4H20L

Crystal structure and computational modeling of the fab fragment from the protective anti-ricin monoclonal antibody rac18
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
b'DIVMTQSHKFMSTSVGDRVSITCKASQDVTSAVAWFQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYGTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain of Fab Fragment from the anti-Ricin Monoclonal
molecule tags Immune system
publication title Crystal structure and computational modeling of the fab fragment from a protective anti-ricin monoclonal antibody.
pubmed doi rcsb
total genus 49
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2012-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20L01
1RPQA 1K6QL 4IIQC 3TA3A 3BX7C 2BNUB 2ITDB 3RVXC 3K1KC 1WFOA 3HZKA 3N1PC 5MEPB 2VH5H 1B0GA 1T5XA 5MI0B 4ZUUA 5HVFB 1ZANL 5TQ2L 3MLTB 5FGRA 2VKWA 1JYNA 4XP1L 3RU8L 4X5LA 1E4XH 3BRDA 3TJEH 3F12B 5HGGS 4C59B 5C0EB 3RNQA 1K3IA 3T08A 1QSFA 3IJHB 5C2UB 1FG2B 5C0CD 1MFAH 4I0PD 1SEBB 3U46A 1UXWA 1L9NA 1BLNA 5BS0E 4PLKD 4WHCA 4YNYB 3UTTE 4UIKH 5LGKA 1D9KB 1UB5A 4L8DA 1SVZA 2NX5B 2Q7NA 3U0WL 1F11B 3DRQB 3VFTB 1GJIA 1FZOB 5INDA 1S7XA 1H3GA 1NBVH 5I30L 3GSRB 5F1SA 3MJ7A 3CLFH 3NPSC 4WRLA 1LO2H 2DIBA 3QFDB 4OFPA 1CDBA 2VDOH 2GFBA 3O6MH 4XPAL 3TVMD 1I8MA 5F6IB 3RRQA 3S36X 4YHYC 1MIEL 4LP4A 1MI5D 5LWYH 3KPNA 3PWNA 1FE8H 3STLB 3MC0A 4PRIA 1SYSA 3L1OL 5CHNB 5EIIB 1AHWA 1KXVC 1M7XA 4L4VD 4PY7B 4H1LB 5C07A 3FQWA 1C12B 1UWGH 4NO5A 4LGPB 4P2OD 5DZLA 1KACB 4OD2B 4L4TE 4POZD 2R0KL 1AGFB 2YXMA 4PPTA 2ESVE 4R7NB 5BQ7A 1E4WH 1J86A 4NZRL 2SEBA 3DUSA 1X6LA 5C2BH 4PJEF 1AD0A 4UZGA 1RHHB 2FBOJ 3RL1A 4J23A 5D7SL 5KSAD 5KSUB 5CJXA 4KDTA 3BEVA 3FQUB 3REWB 4Z9KB 3MJ9A 4GKOA 1U8KA 2AJUL 1KT2B 3ARBB 1MLBB 5A2JH 1FH5L 1R3IL 3LD8B 3C2AH 5CKAA 3QXDA 5F1OB 2OTPA 3LEVL 5K9QG 1NCWL 3AM8C 2CLVB 3T0AA 4XPAH 5GZNC 1KPVA 3QRGL 4ZUTB 3O6FB 3A67L 4AEIL 1MF2H 1YNKL 3MRFA 2I9LB 3VD9A 1QSFB 3IJHA 4PS4L 1K5NA 3CVIH 5BOPA 1ES0A 5FYJD 2QQQA 3EOAA 4WFHE 4HFWB 4MNGE 3S36L 4PB9L 1I8LC 5F1KC 1IGTA 4N5ED 4EI6B 3EJYD 1TZHA 1XF4B 4RQQA 3V4PH 5FGSA 1CFNA 4L4JA 3RWCA 3BT2H 5DVKA 3VWJA 4OI7A 3FJTA 8FABA 4JKLA 3V79C 2F54D 2R8SH 1BZ7B 3MJ7B 2AJZA 4LLDA 3M17B 1HZHL 4J6RL 4KKCC 4JY6A 1G7IB 3T4YA 3S88H 1FL5A 1OAZL 2CKBL 2VOTA 3MRIA 2WLZA 1TETH 3HPJA 4QLRA 1NMCB 3ARXA 1EAPB 2GAZB 5FXCH 5I19H 1DBKH 4NHUA 4HAFA 1SBBA 2FJGB 3KYNB 4NM4H 2GJ6E 2F5AL 2Z91B 2F15A 1NGPL 1JGEA 4HD9A 5BW7A 1CTNA 1NC4B 1IM3B 3P2TA 4N0YH 1YECH 4I9WD 3ZZ1A 3QXWA 2Q6WA 4OLZL 1C08B 3NIGE 4J8RB 4O2EA 1L0QA 2BNQB 4P57B 3WNLA 4JLRA 4HS3B 1IQDB 4G6FD 4CMMA 4LARL 1IKFH 4LVHB 1MI5B 4HIJB 2ICCA 3RL1B 2HKFL 5DK0B 3WO3B 1KFAL 1NEZG 3Q6GL 1BX2B 2DLFL 2DM7A 3QPXH 2LAAA 4LOUC 3UBXG 4MCZA 2BHYA 1TQCB 3FFCA 3LQZA 3QHZL 4KVCH 1INQA 1IE5A 3V5HB 2DQDL 5BOZG 2FLRT 5JQHC 4NKDB 2EC9U 1T80A 3BPCB 3C6LB 5CD3A 4PJIA 3UEZA 3P9WB 1G6VK 3ORJA 5EU3A 1J12A 5JHDA 1OD7A 3MRNB 1D5XA 1J05A 3VFSB 2QHRL 3T4YB 4JREB 3VXOA 3FAWA 2AKRA 4M6MH 3ARFC 4X5XB 4M7JH 3ZYOA 4OIIL 4APQB 3BRGC 3CFCL 1TVHB 2DJSA 3VRIA 2AEPL 4HIXL 3EYQC 3U7YL 1FFQA 3OKDA 4BSJA 3HLAB 2YD6A 3W0WD 1FIGH 4XRCB 4P2YA 3HE7B 1S9WB 2CPCA 5F7EL 1T1ZB 4HUMB 4NQCD 4OTXL 5FYJU 4PRDB 4JFPB 4H25B 3SJVD 3HC3H 2G60H 4WY7H 4MXQD 3IFLH 5DT1H 3VFNA 2F8OA 3TN0D 1MJ8H 5E9DA 3B43A 4ODUB 3LQAL 1IEBB 2FGZA 2X42A 1Z9OA 1Q9KB 1KBGH 5CZVL 4JN2B 1J7VR 3TBYA 4KJWD 1NPUA 2R2EA 4P4KC 5DK3A 4HUKB 4ZTPL 3UJTH 4PV8B 2X4NA 3MBEC 1ORSA 1YDPB 1FGNL 4PGDB 1VHPA 1QO3A 2I25N 4H8WH 2RFXA 1UJTA 3QQ9D 3GSVB 4P4KA 4OZHB 3QEQB 4CBPA 3MJ9H 1ZSDA 2L7JA 1J1OH 4D94A 2AK1H 3LKOA 4JB9H 4BYHA 2JCCE 1HNGA 4MGXA 3SOBL 4P3DA 4IRJD 2K3TA 1J0KA 5IFHH 2VZ1A 1DBAL 3FB7A 1CR9H 1OGAA 1WAAF 3GRWA 4KRNA 3V5DB 4Y4HC 5JDSB 2XWTA 5ENWB 3GMOB 5BVPL 3ILQC 3KLDA 4S1QH 1PLGH 4UQ2A 5TE7H 4LP5A 2YN3A 3SKJH 5C3LD 2O5ZL 3FO0L 2FX9L 4Y7MA 4YIQA 1WWCA 4MCYB 4U6HB 4WFEE 2YPVH 5D6DA 4ZDHA 4K94L 1FZKA 3KLHC 5SWSD 1HZHH 2YD4A 2IFFL 5BVPH 4PGBA 2BSRB 4FTVA 3UPCA 5H94B 3OKKB 1IGYA 3SO3C 1NGQH 1DBAH 1OP5K 1ZWIA 2NW2A 1X5LA 4Y4FD 1EEYB 3OJDA 4RGOL 2OSLB 3MQIA 3AUVA 1GHFL 4Q9BA 3Q2CA 4X4YB 1AD9A 4U6XA 1VERA 2BVQA 4P5MB 4LU5L 2OR7A 3BP4B 2NLJA 4KKBD 1MFBL 2X4QB 3SE8H 2BY3A 3U30C 5TFSL 4FXGA 1UB6A 4NO0A 1MH5A 2J8HA 5TGBA 1L0YA 5EBMA 2ZSVB 3PIQA 2AJXL 4WI9A 2OZ4A 3CXDL 2OZ4H 5GISH 4LIQH 3T77B 3NAAH 4PV8A 4LHUD 5AYQA 2GYSA 3KPOA 2WUBH 4NNPH 4JDVA 2ZJSH 4NBXB 5J3HD 2VR5A 2F53D 2Z8RA 3HFMH 1O5DT 1NGYA 3LV3B 1GH7A 5I76A 4O9HL 3SPVA 3VXRA 5FF6A 1N5AA 3QDGD 5H94A 3I50H 4BK5A 5LGHH 4MAYB 1I8KA 2JJWA 4PJ7B 1UVQB 4N1HB 4F7PA 2FJFB 5C0BA 4U05A 3SDXA 5ICZB 5JOPD 1KCLA 2PKDA 1H3UA 1W0YT 4EDWH 2H8PB 1TXKA 1LO4L 4DOHE 3BXNA 3V6FA 2YRZA 1OSPH 3U0PB 1C5CL 1IAIM 5JR1L 1O0VA 4LLWB 2H3NB 4EJ1C 4DKDC 5DC9B 4QTHB 4OQTA 5B21A 5JW5A 3FZUD 2BNRD 2QSVA 4JPKL 5I1EH 4EQ2A 2VZVA 1PAMA 4WV1B 3V6OE 1NAMB 4PJGA 1WIUA 3S37H 3VWKC 2I27N 1B90A 3QUXD 2HTKC 2DN7A 4MAUH 4UTBH 1KFAH 1S7XB 1YN6A 2X10A 5DF0A 4TUJA 2Z31B 4HWNA 5DLML 1DDHB 5C8JA 2IQ9H 1CVSC 5BW7C 1I1AB 4GAFB 3UTOA 3ARWA 1OB1A 3EJYC 3BEWA 1NGYB 3QQ3A 1JPTH 4YE4H 5FCSH 3SDDB 5CEZL 5DQDH 1UENA 4KJYA 