4H20L

Crystal structure and computational modeling of the fab fragment from the protective anti-ricin monoclonal antibody rac18
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
DIVMTQSHKFMSTSVGDRVSITCKASQDVTSAVAWFQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYGTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Light chain of Fab Fragment from the anti-Ricin Monoclonal
publication title Crystal structure and computational modeling of the fab fragment from a protective anti-ricin monoclonal antibody.
pubmed doi rcsb
total genus 49
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2012-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20L01
1FVDA 2ICWJ 5KSUA 3D85A 4JR9H 3LKOA 5DUMH 4MVBD 5EWIL 1E6JL 3Q1SH 1ES0B 2X4TA 2Z93B 4TQEL 4U6HB 4GUPB 4IDLA 2A9NH 1CLOH 4JFFA 2CLVB 5BV7H 5EIIA 4IBLT 1BJ1J 3UJTH 3QUML 5MHSE 1G7HB 4WRLA 4HCRH 5T3ZE 3MREA 3GMOB 1F3JA 2X44D 2ATPB 5D2LB 2F5BH 4XNUL 5D2NE 2ZCLH 4WGVB 2DS4A 1EH9A 4RAVB 3L7FB 2WW8A 1K4DA 3ARQA 4F15B 4JPWL 4ZUSB 4NFBA 2VOTA 1EHLL 3WO4C 5GSVB 3O8XA 4I0PA 5IGXH 4BFGA 4MLIA 4HKZB 1ODAA 3BIBX 4NZDA 1BQHG 4XAKE 5T1KD 3RA7L 2AJUH 3CSGA 3QA3A 1OTUD 4ENEC 4PRPE 4WWKC 4H5SB 3OKMB 1QBMH 1JE6A 3P4LA 1ETZA 4XP1H 1K4CB 1BIIB 1BBDH 2CLZA 3SJVD 3GMRA 4JFDE 4WNQB 2V7NA 5J11C 1UCBH 4FZ8L 3X14A 1MHPL 1KB5L 3VGFA 4N1CA 1N59B 2YXFA 5EC1A 1XZ0A 4HT1L 3F58H 3TZVB 2QHLA 3BD4A 1MJ7L 4QHMB 2W65B 4LCWA 2JJUA 5DHVB 4BK4A 4G5ZL 4F7CA 3FRUB 4BSVB 2KZ1B 1Q9LA 4XCCL 3EOTL 1P7QA 4DUVA 4ODVL 2ITCA 5HHVH 3S4SG 4EDWH 4K7PY 1AXSA 2BVOB 2NY7L 5GHWL 4JRYA 1HNFA 3AGVA 1DUZA 3WNLA 1B6DA 2A83B 4HIEA 2OMBA 3WUWG 1SY6H 1ZLUK 1YMHA 1W8OA 3NOIA 1JFQH 3D39E 5FFLA 1OD7A 1IAMA 3MR9A 4PGZA 3A67H 1FNEB 4JFYB 1RUKH 4DAGH 1IZKA 5B38A 4ORGB 1T03H 4M5ZH 4LAQL 4HG4K 4LGSB 4KQ3H 3P4MA 3H3KA 3EO1B 4OZFH 4YO0A 4JFHE 4UTBH 3WHXA 3FN0H 2G2RA 4MYWB 3FFCA 4WEMB 1BJ1H 2X2YA 5C08D 1KXVC 4KQ4L 4PG2C 1YEGL 4ZFFA 12E8H 1OAQL 2UY6A 4JZJB 4G7YH 2BZDA 4P4KC 4OLEA 1JNJA 4YHLL 3QUXB 3QUZB 3G6JF 4OLYH 1W72L 1GCFA 1JYVA 3HMWL 1QBLL 3SJVE 2ZUUA 3ZKXC 2J8UB 3UTSB 5CEYB 4DN3L 1CGWA 5GRXG 5D7IA 5EOCJ 5EU6B 3QCVL 3D18B 1GGIL 4TTDD 3HHRB 4N8VA 2D0FA 5MEPB 4PB9L 4PB0H 5IHZB 1UACH 4MCYA 4FZEL 4MAYB 1YJDH 3TH3T 3TIDB 4X6CE 2DQDL 4IMKC 2VQTA 3MNVA 3LEXB 5D72H 4OGYL 2NXZC 5E1AB 3SKNB 3SY0A 4GRWF 5HYSA 1T22B 2E27H 1UWXH 4Z5RA 5HI5C 2AQ2A 5MEQA 2E6JA 3O45B 1XR9B 2IQAB 4IRSA 3SOBL 1FCCA 3E6HA 4M6ML 4CGTA 5IMLA 3HE6D 1K9TA 4ELME 2G9HA 2P44B 1G7LB 1HH9A 1KLGB 1U8PA 5CSZB 3IJHB 3D3VA 3PABB 1AP2A 5BO1H 1NCUA 2NR6C 2ARWA 4W4OC 1JI2A 3I75B 1HOCB 5T1KA 3STZA 5ILTH 3BKMH 1UZ8B 2UYLA 5INDA 1VCAA 2X1PA 3D2UD 3BQUD 4UOJA 1ZT1A 3HNVL 3IXAA 3JUZA 1PG7L 5HHME 3FL7A 1SVZA 5HDQH 2XXCB 4EDXB 5IP4A 1RAMA 3SGJA 2JE8A 4NRZB 2H9GB 3SKOA 1IEBB 3AB0C 5IB5B 4LHJB 2FR4B 3BKYH 5DO2C 5T5FH 3WS3B 4PY8I 3MGTA 2C4FT 5L2KB 4OZIE 3UO1L 2X4PA 2X4SA 4MQ7A 4Q9QL 4PJEA 1FVCA 1S7VA 4NBZB 3VE0B 4LOUC 2ZUQC 4L8DB 1J0JA 2CPCA 5DT1L 4JN2B 3PGCA 3W0WB 4LHUD 1MCEA 1HKLL 4U6VH 4S10A 1U42A 43CAB 4OAWB 4RMTA 4PR5A 3DYPA 3VD3A 3CMGA 4XCFL 3MRIA 1CIDA 1A2YB 1E6OH 3L5XH 3WNOA 3CFJA 4BKLA 4BJLA 5C0AE 2AEPH 2EECA 4GH7B 4LLYA 5C0JA 1JPGA 2EC8A 3OL2A 2ADIB 1P4BL 1NC4D 3F62A 5E2UH 3DMMC 5GQBA 2R0WL 2JIXB 2AJZB 1F58L 2OJEA 1KACB 3IJYA 4MZ3A 4HZLA 4XXCC 2XNAB 2EDNA 2BNQB 3QHZL 1FZKA 3SDAB 1LVEA 3AS1A 4WJ5B 4TNWK 2A6DB 3KVQA 3Q5YA 3FO0L 4HS6B 3NZ8B 2YPLD 3VGEA 5C6PB 1NGYB 5HPOA 3FRPG 2UUDK 3U0TA 4Y1AB 2VDOH 3RGVC 1YEHH 2ZOKA 3C6LB 4FQJL 1GSMA 4I8DA 2XN9A 1H0DA 4OT1H 3LKSB 5F9JA 5C08A 3V4VL 1T7XA 4MNHB 1CFNA 1UENA 1L0YA 3QEGL 1PX4A 5E7FA 3HMXA 2DLTA 4PUBL 1KEML 2NY1B 3LN4A 2VSCA 1EHLH 3LN5A 2WP3T 4L8SB 1BGXL 1CL7I 4JN1H 2H32A 3K4ZA 2PTTB 4BZ2H 3RIFF 3ESUF 3PDDA 5AYUL 4F2MA 2CXGA 2EYSB 3RA7H 3D69B 1CQKA 3QXUA 1FH5L 1X5GA 4L3CB 4GKZB 5EUKA 3Q3GB 3MYZA 4NKDA 5F97E 4CAGA 4HGWA 3V0VA 3LHPL 1K2DA 4PG9A 2A6KA 4WY7L 3QDJD 5C09E 1KCKA 3L95A 4FZ8H 1W0VA 4U1SA 4X9IA 4JDVA 2F8XC 3MLYL 4OD1H 4JFED 3MA9H 2W0FB 5DQDH 4EVNA 1X3DA 5JR1L 4RGND 2H2SD 3AY4C 1MJ7H 1HHKB 1NQBA 1WBXA 4UDUA 3KPSE 1SBSL 3TBSA 5DJXA 3AM8C 5HVFB 2Y6SC 1JGVL 4LPWA 1CDGA 4LGPB 3PWPD 4HMDA 3FHAA 3DECA 4ODVH 3UTQA 1FSKC 1NFDA 2XA3A 4JKKA 5I1EL 1A1MA 3Q6GH 3QI9C 1FG2B 5F1NB 3U0WH 3QISA 3QJHB 4LARH 1MWAB 2NY6C 4MD5B 5C6TL 5I1AB 1IGJB 3PHQB 4RGMC 5ICXA 3KYAA 1NAML 1FNGA 3CLEH 4WFFD 5INCB 2F53B 4LLDB 3MRKB 5DS8B 4U7KA 3RZCD 4BSWB 1WLHA 4LRIA 1NKOA 4F7MA 4PP1C 2I24N 3VFUB 4Q2ZA 3IS0X 1GGYA 2R0KH 5IEHB 1WJ3A 1EUUA 3K46A 1XGUB 3S35L 4KQ4H 3MRCB 4GMSH 4MQTB 4XX1G 3U7AA 2X40A 5JUEL 4L1DA 4KXZH 3KS0J 5FO7B 3L3OB 5DD1H 3A0OA 1VFBA 3QAZC 4Y2DB 3MV8A 4A2LA 4HGMA 1QLFB 1A6AA 5IB3B 1MIEH 3NACL 2VXUH 4LMQI 2GJZB 1QBLH 2AVGA 3RHWF 5LXGL 2NXYD 1IGTB 4S2SB 4X4XA 3QDGB 3Q2CA 3IDIB 4K3JH 5BZWA 1F4HA 1WEJH 4JG1H 4OB5H 4PFEA 3MYJA 2OMNA 1QG3A 3U2SA 5F21B 2Y25A 2A74B 5BRZA 1LO4L 4KVNL 2BNRB 1FVDB 1OWRM 5KSUB 3D85B 3LKOB 4YPJA 1Z5LA 3MLVH 2BSSA 2FEEI 3SKMA 2R4RL 4FZEH 2X4TB 5FCUL 2NY2D 2A0LC 5KW9L 4JFFB 1WK0A 3OQ3B 4MHHI 1A7NL 3ARPA 4YBLB 4XMKH 1T7VA 4K3EL 5IUSA 3HZMA 2DQDH 4WEUD 4I48A 3MREB 