4H20L

Crystal structure and computational modeling of the fab fragment from the protective anti-ricin monoclonal antibody rac18
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
DIVMTQSHKFMSTSVGDRVSITCKASQDVTSAVAWFQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYGTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and computational modeling of the fab fragment from a protective anti-ricin monoclonal antibody.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Light chain of Fab Fragment from the anti-Ricin Monoclonal
total genus 49
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2012-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4h20L01
3G5ZA 2VR4A 4XVTL 1BM3H 3D25B 4LCWE 4R4NC 3VFPB 5CGYC 4ZXBD 5E95B 3TJHD 5EC1A 1DLHA 4E41B 4UZGA 4NYLA 1GHFH 3CC5A 2QBWA 4L9LA 1HHIA 1KCVL 2GTWA 1I8KA 2CDFB 5I71B 2BNQE 2DQTL 2YD4A 4WFFE 4AT6A 3MV8E 3O4LE 1HHGB 5TE7L 2EE2A 3LH2H 1AQKH 4ONFH 3G6JF 2HT4C 3F65A 3EKCA 5GRUL 2HN7A 3ARED 3O6FB 1JZ4A 1FNSH 4IS6B 2Q7YB 2NNAB 3S35X 2KPNA 1HH9B 3Q1SH 4MNQE 4P2RD 5CFHA 5FO7A 4QY8A 3PP3K 2EYSA 2KQMA 5CGTA 3SDYH 5JMOC 2NY7H 4AEFA 1FBIL 3VWJB 5FUCE 3QIWD 2JCCF 1FH5L 4JB9H 3SE9L 4G9DA 2BSRA 5EU6B 1VFMA 1YNLH 2WBKA 2XZCH 1BBDH 3P40A 2R0ZL 1T1WB 4DVRH 3GIZH 4XPBL 5IVXA 5HGBA 5IKCB 5F9WC 4PRID 1RJLB 3RX7A 1OVZA 1OWRM 3BDBA 1UGNA 2KH2B 2A83B 3VXRA 4N0CD 2EYRB 4JHAL 2RIKA 4JHAH 3MLZL 1Q9WB 5D1XB 1FL3A 2W9EH 4KZDL 4JRXD 2XWTA 4PJIE 1SMOA 4S1SH 3CPLA 1QRNE 4LRIC 4ZSOE 1KLGB 3X14B 2P4AB 4OZ4B 4P9HL 1MCNA 4XBPA 5FHAH 2HH0L 5H37H 3TPUB 2KUTA 1QHPA 1XF4A 35C8H 1YJDH 5T33H 5HDQH 2VLKD 3QIUC 1BOGA 4TSCH 1DQLH 5IBTH 3SE8L 4PRAB 3KYNB 1SYSA 4F7CA 3MRDB 2AK4E 4ZXBC 1NFDA 3FQNB 4JEGB 4L8BB 1KG0A 4OM0L 5JIKA 4HUVA 5JZ7C 5F9OL 4S1DC 4MXVF 4UU9B 4Z7VF 3VWJC 3OKDA 3ZKNC 1PZ5B 3PWNA 1QPPA 1CF8H 1G9NL 3IU4L 1FORH 4HULB 1Q9LB 3H0TB 4KFZC 3BEWA 1QRNB 5DHVB 3EOBB 2YK1H 3QUZD 5ESVB 2VLJB 4X7CC 1AO7A 1LHZA 3LH2L 4ERSH 4OI7A 2EIBA 1C5CH 1CLZL 4BFIA 5CIPH 1SJEB 1PKQB 3PV6A 1JWSA 3FN3A 3SDAA 4NJAL 4X9GA 4JO2L 3T0VA 1A7PL 5I1HL 4PG9A 3NPZB 2YD9A 2XZAH 1EFQA 5C0GB 2YA1A 4RAVB 3IETA 2DRUA 3DX9A 4S1RL 4UAOB 3QDHA 4U1GC 1VACB 5JR1L 4U6HB 1CD8A 4FQCL 2FL5B 1O7SA 1T7YA 4KK5C 1MRCH 4X6DE 4QHKJ 2X1WL 2XNAA 4AL8L 2FEEI 1LNUA 4EDWH 2DQIH 2H2PD 1U9KA 3T2PA 4XMLL 2GQHA 1JTPA 1M7XA 1FGVH 4PJCF 1NC4A 2VLMD 3KJ6H 4MA7L 4LSTL 4OCYH 4TUJA 2FECI 1ULVA 5IMMB 1OAKL 5BZDA 1N59B 5HYSA 2VQ1A 5KSUB 3T09A 4FFWD 3EOTL 1ERNA 2AEQL 2OI9C 5F9WB 5FXCH 1JZ2A 1FN4A 3MOBH 3A6BH 4L3AA 3PWJB 1MREH 5GGVH 5EO9A 2FEEL 4Y2DB 4NHUA 1ZVSA 3FT3B 1GZPB 1V7ML 4QYOB 4MX7B 3SGKC 1J8KA 1EAPB 5C0DB 5E08L 4TRPL 3SKMA 4JDTH 4ODTL 4PJ9D 1HSAB 4M7LT 4H5SB 1N5YH 2D7PA 3QDGE 4DAGH 2LAGB 3BMVA 3HFML 4BJLA 1U58B 4FNLH 5HYSG 4PV8B 1N7MH 1VESA 4HUXB 4LDEB 5L88L 1PGRB 4JDZB 1ND0A 5JMRA 5C0AB 4HV8B 1MAMH 4U1SA 5EBWB 1FO0B 2Y25A 3C8DA 2DIJA 4Z7UA 3EIFA 3OGCB 1JF6A 3BKCH 5EC2B 3GJFB 3REVA 1C1EH 5GRVK 2XV6B 4J1UA 5D2LF 4MXWL 3NIFE 5D1XA 1XGRA 1BQHA 3QFDB 4ZMAT 3H9SB 4WJ5B 2MHAB 5KW9H 4GQ9H 4PGBB 5D5MB 1T04B 4XHJD 3RUGB 3B8YA 3DIFA 3SJVD 5ISZD 1FZKA 2YRZA 3EYSH 4QXUH 1F58L 3TVMB 4X7EC 4JM4H 2ICEA 2WV3A 3C08H 3LS5L 4GO6B 5AEAA 3IS0X 3SPVB 3DMMC 2IFGA 3QNYA 1RU9H 4B5EA 1U8JB 4HPOH 3LKRA 3E8UH 3VI4F 1J8HB 5D2LA 2EDKA 3UJTH 4RISL 1ZHBB 1S7VA 3RVVC 4F2MB 4G9FD 3HE6A 5HGHB 5F70A 5F71A 3TESA 5A2KH 1MNUH 3AM8A 3CFBB 5J3HD 4LSTH 3MODL 2AI0H 4LHUG 5EU4B 1RSFA 2IEPA 4I18A 4NSKB 5CJOL 5D9SA 1QR4A 4LSUH 1N2RB 4KJPD 1EEYA 3AU1A 5BS0A 3Q5YA 3MMEB 5HDBE 5GGTA 4JZNA 4W4NA 1CFNB 4NQCA 4N9OB 4HIIA 4POZC 3B2VL 4N0CC 3RAJH 3W2DH 4LLAA 4GQPH 3S37L 4D8PA 3RWJA 2FNBA 4CAGA 5LCVH 2WAHA 3TCLA 4LEXH 1VCAA 1KJ3L 4KXZH 1KXTB 5IROA 4OGXL 2PETA 3O4LB 3DXAB 3RZCB 1CLYH 2P5WE 4Y19D 1DLHB 1HKLL 1FO0A 2DBJA 2HVJB 3VWKA 1SEQL 1CDIA 1HDMA 2D7QA 4JG0H 3WL9B 5JORA 3QIBC 3RJDA 3KPSB 1KJ2H 5E8NA 3QIUD 1UM6L 4U6TA 4GKZB 3VRJB 5B38B 2XQYK 3ARVA 2W9DL 2VQTA 4B41A 1DUZB 4RAHA 5D7KE 4K3HA 1IJ9A 3B9KB 1CICB 4Z7WB 3OHXA 3LMJH 5DUMH 1NC4B 5C08E 5CSGA 3I75A 5KJRL 3BQUA 5IMMA 1NCAL 2XZQH 4WO4A 1QBBA 1MCDA 4Z7VA 4HLZG 4RCAA 4ZUWB 3JTSB 5HHOB 2NR6D 1A6ZB 4PJGE 4TVPD 4U1HB 4GW4A 1IC1A 4IIQA 1JI2A 1BFSA 5D7IB 4JVPA 1NDGB 4BUGA 3B3IA 4UNTA 5IHZB 3RIAF 2X1OA 5F6IC 4D9RE 3U0PA 1RUML 1V3MA 1DQDH 2PR4H 3SDXA 4KZDH 4YO0B 3EYQD 1MHPH 5ABDE 5BMFH 4PB9L 2PKDA 4NN7B 1CLOH 5T1DL 5DJCA 4L4VD 2CR6A 4GAGL 3KJ4C 3QZWB 5IEKB 2YD3A 3CJJA 4G3YL 4JGJA 3BYYA 2YK1L 1D5BB 3KPQA 1I8MA 4X6CF 2DN7A 3LKNB 4HFUH 4LRNH 5I15L 1UH3A 4TPRH 4AZ8A 4QLRA 1ZV5A 5TJWK 4PP1C 3RAJL 4MWFA 3SGJA 4XP6H 2BJML 4OZGB 3D2UB 4L4TD 4JE4B 3FTGB 1NBQA 4OZFA 5GGSA 1CQKA 4ZQKB 4DGYH 4PJ8B 1R3LB 1WZ1L 4NBZB 4G7VL 4WGVB 3SDCB 1EO8H 2CGRH 1E28B 2AEIT 3TN0D 3GRWH 5J13C 4JG1H 3TVMC 4P4KC 2ICWB 1U8JA 3BUTA 3RVTD 1AXIB 5F89B 2IBGA 1KTDA 4U1IB 1GZQA 1ZA6B 1ZWIB 5SWSD 4WU5B 1ZS8B 4CU8A 4NO0B 1YYMH 2R2CA 1KIRA 4C4KO 4N1CA 4K23H 5CMAB 2HT3C 3P0GB 3NIGF 3MREA 4Y8DC 5F44A 1EUUA 1MQ8A 3T2OA 4HWNA 2P42B 2DQGH 3W0WE 3M1BB 1QFWM 3K2UL 2HYMA 4O5LL 4TVSa 1P7KB 1QLRB 2DL9A 2R9HC 2MNUA 4M9OA 4OGYL 2BDNL 2XXMB 4H20L 3NABH 