3GGWA 4TRPL 1AC0A 1T66D 1GAFL 4FABH 4FQIH 3UJIL 1QFPA 1BQSA 3RUGE 4XZUB 5JNYB 1NAKH 2YZ1A 4AT6B 3T4AB 1JPSH 4ZS7L 1B4JH 1YC8A 3VU2A 3DV6B 2WBJA 5I19L 4BH8A 4OCXL 4FABL 5CUSL 1GAFH 4M02A 3S34H 3Q6FA 4O51B 1T7VA 3U4AA 2BY2A 1NCTA 3L3JB 3WLWD 4Y8AA 4TOYH 5GRYA 4RFOH 4BJLA 1KB5B 4PJFA 4Y88A 2JJSA 4Y4HB 4IDLA 2DQTH 5IHUL 4YFDB 4Q0XH 3NA9H 4WCYH 4KJQD 1GCFA 1HHIB 1A7NL 2RB8A 1B6DA 5D2NB 1DDHA 5C8JB 3LOWA 4P5TC 4TPRL 3EUUA 4ZSOE 1T7YA 1BZ9A 1PG7L 4WI8A 2G9HB 4M1GL 3E1F1 1ERNA 5FYKU 3WEXB 3MRIB 2AEIT 5TE4L 3MJ8A 4XP9L 1IGJA 3WDHA 1LO3H 3A6BH 4NHUB 4QOKD 4YHMH 3RVTD 5E8OA 1DLHB 1F3DH 5HBBA 5K9OA 3EOBA 4J3WA 3D0LA 3QJFB 4JFOB 5T1DL 4GAGL 3UO1H 3BUYA 5C09D 2WBJB 3GUTB 3DRTB 1CFBA 4O5LH 4X9BA 2QQNH 3KR3H 4KQ3L 4Z78B 1BECA 3SDYL 1CT8B 1CLYL 4YFLI 3BJLA 4OF0A 2AJZB 1OAUL 3OAYK 1O7VA 5C0IB 2IEPA 3TO2A 2BSTB 1WAAE 5GGRB 5F7DB 4XI5D 5EOTB 1E4WL 3H6JA 1XR9A 4JFQB 2G2RB 3QP3A 2ZJSL 4NKOA 3D39D 1Q0YL 5KN5B 2VO5A 2EIBA 3DMMD 4M7LH 2QL1A 5D72H 3X12B 5C0AD 4CMHC 1EXUA 1N2RA 1KPRB 1INQB 3OAUL 1FAIL 1FQ9C 1HKLH 4C83B 5IF0A 2CR6A 1FV1A 4LSTH 1X9QA 5FK9A 2VB5A 3IGAA 3SDAD 3RTQD 2GK0A 3SE8L 3AREB 4XCYA 2B0SL 1HHKA 5IWLA 1GGCL 4FFVC 1E0OB 1RK0A 4X4XB 4HW6A 4G80B 5E1AB 4HPYH 5DMGC 1F4YL 2H45A 4UV4H 4EN3D 1I8IA 7FABL 4QHNB 5E5UB 4JZNA 5JXEA 2ZG3A 3GSXA 4HS8L 1EGJH 4OJFL 1FGVH 4X6DA 5I1HL 5IT2L 2BMKB 4C55A 3KLHD 5I8EB 1KCRH 1F8TL 4V2CB 1ZLUH 3ZE1F 1YN7B 3ILQD 3TBWB 1D9KC 4LF3B 1U8HB 4GKNA 1E4XL 5HY9B 2D0HA 3MRBA 1EZVY 4PUBH 4QF1A 1EO7A 4MQTB 1Z5LA 3W9EB 2GK2A 5CIPB 5EPMB 3MNZA 5IK3A 4AIXA 3V8OA 4U0RB 3ZHDA 4NC1E 4PRHE 5FHBH 4NN5C 1N64L 5MENA 2P5ED 4HF5H 4U2YA 3T8XA 1UKSA 1YQVH 4M93C 5I8OL 1FZOA 2AJSL 6FABL 4HFUL 1CGTA 4E41D 4OFKA 4ZOEA 4ZFZA 3BJ91 4YXLL 5JHLL 5F7DA 2XG4A 5EN2A 3WKML 3BKYL 1F6LL 4TTGA 1Q1JL 4OKVA 4KY1H 4LVEA 1QSFD 5EIVA 3BZ4A 2JE8A 3VFOB 1J10A 3QDGB 3LQMA 4JZNB 2ZSWB 1QBAA 1OARH 3WYRA 5ETUB 3WN5C 1AC6A 3NCEB 1N59B 4HH9B 1OGAB 4QO1A 3IU3A 2KZ1B 1C5BH 4XAWL 3RHWF 5A3IC 3KWWB 5IGXH 2NZ9C 5AUMA 4KZEH 2EEAA 4Q74A 4NRZA 4M48L 5D7LE 1KNOA 1FFOA 2VIRB 1JWUB 2G75A 2Y06H 5EUOB 1A7NH 4P4KB 5I9QB 3KYKH 3QG6A 2FJHB 1JJUA 5ALCH 3RWGB 5CIPH 1B4RA 2RIKA 5A1AA 4K8RL 1FL3A 1UJ3A 4Z7OE 1MPAL 2CXGA 2XIDA 1NLDH 4R3SA 4M8QB 3IDXL 4WFHD 3WDIA 4LASH 1HSAB 3RX7A 5CJ5A 1BOYA 4HIXH 5CZXC 4J2XA 4XPFL 1M6OA 5E2JA 1HQRB 3BO8B 3ZT6A 5TJWK 5IIEB 1CU4L 5DEGB 1G7LB 3I6GA 2I26N 1AQKH 2YOCA 4JZOA 4LAQL 5ICYB 1I1FA 1VDGA 4OBRA 1XGYH 2CKNA 2DYPB 2A6IA 4QXTA 5IMKB 3BAEL 4S10A 3PGCB 3FKUS 1XGPB 2KH2B 4WUUA 4O58H 5D1QD 3VFUB 1UA6H 4KDVA 1BFVL 4GAYB 1MY5A 1H15B 3L3KA 5DWUL 5GZND 3V0AC 4UMGA 1FAKT 4EXPX 2BP3A 3BHBA 1MQ8A 5GS1B 4ODHL 1YEGL 5J1TC 1JNNH 4OZGA 1JE6A 4M8VA 1NFDB 1BIIA 2ENYA 3P73B 4QRQA 2ZPKH 2RGSA 4KC3B 3MCKA 2ZSWA 1A22B 1B2WL 5DJZA 5JOEA 3KLSA 1MH5B 3HMXL 4MB3A 3MGTB 3M45A 2YA0A 4M3KB 4DZ8A 4K2UL 2MOVA 1X5JA 3BKMH 1F4XH 4ZPVB 4U6YA 4ZNEE 1DUYB 5CILH 4KUCD 1JUFA 3VG9C 1OF2A 4JY4B 4OZIF 1OQOA 5F9AC 2CRIA 5IW3A 1EERB 3EYVA 1OHQA 5SWZB 1FJ1A 1OSPL 5CMAB 3ULSB 4G9FD 3P11L 1OGTA 3CDGA 1DVFB 4WHYG 1X5ZA 4YX2L 3T65B 5HHNB 3DBXA 3Q5TA 2WBKA 3ROOA 4LSQH 1QUNA 3U9UB 3KPQA 5E03A 5DRXA 2MCG1 4ZG1A 1NDMB 1G7QA 4X8XA 3GSOB 5KVEH 1G6RA 2ESVB 4WI4A 3MLZH 25C8H 1U9KA 5IW6B 5CJQH 1I9IH 3MCG1 1EVUA 3P0GB 3P0YH 3C60A 4ODBD 1F2QA 2VDML 1T2QH 2B2XL 2VMFA 4XCFL 5E2WH 4HQQH 5EORL 2F74A 4PJCA 1VFOA 5CJXC 2BVPB 2OMBA 1Z0NA 5CBAA 3D0VB 4O02L 2AK4B 3MRMB 1I1FB 4S2SA 3I6LE 4C56E 4R26L 5I74C 1TQCC 1TNMA 2BVYA 3THML 3AY4C 5CAYB 1IC7L 5I1AA 1W0VA 2E9IA 3T0EC 3UBXA 4OI9A 1U8LB 3ALPA 4LLWA 4C58B 4QRRD 1QLEH 1LHZA 3FRUB 3VXSA 3W11C 2MQ3A 5JQ6L 2H32A 5DQ9A 2H1PH 4XBGA 1HILB 5IQ7H 2DQJH 5DJYA 1R24A 4HKZB 4C57C 2HLFD 1XR8A 4TVPD 1T3FB 3O6LL 4MX7A 1P4LA 3IU4L 1Y6NR 3LEXB 3P0YL 3QIUC 4NN6C 2YMXL 3F7VB 4XZUA 4Z7UF 2J8UA 4QRTB 5DS8A 3UAJD 3UTSE 1MCFA 4Y4FB 3D6GA 3EOTH 5E95B 5DD3H 1R3JB 4R8WL 4G6FB 5DYOA 5HHPB 3MA7B 4K3JL 4PRIE 1I1RA 3CFEA 1Q9LA 4RCAA 1U2HA 4ODSH 1ZGLP 5KW9L 3G5YA 1LWRA 2JIXA 4NZUL 2OJEB 5AAMA 2IPUG 1ZLVK 2P47B 3E8UH 4JQIH 4S2SB 2ZUSA 3DX6B 3MV9B 2P43B 4G8EA 3DECA 1CR9L 3K3QA 3RNQB 1M7DB 3JV4B 1U8QB 2OP4L 3SOBH 1IM9A 2HKHL 4LSSH 4L8CA 4TN9A 2A73B 3VW3L 5TQ0H 4Y5VC 3ARZA 1KTRL 4LLUB 2NZIA 2GUOA 5ESQA 3QIUA 1MJUL 3U36B 4BELD 3ESUF 3MYJA 3V8CA 3UZVB 5INDB 1IQWL 2HN7B 1ZLSL 5CD3B 4OSUL 2JELH 5ID0B 3KXFA 3QUKA 1YMHA 5CINL 5C0AE 1GC1C 1P4IL 5HGAA 2B8OT 3I02A 3UTTD 2W65B 1FP5A 1MCQA 1GPOL 2HTLD 4P2QD 1U8MB 1NFDE 3QZWA 1T0NB 1FVEA 4U6VH 4KKCD 1NFDF 3LSOB 4PRHA 3ELAT 3BH9A 5IFHL 3BD3A 4OCSL 4K7PY 3PG2A 1XGYL 3C09C 3N1FC 5IMLA 1P6AB 2GW5A 5IMMB 1X5FA 1VEMA 4OLXH 5T1LA 3SGJC 1AIFA 1G9NL 3O3EB 3WFHB 2W38A 4K9EL 1MWAH 5T3ZE 1S9WA 4F37F 4Z0XB 5DGRA 2BXZA 1CF8H 4G5ZH 3MV9A 3QNXB 3HZYA 2EIDA 3ARQA 1T1WB 3UO1L 2J5LB 1EXUB 3CFDA 5GJTL 3ZE0F 1JV5B 4KVNL 1TVBB 1VACA 3Q48A 5KOMC 1RZKH 1ADQH 2CO6B 1L4IA 1OVZA 1ADQA 1IBGH 4XPHL 2E6PA 2O5YL 4D0BB 2FHFA 2V5SA 4M6ML 4OV5B 4Z8FH 4I3RL 4P2RE 5ELIA 1MJ7L 2LABA 4G8GD 4JN2A 4NCC2 3EDDA 3PUCA 3RKPA 1LVEA 3QNYB 2H26A 2FBJH 2O5YH 4MNQD 2VABA 3QPQC 3B9KC 4U1GC 1E6JH 3JV4A 1U58A 1KT2A 3ARBA 4YXHL 3TNNB 