4H1XA

Crystal structure of a phosphate abc transporter, phosphate-binding protein (sp_2084) from streptococcus pneumoniae tigr4 at 1.77 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
257
structure length
257
Chain Sequence
GTIEVISRENGSGTRGAFTEITGILKKDGDKKIDNTAKTAVIQNSTEGVLSAVQGNANAIGYISLGSLTKSVKALEIDGVKASRDTVLDGEYPLQRPFNIVWSSNLSKLGQDFISFIHSKQGQQVVTDNKFIEAKTETTEYTSQHLSGKLSVVGSTSVSSLMEKLAEAYKKENPEVTIDITSNGSSAGITAVKEKTADIGMVSRELTPEEGKSLTHDAIALDGIAVVVNNDNKASQVSMAELADVFSGKLTTWDKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate-binding protein pstS 2
publication title Crystal structure of a phosphate ABC transporter, phosphate-binding protein (SP_2084) from Streptococcus pneumoniae TIGR4 at 1.77 A resolution
rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 76
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2012-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12849 PBP_like_2 PBP superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h1xA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h1xA02
4WEPA 2Z8DA 2XX9A 1IXGA 1YTVA 3C4MA 3TZAA 1LFGA 3EQ1A 4ZEDA 5H8QB 2OZZA 3TYHA 3U1OA 3IB1A 3W9VA 3HHGA 4OFJA 2V25A 1P1NA 2XXIA 4R9GA 1S7YA 4JWYA 1PB9A 4OQOA 5ISUA 2DS9A 2HEUA 4OETA 4O3BA 4F39A 3FXQA 3MP6A 4LQ2A 3QUFA 3V8XB 5BWJA 2UVIA 1R1NA 1MQDA 1IQ7A 1Y3PA 3AXFA 2X7QA 2ZYMA 1YPNA 3HCQA 3WAEA 1MQJA 2UVGA 5ITPA 5H8NA 4GOTA 4ZECA 4Q8RA 2V3TA 5M2VA 4F1YA 4U23A 4OEUA 4IB2A 4BDRA 1B05A 4GRKA 3OO9A 3MC2A 1M5FA 1IEJA 4H0WA 3D4GA 2QRYA 4I62A 1MPBA 1A99A 3EHTA 1IXCA 2LAOA 3KOTA 2GHAA 3TTMA 3GBAA 2VP1A 4ZZAA 4BDOA 5TPAA 4FORA 1JQFA 1Q1KA 3BBRA 4LATA 3T66A 2RINA 3OXNA 2O7IA 3O6HA 3RT8A 3FJGA 4AQ4A 5TP9A 1MQIA 1B51A 3QIMA 3CSGA 3KBRA 5FTIA 3FASA 4L17A 3UP9A 1J1NA 3RPWA 3LSLA 4M4GA 1VFDA 5CBRA 2XX8A 3FXUA 3E13X 4U4XA 3C35A 4ELQA 2D21A 4OYVA 4FAJA 2F8DA 2X7PA 4R73A 3SESA 4F3SA 4OFLA 1RYOA 1XVXA 1QKBA 1OQGA 4QFLA 3M3KA 1B5JA 1Y4CA 4R2FA 3PUVE 1B9JA 3MPLA 2DXYA 1DTZA 5I2KB 1VSOA 1P1WA 4NMYA 3RNNA 1XC1A 3TUSA 2KLFA 3VXCA 1N84A 4JBZA 3DP4A 4MBPA 1GGGA 3GXAA 3U8QA 1JVXA 5EHSA 1GV8A 2GRVA 3IB2A 3USDA 4DZ1A 4ELPA 5B7DA 4OXVA 2QPQA 4C1UA 4ZDMA 4X48A 1O7TA 3IR1A 3T9VA 4YB7A 1RYXA 4H8IA 2M8CA 4KHZE 3PU5A 3SERA 4BDMA 3H6UA 1LLSA 5CMMA 2NOOA 3ILTB 3JYRA 3FVKA 1FQCA 3QYTA 2O1LA 3C32A 3H6VA 2HXWA 3O29A 3G3JA 2V84A 4R72A 1UTBA 5B70A 4Q5TA 3L6GA 1B3LA 1OLAA 4UA8A 2RCAA 3LSFB 4YZZA 2Q2CA 3OELA 2UXAA 3KEIA 2OWTA 3K6UA 3FV2A 2UYFA 2XX7A 2QMXA 3K1NA 3C31A 3UIFA 1LBCA 3H7MA 4N13A 1AL3A 2I58A 3FGSA 3D4CA 5H8HB 3UK4A 3SETA 2QS2A 4I9DA 3TPAA 1QUIA 1POTA 2QS1A 3SEXA 3EN3A 1B1HA 1IXIA 3TDJA 1TFAA 4YKPA 1SD3A 3H6TA 1B5HA 1TFDA 3HN0A 3EHSA 1EZOA 3OSQA 1TXFA 5JEIA 3IJXB 4EF1A 4NF8A 1IITA 2OJTA 2ALUA 2OBGA 3DELB 3IB0A 2OCUA 4QFKA 1MXUA 1SW1A 3IOUA 4XIGQ 2F7AA 4U21A 3HPIA 2WKYA 4ZS9A 3SKPA 1BLFA 5DVIA 3VLUA 4GXSB 2HAVA 2ZNUA 4OERA 1MXWA 3MAMA 5HM4B 1B3EA 2XD2A 4KQPA 1N7XA 1WODA 1PBPA 3DP6A 3H06B 1YAEA 5H8NB 4MH5A 3OMBA 3CG3A 1RKMA 3MVZA 2UVJA 1PB8A 5ICTA 3H03A 3IOTA 4R6KA 1ZLQA 3IJOB 3QUJA 1JW1A 1LSTA 2RKMA 2REJA 4QHQA 4QSDA 3H6WA 4LA9A 4OVJA 2FA7A 1OLCA 1PBQA 5I57A 2OWSA 4G4PA 3VV5A 4POXA 1UQWA 1QUJA 2H4IA 5KZTA 3VXBA 1US5A 4FEDA 2Z8FA 4ND9A 5TPAB 4IGTA 4JDFA 4JSOA 3G3HA 4NF5A 2HCAA 4JWXA 4F22A 5AA4A 2XXHA 3A09A 1NH7A 1LAFE 3B6QA 3LSXA 2UYEA 2F34A 3KG2A 4EXLA 4R6YA 2A5TA 4KCCA 1MY4A 2DQVA 4IGRA 2P0SA 4ESXA 3TFLA 5J1DA 1B3GA 3O66A 2YLNA 1VE4A 4NEDA 3HSTA 4GLIA 4FATA 2V3UA 4OHNA 4N6PA 5A5XB 2A5SA 3PD9A 1ZU0A 2ZXTA 3RLFE 5AA2B 1O63A 1N04A 2HZKA 5L9SA 5I84A 1CB6A 3PPQA 3SEVA 5TU0A 3DLNA 4O3CA 3F11A 2GHBA 2FYIA 1MQHA 3L6HA 1M5EA 2O6AA 4GIZA 1NL5A 2YPNA 3VDFA 3DM0A 5I58B 3TKDA 2F7BA 1A7LA 5H8FA 3CFXA 5LOMA 3G3GA 4KI0E 1B0HA 3Q25A 1B52A 3RN8A 2ONKE 3TCFA 3A3CA 1N7WA 1FQFA 4EF2A 2O7UA 3W15C 2PBWA 2XXVA 1AIVA 4GFRA 1SYHA 4AB6A 5I56B 4ZZEA 1XHYA 4YKJA 1XVYA 2X26A 4QSCA 1B5IA 4Z0IA 3U72A 1SBPA 3ONMA 5KCJA 3TMGA 2PVUA 4MF3A 1AMFA 3CIJA 3O97A 2I6EA 2RCBA 2AL4A 4PE5B 1JEVA 2PT1A 2DP8A 4U1OA 2XXYA 3Q29A 4JWOA 2NVUB 4F2QA 4R9FA 3OEMA 1MY0A 3V83A 1B2HA 2DWHA 5AE4A 1QVSA 1SI1A 1QJMA 2NUVA 4ONYA 1MDQA 3PUWE 5L9OA 4R2BA 2DWIA 2VHAA 1DSNA 1LFIA 1R9QA 1MM7A 1ZMGA 2O84X 3W9WA 5AA3A 3FD3A 2F5XA 3HV1A 1LFHA 1UIUA 1URSA 4ZE9A 2ANJA 4G2ZA 3PUZE 4EQ7A 4RXLA 4RY1A 4BDLA 5I59A 3FATA 1N76A 1R6ZA 5CC2A 3JV9A 4TQUQ 4YAHX 3S4UA 1LCFA 1N3WA 1B3FA 1Y4TA 4HCWA 1GTKA 3I3VA 1Q35A 2H5YA 1US4A 3LSWA 2QS4A 2F97A 3O9PA 4EQBA 4OESA 3MW0A 1JVYA 2QSXA 2Q88A 3WAFA 3MJNA 4WEDA 1A54A 3PPRA 4QFNA 3M3LA 1IXHA 1A8FA 3TODA 4GL8A 3T93B 1P1QA 1H76A 2O69A 3U94A 2Y7WA 3SEWA 4DIGA 2OK2A 1I6QA 1XT8A 1MXXA 2DWAA 1FW0A 4ZEIA 3O6GA 3PV0E 4YMAA 3VE1B 4K3FA 5AA4B 3VVDA 4THIA 1Y3NA 2RC9A 4F3BA 1P99A 2D3IA 1II5A 3KN7A 1MXVA 1B40A 4LONB 4KYDA 4ZEKA 1I69A 1SI0A 3TTKA 5DEXB 2THIA 1POY1 5JTYA 2PT2A 1MPCA 5CMBA 4DXUA 1VFEA 1URDA 4GWOA 2Y7PA 4AB5A 5KDTA 4OENA 2VOZA 1NNTA 3HO7A 3E9XA 2V93A 2DSFA 1MPDA 4C0RA 2XHDA 1USYH 5DVJA 4PFYA 2B3BA 3MVXA 1GR2A 1LB8A 4P11A 4DCYA 4UACA 3K6XA 3CR9A 3I5OA 2DOJA 3B6WA 5H8FB 4F2OA 1DMBA 1QW0A 1Z7NE 2I48A 3K01A 3RTWB 4QFOA 4ZEFA 3R26A 3TTLA 1ZTYA 4X1DA 3FJMA 2Y7IA 4H65A 2VD2A 3QXMA 2OLBA 4DE8A 3OO6A 3PPPA 5I2NB 3TQLA 3FIRA 1B7UA 1NH8A 4NF4A 5CM6A 4MLVA 2Q2AA 3O6IA 4JSDA 1SQYA 3QAXA 1B7ZA 1N3XA 4YB6A 3CRBA 3O28A 1HSEA 1USYE 1FTKA 4TLMB 3S9NC 4WXJA 2Q89A 3K00A 1EU8A 4YB5A 5EYFA 4PP0A 2BJJX 2R9JA 1P1OA 1ZIUA 3KGCA 4X9TA 1A55A 5CBSA 1WDNA 1IZ1A 1JW4A 5F7VA 4PFTA 2GFEA 3IO4A 1MXYA 3C34A 4KFQA 3C33A 3KN8A 4OZ9A 3T9UA 2B65A 1NMUA 5CRYA 4EDPA 3E3KA 2R6GE 3S9MC 2F36A 1L5TA 3RQTA 4Q30B 4EQ9A 4G68A 3OSRA 3MP8A 4JXIA 1B4HA 5I59B 4IY5A 4F1VA 2H99A 2ABHA 4OFOA 4IY6A 4U2RA 1UIVA 4PETA 3CG1A 2D5WA 2QMWA 3OOAA 4LZ7A 1SDXA 2RC7A 4RPOA 2Q9TA 1B3HA 2DYXA 2DVCA 3ZS6A 4OEVA 5K2XA 1BTJA 2Q8JA 3TTNA 5TP9B 1N0TA 1MH4A 4ZE8A 3G3IA 1QULA 4LQ5A 3KSXA 3FVOA 1T0KA 3KFMA 1SVXB 2DE4A 3PMVA 4NF6A 1PDAA 3S2VA 2Z23A 1FTLA 1AH5A 2R71A 4YU0A 3MZBA 3K1PA 4DXBA 3FJ7A 2XXQA 3MVYA 4RJZA 2QS3A 2H9BA 1SW2A 1I6BA 2B3FA 3LC8A 3N6UA 5ELVA 1PB7A 4KD5A 3PUXE 4F18A 3S9EA 1B1XA 3FVGA 1OVBA 4ZEBA 1LCTA 4I8CA 5JTYB 3OEKA 3R6UA 1DPEA 2NXOA 1B0LA 3M8UA 1Y20A 1KWHA 3TAJA 2E0SA 4LZ8A 2I4CA 4PFUA 2I4BA 3Q28A 4P0GA 2HZLA 4WKMA 5KDTB 3HHFA 4NWCA 1DOTA 3Q27A 4KYSA 3MZ9A 5FTHA 2XXPA 4G8NA 4XXUA 4FJPA 2HFBA 3H3GA 1ZKBA 3ZSFA 4H5FA 1Y1ZA 5F1QA 3ZKLA 3T22A 3G7WA 4YMBA 3GLBA 5DVFA 3OD7A 2ZYKA 1H45A 5FHOA 2RF1A 4RA1A 2DXRA 1UTBB 2UVHA 4IO7A 5CMCA 1ZJLA 1UTHA 3P7IA 3H4ZA 5H8HA 4LZ5A 4F29A 1B32A 4GF8A 1H44A 4OWDA 1IUDA 5H8SA 2ZNTA 3KSJA 3SEUA 1MRPA 2ZYOA 3V89B 2AIXA 4HCYA 4O3AA 4KR5A 5AA1A 2Z22A 4BDNA 4GXAA 4FE8A 4H67A 4ELRA 1OMPA 4G8MA 4DLDA 1BKAA 2PYYA 4NF4B 1CE2A 3OENA 4EUOA 1NNPA 1LAGE 2QL3A 2XXRA 3FXRA 2F6PA 2ESNA 4R6HA 3TCGA 1MXZA 2P2AA 4LP2B 4NF8B 5K2YA 4U4SA 3I6VA 1M5CA 3UGWA 4EXKA 1FQBA 3VLWA 4TOZA 2XXUA 4F1UA 1PEBA 3UORA 1FTOA 1O64A 3MPKA 4H1XA 1B46A 2ONSA 3R7XA 3TCHA 1VR5A 4XKPA 1B7HA 3ODBA 3MBPA 2DWJA 4IO5A 4IO3A 2I49A 1JETA 4G68B 4ELOA 3N6TA 2DVZA 3LUYA 4MLQA 5CI5A 3S9LC 4YKIA 4ECFA 4KYEA 4Z7EA 1MG1A 3VFJA 1OQHA 4Q0CA 2VGQA 2GH9A 4M1VA 4F3GA 5I57B 3PUYE 1FQEA 1A8EA 4OTEA 1SW5A 4HS7A 2ZYNA 4H6DA 1P1UA 2ZMBA 1B4ZA 4NTLA 3PMXA 4KCDA 5L9MA 4NF5B 1S50A 4ESWA 3T96B 4PQJA 5HBCA 3T9HB 3TQWA 3KOSA 3K02A 1MQGA 4RYAA 2E1SA 3K0VA 4H5GA 5ICQA 3FUZA 2A5TB 1OVTA 2VD3A 1EZ9A 5A5XA 4NF6B 4QRZA 1URGA 4G68C 5AA2A 1IIWA 5FHMA 2H25A 4XKRA 4P0IA 4HTGA 2XXWA 1A40A 3QK6A 5DTBA 1Y9UA 4XKNA 2Y84A 1H3DA 1HSJA 3N5LA 1LAXA 2IEEA 5I58A 1EZPA 5IAIA 2PX1A 1D3KA 2QJEA 3IOVA 2CMOA 4NWDA 3IORA 3ZKKA 3CSBA 2O68A 4MFIA 4RK9A 1FCKA 1ELJA 1NNFA 4POWA 3RUMA 3K6VA 4R74A 3O2AA 4QSEA 4FEBA 1H43A 5I56A 3E4RA 3B7DA 5DT6A 3OO7A 1SW4A 4G8HA 1QUKA 5JK4A 3PPNA 4X1BA 1JW5A 3MWBA 3TELA 1NNKA 4PFWA 1S9TA 3CFLA 3KZGA 3VVFA 4H8JA 4LUBA 3SDFA 4TLLB 1B58A 2W7YA 5H8QA 1GVCA 5KCJB 2ONRA 3IK6B 3U92A 4LVQA 5BUUA 2YJPA 2XXTA 1JNFA 1UTHB 3EHUA 4OMBA 2PMSA 3ILUB 2F78A 3MZ1A 4N07A 1D9YA 1LBBA 4BDQA 3MQ9A 3TEPA 1FQAA 3RT6B 2I0CA 1WVJA 2NWJA 3GZGA 2O1MA 4DXCA 1MM6A 1MY3A 1TT1A 1M5DA 3BFTA 2I0BA 3EPEA 4RNSA 3IL1B 2REGA 5EHMA 1D9VA 3RY3A 3VLVA 1FTMA 3M3FA 3IOWA 1D4NA 4F31B 1LB9A 5IKBA 5HPQA 3K1MA 1I6AA 3FV1A 3LBSA 3MUQA 4YICA 3CI8A 3G3FA 5ITOA 3EF7A 2Y7RA 2O51A 4GVOA 1TWYA 4U1ZA 5DYHA 2HQ0A 3ECRA 2HAUA 3N94A 1FQDA 3DP8A 1LAHE 4NE4A 2XXXA 3PD8A 2IA4A 3Q26A 3RTFB 4I1DA 3VVEA 4F3PA 3UN6A 3UA8A 3K4UA 4DCXA 1ZBMA 2G93A 4KPTA 4IO2A 4F19A 1MDP1 5AA2D 3PMWA 3MVWA 1R9LA 2DE2A 3QSLA 5CMKA 3N26A 2Y7KA 4IO6A 3V5AA 2ZNSA 1JEUA 1FTJA 4E0WA 2H98A 4JB7A 3SEYA 2F7CA 4BLAA 3BKIB 4IO4A 1AOVA 2RC8A 3CFZA 2F35A 4FIMA 2CZLA 3KN3A 3LR1A 5I2KA 2FNCA 5DEXA 1ANFA 2I3WA 3BFUA 2AYSA 1NFTA 3OO8A 3MP1A 3B6TA 4QFPA 4FECA 3KJ7A 1NKXA 4C1TA 1ATGA 3C9HA 1MY1A 2V3QA 4G77A 4GD5A 3TTRA 1OIBA 1Y3QA 3T9XB 4ISUA 1Z7ME 3K2DA 1MH3A 3K6WA 3FVNA 3RGYA 4R75A 4E0XA 1LGBC 1SYIA 2I3VA 1Y1MA 2AL5A 1DPPA 1QKAA 3A3UA 3FZVA 4GL0A 1BP5A 3CVGA 1HSLA 4U22A 2XD3A 1F9BA 3IX1A 4XTCQ 4RPNA 3C36A 4GQOA 1PC3A 3IAZA 4QF9A 3GBBA 3JZJA 3PGFA 3G3KA 4DDDA 1MY2A 1YCJA 2G29A 3KJTA 1XOCA 2P1SA 4HW8A 1BIYA 1EH3A 3THIA 4YKKA 4RK2A 2Z8EA 1MS7A 5FHNA 3U93A 1M5BA 2DE3A 1XS5A 2F6GA 4XKQA 5I2NA 3IO6A 1B6HA 5L8DA 1DTGA 3PPOA