4XMKL 3B8SA 4RMRA 1F6AB 3S8WA 1UACH 4DUWA 3MRBA 5E2VL 3C6LC 3PHOA 1OT1A 4OCRL 5I74C 3MUY1 5JTWA 1BD2B 2VITB 3QDAA 4PG2A 5EBLA 4EXKA 4QF1B 3HUJB 4J4PC 4PJIA 2YUZA 5DRZA 4PLNC 1E6JH 3KPNA 4FMKA 5DEFA 2ADFH 3TNNA 2AJYL 5HVHC 1JPSL 4HF5H 4KPHL 3F5WB 1MJ7H 1V7NL 2B2XL 3KS0J 4LLYA 2J88L 3PG2A 3KPMB 1FVCA 4C59B 8FABB 5J3HC 1IQWL 5K59E 5L8KB 1DANT 2DTSA 2OL3H 5CEZE 1KIQB 1HKLH 1IEHA 4TNVF 3TIEA 1FVEB 4K55A 4J3WA 5MENE 1SEBA 3QPQD 3W9DB 3OJMB 1I3GL 4ZAKB 4O2EB 3NIFF 2VXVH 2NY3C 3KYKH 3HUJE 5FDWB 1BGXL 1I9IL 1IC5L 2BY0A 4OLUH 1MF2L 3TN0C 1BFOA 5FB8A 4X6CA 1CFVL 2F54B 1E4XL 3QFJB 3NZ8A 3DPBA 4MB3A 3EFDH 5F21B 3RNQA 3B2UC 2DBLL 4UT9L 2ORBL 4X80H 1ZLVK 3T0EC 2R56L 1XGRB 4YBLB 3ZT5A 1CD0A 1GC1L 3A67L 4RQQA 3G5YA 3U0TA 2BRRL 2MKWA 3QR2A 2VABA 3BIAX 4BM7A 5J12B 1LO2L 5C0BE 4LOUD 5FOJA 4WTZG 3N1MC 4JFOB 2BMKA 2DQHH 3TNMA 1YUHB 1Q94B 4PGEA 4ODWA 5GSVB 5E24E 1P1ZA 4C57C 1MRFH 4HZAA 5DMYA 3GO1H 1D6EB 2NR6C 3V4VL 5AYUH 4O2FA 3BJLA 3ROOB 3MBXH 5IB2A 1EFXA 4DJMA 3F8UB 4NRZA 2KZ1B 3SDCA 4LLUB 3T2NL 1JRHL 3V6BR 5I18H 3VGHA 3WNPA 5CLWA 1EVUA 3MRRB 4NZRH 1MIML 4OBRA 1FVDA 1X5LA 2HFGH 1TENA 3BGMB 1MIEL 2Y6SC 4I5BB 2PYFA 2EDEA 3U7WL 4Q2ZB 2ATPA 2FX8L 3MCLL 4PRPB 4JDTL 3LSOB 3SQOL 1SBBA 1ZA3A 4B7LA 2CPCA 4LHUA 1FAKT 2D03L 1NBVL 1QKZL 3KWWB 2DQJH 3TV3H 1QBML 3WDIA 4JZJC 3MOBL 3KPRB 2K7QA 3QJHA 1FNSL 3QUXA 5TH2B 1K8IB 4WUKH 2NY1C 4YHZL 4HIXH 5KTEL 5DWUL 4MLIA 4YBLC 4GOSA 1GH7A 1AQDB 4GBXD 1JWSB 4MZ2A 1CXHA 1DUZA 1IGCH 4PJAE 1CG9B 2IPTH 1OGAD 1Z3GL 4MNGB 4Y16D 2VISB 5HHOE 3ARSA 1HIMH 5FKPA 2OZ4A 3RWCA 3BZEB 3DRTA 3O2DL 4NUGH 3UPRB 4EJ1C 1FNFA 1NPUA 1MCSA 4R26H 5H35A 3BP5A 4WO4C 4ZS7L 3QB7C 1HNGA 5FECA 3X3GH 4DKFH 3FQNA 1BOYA 4A6YH 1KN4L 1X5IA 3MRMB 1ZLWK 5C3TA 3UDWA 3DO7A 3H0TA 1Q9LA 1P4LB 3BH9A 4XMPH 4LVHC 4PJIF 2COQA 4U6VH 3RWIA 1WCQA 4NGHL 5F7NC 4NQTA 1JHTA 2J4WH 1UVQA 2F58H 15C8L 1II4E 2WUBL 1X5ZA 3OAUH 1OTTC 1FZOB 3ILQD 1XIWD 5IJKA 1EFXD 1BM3L 2V2WB 5I74B 4FQXB 4P49A 1IBGL 3D85D 4YAQA 3QPXL 5IVXB 1JVKA 4LCIH 3ARDB 4UOW1 4NN5C 5GS3A 4HUWB 4RBPK 1EXUB 2HKFH 2R2HA 3V5DB 1VACA 3P30H 3RIFK 3MOAL 2NZ9D 1QSFD 1SYVB 2WW8A 4GRLB 3ULUE 2H26A 2VO5A 3K80A 4H26B 4NOFA 2Y7QA 1EEQA 2X2YA 4HIJB 1LDSA 3W39A 2X42A 2O5YL 3VRLE 3E2HC 1A6UL 2EDRA 4PJGF 3VXOA 1XR9B 2G5BB 3PL6D 3LRSB 3PQYA 4TSBL 4TSBH 3HB3C 1MCPL 2X4UA 3GK8H 1U8HB 3KYNA 3RA7L 4JY6B 4BKLA 4XXCA 4QCIA 4ALAL 3MLRH 4KKBD 1C5BH 1MHCB 2CUMA 2DYPA 1YEIH 1HQ4A 2Y23A 1WICA 2DQDL 3H6JA 1E4KC 1CICA 3PGFL 4WO4D 5HPMB 2O61B 2WQ8A 5ACZA 3A6BL 4LVOC 3OV6A 5DK0B 3UPAA 4MX7A 5GZOD 3BQUB 4P23D 3MLSH 4ODSL 4R7DB 3KR3H 3RDTC 1QFUH 4PLKD 2Q8AH 1I8KB 1XAUA 2CDFA 3VXNA 5F88B 4YHIB 1I1YB 4ZDHB 4PJHE 3TYFA 2WWMC 3WDJA 2VXSL 5CEZL 4UQ2B 2CLRA 5MHSE 5GS0D 1MUJA 4TOYL 4WI2A 5GGTL 5AZ2L 3MUHL 3V6OA 2R1WA 1CE1L 1P5UA 4M62H 1IEAB 1OTTD 4EDWL 3CFEB 3ILQC 1BGXH 3EO9L 4H8WH 3I85A 4NQCB 4Z9KB 5C1MB 3TFKC 1I9RL 5DMGD 5I1EL 4P46C 1NFIB 4HC1A 4QOKB 2LTQB 4NC1C 3NIGE 4CMMA 2W60B 5EU6A 3CIQA 2NW2A 3KPPB 3U7AA 1INEH 3GSNA 3QG7L 4K8RH 4E0RA 4M5YH 3MV7E 4APQA 1B0WA 3AAZB 3IKCB 4DKEH 2HJKB 3HA0A 3L9RA 4P3WA 4MVBD 4ZAKA 5T1KA 1H3UA 5DD1L 1DZBA 4OCSH 2I27N 5I1LA 2XT1B 2RJMA 4NRYB 1CLZH 4OF8A 1D5ZA 2D7TH 1FFNA 5HHPA 5BV7C 1VEMA 3FO2A 2R69H 3I50L 4I0PB 3UTPD 2VL5A 2P8MB 2VDNH 2DDQH 1IGTA 2BHYA 1ACYH 3W0WA 5ICXA 3OKOA 1Q38A 1NKOA 2YA0A 5JIPA 2YXMA 4U3XA 3VDBA 4JRXE 4ZOBA 4NO2B 4OKDA 2VLKA 2NY1D 3QDJD 4HS6A 4OF7A 5CILL 3JWDC 1YEEL 5A43C 5IOPB 5IHUL 1S7XB 5I9QB 5J56B 2AW2A 3OKLB 1U3YA 5I1AA 2XG4A 4GFTB 4JFEE 4Y5VA 2IMNA 1SQ2N 4PJFE 2AERT 1NEZB 1A1NB 3V8CA 3VWKB 2EE3A 4MCZB 1Q72H 4JHBA 1S9KC 4P23A 4M48L 5IBUB 5FYLH 3REVB 1KLUA 1QA9A 4Y16A 3KDMA 5FO8B 3MBXL 5DJCB 4BFIB 4WUUD 3UO1L 3RUGA 3U7YL 4WW2F 1MCCA 2VXQH 3H42L 3SDAD 2VL4A 2VR5A 2WSKA 4UTAH 4G8GE 2B20A 4YGAB 4OF6A 4DGIH 4QGYA 5I1IH 3QNYB 4U2ZA 4JFEB 4LHUD 5B22A 1F4YH 3NGBB 5C0AE 1CFTB 4HT1L 3DI3B 4OGZA 1FAIL 2GAZB 5DMKA 5TE6H 3DX8A 4UV4H 1XGQA 4U1JA 1JGDB 1BAFH 3QEQD 1SM3L 3C5JA 4YK4C 1A1OB 4NFBA 3PGFH 2YUVA 1GIGH 3SKUD 3GMQA 3ALWA 1J5OH 2L7UA 3OPZH 5DA4A 3ES6A 1FNGB 2NLJA 5E6YA 3JWDH 1L7TL 5C9JB 2EDYA 1GCFA 1BEYH 5DFWH 4K71C 3B9EA 5IJVB 1AC6A 2GJ6D 1H3VA 5DZLA 4ELME 4JKWA 3TZVB 3MNVB 1QD0A 2EYTA 1KV3A 3MJ8A 4PJDE 3GSWA 4MNGA 3TBVB 4IDJH 3RP1A 2VLRE 3RVXC 1BJMA 3NFSH 2I60L 3K8LA 3NCYP 2J6EH 4KVCH 1EGJL 2XY1A 4Y5XA 4L3EA 2CRYA 1LP9F 5EU5A 5CZVL 3ISWA 1SY6L 3S36X 1G1CA 2PO6C 3IDIA 1I8IA 4EDXB 2ED8A 3IDNB 3P4OA 4N0UA 4OCNC 3CCHB 1NCAH 1M7IB 4DVBA 3NFNA 2H1PH 4HFWB 3HC0B 2OR9L 4HCRA 4JJHA 3T65A 4OKVB 2CDEA 4PJEB 2DYPD 1CU4L 1GGIL 1CGUA 4OQTA 3MRKB 4YDKH 5GZOC 2KBGA 3MACH 1B0GA 2XQBL 4PRAA 2B1HL 5C0EA 1AKJA 3VU2A 5IWLC 3CFIC 5DZNA 4XNYH 4YDIH 3ZO0A 4L9LC 4XC1L 4JR9H 1YPZB 3K2UH 2IPUK 3CMOH 4I13B 4MAYB 2FATL 4YDJA 2IWGA 5GSRA 3WS3B 5IJKC 4JJ5B 2YZ1A 3PWPD 4XXDA 3OKYA 2IANB 4F7MA 4S1RH 4G6JL 4P5TC 1PLGH 4ODHH 3GBML 1AO7B 4OLXL 1AHWA 1K85A 1I7RB 4RRPA 1ZT1B 3MLUL 5BXFB 1QSFE 3HC4H 1C5DA 2EDXA 4U1GB 2HJFA 4J6RH 1W0WB 4CVZB 1QG3A 1F6AA 4FQHA 2X4QA 2QADB 2HTKC 4JHZA 4QRQB 3O11A 4KK6C 4TNVK 4RAVA 2Y5TA 5K9KA 2CKBL 5TE4L 4FZEL 4YHYC 