1RZFH 5E2TL 5D1XD 3QBTB 2YPLA 5TQ0H 2WP3O 5E8OA 1S5HB 5EU4A 3N1PC 1TETH 2WQRA 4M62L 1T80A 2EDOA 4KK5C 4UQ3A 3AFLA 3KLAA 4I0PB 3H6JA 3VA2C 2OI9B 4OQTL 4QWWD 1CL7L 1B90A 4M6MH 2N4IA 3H9HB 1CLCA 3QA3B 2VISA 5CEXA 3FFDA 4XVTL 3ABZA 4KVCL 1ETZB 5CZVL 2YZ8A 4ISVA 3EJYD 4ALAL 3ARYA 2CLZB 2EEDA 3TT1H 5L8LB 4QF1A 3X14B 4YBQC 4QXTA 1Q0YH 3B5TA 5FM4A 1OAZH 4RA0C 3SQOH 1PG7H 1T1YA 3T2NL 5EC1B 2EH8H 4AENA 1XZ0B 4JFZL 4YEEA 1G7QA 3GKZA 4E41A 3QDJA 5HGAB 3QEQE 3RJDA 4LCWB 3H9ZA 1HQ4A 4F7CB 1KJ2L 3QUMA 2HFFA 4JFEA 1N0XL 2Q6WA 1UJ3A 1Q9LB 4LCIH 4MQXC 1I1FB 3ARBD 3ZDXF 1P7QB 2FWOA 4I18A 2ITCB 3V52L 1S7WA 1AXSB 2JCCA 2RB8A 3RPKA 1F2QA 5D93B 1Q38A 5GGVH 5ACZA 4R2GB 2BCKB 3GSNL 3ILQC 4RFOL 3C60A 4JRYB 5EZLA 4BZYA 4P48A 2AK4D 2YSSA 1DUZB 1HKLH 3PWPA 4HIEB 4MXWL 2NMSA 3NIFF 4G9FE 1AR1C 1XMWA 3MR9B 5C0EA 3QDHA 1IJ9A 1KN4L 5B38B 3B4NA 1R3KA 1OGAE 3CH8A 5T1LB 5DD0L 3TVMA 4XVUD 4M7ZB 5FYKL 4YO0B 2GSGA 2R0WH 5FF6B 4EXKA 3WHXB 1S78C 2RHEA 2VMFA 3UP1A 3LMJL 3DXAE 1GXEA 2G2RB 4RNRA 3FFCB 1KB5A 2DWEA 1QYGH 4NWUH 4ZFFB 4PY8J 4BUGA 2ADGA 3UJIL 4PJDE 4ZUVA 1IC7H 1A3QA 5EOQL 4WI9A 2VLRD 4Y16C 3MV9D 2J4WH 4OM1H 4FQJH 1AXTH 5IQ9A 3L3GB 4HF5H 1CDBA 5CGYD 3QIUB 3IFNL 2E9IA 4OSUL 4NDMA 4ONGH 5HY9A 4PRHA 4PJBA 2ZKHL 3ARTA 5D7IB 5BS0E 4PUBH 3LH2L 1EA9C 5C0ND 3ULUC 3IAGC 3UDWA 4YK4B 1JNNL 3PP4H 4N8VB 4MZ2A 1OLZA 1SEBA 4HWZA 2EZ0C 4NC1C 5CUSL 4MCYB 1HHHA 3WUZA 3WMSA 2O93L 1FH5H 4QT5A 3TO4A 2HFTA 3V4PL 4LEOA 3ZTJH 5HI3D 3KPQA 1OPGL 5GRZA 3LHPH 4XVJH 5BXFA 2DL2A 5JQHC 3MNVB 2AGJH 3N1MC 3WJLC 4JY6B 1N0LA 4EBQH 3RWHA 3SY0B 5HYSB 3BH8A 4JCMA 4YIQA 3W11D 2FO4B 4Z5RB 4YHPA 5JR1H 5MEQB 3UPRA 2VL5A 1S7SB 5EOTA 2FJGA 4IRSB 3VD5A 4J12A 5FV1L 3AS0A 2R2BB 4M1CD 1C12A 2PN5A 3PIQA 4RMRA 1IC4L 5TPWH 3HKFA 3E6HB 4LPXA 1F4XH 1F4YH 1J0YA 5GPRA 3WLWD 3WSQL 5ICZB 5IMLB 1JGVH 4ESKA 2G9HB 3K1DA 4NN5C 4OZGA 2ZPKL 4GBXC 1FO0A 1HH9B 1X6NA 1U95A 2AABL 1S3KH 1KG0A 3D3VB 4JKLA 1AP2B 5FHBH 4ZUWB 2DLFH 2B7DT 3TO2A 1I9EA 4OCMC 1ADQL 1DBKL 5T1KB 4EUPA 4GRWH 3STZB 3TESA 5KJRL 1NMCB 2UYLB 5INDB 2R15A 1RUQL 5J1SC 4K23H 1ZT1B 1ZXQA 3IXAB 1NAMH 1MAML 5HYEA 1KJ3H 3O4OC 4EN3C 3SJVB 4MX7A 3SKOB 4KHXH 1KCLA 1T7ZA 1T83A 1CXIA 1J1OL 1MQ8A 1CD1A 2VR4A 2PR4L 2X4PB 2E3VA 4IOFC 2X4SB 4MQ7B 3MLPA 4PJEB 1FE8H 5BOZG 1X5FA 3I02A 2AW2A 1S7VB 1IGCH 4JZNA 1HI6A 3PGCB 5JMRA 1QPXA 1EFXA 3V95A 5ALCH 3H7LA 2RJMA 2ZCKL 3ARBA 1I8KA 1CTNA 4I2XA 5D7LD 5E8NA 1FZMA 3S37L 4PR5B 1J18A 2V7HA 4Y4KA 4O2FA 1XT5A 1I3RA 3MRIB 1KCRH 5DA0B 1K5NB 4DW2L 3OPZL 2AK4A 1QQDA 2Y06L 3L5WA 3PQYE 1NGQL 2HT3C 5C0JB 1JPGB 1SMAA 4KRPD 4HUXA 4Z7VE 4X7CC 3B43A 2OJEB 1LO4H 3IJYB 3SKUD 1OSPL 3QT2A 4HZLB 5FEBA 1MIML 4RMVA 1QNZH 1PAMA 4LLWA 1FZKB 2VO5A 5DC0A 1XIWC 4P9HL 1JPST 1N6UA 5EFIA 2HLFC 5EBGA 1CGUA 2QBWA 1WTLA 3W81A 4WCYH 3O6FC 2CO6B 4N8CL 1U8HB 3GBLA 5I73C 1KOAA 1UG9A 2DN7A 5DC9B 2ZOKB 3U0TB 2Y5EA 4PGJA 1D9KC 2XN9B 5C08B 5ADPL 5F9JB 1B4RA 2J8OA 3P0YH 1ZLVH 3G6JE 1CFNB 3KJ6L 4GG8A 3U9UB 3GZKA 2WIMA 4KJPD 1D3CA 1GOHA 2EIZA 1AJ7H 2VLRA 3NGBB 5GSRA 5E2VL 3MV9A 1MPAL 3CDFA 3LN4B 3LN5B 1U8KA 3DSNA 2H32B 4Z7UA 1KSRA 4ZO8A 2HTKD 32C2A 4NM4H 5DD3L 1R3IH 4F2MB 2ZCHH 4ZTPL 1T0MB 5EUKB 4KVCH 4YDKH 3QXTA 1S7XA 4XNZC 4HGWB 4OGAD 4S1SH 5D5MA 3V0VB 1K2DB 4KMTL 4PG9B 1C08A 2A6KB 1A14L 4LLUA 4ZG1A 3L95B 1JMZA 2A6IA 3BW9A 1W0VB 4U1SB 1MFBL 4JDVB 1DQMH 2MCPH 1QUNA 1HINH 4EVNB 4LLVB 2K7PA 5JDSA 5FM5O 2IH3A 3OAZK 2VJXA 3PG2A 4GRWE 1WBXB 4UDUB 1BF8A 5GXBB 1MCRA 4M6OL 4LEXH 2YRZA 3MOAH 3TBSB 4XI5C 4M61A 5DJXB 3QWRD 1XGRA 4LPCA 4RA3A 5KVEL 4NJ9H 5SX4I 1RZIA 1MFEH 1BFSA 3DI3B 2W9EH 4U49A 4ZUTA 5CP7A 3UTQB 1NFDB 4B7IA 2YN5A 3MLZL 1UFUA 1A1MB 4H25A 1FRGL 5I16A 5FXCH 5C6WH 3ETBF 1OWWA 5FYJU 1ORQB 4RFOH 3DLQR 2Q1EA 4IIQA 2W60A 1I9RH 2BJMH 2HKFH 4LVOC 1NBVL 1A6TA 1R3LA 1EZVX 4NKIH 5ICXB 1T2XA 4L9LA 1FNGB 4RQQA 4L4JA 4XAWH 2VUOA 4KKCD 2FB4H 3MFGB 3I50H 5DD0H 5GJTH 5TE6H 5JXAH 3D2UB 3T2PA 1I3UA 2HTLC 2J2ZA 3KXFA 2IAND 4P3WA 3DUUA 4F7MB 3UROR 4Q2ZB 2APWA 4NQEE 2BSRA 1IRAY 1U3HD 2VZTA 1CFBA 2A6JA 1QFUL 3JXAA 3UJIH 4NSKA 2FHCA 1P6FA 2K3TA 1VFBB 4J3UA 1A9EA 3RVWD 5EC2A 1A6AB 5M95B 5AYQA 3AREA 4KDTC 4X4XB 1B4JL 2DLIA 1DQLH 5BZWB 2XIDA 5LG1A 1G6RH 5D7LA 4WW2F 5F7YC 2GKIA 3MYJB 4N0CD 4M93C 4WTZA 2VDRL 5C3LD 3FT4A 3VI4F 3U2SB 5BRZB 1RJLB 3TBWA 1TTUA 3MRGA 2IALA 5JZ7C 3M8OH 3WS6C 3ULUF 3X13A 5HBBA 1TNMA 3MODL 3MMEB 2BSSB 5FYKD 1FIGL 4TPRH 1S5IH 3O11A 4W6WB 1YPZF 3HZMB 2V9RA 4I48B 3VXUA 1V3JA 5KZCD 5I75C 4ZMAT 5I8CA 5FOBA 2YPLB 3VWKD 5E8OB 2P5WD 5EU4B 2YMXL 4XCEA 2EDKA 5DJ8B 3ZL4H 3IVKA 4UQ3B 1QRKA 3EYVA 3KLAB 3MOBH 3ZE0F 1JHKL 4K3HA 1IC4H 1KIRA 1JF1A 2VLMD 1OTSC 4DKEH 1XF3A 2F54A 2Y5TA 3VFOA 3EKCA 4PGEA 5CEXB 4LU5H 3FFDB 2L0DA 4O9HH 3T77A 2B8OT 4UIMA 2DQEL 4ISVB 1TFHA 4GXVL 4K8RC 3QCTH 3C9NA 4M48L 4QF1B 4YBHA 1WICA 2DD8H 2IAMC 2HH0L 4QXTB 4GG6F 4OZHA 3C87A 1T1YB 2AERT 4AENB 4WUUA 3ZSSA 1G7QB 4E41B 3QDJB 4AL8L 4WHDA 2ZG1A 2MSPA 4PJXF 2UWEA 1BD2D 1IM9A 4QRRA 1HQ4B 3CX5K 3QUMB 2HFFB 4YHIA 4JFEB 2Q6WB 1UJ3B 5L7XL 1A1OB 2FWOB 1TXKA 2R0LH 2YD5A 3GJEA 3BFOA 4I18B 3CDYA 4RGNB 1ACZA 5IMKA 2BRQA 3SPVA 4YHYC 4UU9A 5ACZB 