5D7W A;  3U1R A;  1JAP A;  1CGE A;  3DL1 A;  3Q2H A;  2SRT A;  2HU6 A;  2X3C A;  1K7I A;  1HOV A;  1XUD A;  2K9C A;  4FXQ A;  2JIH A;  3N2U A;  4CTH A;  4I35 A;  1R54 A;  1SRP A;  1UEA A;  3O2X A;  2OZR A;  1D7X A;  3WV2 A;  1SLM A;  1Z3J A;  966C A;  4IN9 A;  2WO8 A;  1ZXV A;  2ERQ A;  2W12 A;  1D8M A;  1BUD A;  1IAG A;  2FV9 A;  4ZR5 A;  1G4K A;  4L6T A;  4JIJ A;  1IAE A;  4FXY P;  4ILW D;  2K2G A;  3SHI A;  1KAP P;  1A85 A;  3I7I A;  1J7N A;  1PWU A;  3EDZ A;  3LUM A;  3G42 A;  4HX3 A;  3DTI A;  1FLS A;  4FVL A;  1MNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...