4JO1L 5TPWH 1CXEA 1WZ1H 2NPLX 3SDDB 4HBQA 2XNAB 2PXYA 4MS8C 5I8EA 4GKSA 1JPST 4PRHD 3ZL4L 4PBXA 3HR5A 2WBJD 3PWPE 1IAOA 2QHLA 4U6XB 2GJZA 4U1NA 4YHPB 5K33A 2V2XB 3TO2A 1NBYA 2E6JA 2Z4QA 3A6OA 1GAFL 4M6NL 5F89A 2OZ4L 3HI6H 3KG5A 3DROB 5AWNH 5DUBA 3OKDB 4HXAL 4JPIA 4FP8H 4UQ3A 2YD2A 1JNLL 1KLFA 2UZIL 1BFVH 3O8XC 5A16B 4O9HH 3UJJH 2Z35A 2I25N 4MA3B 5HDLA 4QOKE 3MBEB 2VAJA 4K3DH 1UKQA 1JUFA 3BGFC 2R69L 3I50H 3I75B 3P4LA 3VJ6B 1MWAL 2PYED 3O8XA 3RI5F 1ZVYA 4YZFF 3MRHA 5F3HB 4IEFB 3BGMA 3PGDB 5INCA 1OP5K 4DAGL 5DDHA 1LQSR 3VGFA 5A3ID 1LK3L 2UWEA 2P49B 3ESVF 1OQOA 1JYNA 5ICYA 4NQDD 2DLIA 5CZXC 1WK0A 1T2QL 2JK5B 2VH5H 4XCYA 5I8CB 3LKSB 5IMLA 3CSPA 3SDAC 5GS2H 4XPAH 2X4QB 5DXWA 3CK0L 5IK3A 1DTUA 4KK8D 3ZKXB 2AXHA 2ZP0T 4U6HA 2DKSA 3O3EA 1KPUB 1IRAY 4JR9L 2N7AA 4QXTA 1JHKL 3QCUL 3RZCD 5GJTH 3K4ZA 5FF6B 4L4VA 2C7UA 4OSUL 4XB7A 3W0WB 3MLWH 1CU4H 1GGIH 3OAZH 5EFIB 2ZUQB 1KJ2L 4J3SA 3CLFH 1FL6B 5CBAB 4CJ1A 4PTTB 2OCFD 5DK2B 3MYJB 3BHBB 4KUCD 1F3JB 4F37K 4R9HA 2NXZB 4KI1A 3DYMA 1LVEA 5FDWA 2HKHL 5A2LH 2OX5A 4MD4A 3HE6B 5DTFA 1FN4B 5T5FH 4G8GA 3QJFA 3FFDB 5C2BL 3CH1B 2OSLB 4WTZA 3C8KB 3N9GH 4MQXD 4GG6E 3VFUB 4R2GD 5ACZB 5TF0A 3RWIB 1A1MA 4IRSB 5DHYA 3HZYB 4BELD 3U79A 3TCXA 5CP7A 4KGLA 5DJ0B 3FQXA 4U1LB 3ZTNL 5LWYL 4L4VE 4UT6L 1YEDB 4IRZH 3SDDC 4HBCH 2BXZA 4YPJA 2WM0A 4Q0XL 5K9QG 4MA8H 1NGZB 3CLEH 1RK1B 1A7OH 1Q0YL 4LCYB 3QP3A 3N06B 3ZDYE 1EHNA 2ITCA 3UAJD 4D9RD 4PGEB 3RU8L 4DFIA 3OZ9H 5CZXD 4JM2B 3HNSH 1KT2B 4N8CL 3H9SA 3BP4B 1MLCB 4R96B 1I9EA 1MCOH 1MEXH 4KJQD 4XCEB 5HDQL 3H7BA 3W82A 2EDDA 2FR4A 1X5HA 4XP1L 3UBXI 4X6BA 3K4AA 1A64A 2YPVH 1JGUL 1LEIA 2NXYC 3BVNA 1G6RA 1D9KB 3WJLC 4IHOB 1EJ6A 4XPGH 3IRZA 4NQEE 1S8DB 4C56E 4M3KB 3QWQB 2XXCB 1XH3B 5HVFB 2MPAH 3T1WA 5I17A 2J8OA 3VH8B 3ULUD 1MCBA 1UCTA 2Y07L 2HLAB 2YBRA 2BNRA 2HFEA 3HNVH 1I75A 4PY7B 2RCSL 4DUXA 5JXED 3FO2B 3BWAB 1B88A 5DYOB 3OKKB 2HN7B 1A5FH 4FQQA 4K3EL 5IVNA 3O6FA 1R24A 3UXFA 3F58L 3RKDD 5ITBL 2H2SD 3S88H 5AG8A 1LD9A 4GRWH 1IBGH 4JM2F 2XKNA 4D2NA 1JZ6A 1TQBB 1HXYA 2ZG1A 5JW4M 1KJ2A 1KGCE 4HG4J 5I1GL 4DK3A 1A21A 5CJXC 1A3LH 5CWSB 1OAYL 5IB4A 2P5WD 5BOZG 1ZTXH 4MHHI 3ARGC 4WGWB 4L1DA 4F8TA 5JO5A 5IMLB 4LPUA 2BNQA 3QIWC 1J0IA 3MGTA 4ZUSB 4PS4H 3MLPA 1ZHLB 3ZDXF 3MRKA 1M7DB 1UH2A 1YYLL 1RJLA 4U49A 1J87A 2ZNWA 4R2GB 3OXRA 1DBKL 3DRQA 4RZCA 3CXHK 4WEBH 2X7LB 4HDIA 5L7XH 5F8QC 1BQLH 4XCEA 2PF6A 1U8IB 4OFIA 2VUOA 4HJ0D 4OLZH 1NCDH 1TPXC 2NYYC 2R1YB 4J3TA 4MB5A 1MCKA 4PJAB 4TVPL 3D9AH 1HZHH 5LGHH 3QEQE 1KIUA 1I3UA 1G7LA 1YDPA 3GNML 4A2MA 3MRDA 1QUNA 5J1SC 2BOCA 1Z5LB 1FYTD 2HLAA 2YBRB 1I9RH 2EEAA 2LV4A 3P11L 4BQBA 3K8MA 3WJJA 4M7KH 2PXYD 3STZB 3OKOB 5DR5L 5DR5H 1YNKH 4KJYA 1T5WB 1QEWB 5BS0D 1ED3A 2X44D 4IRSA 1MFAL 1GGTA 5JDJA 5LGKA 3O2WH 2VN7A 4OQTH 2VLKB 1KTLB 4PJXA 4C58B 3P4NA 4ISVA 5DURB 3QUZC 1DQMH 4HIJA 2J5LB 1Q0XL 1LP9A 1T22B 2APBA 3P0YL 4TUOA 2A0LC 2HTLD 4XB8A 4KTEH 4JFED 1XGYL 4LHUB 1QLEL 1OTUD 3C60A 3LRSA 3PQYB 5C0GA 3VWKD 3T3ME 2ID5A 3RVUD 4ZS6C 3MV9E 3EDKA 2APXA 2P43B 3C5SA 1BJ8A 5JW5A 3ARWA 3TT3H 3SGEH 5MEQB 1AGFA 4CBPA 3G04B 1FV1B 4OLYH 1IEBA 2DI8A 2WIIB 4MD5A 4PJBB 2AQ1A 1CBVH 1FE8H 3D69A 5C0JA 2YN3A 2RB8A 4JAMA 1BQSA 1HEZA 3T0EA 5E8DL 3VXUA 4KVNH 3BZFB 4L8SC 1BJ1H 4BK5A 5CINL 3RKPA 3UJTL 5GZNC 2YZ8A 1A3LL 2MFNA 3GMOB 1FG2B 4MMXC 4L8BA 4L8CB 3KVQA 4GMTH 3S96A 5GGQH 4LVNB 5L8LB 1R3IL 4YPGB 3C2AH 3TJEL 3QEGH 5DUPL 3ZHDA 1TMCB 4FFWC 1F45A 1RZJH 4LLVA 1FE8L 4ODBD 2MTPA 4JJ5A 4WDIB 1CXFA 1WIPA 1P4LA 5ITFB 5EZOL 1U8MA 3RUGF 3C60D 5TDPB 2VXUL 3SJVA 4NUJA 1ADQA 4HCRH 2E7LC 1G7MB 4WW1B 5B39G 4WW2B 3PJSB 2AK1H 3QULB 4QWWC 1KIPA 4AIZA 3T8XA 2OR9H 3X13A 1BIIA 2HRPL 1S5HB 5IQ7H 5DLML 5T3XE 2VE6A 1W72B 3DURB 5DD3L 3MLUH 1CDCA 1FO0H 1MSPA 2CLVA 3W11D 5A2JH 5LBSL 3MRIB 4MZ3A 3U9PH 3N85L 2VDML 3VDCA 4HMCA 3GSXA 4GRLA 1DVFA 5D1ZB 3BIKA 1OTUC 1CFSB 5L7XL 3NMEA 3TPKA 1TETH 1J9CT 3DV6B 3D0LA 4GRWF 5D71L 4NCC1 2J8UA 3WCYA 4PJ7B 5HHXL 4H25B 4HWBL 1ZMYA 5IEHB 5J7CC 3RI5K 3SJVE 4FP8L 1DSFH 4H88H 4O2EA 5GISH 4X4XB 4Z95H 5LWYH 3QIBA 4OI8A 3MA7B 1L7TH 3LEVH 2RFXA 1TXKA 3F62A 3LV3B 4YUEL 4RAUA 5CP3A 1MWAB 3BE1L 3DROA 1KCSL 5C09B 1AR1C 5E7BA 1S5IH 3FT3A 4YFDB 1HI6B 5EO1A 1MI5A 2OK0L 3PL6B 3UYPA 4LKCB 1R3HA 2X1XR 5IFAH 5TGBA 3S35L 4PJ7E 1BX2B 3PF2A 5FA3A 2X4OB 4ZSOB 1RZ7H 1BF8A 5ALCL 4F7PB 5I2IA 4FTVA 3C5ZB 3H7BB 5ANME 3U9UB 4GRLD 2VWEC 3ARFD 1S5HA 1KBGL 4POZD 2V2TA 1FZMB 3U2SA 3LKSA 4ZFZA 3GJFH 2JJUA 4J3OC 4PP2B 4JFOA 2UZXB 5ADOL 5EC2A 5T1DH 3CFCH 2VYRE 5EDXA 4ACPA 4HIEB 3S5LA 3VFRB 1K9TA 2B0SH 4DGYL 1ITCA 1WAAF 5D8JL 1A8JH 1NFIA 1S9VA 1VGKB 3W11C 4V2CB 3WNMA 4RGMB 4DCQA 3T77B 1MPAH 2NTFB 3U36B 2C7UB 3LDBC 4N90E 3NIDF 4OCWH 1BLNA 3B9AA 4YR6A 4N0FB 4XXDB 2GTZB 4LKXB 3VW3L 1T1ZA 2ARWA 2I5YL 2Y07H 2QHRL 4APQD 1HWHB 5F1NA 1FFRA 4H5SA 4WI6A 4X5WB 3JTSA 4G3YH 4NRYA 1P4IH 3EZJB 4NKDA 1RMFL 3F12B 4NZJA 1WIOA 2Q86B 1A4KA 4I8DA 4JZJA 3GMMB 4F58H 2NXZC 4LDOB 3L3HB 5F7LB 3KWWA 5KSAD 1QSVA 1H8NA 3NAAL 2HLFD 4JQXC 3MR9A 3GSVA 3EYVB 5C0FB 5CIPB 2XWBA 3SGEI 4NQXB 3GUTA 3MCKB 3JV0A 1HSBB 2D4FA 2H9GB 3BO8A 4Y5YC 1G9MH 4WHTB 1A9EB 2F74A 1KB5B 