5E1AA 2DM2A 4LQFH 3WNKA 5DRZB 1K4CA 1N6QL 1CD8A 4C56A 1KN4H 1PZ5B 2P44B 2EIZA 3BVNA 3NBNA 1AQDB 5LXGH 2Z0BA 3SDXE 4P2OC 32C2B 1Q1JH 1YNTB 5J3HC 4QRPD 4HG4J 5ID0A 4M43H 1MHPL 1D5IH 1I9RH 2O61B 4MAYC 3QEHB 3QQ4A 1CLZL 4OCXH 1G7MB 3BZEA 5FGCE 3MNZB 4Q97A 4GAJH 4XH2B 1CDHA 1ZGLM 3HCVB 4I13B 4MNQE 4RDQG 2LTQC 4HF5L 5TH2B 2R23A 2ZG2A 1NCBH 1NC4D 3QULB 4OZIA 3RIFF 1YEEL 4FQIL 3UJIH 1A02N 2NY6D 1JGEB 3NTCL 3OWEA 1XF2B 4GKSB 1REIA 3KPSD 4FQQB 2DQIH 3TNMA 4I0CC 4PP1D 5AUMB 4RWYL 2QSTA 2OTUA 3X11A 4BZYA 3GMMA 4DW2H 2YD8A 3X3FL 4MA3A 4WWKC 5F7WC 4GRMB 5SX4H 4AT6A 2WBWB 4J3SA 1H3PL 5ERWB 5E6IB 2F58L 4IM8A 1DLFH 1MFCH 5AD0B 1BQUA 5KZCB 1HSAA 3EFFA 4CDHA 1JF6A 2RHEA 4EI5C 3AAZA 5EBMB 2HJFA 2VAJA 2IPKA 4PJ9A 5D9SA 1F02I 3BGMA 1Z9MA 4YBQD 5D1XB 3PV6B 4X6EA 2RCSH 2CIKB 5F9JA 5GGVL 2WAHA 2H6PA 4NWUH 3U46B 2Y72A 3OQ3B 3V7MA 1LP9A 5C0NC 1HHIA 4GW4B 2VXTL 3LDBB 2VISA 3RPIB 5HYEA 1WBYA 3RIAK 4U1MB 3OKDB 4TNWK 3RGHA 3O6KH 2LVCA 5BV7H 1JGUL 1U3ZA 2CUIA 2ADFL 3G04B 1AY1H 1ZA6B 5E08H 1Q94A 1S7VA 4A2MA 1I3RB 3GBLA 1ZK9A 2E9WA 5AWNL 3HAEA 4O2FA 2HFFB 2OR9L 4FQXA 3K8LA 3V52L 2OZ4L 1XGRB 2J88L 2VKXA 4M61A 3W0WE 4ONHB 3L1OH 4RAUB 4PB0H 1LO3L 2YPLB 1QRNE 4WW1A 4YHML 4XRCA 4NQCE 2A9MH 5C07B 4RZCB 4GRWE 3UDWA 1OCWL 3WIHH 3VH8G 2PO6C 5BO1L 4HCRH 3MLYL 5MP6L 5SX5H 2EYSA 3BHBB 4ONGH 3FFDB 2FWOB 4GXVL 3KPMA 3WNOA 3MLSL 4KAQH 1MRCH 3FTGB 4O4YL 2QADC 3REWA 1I1AA 3N1GC 4QT5A 4KK5C 2B2XH 4RGOH 4Z7WE 1XCTA 2K7QA 4GMTL 4CRPA 1A6AA 1KPVB 3QI9C 2W07A 2YD9A 2IH1B 4RMRA 2PYEB 1ZGLB 3EDKA 4FNLH 4TULH 5DJ2B 4DEPC 2R9HD 3BKCL 4OQTH 2AABH 3N85L 4F58H 5IJKC 1TJIH 1JNLL 1RUAH 4CNIB 4ZXBB 2GTZA 3OXRA 4R2GC 2VAAB 4JKPH 4YZFE 3RWCB 2NY4B 1F00I 4L8BA 5HYJB 3ROOB 5CS7A 1IGTB 2VR4A 5CILL 2NY2C 2D0GA 4LSRH 3BKML 4PGBB 2JIXD 1KCUH 1ZT1B 4ZFGH 3L3GA 4K3EH 2FGWH 3RPIA 3V6ZA 1SMOA 1U6AL 1R5VB 4PJAB 3WL9B 1RJCA 4LLQB 4NQDE 5JLZA 1LE9B 5IBUB 1S7TA 3LRGA 1CS6A 1UB5B 4L8DB 1EAPA 2OK0L 5BZDB 1NUNB 1JHKL 4HIHA 4U1SA 5ITFB 3GSNB 1SJEB 4S1RL 4MDJB 2EC8A 3GMPA 3BDYL 3QUYD 4NKIH 3I9GL 5D93B 1IAIL 1BFVH 1HEZA 4ETQA 4ESKA 1I3GL 2BC4B 4OB5H 3H3BC 4Y4HD 3VRJB 5EOCJ 3RZCD 3VI3E 4PJDF 3SCMB 5HYJE 3PIQB 3B9KA 4NFBA 1D5BB 1JK8B 5HYIA 2IF7A 1PFCA 4H1LH 3RWDA 4LAQH 4NNXB 1P2CA 5L8KB 4MQXD 1IILE 1CFQA 3FB6B 1VKXB 1JRHL 2NCMA 4ZUSA 3N0PB 3T2PA 3HN3A 1EFXD 1R3LB 2R39A 3EJJX 4WEBL 4XPFH 1GPOH 3QQNA 4W6YB 5KS9E 2SEBB 3C5ZA 1T1XB 4Z0BL 1YPZE 3QCVL 1DP0A 3AFLA 2Z4QB 3H7BA 2IH3A 3I50L 1KLUA 3M07A 1XGQB 3O4LA 4XWGL 4TNWF 1F97A 4QHUB 4XVUD 5B38G 2ED7A 4OFYA 5C0DB 4PRPE 1EEUA 4PJCE 5CGMA 4KRPB 3E2HB 5BS0B 3PP3K 4R6UA 2X1QA 4L3EA 1YYLL 3LMJH 3U6RA 3QUKB 4GLRI 1VCAA 1IZKA 4NFCA 4UINL 1FN4A 5BV7B 1A5FH 1I7ZB 4N8VB 2FJFA 3MXVL 4JPVL 5C71A 4NC0B 4YH6A 1BMGA 4GXUM 1WT5C 3IJSA 1IFHL 1ZA3A 4ODSL 1J1PL 3BN3B 3QI9A 3T0EA 4L8CB 4LU5H 4Y16C 4OLVL 4X6FB 3TZVD 1VB9A 3T2NH 4WGWB 4CW1A 3D25A 3K74B 2CDGB 2J8OA 3PHOB 3GMPB 1VFAB 2F9BT 4ZXBD 4O2CB 5C1MB 2AJSH 3HZYB 3G5VB 3UXFA 4N8PA 1MRCL 3VFVB 3OKNA 2QV2A 3CFDB 5FHBL 2NXZD 3FMGH 3BMVA 1X3DA 1QKZH 3GI9L 5IMMA 4PJXB 4OBSA 4WENB 1HQ4B 5IW1A 1T6WA 1QFWI 2FECI 5HI3C 5C0RH 5E2VH 3LN9A 4EI5D 1I1YB 4K23H 3BGAA 1DUYA 3KS0J 3L3JA 5C08E 4WO4C 3SDCA 4UQ3B 4PBVC 5A43C 3GMNA 1RZIB 3TM6A 4YHZL 1NGWA 4G7YL 5A16A 1KTKE 2NW3B 3QAZB 2ESVD 1RZJL 3EW3B 3RA7L 4ZO7A 1T1WA 4IRJA 4A6YH 3KXFD 4JANB 5IHBA 1LILA 4Y1AB 5T1KB 4QXWA 4RRPA 1VACB 2DTMH 5EOQH 5C07D 1T0PB 4XCFH 5EORH 2YPLD 1JNHA 4ZOBA 2VDKH 2EC9T 5DDHA 3PGFH 4ODWB 4M62H 5JW4R 4AEHH 4UB0L 1KEGL 1D5XB 5CJOH 1CICD 5CSZB 4PJEE 1JHLH 4Z5RA 2P49B 3Q1SH 1M7IA 4IS6B 4FG6D 2BNUA 4KUCF 2EDXA 4LDLB 5I73B 4R4BB 4XNZB 1L7IL 3WFCH 3GI8H 3L95B 3TWCL 5C7XH 1MRDH 1AGDB 4OB5L 1PY9A 1G1YA 5FYJL 4X7SH 1T4KB 5C9JB 2V17L 1TNNA 3GO1L 3VFMB 4PJ5B 5CHNA 3RZCC 1AR2A 4HKBB 2NXYB 5JXAL 4S1RH 3HG1D 3PWNB 4P23B 5GHWH 5JW4M 3W0WA 3R0MA 2D7TL 2F54E 3DX7B 5E6IA 2WIIB 3KYMB 5I1CL 4XPHH 4MNGA 2Z31C 4IRJB 4RGNC 5E99L 1I1AC 3TESA 3KNBB 4TQEL 1DL7L 1KPRA 2H2SD 4M03A 5FO9B 5GHWL 1Z9LA 5ISZB 1N4XH 1T3FA 3PQYA 4D0DA 3T0ED 2WINB 4U1NA 2D4FA 4NQVA 3MMEA 4NSKA 5D1XA 2CRYA 2XKNA 4G3YL 4M1DH 1JP5A 4QRQB 5J6GA 4KTEH 3GI8L 3QUYB 3O81A 4HGKC 4YPGA 3EFFB 5GRZA 3K2UH 3MR9B 4JPWL 4P3DB 3NH7L 2Z8SA 4CUCA 3OXSA 1YEDA 1JBJA 1NBYA 5CJOL 1DBBH 4OFYD 4H0HB 3ZYZA 1UEMA 1ZLWH 1QNZH 4YFEA 3EYVB 4POUB 2VDKL 3PDGA 2DIJA 1A9BA 4X80H 4N1CA 5F9JB 1RVFL 3U4EB 1A6ZB 3BW9A 4F57L 3H9SE 1WEJH 3MROB 5GS0D 1E6JL 4XMLH 4LLUA 4NRYA 1G1CA 1HIMH 3MRQB 2R0LL 3JWNC 1RUQH 2ADGB 4OGAD 3HI1A 5DHXB 3QXDB 4D8PA 3FN0L 3MYJB 1JGVH 5IW6A 5GGUB 5AG9A 2ICWI 5ESVA 1BVLB 4GKNB 1KCUL 5CGTA 1PJ9A 3KDMB 5DK2B 5MI0C 4NQSA 4L4VB 3BPOC 3HRZB 1LE5B 2PYED 1DE4A 2XY1A 4LLVB 5DJ6B 5TE6L 3U7AA 1JNLH 2PO6B 3V52H 4NQDB 1PKOA 5T5NF 1IKNC 3GI9H 4TULL 2BOBB 4UU9B 3S36H 3UZQA 1W72B 5JW3H 3STZA 3MUGB 5DD3L 4AL8H 1BJ1H 1MJJB 1PQZB 5T3ZH 4PJHB 3S4SA 2IG2L 2MQ0A 3ILPA 1MLCA 1OAKH 3TA3C 3D3VD 1EX0A 2YHGA 2V5RA 1PY4A 1EJOL 43C9B 1FORL 2J3SA 4Z7QF 1WIPA 5EUKB 2RCSL 5SV3A 1J1PH 5GS3A 3WLBB 1HH9A 3LKPB 1JWSA 3C9NB 2R0ZL 4LBEB 2FZ3A 3K0WA 1CL7H 1S7SA 4IOIB 3VG0L 4NRZB 3MXVH 3HR6A 1UVQA 