3LD8B 1N5YH 2DBJA 2VDNH 3QWRA 3C60B 5F7MC 3HRPA 5EZLB 3W82A 4ODBD 3GRWL 3QO1B 3PWPB 3MCLL 4H0HB 1JVKA 3S37H 1OL0A 3C6SA 4OQTA 5C0EB 4FFVC 2OR7A 3VFMA 2NXZD 2QQKH 1YEDA 5JOFA 1R3KB 4HBQA 3OPZH 3L3HA 1G0DA 2XQYG 5HI5D 4EI5C 1FIEA 3TVMB 3QQ4B 4Y4HC 2YZ1A 3CMOL 2YPKA 2GSGB 3B9KD 15C8L 3GI9L 5HGHB 3NN8A 3U7WH 3G04A 4RNRB 3SO3B 4LQ1A 1EXUA 1KB5B 2DWEB 3RZCB 4NGHL 1WFUA 2DIJA 3H42L 2NR6D 4N0UE 2IANA 5HYJD 4FG6D 2HLAA 2ADGB 4ZUVB 4YXKL 3M1BA 4G8IA 1JZ4A 2FYYA 3HI1B 2C1OB 1KJ2A 5F9OL 5IQ9B 5ADPH 2WWMC 1DQJA 4LDEB 3HB3C 1U3HA 2W07A 3O2WH 5E9DD 4NDMB 3RWJA 5HY9B 2C9AA 4PRHB 4PJBB 1QSZA 4P3CL 5ITFA 1MPAH 3IYLW 5HHOE 4J8RA 3GSNA 2IPUK 4U1IB 1QFPA 3MUZ1 1MI5A 5IQ7L 2NXYB 2BHUA 3S5LA 3ME0A 4QRUA 1DE4A 2FX7H 4JKMA 5C9JA 2APVA 2QADC 4QRPD 3SDXE 5IR1A 1OOAA 4WEBH 1HHHB 2AJSH 4ZTPH 3V5HB 3V5KA 4QT5B 3TO4B 4P2QD 5KS9F 4LEOB 5LQBL 3FOLA 2NW3A 5IVXE 1TVHB 1UWEL 1QBBA 3KPQB 5BXFB 5J8OA 4Y5YC 5B3NA 3EFDL 1FAIL 4PJGF 2NY2B 3AAZB 1MFBH 5IJKC 3RWHB 2B1AL 1LK3L 3BH8B 4YIQB 3RDTD 4YHPB 3UPRB 1TJHL 5EOTB 2FJGB 3E2HB 3DMMD 1C12B 5A2KH 1BEYH 3PIQB 3VWKA 2P5WA 3ARFC 1U3JA 3T3ME 2X10A 1ZLSH 1ZT7A 2VXSL 1W72B 1KJMA 4OZGB 3OXRA 1FO0B 4DGYL 3ARSA 1U95B 2AI0L 1FJ1A 1FFQA 1KG0B 3MLZH 1KFAL 2CKBH 4NHCL 3S34H 1FRGH 3TO2B 3MLSL 3DV4A 5GRWA 4WHTA 4JM4L 4EUPB 2X9XA 1U91A 2O5ZL 2D31A 5HYJE 2DRUA 3NFSL 3BVNB 5ESQA 4MNQE 5IJVB 2J3SA 3NIGE 4RWYH 4HFWA 3L3IA 4MX7B 3SBWC 1ZGLA 5E9DE 4TTGA 1Z9LA 5I1IH 4ZFOA 1CD1B 1UZ6E 4JQIL 1GGBH 1P4LB 1P6AB 3I02B 4PV9A 1NANH 4WTXA 3MBEC 1BVKA 5CBEA 4JZNB 3QR2A 1HI6B 1BD2A 5GRJH 3QPXL 2B5IB 4UTAL 3SGDH 1EFXB 4R0LA 3ARBB 1I8KB 2QSTA 3C09C 4I2XB 4YJZL 4QY8A 5E8NB 4CRPA 1FZMB 3GO1L 1VPOL 2V7HB 2QHRL 4Y4KB 2A38A 4O2FB 3X3FL 5D7SH 3ORJA 1V7NH 2BVUA 2AK4B 1QQDB 3L5WB 1X5LA 3CZJA 3V7MA 5KSBA 3MV7D 4HUXB 2E8ZA 3WIIL 1L7IL 2VDRH 4JREC 5JO5A 7FABL 4APQC 1K6QL 5F89A 3GSRA 4OFYD 1ADQA 5IK3A 4ODHH 5K33A 1WBZA 2AEIT 5IBUB 4OJFL 4I4WA 2Y6SD 4LLWB 4MAUL 4HC1H 3IKKA 5EH1A 1DBJL 1FIGH 2NY4C 3WIHA 4P57A 2A9MH 4XNXH 5EFIB 3SE4C 3B9KA 2YPVL 4DK3A 3QI9D 5E03A 5L88L 2BXZA 3NFNA 4D0DA 4U6XA 4PJ7A 2NY6D 4TULL 2V2TA 1HZHH 1YUHA 3S36H 3FCTA 2W1NA 4TOYH 1BZQK 2XV6B 4KPHH 4LF3A 4WGWB 1IKNA 4GG8B 3QP3A 3FB7A 1A6ZA 4PLKC 4XC3L 5DD6B 2EIZB 2VLRB 2DOCA 3L6FB 5GSRB 3SCMD 3MV9B 4JO1H 3HLAA 2IGFH 4PJAE 1RUML 1U8KB 4Z7UB 3W2DH 1JHKH 1EERB 1L0QA 4ACPA 1I9IH 4I3SL 1D5XA 4R4FH 4PP1D 4AYFA 1GVIA 3PL6A 2P43B 1S7XB 4LKCA 3CLFL 3QXWA 1MHCA 2DQEH 5D5MB 3LQZA 1C08B 3VGHA 4QRPA 2A6IB 3KPRE 3BW9B 4P2QA 1FGNL 3D39A 5I8KL 5ETUA 2A73A 4XVSH 1A3LL 1FL5A 3LCYA 2APFA 4BFEA 5JDSB 1N2RA 4HS8L 3WBDA 2IH3B 4NCC2 4WV1A 1T66C 5BJTA 2QJDA 4KK6C 3O0RH 1FBIH 3OB0K 4G8FA 4M61B 1L9NA 1XGRB 4OLUL 4F15C 1RZIB 1H5BA 1YC7A 3RDTA 2DB8A 4ZUTB 5CP7B 3SDDA 1RJZB 2BVEA 1MELA 1OM3L 3S6CA 4KAQL 4H25B 4QXWA 3ZDYF 1DBAH 3RWCB 2EDEA 1WZ1L 4IIQB 3DVNA 2W60B 1A6TB 1R3LB 3TIEB 5F6IB 4L9LB 1MHHA 1DQTA 1A1NA 3V6OA 1FNLA 4RQQB 1FLRL 4WO4A 1U8LA 4DKAA 4KK5D 2DDQL 2P42B 5T3XH 3VH8G 1TMCB 5FB8A 1RZKC 3KXFB 5J3HC 3I3EA 3TZVC 4GKNA 3DUUB 1T7WA 3GI9H 4JO3L 1B3JA 3GJFK 1VEMA 3RIFK 2Q8AL 5IM7A 1DQQA 3PV7A 2BSRB 1AQKH 3BH9B 3RWEA 1MFAH 1I8IA 1YNLL 3O2DH 4P23A 4NSKB 1YNKH 5D4QA 4PGCA 1SYSA 5BZDA 4S0TD 3DVGA 3CGTA 4JKPL 2WK2A 3CH1A 5EC2B 2YBRA 3GI8H 3KYNA 3UPCA 3ZKNC 3AREB 4YBQD 1FCGA 4M3JA 4GJTB 5HXMA 1WIOA 4N68A 1PG7X 4LVEA 5D1ZD 4Z7NE 3VXPA 3NA9L 5D7LB 3GHEL 5C0DA 4MB4A 4P3CH 4F9PA 4JO4L 2RCSL 3FT4B 5IG7A 2CJUL 4XNYH 4L3AA 3X13B 2C4XA 5L2JA 1BQLL 2UZXB 4CVXA 4KRPB 1E28A 3MV7A 4LSDA 3O11B 2D03L 3KDMA 4G6AD 1NEZB 1GZPA 4OFYA 1J0HA 5B22A 1SJXA 3ILQD 1RJYA 3VXUB 2ESVE 5EPMB 1AGCB 2KDGA 1FAIH 5I8CB 1HN1A 2KL6A 4L29B 5FOBB 1AR1D 4JZJC 3TC9A 4LSPL 1LK3H 1E4WH 4XCEB 1DLFH 3QUXC 3IVKB 3WDJA 2YK1H 3ULUH 3J7HA 2V5SA 4HFUL 4LIQH 5EUOA 1J8HD 3EYVB 2EDFA 4M1DL 1MRCL 1KIRB 1JF1B 1S78D 1XF3B 2F54B 2Y5TB 3VFOB 1CDYA 4PGEB 1RK0A 2Q7YA 3KJ4B 3SCMA 3HFMH 3MJ8A 1BM3L 2OR9L 2WSKA 3T77B 5B3JF 3HUJA 4NRXA 4NHCH 3VFPA 4GAJH 4F7TA 2IWGA 1UKSA 5KVFL 4QRTB 4J3XA 4ZYKA 5I71B 2VN4A 3S7GA 1FC2D 3C9NB 5HYQA 4MAYC 3TT3L 4K2UH 3LV3B 3B9EA 3FZUD 1I9JH 4OZHB 1NL0H 1EO8L 5TF1L 3LKRA 4WUUB 3RHWK 5DI8A 1FFNA 4PTUA 5C0AA 1ZLWH 3VXSD 4H0IA 4WDIA 2UWEB 1DSFL 3BXNA 1IM9B 3HC3L 3VMPA 3WKNA 4BZ1L 4Z8FL 5FM8A 3ARDA 1KYOJ 1EHXA 3AS3A 1KLUA 5IMKB 2BVQA 2UVEA 3SPVB 4AT6B 4GQPH 5DUBA 3P77A 5BW7A 4L8CA 3UTPD 5T3XE 1TITA 3S3PA 4G42A 2ED9A 4OLVL 5LGHL 1CVRA 4YFDB 3VFMB 4TN9A 5JOFB 4TNVF 3LEVL 3L3HB 1X4YA 1KV3A 4C58B 3DX8A 2JJSC 2YPKB 3MRLA 4KUCD 4BH7A 4XPFL 1K6QH 4OCSL 1CD0A 3VW3L 1ZMYA 4AM0A 1J8HE 3JTSA 4V1DA 4ZXBD 4UV4H 2HRLA 4DZ8A 2VR5A 3G04B 1RMFH 5FUCC 1EXUB 2ADFL 5DJ2A 4GBXD 1DBJH 2BNUB 5DK2B 4M5YH 2YPVH 2L7JA 3SDCA 2IANB 2VWEC 2QR0A 4FTVD 4HSQA 3M1BB 4TULH 2FYYB 3P30L 4HLZH 1KJ2B 4UB0L 4F37F 2ZG2A 1QKZL 1BX2A 3F7PC 1R5IA 1DQJB 1ND0A 1P5VA 3CXDL 1U3HB 4Z7QF 4LCCC 3RWJB 2XG4A 4IS6A 2LAAA 3B5GA 1PKQE 1NDGA 4XC3H 2Y23A 1PLGH 5ITFB 1WF5A 4J8RB 3GSNB 3IDNA 2GY5A 1F97A 3KPSA 3GRWA 3S5LB 4QRUB 4HH9A 5C9JB 5C71A 5AAWA 3RFZC 5D1ZA 4DJMA 3V5KB 4UILH 4Z0BH 3ULUE 4LIQE 4FXGA 3FOLB 2NW3B 2VAAB 5F1IB 1T89C 1H15A 