3A0OA 3QWOA 3O3DB 3DRQB 1AR1D 4RNRA 3JUZA 5D2NB 3N9GL 3U0WL 4N0YL 2FX7H 2NY6C 3IDNA 3P4OB 3P30L 2E27H 4HPYH 1KPRB 4Z78A 1SEQH 5JPNB 3IFLL 1IM9D 1VFAB 1W8NA 4GXUN 5JW4Q 1AD0A 1MJJB 2HVKB 1OLLA 1NAML 2VISA 5JW4R 2V2TB 3T65B 5D1QC 3V5HA 1NDMB 1VADB 4BZ1L 3PWUA 4RX4A 2A9NH 2VB5A 3OJ2C 2DWEB 3CVHL 5ALBL 5FYKE 3T4YA 1JMXA 1LP9E 2AXJA 1Q9WA 4JQVC 4LPTA 5EOQH 5ERWB 3CFKB 1OB1B 3D3VB 4R7NB 5F1OB 5C3LD 5TE4H 1P69B 1R3JA 3KPRD 5CEZH 1VFUA 1X44A 1R5WB 3LN5B 1X5XA 1N2RA 5T3XD 1WT5C 4X6EA 4P46A 1AGBA 3B6SA 4DFHA 1J05A 3IFNH 2GTZA 4LKXA 4PRPE 2ICWA 2Y4SA 3GMLA 2XI9A 3O8XB 4DKFL 2NY0B 2YMXH 4XCFL 1HH6B 4X6CE 3CUPB 1A2YB 5H94B 2D9QB 3TVMD 3HCVA 1LP9B 4L4TE 1CDHA 2BNUB 3F12A 3FONB 4QWWD 2AQ3A 4S0SD 3C5JB 3T0EE 3B3IB 1FPTH 3WJJC 1W0WA 4CVZA 1HIML 1HHKB 4ZUTB 3O4LA 3MRGA 1S5IL 5TDOA 2VIRB 2GSIB 3IJSB 3DECA 4GKNA 5FCUH 2B8OT 5CCKL 3MR9B 1DN0A 3S98A 4KDTC 4MDJB 3H3BC 4XCNA 2NZIA 4TNWF 5IBLC 4F37F 4XAKD 2H26B 2P5WA 4OUUB 5C0ND 5KTEH 4XTRD 4AMKL 2XQBH 1WVZA 1EA9C 1U8OA 4HD9A 3NACL 5C0AD 4E9LA 5GGRA 4NZTH 4E42A 4YHYB 3T0EB 1AE6L 4KZEH 3QH3B 3G08A 4O2CA 4F9LC 3UYRL 3OJVC 1LK3H 1N7ML 4MWFB 5IR1B 5IFJB 4XWOC 3INUH 5DHXB 4PRNB 1FIGL 3EYSL 5F9JA 3VFOA 5M95B 3D85B 1AGCB 4F3FB 2K7PA 1G7HA 4WFFD 4QRTB 5D1QD 3MV9D 1SY6H 1U8PA 3QIUA 1FO0L 3PDDA 1YQ2A 3CH1A 1G9ML 1AXSB 3U0PB 1ACYL 3EO0A 3C9NB 1S7TB 4X7DC 1U8MB 1TQBC 2WUCL 1SEBB 3QXWA 1YMHB 3WO3B 3BZDA 4RGNB 4M93B 2EYSB 5F1IA 2Y36L 3A6CH 4HJJL 5EZJB 4PJBE 3BN9D 3ZYZA 2F53E 3AS3A 4L3CA 4PY7A 1YNTA 4Y8AA 2F8XC 4IRJB 5HHME 2A73B 2E3VA 4GLRH 3K2MC 3FO0L 4HIHB 2O5YH 3ZL4H 5E2TL 1WZLA 1D5IH 4UNVA 1TJIL 3C6LB 6FABL 4KROB 1FYTE 3VI3F 2PW2A 4JPWH 43CAA 3EOAB 1KCSH 2FL5A 5TE6L 3U30C 3WKNA 2WINA 3FAWA 4QOKA 4YXHL 3VXRD 2FO1A 1BQUA 1RUAL 2AEQH 2FJGB 2Q1EA 3O3BA 1U8OB 4PJ5D 4TYUA 5EBWA 1V05A 4OD3H 3WFDH 4E0RB 1DSFL 5KS9B 3QDJA 3QG6A 4L8DB 2WUBH 4UTAL 5EPMB 4JFFD 1FGVL 1UCBL 4NJ9L 5C09E 1BWWA 4GRWB 2HAZA 3C5SB 3QEQA 1YZZA 4APQC 2MOVA 4RZCB 4KXZI 4LOUC 2ATKA 1O0VA 2GSGA 4M43H 4BSVA 4WU7A 2BNRB 2HFEB 2I07B 2ICCA 4QXGL 4XHJC 1INQA 2YS4A 1QFOA 3OKEB 1Y0LB 1DJSA 4Z77A 4NRZB 5EU6E 3S35H 2CLZA 5KSAC 2AJXH 4AJ0A 5HHNA 1F3DJ 4JKPL 3KPOA 4UOW0 5DHVA 1TCRA 4NZDA 3S5LG 3FB5B 1DQML 3LQAH 4NWTL 5F1IB 1DQJB 5J9PA 1FIEA 5DJDB 2EYTB 4BH7B 4JFXB 5KS9F 3CZFB 1JHKH 1IGYB 5BVJA 4NQCE 2R0WH 4W6YB 4JRWA 5AYUL 2EC8A 5AZ2H 2GKIA 4EI5B 3TIDB 1D6VL 3V4UL 1LDPL 2P8LA 5MEPB 1OGTA 5TDNB 2M2DA 1K8IA 4OI9A 1PJ9A 2D7TL 3T0BA 1HHJB 2E9BA 2DWDB 2ZG2A 1T22A 5HGDA 3T04D 4EN3A 3MLSL 4ODSH 5EU6D 3U9PL 4NN7C 1LO5B 3GMRB 3FB6B 5JHDE 2VE6B 1T66D 2IFFH 4GAJL 4Z7OE 1FAIH 4PLOB 3LY6A 3HMWH 4YHKL 2GT9A 5I75C 2WLYA 4IOIB 5IK3B 4DUVA 3PGCB 4X7SH 2X1PA 3EYFA 5F6IB 5CBEB 2VLJE 3S3PA 5I1KH 3MLYL 3VGBA 5TQ2L 1I3VA 1S7VB 2V7NB 4ZD3L 3IF1A 4JG1L 5CJ5A 3SY0B 4HX1A 5CGYD 1NAKL 3UP1A 2VLME 3N50A 3BPLC 4MGXA 4RMVA 1K2DB 5CBAA 3HTLX 1GAFH 4M6NH 4RA3A 1HSBA 1KB9K 1TCRB 2FHCA 3L3JA 1W8OA 3E6HB 4Y5YB 2VJXA 3CMGA 3R4DA 1A7RL 1CFNA 4JB9L 1MJUL 3B9KC 2IAMA 2R23A 1JJUA 3B83A 1LEKA 2CRMA 2E6PA 2FD6L 2HG5A 4G42A 4M9PA 4AEIL 3LKQA 3FQTA 4JCMA 3BKML 4X6DB 1DBBL 4GW4B 2HT4D 2DQFB 1L7IL 1MRDH 3QHFH 3V4PH 3UBXG 1Z9OA 2CQVA 5DQ9A 1IM3B 4XVTH 5GS0H 2YMXL 1V7NH 2B2XH 4X9FA 3N1PC 3W5NA 2Y9RT 3ULSB 5F7WC 4YX2L 2B4CH 2P47B 4W70A 2F53D 3SCMA 4KVNL 3BE1H 3MV8D 5J6HA 5EH1A 1YC7A 3FMGH 4FXKA 3MJ7B 4NKQB 3C09C 5E8OB 3RUGE 5TE7H 1P7QB 3EYUL 3GBNL 4Y4FC 2BCKA 2NZ9C 1X4ZA 4CN1A 3PHSA 3TVMA 5DRWB 1IE5A 3WIIH 3S4SG 2H32H 4W4OA 4YHML 4AM0B 4OCSL 2R1YA 2C3HA 4O5LH 5EPMA 3QUYB 2AGJL 3SDXE 4N5ED 3ZHLA 1IAOB 1QYGL 3RPKA 4TTDD 4UNUA 2W0FB 4JY6A 5KVGH 1Y18A 1S78C 2PTVA 3EHBD 4Q9RH 4KKNA 3IJHA 3Q2CA 4GG8A 3IFPB 2EKJA 5IP4A 5GRWA 2CK2A 1TTUA 5FYKH 2ATPB 3BDXA 1YPZF 3CLFL 4ZUTA 4WNQA 3RDTB 3JXAA 3C5ZC 4XAWH 4N8VB 4Q9CA 2J6EL 4KKBC 4KVCL 3V6ZB 1ZXQA 1JPSH 1RUPL 3MACL 5F1SA 1XH3A 5I73B 2OBGA 3RGVC 3ARTA 3HG1E 3WLWC 1NUGA 4LCWA 2QEJA 4U1IA 4JY4B 1YN6A 3B5HA 3CFJB 1QACA 4PPTA 3HAEG 3IDYB 4KMTH 1FGNL 1A6TA 3RPIB 3BRDA 1M4KA 3FQTB 5IF0B 1BBJB 2BNRD 1INEL 4H20H 4KGJA 2M1KA 2P7TB 5EBMA 3BD3A 3OG4B 5E9DA 3T1FB 4OQ1A 1XF5B 3WN5C 5HGBB 2Z92B 1R3IH 3RL1A 2IMMA 3O81A 4V1DD 1KPUA 4OCLC 3B2VH 4F7PA 5I2IB 8CGTA 3FTGA 5I8EB 2FEDD 2YD1A 1DBJH 5TF1L 5HGGS 1CFQB 3G6DH 1A7PH 4HT1H 3OB0K 5C08B 4M7LL 4FFYH 1F2QA 1F4YL 1AD0B 2HT2D 3VMNA 5DRWA 2VXSH 3HRPA 2AI0L 4MA1C 3P9WB 2GCYA 2F5AH 4IOIA 4L9DA 2QL1A 5GRZA 4KI5C 4XNMA 1R5VB 1RZGB 3QAZB 4KK5D 4OLXH 2ED7A 4H8WC 1OAUL 1J5OL 1LO3L 1BZ7B 4R4FH 2VZVA 2VDOH 3TO4B 2A9MH 1UJTA 2AVGA 4AENA 3GMPA 1PG7X 4QHNA 2RAMA 2L7JA 2BSSB 1PY9A 3RWDA 3CNKA 4N8VA 3PHQA 5DK0A 5ID0A 2BX5A 5AUMB 4XVUD 3SE4A 1GPOL 1J1PH 2WK2A 3O41A 3MC0A 5JPMB 3TA3A 4HZLB 4WWID 1S7UB 1K6QH 3SE9H 1I1YA 3CUPA 2VXQL 4YXLL 4JFYB 3QI9B 4PGDA 3KPQB 1I8MB 3ZLQC 4I2XB 4DOHE 3V6OC 1BIHA 2YD5A 1AGDA 3MRBB 1PZUB 4XMKH 2A74B 1B4JH 2OTPA 2DDQL 4QO1A 2PR4L 1T21B 3BUYB 3MV8B 1N0XL 3RY4A 5DMIL 3D87B 4X4ME 6CGTA 1MI5E 1J0JA 3WNKA 1CFBA 1S9VB 3NZHH 4OZHF 1UB5A 1VGEL 2LU4A 3O6KL 3X3GL 4LEOB 2H32B 4GKOA 2VABB 4Z5RA 3LKPB 5D7KD 3RWGB 4IHOA 3AMLA 3V5HB 4JFEA 2RHEA 5DFVD 3MLVH 