1NBYB 2BHUA 5H35B 2AKRB 3DLQR 4LL9A 4OLUL 3RQ3A 1C5DA 4P2RA 1FNGB 1BGXL 3HNSH 1KJVA 5BZWB 3U9PL 1GL4B 1ORQA 3AS2A 5I1GL 3CPLB 3B8YA 4OJFH 2VSCA 4C4KT 2VAAA 5T33L 1CD1B 3ARVA 5F1IB 4TSBH 1UG9A 5FOBA 4RGND 4OM1H 3RWIB 4XMKL 3LKRB 1AXTH 1PZUB 2EYTB 4PJEB 3DUUB 3S97C 3TH3T 2ADGA 5HPMB 4G8EB 1Y18B 5ECJE 3BZFA 4L9DA 4Q9QL 2DD8H 1FYTD 4F7MA 3ARBD 3KLAA 4JFPA 4G6MH 3EFDL 1EZVX 4JGMA 1W72L 4W6XB 5CFHA 3IDGA 3FMGL 5EZJA 4JFYA 3TZVC 5JW4N 4NPYA 2P24B 2DLTA 4KI5E 3SQBA 3I6KA 3TBSB 4KZDL 2PO6A 5GRJH 2X1PA 2C3VB 4ZODA 1KTDA 3D85D 5L7XH 3NFSH 2V9RA 4ZFOB 5K59F 2X44D 3HI6H 4ZFOL 2EIEA 4AQOA 3AREA 5CEZE 4J4PA 5D96C 4HUWA 2NXZC 2WMPA 4FQXC 5FK9B 1X5GA 5JW3L 4APQC 4U33A 4FZ8L 4X83A 3QUZA 2MFNA 4BH7A 4G6KL 1EO8L 4HXBL 4PY8J 4DKAA 1PX3A 3MUY1 4L29A 2VWEE 2ZUQB 1KJVB 2HVKA 5BZWA 2RFXB 3X3GL 4PJGF 3DTXA 3S37X 2FX7L 1ZSDB 4OZGE 5SWZE 2UWEA 3NPSB 5FFLA 1KYOJ 2APFA 5HHME 1YEGH 1IAOA 1EA9C 3SBWA 1RHFA 4I3RH 1F45A 1AR1C 3D69A 1ZHBA 4MSWB 3C8KA 3JUZA 3WUWB 1OAYL 3IDMA 1RZKL 3GKWL 5I0ZA 1Z5LB 4AM0B 3H9SB 4HZAA 4F57H 4RWHA 5E24E 5D7JB 3KYOA 5LJYH 3IVKB 4HT1L 4KUZL 2PR4L 4P2CG 4YK4B 2AI0H 1CF8L 1OTTD 3CC5B 5JXED 1KOAA 2V2WA 1TCMA 5GSRA 3HZVA 1CLOH 5EN2B 3V5DA 3N50A 3VXSB 1Q94B 4FQHA 3ZKSD 4X99B 2FCBA 1T03L 1LO0H 3ZDZE 3BWUC 3QUZB 4OUUA 4TUKH 4HG4K 1AD9B 2ZOLB 5SX5K 1TZGL 2PNDA 3MNVB 4MNHA 1IEAA 3C6LC 3MUHL 4U7SA 1CT8A 5E8DH 4G8FA 4F2MA 4G3YH 3DGGB 5TPWH 15C8L 5CP3H 1QYGL 3LDBC 4X4ZA 2CR3A 4F37K 3IDNB 4KQ4H 3ARDB 2HT2D 2LU7A 2VZ3A 4PJAF 1H0DB 5E0QA 5GS2D 5DQDL 2VLRD 1UZ6E 3PHOA 4IRSC 4MA1C 5H8DA 5BVJB 3ZTJH 3P4NA 1QRKA 2UVFA 5A16B 5HHXL 3G6DL 1UFUA 2XV6B 1N6UA 3D69B 2VERN 2ZNWA 3G6JE 1QR1A 2Q1EA 4NM8H 1U8NB 2D7TH 4M9PA 4RMWA 1AJ7H 2N4IA 4LHUG 4OF6A 3T1FA 4WI6A 3MTRA 3OR7B 4Y2DA 1CDIA 4NN5B 5GSVB 2Z9TA 4XVSL 4YZFF 2BK8A 3EO9H 2UWEB 5JHDE 1CDGA 3BKYH 5M7QA 2YXFA 3FO1B 1J0YA 5EBGA 4GUPA 3Q5OA 4NQXA 3KGRA 4P5TD 3CH1A 4JKPL 2J12B 2NY7H 3NFSL 1FVDA 3SDCC 5C0FA 5IMOA 5C0BB 4JR9L 2JCCB 3B83A 3P4MB 1WZMA 4M6OH 3ROLA 3RUGF 1KV3A 1A64A 4EDWL 2DYPA 4UTAL 4WO4B 1EVTC 2NW3A 3M1BA 1A2YB 2GHWB 1JZ3A 4LPWA 4L3ED 1KG0B 5JORA 4OGAC 1L6XA 5D5ME 1I7TA 3IVKA 3EFDH 3ZYIA 4OT1H 1SMAA 2H3NA 2JELL 1OM3L 3SKUD 2YZ8A 4ZQKB 1RZFH 2A9NL 3VWKA 5A2FA 2G5RA 2ZP0T 1HINH 1T2JA 1Z6JT 2A73A 3FCTA 3QDMB 4GBXB 2DI8A 4BFBD 5C92A 3HZVB 5DD1H 1JMZA 4A6YL 4MXVF 3T0WA 4AMKL 1XF5B 4JJ5A 5HHQA 4FP8L 5LGJA 5T3XL 2BY1A 3QIBD 4DK3A 4OLUH 1JRHI 2R4SL 2WP3O 1QLEL 4OLWH 2A83B 5E4EB 3O45A 4DN3H 3WJLC 4Z0XA 4NZTL 3JTTA 4KJPD 5FB8B 2NY5L 1NMBL 2W60B 3ULUF 3KJ6L 2KKQA 4WUUE 3SKOB 1YEEH 3ULUE 3VGAB 3PQYD 3P4OA 2BNRE 1PKQA 1I75A 1ED3B 1CFSB 3MV11 4YDVB 4D0BA 3WFDH 2W0LA 3VD5A 4KTDL 3WN5B 3U79A 3QQ3B 4IRJC 5FYJE 4S0TD 5JO5B 2IG2H 3L5IA 1WBXB 1UWXK 4JGUA 25C8L 4N5UA 4GO6B 3OKKA 4F3FB 4PJ8B 3WIIH 4IEFB 1SEBA 4OLVH 3CLEH 2FJGA 5E00A 5IB5A 1CGSH 3CSYB 4YR6B 3U30B 2YPVL 4HK3N 4KHXL 1JPFB 1KLFA 3O3AA 4K7FB 4AIOA 5EO9B 5ANME 4PJBA 2I5YL 5A2LH 3DV4A 4WUUD 2FH8A 3BYYA 3MLTA 5GGUA 3QCTL 3FFCD 4OF7A 3LEYL 3MR9A 5D5MF 5JXEC 1OQXA 3CUPB 1BZ9B 4K2UH 2Q8BL 3THMH 3QWRD 2ICWJ 5K9OB 3DVNA 3GSUA 2ERJC 1IGJB 1NFIB 4ZPTB 4JM2B 4Y4KC 3B3IB 1YY9D 5KBNC 4POYA 2AXFA 1I3VA 4M4RA 1Y0LB 3HG1E 3VFTA 5HXMA 4LQ1A 4WHTB 1A14L 1CDYA 1YPZF 4D8PB 2COQA 5FUOL 4V1DA 1NCNA 2GT9A 4PTUA 3RX5A 3MLZL 1T1YB 4G9FB 5I76B 3PGDB 5GS1A 2VE6A 4HKXB 5GXBB 4BQBA 2ADJA 4LSQL 3ES6A 4DUVA 4M7LL 3IFLL 1FZJA 4MDIB 2APXA 3AXLB 4GAJL 2OTWB 2R4RH 3GIVA 4HIHB 5C6PB 2MHAA 1P69B 3QJFA 4L8SB 1Q9LB 3F7PC 4C54A 5C08B 4HUUB 3C9NA 2DWDB 3MV7D 1MJJA 3SDAB 2VN7A 4DN4L 4PY7A 1W72A 3TGXA 5EU7C 1WITA 4ELKA 1G7PB 1NH6A 3VCLB 3HMXA 4WJ5A 3HMXH 5LXGL 2H32H 2HLAA 4UOJA 4F33A 4ORZC 2HJKA 2ZPKL 4D3CH 2J7LA 3VA6A 4EIGB 1FFPB 3IRZA 4LQFL 3A6BL 3GJFB 3ULVF 3TN0C 5KSUA 3SDDC 1RJYA 3V4VL 2H6PB 5KS9F 5TDPB 5FDYA 1E6OL 4M48H 2AV7A 3ZDYF 4C83A 4ZTOL 1V3LA 5IOPA 2YD1A 4NHCH 3RUGA 3TPUB 2V5TA 2Q8BH 2DYPD 4FFYH 4OCLC 3O6FA 4TVSa 2HN7A 2VXVH 4XCCL 5I0DA 3PV6A 3I02B 3L3DA 2EDDA 3TEUA 3WHE1 3LEYH 1FVCB 2WW8A 1MRDL 3STBA 3OG4B 3TWCH 3UTQA 1BREA 5EZIH 4JQIL 1T21A 4PRPA 3Q0HA 1YJDL 4PTTA 1LMKA 2UZXB 4N0RA 1CU4H 3TBVB 4N90D 1AKJD 5HJ3A 4FQCH 1IGFH 4U0RC 3WFBL 3FB7B 1BOGA 3EOTL 2AI0L 1TZHB 2B5IB 5J11C 1UH4A 4P9HH 4LPXA 2R56H 5HI4D 2FR4B 3K80A 4DVRL 3HHRB 4HFUH 4EOWL 1YECL 4KK8D 3IDGB 3HC0B 1X5XA 2OR8A 5F7UA 2Y23A 2ORBH 4JHZA 3GKWH 4Y19B 2IWGA 4P99A 2Q86B 3IFOA 1DQTA 2NTFA 3LY6A 4X4MA 1YUHB 3G5XB 1QA9A 1NUDA 5E94A 1R6VA 4LFHD 1D5ZA 3S88L 3MV8B 1CXHA 1RUKH 3MRRA 4KPHL 1CD9B 2AQ2A 1U95A 5C0AA 2AJXH 4TTDD 4RGMC 1IQWH 4JFXA 2Q6WB 1C08A 2X89D 4I77L 5B8CA 1BWWA 3VCLA 5EU3B 1E4KC 3HE7C 5C0JA 4WV1C 3RZCA 2YC1A 2XKNB 5IEKB 4JRXE 3B8SA 4Y4FC 1BM3L 1FVCA 4UBDC 5HYFA 3KYOB 3L6FA 4PREB 4C56B 4XHQA 3GJFH 4JPKH 4RGNB 2AXHA 4HX1A 4DKEH 1KIQB 1WZLA 3OKEA 4LCWE 2DS4A 1QSFE 3JBG7 2H2SC 3D85A 2G5BA 5C09A 3DX6A 1I1AD 1WGOA 1FG9C 1N5YL 4DWHA 4AEIH 1YJDC 2DTSA 5H37H 4WU5A 3UX9B 4QOKA 4Q9RL 3H9YA 4PGZA 1CXKA 1J8HD 1NCWH 4AYFA 4EUPG 3I3BA 4MZ2A 1NC2A 1CN4A 5GGVH 3ZKXB 4NZDA 3G5ZB 1EAJA 1J05B 1T21B 5B22A 4UTAH 5GRUH 1XGPA 1DANU 1WWAX 3EYQD 3DI3B 3DUHA 3LRSB 