1FP5A 4NC1E 2NW2A 4F9LA 1IAII 1Q94B 4WI5A 3SDAC 5I1GH 4R97B 3ZHLA 3BRGC 1VEOA 5BMFH 1HHIA 5GS0L 2VTFA 2D7NA 4WTWA 4KKLD 3OGCA 4Q6YA 5ID0A 5E5MA 1EAJA 3C6LC 1JWSA 4NQTA 2FIKA 5KZCB 3UTTE 1VADA 1ZHNB 5D2LF 2Y9RT 1NCCH 1EGJL 3VWKB 2P5WB 4NFDA 4H20L 4FMKA 3ZE0E 1ZT7B 2R9HC 1KJMB 3HPLB 3ELAT 3OXRB 1MY5A 3U4EA 1FJ1B 4L8SC 1OM3H 1XIWD 4KAQH 3CXHJ 2ERJC 3EDKA 2HLFD 3DV4B 5SWZD 1A7QH 3KPTA 4WHTB 1RIHH 1RIVL 1CFSA 1WZ1H 1U91B 3CSYA 4FQHA 4CMMA 1TVBB 2D31B 3IU3A 3MBXH 3R1GL 5ESQB 5BVJA 2DIBA 1G0YR 1FLRH 1HWGB 4HFWB 3L3IB 3L1OL 3NCJH 5ITBH 5A16A 1ZT4A 3BPNB 3OZ9L 1MF2L 1QLRA 5GGVY 4PJXE 4UIKH 3ALXA 5K9OB 3DETC 2V5YA 1XF5A 3WKML 3FQUA 5J6GA 1MJ8H 4PV9B 3VXSA 3VXRD 1BVKB 4XCYB 5GGTH 5CBEB 5LBSH 1MRDH 4UNTA 1BD2B 2FL5A 1M7IA 2WZPD 3P4OB 4R0LB 2C26A 2NX5E 5I19L 4QO1A 3WN5C 3RP1A 3EO9H 3BE1L 4U1JA 4HPYH 4QHUA 1WAAA 5KSBB 4OZFG 3NA9H 4HWEH 3GHEH 1VFOA 4J3TA 1KN2H 5DK0A 4JO4H 4PV8A 5JO5B 4IHOA 5F89B 3Q5TA 2NXZB 1A3RL 3GSRB 5IK3B 4GS7B 1WBZB 1YEJH 3VFRB 4I4WB 4PRDB 4NQSA 1BQLH 1N5AB 3RTQD 1KBGL 2D03H 3MXVL 2AQ3A 4P57B 3B9KB 4OFIA 2OCFD 4F8TA 1MCDA 3WFBH 3HAEA 1TJIL 3MRHA 3NFNB 1X4XA 3VU2A 4D0DB 4ZXBA 4U6XB 3DVFA 4PJ7B 2V2TB 3LIZL 1YUHB 4QTIL 8CGTA 1GZQA 3FCTB 4U0RC 2PYEA 5EZOL 1IILE 4QHKI 3MLRL 4LF3B 1Q8MA 2VXVL 3KYOA 1W2KT 3DBXB 4FABL 4ONFL 3FB7B 3JWDC 1A6ZB 4FTVA 2EYRA 4UT9L 4Y2DC 1JGUH 4HFUH 3KLSA 4XXDA 3FHQA 1CLYL 5DWUH 2HTLD 1JN6A 2E9JA 4X9FA 4C56E 4ONHB 1MRCH 5SV3A 1Y0LA 1D5XB 4GKSA 4JJ5A 4R4BA 1RZ7L 4BSJA 1YYLL 2B2XL 4LKCB 1MHCB 5KS9E 1CE1L 3LQZB 3NAAL 5LCVL 2IMMA 1UH3A 2MMXA 4QRPB 2GEEA 2R8SH 4O4YL 2W92A 3PWUA 4LRNL 4FFYL 4PD4K 2B39A 4P2QB 5ETUB 2A73B 4YBLC 1VESA 1FL5B 2XWBA 3CD4A 1T3FA 4KI5D 1NFIA 1UJTA 4LKXA 4BM7A 1N2RB 4XWGL 1NGXA 2I5YH 3FB6A 5F6HJ 4PJIE 3CC5A 1BZ7A 3OR7A 1TZGL 1ZK9A 4WV1B 1PG7W 1V5JA 5IFHH 2DQTH 5BJTB 3WO3B 4CKVX 4JCLA 1H3XA 4G8FB 4N90D 4RSVA 5CINH 1H5BB 5JZ7D 4PJCA 5C0BA 3RDTB 3QRGL 3QXAA 4LHUG 3SDDB 4UBDC 4QNPF 4K8RH 3O8XC 4I0PC 5GGQL 5C07E 1I7RA 2OI9C 4YZFF 1RV6X 1QR1A 1T5WA 4CJ0A 3JTTA 3EFFA 3WNKA 43C9B 3DVNB 4XX1E 3L3JA 1Z0NA 4PJHA 4WFEE 1MHHB 4DZBB 1A1NB 3SDYH 5JHLL 3NZHL 2X4UA 4JHAL 3QHFL 4WO4B 4W81A 3AC0A 1U8LB 2JB6A 3RGHA 3WNPA 1HWHB 1NANI 5E7BA 3Q6FA 5HYIA 3QNXA 5FB8B 1T1WB 3X3GL 3TBVA 4ZPTA 4GKNB 4E9LA 1ERNA 7CGTA 1OTSD 5IM7B 4ETYA 5KSAA 3KG5A 3O81A 3RWEB 1N7ML 1CD9B 1I8IB 4P23B 4AJ0A 4YXLL 3HR5A 3S98A 1FYTE 3KLDA 5DFVC 2P47B 5BZDB 1CGSL 3VXRA 3BWAB 3DVGB 5C7XL 5D93C 3CH1B 2YBRB 5EIVA 4R2GC 2YA2A 3HG1A 1MOEA 2H1PH 1Y18A 1IGFH 1AKJD 2IG2H 1RZKL 1I7UA 3VXPB 5C0DB 4DVBB 4JO2L 5IG7B 1KCUH 4NO2A 3EYUH 5GRVL 4YNYA 5DFTA 3H9YA 3BKJL 3WFDH 5HI4C 5L2JB 4CVXB 3B2UC 5MERA 1E28B 3MV7B 4J6RH 4M7ZC 4N90E 2X42A 3KDMB 5DMJB 1DUYA 1GZPB 1TZHA 4ZAKD 3IB4A 1RJYB 1ZHLA 2B0SH 1U8MA 2KZWA 1TJGH 3RTQA 1I7TA 1GIGL 1JPSH 2YEZA 4OCRL 1JL8A 4KTDL 2XXMB 1NUDA 3S37X 3QI9B 4UT7L 5D9SA 1NAKH 5H8DA 1G9EA 3OAYH 4YWGL 4MDIA 4X5LA 3N1GC 1EGJH 4C59B 4H20H 3DO7A 1RK0B 2Q7YB 3SCMB 4U1GB 3EDEA 3MJ8B 3HUJB 4NRXB 4F7TB 3U7YH 4NO0D 4YK4C 4ZYKB 4G6ML 1NCBH 2XWJA 2W0KA 1IGML 4S0SD 1FORL 3I6GA 1UVQB 5HYQB 5DHYA 2CLRA 4UI2A 3FMGL 5F71A 5CEZH 3ARUA 1ZANL 2WWMD 3LKRB 3FQXA 2EXWC 3PQYA 5DI8B 1FFNB 1FFRA 2PNDA 1QSFE 4PTUB 3UBXG 4MVBC 2VZUA 3RZWA 5GS0D 4XP9H 4WDIB 2Z8WC 3OZ9H 4YHZL 2VN7A 3HC4L 2EICA 1YMMD 4G7VH 5FUOL 1MVFA 3V0AC 2AXJA 2QADD 5AWNH 2YRLA 3EO0B 2IF7A 4IRSC 3CNKA 1RZ8A 1WT5A 2BVQB 5CS7A 2ZSWA 3P77B 4M6AA 3LN9A 4R26L 4HAFA 2HVKA 1JF5A 3CFKA 5FGBA 3ZDYE 4NN7B 1LDPH 4EIGB 4I9WD 5DYOA 3IETA 4IRJA 2HFGL 5CP3H 3U83A 5I19H 5CFHA 1IEAA 5KG9A 4OI7A 5HSFA 1OTUC 1M05A 1XCTA 2XACC 4GRLA 3DX8B 3N9GL 3PNWA 3VXOA 3P9LA 1SVCP 3RBSA 4FQLL 3MRLB 4NQDE 4B50A 2BP3A 1CFTA 1J88A 3QNZA 3KWWA 4BH7B 4L8BA 2FO1A 4AM0B 2X9YA 3JTSB 3K4AA 3P11L 4V1DB 3ARFD 3SGJC 2V6HA 4DZ8B 4M43L 4NT6A 5CKGA 4XB8A 1NH6A 5DJ2B 1UH4A 1ZLWK 3KHOA 5E2WH 4WI2A 1KELL 1IQDA 3JWOC 4YPGA 3MXVH 3SDCB 5FGRA 3TBTA 4Z78A 1MAKA 2QR0B 1OGTA 4AG4L 1BX2B 1CK0L 2XKSA 3RNQA 1R5IB 1ND0B 5DRNA 3MLRH 4CJ1A 4GOSA 1QO3B 1KCVH 4IS6B 2GJJA 4ONFH 4NOBA 4C54A 1NDGB 4LSVL 1NCWH 3QFJD 3IDNB 2N1KA 3LQMA 1PYWA 3TGXA 1ZA6A 4PRID 4HH9B 3DPBA 5C2BH 1S7TB 2GIYA 5D1ZB 5E0QA 1R5VA 1F3DJ 2LABA 1JZ8A 3MJ9H 3HNSL 3MBED 4O02H 4FXGB 4OIIL 5KVDL 2OK0L 2B2XH 1H15B 1BMGA 4XP4L 3RUGF 3KR3L 5LCVH 5J6HA 2NW2B 3RL2A 3SE8L 4KKBC 1NGPH 2VL4A 1Z3GH 5L0QB 1HHIB 3P2TA 3QDMD 3VDCA 4N9GA 5I30L 4YHML 5LWYH 2HT2D 1YEFH 5C0CA 3N06B 4ZAKA 5K9JH 1CN4A 3OGCB 5ID0B 4I9WE 5E5MB 5FKAA 4XWGH 1JWSB 3SE9L 2FIKB 1VADB 4KFZC 1TZGH 4OBSA 2DL9A 1B2WL 5CIPH 1KIPA 5CEZE 2B1HL 4KV5F 4PLJC 5KAQG 3TJEL 3NGBC 2B4CC 4XCNA 3U4EB 4U6YA 4NUGL 4NQEA 1N64L 4TRPH 2NY4D 1JYXA 4BFIA 5GGQH 3RVVC 1J12A 5GIRA 1E4XL 1RUPL 1CFSB 4UMGA 3CSYB 5EORH 4CMMB 3WL9A 1OLLA 4JDZA 3IU3B 2IBZX 5JW3H 3RVUD 1EUTA 4NO0A 4TTDC 1GGCL 5BVJB 3MQIA 1J1XH 3VMOA 1P84J 4AEFA 1BIHA 3TLRA 1MRFH 5A16B 1KNOA 1ZT4B 2EDLA 3BMWA 1A4KA 3O6KL 3K3QA 4QYOA 4J4PD 3DX6A 5IB1A 1HK6A 3W9DA 1XF5B 4NM8L 3QCUL 2HWZL 1UCTA 5J6GB 3VXSB 3GKWL 3F65A 2XY1A 1RFDL 2FL5B 4HXAL 4X6DE 1M7IB 3IFPA 3HRZA 1GYAA 3ARRA 2P45B 3GIZH 4O58H 1INDL 4Y5XA 