5DJXB 3ULVE 3VDAA 1AP2A 2YC1B 2C1OA 1DUYA 1HINL 3M8OH 4HUUA 2HT2C 4AQOA 1ZA6A 1ZWIA 5FOBB 4I77L 4U6VL 2NY2D 2WMPA 2AJZB 3SEPA 3ZTJG 1IGTB 3C6SB 4ZXBB 2MSPA 1S7SA 4EUPA 4Z7NE 2FX9L 5JA8B 1AR2A 2DOCA 1EO8L 3W81A 3BP7B 1GZPA 1R3HB 1V3KA 3ZYIA 3F7YA 4V1DE 1FG2A 2IBBA 2EXYC 1VFOA 4IRJA 1WFTA 3G5YB 1JK8A 3O3AA 4G43A 4YGVB 3VXQA 5EC1B 1K4CA 4I2XA 4WFHE 4NM4L 3RGHA 1F4XH 1AY1H 4JZOA 3UO1H 3MV7B 1CD1A 5C86A 3VXSD 4XNYL 4YDIL 4QHMB 2DWEA 3HE7D 3BUYA 5DEFB 3O45A 2X4TA 4AH2B 5DEGA 3VGDA 1HE7A 1PKOA 1HNFA 4FQ1L 4ALAH 1Q72L 1MNUL 1QSED 1UB5B 2A6KB 3DTXA 4N1HB 5DGRA 1DEEB 4M5ZH 4OFPA 2X4NA 4NT6B 3QUZA 4J2XA 5IR1A 3P0VH 1JGLH 1CI5A 3LB6D 1P6AB 1T2QH 2GJ6E 4KQ3L 4PJDF 4G80A 3D18A 4K7FA 4R3SB 3TN0B 3QIWB 1TZGL 2ZPKL 1MI5D 4OZGF 3TJHC 1NBZA 4JKMA 2HRLA 4I5BA 1I3RA 1Q0XH 3MRFA 2E7MA 4NRXA 5DFVC 4HGWA 3IDXH 4O4YH 5E8DH 4HKJB 1VB9A 1CE6B 1OF2B 1OTSD 5D93B 1Y0LA 4MJ5B 4LCWD 2FSEA 3G9AB 5HVWA 1YNKL 2W65B 4HUNB 5SX4I 4PUBH 1D3CA 3BXNB 5M94B 1RJZA 3UTZB 3CFCL 2DI9A 4EQ3A 5BXFA 2XWTB 4KTDH 4NN6B 3RWFB 4XPBH 3LQAL 2CUIA 4HWZA 3Q3GA 3VD9A 2AJ3A 3MOQA 3MGTB 4ZUSA 5IW6B 4E41D 4O2CB 2FIKA 4D94A 3CVHB 3G5VA 1WC7A 5FEBA 4JLRA 3QNZB 3RIFF 1GXEA 3QXDB 1DBML 4WTXA 4WI9A 3EOAA 1KC5H 4KK6D 1WFNA 1UZ8B 2X4TB 1D9KC 1MFEH 5KBNC 5D5MA 5EU3A 4ODVL 3MXWH 1MH5B 1H5BB 3OAUL 1V3JA 1WT5A 2AK4A 3QCVL 4HMEA 5BV7H 1DEEA 3PIQA 4HHAB 4PJEF 1RJCA 4OM1L 3PHOB 4ODXB 3G6JA 5IMKB 2GITB 1VPOH 1VPOL 4I77H 4K7PY 1D7FA 3ARDC 3KJ6L 2FO4B 4F2MA 1MHCA 1KCVH 1G9NH 1S7WA 3IU4H 3VG9C 3V6FA 1U6AH 4K94L 5D7IA 3L1OL 4UQ3B 5D71H 4R0LA 4JG0L 5MP6H 1WWCA 4UBDC 4HKJA 3IJSA 1KENH 5D9SB 1T0MB 2QSVA 2PN5A 3MRPA 4PV9A 2FB4L 4AL8H 1U3JA 1QEWA 3TIEB 3L95B 4GT7A 3S88L 1MELA 2VMFA 3N1GC 1IZKA 2D7NA 2FATH 1TFHA 1EAJA 5F88A 1MIEH 5T1LD 5DT1H 5D5ME 5DFTA 2ED9A 2IPTL 3UTSB 1N6UA 1MAKA 5HBBA 5KJRH 3NH7L 1U3HD 3HC0A 3QH3A 3MV11 3NA4A 2NMSA 3WIHL 5GS0C 1RULL 3TGXA 3VXOB 5HHXH 5JW4N 3CVHA 1U41A 4M02A 2ZCKH 5JW3H 1C7SA 2LU3A 2A1WL 3GSXB 3DUUB 4KKAD 3MJ9A 1QTYT 4L29A 5IGXH 2VDMH 1FJ1A 2FX8H 3MCLH 3SQOH 3JV4B 2ZJSH 1KB9J 3DTXB 1IAII 5F6HI 1KFAH 3GMRA 2MQ0A 3H7LA 3X12B 5I76A 4QYOA 3MRJB 2VLLB 5CSZA 3SGKA 1D9KD 1CIUA 1RHHB 4P3DA 2GY5A 1PX4A 2NTSP 1IQDA 3ZE1E 4DOHB 1WCBB 4AT6B 4PRIE 1I1FA 5C07A 1IAMA 1EK3A 1GZQB 3QUYD 4IIQB 4XPGL 3DVGA 4Z7QF 5IHZA 3EOYG 1IGYA 5EZOH 3C8KA 3IDGA 1R5WA 4IS6A 4P2OB 1U95A 2W9EL 3L5XH 5BRZB 2XN9A 1FL5B 4LKCA 3L3JB 5EG6C 4WV1A 1DP0A 3MRCB 1JPGA 5GGQL 4HWEL 3O6LH 5DD0L 2ZUTA 4DTGH 4NPYB 1X4YA 4OZIA 1ORSB 4FQCH 2BRRH 4EUPG 3CFJA 1IAKB 1CGYA 2XY2A 1FZKB 5FM4A 3ZYJA 3ZDXE 1P2CA 1URLA 5GXBB 1UJ3C 4XH2B 1J11A 5GHWL 3RQ3A 3IU3A 2F53B 5DK3A 5LXGL 3FQUA 2GFBA 3I9GL 4PP2A 3EFDL 1YEKL 2A83A 4GQ9L 4HMDA 3KAAA 4BKLB 4PG2C 1U42A 3MLWL 1LDPH 4Z7WF 3V7AE 3S36H 3UAJC 3AB0B 5F3BA 4Y88A 5DJZA 2IQ9H 1N8ZB 3CFBA 3TV3L 5FUZH 1MH5A 4Q9QL 5HSFA 4TSAL 4JHWL 3ZE2E 2A6IA 4KKAC 4NZUH 5DVMA 1K3ZA 5FGBA 2JTDA 5BS0B 1MQKL 2XFXA 2PTTA 4GSDL 3VFSA 5FUCC 1ZT7A 5F3HA 1EMTH 3WMSA 3UTPE 1KG0B 4B7IA 3OJDA 4HPYL 4UU9A 3DYPA 3FFDA 4WFGE 3TO4D 4X6DA 4LLQA 2BSRB 1RUQL 1WLHA 2OSLA 4OGAD 2QKIB 4XAKE 3PP4L 2JK5A 1QRNA 1KYOJ 5FUZL 1I8LC 1U92B 4M62L 2Q7NA 5HJ3A 3WO4C 3ARRA 3NAAH 1OARH 3THML 4K3DL 5C9KA 3DX7A 2YD8A 1VSCA 2MCPH 3QWOB 4GRMA 4HZLA 3E1F1 1I9JH 1QBAA 2JJTC 4ORGB 5F96L 1NGXB 3L6FB 1BECA 2I9LB 3PWPB 4W6XB 3RHWK 3G6AA 4JFHD 4XMPL 4PJFF 1KCUH 3GSRA 3UTTE 4BYHA 2X4NB 4NT6A 3MJ9H 4XH2A 1U8QB 4XNXH 4V1DB 2VR9A 5LAXB 1MRDL 1L7IH 1CDUA 3LIZH 4JPVH 1HXMA 1DDHA 4P2QE 3KHOA 5DC0A 2DJ4A 3AUVA 3VXMB 2C4XA 3TBSA 3CCHA 1E4XH 3Q6GH 4D0BB 4XP6L 2MMXA 3Q0HA 1F3DH 3MO1A 5FYKD 3TM6A 3VG0H 3EGSB 4JFFE 5DD6B 4MSWA 5JLZB 2WBJB 1OAXH 2R15A 1N64L 3GSOA 1ZAGA 5CSZB 3QRFM 5C6WH 5HYSB 5J1AB 2WP3T 5C9JA 4HJ0C 4JO4H 2YHGA 2ZG3A 1XZ0B 4KTDL 3G5XB 2V5RA 4I3SL 4XP4H 4Z7UF 3VMPA 3VD4A 2BXYA 2YPLA 2ERJC 1TZHB 3GMMA 3EAKA 3PUCA 4F7EA 2HA1A 4Q2ZA 3TLRA 5E5UB 1HHKA 1A6WL 3RWHA 4KKLD 2IFFL 2VLRD 5BRZA 4NQXA 5HYJA 4XPTH 4JFFB 3CDGA 4G6JH 1U92A 4P5TD 2IAMC 3OKNA 3ZE0F 1UJ3B 1FIGH 3VGGA 4P4KA 4JO1H 5TPWL 5H8DA 3BGAA 2NW3A 4DGVL 1FL3B 4Y2OA 3FB7B 3ULVH 5I15H 3PWVA 43C9A 1YEHL 4HS3B 5DJDA 2H3NA 1J1XH 1NCWL 3U46B 4Y5XC 5C0BD 1GYAA 2D0HA 4OZ4A 4TUKH 3OR6B 4NDMA 1AD9A 2ADIB 4CRPA 1ZT4A 4Z7UB 4PY8J 32C2A 4NNPL 4KK9D 4P2OC 4D0CA 2OXHA 3GO1L 1SYSB 4F7CB 1CD1B 3EW3B 4LIQH 4F57H 4F33B 1RFDH 1IT9L 4XBGA 4ZFGL 2DKUA 1RK0A 4ZFOB 3VI4E 3QYCA 1FV1A 1CYGA 3HNSL 1ZGLP 4W4OC 3QUYC 1LO2H 3RY6C 2X09A 4ZS7H 4AYFA 4BSWA 4P9HC 2BY2A 4PD4K 1LO5A 1T0MA 5CUSL 5CUSH 1BD2D 5EUOA 4LSQL 4BQ8A 2FLRT 5B4MC 3V9FA 1U3HA 4J3UA 1F2XK 3VFWB 2P5EB 4Q0XH 4PR5B 4LEXL 3RY6A 5BJTB 5FA4B 1IGJA 3RZWA 4B0MM 4M43L 3NOIA 3LKOB 2JE8A 5JHLL 5HI3C 4Z7QE 2JIXA 2YOCA 4CL7A 1BQHG 1BBJA 4G7YL 4OFKA 4D3CH 4F15C 4S0TD 5I9QC 2BVOB 4H0IA 2W9DH 2SEBB 1QNZL 1QNZH 1RY7B 3WFDL 1OM3L 3U4EB 4ONOA 2HFTA 4S1QH 4M1GL 1INDH 3JWDL 4N8PA 3ZKSD 2Z9TA 3LVEA 3VD3A 2KL6A 3OKNB 5FO7B 2P5EE 1P4BH 4PY8I 3OBAA 3NFPB 3QDME 3KS0H 1HINH 1SM3H 2HMIC 3BPLB 2DQFA 4JPKH 4XPTL 4IDJL 3P4MA 4GAYB 2XA8L 2DL2A 3BKMH 5D7JD 4HC1H 1T89A 2NQCA 5E8NB 1E4KA 1HWGB 1UWGH 3ZKMD 4HEME 