chains in the Genus database with same CATH superfamily
3HFUA 1NUZA 2XA5A 4WEPA 2Z8DA 2XX9A 1IXGA 1YTVA 3C4MA 3TZAA 1LFGA 3EQ1A 5I7IA 4ZEDA 3KC0A 5H8QB 4MAGA 2OZZA 3RPLA 3TYHA 3U1OA 3IB1A 3W9VA 3HHGA 4OFJA 1FRPA 2V25A 1P1NA 2XXIA 1NUYA 4R9GA 1S7YA 4JWYA 1PB9A 4OQOA 5ISUA 2DS9A 2HEUA 4OETA 4O3BA 4F39A 3FXQA 3MP6A 4MX6A 4LQ2A 3QUFA 3V8XB 5BWJA 2UVIA 1R1NA 1MQDA 1IQ7A 1Y3PA 3AXFA 2X7QA 2ZYMA 1YPNA 3HCQA 3WAEA 1MQJA 2UVGA 5ITPA 5H8NA 4GOTA 4ZECA 3E78A 4Q8RA 2V3TA 5M2VA 4F1YA 4U23A 4OEUA 4IB2A 4BDRA 1B05A 4GRKA 3OO9A 2XXKA 3MC2A 1FJ9A 1M5FA 1IEJA 4H0WA 3D4GA 1FJ6A 2QRYA 4O8MA 1FBEA 4I62A 1MPBA 1A99A 3EHTA 1IXCA 2LAOA 3KOTA 2GHAA 3TTMA 3GBAA 2VP1A 4ZZAA 4BDOA 5TPAA 4FORA 4PC9A 1JQFA 1Q1KA 3BBRA 4LATA 2B4MA 3T66A 2RINA 3OXNA 2O7IA 3O6HA 3RT8A 3FJGA 4AQ4A 5TP9A 1MQIA 1B51A 4GX6A 3QIMA 3CSGA 4O7MA 4DI4B 3KBRA 5FTIA 3FASA 4L17A 3UP9A 1J1NA 3RPWA 3LSLA 4M4GA 1VFDA 4JVDA 5CBRA 2XX8A 3FXUA 4P56A 4N6DA 3E13X 4U4XA 3C35A 4ELQA 2D21A 4OYVA 4FAJA 2F8DA 5T3JA 2X7PA 4R73A 3SESA 4F3SA 4OFLA 1RYOA 1XVXA 4PBHA 1QKBA 1OQGA 4QFLA 3M3KA 1B5JA 1Y4CA 4R2FA 3PUVE 1B9JA 3MPLA 2DXYA 1DTZA 5F24A 5I2KB 1VSOA 1P1WA 4NMYA 3RNNA 1K9YA 1XC1A 3TUSA 2KLFA 3VXCA 1N84A 4JBZA 3DP4A 1D9QA 4MBPA 1GGGA 3GXAA 3U8QA 1JVXA 4GWXA 5EHSA 1GV8A 2GRVA 3IB2A 3USDA 4DZ1A 4ELPA 5B7DA 4OXVA 2QPQA 4C1UA 4ZDMA 4X48A 3D1RA 1O7TA 1KA1A 3IR1A 3T9VA 4MNIA 4YB7A 2V4CA 2ZZXA 1RYXA 4H8IA 2M8CA 4KHZE 1LEVA 3PU5A 3SERA 4BDMA 5IGAA 4QBAA 4OVRA 3H6UA 1LLSA 5CMMA 2NOOA 3ILTB 1YZ0A 3JYRA 3FVKA 1FQCA 2KR0A 3QYTA 2O1LA 5IZZA 3C32A 3H6VA 5J16A 2HXWA 3O29A 3G3JA 2V84A 4H46A 4NG7A 4R72A 1UTBA 5B70A 4Q5TA 3L6GA 1B3LA 1OLAA 4UA8A 2RCAA 3LSFB 4YZZA 1NV3A 1DCUA 2Q2CA 3OELA 1FBPA 2UXAA 3KEIA 4O94A 2OWTA 1FBGA 3K6UA 3FV2A 2UYFA 2XX7A 2QMXA 3K1NA 3C31A 3UIFA 1LBCA 3H7MA 4N13A 1AL3A 2Y5KA 2I58A 3FGSA 3D4CA 5H8HB 3UK4A 3SETA 2VT5A 2QS2A 4I9DA 3TPAA 1QUIA 1POTA 2QS1A 3SEXA 1FPDA 3EN3A 1B1HA 1IXIA 3TDJA 1TFAA 1G0IA 4YKPA 4IR8A 1SD3A 3H6TA 1B5HA 1TFDA 3HN0A 5EYHA 3RPLB 3EHSA 1EZOA 3OSQA 1TXFA 5JEIA 5FBPA 3IJXB 4OA4A 4EF1A 4NF8A 4MHFA 1IITA 2OJTA 2ALUA 2OBGA 3DELB 3IB0A 2OCUA 5I5PA 4QFKA 1MXUA 1SW1A 3IOUA 4XIGQ 2F7AA 4PDHA 4U21A 3HPIA 2WKYA 4ZS9A 3SKPA 1BLFA 5DVIA 3VLUA 4GXSB 2OWZA 2HAVA 2ZNUA 4N4UA 1MXWA 3MAMA 4OERA 4GBVA 5HM4B 1B3EA 3ROJA 2XD2A 1NUWA 1N7XA 1WODA 4KQPA 1PBPA 3DP6A 3H06B 1YAEA 5H8NB 4MH5A 3OMBA 3CG3A 1RKMA 3MVZA 2UVJA 1PB8A 4N8GA 5ICTA 3H03A 3IOTA 1LBXA 4R6KA 1ZLQA 3IJOB 3QUJA 1JW1A 1LSTA 2RKMA 2REJA 4QHQA 2PFZA 4QSDA 1SPIA 3H6WA 4LA9A 4PFBA 4OVJA 2FA7A 1OLCA 1PBQA 5I57A 2OWSA 4G4PA 3VV5A 4POXA 1CNQA 1UQWA 1QUJA 2H4IA 5KZTA 3VXBA 1FBDA 1US5A 4FEDA 2Z8FA 4ND9A 5TPAB 4IGTA 4MJOA 4JDFA 4JSOA 3G3HA 4NF5A 4GWWA 2HCAA 4JWXA 4F22A 5AA4A 2XXHA 3A09A 1NH7A 1LAFE 3B6QA 3LSXA 2UYEA 2F34A 3KG2A 3EKIA 4EXLA 4R6YA 2A5TA 4PBQA 4KCCA 1MY4A 2DQVA 4IGRA 2P0SA 4ESXA 3TFLA 5J1DA 4N17A 1NV2A 1B3GA 3O66A 2YLNA 1VE4A 4NEDA 3HSTA 4GLIA 4FATA 2V3UA 4OHNA 4N6PA 5A5XB 2A5SA 3PD9A 1ZU0A 2ZXTA 3RLFE 5AA2B 4MEVA 1O63A 1N04A 4PFIA 2HZKA 5L9SA 5I84A 1CB6A 3PPQA 1VDWA 3SEVA 5TU0A 3DLNA 4O3CA 3F11A 2GHBA 2FYIA 4PAKA 5EQAA 1MQHA 3L6HA 1M5EA 2O6AA 4GIZA 1NL5A 2YPNA 3VDFA 3DM0A 5I58B 4H45A 3TKDA 2F7BA 1A7LA 5H8FA 3CFXA 5LOMA 1NI9A 3G3GA 4KI0E 1B0HA 3Q25A 1B52A 3RN8A 2ONKE 3TCFA 3A3CA 1N7WA 1FQFA 4EF2A 2O7UA 3W15C 2PBWA 2XXVA 1AIVA 4GFRA 2FIXA 1SYHA 4AB6A 5I56B 4ZZEA 1XHYA 4YKJA 1XVYA 2X26A 2FBPA 4QSCA 1B5IA 4Z0IA 3U72A 1SBPA 3ONMA 5KCJA 3TMGA 2PVUA 2QVVA 4MF3A 1AMFA 3CIJA 3O97A 2I6EA 2RCBA 2AL4A 4PE5B 1JEVA 5IZ3B 2PT1A 4UABA 2DP8A 4U1OA 4XF5A 2XXYA 3Q29A 4JWOA 2NVUB 4F2QA 4R9FA 3OEMA 1MY0A 3V83A 1B2HA 2DWHA 5AE4A 1QVSA 1SI1A 1QJMA 2NUVA 4ONYA 5LDZA 1MDQA 3PUWE 3T0JA 5L9OA 4R2BA 2DWIA 2VHAA 1DSNA 1LFIA 1R9QA 1MM7A 1ZMGA 2O84X 4P47A 3W9WA 5AA3A 5ET8A 3CHGA 3FD3A 2F5XA 5ET7A 3HV1A 1XI6A 1LFHA 1UIUA 1URSA 5A5LA 4ZE9A 4NQ8A 5ESYA 2ANJA 2WEFA 4G2ZA 4GBWA 1YXIA 3PUZE 4MNCA 4EQ7A 4RXLA 4RY1A 4BDLA 5I59A 3FATA 4N91A 1N76A 1R6ZA 4NN3A 4P3LA 5CC2A 2WX9A 2XWOA 3JV9A 4TQUQ 4YAHX 3S4UA 1LCFA 1N3WA 1B3FA 1Y4TA 1IMCA 4HCWA 1GTKA 3I3VA 4PAIA 1Q35A 2H5YA 1US4A 3LSWA 2QS4A 2FIEA 2F97A 3O9PA 4EQBA 4OESA 3GYYA 2R8TA 2XWIA 3MW0A 1JVYA 2QSXA 2Q88A 3WAFA 4PTKA 3MJNA 5IM2A 1FPIA 4WEDA 1A54A 3BIGA 1RDZA 3PPRA 2P3VA 4QFNA 3M3LA 1IXHA 1A8FA 3TODA 4GL8A 1FBCA 1FPLA 2CEXA 3T93B 1P1QA 1H76A 2O69A 3U94A 2Y7WA 3SEWA 3SZPA 4DIGA 2OK2A 1I6QA 1XT8A 1MXXA 2DWAA 1FW0A 4ZEIA 3O6GA 3PV0E 2MKZA 2FVZA 4YMAA 3VE1B 4K3FA 4JVCA 5AA4B 1IMEA 3VVDA 4THIA 1Y3NA 2RC9A 4F3BA 1P99A 2D3IA 1II5A 3KN7A 1MXVA 1B40A 4LONB 4KYDA 4ZEKA 1I69A 1SI0A 3TTKA 5DEXB 2THIA 1POY1 2ZZWA 5JTYA 2KQZA 2PT2A 3ISPA 1EYKA 1MPCA 5CMBA 4DXUA 1VFEA 4NX1A 1URDA 4GWOA 2Y7PA 4AB5A 5KDTA 4OENA 2VOZA 1NNTA 3HO7A 3E9XA 5ET6A 2V93A 2DSFA 1MPDA 2VPNA 4C0RA 2XHDA 4HXVA 1USYH 5DVJA 4PFYA 2B3BA 3MVXA 4PFRA 1GR2A 1LB8A 4P11A 4MNPA 4DCYA 1FPKA 4UACA 4X04A 3K6XA 3CR9A 4PF8A 3I5OA 2DOJA 4KXPA 3B6WA 1FPGA 5H8FB 4F2OA 1DMBA 4N81A 1QW0A 3BIHA 1Z7NE 2I48A 2FHYA 3K01A 1LBVA 3RTWB 4QFOA 4ZEFA 3R26A 3TTLA 1ZTYA 4OVQA 4X1DA 3FJMA 1DBZA 2Y7IA 4H65A 2VD2A 3QXMA 2OLBA 4DE8A 3OO6A 3PPPA 5I2NB 3TQLA 3FIRA 1B7UA 1NH8A 2Q74A 4NF4A 4HE1A 2JJKA 5CM6A 5EQ9A 2Q8MA 4MLVA 2Q2AA 3O6IA 4JSDA 1SQYA 3QAXA 4GWUA 1B7ZA 1N3XA 4YB6A 3CRBA 3O28A 1HSEA 1NV5A 1USYE 1FTKA 4TLMB 3S9NC 4WXJA 1FPJA 2Q89A 3MSTA 3K00A 1EU8A 4YB5A 5EYFA 4PP0A 2BJJX 4XFEA 4P1LA 2R9JA 3IFCA 5IZ1A 1P1OA 1ZIUA 3KGCA 4X9TA 1A55A 3LV0A 5CBSA 1WDNA 2WYPA 1IZ1A 1JW4A 5F7VA 4PFTA 2GFEA 3IO4A 1MXYA 2F3BA 3C34A 4KFQA 3C33A 3KN8A 4OZ9A 3T9UA 2B65A 1NMUA 5CRYA 2PFYA 4PF6A 4EDPA 3E3KA 2R6GE 3S9MC 2F36A 1L5TA 3RQTA 4Q30B 2P3NA 3FBPA 4EQ9A 4G68A 1G0HA 3OSRA 3MP8A 4JXIA 1B4HA 5I59B 4IY5A 4F1VA 2H99A 2ABHA 4OFOA 4IY6A 2WBDA 4U2RA 3PTYA 1UIVA 4PETA 3CG1A 2D5WA 2QMWA 3OOAA 4LZ7A 1SDXA 2RC7A 4RPOA 2XWKA 2Q9TA 2F3DA 4P8BA 1B3HA 3B8BA 2DYXA 2DVCA 3ZS6A 4OEVA 5K2XA 1BTJA 2WBBA 1IMFA 2Q8JA 3TTNA 5TP9B 1N0TA 1FBFA 1MH4A 1YYZA 4ZE8A 3G3IA 1QULA 4LQ5A 3KSXA 3FVOA 1T0KA 3KFMA 1SVXB 1IMDA 2DE4A 3PMVA 4NF6A 1PDAA 1QGXA 3S2VA 2Z23A 1FTLA 1AH5A 2R71A 4YU0A 5EYGA 3MZBA 3K1PA 4DXBA 3FJ7A 2XXQA 3MVYA 4RJZA 2QS3A 2H9BA 1SW2A 1I6BA 2B3FA 4OANA 1LBWA 3LC8A 3N6UA 5ELVA 1PB7A 4KD5A 3PUXE 4F18A 2OX3A 3S9EA 1B1XA 3FVGA 1OVBA 4ZEBA 1LCTA 3LUZA 4I8CA 5JTYB 1RDYA 3NOHA 3OEKA 3A29A 3R6UA 1LBYA 1DPEA 2HHMA 2NXOA 1B0LA 3M8UA 1Y20A 3MYUA 1KWHA 2CZHA 3TAJA 2E0SA 4LZ8A 1IMBA 2I4CA 4PFUA 2I4BA 3Q28A 4P0GA 2HZLA 4WKMA 5KDTB 3HHFA 4NWCA 1DOTA 3Q27A 4KYSA 3MZ9A 5FTHA 2XXPA 3KC1A 4G8NA 4XXUA 4FJPA 2HFBA 3H3GA 1ZKBA 3ZSFA 4H5FA 1AWBA 1Y1ZA 4QXDA 5I3SA 5F1QA 3ZKLA 3T22A 3G7WA 4YMBA 3GLBA 4OVPA 5DVFA 3E79A 3OD7A 2ZYKA 1H45A 4G61A 5FHOA 2RF1A 4RA1A 2DXRA 1UTBB 2UVHA 4IO7A 5CMCA 1ZJLA 1UTHA 2QVUA 3P7IA 3H4ZA 5H8HA 4LZ5A 4F29A 1B32A 4GF8A 1H44A 4OWDA 1IUDA 5H8SA 2ZNTA 2DDKA 3T1BA 3KSJA 3SEUA 1MRPA 2ZYOA 3V89B 2AIXA 4HCYA 4O3AA 4KR5A 5AA1A 2Z22A 4BDNA 4GXAA 4FE8A 4H67A 4ELRA 1OMPA 2CEYA 4G8MA 4DLDA 1BKAA 2PYYA 4NF4B 1CE2A 3OENA 4EUOA 1NNPA 2CZKA 1LAGE 4NF0A 2QL3A 4P1EA 2XXRA 3FXRA 1K9ZA 4HE2A 1EYJA 2F6PA 2ESNA 4R6HA 3TCGA 1MXZA 2ZZVA 2P2AA 4LP2B 4NGUA 4NF8B 4GWYA 1NV7A 5K2YA 4U4SA 3I6VA 1M5CA 3UGWA 4EXKA 1NUXA 1FQBA 1FTAA 2BJIA 3VLWA 1NV6A 4TOZA 2XXUA 4F1UA 1IMAA 1PEBA 3UORA 1FTOA 1O64A 3MPKA 4H1XA 2QVRA 2HXRA 1B46A 2ONSA 3R7XA 4DI3D 4N6KA 4P9KA 3TCHA 4HE0A 1VR5A 4XKPA 1B7HA 3ODBA 2PCRA 3MBPA 2DWJA 4IO5A 4IO3A 2I49A 1JETA 4G68B 4ELOA 3N6TA 4MIJA 2DVZA 3LUYA 4MLQA 5CI5A 3S9LC 4GWZA 4YKIA 4ECFA 4KYEA 4Z7EA 1MG1A 1OQHA 4Q0CA 3VFJA 2VGQA 2GH9A 4M1VA 