5JQ6L 5C7XH 2UY7A 4LVHB 3B9DA 4ZPVA 1MCPL 4P9MH 1PX3A 4KKNA 2OZ4L 2IQ9H 1JNLH 4U1JB 4QHUB 1T0NA 4WVRA 3OTTA 4X6EA 2G60H 1AGEB 5DK0B 4JO2H 4G6KL 5E5UB 3MGAA 4PV8B 5MEOA 1MQKH 1T66D 4IHOB 3DUSA 4NP4H 1M6OA 1AO7A 2Y4SA 5DHVH 3BKJH 1M7DA 3ET9F 1GPOH 2D4DA 4D8PA 5I0DA 2CR6A 4NQSB 4K7FA 3GJFA 1D5IL 3PWVA 1NJ9A 2GJ6D 2YHGA 3O4LA 3WD5L 4H1LB 4G8GD 4NWTL 1J7VR 3LOWA 4MA8H 3HAEB 2J6EH 3TNMB 3MRHB 5C8JA 4LRIC 4ZXBB 2OS7A 3MACL 1MFDH 1GZQB 1ROWA 4GBXB 2PYEB 4PRAA 2OL3A 2HYMA 1P1ZA 3KYOB 1C7SA 2DF3A 3EDFA 5DRZA 4FTVB 1RU9L 2EYRB 3LEYL 1W0WA 1IT9L 3GMMA 4XXDB 2DI9A 4OFKA 4YWGH 3ROLA 4AZ8A 4UINL 1EEZA 2O5YL 1Y0LB 3M45A 5TFSL 3TZVD 3VFWA 4C4KT 4GKSB 2SEBA 3IU4H 5D7IF 4R4BB 2RGSA 3H3PL 4XWOD 3ZTJG 3CDGA 3GSQA 4YLQT 4D9LL 3U4AA 1KTKE 4P5TA 4PRIA 4G6MH 5FGCE 3LB6C 5IB2A 1BOGA 3PWUB 1IMHC 2WWKO 1H8NA 2W9LA 3FMGH 4HUKB 4ERSL 5EA0L 5DZNA 3ZKND 2XWBB 3WHE0 1T3FB 1REIA 1G7MA 1I8LA 4I5BA 1NFIB 4XBEH 5FK9A 4XBPB 4LKXB 1NGXB 3FB6B 5JDJA 3CC5B 1BZ7B 2ZNWA 3OR7B 4PTTA 3C8HA 3QDMA 2FEDC 4GW4A 1QSED 1AI1H 3O41B 2HKHL 4YHZH 1ZAGA 1PSKL 3E0GA 5FO8A 1HCVA 3MXWL 5D2LE 4PJCB 5C0BB 3QXAB 5B39A 2WINA 1G6RA 2R2EA 4BFBD 1KCSL 4UAOB 1I7RB 1QR1B 1T5WB 2RAMA 3JTTB 4Y4FD 3GMPA 2YUZA 3KNBA 3L3JB 5ENWA 3QPQC 4S11A 4PJHB 3TYGL 2YUXA 1NEZG 5SWZB 1C5CH 2EDQA 4N1EA 2WMPA 3K4DA 5I73B 2JB6B 3QUXD 1UB6A 3N9GH 4H88H 3Q6FB 3CFBA 3CVHL 3QNXB 4FQLH 1JZ7A 2DYPA 3TBVB 1WZKA 2X4NA 2V2WA 3P11H 1T4KA 1UM6L 4ZO6A 1CQYA 2ZP0T 5KSAB 1URLA 3QEHA 3G9AB 4J4PA 1UJ3C 4AEIL 4UNVA 1IQWL 4NJAL 1G7PA 3HR5B 4PRBA 2WM0A 4I18C 1CD8A 1A7RH 2D7OA 2H2SC 4RGNC 1HXYA 4ZS7L 3VXRB 4AG4H 4OFVA 3LD8C 3IDXH 4JDTL 3CDCA 3VXNA 3C60C 4XNZB 4DKFL 1XF4A 2LU7A 3HG1B 1Y18B 1DN2A 3G5ZA 1I7UB 4LSVH 3E1F1 4X6CF 1KPRA 4NO2B 3FJTA 5I17A 4FNLL 4YNYB 1BJ8A 3VG0L 4JEGB 3QRFM 5MERB 3TVMC 2VSDA 2AV7A 4Y0GA 4OIIH 4EZMA 2OK0H 1TZHB 5IF0A 4WFGD 4XP4H 2XRAH 3ZLQC 1Z9OA 1ZHLB 3SE8H 3SO3C 2GJ6A 4P2RA 3RTQB 1I7TB 4R8WH 2YEZB 4DEPB 4KK9C 4AQOA 4DCQA 2EIEA 4G8GA 3T0AA 4ELMF 4YHMH 3RL1B 3IGAA 1DCLA 2VH5H 3EOAA 5D9SB 4HH8A 4C4KO 5AD0A 4GT7A 4ZSOA 3V7AG 4KRNA 5FYJL 4MDIB 3ULVC 2YKLH 6CGTA 3LVEA 1QD0A 5DVLA 1SJEB 4G80B 5I1CL 1EIBA 3DO7B 4H26A 1L9MA 3GSOA 1PKOA 1OARH 2J8UE 4NUGH 3UTSE 2MQ0A 3U82B 2NXYC 3I3BA 3UDWC 3TF7C 1U2CA 5DEFB 3EYQC 2NLJA 5EU6E 2BMKA 3I6GB 4ODWB 1MUJA 5DHYB 2CLRB 3TO4C 3QQ9C 3FONA 4U1MA 2PTVA 3SKJL 3JVGA 2Z91A 3EZ8A 3GMLB 4MWFA 1RJCA 4KC3B 1CTOA 2QSCH 1UEYA 3FQXB 4Y8DC 4HQQL 3CU7A 3UC0H 2EXYD 2NY2C 4MDJA 4XMPL 2AKRA 4N5UA 4AEEA 1X7QA 2WNGA 5B21A 3O6KH 1IM3A 3LRSA 3WNNA 2BXYA 1VKXB 4ETQA 3ZYJA 1N8ZA 1TIUA 4LSQL 4NM8H 4M9OA 2DQCH 3KLHC 1RZ8B 4ZD3L 2ZSWB 4FP8L 1QSEA 5FECA 2HVKB 3ULSA 4QNPE 3CFKB 2AJVH 3RWGA 4R9HA 4YZFE 3SDAD 4WFGE 5DYOB 1IAOA 5FM5M 1NFDF 2AEWA 3IETB 3N1FC 5E08H 4QWWC 5GISH 4PY7A 5KG9B 4Y4FA 4OD3L 4AMKL 1F8TL 1M05B 1XCTB 1S7QB 4GRLB 3C6LD 3PNWB 1XGYL 4OF5A 3P9LB 2VDML 5ID1A 1CFTB 1F4WL 3FT2B 3KWWB 3QNZB 5LVEA 4L8BB 1FGVL 1LO5A 4KJQC 5AZEL 3O6MH 5AUMA 2H6PA 4NT6B 4KRMB 4X6FA 1T83C 1IQDB 1PZ5A 5GJSL 4QXUL 4KZEH 2I07A 3LPWA 4L4TD 4Z78B 5FUCE 25C8L 4NZUL 4EIZC 1E4JA 1U8IA 1G9NL 5I15L 1OGTB 2WIIA 4OKDA 1P4IL 1MWAH 5L2KE 1MCCA 1AD9A 3KYMA 3CFIC 3RNQB 2B5IC 3GIVA 2VWEE 5DRNB 5E99L 5FDWA 1D6VH 1UXSA 1UWGL 2VITB 4R90L 3MV11 3ARBC 1ZSDA 2UZIL 5FHAL 1J05A 4FQXD 4RGOH 2LU4A 4Y4KC 3W0WE 1PYWB 4XTRD 2NY5L 1ZA6B 3JWOL 3NH7L 1U92A 1R5VB 5JHDA 4PRNB 1AE6L 3H3PH 4FFZH 3V4UL 2NY0D 3WXVL 4CVZA 5J6HB 3RL2B 4TVPL 3JWDH 2Y7QA 4N9GB 3WIFA 4CVUA 4LAJH 5IHLB 2X1QA 2KKQA 4ZAKB 2CIKA 2D3VA 1MJUH 5FKAB 4TNVK 5I2IB 1A0QH 2EE9A 2ZJSL 2R4SH 3WFCL 2DQUH 3VFTA 1KIPB 1H3WM 3HTLX 4Y1AE 3VG9B 1PSKH 3MXWH 3GSUA 4XCNB 1LNUA 4U6YB 2FATL 5CGYC 4NCDA 1KCSH 4BFIB 2BHZA 2GT9A 1EMTH 5GIRB 2OXHA 2CRMA 1YZZA 5F9AC 2ZUYA 3WL9B 4JDZB 4IMLA 4TSAL 1I75A 4XPHH 1M4KA 3TYGH 4NO0B 4F37K 5TDNB 2XZCL 3M07A 4FQ1L 1K8IA 4HJJH 1II4E 1QFWL 4YDLC 5K9QG 1JRHI 1UQSA 4Y2DD 1KNOB 2Z8SA 4YR6B 1NBYA 1UKTA 3HMXL 1A4KB 2B4CL 1C16A 3NPSB 4LFHD 4QYOB 4K7PL 5HI3C 5IB1B 5DSCB 1KC5L 5F7EH 3W9DB 4ODSL 5J1AA 1OW0A 3WFEH 4QOKD 4HEME 1UM6H 2BX5A 5A3ID 1BQHA 1NCDH 1X44A 2ZUWA 4FS0A 5CJXA 1DEEA 2CSPA 1YMMB 3HRZB 1K3ZA 3W11C 3BN3B 3D85D 2EDDA 4Y5XB 2BVTA 4ZS7H 4OD2A 3GMQB 3ROOA 5E2JA 4AEHL 4ZPVB 4JFFD 4MCZB 5DD5L 1J5OL 4JDTH 4NZJA 3VFGL 3WLWC 4YEFA 1TTFA 4IIQC 6FABL 5GGSA 1T0NB 4G6JL 3GK8L 2ZG3A 4X6EB 5MEOB 1H3PL 3NCYS 4L9LC 5ISZD 4ZOAA 2CMRL 4JY5L 2OJZL 3DUSB 4FNLH 1FHGA 1M6OB 1AO7B 4FMFA 1GOFA 1M7DB 3VG0H 1ITCA 5F93C 1CF8L 4F58L 5EO1A 4K7FB 4U1NA 3GJFB 3BIKA 3PWVB 1NJ9B 4IRZH 3C8DA 1BFVL 2XZQL 5IMMB 4KTEL 1JZ6A 4RBPH 4UBDD 8FABA 1FNSH 3O3DA 3O4LB 2F53E 1KB9K 1X5AA 3S4SA 5K9KA 3O8XD 1T0PB 1G7JA 3QFDA 3ARFB 5DRXA 2FDBP 1P9MA 3MRPA 2C3HA 3X17A 4PRAB 3IRZA 4HK0A 3VGAC 2OL3B 2PW2A 2WLYA 3WUWA 1EFQA 1P1ZB 3PDGA 2GCYA 5KVGH 4L4TA 2AJYH 3RBGA 4HXBL 1W0WB 4X0KA 4CDGC 3AREC 5DJAB 5FUZL 3N85H 3ROLB 1EEZB 4YX2L 4JFPA 3UTZA 5SWSD 1TPXB 3VFWB 1NEUA 3WCYA 4O00A 4FQXA 2SEBB 3QFJB 1T5XA 4PJBF 4HIXL 2OZ4A 4KY1H 4QOKE 4U1LA 3GSQB 4PRIB 3L5HA 5IB2B 3MLXL 4G43A 1E27A 4JPVH 3NABH 3DSFH 5I9QB 4KRPC 3DGCR 1JWMA 3BKCL 2BNRE 4Y19D 