3GHEL 3OR7A 1HHIB 2GTWB 3TFKD 3QEQB 2FBJH 5IGXL 4Q74A 1U8KA 1UZ8A 4OD1L 4NKIL 3VXMD 1DQDL 3RZCC 3MJ6A 2XZZA 3KLSA 4HKBB 1MOEA 2PYEE 3L3KA 3DXAD 3MRLB 2JIXD 4OTXH 1CF8L 4X5LA 1RZFH 4AY0A 5GGSY 4QOKD 4HUKB 1NMBH 4C55A 5F6HJ 4YC2B 5SX5H 1XF2A 3QXUA 3VXSB 1JHTB 3IS1X 5E99H 4ZTOL 5HHOA 1ZK9A 5B38G 5ISZB 3V2AR 2UUDK 3QNXA 4UUJB 4U1HA 4M1CC 4JRYD 4F7EB 1U8LA 3QJFB 1A1OA 1PG7W 1MCLA 2A38A 3UYRH 1CE6A 3ZDZE 4MJIE 2NCMA 4WTWA 3BEWB 3U4EA 1T6WA 5HI3D 3GJFA 3ZSTA 4FQJH 3MRNB 2E7LA 1U6AL 4K94H 4WI5A 5MP6L 1FCGA 2JJWA 1LO0L 5GGUA 1ODAA 1D6EA 5E4EB 2CO7B 1KTKE 4MD5B 3GRWL 4BUHA 1T04A 5C6TL 3D69B 3RFZC 4J6RL 3LKNA 5T3ZH 1L0XA 2X1QA 4K8RD 1JN6A 1G84A 5DSCB 1C08A 1CD9B 5F7DA 4KI5F 2J7LA 3AY4C 2CKNA 2AJUL 1NCDL 1MLBB 1G0DA 4CNIA 2QSCH 1DE4B 3MPCA 4I2XE 4MMZC 3PDOA 4GAFB 3HR6A 3AY4A 4ZPVB 4NQED 3JZ7A 4QRRD 1ZLSL 4N9GB 4I9WE 5FM5M 4L3ED 1XIWB 3EO9H 4H8WL 1WV7T 3AU1B 2ZSVB 4Q6YA 3VXTA 4G8EA 1IGCL 3QJHB 5HHMB 2XYCA 3F7VB 2IJ0C 1XT5A 4OCYL 4M6MH 1MHPL 3LS4L 4LDLB 5BMFL 3AROA 3I6GB 4WW2A 4YNYB 3IDMA 4NQSA 1FLRH 1ZS8A 4FRWA 3WD5H 3QNXB 4UUJA 3C08L 4YGVA 4FQQB 4MAYA 1A6AB 4YHNA 5I66B 3O9WD 3GUTB 1S9YA 5AUMA 5KN5A 4KHTL 2HLFC 5EU7E 3WLBB 3ZSSA 4G6FB 3FT4A 1FFQA 1T83C 4Q6IB 5JDSB 4FHBD 5FYLE 4JFQB 5D93C 5KOMC 3SOBL 3OHXB 2NW2B 3U0TB 1NMBL 1TVHB 4MSWB 5T1MB 5F7MC 1X3DA 3PIQB 1WFUA 1E28A 4Q9QH 2N7BA 1ACZA 1KELL 2CGRL 2FJHB 3HMXH 4OB5H 2BMKB 2XTJC 3EYFB 4LAJH 3TNMB 3VXUE 2PO6D 3J7HA 1AXTH 5E2UL 4RGOH 3T4AA 2CJUL 3OF6A 3ULVF 3RNKA 2NY5C 5EA0H 1AFVH 1WITA 1A02N 1C12A 2J12B 3QRGL 5IQ9B 3QRGH 4HH9B 1CLYL 4GMTL 1F58H 1FZJA 4G5ZH 2I60H 3EOBA 1EDQA 5DQDH 3CXDH 2O5XH 5D1ZD 1LWRA 3E6HA 4TSCL 4Y5YA 4DZ8A 2XKNB 4BQ9A 5D2LB 3VD5A 4JO3H 5JW3L 3ZTNH 4ONHA 4DGIL 3G6JE 2X4SB 4JGUA 2BNUA 5GQBA 4NQEA 4XRCA 3WXVH 3STZA 3V6OE 5BW7A 3LRHA 3J8F7 4NQDE 2OL3B 2IADA 1BZQK 5E9DB 3DGGB 3T0AA 2JB6A 3IDUA 1S9YB 3F7YB 2I9TA 1G0YR 3JV6B 5BW7C 2BFVH 1AY1L 2J8HA 2NX5B 4WUUE 1LO4L 2NY0C 2XPGA 4PJXB 4WFEE 5T5NF 5GGSB 5TQ2H 3BRGC 1J0ZA 1LNUB 5D2LE 5MENB 3CU7A 3SE4C 4JCLA 1M7IA 3SKJH 5C2UB 4GW1B 4TUOB 2IPUG 3GSRB 4XCYB 4FQLH 5I8CA 1GOFA 2ZJSL 2OMBA 3RVUC 2AJUH 1MLBA 5C8JA 1GOGA 4XNMB 1DDHB 3EOTH 3O3EB 1YDPB 5IESH 1FFOA 5L2KB 1U36A 4U7MA 2DLHA 4PRBB 4XWOD 5GISL 5E6IA 1BFOB 4L4VB 5SV3A 3AXLB 2NY4C 4Z7UE 2WBJC 1AI1L 1OT2A 4QRUA 5EOQL 3NABL 2H9GA 1U0QA 3BO8B 3SKMB 2X05A 5ANMB 4ENED 3O3DA 1HSAA 1ZT7B 3FRPG 3HFMH 3NBNA 3NFPA 1JPGB 1KJ2B 1YN6B 4OZIB 3O2DH 4NUGL 3RVWC 4P57B 3QSKB 1VGEH 4YHMH 4G8GB 1CL7L 1KENL 5E99L 3BP6A 2Q8BH 4Y4KA 5K93A 4LVEA 4NC1E 2LVCA 4FXGA 4ZAKC 1WZKA 2EZ0D 4LLWA 2VDNL 3TWCL 3VFNB 5KANI 3DUSA 1FFNB 1P1ZB 3HI5L 3IDYC 1PVHA 1X9QA 5C0BA 1RV6X 4HCRL 2VQUA 4I0PD 4XGZB 1OAKH 5IW1B 1CG9A 3ROLA 2WIIA 4PJBA 5MEND 1OP3K 4OCXL 5DA0B 4FFVC 5E94A 2FWOA 1RU9L 4KMQA 1JTOA 3UPRA 4HK0B 2A77L 5L9DL 3LPFA 2DQIL 1XF2B 3BPOC 4JLRB 1OAQH 4W6WB 3VFSB 1WBYA 1M6OA 4IM8A 2JELH 2VZOA 3MLXL 2ZOKA 4KU1A 2CKBB 3TBYB 2R8SH 4P99A 1DBMH 4P2CG 1A14L 2Y06H 3OKLA 4PRPA 2AEPL 1OSZA 2VLRB 2AV1B 4Z6AT 4EEEA 1GVIA 4M5ZL 4DN3L 4BSWB 1YEIL 5D2NE 4GKNB 1FHGA 4JFPB 4PJ5E 4TOYH 1IKFH 2NNAA 4QRPE 3KPRA 3QUXB 2VC2H 5TFSL 1DQQA 3VH8A 4OUUA 5DI8A 3HC4L 3AS1A 5D72H 5T3ZE 3L7FA 2YRPA 3TA3C 3FAXA 1I9JL 1DR9A 2W07A 3KYMA 2I9LA 2YPKB 1NC2A 3PWPA 4JY5H 3BAEH 3F7PC 1KBGH 5C09A 1C7TA 4OLVH 4JQIL 3O2DA 4WUUA 4LSRH 1PLGL 4ODHL 1PX3A 2P1YA 3BP6B 1I1AB 5HGAA 3MRPB 4PV9B 3OZ9L 1Q94A 3EO1B 3RVWD 4DQOL 2UWEF 1IGFL 1WZMA 1ETZB 1VKXB 1IC4L 5A2IH 4YHOL 1W72L 3RGVB 3IXTA 3SDCC 2FGWH 5E03A 3ZDZF 5DJZB 5L6YL 1INDL 3KLAA 1CFSA 2BVYA 2H32A 1TJHL 5E5MB 3GK8L 5B3NA 1EERB 3BKCL 3WIFA 3DO7B 3X11A 4N90D 4OCRH 1QBLL 4V2BA 4JN1H 3SCMC 5DRZB 4PRHE 4FQPA 1U91B 1OP3H 4KJWD 2ICWI 2BOBB 4I3GA 4KJQC 3D6GA 4XBEH 1NH6A 4X99A 3UJIH 1FG9C 5L2JB 2GK0A 1Q1JL 3UC0H 1JUFB 3VMOA 5LG1A 4Q9RL 4G8IB 4H0HB 4CVXB 1FPTL 2VRAA 5KN5B 3ULUC 1Z0NA 1NGXA 2YA2A 1DQJA 4NKDB 2EDOA 2EE9A 4HWUA 2EIZA 2H3NB 4U0QB 1RURL 5A40E 1TZIB 1C5CL 1RZIA 4Z8FH 4DZBA 1WSST 1S7QB 3L3OB 2H2SC 1U95B 4XPFH 5BOPA 5KS9E 4P5KA 5HGAB 1NAKH 4PRDA 2AV7B 1BD2A 2VITA 4MHHG 3WFBL 5IMOA 3HUJA 2DD8H 1MFCL 5AZEL 4Y16B 5GS1C 2AEPH 4BH8A 1NUFA 1YC8A 2EH8L 2VH5L 1EUTA 4K23L 3H3PH 3FFCA 5DUPH 3EGSA 1H5BA 4AEIH 4WWKC 2H6PA 4U31A 3VFTB 2NY4D 2XKSA 4AM0A 5HYFA 3IU3B 2VUYA 3SQBA 4PD4J 4Y4FD 4NBYB 5IFHL 2Z93B 4ZODA 1NGWA 1WBYB 2YEZB 5GJSH 2X70A 1R3KB 3AS2A 4HWBA 4XNUH 4JO2H 3IJHB 1U91A 3MA9L 1RIUH 4ETYA 5C0RL 4Y0GA 4ZPVA 4LQ1A 3EHBC 1S78D 3CZFA 1EJOH 4IDLA 3ARBB 1FYTB 3BT2H 2SEBA 5MEOB 1VEOA 4PLJC 3L7EB 3SN6N 4GUPA 3L5IA 1T5XA 1RVFH 2VSCA 4UMGA 1VDGA 2EZ0C 2XPGB 2Z31D 1MFNA 4LL9A 4LQFL 4JFDB 3MGAA 3HCVB 4FG6D 4KTEL 4TRPH 5E08H 3GB7B 3SO3B 5IF0A 4LLQB 5IBUG 4X6DF 5HTSA 2QKIA 2QTEA 3MGOB 3FQWB 4M03A 3VE0B 2ITDB 2D31B 1JGLL 4YHNB 4CVUA 5I66A 2AS5M 1B90A 4NYLB 5FV1L 4BFBD 3C8HA 2BNRE 5KVEL 3QUMB 3OGCA 4S2SA 4NO5A 1JWUA 4ZPTA 3DMMB 2LQRA 4OIAA 4CW1A 2A1WH 3THMH 2WP3O 3DUUA 4EDXA 1KELH 3CFKA 4HDIB 1CFQA 3MLZH 5JXAL 4M7KL 2V5YA 4X7TB 1D9KA 3MFGB 3QISA 1RZKH 2G60L 5EOCH 3VGAB 1PAMA 5ICZA 4ODXA 1JZ8A 1M1SA 3OGOE 5EUOF 2EECA 3WNOA 5GRJL 2OJEB 5DS8A 3MRIA 