4PDDA 4F3GA 4PE3A 5I57B 4NHBA 3PUYE 1FQEA 1A8EA 4OTEA 4JVIA 1SW5A 4N8YA 4HS7A 2ZYNA 4H6DA 1P1UA 2ZMBA 1B4ZA 4NTLA 3PMXA 4KCDA 5L9MA 4NF5B 3U65A 1S50A 4ESWA 3T96B 4PQJA 5HBCA 4NAPA 3T9HB 3TQWA 3KOSA 3K02A 1MQGA 4RYAA 2E1SA 3K0VA 4H5GA 5ICQA 5LTCA 3FUZA 2A5TB 4GWSA 1INPA 1OVTA 2VD3A 1EZ9A 5A5XA 4NF6B 2Y5LA 4QRZA 1URGA 4G68C 5AA2A 5EQ7A 1IIWA 5FHMA 2H25A 4XKRA 3IFAA 4P0IA 4HTGA 2XXWA 1A40A 4PGNA 3QK6A 5DTBA 1Y9UA 4XKNA 1NV1A 2Y84A 1H3DA 1HSJA 3N5LA 1LAXA 1Q9DA 2IEEA 5I58A 1EZPA 5IAIA 2PX1A 1D3KA 2HPGA 2QJEA 1KA0A 3IOVA 2CMOA 4NWDA 4PAFA 2QFLA 3IORA 3ZKKA 3CSBA 1DK4A 2O68A 4MFIA 4RK9A 4I3YA 1FCKA 1ELJA 1NNFA 4POWA 4O7IA 3RUMA 3K6VA 4R74A 3O2AA 4QSEA 4FEBA 1H43A 1NV4A 5I56A 3E4RA 3B7DA 5DT6A 3OO7A 1JP4A 1SW4A 4G8HA 1QUKA 5JK4A 3PPNA 4X1BA 1JW5A 1KZ8A 3MWBA 3TELA 1NNKA 4PCDA 1S9TA 3CFLA 4PFWA 3KZGA 4GX4A 3VVFA 4H8JA 4LUBA 5IZ3A 3SDFA 4TLLB 1B58A 2W7YA 5H8QA 1GVCA 5KCJB 2ONRA 3IK6B 3U92A 4LVQA 5BUUA 2YJPA 2XXTA 1JNFA 1UTHB 3EHUA 4OMBA 2PMSA 4LN5A 3ILUB 1FPFA 2F78A 3MZ1A 4N07A 1D9YA 1LBBA 4BDQA 3MQ9A 3TEPA 1FQAA 3RT6B 2I0CA 1WVJA 2NWJA 3GZGA 2O1MA 4DXCA 1MM6A 1MY3A 1TT1A 1M5DA 3BFTA 2I0BA 3EPEA 4RNSA 3IL1B 2REGA 5EHMA 1D9VA 3RY3A 3VLVA 1FTMA 3M3FA 3IOWA 1D4NA 4F31B 1LB9A 5IKBA 5HPQA 3K1MA 2VPOA 1NV0A 1I6AA 3FV1A 3LBSA 3MUQA 4YICA 3CI8A 3FXBA 3G3FA 5ITOA 3EF7A 4X8RA 1FPEA 4I3EA 4PGPA 4XEQA 2Y7RA 2O51A 1FBHA 3B50A 4GVOA 1TWYA 4U1ZA 5DYHA 2HQ0A 3ECRA 2HAUA 2L5VA 3N94A 1FQDA 3DP8A 1LAHE 4NE4A 2XXXA 3PD8A 2IA4A 3Q26A 3RTFB 4I1DA 3VVEA 4F3PA 3UN6A 3UA8A 3K4UA 4DCXA 1ZBMA 2G93A 4KPTA 4IO2A 4F19A 1MDP1 5AA2D 3PMWA 3MVWA 1R9LA 5ET5A 2DE2A 3QSLA 5CMKA 4OVSA 2B4LA 3N26A 2Y7KA 4IO6A 3V5AA 2ZNSA 1JEUA 1FTJA 4E0WA 2H98A 4JB7A 3QMFA 3SEYA 5DW8A 2F7CA 4BLAA 3BKIB 4IO4A 1AOVA 2RC8A 3CFZA 2F35A 4FIMA 2CZLA 3KN3A 3LR1A 5I2KA 2CZIA 2FNCA 5DEXA 1ANFA 4GX3A 2I3WA 2AYSA 3BFUA 1NFTA 3OO8A 3MP1A 4FBPA 3B6TA 4QFPA 4FECA 3KJ7A 1NKXA 4C1TA 1ATGA 3C9HA 1MY1A 2V3QA 4G77A 4GD5A 3RYDA 3TTRA 1OIBA 1Y3QA 3T9XB 4ISUA 1Z7ME 3K2DA 1MH3A 1FPBA 2GQ1A 4I40A 3K6WA 1EYIA 3FVNA 3RGYA 4R75A 2WYKA 4E0XA 1LGBC 1SYIA 2I3VA 1Y1MA 2AL5A 1DPPA 4AS5A 1QKAA 3A3UA 3FZVA 1FSAA 4GL0A 1BP5A 3CVGA 1HSLA 4U22A 2XD3A 1LBZA 1F9BA 3KBZA 3IX1A 4XTCQ 4RPNA 3C36A 5EQ8A 4GQOA 1PC3A 4N15A 3IAZA 4QF9A 3GBBA 3JZJA 3PGFA 3G3KA 4DDDA 1MY2A 1YCJA 2G29A 4OVTA 4MMPA 3KJTA 1XOCA 2P1SA 4HW8A 1BIYA 1EH3A 2XWVA 4MCOA 3THIA 1BK4A 4YKKA 4RK2A 2Z8EA 1RDXA 1MS7A 5FHNA 3U93A 4AS4A 1M5BA 2DE3A 1XS5A 2F6GA 4XKQA 5I2NA 3IO6A 1B6HA 5L8DA 1DTGA 3PPOA
chains in the Genus database with same CATH topology
4WEPA 2Z8DA 2XX9A 1IXGA 1YTVA 3C4MA 3TZAA 1LFGA 3EQ1A 4ZEDA 5H8QB 2OZZA 3TYHA 3U1OA 3IB1A 3W9VA 3HHGA 4OFJA 2V25A 1P1NA 2XXIA 4R9GA 1S7YA 4JWYA 1PB9A 4OQOA 5ISUA 2DS9A 2HEUA 4OETA 4O3BA 4F39A 3FXQA 3MP6A 4LQ2A 3QUFA 3V8XB 5BWJA 2UVIA 1R1NA 1MQDA 1IQ7A 1Y3PA 3AXFA 2X7QA 2ZYMA 1YPNA 3HCQA 3WAEA 1MQJA 2UVGA 5ITPA 5H8NA 4GOTA 4ZECA 4Q8RA 2V3TA 5M2VA 4F1YA 4U23A 4OEUA 4IB2A 4BDRA 1B05A 4GRKA 3OO9A 3MC2A 1M5FA 1IEJA 4H0WA 3D4GA 2QRYA 4I62A 1MPBA 1A99A 3EHTA 1IXCA 2LAOA 3KOTA 2GHAA 3TTMA 3GBAA 2VP1A 4ZZAA 4BDOA 5TPAA 4FORA 1JQFA 1Q1KA 3BBRA 4LATA 3T66A 2RINA 3OXNA 2O7IA 3O6HA 3RT8A 3FJGA 4AQ4A 5TP9A 1MQIA 1B51A 3QIMA 3CSGA 3KBRA 5FTIA 3FASA 4L17A 3UP9A 1J1NA 3RPWA 3LSLA 4M4GA 1VFDA 5CBRA 2XX8A 3FXUA 3E13X 4U4XA 3C35A 4ELQA 2D21A 4OYVA 4FAJA 2F8DA 2X7PA 4R73A 3SESA 4F3SA 4OFLA 1RYOA 1XVXA 1QKBA 1OQGA 4QFLA 3M3KA 1B5JA 1Y4CA 4R2FA 3PUVE 1B9JA 3MPLA 2DXYA 1DTZA 5I2KB 1VSOA 1P1WA 4NMYA 3RNNA 1XC1A 3TUSA 2KLFA 3VXCA 1N84A 4JBZA 3DP4A 4MBPA 1GGGA 3GXAA 3U8QA 1JVXA 5EHSA 1GV8A 2GRVA 3IB2A 3USDA 4DZ1A 4ELPA 5B7DA 4OXVA 2QPQA 4C1UA 4ZDMA 4X48A 1O7TA 3IR1A 3T9VA 4YB7A 1RYXA 4H8IA 2M8CA 4KHZE 3PU5A 3SERA 4BDMA 3H6UA 1LLSA 5CMMA 2NOOA 3ILTB 3JYRA 3FVKA 1FQCA 3QYTA 2O1LA 3C32A 3H6VA 2HXWA 3O29A 3G3JA 2V84A 4R72A 1UTBA 5B70A 4Q5TA 3L6GA 1B3LA 1OLAA 4UA8A 2RCAA 3LSFB 4YZZA 2Q2CA 3OELA 2UXAA 3KEIA 2OWTA 3K6UA 3FV2A 2UYFA 2XX7A 2QMXA 3K1NA 3C31A 3UIFA 1LBCA 3H7MA 4N13A 1AL3A 2I58A 3FGSA 3D4CA 5H8HB 3UK4A 3SETA 2QS2A 4I9DA 3TPAA 1QUIA 1POTA 2QS1A 3SEXA 3EN3A 1B1HA 1IXIA 3TDJA 1TFAA 4YKPA 1SD3A 3H6TA 1B5HA 1TFDA 3HN0A 3EHSA 1EZOA 3OSQA 1TXFA 5JEIA 3IJXB 4EF1A 4NF8A 1IITA 2OJTA 2ALUA 2OBGA 3DELB 3IB0A 2OCUA 4QFKA 1MXUA 1SW1A 3IOUA 4XIGQ 2F7AA 4U21A 3HPIA 2WKYA 4ZS9A 3SKPA 1BLFA 5DVIA 3VLUA 4GXSB 2HAVA 2ZNUA 4OERA 1MXWA 3MAMA 5HM4B 1B3EA 2XD2A 4KQPA 1N7XA 1WODA 1PBPA 3DP6A 3H06B 1YAEA 5H8NB 4MH5A 3OMBA 3CG3A 1RKMA 3MVZA 2UVJA 1PB8A 5ICTA 3H03A 3IOTA 4R6KA 1ZLQA 3IJOB 3QUJA 1JW1A 1LSTA 2RKMA 2REJA 4QHQA 4QSDA 3H6WA 4LA9A 4OVJA 2FA7A 1OLCA 1PBQA 5I57A 2OWSA 4G4PA 3VV5A 4POXA 1UQWA 1QUJA 2H4IA 5KZTA 3VXBA 1US5A 4FEDA 2Z8FA 4ND9A 5TPAB 4IGTA 4JDFA 4JSOA 3G3HA 4NF5A 2HCAA 4JWXA 4F22A 5AA4A 2XXHA 3A09A 1NH7A 1LAFE 3B6QA 3LSXA 2UYEA 2F34A 3KG2A 4EXLA 4R6YA 2A5TA 4KCCA 1MY4A 2DQVA 4IGRA 2P0SA 4ESXA 3TFLA 5J1DA 1B3GA 3O66A 2YLNA 1VE4A 4NEDA 3HSTA 4GLIA 4FATA 2V3UA 4OHNA 4N6PA 5A5XB 2A5SA 3PD9A 1ZU0A 2ZXTA 3RLFE 5AA2B 1O63A 1N04A 2HZKA 5L9SA 5I84A 1CB6A 3PPQA 3SEVA 5TU0A 3DLNA 4O3CA 3F11A 2GHBA 2FYIA 1MQHA 3L6HA 1M5EA 2O6AA 4GIZA 1NL5A 2YPNA 3VDFA 3DM0A 5I58B 3TKDA 2F7BA 1A7LA 5H8FA 3CFXA 5LOMA 3G3GA 4KI0E 1B0HA 3Q25A 1B52A 3RN8A 2ONKE 3TCFA 3A3CA 1N7WA 1FQFA 4EF2A 2O7UA 3W15C 2PBWA 2XXVA 1AIVA 4GFRA 1SYHA 4AB6A 5I56B 4ZZEA 1XHYA 4YKJA 1XVYA 2X26A 4QSCA 1B5IA 4Z0IA 3U72A 1SBPA 3ONMA 5KCJA 3TMGA 2PVUA 4MF3A 1AMFA 3CIJA 3O97A 2I6EA 2RCBA 2AL4A 4PE5B 1JEVA 2PT1A 2DP8A 4U1OA 2XXYA 3Q29A 4JWOA 2NVUB 4F2QA 4R9FA 3OEMA 1MY0A 3V83A 1B2HA 2DWHA 5AE4A 1QVSA 1SI1A 1QJMA 2NUVA 4ONYA 1MDQA 3PUWE 5L9OA 4R2BA 2DWIA 2VHAA 1DSNA 1LFIA 1R9QA 1MM7A 1ZMGA 2O84X 3W9WA 5AA3A 3FD3A 2F5XA 3HV1A 1LFHA 1UIUA 1URSA 4ZE9A 2ANJA 4G2ZA 3PUZE 4EQ7A 4RXLA 4RY1A 4BDLA 5I59A 3FATA 1N76A 1R6ZA 5CC2A 3JV9A 4TQUQ 4YAHX 3S4UA 1LCFA 1N3WA 1B3FA 1Y4TA 4HCWA 1GTKA 3I3VA 1Q35A 2H5YA 1US4A 3LSWA 2QS4A 2F97A 3O9PA 4EQBA 4OESA 3MW0A 1JVYA 2QSXA 2Q88A 3WAFA 3MJNA 4WEDA 1A54A 3PPRA 4QFNA 3M3LA 1IXHA 1A8FA 3TODA 4GL8A 3T93B 1P1QA 1H76A 2O69A 3U94A 2Y7WA 3SEWA 4DIGA 2OK2A 1I6QA 1XT8A 1MXXA 2DWAA 1FW0A 4ZEIA 3O6GA 3PV0E 4YMAA 3VE1B 4K3FA 5AA4B 3VVDA 4THIA 1Y3NA 2RC9A 4F3BA 1P99A 2D3IA 1II5A 3KN7A 1MXVA 1B40A 4LONB 4KYDA 4ZEKA 1I69A 1SI0A 3TTKA 5DEXB 2THIA 1POY1 5JTYA 2PT2A 1MPCA 5CMBA 4DXUA 1VFEA 1URDA 4GWOA 2Y7PA 4AB5A 5KDTA 4OENA 2VOZA 1NNTA 3HO7A 3E9XA 2V93A 2DSFA 1MPDA 4C0RA 2XHDA 1USYH 5DVJA 4PFYA 2B3BA 3MVXA 1GR2A 1LB8A 4P11A 4DCYA 4UACA 3K6XA 3CR9A 3I5OA 2DOJA 3B6WA 5H8FB 4F2OA 1DMBA 1QW0A 1Z7NE 2I48A 3K01A 3RTWB 4QFOA 4ZEFA 3R26A 3TTLA 1ZTYA 4X1DA 3FJMA 2Y7IA 4H65A 2VD2A 3QXMA 2OLBA 4DE8A 3OO6A 3PPPA 5I2NB 3TQLA 3FIRA 1B7UA 1NH8A 4NF4A 5CM6A 4MLVA 2Q2AA 3O6IA 4JSDA 1SQYA 3QAXA 1B7ZA 1N3XA 4YB6A 3CRBA 3O28A 1HSEA 1USYE 1FTKA 4TLMB 3S9NC 4WXJA 2Q89A 3K00A 1EU8A 4YB5A 5EYFA 4PP0A 2BJJX 2R9JA 1P1OA 1ZIUA 3KGCA 4X9TA 1A55A 5CBSA 1WDNA 1IZ1A 1JW4A 5F7VA 4PFTA 2GFEA 3IO4A 1MXYA 3C34A 4KFQA 3C33A 3KN8A 4OZ9A 3T9UA 2B65A 1NMUA 5CRYA 4EDPA 3E3KA 2R6GE 3S9MC 2F36A 1L5TA 3RQTA 4Q30B 4EQ9A 4G68A 3OSRA 3MP8A 4JXIA 1B4HA 5I59B 4IY5A 4F1VA 2H99A 2ABHA 4OFOA 4IY6A 4U2RA 1UIVA 4PETA 3CG1A 2D5WA 2QMWA 3OOAA 4LZ7A 1SDXA 2RC7A 4RPOA 2Q9TA 1B3HA 2DYXA 2DVCA 3ZS6A 4OEVA 5K2XA 1BTJA 2Q8JA 3TTNA 5TP9B 1N0TA 1MH4A 4ZE8A 3G3IA 1QULA 4LQ5A 3KSXA 3FVOA 1T0KA 3KFMA 1SVXB 2DE4A 3PMVA 4NF6A 1PDAA 3S2VA 2Z23A 1FTLA 1AH5A 2R71A 4YU0A 3MZBA 3K1PA 4DXBA 3FJ7A 2XXQA 3MVYA 4RJZA 2QS3A 2H9BA 1SW2A 1I6BA 2B3FA 3LC8A 3N6UA 5ELVA 1PB7A 4KD5A 3PUXE 4F18A 3S9EA 1B1XA 3FVGA 1OVBA 4ZEBA 1LCTA 4I8CA 5JTYB 3OEKA 3R6UA 1DPEA 2NXOA 1B0LA 3M8UA 1Y20A 1KWHA 3TAJA 2E0SA 4LZ8A 2I4CA 4PFUA 2I4BA 3Q28A 4P0GA 2HZLA 4WKMA 5KDTB 3HHFA 4NWCA 1DOTA 3Q27A 4KYSA 3MZ9A 5FTHA 2XXPA 4G8NA 4XXUA 4FJPA 2HFBA 3H3GA 1ZKBA 3ZSFA 4H5FA 1Y1ZA 5F1QA 3ZKLA 3T22A 3G7WA 4YMBA 3GLBA 5DVFA 3OD7A 2ZYKA 1H45A 5FHOA 2RF1A 4RA1A 2DXRA 1UTBB 2UVHA 4IO7A 5CMCA 1ZJLA 1UTHA 3P7IA 3H4ZA 5H8HA 4LZ5A 4F29A 1B32A 4GF8A 1H44A 4OWDA 1IUDA 5H8SA 2ZNTA 3KSJA 3SEUA 1MRPA 2ZYOA 3V89B 2AIXA 4HCYA 4O3AA 4KR5A 5AA1A 2Z22A 4BDNA 4GXAA 4FE8A 4H67A 4ELRA 1OMPA 4G8MA 4DLDA 1BKAA 2PYYA 4NF4B 1CE2A 3OENA 4EUOA 1NNPA 1LAGE 2QL3A 2XXRA 3FXRA 2F6PA 2ESNA 4R6HA 3TCGA 1MXZA 2P2AA 4LP2B 4NF8B 5K2YA 4U4SA 3I6VA 1M5CA 3UGWA 4EXKA 1FQBA 3VLWA 4TOZA 2XXUA 4F1UA 1PEBA 3UORA 1FTOA 1O64A 