3BDXA 1PD6A 2X41A 4KI5D 1N5YH 2XZAL 3VXMD 3GM0A 4FQQA 4KMQA 1RZJC 3TNMB 1WJ3A 1XF2A 1MREH 4M7KL 4MD4B 5IQ7L 3LIZH 1K85A 3U48A 1HQRA 3ARGD 3UZEA 3MBED 2FR4A 4Y19D 1QP1A 1VFUA 1R3KA 4E9LA 4QCIA 3FRPG 3QRFM 4PD4K 2NY3B 1BIIB 3CX5K 3VFRB 3R0NA 1HCVA 4Q9CA 3E6FB 1CZ8L 3NCFB 5TE4H 3TYGL 3MGAA 4AH2A 3MLXL 3K4ZA 3VD7A 5E8PB 2BMKA 4NZJA 2WBJD 5C09B 3UTPE 5HVHB 5SWZA 4EVNB 1QFWH 3TA3D 4J3UA 2AAVA 3BQUB 1OF2B 4JY4A 4PJHF 4XXDA 4WFED 3L3HA 4IIQA 4IMLA 1NCBL 1NLBH 4XHJC 2NTSP 3ECBB 4U3HA 1NFDA 3PHQB 1NDMA 5IKCB 3BP7B 1FNAA 3KPQB 4A2LA 3W9EA 4JDTL 5ACMA 3HE6B 4Y2DD 3QIWA 3QUMH 4GRLD 3UBXI 1RZGB 4DCQB 3AB0B 2PR4H 4XMPH 4KWUA 3HR5B 5J9PB 4LNRB 2ZUUA 4YHYB 1FNGA 2OM5A 1H3XA 3TA3B 3NZHH 3DX8A 5CBAB 4LSUL 3CDGB 1MCWW 4WDIA 1RJLA 1UZ8A 1Z9SA 4JFEB 3QXUA 5JMRA 4GQPH 2E9BA 3VGBA 1IARB 4WO4A 1OAYH 3RWIA 2NLJB 2EDQA 2X4QA 3GMQB 3DGCR 2FEDD 4UDUB 2QEJA 4CVXB 1S5IH 2PW1B 3LB6C 4NJ9H 3IAGC 2X7LA 1B2WH 1U8LA 2APVA 1BQHB 1QEWB 3WS3A 2XTJE 1NKOA 2VLJD 3FT2B 4JRYD 2OSLA 3T0EB 2IQ9L 5D71H 5D1ZD 5I71B 5K9QI 4MNQB 3ULUL 3MRQA 3PWVB 2K1MA 5I16B 5I15H 1R0AH 1FFOB 2VIRA 4FXKA 1H5BB 3DRQA 4OQTL 3LPWA 4TOYL 4MS8D 1YMMB 4P2QE 2Z31D 5I2IB 1T20A 3E6FA 3LAFA 4NNYA 1MWAL 1CE1L 1IAMA 2BHZA 1MJ8L 1V7NH 3MLVH 4R4NC 3MNWA 2J6EA 4TSCH 3W5NA 4Y16A 4GMTH 1DE4B 3N9GH 1M05A 5L7XL 2DJUA 4I0KA 4YO0B 1WFUA 1KENL 1J18A 3QFJE 5DD6A 5EO0B 3SKOA 4MA7H 3ARUA 2BDNL 5DJCB 4S1DD 4KRLB 4WUKL 4ZD3L 2GJJA 1FNEB 3ARYA 1XR8B 1I85A 4LVNB 5FUOH 4DJMA 4QWWD 5LQBH 1JPTL 4CADB 4OF3A 4XTRD 3ARPA 1WAAA 5F9DC 1YY8B 3KVQA 5IUSA 2BNRB 3QJHB 3HR5A 5J9PA 4KKAC 3S3JA 1R5VA 4MAYD 2Y06L 2HA1A 2R2BA 4Z76B 1SY6H 2IAMD 2DMBA 4Q2ZA 5JZ7C 4OD1H 4TVPH 3V6FB 4X4XA 4XP5H 3DXAD 3U2SB 4ENEC 3VFGH 4X6CF 5I66A 4HFWA 5GS1C 1E4XI 3GBNL 1RI8A 5D7IA 2EKJA 5GIRB 2VXTH 1GC1H 2FX8L 5TF1H 1LK3L 3FQRB 1CZ8H 1IVLA 2AEWA 1TITA 2VLKD 2GITB 3OZ9L 1DQJB 4CGTA 2KZWA 2XN9E 3EHBD 1CQYA 4UB0H 3EYOA 1B9ZA 1VENA 3BZFB 1X7QB 2IPUK 2CDFA 1MHHA 4HKXA 2VE6B 4RDQF 1S9YB 1NBZB 5CP7B 1NGPH 1A7RH 1EHLL 4GXUN 2E5EA 4HULB 4KHTL 2DQJL 4Q7DA 1YNLH 3QXTA 5B3NA 4KXZI 1A6TB 1RZJH 3VXQA 1CLYH 2BVOA 2ZG1A 5DVMA 5EFIB 1JV5A 5JA9A 5DMJB 1S9VA 1A9EB 3CFJB 3TPUA 4OZHA 4LDOB 2FIRT 2Q76B 1SQ2N 3EYFB 4HUWB 1I8LA 1K4DB 1V8HA 4KK9C 4D9LH 3DX9B 4WNQB 1JI1A 1OP3K 5B38A 1PG7H 3O41B 3U2SA 1RY7B 3C08H 1T89A 5J4MA 1BX2A 1QKZL 1J1OL 4I2XE 4Z95H 4LCWA 4PJGE 4HBQA 4LRNH 5D2NE 5D1ZC 2V7HB 3EOBB 1S78D 3GFUA 2DKUA 4PS4H 5K9KA 4LCCB 1WEJL 2R1YA 3D1MC 4FRWA 4XB7A 5ANMB 4Z78A 3RPKA 1A6WH 5JORB 2FL5A 4OV5A 4JDZB 4OT1L 5E6IC 4CU8A 5F9WC 4M43L 4JKWA 3TCLA 4PD4J 4I77H 3T2NL 4OD3H 1X5AA 3HA0A 1IM9D 1SJHB 1JWUA 2G75B 2XZCH 2G2RA 4XB8A 4HUXA 4PRAA 5GRWA 3VE0B 1MRFH 1G7MA 4AEFA 1K3ZA 2IBZY 4TUOA 4XC3H 4BSWA 4B7IA 3HCVA 1KJ2L 2F19L 4EI5A 4ZAKC 1SYSB 1HQ4A 4M1DL 5DHVA 3BUYB 4FN0A 5F72S 3CC5A 3TO4A 3IGAB 3MFFA 3TF7C 4WW2B 4JM2D 4JM2C 4Y4KB 3RWHA 3VMOA 3KPPA 2QQNL 3KR3L 2HYMA 2GI7A 4N9GB 5FHAL 5I1DB 4W68A 5E2TH 2J6EH 4NM8L 3D18A 2BSSB 1PKQE 1CGWA 1DSFL 2BOBA 4UU9A 1XAUA 2Z92B 3F6LA 3U4BL 5FKPA 2VDPH 2R1YB 1MFEH 5B39G 2DLHA 1H0DA 4MXQC 1LO2L 3ILPB 3VD4A 2AJVL 5DZNA 2QSCH 3QDME 5KJRL 2I9TA 1UA6L 4PGDA 4FFYL 1BIHA 5HY9A 3VXSD 2QLVB 2DQTL 3QQ9C 2YRLA 1U8NA 2NNAA 4MJ6A 1MFEL 4P2RB 5J57B 3SE4A 4MJ4A 4WTXA 5LAXB 4XBEL 5I8EA 1FZMA 4ZPVA 1MAKA 2C7UA 2FO4B 2FHCA 4GH7B 2J5LC 5CINH 4HT1H 5C09E 1Y18A 1T66C 3KHQA 5F7LB 4PBXA 1R3KB 2VZOA 2VC2L 3VXMB 3QWRA 1OT1A 2CRZA 3C87A 4KKNA 4LCIL 4M4PA 5ADOH 3VWJB 3W5MA 1FSKB 4RZCA 3MRCA 3N9GL 4PJCF 1WFNA 2B7DT 5FO9A 4WW1B 4NC1C 2YPKB 4XAKE 3GMRB 1WQVT 2AERT 4H1LG 1OWRM 4JG0L 1CE6A 4K07A 4ELME 4N0UE 2R8SL 3FONB 3FFDA 3VFWB 3TBTA 4MXVE 3V4UL 4N0FA 2DRUA 1BWMA 3AXLA 1ZHLB 3QYCA 4OGYL 3ZMRA 2P5WA 4NKQB 1WV7T 4ODXA 1QTYT 3VFOA 3O9WA 3V0WH 4GRWH 5TGBB 1YNKH 1Q72L 1YEJH 1ROWA 3ZHLA 4KK9D 4NJ9L 2EXYD 1EPFA 1S5IL 3VXTA 4ONFL 1YPZB 2ZUXA 4ELMB 2ZSVA 3P77B 4OIAA 3I6LD 1OTUD 3KWWA 3IFNH 4EUPH 3L5XL 5DMIH 3RVVD 1JWMA 2ATPB 3IF1A 4ZS6D 3AC0A 2OX5A 3MV8D 5DUBB 2AJUH 4K94H 2IFGA 1KNOB 2IAMC 1F4WH 4X7TA 3SGEH 4DGIL 2VL4A 1NFKA 3SDAC 5HYJA 5D7IF 1NQBA 5TH2A 1CGSL 1RZKC 5IESH 1I4FB 4ZXBC 5ID1B 1R5WB 2CLRA 1BVLA 1GZQB 2C7UB 5GS0H 4PB0L 2FO4A 3ZE1E 2GJ6B 4D0CB 2WWKO 1J87A 1I8MB 3FONA 2DQHL 5CGYC 2C1OB 4HIEA 3PWVA 1T1ZA 3AB0C 3LS5L 2VN4A 4JZJA 3D5OF 4ODTH 3ZKMC 5C6TL 2R69L 1VESA 1S9XA 2NX5E 1WC7A 2VITB 3V5KB 1GGYA 3LKNB 3PWJA 1ACYL 1U3YA 4NQDA 5E2UH 3BXNB 3VGHA 1MCLA 2PXYC 4HXAL 2FSEB 3UTSD 3TZVA 5IFAH 5FYKE 4L1DA 3QRGH 3W2DL 3SGJA 4GRWB 2C3HA 4QTHA 1MFBH 4IOSD 4YBQC 5GGTA 1ACYH 2X70B 3CLFL 4OLWL 3W0WB 1E28A 4GS7B 3G9VA 4NQEA 4RGMB 4QRPB 3TPKA 2NQCA 1ORSB 2G60L 1HE7A 4FZEH 3BEWB 4OV6F 2XA3A 4JRXD 1C1EH 1G7QB 1JGDB 2YD7A 1J9CT 4WHDA 4MJ5B 2WINA 1PSKL 5GS0L 1BF8A 1Q9KA 1KTLA 4JREC 3RGVA 1JWSB 1RULL 1FIGL 1HHGA 1WBYB 2NY3C 1E4KA 4YO0A 1QRND 3OSKA 1H3TA 5D1XC 3TLRA 3IKCB 5FV1L 2DM4A 4Q2ZB 5MENE 4G8GB 4EZMA 4MJIE 3SE3C 3LRHA 3MOBL 3SGDH 1F2XK 3DETD 2CSPA 4F7CA 4Z7OF 2QHRH 1I7UA 3BIKB 4X6BA 3C5ZB 3S3PA 3FN0H 2FGWL 1I7ZA 3ZKXC 3DURB 1BZ7A 3GHEL 5DJDB 2B1AH 2DDQH 4LAJH 4KGLA 4UV7L 3ULVH 3EO9L 2L4OA 3ZTJG 4N8CL 4A6YB 