4M8VA 1E4KC 2F8VA 1RULH 2AK1H 3SKJH 2BDNL 4UQ2B 3BAEL 1UKQA 5TQ2H 2BY2A 2WUCL 4I5BB 4JRYD 5FK9B 3LS4H 3O2DA 2FD6L 1G0XA 3LRHA 4JFFE 1YN6A 5EO0A 2VQ1A 4PTTB 3DNKA 3B2VH 3QDMB 2VDPH 4NNYA 4XP5L 4GW4B 4BQ9A 5EU7C 2Z9TA 5KTEH 1OP9A 4QGTA 3KPPA 5FO8B 4UZGA 4JY4A 4DGIL 5TE7L 1PBYA 4KV5E 5B39B 5FYJD 4OGXL 2WINB 2R2EB 2CIIA 3BWUC 4PGDB 1LE5A 1CBVH 3RRQA 1X9QA 2NQCA 1V7MH 4FP8H 4JREB 1F4AA 1Y6KR 1ZKAA 4NBYB 3GMPB 3KJ4C 2AEQL 1BPVA 5I66A 3FFCD 3KNBB 5ENWB 4OZGF 3GNMH 2NY4B 1N4XL 4XP6L 5I71C 3JV4A 4IOSD 4OI8A 4JRXA 1F90L 4G3YH 3INUH 3ALPA 4OD3H 3NVQA 4AMKH 3JUYA 3B9VA 1UB6B 4JG0H 1NLDL 1XGYH 1ZEAL 3CFBB 1OSZA 2Y07H 4WW2A 5TGBB 2DYPB 4OGAC 4Q74A 4Z6AT 2VABB 1MEXH 4RAUA 2X4NB 2QQNH 1PEZA 2V2WB 3ZYOA 2A1WH 3TN0A 1T4KB 1HIML 4KJWD 3BUTA 1DANU 4NHUA 4YUEH 4RMWA 3QEHB 1O0VA 4QXUH 4JFOA 1G7PB 4LCWE 4PRBB 25C8H 4NZUH 3VDBA 1GHFH 4Y8AA 4EI6A 1MJJA 1HXYB 3VXTA 5FCSH 5I15H 1YPZA 2WBJD 3MRJA 4RWHA 3VXNB 1SM3H 3BPOB 2XA8L 3LS5L 1JHLL 2EXWD 3G5ZB 2UZIH 3FQTB 3B3IA 2XQYK 4JRYE 1KPRB 3V8CA 4JB9L 5KAQF 3JWOH 3NH7H 5JXED 1F02I 1WFTA 2XZZA 1SEQH 5DLMH 4DN4L 4K07A 2AV7B 4IRSD 5ISZA 1AE6H 4OCNC 5IF0B 3WXVH 4LQFL 2FGWH 4KKCC 4F33A 3CVHA 2GJ6B 4P2RB 1EEYA 4PPTA 3D3VD 1IFHL 4DCQB 3QUYD 4G8GB 1SMOA 4LLMA 3FFCE 1JMXA 3IGAB 4GG6A 4OCYL 3QQNA 3EOAB 3S88L 4B5EA 2XZAL 2VRAA 5AD0B 5DJ0A 4ZSOB 5F9WC 3LPFA 1PY4A 1QHOA 1U3HC 2LU3A 2KQMA 4NUJA 4PJXA 2D9CA 2PUQT 3P0VL 4H26B 3RVWC 5MI0C 3GSOB 2EC9U 3PWLA 3SGEI 4QHLA 2HT4D 1CGYA 5D7IE 9CGTA 3RJQB 5SWSA 5EN2A 2NLJB 3DUHA 2BMKB 4OV5A 1MUJB 2YD3A 1CR9L 4N0CC 5CCKL 2D7MA 5FYLL 3K7UA 2YD8A 3FONB 3U9PL 2NTSP 2FRGP 3HPJA 2Z91B 3FRPA 4TSAH 2VR9A 5FKPA 5HD8C 4MWFB 1K85A 4KHTL 2DQJH 3ULVL 5D5MF 4TVPD 1K8DA 4R97C 4RAHA 1V3LA 1QFWH 3SO5A 4Y19A 3BUYA 4ZNEA 2AKRB 2XY2A 2PXYA 3D48R 1YN7A 3O3AA 1OB1A 3HMXH 1OAKL 2ED8A 1F00I 2B4CH 1IM3B 3LRSB 3P0GB 1WWCA 35C8L 1ZHKA 4ETQB 4D9RD 1N8ZB 4KUZH 1T2QH 2H32H 4ODSH 1HKFA 1Q0XL 3SEPA 1QSEB 5FECB 1X5YA 3ULSB 3VWKC 1DR9A 4Q0XL 3NFPA 4Z7VF 3RWGB 5JTWA 2IFGA 4KKBD 4QKXB 1IAOB 1Q1JL 1NSNL 4AEHH 3T0EA 4PY7B 4OLWL 4NRYA 3UYRH 3R8BB 4Y4FB 1U6AL 3D3VE 4GAYA 5GZOC 4FRWA 3QUKA 1YQVH 4G6JH 2XN9D 5F88A 5ID1B 3G5VA 3RNKA 4C56A 1LO5B 3A6BL 4IOIA 2VLLA 3OG6B 4PLJD 5AUMB 2H6PB 3OAUL 4JHWL 4F58H 3CK0L 2FLRT 2I60L 5TE4L 1BBJA 2AJXH 4X6FB 4A2MA 2XZQH 3BPNC 4KTEH 5C2UB 1PZ5B 1SJHA 1FO0L 2DKUA 4FQ2H 1CU4L 2FBOJ 3FB8A 2I07B 4X80H 1ONQA 3RVVD 5KS9A 1U8IB 1LP9B 1CT8A 3T0VA 5L9DH 3CPLA 2WIIB 4A6YL 2NYYD 2YD1A 3TPKA 1AD9B 3KYMB 5FDWB 3GIVB 4PJEE 1UXSB 4PJGA 3ZE1F 5JPMA 4R0LC 5IBTH 5DMIL 3H8NA 1ZSDB 1J05B 2NNAA 3R06B 2WBJA 5FYKU 3RIAF 2ZUTA 3C08L 3T0XA 2FIRT 2ICCA 3O2VH 1VGEH 4YX2H 2GUOA 1U92B 5TF0A 1RURL 2M2DA 4EOWL 3AMLA 1KEGL 3FAXA 4J1UA 1TZIA 4D9RE 4HIXH 3UZQA 1JI1A 1ORSB 4DTGH 4GS7C 3LKPA 4CVZB 3T09A 3BT2L 5JXEA 3BOVA 5D70L 4HUUA 3TH4T 1A8JH 1QBAA 4C57C 2Y7QB 3WIFB 3B9KC 2P5EA 3SE3A 4XMLL 2JJVA 2BDNH 4AY0A 2W9DH 3BAEH 3TH2T 5DXWA 3CVIL 1A6PA 4ZO7A 2FD6H 2DQIH 1WITA 1PVHA 1N6QL 4ZTOH 3VFTB 2KPNA 4P59L 3QUYA 1IKNC 1JGLL 4FG6C 1IGYA 1U8JA 4F7EA 3E6FA 2Y36H 2XN9E 5H37G 5C08E 3S96A 3REWB 3GSUB 2IPKA 4P2OD 5TE7H 3MFFA 4KWUA 1HEZB 4OGXH 3BZDA 1LK2B 4TUKL 1D5ZA 2DQHH 4X4YA 2GT9B 2VE6A 3GHBL 4ODUA 4DFHA 5JORA 4S1RH 1QFHA 4Q6IA 3WDHA 3PL6C 4YXHL 3ZT6A 3JV0A 1IGIL 3LDBB 4XPTH 4XP6H 4H1LG 1T7YA 1K8IB 2CGRL 4DOHB 5IB4B 1UQSB 5IHUL 4DQOL 3MV8D 3GBMH 1NLDH 1GRWA 1NBYB 4UUJA 4WIQA 4ZFGL 1ZEAH 3ALWA 1OTTD 3WXWL 1C16B 3NIDF 3OHXA 4LCCB 3GB7A 5J1AB 3MRDB 4P9HC 5IW1A 3K2MC 3RY6A 1HIMH 4WV1C 2NPLX 5DMKB 3MLTA 2DKSA 1BQHB 4CVWA 3M17A 4OFDA 1YC8A 5EOCH 1DEEB 5BRZD 3BZ4A 3QYCA 2E9WA 1OY3B 1KPUA 1H5BC 1AY1H 3RDTC 3LB6D 1YEIH 4MJ5A 3SDDC 3H9SA 3LZFL 4ELKA 1JGEB 3ROOB 4E5XA 2MNUA 1ZTXL 4D3CH 2R69H 5IWLA 1NFDE 3MLUL 2XA8H 5GGSB 2D2OA 5EZIL 1MCOL 1HDMA 3WJJA 4KKAD 5EWIH 1E6JH 3QH3A 1IAKA 2FEDD 4TQEH 3V6OC 2CRYA 4WO4C 3QUMH 5EO1B 4U1NB 3BIKB 1X5JA 3MZTA 4ZQKA 8FABB 5JMOC 3O3DB 2YD2A 4OZ4B 3S4SB 5K9KB 4XNUH 4XHQA 5H2BA 1OT2A 1G7JB 3QFDB 1J87A 5DRXB 4OLZL 5HVHB 4KU1A 4HLZG 4JPWH 1VA9A 2VLKD 3MRPB 4HK0B 2PW2B 3QPQD 1IFHH 4X99A 2ERJB 2GCYB 1WGOA 4L4TB 4P23C 3VXQA 4OCYH 2XZAH 3BYYA 4BH8A 1MLBB 5SWQB 1RIUL 1AGDA 2F8OA 3MV8E 4JFPB 3UTZB 3A6CL 4E41D 3P0VH 2E7BA 4FQXB 3FQRA 4F9PC 4X7TA 1T5XB 3WEXA 1JGDA 2OR8A 4N8PA 3OJ2C 1MHPH 4U1LB 4Z0XB 2GSIA 1KB5H 4LSRL 1L7TL 4POZC 3VJ6A 1E27B 1KIUA 4HT1H 5BRZE 1JWMB 2N7BA 5FYLH 1U0QA 2ID5A 5T33L 3U9PH 4HK3N 2MCG1 4G5ZH 5DUPL 2NY0B 1XH3A 1UXWA 4NZTL 3C60D 3IDMA 3ULVH 1HSBB 3EOTH 4GQ9L 4XCCH 5MENA 1YN6B 3MRRA 5EO0B 1VERA 2VQ1B 2NY7H 2F5AL 3VDAA 3NCEB 3WN5B 1XAUA 5GHWH 3KPPB 5CJOL 35C8H 1QP1A 5HGDB 2AXFA 4JY4B 5EBWA 5CBAA 5DVKA 1IEHA 2YPLE 1LE5B 1AC6A 2CIIB 5FOJA 4U05A 3Q5OA 3TVMD 1JZ5A 4R4ND 4MS8C 5DRWA 4ORZC 2P4AB 4Q0XH 4NYLA 3SCMC 4U1GC 2XPGA 3PJSA 4LAQH 4P2OA 4RZCA 5I66B 4WI8A 3EYFA 3V6FA 2X7LA 1NSNH 4KK9D 3VXMA 1RZJL 3JV4B 1IC1A 1JCKA 4JRXB 5FYLD 3QIBD 3ESVF 1J0IA 3JV6A 5EO9A 3TEUA 4U0RB 1OSZB 2COQA 3FOMA 1DBBL 4WW2B 2H26A 1FQ9C 3ULVD 1YEGH 3V0WL 4CN4A 1OAQH 4RAUB 3DROA 3AMKA 4MGXA 2FX8L 2PCPA 4PRHD 4YHLH 2HN7A 1KENL 4L5FL 4NHUB 1W72H 