3MPKA 4H1XA 1B46A 2ONSA 3R7XA 3TCHA 1VR5A 4XKPA 1B7HA 3ODBA 3MBPA 2DWJA 4IO5A 4IO3A 2I49A 1JETA 4G68B 4ELOA 3N6TA 2DVZA 3LUYA 4MLQA 5CI5A 3S9LC 4YKIA 4ECFA 4KYEA 4Z7EA 1MG1A 3VFJA 1OQHA 4Q0CA 2VGQA 2GH9A 4M1VA 4F3GA 5I57B 3PUYE 1FQEA 1A8EA 4OTEA 1SW5A 4HS7A 2ZYNA 4H6DA 1P1UA 2ZMBA 1B4ZA 4NTLA 3PMXA 4KCDA 5L9MA 4NF5B 1S50A 4ESWA 3T96B 4PQJA 5HBCA 3T9HB 3TQWA 3KOSA 3K02A 1MQGA 4RYAA 2E1SA 3K0VA 4H5GA 5ICQA 3FUZA 2A5TB 1OVTA 2VD3A 1EZ9A 5A5XA 4NF6B 4QRZA 1URGA 4G68C 5AA2A 1IIWA 5FHMA 2H25A 4XKRA 4P0IA 4HTGA 2XXWA 1A40A 3QK6A 5DTBA 1Y9UA 4XKNA 2Y84A 1H3DA 1HSJA 3N5LA 1LAXA 2IEEA 5I58A 1EZPA 5IAIA 2PX1A 1D3KA 2QJEA 3IOVA 2CMOA 4NWDA 3IORA 3ZKKA 3CSBA 2O68A 4MFIA 4RK9A 1FCKA 1ELJA 1NNFA 4POWA 3RUMA 3K6VA 4R74A 3O2AA 4QSEA 4FEBA 1H43A 5I56A 3E4RA 3B7DA 5DT6A 3OO7A 1SW4A 4G8HA 1QUKA 5JK4A 3PPNA 4X1BA 1JW5A 3MWBA 3TELA 1NNKA 4PFWA 1S9TA 3CFLA 3KZGA 3VVFA 4H8JA 4LUBA 3SDFA 4TLLB 1B58A 2W7YA 5H8QA 1GVCA 5KCJB 2ONRA 3IK6B 3U92A 4LVQA 5BUUA 2YJPA 2XXTA 1JNFA 1UTHB 3EHUA 4OMBA 2PMSA 3ILUB 2F78A 3MZ1A 4N07A 1D9YA 1LBBA 4BDQA 3MQ9A 3TEPA 1FQAA 3RT6B 2I0CA 1WVJA 2NWJA 3GZGA 2O1MA 4DXCA 1MM6A 1MY3A 1TT1A 1M5DA 3BFTA 2I0BA 3EPEA 4RNSA 3IL1B 2REGA 5EHMA 1D9VA 3RY3A 3VLVA 1FTMA 3M3FA 3IOWA 1D4NA 4F31B 1LB9A 5IKBA 5HPQA 3K1MA 1I6AA 3FV1A 3LBSA 3MUQA 4YICA 3CI8A 3G3FA 5ITOA 3EF7A 2Y7RA 2O51A 4GVOA 1TWYA 4U1ZA 5DYHA 2HQ0A 3ECRA 2HAUA 3N94A 1FQDA 3DP8A 1LAHE 4NE4A 2XXXA 3PD8A 2IA4A 3Q26A 3RTFB 4I1DA 3VVEA 4F3PA 3UN6A 3UA8A 3K4UA 4DCXA 1ZBMA 2G93A 4KPTA 4IO2A 4F19A 1MDP1 5AA2D 3PMWA 3MVWA 1R9LA 2DE2A 3QSLA 5CMKA 3N26A 2Y7KA 4IO6A 3V5AA 2ZNSA 1JEUA 1FTJA 4E0WA 2H98A 4JB7A 3SEYA 2F7CA 4BLAA 3BKIB 4IO4A 1AOVA 2RC8A 3CFZA 2F35A 4FIMA 2CZLA 3KN3A 3LR1A 5I2KA 2FNCA 5DEXA 1ANFA 2I3WA 3BFUA 2AYSA 1NFTA 3OO8A 3MP1A 3B6TA 4QFPA 4FECA 3KJ7A 1NKXA 4C1TA 1ATGA 3C9HA 1MY1A 2V3QA 4G77A 4GD5A 3TTRA 1OIBA 1Y3QA 3T9XB 4ISUA 1Z7ME 3K2DA 1MH3A 3K6WA 3FVNA 3RGYA 4R75A 4E0XA 1LGBC 1SYIA 2I3VA 1Y1MA 2AL5A 1DPPA 1QKAA 3A3UA 3FZVA 4GL0A 1BP5A 3CVGA 1HSLA 4U22A 2XD3A 1F9BA 3IX1A 4XTCQ 4RPNA 3C36A 4GQOA 1PC3A 3IAZA 4QF9A 3GBBA 3JZJA 3PGFA 3G3KA 4DDDA 1MY2A 1YCJA 2G29A 3KJTA 1XOCA 2P1SA 4HW8A 1BIYA 1EH3A 3THIA 4YKKA 4RK2A 2Z8EA 1MS7A 5FHNA 3U93A 1M5BA 2DE3A 1XS5A 2F6GA 4XKQA 5I2NA 3IO6A 1B6HA 5L8DA 1DTGA 3PPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WEP A;  2Z8D A;  2XX9 A;  1IXG A;  1YTV A;  3C4M A;  3TZA A;  1LFG A;  3EQ1 A;  4ZED A;  5H8Q B;  2OZZ A;  3TYH A;  3U1O A;  3IB1 A;  3W9V A;  3HHG A;  4OFJ A;  2V25 A;  1P1N A;  2XXI A;  4R9G A;  1S7Y A;  4JWY A;  1PB9 A;  4OQO A;  5ISU A;  2DS9 A;  2HEU A;  4OET A;  4O3B A;  4F39 A;  3FXQ A;  3MP6 A;  4LQ2 A;  3QUF A;  3V8X B;  5BWJ A;  2UVI A;  1R1N A;  1MQD A;  1IQ7 A;  1Y3P A;  3AXF A;  2X7Q A;  2ZYM A;  1YPN A;  3HCQ A;  3WAE A;  1MQJ A;  2UVG A;  5ITP A;  5H8N A;  4GOT A;  4ZEC A;  4Q8R A;  2V3T A;  5M2V A;  4F1Y A;  4U23 A;  4OEU A;  4IB2 A;  4BDR A;  1B05 A;  4GRK A;  3OO9 A;  3MC2 A;  1M5F A;  1IEJ A;  4H0W A;  3D4G A;  2QRY A;  4I62 A;  1MPB A;  1A99 A;  3EHT A;  1IXC A;  2LAO A;  3KOT A;  2GHA A;  3TTM A;  3GBA A;  2VP1 A;  4ZZA A;  4BDO A;  5TPA A;  4FOR A;  1JQF A;  1Q1K A;  3BBR A;  4LAT A;  3T66 A;  2RIN A;  3OXN A;  2O7I A;  3O6H A;  3RT8 A;  3FJG A;  4AQ4 A;  5TP9 A;  1MQI A;  1B51 A;  3QIM A;  3CSG A;  3KBR A;  5FTI A;  3FAS A;  4L17 A;  3UP9 A;  1J1N A;  3RPW A;  3LSL A;  4M4G A;  1VFD A;  5CBR A;  2XX8 A;  3FXU A;  3E13 X;  4U4X A;  3C35 A;  4ELQ A;  2D21 A;  4OYV A;  4FAJ A;  2F8D A;  2X7P A;  4R73 A;  3SES A;  4F3S A;  4OFL A;  1RYO A;  1XVX A;  1QKB A;  1OQG A;  4QFL A;  3M3K A;  1B5J A;  1Y4C A;  4R2F A;  3PUV E;  1B9J A;  3MPL A;  2DXY A;  1DTZ A;  5I2K B;  1VSO A;  1P1W A;  4NMY A;  3RNN A;  1XC1 A;  3TUS A;  2KLF A;  3VXC A;  1N84 A;  4JBZ A;  3DP4 A;  4MBP A;  1GGG A;  3GXA A;  3U8Q A;  1JVX A;  5EHS A;  1GV8 A;  2GRV A;  3IB2 A;  3USD A;  4DZ1 A;  4ELP A;  5B7D A;  4OXV A;  2QPQ A;  4C1U A;  4ZDM A;  4X48 A;  1O7T A;  3IR1 A;  3T9V A;  4YB7 A;  1RYX A;  4H8I A;  2M8C A;  4KHZ E;  3PU5 A;  3SER A;  4BDM A;  3H6U A;  1LLS A;  5CMM A;  2NOO A;  3ILT B;  3JYR A;  3FVK A;  1FQC A;  3QYT A;  2O1L A;  3C32 A;  3H6V A;  2HXW A;  3O29 A;  3G3J A;  2V84 A;  4R72 A;  1UTB A;  5B70 A;  4Q5T A;  3L6G A;  1B3L A;  1OLA A;  4UA8 A;  2RCA A;  3LSF B;  4YZZ A;  2Q2C A;  3OEL A;  2UXA A;  3KEI A;  2OWT A;  3K6U A;  3FV2 A;  2UYF A;  2XX7 A;  2QMX A;  3K1N A;  3C31 A;  3UIF A;  1LBC A;  3H7M A;  4N13 A;  1AL3 A;  2I58 A;  3FGS A;  3D4C A;  5H8H B;  3UK4 A;  3SET A;  2QS2 A;  4I9D A;  3TPA A;  1QUI A;  1POT A;  2QS1 A;  3SEX A;  3EN3 A;  1B1H A;  1IXI A;  3TDJ A;  1TFA A;  4YKP A;  1SD3 A;  3H6T A;  1B5H A;  1TFD A;  3HN0 A;  3EHS A;  1EZO A;  3OSQ A;  1TXF A;  5JEI A;  3IJX B;  4EF1 A;  4NF8 A;  1IIT A;  2OJT A;  2ALU A;  2OBG A;  3DEL B;  3IB0 A;  2OCU A;  4QFK A;  1MXU A;  1SW1 A;  3IOU A;  4XIG Q;  2F7A A;  4U21 A;  3HPI A;  2WKY A;  4ZS9 A;  3SKP A;  1BLF A;  5DVI A;  3VLU A;  4GXS B;  2HAV A;  2ZNU A;  4OER A;  1MXW A;  3MAM A;  5HM4 B;  1B3E A;  2XD2 A;  4KQP A;  1N7X A;  1WOD A;  1PBP A;  3DP6 A;  3H06 B;  1YAE A;  5H8N B;  4MH5 A;  3OMB A;  3CG3 A;  1RKM A;  3MVZ A;  2UVJ A;  1PB8 A;  5ICT A;  3H03 A;  3IOT A;  4R6K A;  1ZLQ A;  3IJO B;  3QUJ A;  1JW1 A;  1LST A;  2RKM A;  2REJ A;  4QHQ A;  4QSD A;  3H6W A;  4LA9 A;  4OVJ A;  2FA7 A;  1OLC A;  1PBQ A;  5I57 A;  2OWS A;  4G4P A;  3VV5 A;  4POX A;  1UQW A;  1QUJ A;  2H4I A;  5KZT A;  3VXB A;  1US5 A;  4FED A;  2Z8F A;  4ND9 A;  5TPA B;  4IGT A;  4JDF A;  4JSO A;  3G3H A;  4NF5 A;  2HCA A;  4JWX A;  4F22 A;  5AA4 A;  2XXH A;  3A09 A;  1NH7 A;  1LAF E;  3B6Q A;  3LSX A;  2UYE A;  2F34 A;  3KG2 A;  4EXL A;  4R6Y A;  2A5T A;  4KCC A;  1MY4 A;  2DQV A;  4IGR A;  2P0S A;  4ESX A;  3TFL A;  5J1D A;  1B3G A;  3O66 A;  2YLN A;  1VE4 A;  4NED A;  3HST A;  4GLI A;  4FAT A;  2V3U A;  4OHN A;  4N6P A;  5A5X B;  2A5S A;  3PD9 A;  1ZU0 A;  2ZXT A;  3RLF E;  5AA2 B;  1O63 A;  1N04 A;  2HZK A;  5L9S A;  5I84 A;  1CB6 A;  3PPQ A;  3SEV A;  5TU0 A;  3DLN A;  4O3C A;  3F11 A;  2GHB A;  2FYI A;  1MQH A;  3L6H A;  1M5E A;  2O6A A;  4GIZ A;  1NL5 A;  2YPN A;  3VDF A;  3DM0 A;  5I58 B;  3TKD A;  2F7B A;  1A7L A;  5H8F A;  3CFX A;  5LOM A;  3G3G A;  4KI0 E;  1B0H A;  3Q25 A;  1B52 A;  3RN8 A;  2ONK E;  3TCF A;  3A3C A;  1N7W A;  1FQF A;  4EF2 A;  2O7U A;  3W15 C;  2PBW A;  2XXV A;  1AIV A;  4GFR A;  1SYH A;  4AB6 A;  5I56 B;  4ZZE A;  1XHY A;  4YKJ A;  1XVY A;  2X26 A;  4QSC A;  1B5I A;  4Z0I A;  3U72 A;  1SBP A;  3ONM A;  5KCJ A;  3TMG A;  2PVU A;  4MF3 A;  1AMF A;  3CIJ A;  3O97 A;  2I6E A;  2RCB A;  2AL4 A;  4PE5 B;  1JEV A;  2PT1 A;  2DP8 A;  4U1O A;  2XXY A;  3Q29 A;  4JWO A;  2NVU B;  4F2Q A;  4R9F A;  3OEM A;  1MY0 A;  3V83 A;  1B2H A;  2DWH A;  5AE4 A;  1QVS A;  1SI1 A;  1QJM A;  2NUV A;  4ONY A;  1MDQ A;  3PUW E;  5L9O A;  4R2B A;  2DWI A;  2VHA A;  1DSN A;  1LFI A;  1R9Q A;  1MM7 A;  1ZMG A;  2O84 X;  3W9W A;  5AA3 A;  3FD3 A;  2F5X A;  3HV1 A;  1LFH A;  1UIU A;  1URS A;  4ZE9 A;  2ANJ A;  4G2Z A;  3PUZ E;  4EQ7 A;  4RXL A;  4RY1 A;  4BDL A;  5I59 A;  3FAT A;  1N76 A;  1R6Z A;  5CC2 A;  3JV9 A;  4TQU Q;  4YAH X;  3S4U A;  1LCF A;  1N3W A;  1B3F A;  1Y4T A;  4HCW A;  1GTK A;  3I3V A;  1Q35 A;  2H5Y A;  1US4 A;  3LSW A;  2QS4 A;  2F97 A;  3O9P A;  4EQB A;  4OES A;  3MW0 A;  1JVY A;  2QSX A;  2Q88 A;  3WAF A;  3MJN A;  4WED A;  1A54 A;  3PPR A;  4QFN A;  3M3L A;  1IXH A;  1A8F A;  3TOD A;  4GL8 A;  3T93 B;  1P1Q A;  1H76 A;  2O69 A;  3U94 A;  2Y7W A;  3SEW A;  4DIG A;  2OK2 A;  1I6Q A;  1XT8 A;  1MXX A;  2DWA A;  1FW0 A;  4ZEI A;  3O6G A;  3PV0 E;  4YMA A;  3VE1 B;  4K3F A;  5AA4 B;  3VVD A;  4THI A;  1Y3N A;  2RC9 A;  4F3B A;  1P99 A;  2D3I A;  1II5 A;  3KN7 A;  1MXV A;  1B40 A;  4LON B;  4KYD A;  4ZEK A;  1I69 A;  1SI0 A;  3TTK A;  5DEX B;  2THI A;  1POY 1;  5JTY A;  2PT2 A;  1MPC A;  5CMB A;  4DXU A;  1VFE A;  1URD A;  4GWO A;  2Y7P A;  4AB5 A;  5KDT A;  4OEN A;  2VOZ A;  1NNT A;  3HO7 A;  3E9X A;  2V93 A;  2DSF A;  1MPD A;  4C0R A;  2XHD A;  1USY H;  5DVJ A;  4PFY A;  2B3B A;  3MVX A;  1GR2 A;  1LB8 A;  4P11 A;  4DCY A;  4UAC A;  3K6X A;  3CR9 A;  3I5O A;  2DOJ A;  3B6W A;  5H8F B;  4F2O A;  1DMB A;  1QW0 A;  1Z7N E;  2I48 A;  3K01 A;  3RTW B;  