4X6FA 1RUMH 1YC7A 1FNLA 5CKGA 1IGML 5C0DA 4UNTA 1HDMB 3QPXL 4NOBA 5HTSA 3RWEA 5T1MB 1L6ZA 4NRXA 4P2OA 3V9FA 4LK4A 2XRAH 5EA0L 3G5VA 2IADA 3FT4A 1ZWIB 1E27A 2NW2B 3BPNC 5E56A 3VDAA 2J8UB 1MFDL 1UB6B 5T3XD 2DLIA 2BJMH 4JFOA 4FQ1H 4EBQL 5E8OB 3Q3GA 1FNSL 3BVNB 5EU5B 5LGJB 5DK0A 4HDIB 1NAKL 5JPMA 2KPNA 4U1IB 2WP3T 4ISVB 5F89A 5LBSL 2R56L 1N4XL 2DM3A 3TO2B 3QQ4B 5C0IA 4UT9H 4Q6YA 3RWFB 5BO1H 1CLOL 1X7QA 1HCFX 1OCWH 2AP2A 2HFEA 1DL7H 4X6DE 4FOMA 1A0QL 2W9LA 2MJWA 1IM9B 4UNVA 2P45B 4JDTH 5F8QC 4EUPB 1FO0L 5MERA 1KIRA 1RIUH 3RGVD 2DWEB 3V4PL 1A3LL 5ICZA 3SE9L 1XF3A 2EECA 4LBEA 1R3HA 2F5BL 1NLBL 1NUGA 1LK2B 1CCZA 2WBJC 1MF2L 2QQLL 1RZGA 1HHKB 3DHJA 5JMOC 2YC1B 3S35L 1Q38A 2YSSA 5FV2A 4NJAH 4OGXH 2A0LC 1HHJA 2AW2A 4MWFB 2P8MB 3S5LB 1DSFH 2VDQH 1M71A 3IAPA 1JFQH 1JHLL 3GEWB 3W81A 5HGDA 4RQQB 4XX1G 4YHPB 3IDYC 4DUWA 2GJZB 4XPBL 4PP2A 3PGFL 3PGCA 3OV6A 4ISVA 4G6KH 1JN6A 2XA8L 3QDJB 2XNAB 5SWQA 4YC2B 1O7SA 3QUXA 1WLHA 3FB5B 2ZCKL 4GBXD 3DROA 3OR6B 5EG6C 1E4JA 5F6IC 3KHOA 3GJEB 1DBKL 3U7WL 4PJGB 4JN1L 1RD6A 5DO2C 4G7YH 2E8YA 3MZGB 3SO5A 1WBZB 5GS2H 1J0IA 3L3OA 4QTIL 4P59H 4QHUA 5L2KB 1GGIL 2GKIA 4PRHB 2FECL 2OS7A 4NGHL 1F4YH 4ORGA 1FNHA 4OD3L 5HDBE 4HCRA 2H41A 1AHWC 5J56B 2B0SH 4U1NB 2OBGA 3U6RB 3O6ML 1W0WA 2X4UB 3D3VA 4LSTL 2NXZB 1J8HA 4MJ6B 1F42A 2VRAA 3CFKA 1IGCL 1QSVA 3BWAA 5F7MC 3CH1B 1INEH 2XG5A 1K4CB 3FT3B 4U1HB 4JHAH 4Z7NF 4YHNA 3NFNB 3CVHH 1V7MH 4X98B 3KS0H 3PHSA 3QA3A 1OW0A 1PDKA 1BGXH 4KV5E 3OB8A 5DRXB 4OCWL 4BUGA 4CJ1A 4HZLB 4KRPD 4Y5VA 3VWKB 4GQ9L 5E5MB 4PJ8C 4L3AA 4LHUA 4ZOAA 3WHE0 5F96H 3X13B 3DROB 3MRNA 5DHYA 3P30H 3QEGH 3OTTA 5DQJB 3LH2L 3HC4L 2CKBB 4P3CL 5BCAA 3ALWA 2X89A 4O5LL 5DEFA 4QT5B 3WEXA 1G9ML 3UTQB 4UDTB 5TQ2H 2CQVA 2ITDA 4S1QL 2XQYG 3B2VL 2EIZB 1EHLH 3HNVH 1YMMD 2DICA 1A7RL 4QGYA 1UM6L 3F7QA 4IDJL 5F93C 2DJ4A 4WU7B 1NCDL 2ZUWA 1LNUB 2CUHA 4Z7UA 1GZPA 1UWGL 4LNRA 5DVOA 1C7SA 2NYYC 5D1ZB 1LEGA 1M6OB 3VG9B 1S7WB 3V0WL 4F80A 3X14A 5DUML 1PEWA 3O45B 1JGLL 4ZXBA 2ILLA 2Y36H 1JTOA 1CFTA 5TDOA 1ZTXH 1NCCL 1FO0B 3AS1A 1T83C 2AQ3A 1NMBH 3GMQA 3QT2A 3GBNH 1ZVSB 1H15A 3WHXA 3LPGA 1J0ZA 2HTKD 5IHZB 1N2RB 5DJYB 2DQGL 3MV7A 3BESR 5CZVH 5AAWA 5T1KA 4OZIB 4G5ZL 5DURB 1F4HA 3G6AA 4XP5L 5KVEL 4L9LC 2X40A 1T2XA 3PDDA 4MMXC 5HD8C 4HZLA 4NQED 3FZUC 5DO2D 3QEUA 1CICB 1KGCD 1NMAH 4NHCL 3IJYA 1A8JH 4MNQA 4YAQA 3UPRA 4FQ2H 1QA9B 1MLBA 2XQYK 5ACZB 2NY1C 3FO9A 4JHWL 4DGYL 2P5WB 5DUPL 1R5WA 3GSQA 4K7PX 5IP4A 1I9JL 2GK0B 4DQOH 3F58H 4NO5B 4LKCB 4PLNC 2VQUA 4JAMA 4HWBH 4XP1H 3RU8H 1B0RA 1RZ7L 3SE4C 3SKNA 4BFEA 1GRWA 2UY6A 4ZUTA 5H35A 4JVPA 1T22B 2C4FT 4FTVE 3ZO0A 3BGMB 1TDQA 5AG8A 3L3IA 3NH7H 1MJUH 4JFHD 4LMQE 2VDNH 3K2UL 5D9SB 4UTBL 3T0EE 4PV9A 4FQXB 3UDWC 3U0TB 1PX4A 5EBLA 4P23A 3QG7H 1AFVH 2V9QA 2EDJA 3S35H 4U7KA 1UM4H 4HEPG 2DQUH 5HYJD 3JSSA 1OAXH 5DWUH 5MHSE 2IAMB 1WK0A 3QUMB 3GZKA 1INDL 3E0GA 5AZEL 4AQ1B 5I18L 1NEUA 4LKXA 4PGCB 4WHYH 1TTGA 1JYWA 4G9FA 1DQDL 3ULVC 3G6AB 4CMHB 2GT9B 1R5IB 4PTUB 4G8IB 2XT1B 1ONQB 4MD4A 1QBLL 3ARGB 4KMTH 3DXAB 3QCUL 4QKXB 1CICA 3CK0H 4U1JA 1BQHG 1F6AB 3N85H 5JIIA 3V5KA 4RMVA 1QACA 1QFOA 1FO0A 4WW2C 1IKFL 3GIVB 2IGFH 4WFGD 4HKJA 5EUOE 2JF1A 4JRXB 4V2BA 4OLZH 4HWBL 3GK8H 4LKCA 4POZC 2MKWA 1QYGH 1UM6H 5TPWL 5MHSD 2OQJA 2EICA 3EAKA 1IQDA 4Q58C 4NWTH 4CVZA 3L3HB 4OLEA 2FWOA 4EBQH 3S8WA 2M8XA 3UPRB 3EYOB 5C0BE 3UYRL 1OAQL 3V5HA 4KHXH 2O26U 3WN5A 3KYNA 1BD2B 3E2HC 1RJYB 4J6RH 4PJIB 3IAQA 3CZFB 4Y5YA 1V3JA 3QUMA 3OHXA 4D9RD 2NXYC 1U8PA 4HWUA 5GGQH 5I9QC 1P9MA 2P1YA 3U1SL 3ZE2E 2F53E 3GDBA 1I7RB 2OR9H 4X5WB 4X5XA 2C3GA 3BP7A 2DTML 1B3JA 4XVTL 5C0GA 1EHAA 3P9LA 1A3RH 3I75B 1TVDA 5JHLH 1RUPH 1LQSR 2EO9A 1CFVH 3RDTA 3KJ6H 2BCKA 2QTEA 3FQXB 3QR2A 5C9KA 5E9DE 3FO2B 4XWOC 3ZSTA 4NKDA 3T0BA 4IDJH 5I75B 3LPFA 4PG2C 4F9LA 5BJTA 3QIBC 1LO5B 1LD9A 5HGBB 1KN2L 3MACH 2MKLC 2IFFH 1JK8A 5TDNA 3EYSL 5CD5C 3QIUB 4NN6B 3U36A 3UYRH 4GW1B 4XH2A 1OSZB 2OI9C 4P3CH 4HXBH 3QIBA 4WHTA 3L9RA 3SEPA 4UDUA 4CVXA 4L5FH 3SQOL 1PLGL 3DHMA 5L2JB 5IBTL 1U0QA 5D4QA 1BQHA 3RX8A 5IEHA 3L5XH 1XMWA 4MMZC 4PJIF 2R0KH 2XN9A 2XTJB 4RGNE 4L5FL 3SQOH 2OL3L 2R29L 5LKNA 1MCEA 3OKOB 3H3PL 2AK1L 3B9KB 1T0NA 5I1LB 3VFPA 3WXVH 4HDIA 3HE6D 3PV7A 1AP2A 5HHVH 3SDAA 4PYHA 1IC4H 3MCKB 3S98A 3C5ZD 1UACL 4RWYH 1WISA 2BNQE 3H0TA 5DJXB 4G6ML 2Y6SC 3CK0L 5FYKL 3P3YA 1OOAA 1AI1L 1NAML 2FATL 4TTDC 4QNPE 5IFAL 5I74B 4K8RD 1DEEA 4WU5B 4GUPB 2EDEA 4I3SH 3VXPB 1FAIH 2A6JA 3DX7A 1Z0MA 2R69H 1MIML 4PJFB 3UJJL 3H7BB 2Q7YA 4JO2L 5HGBA 1S3KH 1VSCA 4NKMA 2X4NB 3IJSB 3ESVF 4WY7L 4HIIA 1A3LH 2HWZH 4BFIA 3M1BB 1A2YA 1VGEL 2I24N 1KIRB 3K1DA 1KPUA 1YY9C 3D0VA 2BSRA 1ITCA 5F97E 2ZOKA 4F8TA 5C0EA 1KEMH 3G08A 4JKKA 2D0FA 4NOFA 1RK1A 2DQEH 2NX5D 1WSST 1OY3B 1W0VB 3O3DA 1FIEA 4HWEL 5FO7B 2VABB 4JM4H 4LHJB 1JNJA 5JDSA 1IL1A 4ZD3H 2UY7A 1DQQA 4UT7L 1ZA6A 4S1SL 5MEPA 2VH5L 5TDNB 2VYRE 1ULVA 3EZ8A 2R9HC 3JWOC 5DQ9B 3T3MF 4O00A 4JQVA 1KB5L 3ETBF 2APTA 5C08D 1T03H 3QUXB 2NR6D 1MJ7H 2QQLH 4NO3A 3RJDA 3S35X 5FAAA 2ZCLL 4K7PL 4LSVH 1JN6B 4I8DA 1V7NL 5J0BA 5EOTA 1K2DB 3MLUL 1P4BL 1IBGL 5EA0H 4UAOB 3NA9L 2JLLA 3FQRA 3E3QC 3I2CL 