1E4XI 5DD5L 2AJXL 3WHE1 5DO2C 4PB0H 3N1QC 5DJ8A 2NX5D 5F7HA 5D4QA 2J2ZA 4LLDA 1F90H 5GGVY 2C3WA 1T1WA 2F19L 4LSPH 5DEZA 4FXGB 3MCKA 1A0QL 4XP5L 1ADQH 2LAAA 4CN6A 2DD8L 1FGNH 4DEPC 3NA9L 3DHJA 1DVFD 2FZ3B 1QBLH 2V9TA 3FT2A 1EIBA 2V5SA 3G5XA 4TULH 4ERSL 1A6TB 1KEML 4K2UH 3A6CL 4HJJH 1YN7A 1MWAA 1RUPH 4UILH 3KYOB 4NQEB 4XRCB 1IM9A 5CGMA 1EHLL 4HPOL 3HZMB 3CD4A 2R2BB 3QDJE 4KRPB 4P5KB 3DRTB 3IDXL 3C60C 4O4YL 5F9OH 1YUHA 1CT8A 4PRNA 1HQRA 2P45B 4DN4H 2AJVL 4P2QA 2UUDH 3GIVA 5DMKB 5ERWA 1AGFB 1RIVH 2ZUVA 5EU7C 1DLFH 1JYVA 4FZ8H 3KPLB 4LSRL 4ZFGH 1F4AA 4GKSB 1DBAH 3P0VL 3H9SE 4G6ML 2BFVL 1BP3B 4LEOA 4JREB 4X7TA 2ZKHL 3KNBA 5DD3H 3U2SB 3EDEA 5DQJB 5C6TH 4TUKL 2A6JA 3GGWA 3VFVB 5EIVA 2G2RB 1CS6A 2MJWA 3LOWA 4UAOC 3O2VL 1UFUA 2DM3A 1LK2A 1DEDA 1MFDL 3BDYL 3DOSA 4BFGA 1HKFA 4L3CB 4G6KL 1TLKA 4FNLL 1NGPL 5D7SL 1WWWX 1YY9C 4NM4H 4MQTB 1NEZA 4YQXL 4YQXH 1ZEAH 4ELKB 3BP7A 4HKZA 2OYPA 3VXPB 4R7DA 4XPHH 4MD0A 1Q9OA 3WS6C 2UVFA 3P4NB 3MRHB 5IT2H 4CKVX 3WFZA 4X7FC 3BKYH 3O2VH 1XCQB 4MA8L 3VFGL 4Y4KD 1IILE 1DVFC 1JHLL 2OTWB 5CINH 2R0WL 3AFLA 4J12A 3R06A 1V3LA 3WL9A 5JORB 4ZUUA 4FABL 1CGSL 4CNIB 3K74B 1R5VA 4M4PA 3BP5B 1ZLSH 3SKOB 5BV7L 1NCBH 1KN4H 1FDLH 1UYWH 1CVRA 1T03L 4EN3B 3MLVL 3IXAA 3U48A 3UZQA 4AENB 1YY8B 3FN9A 5FCSH 5B8CC 1T66C 3GSNB 4Z7WE 3ZE0E 3MV01 4PJ7A 4CUCA 4PLJD 1NDMA 4YBHA 2X4RB 3LDBB 3QHZH 3MSPA 2WZPD 4AIOA 3CX2A 2LFGA 3V5KB 4RSVA 1NAMA 3OR7B 2NXYD 2Z31C 1LEGB 5DRXA 5B3JE 1FZOA 1ZVHA 1R0AL 4MD4B 5DTFB 4ZNCD 1CGWA 3LB6C 2X9WA 3QI9A 2WWKT 4PGDB 4BH7A 2X10A 2UV3A 3PQYE 5JIIA 3T2QA 1I7UB 3VJ6A 2AV7A 1NL0L 1OTSC 2I9TB 3VXPA 2PW2B 4YXKL 4NKMB 3FT4B 4Q6IA 3B9KD 1LEKB 4WJ5A 3MRQB 1IC4H 3RKDC 4QRSA 4ZYKA 1ZHKB 4ZTOH 4C54A 2C1PA 1TZGH 2ZPKH 4WY7L 2BVQB 2R1XB 2W60A 4JRYA 4BK4A 1IKNC 1MQKH 2E9WA 5C6PB 1XCTB 2VIRA 1RQ5A 1G7JB 2Z93A 4NNYB 5D7IF 2Z4QB 5C0EB 4QCIB 4Y19B 4C83B 1RFDL 2Y36H 4XBGB 1SVZA 3BIKB 4PUBL 3TBSB 2DLGA 1PD6A 2YUWA 5I8OL 1LO0H 4HS8L 1X5GA 4FQIL 1KLGA 2FGZA 3QWRD 2D0GA 1G6RB 3GSOB 3MJGX 4JFDE 4O58H 5ECJE 1JFQL 3WUWG 5F7DB 4PJ7F 2Q8AL 4BZ2H 1MFBH 1IVLA 4H1LA 4XNUL 3G6DL 1OSPL 4TTDC 5IFJA 4RFOL 4YHLL 4U33A 3BKYL 1F02I 4JPWL 3PWLA 3WE6B 3QQ9C 4PGZA 3DX6B 2R56H 4F9PC 3V7MA 1MJUH 3OKKA 4LNVA 3VXQB 3MGOA 1WEJL 4Y4KB 3DGGA 2B0SL 1JL8A 3ES6B 2X89D 4S1QL 1OM3H 2CXKA 3W5MA 4NCC2 4F9LA 5IJVA 2OLDA 4MA1B 4GRWE 5D7JB 4EKXA 4XPFL 1NCTA 2UYLB 5EUOE 1IMHC 5I1CL 4WCYH 3RPIA 1NC2B 4BZYA 1KEGH 4M6AA 1OAXL 3FB8A 2DLFH 5EUKB 5CCKH 3GJEA 3BX7C 5C07D 5L0QB 1HCVA 4XAWL 4DZBB 3QUYA 1NBYB 3ZZ1A 5FUOL 4ETQA 5DS8B 2HWZH 1YEEH 4NO3A 5C0NC 4J1UB 1NBZB 4XVJL 2G9HB 1XR8B 2X7LA 3CXHJ 3ZE2F 4PJXE 4KZEL 1MFDH 1A7OL 4D9LL 4L3EE 3VFWA 1D6VH 3O9WB 3V4UH 3EFFB 3P77B 5DLMH 3EYQC 5DJYB 5SWQA 2X89A 3WO4B 5JQHC 1JGEB 3TBWB 4QHKI 5DDHB 5SWZD 2RQ8A 5DC4B 4FTVD 2BOBA 5IEKA 3LKQB 1OPGH 1Z9SA 1PKQE 3GM0A 3FONA 4ZTPL 4Y4KC 3QUKA 3Q3GB 4NKOB 3WFCL 4YX2H 1NCNA 3T3MF 1ADQL 5IW6A 1LD9B 4F7MB 3CX5K 3GM8A 1RZKC 2YRLA 3B5TA 5JPMA 1FNEA 4L3EB 2E27L 2EKSA 5D2NA 5JR1H 2OR7A 3BN9C 4QXGH 1PQZA 1QPXA 3QUML 1WISA 4UILL 3U4AA 3UTSA 4N0UB 3IFNL 3D48R 2Q76A 1BD2E 5EZLB 4MCYB 5ILTL 4MNQA 3V79C 1CE1H 4JFXA 1F8TH 1XF3B 4Y4HC 2FH6A 1HDMB 1YEJL 2GITA 1T2XA 5DF0A 1L6XA 3ECBA 4UT7H 2H8PA 3VFOB 1NFDB 4GKZA 3SDDA 3PNWA 3SKNA 1OLZA 4YHOH 5HPOA 4GBXB 4HLZH 4OF5A 1IGFH 3L3KB 1ZEAL 1GIGL 2VSDA 4DGVH 1SBSL 3HR5B 1IGIL 2F5BH 3HE7B 3HLAB 1MPAL 1OCWH 4U1MB 3S34H 4YHLH 3VXTB 4TPRL 3CFDA 3P0YH 2YPLE 3BAEL 3BDYH 1FVDB 2NY5L 5GS1A 3SHSA 4XX1G 3PWLB 1AHWB 1NC4D 4BQ6A 2WLZA 1CLOL 3MJ8B 1P5VA 5FHAL 2HP4A 3GKWH 1GGBH 3GSNH 4LNRB 4BA8A 4PYHA 4OLYL 1EH9A 2A6DB 1I1AA 4K7PL 1T5WA 3WDHA 1PYWB 4O9HL 3UJJL 2XWJA 3RL1B 4F58L 3W0WD 3R0MA 4J4PD 4OGAC 4WV1B 3QA3B 3WUZA 1H3TA 3IKKA 3SDXB 4XX1E 3KPSD 4K9EH 3Q6GL 2IH1A 4OV6F 5CLTA 1I1CA 5JOFB 3MLXH 4CADA 5KVMC 2EXYD 2HKFL 1EMTL 3TH2T 1U8IA 4JPKL 4PJ9A 1QQDA 5ENWA 5AD0B 3V52L 3S37X 3GMNB 3GDBA 5SWSE 2IG2H 3TEUA 4NWUH 1T1ZB 5K9JL 2G5BA 1N59A 2APFA 3O2WL 1IL1A 1A7QL 5B21A 4QHMA 1XGPA 1KYOK 4PTUB 4TSAH 3BSZH 1AP2B 3LQZB 5D7LB 5FK9A 4LSSH 1J8HE 3I2CH 3VXMA 4OZFB 1ROWA 4XCCL 4MNQD 3B9KA 3DVNA 4PJCA 3FOMB 2DMKA 4PJBF 2R0KL 1YEKH 4JFHE 1D5MA 5JHLH 3HE7A 4NOBA 4RMQA 5EOTA 2KQNA 1RUAH 3PP4H 4LGPB 4PJGB 1U58A 1G6VK 4U7SA 5INCB 5CD5D 5KSAB 1FNLA 2BSED 3UZEA 1G7QA 3VWJD 2DLEA 1P2CB 1YECL 2BVQA 2R1XA 4XCFH 4Y7MA 1A6AA 3BD5A 5L2KD 1NSNH 1AI1H 1T7XA 2EE6A 1KSRA 4PRDB 3S97C 2W65A 5ESVA 2BSTB 4XVSL 2JJTA 4R6UA 3HZYA 2IALB 3WFHB 1H8OA 4MNGE 7CGTA 1MVUB 4JY4A 1X7QA 1H5BC 1F11B 1MVFA 2X4PB 1F6FB 3UDWC 2YPKA 4NM8L 4HGMA 5GS0L 1Z6JT 3SGDI 4IRSC 4P48A 4RWYH 1HEZB 5CEZD 1P6FA 4TVPE 1GC1C 1KNOB 2FJHA 2X4UB 1NEZG 3L9RB 1RZ8B 4POYA 3GMOA 3ELAT 2H8PB 5KW9L 1UA6L 1L4IA 1WTLA 3KPLA 3ZMRA 25C8H 5BRZE 4DTGL 3KLAB 4UIKL 1HOCA 2H2PC 1WBZA 2AK4B 2FCBA 5C08A 3E0GA 4KI5E 5JXAH 2IGFL 4JN2A 4P2YA 1F4HA 5DJ6A 1QOKA 4FA8A 1U3HB 3X11B 4Y19E 4LU5L 3ARBC 4TNWK 4NKIH 4YO0A 3HG1A 5D7JA 4IBLT 2X40A 2XICA 3GKWL 3GSNL 1N64H 4ZDHA 1ZLUK 3HMWL 5IVXF 3T8XB 5DJ0A 5E2JA 3X13B 5I30H 4P2QD 5EULV 1OY3B 2XA3A 1HI6A 3CXDL 3QXTA 5IIEB 2IADB 1R24B 2Z8VC 