4QFO A;  4ZEF A;  3R26 A;  3TTL A;  1ZTY A;  4X1D A;  3FJM A;  2Y7I A;  4H65 A;  2VD2 A;  3QXM A;  2OLB A;  4DE8 A;  3OO6 A;  3PPP A;  5I2N B;  3TQL A;  3FIR A;  1B7U A;  1NH8 A;  4NF4 A;  5CM6 A;  4MLV A;  2Q2A A;  3O6I A;  4JSD A;  1SQY A;  3QAX A;  1B7Z A;  1N3X A;  4YB6 A;  3CRB A;  3O28 A;  1HSE A;  1USY E;  1FTK A;  4TLM B;  3S9N C;  4WXJ A;  2Q89 A;  3K00 A;  1EU8 A;  4YB5 A;  5EYF A;  4PP0 A;  2BJJ X;  2R9J A;  1P1O A;  1ZIU A;  3KGC A;  4X9T A;  1A55 A;  5CBS A;  1WDN A;  1IZ1 A;  1JW4 A;  5F7V A;  4PFT A;  2GFE A;  3IO4 A;  1MXY A;  3C34 A;  4KFQ A;  3C33 A;  3KN8 A;  4OZ9 A;  3T9U A;  2B65 A;  1NMU A;  5CRY A;  4EDP A;  3E3K A;  2R6G E;  3S9M C;  2F36 A;  1L5T A;  3RQT A;  4Q30 B;  4EQ9 A;  4G68 A;  3OSR A;  3MP8 A;  4JXI A;  1B4H A;  5I59 B;  4IY5 A;  4F1V A;  2H99 A;  2ABH A;  4OFO A;  4IY6 A;  4U2R A;  1UIV A;  4PET A;  3CG1 A;  2D5W A;  2QMW A;  3OOA A;  4LZ7 A;  1SDX A;  2RC7 A;  4RPO A;  2Q9T A;  1B3H A;  2DYX A;  2DVC A;  3ZS6 A;  4OEV A;  5K2X A;  1BTJ A;  2Q8J A;  3TTN A;  5TP9 B;  1N0T A;  1MH4 A;  4ZE8 A;  3G3I A;  1QUL A;  4LQ5 A;  3KSX A;  3FVO A;  1T0K A;  3KFM A;  1SVX B;  2DE4 A;  3PMV A;  4NF6 A;  1PDA A;  3S2V A;  2Z23 A;  1FTL A;  1AH5 A;  2R71 A;  4YU0 A;  3MZB A;  3K1P A;  4DXB A;  3FJ7 A;  2XXQ A;  3MVY A;  4RJZ A;  2QS3 A;  2H9B A;  1SW2 A;  1I6B A;  2B3F A;  3LC8 A;  3N6U A;  5ELV A;  1PB7 A;  4KD5 A;  3PUX E;  4F18 A;  3S9E A;  1B1X A;  3FVG A;  1OVB A;  4ZEB A;  1LCT A;  4I8C A;  5JTY B;  3OEK A;  3R6U A;  1DPE A;  2NXO A;  1B0L A;  3M8U A;  1Y20 A;  1KWH A;  3TAJ A;  2E0S A;  4LZ8 A;  2I4C A;  4PFU A;  2I4B A;  3Q28 A;  4P0G A;  2HZL A;  4WKM A;  5KDT B;  3HHF A;  4NWC A;  1DOT A;  3Q27 A;  4KYS A;  3MZ9 A;  5FTH A;  2XXP A;  4G8N A;  4XXU A;  4FJP A;  2HFB A;  3H3G A;  1ZKB A;  3ZSF A;  4H5F A;  1Y1Z A;  5F1Q A;  3ZKL A;  3T22 A;  3G7W A;  4YMB A;  3GLB A;  5DVF A;  3OD7 A;  2ZYK A;  1H45 A;  5FHO A;  2RF1 A;  4RA1 A;  2DXR A;  1UTB B;  2UVH A;  4IO7 A;  5CMC A;  1ZJL A;  1UTH A;  3P7I A;  3H4Z A;  5H8H A;  4LZ5 A;  4F29 A;  1B32 A;  4GF8 A;  1H44 A;  4OWD A;  1IUD A;  5H8S A;  2ZNT A;  3KSJ A;  3SEU A;  1MRP A;  2ZYO A;  3V89 B;  2AIX A;  4HCY A;  4O3A A;  4KR5 A;  5AA1 A;  2Z22 A;  4BDN A;  4GXA A;  4FE8 A;  4H67 A;  4ELR A;  1OMP A;  4G8M A;  4DLD A;  1BKA A;  2PYY A;  4NF4 B;  1CE2 A;  3OEN A;  4EUO A;  1NNP A;  1LAG E;  2QL3 A;  2XXR A;  3FXR A;  2F6P A;  2ESN A;  4R6H A;  3TCG A;  1MXZ A;  2P2A A;  4LP2 B;  4NF8 B;  5K2Y A;  4U4S A;  3I6V A;  1M5C A;  3UGW A;  4EXK A;  1FQB A;  3VLW A;  4TOZ A;  2XXU A;  4F1U A;  1PEB A;  3UOR A;  1FTO A;  1O64 A;  3MPK A;  4H1X A;  1B46 A;  2ONS A;  3R7X A;  3TCH A;  1VR5 A;  4XKP A;  1B7H A;  3ODB A;  3MBP A;  2DWJ A;  4IO5 A;  4IO3 A;  2I49 A;  1JET A;  4G68 B;  4ELO A;  3N6T A;  2DVZ A;  3LUY A;  4MLQ A;  5CI5 A;  3S9L C;  4YKI A;  4ECF A;  4KYE A;  4Z7E A;  1MG1 A;  3VFJ A;  1OQH A;  4Q0C A;  2VGQ A;  2GH9 A;  4M1V A;  4F3G A;  5I57 B;  3PUY E;  1FQE A;  1A8E A;  4OTE A;  1SW5 A;  4HS7 A;  2ZYN A;  4H6D A;  1P1U A;  2ZMB A;  1B4Z A;  4NTL A;  3PMX A;  4KCD A;  5L9M A;  4NF5 B;  1S50 A;  4ESW A;  3T96 B;  4PQJ A;  5HBC A;  3T9H B;  3TQW A;  3KOS A;  3K02 A;  1MQG A;  4RYA A;  2E1S A;  3K0V A;  4H5G A;  5ICQ A;  3FUZ A;  2A5T B;  1OVT A;  2VD3 A;  1EZ9 A;  5A5X A;  4NF6 B;  4QRZ A;  1URG A;  4G68 C;  5AA2 A;  1IIW A;  5FHM A;  2H25 A;  4XKR A;  4P0I A;  4HTG A;  2XXW A;  1A40 A;  3QK6 A;  5DTB A;  1Y9U A;  4XKN A;  2Y84 A;  1H3D A;  1HSJ A;  3N5L A;  1LAX A;  2IEE A;  5I58 A;  1EZP A;  5IAI A;  2PX1 A;  1D3K A;  2QJE A;  3IOV A;  2CMO A;  4NWD A;  3IOR A;  3ZKK A;  3CSB A;  2O68 A;  4MFI A;  4RK9 A;  1FCK A;  1ELJ A;  1NNF A;  4POW A;  3RUM A;  3K6V A;  4R74 A;  3O2A A;  4QSE A;  4FEB A;  1H43 A;  5I56 A;  3E4R A;  3B7D A;  5DT6 A;  3OO7 A;  1SW4 A;  4G8H A;  1QUK A;  5JK4 A;  3PPN A;  4X1B A;  1JW5 A;  3MWB A;  3TEL A;  1NNK A;  4PFW A;  1S9T A;  3CFL A;  3KZG A;  3VVF A;  4H8J A;  4LUB A;  3SDF A;  4TLL B;  1B58 A;  2W7Y A;  5H8Q A;  1GVC A;  5KCJ B;  2ONR A;  3IK6 B;  3U92 A;  4LVQ A;  5BUU A;  2YJP A;  2XXT A;  1JNF A;  1UTH B;  3EHU A;  4OMB A;  2PMS A;  3ILU B;  2F78 A;  3MZ1 A;  4N07 A;  1D9Y A;  1LBB A;  4BDQ A;  3MQ9 A;  3TEP A;  1FQA A;  3RT6 B;  2I0C A;  1WVJ A;  2NWJ A;  3GZG A;  2O1M A;  4DXC A;  1MM6 A;  1MY3 A;  1TT1 A;  1M5D A;  3BFT A;  2I0B A;  3EPE A;  4RNS A;  3IL1 B;  2REG A;  5EHM A;  1D9V A;  3RY3 A;  3VLV A;  1FTM A;  3M3F A;  3IOW A;  1D4N A;  4F31 B;  1LB9 A;  5IKB A;  5HPQ A;  3K1M A;  1I6A A;  3FV1 A;  3LBS A;  3MUQ A;  4YIC A;  3CI8 A;  3G3F A;  5ITO A;  3EF7 A;  2Y7R A;  2O51 A;  4GVO A;  1TWY A;  4U1Z A;  5DYH A;  2HQ0 A;  3ECR A;  2HAU A;  3N94 A;  1FQD A;  3DP8 A;  1LAH E;  4NE4 A;  2XXX A;  3PD8 A;  2IA4 A;  3Q26 A;  3RTF B;  4I1D A;  3VVE A;  4F3P A;  3UN6 A;  3UA8 A;  3K4U A;  4DCX A;  1ZBM A;  2G93 A;  4KPT A;  4IO2 A;  4F19 A;  1MDP 1;  5AA2 D;  3PMW A;  3MVW A;  1R9L A;  2DE2 A;  3QSL A;  5CMK A;  3N26 A;  2Y7K A;  4IO6 A;  3V5A A;  2ZNS A;  1JEU A;  1FTJ A;  4E0W A;  2H98 A;  4JB7 A;  3SEY A;  2F7C A;  4BLA A;  3BKI B;  4IO4 A;  1AOV A;  2RC8 A;  3CFZ A;  2F35 A;  4FIM A;  2CZL A;  3KN3 A;  3LR1 A;  5I2K A;  2FNC A;  5DEX A;  1ANF A;  2I3W A;  3BFU A;  2AYS A;  1NFT A;  3OO8 A;  3MP1 A;  3B6T A;  4QFP A;  4FEC A;  3KJ7 A;  1NKX A;  4C1T A;  1ATG A;  3C9H A;  1MY1 A;  2V3Q A;  4G77 A;  4GD5 A;  3TTR A;  1OIB A;  1Y3Q A;  3T9X B;  4ISU A;  1Z7M E;  3K2D A;  1MH3 A;  3K6W A;  3FVN A;  3RGY A;  4R75 A;  4E0X A;  1LGB C;  1SYI A;  2I3V A;  1Y1M A;  2AL5 A;  1DPP A;  1QKA A;  3A3U A;  3FZV A;  4GL0 A;  1BP5 A;  3CVG A;  1HSL A;  4U22 A;  2XD3 A;  1F9B A;  3IX1 A;  4XTC Q;  4RPN A;  3C36 A;  4GQO A;  1PC3 A;  3IAZ A;  4QF9 A;  3GBB A;  3JZJ A;  3PGF A;  3G3K A;  4DDD A;  1MY2 A;  1YCJ A;  2G29 A;  3KJT A;  1XOC A;  2P1S A;  4HW8 A;  1BIY A;  1EH3 A;  3THI A;  4YKK A;  4RK2 A;  2Z8E A;  1MS7 A;  5FHN A;  3U93 A;  1M5B A;  2DE3 A;  1XS5 A;  2F6G A;  4XKQ A;  5I2N A;  3IO6 A;  1B6H A;  5L8D A;  1DTG A;  3PPO A; 
#chains in the Genus database with same CATH topology
 3HFU A;  1NUZ A;  2XA5 A;  4WEP A;  2Z8D A;  2XX9 A;  1IXG A;  1YTV A;  3C4M A;  3TZA A;  1LFG A;  3EQ1 A;  5I7I A;  4ZED A;  3KC0 A;  5H8Q B;  4MAG A;  2OZZ A;  3RPL A;  3TYH A;  3U1O A;  3IB1 A;  3W9V A;  3HHG A;  4OFJ A;  1FRP A;  2V25 A;  1P1N A;  2XXI A;  1NUY A;  4R9G A;  1S7Y A;  4JWY A;  1PB9 A;  4OQO A;  5ISU A;  2DS9 A;  2HEU A;  4OET A;  4O3B A;  4F39 A;  3FXQ A;  3MP6 A;  4MX6 A;  4LQ2 A;  3QUF A;  3V8X B;  5BWJ A;  2UVI A;  1R1N A;  1MQD A;  1IQ7 A;  1Y3P A;  3AXF A;  2X7Q A;  2ZYM A;  1YPN A;  3HCQ A;  3WAE A;  1MQJ A;  2UVG A;  5ITP A;  5H8N A;  4GOT A;  4ZEC A;  3E78 A;  4Q8R A;  2V3T A;  5M2V A;  4F1Y A;  4U23 A;  4OEU A;  4IB2 A;  4BDR A;  1B05 A;  4GRK A;  3OO9 A;  2XXK A;  3MC2 A;  1FJ9 A;  1M5F A;  1IEJ A;  4H0W A;  3D4G A;  1FJ6 A;  2QRY A;  4O8M A;  1FBE A;  4I62 A;  1MPB A;  1A99 A;  3EHT A;  1IXC A;  2LAO A;  3KOT A;  2GHA A;  3TTM A;  3GBA A;  2VP1 A;  4ZZA A;  4BDO A;  5TPA A;  4FOR A;  4PC9 A;  1JQF A;  1Q1K A;  3BBR A;  4LAT A;  2B4M A;  3T66 A;  2RIN A;  3OXN A;  2O7I A;  3O6H A;  3RT8 A;  3FJG A;  4AQ4 A;  5TP9 A;  1MQI A;  1B51 A;  4GX6 A;  3QIM A;  3CSG A;  4O7M A;  4DI4 B;  3KBR A;  5FTI A;  3FAS A;  4L17 A;  3UP9 A;  1J1N A;  3RPW A;  3LSL A;  4M4G A;  1VFD A;  4JVD A;  5CBR A;  2XX8 A;  3FXU A;  4P56 A;  4N6D A;  3E13 X;  4U4X A;  3C35 A;  4ELQ A;  2D21 A;  4OYV A;  4FAJ A;  2F8D A;  5T3J A;  2X7P A;  4R73 A;  3SES A;  4F3S A;  4OFL A;  1RYO A;  1XVX A;  4PBH A;  1QKB A;  1OQG A;  4QFL A;  3M3K A;  1B5J A;  1Y4C A;  4R2F A;  3PUV E;  1B9J A;  3MPL A;  2DXY A;  1DTZ A;  5F24 A;  5I2K B;  1VSO A;  1P1W A;  4NMY A;  3RNN A;  1K9Y A;  1XC1 A;  3TUS A;  2KLF A;  3VXC A;  1N84 A;  4JBZ A;  3DP4 A;  1D9Q A;  4MBP A;  1GGG A;  3GXA A;  3U8Q A;  1JVX A;  4GWX A;  5EHS A;  1GV8 A;  2GRV A;  3IB2 A;  3USD A;  4DZ1 A;  4ELP A;  5B7D A;  4OXV A;  2QPQ A;  4C1U A;  4ZDM A;  4X48 A;  3D1R A;  1O7T A;  1KA1 A;  3IR1 A;  3T9V A;  4MNI A;  4YB7 A;  2V4C A;  2ZZX A;  1RYX A;  4H8I A;  2M8C A;  4KHZ E;  1LEV A;  3PU5 A;  3SER A;  4BDM A;  5IGA A;  4QBA A;  4OVR A;  3H6U A;  1LLS A;  5CMM A;  2NOO A;  3ILT B;  