1X4ZA 3H3KA 4XXDB 4NKOB 3K46A 1JZ8A 1VFAA 3SDDD 4EVNA 3QHZH 4KUZH 4KVCL 1AHWB 1WBZA 2JJVA 3F7RA 3CNKA 3NZ8B 4YK4C 3UTTB 5I15L 1QBLH 4UILH 1R0AL 4QRPA 2R23B 4ETYA 1ZE3C 4YDVA 1MHHB 1OT2A 2UZIL 1OTSD 2YA1A 4MJIB 3WDJA 3ME0A 3LHPH 4PRBB 4PR5B 1BBDL 2E9JA 3HAEG 4MHHI 3GHEH 4U6TA 2ZOKB 1YA5A 5FHAH 2ZCLH 4LSVL 4M8QA 4UI2A 2BRQA 5BRZA 5E00B 1QSED 2P8PA 5DTFA 1A4KA 1ZEAH 1F58H 3CXHK 1KSRA 4PJ8A 3IS1X 2FO1A 3T0DA 4YBLC 3JV0A 3IKKA 5IIEA 4BQ8A 2H9GA 4ZS7H 1H8NA 3OB0K 1JPSL 4M5YL 3BWAB 1GIGH 1RVFH 1X5YA 5MEQB 2OJEA 2QR0B 2A6IB 5CD5D 3NCYS 4X6DB 5FKAB 2F19H 1MFDH 2A74A 3DOSA 4LEOB 3CUPA 5F7KC 4F7CB 1EO8H 3BKCH 1T7ZA 4M5ZL 1MI5E 1MRFL 4DQOL 2ITCA 1HSBB 3QB7C 4XNUH 2GCYB 3MBEA 5C0CA 1SJHA 3WKNA 5GJSH 4ZPTA 2A6DA 5GGRY 4YR6A 2HKHH 3WUZA 4Q6IA 1V7ML 4PB9H 4LRIC 5GGSY 4UDTA 3BPNB 1T04A 3O4LE 2HFGH 4ZAKA 4YXKL 5CEYA 3W9DA 3T2OA 4OF5A 4Z95L 1AH1A 1U93B 5CSGA 5L6YL 5EU4A 1CL7I 3MRKB 2EDHA 1HYSD 1BFOA 2OTWA 1ORQB 4PJ5A 2UZYB 3CFIC 3QO0A 2NZ9D 1ES0B 4C4KO 3AMLA 5DURD 1B88A 5KTEH 1MAML 1S9XB 2WWMC 2J88H 3QDGA 5D72L 3AS0A 1ZV5A 2EDWA 5BS0D 3PWUA 4QRUA 1KYOK 4KKBC 4U1IA 5JXAH 3MV7B 5AYUL 4BH8B 1UKQA 4Y4KA 3RWHB 3NMEA 4PGJA 2N56A 4X7SL 1YEDB 3RIFK 2BFVH 4F7EB 2A6KA 1G6RB 2ESVA 3F8UB 3W82A 4KKAD 3MYZA 1FL5B 2ARJQ 5IBLC 4P2RD 3PDOB 1BFSA 4XTRC 43CAA 4XPBH 2CIIB 2LU3A 2WSKA 2DKSA 3HZKB 1NSNH 2XZCL 1CGVA 3KPLB 4W4OC 1EMTH 4QHKJ 2EDBA 2P7TB 2QR0A 1T04B 4LGSB 3UMTA 2A38A 3HNTH 5LAXA 1SJVA 2C1PA 4JFFB 5CEXA 4ELKB 1NDGB 4WTZA 1OWWA 3DO7B 2Y9RT 1GVIA 1YNTA 3BPLB 1TIUA 3EJZC 1FN4B 1HI6B 5I66B 1MVUA 2G9HA 2X4OB 4R90H 3CFBB 2VLME 3A6CH 3CSGA 5IMKA 1J1XL 1MFCL 4HQQL 4JE4B 1F3RB 3MO1A 2VDMH 4YHZH 5CEZD 3FFCB 1ZT1A 4RFNC 5HJ3B 1AKJA 2J4WH 4JRXA 5IG7B 4XVJL 3SDXF 4LCYA 3SJVB 3T0XA 1H8OA 1P4LB 4CDGC 4KK8C 2ZNXA 3IDIA 3KPRA 1CWVA 1F4WL 2E6QA 5IFJA 1H9VA 4FXKB 4AMKH 2NY1D 4KHTH 1NL0H 4LPCA 2BDNH 3MA7A 2L0DA 2YA2A 3X12A 1VEOA 1QFHA 4LLVA 5DJ6A 3TBVA 5C0ND 2R0WL 4ODUA 2MCPH 4KROD 4ORGB 1AO7E 1BPVA 5CWSA 2P7TA 2A2QT 1A3QA 5HI5C 2YS4A 1F58L 3KJ4B 2BC4A 1UQSA 5F3HA 5EIQA 2DQCL 3S4SB 1MOEA 1FL6B 3MODH 2X4TA 1RIVL 3DWTA 1BF2A 3R06A 3MNVA 1RHHA 3JV6A 4MNHB 3LHPL 2V2TA 1ITBB 1K8IB 3QDJD 4PJDE 1OGTB 4ZUSB 1DBJH 1JWMB 1F90H 3TT1H 1MCWM 1MQKL 3PNWA 5A40E 2OCFD 3CVHB 2J8UF 3WLBA 1RUML 1U92B 2BSED 3V7AG 3WIFA 2VDLH 4YXHH 1A1NB 1DQDH 3I2CH 1B0WA 1RU9H 3R8QA 1U3HA 3H9SD 5ESAA 5D8JH 2R2EB 1OAXL 4K7PH 1NDGA 4QXGH 5KSVB 3W11D 1X6NA 4LDEB 3L5HA 4X5WA 1KB5H 2CLZB 2NMSA 5F9OL 3PGDA 1AGEA 1WT5A 5I75C 3NA4A 3QIBB 5D7KD 5BV7C 2NY0B 3IFPB 2AK4A 3MRMA 3OPZL 5DRNB 4IOFD 2DI7A 1TPXC 3DSFL 4KJQC 5EUOF 4LIQE 4HPOL 1MCJA 4GSDH 3QH3B 4YDKH 4LASL 4W6WB 1PW3A 2FSEA 4WFFD 1P7KB 5CZXD 5CCKH 3MX0A 1FLTX 3GMOA 3HTLX 2GY7B 3DSFH 1KC5H 1VA9A 1I3RA 2XZQL 4F9PA 2C26A 2PW2A 5K93A 4XT1C 4MLIA 1K8IA 1V05A 4QF1B 3VFRA 2HWZL 4AH2B 1L7IH 2GJZA 2EEDA 2GSGB 4WIQA 2X4SB 3NAAL 2CDEB 4JO2H 1OTSC 5GISL 1G7HA 4E41B 4Y5XA 1F3JA 3I3DA 5D8JL 1TLKA 2D7NA 2OI9B 3OJVC 4I2XB 3GHBL 1Q9OB 1Z2KA 3TT3L 1S5HB 4L1HA 1TQBB 5D2LA 1MNUL 4IMLB 2P5EE 2O93L 4JO4H 3OKOA 3GJEA 1NAMH 4OZFB 1BBJB 3T1WA 1A14H 2RAMA 4P4RA 1F90L 3MCLH 3BQUC 3L3DB 4X7FC 3ZHKA 2YUXA 4BK4A 4IHOB 2APWA 5I1LA 2GSIB 1KJ3H 4APQA 1RIVH 1U91A 3IFPA 5DRNA 3X17A 2NY5C 4P9MH 1CI5A 1J8KA 4ODVH 1JZ6A 4YPGB 1NBQA 2DQHH 2F53A 3PABA 3AU1B 2OL3H 3LKSA 2OL3A 2W0FA 4WEUD 4J1UB 5DRWB 2MCPL 5I1IL 1H3WM 4HJGA 3IYLW 3HNVL 4LCWB 3SDXB 3C8KB 5JHDB 1YEHH 3K4DA 3L5JA 4XGZA 3CH8A 3ZE2F 1KIPA 1ZS8B 2PW2B 2YD3A 5HHOE 4Z7VA 2W91A 4QRRA 3VGEA 3RAJL 4A6YA 3U4EA 5EBLB 2I60H 4QXTB 4BFIB 3R4DA 4K3JH 5L8JB 1JMXA 1YNLL 2VL5A 1TZIB 3C5JB 3ISWA 3DARA 2X4PA 2OXHA 5D7JD 4GQ9H 4M6NL 4RFNB 2FRGP 2QHLA 3V6ZB 1JHTA 3MRJA 4MD0B 2W9DL 1P7KA 4JZJC 1U95B 5C0AB 3TBYB 1JYVA 4NQSB 1Q72H 2DOCA 2F8VA 4FQHB 5J6HA 3ARSA 4KZDH 1N8ZA 4N0CD 2FEEI 3C60D 1FC2D 3NCYP 4XVTH 3RTQB 1KJ2A 5D1QB 3QDGE 4HWZA 3V0VA 3O11B 1YMMA 4LFHG 4Y5YC 4ZYKA 5IV2B 3W2DH 3ARDA 4JO4L 1K2DA 2E7LA 2P8PB 5JUEL 1QVOB 3MGTA 5JOFA 1EMTL 3RVTC 4NFDA 3P4NB 3B9KD 4NP4L 2I07A 4QTIH 5EU7E 4L3EE 3RDTC 1KLUB 4UNUA 2WIIA 3KYMA 1Q0YH 2VLJE 4JRYE 4Z7VB 2B4CL 2XQBH 2Y07L 4GRLB 3NZ8A 1F5WA 4M7KH 4V1DB 1KG0A 4PJDA 4Y2DB 5C2BL 1RQ5A 2HT3D 3VWJC 3Q5YA 2M2DA 2QADD 1YY8A 5D5MA 1MUJA 4KJYB 4H88H 3F5WA 3O8XC 2IH3B 4K94C 1HXMA 4QNPF 1WZ1H 4PJCB 3GIZH 2EDFA 5DTFB 2CJUL 1FPTH 3ZT5A 4NQXB 3GB7A 5DD5L 1MAMH 2DWDA 2Q87A 3O4OC 2H9GB 5SX4I 3HAEB 3IETA 4O2FB 5ICXA 1PZ5A 2JK5A 4M1GH 5D70L 4MXWH 4JR9H 4M6OL 2C4XA 3JWDC 4QEGA 5D1QA 1FNFA 5B39A 1EIBA 3SHSA 2MQCA 5IJVB 5I30H 3CSBA 5T3ZL 5J8OA 2YN5A 1FFPA 5EU6E 3ZKNC 5GRVL 4XP6L 4DKEL 4HMDA 3GKZA 4ZQKA 2GITA 2NXYD 3U0TA 4L4TD 4WGVB 1AFVL 1ODAA 3BIBX 4YHKL 4M1CD 3JXAA 5EZLB 4H1LA 5DMKB 5IOPB 1DBJL 1R24B 1BEYL 4HJJL 2BVQB 4XHJD 3DIFB 4HBCL 4JFEE 1HILA 2YPKA 1BD2D 4QGTA 2OXGA 5GRXG 4LKXB 5JPNB 1X5HA 4D9QE 1RZ7H 1IT9L 1QBMH 2ICWB 3BP6A 3VXRB 2D7PA 2B1HH 1N5AB 4W4OA 4AY0A 4KQ4L 3HPLA 2HH0L 1LEKB 4Z7WB 5FECA 1GIGL 4FFVD 5JHDD 4YUEH 3CDYA 3QDAA 1SEQH 2Y5EA 4NM4L 4OZ4A 4K7FA 4QRSB 1TZGH 3WSQL 3O3BB 3E6HA 4PJHA 2H8PA 1FRGH 4EXKA 3NFNA 4WNQA 2AABL 3VXTB 1KULA 4HSQA 1DBBL 