2X6MA 4E41E 1FO0H 3HMWH 3QDJE 3STBA 4JFOB 3ARDC 2RQ8A 5D7KD 1H9VA 3EYQD 4QOKB 1CG9A 4DN3H 4EI6B 1MJJB 3VXTB 2Q8BL 4F57L 1YPZB 4JFEE 2X1OA 4YH6A 3TO4D 3MRJB 3QQ9D 4EUPH 5T1MA 3QCVH 1CDIA 1F42A 5BW7C 3BSZL 3SDXF 1GGIH 4RGNE 1JUFA 1BF2A 1WTGT 5DMIH 4OM0L 3UAJD 4NN7C 4PB9H 5IVXF 3B3IB 4PJ8D 1YJDC 3PWPE 5EIIB 1P69B 4M7JL 4NNPL 2MPAL 1WSST 1BFTA 1EJOL 1F3JB 3WYRA 5KSBF 2CKNA 3KLHD 1A64A 1NUNB 5ISZB 2VYRE 4OGYH 3S3JA 5C0FA 1QLEL 2Q87A 1K4DB 1H3GA 5J9PA 4F33B 2JK5A 2LFGA 3CVHB 1OT1A 1PEWA 4WFFE 1EEYB 4OIBA 1QTYT 4AIOA 4MMXC 3SDCC 3O8XB 2HG5A 4LLMB 3SOBH 2DJUA 3T04D 3T3MF 2FH6A 3F8UB 4GG6B 2XTJD 5DVMA 3B5HA 4NQVA 2VLKA 3EJZC 5IROC 5DJ0B 5FYLE 4P59H 4NUJB 1JGLH 1NCTA 1SQ2N 4KJQD 1NMAL 5J13C 3GMRB 5IMOA 5I74B 3ULVE 2V7NB 4OCXL 2OP4L 1AR2A 3VRLF 3PWLB 3TA3A 3NIGF 4QHLB 4PRHE 3HNVH 4P3DA 4PJBE 1U3ZA 3P73A 5SWSB 5EN2B 5DTFA 1BHGA 4BQ8A 5D1ZC 5F7LB 1UZ6F 3HPJB 5FKPB 3K2UL 2EIDA 1EFXD 3UO1H 4F9LC 1K8DB 4Q9QH 4MNGA 1HSAA 5L0QC 2KBGA 3NTCL 4Y19B 4DQOH 1NPUA 3BUYB 3KS0H 2VUYA 4G6AC 2PXYB 3OB8A 3PF2A 3O3AB 1OB1B 4Y4KD 5DT1H 1JPTL 4NQXA 5I1KL 2Z31D 4G8EA 1ZHKB 2DQFA 5C70A 4XPAL 1GAFL 4HG4J 5ADOL 3P40A 5DJYA 1S7RA 1YMHB 2ICES 4U33A 1X5KA 3B8YA 1F2XK 1FFOA 4XCFH 2KUTA 3NFPB 4HV8A 4JZOA 3P4MB 2C5DC 1AGBA 1P4BH 2Z8VC 1KTRL 3T0EB 1ZTXH 3QULA 5EU5A 3QIWA 5IIEA 1F58H 2H41A 4OZGE 4NRYB 4LSUL 4GAYB 2CUIA 1BECA 5EZIH 3QUKB 3DO3A 3QHZH 1OP3H 5F88B 5CD5C 4YDVA 3RNKB 3FO0H 1CZ8L 4IOIB 2VLLB 2VDLL 2A2QT 4U1KA 3L3KA 4QLRA 3QIBA 2X41A 4AH2A 5L6YL 1BBJB 5D71L 5IT2L 3FZUC 5I6XB 1SJHB 3V4VH 4DWHA 3FB8B 1ONQB 4MJIA 1YEKL 3BDBA 1YDPA 4X7SL 1CT8B 4PJAF 4XGZA 2E7MA 4OLZH 3CPLB 3QEGH 4QRQA 5HDBE 1KEMH 1EO7A 2FCBA 2YXMA 4KDVA 1BGXH 4PJGB 5JPMB 2Q3ZA 4BUHA 2AXHA 4HS3A 5AYUH 1R24A 2NNAB 2JTDA 2WBJB 2CLVA 3GM0A 3NCBB 5DJCA 2E5EA 1UA6L 4LVHC 2FEEL 1G7HA 1FZJA 4I2XE 4WUKL 1RVFL 3B9AA 4ZFOL 5ANMA 2GUOB 5D2LA 1CS6A 4WY7H 4X9GA 1DBML 4LCYA 4J1UB 4M00A 1TZIB 2AK4E 4PJ8A 2C4FU 5AEAA 3MLYH 5EG6C 1R0AL 5HJ3A 4CUCA 4PJ5A 2VNCA 4OCWL 4HUUB 3BP5A 2NY3B 4PBXA 2P5EB 4ZODA 5T3ZL 1LD9A 1SBSH 1ZLUH 3PWJA 4YFEA 4ZXBC 5I1HL 3MRNA 5A1AA 3TBYA 4HWUA 1U8PB 3MLWL 1L6ZA 4OTXL 4GW1A 2F5AH 3QUYB 4QXGL 5DZLA 5F96L 4HWBL 5I1EH 1HXMA 1U8JB 5SX5H 3E6FB 1KTLA 2QQQA 4A6YA 1U58A 5C6TH 1I3GL 2IPKB 1QHPA 4OFPA 3ZYZA 4X4YB 3WIHL 4XB7A 3KXFD 2VLRE 4ODUB 2ZUSA 2FSEA 3MV9E 5E6YA 1A6WL 1CXKA 2KH2B 5JORB 5DHVA 4X83A 5IW6A 1Z0MA 4Z7UE 4Q6IB 3UZVB 3T4AA 4I77L 3HUJF 3MGTB 3RI5F 1FVEA 2ZUVA 3HNTL 3OBAA 4HJ0C 1FVCB 2I26N 2QLVB 1UWXK 1S9KC 4OQ1A 4UUJB 5D5ME 4HIIA 1DBBH 3ARED 3S35H 3OHXB 4YHKL 3GB7B 4IEFB 4PIRF 1QFWM 5JUEH 3BN9C 4GAGL 5IW1B 2FX8H 2MKWA 3RVTD 1LO3L 1FNEA 1RUAL 3MLTB 2ICWI 3M17B 4KKLC 3NACH 1AHWA 4LP4A 2Z31A 3BZ4B 4Z7NF 5LXGH 1KPUB 4BKLB 3CFJB 2ZSVA 1WV7T 4MJ5B 2DTSA 3HZVA 4LLYB 5JIIA 2Q8BH 4ELKB 2F58L 4E5XB 4M7LL 4UAOC 3CFCL 4ODTL 4KVNH 3C2SA 4PGBA 2BK8A 4UNUA 1A6VL 1CLZL 3VXUD 1HDMB 4OM0H 3VFNA 3QH3B 2R4RH 1IAKB 3PXJA 5FCUH 5KW9H 1A7NH 4ZO9A 4K3EH 2HVJA 1YECL 2C7UA 4NNPH 4U4BA 4JPKL 4KZDL 4ZQKB 1U8OA 4MXVF 1H0DB 4M3KB 3ISWA 5E2TH 5H2BB 1MCWM 3LAFA 2F54D 1K3IA 3D18A 3PDOA 4JPIA 4M62H 2B20A 3KXFE 4ZOBA 5KSAC 2MFNA 4X99B 1MFNA 3Q1SL 1C5DA 2DLHA 4OQTH 2Z4QA 1CL7H 3ZE1E 2A9NL 1CLOL 4QTHA 1JWUA 4XVTH 3K0WA 4LHQB 4NKDB 5CZVH 4HCRL 1AGDB 2NZ9D 4WUUD 4ALAH 2Z35A 1NMAH 2F5BL 2ZCLL 5ECJE 4F8QA 4X7TB 1JGDB 4OCXH 2OP4H 1IM9D 3QWOA 4QRRD 2GSIB 4WFHD 5D7LE 3T2NH 4JFZH 4TUJA 3MC0A 4PLNC 3HR6A 4JRWA 3SGKA 1XH3B 1KJ2H 1UXWB 3OV6A 1G7LA 4UOW1 1TCMA 1N0XH 3IDMB 1LO2L 1QBML 5ABDE 4XP1L 5MENB 1UADC 3RTQC 3V52H 1KIQA 3MRRB 4DEPC 1BBDL 5J12B 3BRDA 3VXUE 2M1KA 3GSNH 1UCBL 2AXFB 4NIKB 5EBWB 1MREL 1X4ZA 4XPAH 4MB5A 5CBAB 5ADOH 5EU7E 4MXWH 3F58L 5DRWB 3GSWA 4FQPA 1IEBA 2W38A 1KN4H 1EHNA 2XPGB 3PJSB 4P2OB 2WUBL 3EYFB 1M1SA 3V6FB 5L2KA 5ALBL 4HMEA 5FYKH 2F54E 2UUDH 3VXMB 2IFFL 5HHVL 4EDWL 3C2AL 3OXSA 3VE0A 1S8DA 1DN0A 2HRPL 2AQ1A 5DMYA 4LVNB 4NQCD 3U36A 1MH5A 3LMJH 1S9XA 4KMLB 4L3ED 5EU3A 3VFSA 3JV6B 5EO9B 3QG6A 3FOMB 1VSCA 1ZE3C 1WIPA 1SY6L 3DROB 1JFQL 2VDLH 3NIDE 4ZFZA 2PCPB 4OZHE 3A67L 5EOQH 2AXGA 2HN7B 3MV8B 1RUKL 4DAGL 2X89D 4WUUE 3VWJC 2VLJD 1T03L 2G5BA 4M5ZL 4KQ3L 1MI5D 4KI5C 3IFNH 4OSUH 1YEKH 2ICEA 2UWEE 5DJ6A 4K3GA 2M8XA 1CG9B 3F7QA 2DJ4A 4WFHE 2ZKHH 2JIXA 1WT5C 1NC2D 4UTBL 3HI5L 4NOFA 5HD8D 3LH2H 2BNQA 4K55A 1JNNH 3KHQA 5FGBC 2XICA 1U2HA 1Z5LB 5CUSH 3SKMB 4G7YL 1YY9C 3ARVA 2ZZUT 4IRJC 1E4KA 3DHMA 1I85A 3V4PH 3KPLA 4Y1AA 3V7AE 2E7HA 4OLYL 4WUKH 1RVFH 4CU6A 1OPGH 4GRLC 4DUWA 1DBMH 2YA1A 4X5WA 2LVEA 3EHBC 3OWEA 5C0FB 4WENB 5J9PB 3JV5A 2JK5B 4XZUA 3V9FA 4LNRA 4OCWH 2YS4A 3GFUA 2E8YA 4GXUN 1Q9KA 4PB0L 5F7HA 1GC1C 1UACL 2EYSA 4KUCF 3N1QC 1LEGA 3WSQH 1YJDL 4GKZA 5GZOD 2VISB 1JPFA 4NQVB 2VLKB 2ZPKH 4OF8A 3WLBA 2AABH 2IANE 1BQUA 4L4VA 4QXGH 5F96H 4PS4L 4Q97A 3QG7L 3D6GA 5D72L 1ADQH 5HDLA 5IMOB 1DBKH 5KJRH 2GW5A 3UBXI 3T1FA 5EBLA 1RUQH 2E27L 3P9MA 4P3DB 1MAMH 3WIHH 3P73B 3PP3H 1INQA 2CD0A 2Z8RA 1MI5E 5D6DA 4R6UA 4I77H 1J1OH 2W0LA 5GGUA 2I25N 2PR4H 5BO1L 1VFMA 5MHSD 1KULA 4MNGB 1HSAB 2ENSA 5T3ZD 1S7WB 2JCCB 2D7QA 1JTPA 1MWAA 4NQXB 4MD5A 5ILTL 5I1AA 