1YZ0 A;  3JYR A;  3FVK A;  1FQC A;  2KR0 A;  3QYT A;  2O1L A;  5IZZ A;  3C32 A;  3H6V A;  5J16 A;  2HXW A;  3O29 A;  3G3J A;  2V84 A;  4H46 A;  4NG7 A;  4R72 A;  1UTB A;  5B70 A;  4Q5T A;  3L6G A;  1B3L A;  1OLA A;  4UA8 A;  2RCA A;  3LSF B;  4YZZ A;  1NV3 A;  1DCU A;  2Q2C A;  3OEL A;  1FBP A;  2UXA A;  3KEI A;  4O94 A;  2OWT A;  1FBG A;  3K6U A;  3FV2 A;  2UYF A;  2XX7 A;  2QMX A;  3K1N A;  3C31 A;  3UIF A;  1LBC A;  3H7M A;  4N13 A;  1AL3 A;  2Y5K A;  2I58 A;  3FGS A;  3D4C A;  5H8H B;  3UK4 A;  3SET A;  2VT5 A;  2QS2 A;  4I9D A;  3TPA A;  1QUI A;  1POT A;  2QS1 A;  3SEX A;  1FPD A;  3EN3 A;  1B1H A;  1IXI A;  3TDJ A;  1TFA A;  1G0I A;  4YKP A;  4IR8 A;  1SD3 A;  3H6T A;  1B5H A;  1TFD A;  3HN0 A;  5EYH A;  3RPL B;  3EHS A;  1EZO A;  3OSQ A;  1TXF A;  5JEI A;  5FBP A;  3IJX B;  4OA4 A;  4EF1 A;  4NF8 A;  4MHF A;  1IIT A;  2OJT A;  2ALU A;  2OBG A;  3DEL B;  3IB0 A;  2OCU A;  5I5P A;  4QFK A;  1MXU A;  1SW1 A;  3IOU A;  4XIG Q;  2F7A A;  4PDH A;  4U21 A;  3HPI A;  2WKY A;  4ZS9 A;  3SKP A;  1BLF A;  5DVI A;  3VLU A;  4GXS B;  2OWZ A;  2HAV A;  2ZNU A;  4N4U A;  1MXW A;  3MAM A;  4OER A;  4GBV A;  5HM4 B;  1B3E A;  3ROJ A;  2XD2 A;  1NUW A;  1N7X A;  1WOD A;  4KQP A;  1PBP A;  3DP6 A;  3H06 B;  1YAE A;  5H8N B;  4MH5 A;  3OMB A;  3CG3 A;  1RKM A;  3MVZ A;  2UVJ A;  1PB8 A;  4N8G A;  5ICT A;  3H03 A;  3IOT A;  1LBX A;  4R6K A;  1ZLQ A;  3IJO B;  3QUJ A;  1JW1 A;  1LST A;  2RKM A;  2REJ A;  4QHQ A;  2PFZ A;  4QSD A;  1SPI A;  3H6W A;  4LA9 A;  4PFB A;  4OVJ A;  2FA7 A;  1OLC A;  1PBQ A;  5I57 A;  2OWS A;  4G4P A;  3VV5 A;  4POX A;  1CNQ A;  1UQW A;  1QUJ A;  2H4I A;  5KZT A;  3VXB A;  1FBD A;  1US5 A;  4FED A;  2Z8F A;  4ND9 A;  5TPA B;  4IGT A;  4MJO A;  4JDF A;  4JSO A;  3G3H A;  4NF5 A;  4GWW A;  2HCA A;  4JWX A;  4F22 A;  5AA4 A;  2XXH A;  3A09 A;  1NH7 A;  1LAF E;  3B6Q A;  3LSX A;  2UYE A;  2F34 A;  3KG2 A;  3EKI A;  4EXL A;  4R6Y A;  2A5T A;  4PBQ A;  4KCC A;  1MY4 A;  2DQV A;  4IGR A;  2P0S A;  4ESX A;  3TFL A;  5J1D A;  4N17 A;  1NV2 A;  1B3G A;  3O66 A;  2YLN A;  1VE4 A;  4NED A;  3HST A;  4GLI A;  4FAT A;  2V3U A;  4OHN A;  4N6P A;  5A5X B;  2A5S A;  3PD9 A;  1ZU0 A;  2ZXT A;  3RLF E;  5AA2 B;  4MEV A;  1O63 A;  1N04 A;  4PFI A;  2HZK A;  5L9S A;  5I84 A;  1CB6 A;  3PPQ A;  1VDW A;  3SEV A;  5TU0 A;  3DLN A;  4O3C A;  3F11 A;  2GHB A;  2FYI A;  4PAK A;  5EQA A;  1MQH A;  3L6H A;  1M5E A;  2O6A A;  4GIZ A;  1NL5 A;  2YPN A;  3VDF A;  3DM0 A;  5I58 B;  4H45 A;  3TKD A;  2F7B A;  1A7L A;  5H8F A;  3CFX A;  5LOM A;  1NI9 A;  3G3G A;  4KI0 E;  1B0H A;  3Q25 A;  1B52 A;  3RN8 A;  2ONK E;  3TCF A;  3A3C A;  1N7W A;  1FQF A;  4EF2 A;  2O7U A;  3W15 C;  2PBW A;  2XXV A;  1AIV A;  4GFR A;  2FIX A;  1SYH A;  4AB6 A;  5I56 B;  4ZZE A;  1XHY A;  4YKJ A;  1XVY A;  2X26 A;  2FBP A;  4QSC A;  1B5I A;  4Z0I A;  3U72 A;  1SBP A;  3ONM A;  5KCJ A;  3TMG A;  2PVU A;  2QVV A;  4MF3 A;  1AMF A;  3CIJ A;  3O97 A;  2I6E A;  2RCB A;  2AL4 A;  4PE5 B;  1JEV A;  5IZ3 B;  2PT1 A;  4UAB A;  2DP8 A;  4U1O A;  4XF5 A;  2XXY A;  3Q29 A;  4JWO A;  2NVU B;  4F2Q A;  4R9F A;  3OEM A;  1MY0 A;  3V83 A;  1B2H A;  2DWH A;  5AE4 A;  1QVS A;  1SI1 A;  1QJM A;  2NUV A;  4ONY A;  5LDZ A;  1MDQ A;  3PUW E;  3T0J A;  5L9O A;  4R2B A;  2DWI A;  2VHA A;  1DSN A;  1LFI A;  1R9Q A;  1MM7 A;  1ZMG A;  2O84 X;  4P47 A;  3W9W A;  5AA3 A;  5ET8 A;  3CHG A;  3FD3 A;  2F5X A;  5ET7 A;  3HV1 A;  1XI6 A;  1LFH A;  1UIU A;  1URS A;  5A5L A;  4ZE9 A;  4NQ8 A;  5ESY A;  2ANJ A;  2WEF A;  4G2Z A;  4GBW A;  1YXI A;  3PUZ E;  4MNC A;  4EQ7 A;  4RXL A;  4RY1 A;  4BDL A;  5I59 A;  3FAT A;  4N91 A;  1N76 A;  1R6Z A;  4NN3 A;  4P3L A;  5CC2 A;  2WX9 A;  2XWO A;  3JV9 A;  4TQU Q;  4YAH X;  3S4U A;  1LCF A;  1N3W A;  1B3F A;  1Y4T A;  1IMC A;  4HCW A;  1GTK A;  3I3V A;  4PAI A;  1Q35 A;  2H5Y A;  1US4 A;  3LSW A;  2QS4 A;  2FIE A;  2F97 A;  3O9P A;  4EQB A;  4OES A;  3GYY A;  2R8T A;  2XWI A;  3MW0 A;  1JVY A;  2QSX A;  2Q88 A;  3WAF A;  4PTK A;  3MJN A;  5IM2 A;  1FPI A;  4WED A;  1A54 A;  3BIG A;  1RDZ A;  3PPR A;  2P3V A;  4QFN A;  3M3L A;  1IXH A;  1A8F A;  3TOD A;  4GL8 A;  1FBC A;  1FPL A;  2CEX A;  3T93 B;  1P1Q A;  1H76 A;  2O69 A;  3U94 A;  2Y7W A;  3SEW A;  3SZP A;  4DIG A;  2OK2 A;  1I6Q A;  1XT8 A;  1MXX A;  2DWA A;  1FW0 A;  4ZEI A;  3O6G A;  3PV0 E;  2MKZ A;  2FVZ A;  4YMA A;  3VE1 B;  4K3F A;  4JVC A;  5AA4 B;  1IME A;  3VVD A;  4THI A;  1Y3N A;  2RC9 A;  4F3B A;  1P99 A;  2D3I A;  1II5 A;  3KN7 A;  1MXV A;  1B40 A;  4LON B;  4KYD A;  4ZEK A;  1I69 A;  1SI0 A;  3TTK A;  5DEX B;  2THI A;  1POY 1;  2ZZW A;  5JTY A;  2KQZ A;  2PT2 A;  3ISP A;  1EYK A;  1MPC A;  5CMB A;  4DXU A;  1VFE A;  4NX1 A;  1URD A;  4GWO A;  2Y7P A;  4AB5 A;  5KDT A;  4OEN A;  2VOZ A;  1NNT A;  3HO7 A;  3E9X A;  5ET6 A;  2V93 A;  2DSF A;  1MPD A;  2VPN A;  4C0R A;  2XHD A;  4HXV A;  1USY H;  5DVJ A;  4PFY A;  2B3B A;  3MVX A;  4PFR A;  1GR2 A;  1LB8 A;  4P11 A;  4MNP A;  4DCY A;  1FPK A;  4UAC A;  4X04 A;  3K6X A;  3CR9 A;  4PF8 A;  3I5O A;  2DOJ A;  4KXP A;  3B6W A;  1FPG A;  5H8F B;  4F2O A;  1DMB A;  4N81 A;  1QW0 A;  3BIH A;  1Z7N E;  2I48 A;  2FHY A;  3K01 A;  1LBV A;  3RTW B;  4QFO A;  4ZEF A;  3R26 A;  3TTL A;  1ZTY A;  4OVQ A;  4X1D A;  3FJM A;  1DBZ A;  2Y7I A;  4H65 A;  2VD2 A;  3QXM A;  2OLB A;  4DE8 A;  3OO6 A;  3PPP A;  5I2N B;  3TQL A;  3FIR A;  1B7U A;  1NH8 A;  2Q74 A;  4NF4 A;  4HE1 A;  2JJK A;  5CM6 A;  5EQ9 A;  2Q8M A;  4MLV A;  2Q2A A;  3O6I A;  4JSD A;  1SQY A;  3QAX A;  4GWU A;  1B7Z A;  1N3X A;  4YB6 A;  3CRB A;  3O28 A;  1HSE A;  1NV5 A;  1USY E;  1FTK A;  4TLM B;  3S9N C;  4WXJ A;  1FPJ A;  2Q89 A;  3MST A;  3K00 A;  1EU8 A;  4YB5 A;  5EYF A;  4PP0 A;  2BJJ X;  4XFE A;  4P1L A;  2R9J A;  3IFC A;  5IZ1 A;  1P1O A;  1ZIU A;  3KGC A;  4X9T A;  1A55 A;  3LV0 A;  5CBS A;  1WDN A;  2WYP A;  1IZ1 A;  1JW4 A;  5F7V A;  4PFT A;  2GFE A;  3IO4 A;  1MXY A;  2F3B A;  3C34 A;  4KFQ A;  3C33 A;  3KN8 A;  4OZ9 A;  3T9U A;  2B65 A;  1NMU A;  5CRY A;  2PFY A;  4PF6 A;  4EDP A;  3E3K A;  2R6G E;  3S9M C;  2F36 A;  1L5T A;  3RQT A;  4Q30 B;  2P3N A;  3FBP A;  4EQ9 A;  4G68 A;  1G0H A;  3OSR A;  3MP8 A;  4JXI A;  1B4H A;  5I59 B;  4IY5 A;  4F1V A;  2H99 A;  2ABH A;  4OFO A;  4IY6 A;  2WBD A;  4U2R A;  3PTY A;  1UIV A;  4PET A;  3CG1 A;  2D5W A;  2QMW A;  3OOA A;  4LZ7 A;  1SDX A;  2RC7 A;  4RPO A;  2XWK A;  2Q9T A;  2F3D A;  4P8B A;  1B3H A;  3B8B A;  2DYX A;  2DVC A;  3ZS6 A;  4OEV A;  5K2X A;  1BTJ A;  2WBB A;  1IMF A;  2Q8J A;  3TTN A;  5TP9 B;  1N0T A;  1FBF A;  1MH4 A;  1YYZ A;  4ZE8 A;  3G3I A;  1QUL A;  4LQ5 A;  3KSX A;  3FVO A;  1T0K A;  3KFM A;  1SVX B;  1IMD A;  2DE4 A;  3PMV A;  4NF6 A;  1PDA A;  1QGX A;  3S2V A;  2Z23 A;  1FTL A;  1AH5 A;  2R71 A;  4YU0 A;  5EYG A;  3MZB A;  3K1P A;  4DXB A;  3FJ7 A;  2XXQ A;  3MVY A;  4RJZ A;  2QS3 A;  2H9B A;  1SW2 A;  1I6B A;  2B3F A;  4OAN A;  1LBW A;  3LC8 A;  3N6U A;  5ELV A;  1PB7 A;  4KD5 A;  3PUX E;  4F18 A;  2OX3 A;  3S9E A;  1B1X A;  3FVG A;  1OVB A;  4ZEB A;  1LCT A;  3LUZ A;  4I8C A;  5JTY B;  1RDY A;  3NOH A;  3OEK A;  3A29 A;  3R6U A;  1LBY A;  1DPE A;  2HHM A;  2NXO A;  1B0L A;  3M8U A;  1Y20 A;  3MYU A;  1KWH A;  2CZH A;  3TAJ A;  2E0S A;  4LZ8 A;  1IMB A;  2I4C A;  4PFU A;  2I4B A;  3Q28 A;  4P0G A;  2HZL A;  4WKM A;  5KDT B;  3HHF A;  4NWC A;  1DOT A;  3Q27 A;  4KYS A;  3MZ9 A;  5FTH A;  2XXP A;  3KC1 A;  4G8N A;  4XXU A;  4FJP A;  2HFB A;  3H3G A;  1ZKB A;  3ZSF A;  4H5F A;  1AWB A;  1Y1Z A;  4QXD A;  5I3S A;  5F1Q A;  3ZKL A;  3T22 A;  3G7W A;  4YMB A;  3GLB A;  4OVP A;  5DVF A;  3E79 A;  3OD7 A;  2ZYK A;  1H45 A;  4G61 A;  5FHO A;  2RF1 A;  4RA1 A;  2DXR A;  1UTB B;  2UVH A;  4IO7 A;  5CMC A;  1ZJL A;  1UTH A;  2QVU A;  3P7I A;  3H4Z A;  5H8H A;  4LZ5 A;  4F29 A;  1B32 A;  4GF8 A;  1H44 A;  4OWD A;  1IUD A;  5H8S A;  2ZNT A;  2DDK A;  3T1B A;  3KSJ A;  3SEU A;  1MRP A;  2ZYO A;  3V89 B;  2AIX A;  4HCY A;  4O3A A;  4KR5 A;  5AA1 A;  2Z22 A;  4BDN A;  4GXA A;  4FE8 A;  4H67 A;  4ELR A;  1OMP A;  2CEY A;  4G8M A;  4DLD A;  1BKA A;  2PYY A;  4NF4 B;  1CE2 A;  3OEN A;  4EUO A;  1NNP A;  2CZK A;  1LAG E;  4NF0 A;  2QL3 A;  4P1E A;  2XXR A;  3FXR A;  1K9Z A;  4HE2 A;  1EYJ A;  2F6P A;  2ESN A;  4R6H A;  