2X4UA 3D3VB 3FN9A 5FUCC 4YGVB 5KVMC 3NN8A 4K3GA 1IGFL 5J12C 3WFBH 3CFKB 1GGBH 4XPGL 4NIKB 2YPLE 4KU1A 4YDIL 2LFGA 4XVJH 5JW5B 3QNZB 4LCUA 2P8LA 4J4PD 3VXQB 1U8KB 4LOUD 3BGFB 4N8VG 2ZWLT 1X5KA 3EDEA 1ZTXL 3FQTA 3HAEH 1UEYA 1JF1A 4G42B 4NYLB 5K33A 4AENA 5EO9A 4LCCC 2PO6D 4PJIE 1SJEA 1WCQA 4ZSOA 1NANI 2EE3A 2HT2C 3L95A 1U8PB 3TCLB 2D3VA 5B38B 4RSVA 2ICWA 4CN1A 2I9LA 3KPRB 1JF5A 3RZWA 4HC1A 3TYFA 2AVGA 2W65A 5FA4B 5ILTH 2GAZA 2X4OA 3VJ6A 4GW5A 2MHAB 3LQAC 3DO3A 3DUUA 3O9WD 4UBDD 4HWEH 4FQPA 1AE6L 4YHOL 5IG7A 3LKRA 3LH2H 5DC4B 1QPXA 3QEGL 4KY1L 4P0DA 5D7SH 1GYAA 3R1GL 2P5WD 1AKJB 1KEML 3MRHB 4BQCA 1MREL 3D87B 4P23C 3REVA 3L5WB 4NUGL 3SDDA 5INCA 1P5VA 2BSSA 4G6JH 3HPJB 2XQBL 3PWLB 4NUJA 4OCSH 2VLJA 4JRYA 5HHOB 4NSKB 5GRJL 5I6XC 4JHAL 5ISZD 1VFBB 5LCVH 5E7FA 4KI5F 1ZLVH 4HUUA 3S7GA 5KTEL 4FFWC 3VGDA 4L8SA 5DHVB 4IRZH 2PXYA 1S7RB 1A7PH 3CMOL 5KVGH 4I18A 4KJPC 2P46B 1XIWA 2DKMA 4HS3A 2W59A 4BH7B 2IQAB 2ZUVA 4PJXE 1M1SA 4Q6IC 5AZ2L 5IBUG 5L6YH 1D6EA 5CGYD 1YEKL 2ERJB 2X05A 1ND0B 1RURH 1UADC 2AXGB 3MUJA 2Z35A 1NBVL 4B0MM 1Q0XH 3B6SB 4HS6B 5T3ZD 4JQXC 4P59L 2VZUA 3BPOB 4JCMA 4RISH 1DLHA 3VXRD 4PTTB 1GHFH 1J88A 2F58H 4WI3A 1U92A 2OP4H 3HNSL 3U7WH 5FGBA 2X1OA 3OAZK 3GRWH 3HLAA 4ZUWA 1T22A 3L3GB 3WE6A 1IZJA 2AEQH 1GXEA 3O2DL 4NN7B 1N0LA 1GSMA 3L5WA 4DAGH 2EZ0D 2AGJL 5IKCA 5E8EB 2Z8VC 1TJHL 4AK1A 4NCC1 3TNNA 5IVXF 2YRPA 3MV01 3KPSA 4R96A 1NGXA 3WIIL 5DMIL 2C3WA 3GMRA 3WO4C 3HB3D 3S96A 3OGOE 4Q9RH 4LLMA 4JY5H 2X4RB 1HOCB 4Y5XC 5F1NA 5HDLA 1TPXB 1NGZB 1QZ1A 2FB4H 3VDCA 4JB9L 1Z3GH 1I9RL 4LRIA 4P9ML 3MXWL 2D4DA 2HTLC 1EEZB 4ZO6A 1UKTA 3KPNB 3ABZA 4OGYH 2DMCA 3O9WC 1TQBC 3LN4A 1LK3H 5FYKD 2WQRA 5TF0A 3OKYA 4J12A 3RVWC 5F9WB 1IEAB 4DZBA 4NDMB 4H0GA 4JFZH 3V4UH 5F7YC 2QADB 1ED3A 1HNFA 2P42B 3JVGC 3RWJB 1A6VL 3INUH 3QA3B 4JPVH 2CDEA 3GHBH 3FT2A 5HHOD 2VXVL 4XCCH 4HJGB 1NEZA 3DUSB 2Z4QA 3MV8A 5DFVD 3GSNL 2EH8H 4UT9L 3IDJA 1FDLH 3TBWA 2XICA 4XX1E 4QY8A 1VPOH 4AIZA 5GZOD 1QO3B 3B2UC 3I84A 1QRNB 1AGBA 1T7XA 4HV8A 5GQBA 4ZDHB 4WCYL 2VSDA 4FFZH 4IHOA 4Y1AE 4RA0C 2NY4D 4MD5B 2NY4C 4ODXB 3ZSSA 4YBHA 2W0PA 4QHLB 4Y2OA 2WWKT 3S3SA 1XH3B 5JIHA 1SM3L 1EBPA 2VISB 2X4RA 4GSDL 4BKLB 2IALB 1J0HA 2VNCA 2C9AA 3FOLB 4N90E 4X4YA 3WMSA 3K2MC 4X8JA 1Q8MA 1KB9K 1XGUB 2CGRH 1IGMH 5KSAC 4JZJB 5E9DD 1QHPA 4YIQB 5D7LD 4U0QB 5EO1B 5EZJB 1ZVSA 3WHXB 2EDKA 3VXSE 1H5BC 1MCPH 2GIYA 5I18H 3ZKND 2ARJA 3TO4C 1I9EA 2CDGA 2L7UA 3QDMA 1CIUA 2FD6L 4NKIL 3P0VH 5IHZA 1WCBA 4OCYL 3SKMB 4K3DL 1QPPA 1MQKH 3MLXH 3NFPB 2Y1VA 4M7ZB 2D9QB 3UC0L 1DBMH 3L9RB 5E7BA 2NX5A 3KJ4C 1N8ZB 4Y89A 3QFJB 3IDUA 2WV3A 3IJYB 4YAQB 2YD2A 4K3DH 2N1KA 2KL6A 2XFXA 1QVOA 4TNVK 3JTTB 3RTQC 3RGVB 5K59E 4N0YL 4FXGB 2A83A 4PP1C 5DUPH 4GG6A 1RMFL 2EH7H 1NEZB 2YWZA 5DFWH 1MSPA 1DN0B 5IBTH 1FCGA 3R06B 4MJ2A 1CXEA 3CCHA 3O8XB 4YHIA 1ZOXA 2EYSB 2CGRL 3UROR 2CKBH 3G5YB 4PG2A 2A77L 2X9XA 1QSEB 4OZGF 3CGTA 1UC6A 2ZCHH 4MD5A 4F3FA 4HK0B 1DUZA 4GAYA 1TJGL 3OF6A 1WZ1L 3BKJL 1XCQB 4DVBB 6CGTA 5FO8B 1HXYB 5HDQH 4KTDH 1MPAH 5KSVA 2MMXA 3O6LH 1LE9A 1I8KB 4KAQL 5I8KH 1CICC 3VXME 4G8IA 1A3RL 2GUOB 1I85C 2JIXB 2Y4SA 3KPLA 2E7BA 4QHMA 3SGEI 3GBMH 1VPOL 1CG9A 2X6MA 2D03L 3A67H 4GKZA 3T3PE 4EDXB 5KVFH 5MEND 5A3ID 2QQKH 5GGQL 1BOGB 2NY0D 4M00A 5GSRB 4R9HA 2ZUQC 4Z18A 5IJVA 4OZHE 2UV3A 1KLGA 2FX7H 3B2VH 2YK1H 5IBLD 1D6VL 4R7DB 4X6CE 5TFSH 1WF5A 3VI3F 4I48A 3B3IA 4R26H 2AXFB 5CMAA 1NJ9B 3UTPD 5EU5A 1UXSB 1ZAGA 2J8UE 3C5SA 2Q86A 4V1DD 5HGHA 2Q8AL 1GOFA 4NWTL 1Y6KR 5EUKA 5IB2B 3GMLA 4PLJD 3HI6L 3TIEA 1E27B 1QFWM 3ES6B 3WFDL 4JFXB 5BXFB 4Z7WA 1LEKA 4LLYB 5FECB 4EUPA 5I8OH 1WWWX 1U3JA 3BH9B 2VLRA 4I0PB 1MCDA 4YQXL 3O8XA 3OAZH 3G6JF 4LNVA 3BOVA 5IMLB 1MIEH 2PXYD 1YJDH 4XCEB 1XF3B 5JOPE 4WVRA 1DEDA 4Q9QH 4OM0L 3FO2A 1B0RB 1M4KA 1OGAE 1DVFC 5DVNA 1KXQE 2X9WA 1VADB 3FOMB 3RDTB 2GTWB 5I1IH 2HJLB 4XMKH 3TYFB 5T3XH 2FNBA 5EDXA 4TVPE 2JCCA 3P4MA 4Y4HA 1WTGT 1OP5H 1M71B 5F7FA 1Q9WB 2X1XR 5DRZA 5HPOA 4XC1H 4R97B 3LN5B 4MWFA 1X5IA 3ZT7A 3DRTA 2ED9A 3ARDC 2ZUTA 4G42A 4H8WL 3MLRL 4DW2L 3RFZC 5CP3A 4KROC 5F88A 4N5EC 3HI5L 5IB2A 3MLPA 3B9DA 5IB3B 4KPHH 1L7TH 1A7QH 1LP9F 3T0VA 2APBA 1KTLB 5KANI 3EOYG 4GS7C 3FRUA 2VDQL 2XN9B 4XPTL 3VFVA 1MCPL 5CJBA 3RY5A 2ORBL 3S4SG 1WUNT 5HYSB 2W60A 3SY0B 5FOJA 3IKCA 2CK2A 4DVRH 2R4RL 1P1ZA 1LDSA 1P6FA 5IW1B 3MLVL 1BFOB 1BVZA 1ZT7B 3K4AA 1JPST 2F5BH 1NBZA 4BM7A 4FQCL 1YYML 1VADA 5E4IA 1MLCB 3K7UA 4Y19A 2DQGH 1KCVH 1NGWB 5ITBL 1M7DA 2R1XA 4XP4L 1A7BA 1RJZA 5HHMB 5EWIH 3FQWB 5T5FL 1MAJA 1WZKA 5EFIA 1UWEH 4OFVA 1CK0H 3CFCH 3EO0B 2Y5TA 2Y36L 5BQ7B 1IGIL 2MPAH 3WJJC 3QWOB 4GKSA 4I2XA 1LDPH 3IXAB 3EBAA 1RIHL 3ARBC 4HLZH 4LHUB 1KCSH 3HMWH 1MUJB 2XXMB 3EO1A 3CX5J 4ZTOH 5I1JH 4PGEA 5DDHB 4G80A 3MRLA 3FFCE 1I1YA 1IGIH 2MPAL 3BSZH 3CSYA 3ZTNH 4KVNH 5CIPA 5EPMA 4L9LB 5IHUH 4PJBB 2P48B 1CD1A 3QXVA 2ZUYA 1S8DB 4PLJC 1W8OA 1TJIL 2A1WL 4GW4A 4ERSH 1CDCA 1KIQA 3OKEB 4QXUH 5D2NC 4RMQA 2HKFH 1DQLH 4ONOA 2HT3C 4PJFF 3VWJD 2BX5A 4IOFC 3AAZB 3PL6A 3MFFB 2XRAL 3QUML 4B5EA 3IDNA 1KEGH 1XEDA 2M26A 4JDZA 3BGFC 1S7VB 5EBWB 4UT6L 3RY6A 1VGEH 2YUVA 1L9MA 3WSQH 5FDWB 4WEMB 4MQ7B