4H2HA

Crystal structure of an enolase (mandalate racemase subgroup, target efi-502101) from pelagibaca bermudensis htcc2601, with bound mg and l-4-hydroxyproline betaine (betonicine)
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
368
structure length
368
Chain Sequence
SLKIAEIQLFQHDLPVVNGPYRIASGDVWSLTTTIVKIIAEDGTIGWGETCPVGPTYAEAHAGGALAALEVLASGLAGAEALPLPLHTRMDSLLCGHNYAKSALDIAVHDLWGKRLGVPVHELLGGALTDSVSSYYSLGVMEPDEAARQALEKQREGYSRLQVKLGARPIEIDIEAIRKVWEAVRGTGIALAADGNRGWTTRDALRFSRECPDIPFVMEQPCNSFEDLEAIRPLCHHALYMDEDGTSLNTVITAAATSLVDGFGMKVSRIGGLQHMRAFRDFCAARNLPHTCDDAWGGDIVSAACTHIASTVLPRLMEGAWLAQPYVAEHYDAENGVRIEGGRIRVPQGPGLGLTIDPERFGPPLFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Discovery of new enzymes and metabolic pathways by using structure and genome context.
pubmed doi rcsb
source organism Pelagibaca bermudensis
molecule tags Isomerase
total genus 137
structure length 368
sequence length 368
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.1.1.22: 4-hydroxyproline betaine 2-epimerase.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4h2hA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4h2hA01
3SSZA 1MDLA 3IK4A 3R10A 2P8CA 2DW7A 3ZVHA 2GGJA 3TQPA 3MSYA 2POZA 3MZNA 4HCHA 3V4BA 2PA6A 4M6UA 2ZADA 1SJDA 3DERA 3UJEA 3P0WA 2QVHA 4MKSA 3TJ4A 3K1GA 3QLDA 1ECQA 3RO6A 4MMWA 1F9CA 3T9PA 2MNRA 1JCTA 3TTEA 3N4EA 1JPMA 2OG9A 3GC2A 1SJBA 3PWGA 3U4FA 4EWJA 2QJJA 4GGHA 3I4KA 3CK5A 3OZMA 1KCZA 2QJMA 3JVAA 3H7VA 3BJSA 2XH7A 2HZGA 2OZ3A 3HPFA 2NQLA 3D47A 2GL5A 2P3ZA 1EBHA 2PMQA 1XS2A 3OZYA 2MUCA 3OPSA 2PP1A 3TW9A 2PGEA 4ZA0A 3UGVA 2HXUA 2I5QA 3IJQA 2FYMA 3QKEA 2AL2B 3VCCA 3VC6A 3D46A 4YWSA 2HNEA 3CYJA 2GGEA 5IDZA 3RRAA 2CHRA 1MNSA 4G8TA 3UCCA 2AKZA 1DTNA 1FHVA 3NXLA 4M0XA 1RVKA 4JN8A 2ONEA 3P93A 1OEPA 3OTRA 5EU9A 6ENLA 1MDRA 3MKCA 3ZVHB 3UXKA 3TOYA 3T6CA 5FJOA 4G7FA 3JW7A 4Z17A 2AKMA 2P88A 3QTPA 3DGBA 1BKHA 1P43A 4DX3A 1SJCA 4HN8A 2XH2A 