4ZAKC 1IGJA 4G8EB 3PHOA 4PJFA 4YHKH 5FYKE 2DQFB 4DVRL 2YSSB 4GAGH 2LVCA 2ZCKH 2R29L 3S97C 1BREA 1ZWIA 1S7RB 5HDQL 2VDKL 3O6LL 1FFOB 1MNUL 4PBVC 1CWVA 1UB5A 3VG9C 1UYWL 3MRKA 1RY7B 1ULVA 3BKYL 4K3DL 5DS8A 4DW2H 5T5FL 2Y06H 3CJJA 4XAKD 4JZOB 1WWWX 1NGQH 4PJCF 2H45A 4HWNA 4PRPD 3MPCA 5HHXL 3IDGA 2P5WE 2F58H 1AGBB 4O2CA 3QULB 5EU5B 5IIEB 2PO6D 2CO7B 5I8EA 1OSPH 4OIAA 1MIMH 4JM2D 1A6VH 1CLZH 1XGUA 2R1YA 4JANA 4KXZI 5EIQA 4JFDD 3PGDA 2M26A 2VLME 4P9HH 4YDVB 4U6VL 4OV6F 1LEKA 1TLKA 4OUUA 3OSKA 1LHZA 4HKJA 4U1KB 3MUJA 4NQCA 3QIBB 4L3EA 4N8CH 4PLOB 5IB3A 4Z7WA 4AH2B 1WISA 4JPKH 1E6OL 3QDGA 3NPSC 2AEPL 3IDIA 3U46A 4MJIB 5E4EB 3KJ6H 2F74A 4OGZA 1YDPB 5E2UL 3DRQA 5GS0C 2GK0A 2PETA 2VZSA 1VEPA 3RUGA 2BNRA 5E2VH 2X89A 3PL6D 2VLJA 4P46D 3MUHL 4HS3B 1SEBB 1A7OL 4HWZB 5DD3H 1BD2E 4K71B 1R24B 4Y5XC 3TFKC 1EZVY 1NC2A 5DJCB 2DBLL 3D39D 3MZGB 1FZJB 3WE6A 1QRNA 2VDOL 1YEHL 5E8PA 3DOSA 4NKMA 5ANMB 4OT1L 3VH8A 1XF1A 4KMTH 3RWDA 1A14H 1FL3A 4LCYB 5E24E 1S5HA 4RISL 4PJ8B 1OP3K 1DDHA 5KSBE 4JFHD 4PJIF 5HJ3B 4PJ5B 4JN1L 3W39A 4BZ2L 2FH8A 2VL5B 3SDDD 3BP5B 1QOKA 4M6OH 1LD9B 3H9HA 3PWJB 5KVEH 1LO2H 3MRNB 3TP4A 1DVFD 3TBYB 2HFEA 4GW1B 4FQQA 1HXMB 4PJ7E 3U4BL 1KTLB 4A6YB 2XTJB 1MCNA 1U58B 1I1AD 3DYOA 1MREH 4WO4D 1A6UL 4OD1L 3MA9L 5DQDL 1NBVH 3KPNA 5HGAA 2P8MA 2FSEB 4NQUA 3VRLE 1TPXC 3ARWA 2ZUXA 5IW6B 5KVMC 2F19L 3R4DA 2WUBH 3T4AB 1CYGA 3OKOA 1I1FA 5ALBH 4P5TC 2IFFH 3C2AH 3TNNA 1FVEB 3ZZ1A 4H8WC 4P23D 3Q6GL 2HRPH 3C5ZA 2PYFA 3MUY1 5I9QC 3U0WL 4WI3A 4LARL 2BCKA 3NA4A 4HIIB 4X6BA 3V79C 1UT9A 1CGXA 4KROC 4QRPE 3UX9B 2ORBL 3RIAK 1I8LC 1QFUH 4P2QE 1A22B 4BELD 1G84A 3CLEL 5DQJA 2YD4A 2HT2C 5E5RB 3D0VA 5D2NA 1AHWB 1MCQA 2Z31B 5T1LA 1I3RB 3T0BA 4OF3A 4POZD 2ZSVB 5SX5K 1B4JH 4KI5F 5J56B 3HZVB 5FF6A 3GSVA 4HWBA 3HI5H 1WC7A 2R0KL 4PGBB 4XH2A 4NKQB 3MODH 1FNHA 4GMSL 3VFNB 2PF6A 4PRPA 1LILA 5DD1L 5HHMD 2PO6A 2HVJB 1MIEL 2C7UB 4JM2A 2VXUL 1WQVT 3L3GA 4GLRH 3QIUA 4JFDA 1ZVHA 3V6OE 1U8OB 4W68A 4X7DC 3RVUC 3RVXC 5JA9A 4K3JL 1JTOA 1WEJL 4JG1L 4OB5L 2ADJA 4MS8D 5E00A 1QZ1A 4P99A 4RMSA 4N0FA 4CADA 2YMXH 5JIHA 3PDOB 4JPIB 5J4MA 1A9BA 3OG4B 2XG5A 3MLVL 4J4PC 32C2B 4RRPG 1EBPA 1C5DB 2Z4QB 5DMGC 2DM7A 4LLQA 2CUMA 3FQWA 4QTHB 2DLGA 3BMVA 1JWUB 4XMKL 4YGAB 5F44A 4MB3A 3RPIA 4P46A 1E0OB 4PS4H 2DI7A 2J1KA 3BPOC 3QG7H 1RZFL 4X4ZA 4M7KL 2Z35B 3HZYA 4GXVH 5C0AD 3TPUA 4JY6A 4LLUB 4YDLB 4N5EC 4M48H 5TQ0L 1G1YA 5F7WC 3QWOB 2HH0H 4P2CG 1TETL 2FO4A 2IH1A 3ARDD 1S7SA 2X4OA 3G5XA 2GK2A 3CFDA 4AL8H 2R2BA 4TUJB 2JJTA 5ICZA 3IDJA 3TYFA 5AZ2L 3EYSL 1ZLVK 2BVYA 5J89A 3MV7E 4LFHG 3ZE2E 5L7XH 4ZUWA 4FXLA 1KIQB 5SX4H 3S9DB 3TT1L 1RD6A 5I16B 5F72S 1ZVSA 4DVRH 1CGVA 1Q0YL 3GRWH 1OAZL 1YYML 1DVFA 1I1RA 2R29H 3SQOL 1ZS8A 3MCLH 2EH8L 2ATKA 4URTB 5CLTA 4JLRA 2VDKH 3O6LH 3SJVA 3U30B 3GSWB 4NN6B 1MNUH 2DTML 5EUOE 2LTQB 1QA9A 1UYWH 4V1DD 1I1AA 4K3DH 4XPGL 1OQOA 2WBKA 4MA7L 2YUWA 3U1SL 2DM4A 2RFXA 5HHXH 4LCIL 4HCRA 3CMOH 3DYMA 3SDCD 2L7UA 3OXSB 1I1YA 1KPVA 3ZTNL 1S8DB 1DN0B 15C8H 3HUJE 4XHJC 5GGVL 1MH5B 5C09D 1S9XB 5EU3B 3U36B 3B83A 3VFSB 3EJZD 3JVGC 4XWOC 3AUVA 3QG6B 2OTWA 4HUWA 3VGAB 5I18L 3EDDA 4NGHH 5L8KB 1LO0L 4HEPG 5E8EA 2EDRA 2A6JB 3H42H 2VKWA 4X6CA 5J06A 4ZFZB 4YXKH 3CCHA 3EIFA 1NGWA 2AXGB 1A9EB 1GOGA 2YN3A 1K5NA 5F9OH 1JJUA 2G5BB 3KPSD 3D5OF 1MCWW 4R96A 2ICEB 4NKOA 5DJ6B 1H3TA 3NCCB 5HGGS 4WU7A 3TBWB 4C55A 4FFWC 3MRGB 5IQ7H 2IALB 1QYGL 4NWUL 4ELMA 1HYSD 1A7OH 4NBXB 1AH1A 3VGBA 1BVZA 1NUGA 2DBLH 1IC7L 5LQBH 1U8HA 3OAZH 1AXIB 3KPLB 5IW3A 5I1LA 3LKNA 2J4WL 4Y4FC 1B6UA 4OM1L 1UWEH 1AXTL 4HF5L 3EFDH 4MXQC 2K1MA 5C9KA 4ONGL 4X5WB 3U9UA 4P4RA 4RISH 2WANA 1B0WA 4PJ9D 4MXVE 4ZS6D 5ACMA 1XGPA 2B1AH 4Q9BA 3IDYB 3RWIA 3OKNA 4XZUB 4LNRB 1TJHH 3PP4L 3QSKB 3HS0A 3WNMA 1Q9OA 1NBZA 3CSBA 1SY6A 4JQXA 4V1DE 1Q9KB 2OSLA 2QQLL 4OZIA 1LEGB 1T0MA 5B38G 1JPFB 2VXSH 5H37H 1VFAA 4HX1A 3WLBB 4DGYH 3RQ3A 2AI0H 4L4VB 1G6VK 1KFAH 2ICWA 2X5PA 4OZFA 4XVJL 5CD5D 4UIMB 3U4BH 2AGJL 3MLSH 3THML 1DEDA 4JM4H 3ZYIA 1A6UH 2O5ZH 4EBQL 4MSWA 2HJKA 3T1FB 4LLVA 5EBLB 4POYA 3NFSH 3G6DL 3P9MB 3CX5J 1QPPA 5A2IH 2YUVA 4H1LH 3IJSA 1GC1L 1INQB 3HAEH 5TPWL 1FFPA 2F19H 1F4YL 1F4XL 1TQCB 3OKLA 4QRRB 5DEZA 5GGUB 3P4NA 4YHIB 3DARA 2APXA 1S3KL 2R1WA 4JQIH 5FHBL 3GJEB 2DLFL 1F3RB 4S1DD 1HH6A 4X6DF 2EDJA 3O3BA 5JIPA 5F7FA 1ORQA 3HE6A 3P3YA 4UU9B 3QPXH 4UV7L 4UTAH 3PHOB 4PJFB 2ORBH 4WW1A 4K23L 4N8VG 3LPGA 1ZWIB 1KJ3L 3GO1H 1VPOH 3C6SB 4M9PA 2QHRH 4KHXL 1UB5B 2VZVA 1EVUA 1YEDB 3X3FH 5J0BA 5D1QD 4K9EC 3D2UA 3H2WA 3BQUA 2JKXA 1DLHA 3UPAA 3IDGB 1CDJA 4LGRB 1KUMA 3WIIH 1L7IH 2EKSA 3ARXA 1FE8L 7FABH 4O2CB 2YWZA 5I8EB 5FV2A 4HJGA 1IGCL 1ZGLP 1OAUL 3OKDA 4OJFH 1VACA 3NN8B 2R1YB 1H3UA 4JANB 5HYSG 4MAUH 3PGDB 3PP3K 3WV0A 2PYED 5ALCL 5K59E 3LDBC 1LEKB 4MJ4A 4OUUB 4RCAA 2HLAB 5L88H 4D9QD 4HKJB 4NQCB 4Y88A 5C09A 4L3EB 3QEQD 4Z7WB 3OKYA 4G8IB 1EHAA 4HLJA 1KCRL 5IROA 4MLSA 5F9WB 4LHUA 3U46B 5D8JL 3G5YA 1OW0C 2F74B 3VCLA 3FT3A 1T1XA 3DRQB 2GK0B 2EXYC 1RJLA 3RUGB 5I8OL 5MI0B 5CJXC 1RUMH 2VLJB 1QNZL 1CDUA 3BHBA 1MI5B 4Z7OE 3MMEA 3VXSE 5IFAL 1DE4B 2EYTA 1NC4A 4I3SH 5IR1B 4HJ0D 1NC2B 4WCYL 4IDJL 3ARZA