3TCG A;  1MXZ A;  2ZZV A;  2P2A A;  4LP2 B;  4NGU A;  4NF8 B;  4GWY A;  1NV7 A;  5K2Y A;  4U4S A;  3I6V A;  1M5C A;  3UGW A;  4EXK A;  1NUX A;  1FQB A;  1FTA A;  2BJI A;  3VLW A;  1NV6 A;  4TOZ A;  2XXU A;  4F1U A;  1IMA A;  1PEB A;  3UOR A;  1FTO A;  1O64 A;  3MPK A;  4H1X A;  2QVR A;  2HXR A;  1B46 A;  2ONS A;  3R7X A;  4DI3 D;  4N6K A;  4P9K A;  3TCH A;  4HE0 A;  1VR5 A;  4XKP A;  1B7H A;  3ODB A;  2PCR A;  3MBP A;  2DWJ A;  4IO5 A;  4IO3 A;  2I49 A;  1JET A;  4G68 B;  4ELO A;  3N6T A;  4MIJ A;  2DVZ A;  3LUY A;  4MLQ A;  5CI5 A;  3S9L C;  4GWZ A;  4YKI A;  4ECF A;  4KYE A;  4Z7E A;  1MG1 A;  1OQH A;  4Q0C A;  3VFJ A;  2VGQ A;  2GH9 A;  4M1V A;  4PDD A;  4F3G A;  4PE3 A;  5I57 B;  4NHB A;  3PUY E;  1FQE A;  1A8E A;  4OTE A;  4JVI A;  1SW5 A;  4N8Y A;  4HS7 A;  2ZYN A;  4H6D A;  1P1U A;  2ZMB A;  1B4Z A;  4NTL A;  3PMX A;  4KCD A;  5L9M A;  4NF5 B;  3U65 A;  1S50 A;  4ESW A;  3T96 B;  4PQJ A;  5HBC A;  4NAP A;  3T9H B;  3TQW A;  3KOS A;  3K02 A;  1MQG A;  4RYA A;  2E1S A;  3K0V A;  4H5G A;  5ICQ A;  5LTC A;  3FUZ A;  2A5T B;  4GWS A;  1INP A;  1OVT A;  2VD3 A;  1EZ9 A;  5A5X A;  4NF6 B;  2Y5L A;  4QRZ A;  1URG A;  4G68 C;  5AA2 A;  5EQ7 A;  1IIW A;  5FHM A;  2H25 A;  4XKR A;  3IFA A;  4P0I A;  4HTG A;  2XXW A;  1A40 A;  4PGN A;  3QK6 A;  5DTB A;  1Y9U A;  4XKN A;  1NV1 A;  2Y84 A;  1H3D A;  1HSJ A;  3N5L A;  1LAX A;  1Q9D A;  2IEE A;  5I58 A;  1EZP A;  5IAI A;  2PX1 A;  1D3K A;  2HPG A;  2QJE A;  1KA0 A;  3IOV A;  2CMO A;  4NWD A;  4PAF A;  2QFL A;  3IOR A;  3ZKK A;  3CSB A;  1DK4 A;  2O68 A;  4MFI A;  4RK9 A;  4I3Y A;  1FCK A;  1ELJ A;  1NNF A;  4POW A;  4O7I A;  3RUM A;  3K6V A;  4R74 A;  3O2A A;  4QSE A;  4FEB A;  1H43 A;  1NV4 A;  5I56 A;  3E4R A;  3B7D A;  5DT6 A;  3OO7 A;  1JP4 A;  1SW4 A;  4G8H A;  1QUK A;  5JK4 A;  3PPN A;  4X1B A;  1JW5 A;  1KZ8 A;  3MWB A;  3TEL A;  1NNK A;  4PCD A;  1S9T A;  3CFL A;  4PFW A;  3KZG A;  4GX4 A;  3VVF A;  4H8J A;  4LUB A;  5IZ3 A;  3SDF A;  4TLL B;  1B58 A;  2W7Y A;  5H8Q A;  1GVC A;  5KCJ B;  2ONR A;  3IK6 B;  3U92 A;  4LVQ A;  5BUU A;  2YJP A;  2XXT A;  1JNF A;  1UTH B;  3EHU A;  4OMB A;  2PMS A;  4LN5 A;  3ILU B;  1FPF A;  2F78 A;  3MZ1 A;  4N07 A;  1D9Y A;  1LBB A;  4BDQ A;  3MQ9 A;  3TEP A;  1FQA A;  3RT6 B;  2I0C A;  1WVJ A;  2NWJ A;  3GZG A;  2O1M A;  4DXC A;  1MM6 A;  1MY3 A;  1TT1 A;  1M5D A;  3BFT A;  2I0B A;  3EPE A;  4RNS A;  3IL1 B;  2REG A;  5EHM A;  1D9V A;  3RY3 A;  3VLV A;  1FTM A;  3M3F A;  3IOW A;  1D4N A;  4F31 B;  1LB9 A;  5IKB A;  5HPQ A;  3K1M A;  2VPO A;  1NV0 A;  1I6A A;  3FV1 A;  3LBS A;  3MUQ A;  4YIC A;  3CI8 A;  3FXB A;  3G3F A;  5ITO A;  3EF7 A;  4X8R A;  1FPE A;  4I3E A;  4PGP A;  4XEQ A;  2Y7R A;  2O51 A;  1FBH A;  3B50 A;  4GVO A;  1TWY A;  4U1Z A;  5DYH A;  2HQ0 A;  3ECR A;  2HAU A;  2L5V A;  3N94 A;  1FQD A;  3DP8 A;  1LAH E;  4NE4 A;  2XXX A;  3PD8 A;  2IA4 A;  3Q26 A;  3RTF B;  4I1D A;  3VVE A;  4F3P A;  3UN6 A;  3UA8 A;  3K4U A;  4DCX A;  1ZBM A;  2G93 A;  4KPT A;  4IO2 A;  4F19 A;  1MDP 1;  5AA2 D;  3PMW A;  3MVW A;  1R9L A;  5ET5 A;  2DE2 A;  3QSL A;  5CMK A;  4OVS A;  2B4L A;  3N26 A;  2Y7K A;  4IO6 A;  3V5A A;  2ZNS A;  1JEU A;  1FTJ A;  4E0W A;  2H98 A;  4JB7 A;  3QMF A;  3SEY A;  5DW8 A;  2F7C A;  4BLA A;  3BKI B;  4IO4 A;  1AOV A;  2RC8 A;  3CFZ A;  2F35 A;  4FIM A;  2CZL A;  3KN3 A;  3LR1 A;  5I2K A;  2CZI A;  2FNC A;  5DEX A;  1ANF A;  4GX3 A;  2I3W A;  2AYS A;  3BFU A;  1NFT A;  3OO8 A;  3MP1 A;  4FBP A;  3B6T A;  4QFP A;  4FEC A;  3KJ7 A;  1NKX A;  4C1T A;  1ATG A;  3C9H A;  1MY1 A;  2V3Q A;  4G77 A;  4GD5 A;  3RYD A;  3TTR A;  1OIB A;  1Y3Q A;  3T9X B;  4ISU A;  1Z7M E;  3K2D A;  1MH3 A;  1FPB A;  2GQ1 A;  4I40 A;  3K6W A;  1EYI A;  3FVN A;  3RGY A;  4R75 A;  2WYK A;  4E0X A;  1LGB C;  1SYI A;  2I3V A;  1Y1M A;  2AL5 A;  1DPP A;  4AS5 A;  1QKA A;  3A3U A;  3FZV A;  1FSA A;  4GL0 A;  1BP5 A;  3CVG A;  1HSL A;  4U22 A;  2XD3 A;  1LBZ A;  1F9B A;  3KBZ A;  3IX1 A;  4XTC Q;  4RPN A;  3C36 A;  5EQ8 A;  4GQO A;  1PC3 A;  4N15 A;  3IAZ A;  4QF9 A;  3GBB A;  3JZJ A;  3PGF A;  3G3K A;  4DDD A;  1MY2 A;  1YCJ A;  2G29 A;  4OVT A;  4MMP A;  3KJT A;  1XOC A;  2P1S A;  4HW8 A;  1BIY A;  1EH3 A;  2XWV A;  4MCO A;  3THI A;  1BK4 A;  4YKK A;  4RK2 A;  2Z8E A;  1RDX A;  1MS7 A;  5FHN A;  3U93 A;  4AS4 A;  1M5B A;  2DE3 A;  1XS5 A;  2F6G A;  4XKQ A;  5I2N A;  3IO6 A;  1B6H A;  5L8D A;  1DTG A;  3PPO A; 
#chains in the Genus database with same CATH homology
 4WEP A;  2Z8D A;  2XX9 A;  1IXG A;  1YTV A;  3C4M A;  3TZA A;  1LFG A;  3EQ1 A;  4ZED A;  5H8Q B;  2OZZ A;  3TYH A;  3U1O A;  3IB1 A;  3W9V A;  3HHG A;  4OFJ A;  2V25 A;  1P1N A;  2XXI A;  4R9G A;  1S7Y A;  4JWY A;  1PB9 A;  4OQO A;  5ISU A;  2DS9 A;  2HEU A;  4OET A;  4O3B A;  4F39 A;  3FXQ A;  3MP6 A;  4LQ2 A;  3QUF A;  3V8X B;  5BWJ A;  2UVI A;  1R1N A;  1MQD A;  1IQ7 A;  1Y3P A;  3AXF A;  2X7Q A;  2ZYM A;  1YPN A;  3HCQ A;  3WAE A;  1MQJ A;  2UVG A;  5ITP A;  5H8N A;  4GOT A;  4ZEC A;  4Q8R A;  2V3T A;  5M2V A;  4F1Y A;  4U23 A;  4OEU A;  4IB2 A;  4BDR A;  1B05 A;  4GRK A;  3OO9 A;  3MC2 A;  1M5F A;  1IEJ A;  4H0W A;  3D4G A;  2QRY A;  4I62 A;  1MPB A;  1A99 A;  3EHT A;  1IXC A;  2LAO A;  3KOT A;  2GHA A;  3TTM A;  3GBA A;  2VP1 A;  4ZZA A;  4BDO A;  5TPA A;  4FOR A;  1JQF A;  1Q1K A;  3BBR A;  4LAT A;  3T66 A;  2RIN A;  3OXN A;  2O7I A;  3O6H A;  3RT8 A;  3FJG A;  4AQ4 A;  5TP9 A;  1MQI A;  1B51 A;  3QIM A;  3CSG A;  3KBR A;  5FTI A;  3FAS A;  4L17 A;  3UP9 A;  1J1N A;  3RPW A;  3LSL A;  4M4G A;  1VFD A;  5CBR A;  2XX8 A;  3FXU A;  3E13 X;  4U4X A;  3C35 A;  4ELQ A;  2D21 A;  4OYV A;  4FAJ A;  2F8D A;  2X7P A;  4R73 A;  3SES A;  4F3S A;  4OFL A;  1RYO A;  1XVX A;  1QKB A;  1OQG A;  4QFL A;  3M3K A;  1B5J A;  1Y4C A;  4R2F A;  3PUV E;  1B9J A;  3MPL A;  2DXY A;  1DTZ A;  5I2K B;  1VSO A;  1P1W A;  4NMY A;  3RNN A;  1XC1 A;  3TUS A;  2KLF A;  3VXC A;  1N84 A;  4JBZ A;  3DP4 A;  4MBP A;  1GGG A;  3GXA A;  3U8Q A;  1JVX A;  5EHS A;  1GV8 A;  2GRV A;  3IB2 A;  3USD A;  4DZ1 A;  4ELP A;  5B7D A;  4OXV A;  2QPQ A;  4C1U A;  4ZDM A;  4X48 A;  1O7T A;  3IR1 A;  3T9V A;  4YB7 A;  1RYX A;  4H8I A;  2M8C A;  4KHZ E;  3PU5 A;  3SER A;  4BDM A;  3H6U A;  1LLS A;  5CMM A;  2NOO A;  3ILT B;  3JYR A;  3FVK A;  1FQC A;  3QYT A;  2O1L A;  3C32 A;  3H6V A;  2HXW A;  3O29 A;  3G3J A;  2V84 A;  4R72 A;  1UTB A;  5B70 A;  4Q5T A;  3L6G A;  1B3L A;  1OLA A;  4UA8 A;  2RCA A;  3LSF B;  4YZZ A;  2Q2C A;  3OEL A;  2UXA A;  3KEI A;  2OWT A;  3K6U A;  3FV2 A;  2UYF A;  2XX7 A;  2QMX A;  3K1N A;  3C31 A;  3UIF A;  1LBC A;  3H7M A;  4N13 A;  1AL3 A;  2I58 A;  3FGS A;  3D4C A;  5H8H B;  3UK4 A;  3SET A;  2QS2 A;  4I9D A;  3TPA A;  1QUI A;  1POT A;  2QS1 A;  3SEX A;  3EN3 A;  1B1H A;  1IXI A;  3TDJ A;  1TFA A;  4YKP A;  1SD3 A;  3H6T A;  1B5H A;  1TFD A;  3HN0 A;  3EHS A;  1EZO A;  3OSQ A;  1TXF A;  5JEI A;  3IJX B;  4EF1 A;  4NF8 A;  1IIT A;  2OJT A;  2ALU A;  2OBG A;  3DEL B;  3IB0 A;  2OCU A;  4QFK A;  1MXU A;  1SW1 A;  3IOU A;  4XIG Q;  2F7A A;  4U21 A;  3HPI A;  2WKY A;  4ZS9 A;  3SKP A;  1BLF A;  5DVI A;  3VLU A;  4GXS B;  2HAV A;  2ZNU A;  4OER A;  1MXW A;  3MAM A;  5HM4 B;  1B3E A;  2XD2 A;  4KQP A;  1N7X A;  1WOD A;  1PBP A;  3DP6 A;  3H06 B;  1YAE A;  5H8N B;  4MH5 A;  3OMB A;  3CG3 A;  1RKM A;  3MVZ A;  2UVJ A;  1PB8 A;  5ICT A;  3H03 A;  3IOT A;  4R6K A;  1ZLQ A;  3IJO B;  3QUJ A;  1JW1 A;  1LST A;  2RKM A;  2REJ A;  4QHQ A;  4QSD A;  3H6W A;  4LA9 A;  4OVJ A;  2FA7 A;  1OLC A;  1PBQ A;  5I57 A;  2OWS A;  4G4P A;  3VV5 A;  4POX A;  1UQW A;  1QUJ A;  2H4I A;  5KZT A;  3VXB A;  1US5 A;  4FED A;  2Z8F A;  4ND9 A;  5TPA B;  4IGT A;  4JDF A;  4JSO A;  3G3H A;  4NF5 A;  2HCA A;  4JWX A;  4F22 A;  5AA4 A;  2XXH A;  3A09 A;  1NH7 A;  1LAF E;  3B6Q A;  3LSX A;  2UYE A;  2F34 A;  3KG2 A;  4EXL A;  4R6Y A;  2A5T A;  4KCC A;  1MY4 A;  2DQV A;  4IGR A;  2P0S A;  4ESX A;  3TFL A;  5J1D A;  1B3G A;  3O66 A;  2YLN A;  1VE4 A;  4NED A;  3HST A;  4GLI A;  4FAT A;  2V3U A;  4OHN A;  4N6P A;  5A5X B;  2A5S A;  3PD9 A;  1ZU0 A;  2ZXT A;  3RLF E;  5AA2 B;  1O63 A;  1N04 A;  2HZK A;  5L9S A;  5I84 A;  1CB6 A;  3PPQ A;  3SEV A;  5TU0 A;  3DLN A;  4O3C A;  3F11 A;  2GHB A;  2FYI A;  1MQH A;  3L6H A;  1M5E A;  2O6A