4JFFA 4WY7H 3ULSA 1J7VR 2Q20A 3S34L 1JWUB 4ZPTB 4OCWL 5GGVL 2E8YA 3MZGB 4QTIL 4ONGL 4X4ZA 2CJUH 5IB5A 3BP4A 2JLLA 1A6WH 3WKMH 5K9OA 5BS0E 4OT1H 4Z76B 4JFYA 1H3WM 1BVLA 1TZIA 5IBLD 1AXSA 4KHXL 3IAPA 1EJOL 1KXQE 32C2B 3GSQB 1XF4B 1VADA 5DHVH 1RULH 5J1AA 5CD3A 1F3JA 3PWUB 3BISA 3TBWA 2G2RA 5CKAA 1RZ8A 3D18B 3H8NA 4K7FB 3QBTB 4RMSA 5DJ8B 2CKBA 3TBYA 2FEDC 3OF6D 4OV5B 1KCRH 3LZFL 4HKBA 1WWAX 4X83A 1QLEH 4YJZL 4PJ8D 3MRJA 3EDDA 3HMXA 3SO3C 3ARDA 5HYJB 3VFUA 3D39D 1HH9A 4HK3N 3V5DA 4P2RB 4RGMC 2AJYH 4OAWB 1NMCB 3PWVB 43C9B 2CUHA 4ZTPH 4JZJB 1TTGA 2DM2A 4QRRB 4XNZC 4HQQH 1S7XA 4PP1D 3Q5TA 3DSFH 5JHDB 3QDGD 1EVTC 2W92A 2F54A 3HKFA 4WUUB 2VOTA 2Y6SD 4NSKA 4U0RC 3B9DA 3EUUA 1WC7B 5JQ6H 2EDTA 1FORL 2HJLA 3CSYA 3FRPA 2CMRH 3FHAA 1ZKAA 4M8VA 1KGCD 1K4DA 3TNNB 5IB1A 4P2RE 1KJMA 3F7RA 5D1QB 1MFEL 3MRQA 3BGFB 2I07A 3OAYH 1EGJH 5HHQB 3CDCA 3PABA 3V7AG 2V9RA 4QRRE 5IBTL 3SE8H 3X14A 3S4SB 4R8WH 4UIMA 2P8PA 4G8FB 3MNWB 3LN4A 4GBXC 1UWEL 4QHLB 1EPFA 4YR6B 4CDGC 4MJ6A 1VEPA 5FKPB 4P23C 5HHVH 2XACC 1H3PH 4G6KH 4X4XA 3M17A 3HNVL 3ZTJH 4Y16C 5GS1B 4MXQC 5F9JB 2V7HA 4LMQI 5KG9B 3G04A 3HE6D 2WWMD 1BFVL 5TQ0H 2G9HA 2Q6WB 5L2JA 2AJSL 3LN5A 5CMAA 2ZKHH 4HK3J 1QO3B 2DI7A 1K8DB 3KXFB 3PXHA 1E4WL 3GSVB 4R4BB 3FQRB 2FLBT 4XVJH 3BWUC 5DJ6B 4FS0A 3CFEA 1I1RA 3MCG1 3VFGH 1NGQL 5KANG 1NUDA 5I1GH 3VRIA 3RY5A 3MROA 4NKMA 3UMTA 5HY9A 2GW5A 1MCHA 1FBIH 1A7RH 3LSOA 3TO4C 4JKLA 3TBVA 3MRGB 4JANA 3MJ9L 4HFUL 4LRNL 2ZSWA 4AEHL 2JB5H 2ZCLH 4XP9L 3EO1A 3LQMA 3D3VE 1E6OL 2VDOL 4RBPH 2GFBB 3IAGC 1ETZA 4NBXB 4U7KA 2VN4A 2ZCKL 4X9HA 3KPNB 3DUHA 1PEWA 2NY3B 3H9HA 5HHPB 4AEEA 1UC6A 3O9WC 1U3ZA 2WWKO 5FYLL 3WIHA 3O3UN 4I0PA 5J6GA 2PXYB 4LLYB 1UZ6F 5IHLB 2CRIA 5JOPD 4HFWA 3W39B 1CDBA 1UM5L 5C0JB 4LARH 1BLNB 1QSEE 4IJ3C 4CMHB 1F4XL 4PREA 1A7BA 1YA5A 2CLVB 2XA8H 3VFMA 2UWEE 4MJ6B 2XKUA 2HKHH 1J8HD 4X9BA 3ARBD 4OZGA 5ALCH 4YEEA 3PL6C 2GSGB 2GHWB 3GIVB 2BVUA 4M6OL 2IPKA 5L0QC 1P4BL 2DM7A 5T1LB 4QHNB 3UTQB 4G9FA 5SWSB 2XQYG 2C4FT 1MFAH 3U6RA 1K8DA 2CIIB 3JV5A 2Z31A 3TA3B 3JWOC 2P24B 2C3VA 5TH2A 2FX9H 4ORGA 1DN2A 5DD1H 4YHIA 3VXRE 2PCPB 4K7PX 3GB7A 1RZIB 1ES0A 1KCKA 1JTTA 4U2YA 1UKTA 2F19H 1T1XA 4LSPL 2R4SL 1OWWA 2QHRH 1G7JA 4OFVA 1T6VN 3TZVC 1KTRL 2Z91A 5FYKL 2XWJB 1FNEB 1Q9OB 4K71B 5CZKA 3IFPA 5DVKA 4QGTA 3VRJA 3H9HB 3Q6FB 5H2BB 2C4FU 1IEBB 5I8KL 5J13B 1JWMA 5J1TC 4RDQG 1EFXB 1CDYA 3IJYB 1DBKH 4OZFG 4LLUA 4ZOCA 1AO7D 3C87A 1CGVA 4P5TA 5DMGC 4NCDA 5D72L 4RX4D 4QNPE 1AGBB 3B6SB 4PJ8C 4JFZL 1DCLA 4G8EB 3C6LD 4NC2B 4P2OD 2MCG1 4PTTA 5ICZB 2GT9B 1QR1B 5EBLB 3MUGB 3IGAB 3MA9H 2LABA 5AAWA 2R39A 4FFZH 1JGEA 4OT1L 3QHZL 1RK0B 4ZFOA 3V0VA 1T1YA 12E8H 3UTTA 4DN3H 4EOWH 2O5XL 3JWNC 3BW9A 3CDYA 2GEEA 4KC3B 2ARJA 2BC4B 1T20A 3IXAB 5F8RC 2O61A 1V5JA 1T03H 4WDIA 1LE5B 2H45A 4WHDA 3SKJL 1WF5A 4KQ4L 5E2WH 4KQ4H 2JELL 5E2WL 3AC0A 2G75A 4OZHA 5SWZB 5TGBB 3OAYK 4TQEH 4WI4A 5DVLA 1QSZA 5KVFL 1KCLA 1VFBB 3P9MA 4LHQB 1CVSC 5E56A 5KSBB 1HCFX 1I85C 5I30L 4JFDA 3VWJA 2P44B 2I24N 4DW2L 1A4KB 4Z76A 2J8UE 2PUQT 2B1AL 1KCUL 1CZ8H 5KAQG 5SV4A 3OR6A 4NDMB 4O58L 1T1XB 4H88L 5M7QA 5CIPA 2JB6B 1CBVL 2APTA 5LGJB 2IQAA 1CT8B 2W38A 5J6HB 2CXGA 5FFLA 1AKJB 4QHUB 3HAEB 2QQNL 3T0ED 1T4KB 4KHTH 1RUMH 1HK6A 4I48A 4M8QB 4YHKH 5F7FA 1U3HC 1WUNT 4QEGA 5DD6A 4MB4A 2YD6A 4JRYB 5ID0B 4Q97A 3QUZB 2CK0L 3Q48A 5DQJA 5IUSA 4KTYA 4Z7VB 4XBEL 1WAAA 4EVNA 4PR5A 1OAZH 5ADPH 1H3XA 1NCUA 2ZOKB 4J4PA 1Q9KB 3HI1B 5HI4D 4DWHA 5E1AB 5F96H 5F3BB 4XZUA 4QRPA 2EDJA 2G5RA 4LLDB 1GSMA 2YWYA 2EC9U 4F7TA 5IV2B 3T0DA 2HTKD 3FO1B 5JOPE 4U3HA 3C6LA 1U93B 5FGCB 3S36L 3QEHB 3ALPA 5D1XD 2XN9E 1X4XA 1MY5A 3OKMA 3QO0B 2Y72A 3MBED 5ISZA 4OZFH 3ULUF 4ZO9A 4FOMA 2NY2B 4P9ML 1KB5L 3S7GA 4CADB 4UDUA 4PFEA 5IB4B 1EHLH 2EXWD 3D25A 5KVGL 4EBQL 5I16B 2OTWA 4KH2A 4QNPF 2ENYA 3ILPB 4APQB 3WSQH 3H9YA 3WD5L 1BQLL 4HWEH 4OUOA 4QF1A 4P3CL 2RCSH 5FGCE 1UXSA 3WFEL 1JPTH 1SJHB 3B9VA 3GEWB 4G6AC 3ULVC 1CTNA 4ZD3H 1MJ8H 2UYLA 2VDPL 3OXSB 3ARGB 1YY8A 5I19H 4NQVB 1UG9A 3BYTA 2JKXA 1P53A 3CFDB 1GL4B 2MQ3A 3G6JB 5IMKA 4HKXB 3WKML 1ZTXL 1J05B 4YXHH 5CD3B 1DE4A 3NCJL 1FCCA 1GPOH 1J1PL 1BVZA 5DQDL 3MUJA 3F6LA 5A3IC 3LS5H 3OAZK 2DQCH 4G9DB 1T7WA 4NO0A 5I18L 1VENA 5EO9B 5E2TH 1J18A 5LKNA 4OJFH 3O0RH 2XRAL 4RGOL 4JZOB 1JI1A 4P46D 5IKCA 5FHBL 2YSSA 4RGNC 5C0DA 5D70L 1A3QA 4JY5L 4WHYG 1EBPA 2EDLA 1ED3B 1MRFL 5ELIA 1QSEB 1K5NA 1KLUB 1QA9B 2JCCA 5EZJA 3L7FB 3SBWC 1IC7L 4QRPD 1ZHKA 4JDZA 4FQXC 3SDXF 1XIWC 1MAML 4OFYA 4Y1AD 1MAJA 1SJXA 1YMMB 2E6QA 2VDQL 5I0DA 1A9BA 1EEZB 3STLB 1IGIH 4FTVE 5T5FL 4TQEL 4R3SA 1Y18B 1D5ZB 4ODWB 5GSVA 4WHYH 5DGQA 3SDYL 2DBLH 1TIUA 1KJMB 3RU8H 3LHPL 4RDQF 1NKRA 4R7NA 1B0RB 3HG1D 3O3BB 2DMBA 3MRLA 5KSVB 1MCQA 3WIFB 1OL0A 3HE7C 5CEXB 1K2DA 4UIMB 1FVEA 1MCIA 4OKVA 1YMME 4G6AD 3N1FC 2ZZUT 4OFDA 4AK1A 1MF2H 5EBGA 2VQ1B 5BZWA 3L3IB 3HB3D 2XFXB 1NGWB 4M7ZC 3TH4T 3KHQA 4Y4FA 2FBJL 5C07B 4AG4L 1E27A 3T3PE 2BY1A 4OV5A 3SKNB 2YN5A 1F4WH 4KROD 2A73A 4JQVA 4K8RL 4PBWD 4Y4HB 4F7TB 5IV2A 4EI6B 4UINH 2GSIA 4LLVB 5D7LE 5IFAL 4W68A 1CDJA 4HLJA 2Q7YA 5EWIH 4LPXA 1PDKA 3LIZL 4JPVL 3L1OH 2V17L 5J11B 2P5WB 4HEPG