A;  4GIZ A;  1NL5 A;  2YPN A;  3VDF A;  3DM0 A;  5I58 B;  3TKD A;  2F7B A;  1A7L A;  5H8F A;  3CFX A;  5LOM A;  3G3G A;  4KI0 E;  1B0H A;  3Q25 A;  1B52 A;  3RN8 A;  2ONK E;  3TCF A;  3A3C A;  1N7W A;  1FQF A;  4EF2 A;  2O7U A;  3W15 C;  2PBW A;  2XXV A;  1AIV A;  4GFR A;  1SYH A;  4AB6 A;  5I56 B;  4ZZE A;  1XHY A;  4YKJ A;  1XVY A;  2X26 A;  4QSC A;  1B5I A;  4Z0I A;  3U72 A;  1SBP A;  3ONM A;  5KCJ A;  3TMG A;  2PVU A;  4MF3 A;  1AMF A;  3CIJ A;  3O97 A;  2I6E A;  2RCB A;  2AL4 A;  4PE5 B;  1JEV A;  2PT1 A;  2DP8 A;  4U1O A;  2XXY A;  3Q29 A;  4JWO A;  2NVU B;  4F2Q A;  4R9F A;  3OEM A;  1MY0 A;  3V83 A;  1B2H A;  2DWH A;  5AE4 A;  1QVS A;  1SI1 A;  1QJM A;  2NUV A;  4ONY A;  1MDQ A;  3PUW E;  5L9O A;  4R2B A;  2DWI A;  2VHA A;  1DSN A;  1LFI A;  1R9Q A;  1MM7 A;  1ZMG A;  2O84 X;  3W9W A;  5AA3 A;  3FD3 A;  2F5X A;  3HV1 A;  1LFH A;  1UIU A;  1URS A;  4ZE9 A;  2ANJ A;  4G2Z A;  3PUZ E;  4EQ7 A;  4RXL A;  4RY1 A;  4BDL A;  5I59 A;  3FAT A;  1N76 A;  1R6Z A;  5CC2 A;  3JV9 A;  4TQU Q;  4YAH X;  3S4U A;  1LCF A;  1N3W A;  1B3F A;  1Y4T A;  4HCW A;  1GTK A;  3I3V A;  1Q35 A;  2H5Y A;  1US4 A;  3LSW A;  2QS4 A;  2F97 A;  3O9P A;  4EQB A;  4OES A;  3MW0 A;  1JVY A;  2QSX A;  2Q88 A;  3WAF A;  3MJN A;  4WED A;  1A54 A;  3PPR A;  4QFN A;  3M3L A;  1IXH A;  1A8F A;  3TOD A;  4GL8 A;  3T93 B;  1P1Q A;  1H76 A;  2O69 A;  3U94 A;  2Y7W A;  3SEW A;  4DIG A;  2OK2 A;  1I6Q A;  1XT8 A;  1MXX A;  2DWA A;  1FW0 A;  4ZEI A;  3O6G A;  3PV0 E;  4YMA A;  3VE1 B;  4K3F A;  5AA4 B;  3VVD A;  4THI A;  1Y3N A;  2RC9 A;  4F3B A;  1P99 A;  2D3I A;  1II5 A;  3KN7 A;  1MXV A;  1B40 A;  4LON B;  4KYD A;  4ZEK A;  1I69 A;  1SI0 A;  3TTK A;  5DEX B;  2THI A;  1POY 1;  5JTY A;  2PT2 A;  1MPC A;  5CMB A;  4DXU A;  1VFE A;  1URD A;  4GWO A;  2Y7P A;  4AB5 A;  5KDT A;  4OEN A;  2VOZ A;  1NNT A;  3HO7 A;  3E9X A;  2V93 A;  2DSF A;  1MPD A;  4C0R A;  2XHD A;  1USY H;  5DVJ A;  4PFY A;  2B3B A;  3MVX A;  1GR2 A;  1LB8 A;  4P11 A;  4DCY A;  4UAC A;  3K6X A;  3CR9 A;  3I5O A;  2DOJ A;  3B6W A;  5H8F B;  4F2O A;  1DMB A;  1QW0 A;  1Z7N E;  2I48 A;  3K01 A;  3RTW B;  4QFO A;  4ZEF A;  3R26 A;  3TTL A;  1ZTY A;  4X1D A;  3FJM A;  2Y7I A;  4H65 A;  2VD2 A;  3QXM A;  2OLB A;  4DE8 A;  3OO6 A;  3PPP A;  5I2N B;  3TQL A;  3FIR A;  1B7U A;  1NH8 A;  4NF4 A;  5CM6 A;  4MLV A;  2Q2A A;  3O6I A;  4JSD A;  1SQY A;  3QAX A;  1B7Z A;  1N3X A;  4YB6 A;  3CRB A;  3O28 A;  1HSE A;  1USY E;  1FTK A;  4TLM B;  3S9N C;  4WXJ A;  2Q89 A;  3K00 A;  1EU8 A;  4YB5 A;  5EYF A;  4PP0 A;  2BJJ X;  2R9J A;  1P1O A;  1ZIU A;  3KGC A;  4X9T A;  1A55 A;  5CBS A;  1WDN A;  1IZ1 A;  1JW4 A;  5F7V A;  4PFT A;  2GFE A;  3IO4 A;  1MXY A;  3C34 A;  4KFQ A;  3C33 A;  3KN8 A;  4OZ9 A;  3T9U A;  2B65 A;  1NMU A;  5CRY A;  4EDP A;  3E3K A;  2R6G E;  3S9M C;  2F36 A;  1L5T A;  3RQT A;  4Q30 B;  4EQ9 A;  4G68 A;  3OSR A;  3MP8 A;  4JXI A;  1B4H A;  5I59 B;  4IY5 A;  4F1V A;  2H99 A;  2ABH A;  4OFO A;  4IY6 A;  4U2R A;  1UIV A;  4PET A;  3CG1 A;  2D5W A;  2QMW A;  3OOA A;  4LZ7 A;  1SDX A;  2RC7 A;  4RPO A;  2Q9T A;  1B3H A;  2DYX A;  2DVC A;  3ZS6 A;  4OEV A;  5K2X A;  1BTJ A;  2Q8J A;  3TTN A;  5TP9 B;  1N0T A;  1MH4 A;  4ZE8 A;  3G3I A;  1QUL A;  4LQ5 A;  3KSX A;  3FVO A;  1T0K A;  3KFM A;  1SVX B;  2DE4 A;  3PMV A;  4NF6 A;  1PDA A;  3S2V A;  2Z23 A;  1FTL A;  1AH5 A;  2R71 A;  4YU0 A;  3MZB A;  3K1P A;  4DXB A;  3FJ7 A;  2XXQ A;  3MVY A;  4RJZ A;  2QS3 A;  2H9B A;  1SW2 A;  1I6B A;  2B3F A;  3LC8 A;  3N6U A;  5ELV A;  1PB7 A;  4KD5 A;  3PUX E;  4F18 A;  3S9E A;  1B1X A;  3FVG A;  1OVB A;  4ZEB A;  1LCT A;  4I8C A;  5JTY B;  3OEK A;  3R6U A;  1DPE A;  2NXO A;  1B0L A;  3M8U A;  1Y20 A;  1KWH A;  3TAJ A;  2E0S A;  4LZ8 A;  2I4C A;  4PFU A;  2I4B A;  3Q28 A;  4P0G A;  2HZL A;  4WKM A;  5KDT B;  3HHF A;  4NWC A;  1DOT A;  3Q27 A;  4KYS A;  3MZ9 A;  5FTH A;  2XXP A;  4G8N A;  4XXU A;  4FJP A;  2HFB A;  3H3G A;  1ZKB A;  3ZSF A;  4H5F A;  1Y1Z A;  5F1Q A;  3ZKL A;  3T22 A;  3G7W A;  4YMB A;  3GLB A;  5DVF A;  3OD7 A;  2ZYK A;  1H45 A;  5FHO A;  2RF1 A;  4RA1 A;  2DXR A;  1UTB B;  2UVH A;  4IO7 A;  5CMC A;  1ZJL A;  1UTH A;  3P7I A;  3H4Z A;  5H8H A;  4LZ5 A;  4F29 A;  1B32 A;  4GF8 A;  1H44 A;  4OWD A;  1IUD A;  5H8S A;  2ZNT A;  3KSJ A;  3SEU A;  1MRP A;  2ZYO A;  3V89 B;  2AIX A;  4HCY A;  4O3A A;  4KR5 A;  5AA1 A;  2Z22 A;  4BDN A;  4GXA A;  4FE8 A;  4H67 A;  4ELR A;  1OMP A;  4G8M A;  4DLD A;  1BKA A;  2PYY A;  4NF4 B;  1CE2 A;  3OEN A;  4EUO A;  1NNP A;  1LAG E;  2QL3 A;  2XXR A;  3FXR A;  2F6P A;  2ESN A;  4R6H A;  3TCG A;  1MXZ A;  2P2A A;  4LP2 B;  4NF8 B;  5K2Y A;  4U4S A;  3I6V A;  1M5C A;  3UGW A;  4EXK A;  1FQB A;  3VLW A;  4TOZ A;  2XXU A;  4F1U A;  1PEB A;  3UOR A;  1FTO A;  1O64 A;  3MPK A;  4H1X A;  1B46 A;  2ONS A;  3R7X A;  3TCH A;  1VR5 A;  4XKP A;  1B7H A;  3ODB A;  3MBP A;  2DWJ A;  4IO5 A;  4IO3 A;  2I49 A;  1JET A;  4G68 B;  4ELO A;  3N6T A;  2DVZ A;  3LUY A;  4MLQ A;  5CI5 A;  3S9L C;  4YKI A;  4ECF A;  4KYE A;  4Z7E A;  1MG1 A;  3VFJ A;  1OQH A;  4Q0C A;  2VGQ A;  2GH9 A;  4M1V A;  4F3G A;  5I57 B;  3PUY E;  1FQE A;  1A8E A;  4OTE A;  1SW5 A;  4HS7 A;  2ZYN A;  4H6D A;  1P1U A;  2ZMB A;  1B4Z A;  4NTL A;  3PMX A;  4KCD A;  5L9M A;  4NF5 B;  1S50 A;  4ESW A;  3T96 B;  4PQJ A;  5HBC A;  3T9H B;  3TQW A;  3KOS A;  3K02 A;  1MQG A;  4RYA A;  2E1S A;  3K0V A;  4H5G A;  5ICQ A;  3FUZ A;  2A5T B;  1OVT A;  2VD3 A;  1EZ9 A;  5A5X A;  4NF6 B;  4QRZ A;  1URG A;  4G68 C;  5AA2 A;  1IIW A;  5FHM A;  2H25 A;  4XKR A;  4P0I A;  4HTG A;  2XXW A;  1A40 A;  3QK6 A;  5DTB A;  1Y9U A;  4XKN A;  2Y84 A;  1H3D A;  1HSJ A;  3N5L A;  1LAX A;  2IEE A;  5I58 A;  1EZP A;  5IAI A;  2PX1 A;  1D3K A;  2QJE A;  3IOV A;  2CMO A;  4NWD A;  3IOR A;  3ZKK A;  3CSB A;  2O68 A;  4MFI A;  4RK9 A;  1FCK A;  1ELJ A;  1NNF A;  4POW A;  3RUM A;  3K6V A;  4R74 A;  3O2A A;  4QSE A;  4FEB A;  1H43 A;  5I56 A;  3E4R A;  3B7D A;  5DT6 A;  3OO7 A;  1SW4 A;  4G8H A;  1QUK A;  5JK4 A;  3PPN A;  4X1B A;  1JW5 A;  3MWB A;  3TEL A;  1NNK A;  4PFW A;  1S9T A;  3CFL A;  3KZG A;  3VVF A;  4H8J A;  4LUB A;  3SDF A;  4TLL B;  1B58 A;  2W7Y A;  5H8Q A;  1GVC A;  5KCJ B;  2ONR A;  3IK6 B;  3U92 A;  4LVQ A;  5BUU A;  2YJP A;  2XXT A;  1JNF A;  1UTH B;  3EHU A;  4OMB A;  2PMS A;  3ILU B;  2F78 A;  3MZ1 A;  4N07 A;  1D9Y A;  1LBB A;  4BDQ A;  3MQ9 A;  3TEP A;  1FQA A;  3RT6 B;  2I0C A;  1WVJ A;  2NWJ A;  3GZG A;  2O1M A;  4DXC A;  1MM6 A;  1MY3 A;  1TT1 A;  1M5D A;  3BFT A;  2I0B A;  3EPE A;  4RNS A;  3IL1 B;  2REG A;  5EHM A;  1D9V A;  3RY3 A;  3VLV A;  1FTM A;  3M3F A;  3IOW A;  1D4N A;  4F31 B;  1LB9 A;  5IKB A;  5HPQ A;  3K1M A;  1I6A A;  3FV1 A;  3LBS A;  3MUQ A;  4YIC A;  3CI8 A;  3G3F A;  5ITO A;  3EF7 A;  2Y7R A;  2O51 A;  4GVO A;  1TWY A;  4U1Z A;  5DYH A;  2HQ0 A;  3ECR A;  2HAU A;  3N94 A;  1FQD A;  3DP8 A;  1LAH E;  4NE4 A;  2XXX A;  3PD8 A;  2IA4 A;  3Q26 A;  3RTF B;  4I1D A;  3VVE A;  4F3P A;  3UN6 A;  3UA8 A;  3K4U A;  4DCX A;  1ZBM A;  2G93 A;  4KPT A;  4IO2 A;  4F19 A;  1MDP 1;  5AA2 D;  3PMW A;  3MVW A;  1R9L A;  2DE2 A;  3QSL A;  5CMK A;  3N26 A;  2Y7K A;  4IO6 A;  3V5A A;  2ZNS A;  1JEU A;  1FTJ A;  4E0W A;  2H98 A;  4JB7 A;  3SEY A;  2F7C A;  4BLA A;  3BKI B;  4IO4 A;  1AOV A;  2RC8 A;  3CFZ A;  2F35 A;  4FIM A;  2CZL A;  3KN3 A;  3LR1 A;  5I2K A;  2FNC A;  5DEX A;  1ANF A;  2I3W A;  3BFU A;  2AYS A;  1NFT A;  3OO8 A;  3MP1 A;  3B6T A;  4QFP A;  4FEC A;  3KJ7 A;  1NKX A;  4C1T A;  1ATG A;  3C9H A;  1MY1 A;  2V3Q A;  4G77 A;  4GD5 A;  3TTR A;  1OIB A;  1Y3Q A;  3T9X B;  4ISU A;  1Z7M E;  3K2D A;  1MH3 A;  3K6W A;  3FVN A;  3RGY A;  4R75 A;  4E0X A;  1LGB C;  1SYI A;  2I3V A;  1Y1M A;  2AL5 A;  1DPP A;  1QKA A;  3A3U A;  3FZV A;  4GL0 A;  1BP5 A;  3CVG A;  1HSL A;  4U22 A;  2XD3 A;  1F9B A;  3IX1 A;  4XTC Q;  4RPN A;  3C36 A;  4GQO A;  1PC3 A;  3IAZ A;  4QF9 A;  3GBB A;  3JZJ A;  3PGF A;  3G3K A;  4DDD A;  1MY2 A;  1YCJ A;  2G29 A;  3KJT A;  1XOC A;  2P1S A;  4HW8 A;  1BIY A;  1EH3 A;  3THI A;  4YKK A;  4RK2 A;  2Z8E A;  1MS7 A;  5FHN A;  3U93 A;  1M5B A;  2DE3 A;  1XS5 A;  2F6G A;  4XKQ A;  5I2N A;  3IO6 A;  1B6H A;  5L8D A;  1DTG A;  3PPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...