4E8GA 4IZGA 4A35A 2PODA 2OX4A 3V5FA 2XGZA 2OZ8A 2PCEA 3VCNA 1TZZA 1EC9A 3R11A 1WUFA 2AL1A 3ES8A 4HCLA 2FKPA 3ZLFA 4GYPC 3CXOA 2PP3A 4DWDA 3QPEA 3NZGA 4IT1A 4KEMA 3BSMA 3STPA 3T4WA 2QQ6A 3OP2A 4HCDA 3S5SA 3EKGA 4GISA 2PPGA 3H12A 4K2SA 2PTXA 3MUCA 2QGYA 1TKKA 3B97A 3VC5A 2PU0A 3R0UA 2PSNA 3ZLGA 4X2PA 3DIPA 3SQSA 1EC7A 1BQGA 2GGHA 5J04A 3CB3A 1MUCA 3BOXA 4IHCA 2OQHA 1NELA 3DFHA 3R1ZA 4GGBA 3ENLA 3FYYA 3NFUA 3H8AA 1JPDX 3UJFA 1P48A 4FI4A 4DYEA 3S47A 4HNCA 1TE6A 3UXLA 4GYPA 3QN3A 4H83A 4IP4A 3I6EA 1W6TA 4ROPA 5FJPA 2O56A 1SJAA 1FHUA 3Q4DA 2ZC8A 3THUA 4DN1A 3ES7A 3VA8A 5FJUA 3VDGA 3IJLA 4DHGA 2XSXA 1ONEA 3R25A 1MRAA 2OO6A 3U9IA 3KUMA 1NU5A 3SJNA 3T8QA 2OQYA 2PTZA 4J1OA 3JZUA 1KKOA 2QJNA 3TCSA 1ELSA 3DFYA 2DW6A 2OFJA 2P8BA 3SN0A 4K8GA 3V5CA 2OPJA 3MY9A 4E4FA 1JDFA 2XH4A 1EC8A 4GIRA 3FVDA 4GMEA 1PDZA 4H2HA 3CAWA 1KD0A 3GD6A 3FXGA 3SN1A 3DG3A 4IL2A 3UJSA 1EBGA 3H70A 3N6HA 3GO2A 3NO1A 2GSHA 1PDYA 3ZLHA 3UJ2A 2PTWA 4K1WA 2PGWA 5ENLA 4JHMA 5FJTA 4A6GA 4E4UA 4Z1YA 5BOEA 2PTYA 4E6MA 3FCPA 2OLAA 4F4RA 3FV9A 3UJRA 1KKRA 3MQTA 4HNLA 4HYRA 4E5TA 3GY1A 3RR1A 4KWSA 2OZTA 1IYXA 2QDEA 3DG7A 4H1ZA 3N6JA 3R0KA 3OW1A 1YEYA 4ZCWA 3DEQA 3PWIA 2PP0A 3P3BA 5BOFA 2PU1A 3MWCA 2QDDA 3I6TA 4H19A 3DG6A 2GGIA 4IP5A 3DDMA 3PFRA 3EEZA 1E9IA 3ZVIA 1XPYA 4HPNA 3TJIA 2OKTA 4ENLA 1L8PA 5FJRA 3TWAA 3PK7A 4A3RA 4KT2A 3IJIA 2PS2A 2RDXA 3CT2A 3Q45A 1R6WA 3N4FA 2P0IA 1WUEA 4GFIA 4KPLA 3SBFA 2HXTA 4MGGA 3RCYA 3UCDA 3DESA 2AL2A 3RITA 3TWBA 4J3ZA 4FP1A 4DXKA 3V3WA 4IL0A 3FJ4A 7ENLA 3VFCA 2GDQA 3SN4A 3RGTA 2XH0A 2GGGA 2OVLA 4JN7A 1R0MA
chains in the Genus database with same CATH superfamily
4A2RA 3SSZA 5CBJA 1D7KA 3IK4A 2YFOA 4GI9A 3R10A 2VEMA 1QI3A 1WAWA 1UJQA 2A3HA 1PVNA 4D1JA 3TQPA 3LRLA 4QXIA 1OINA 1GKRA 3EXRA 1AD4A 2BGNE 1JYWA 3AN1A 2V30A 1UIPA 1J12A 1OD0A 1JUBA 2QVHA 5DLCA 5L6UA 2W27A 3RO6A 1RA0A 3C3UA 1BF2A 1VKFA 2XSAA 2ZTKA 3WD3A 1Y7VA 4ZQCA 4UCFA 1H5VA 5BROA 1XCFA 3LADA 1YNQA 4J40A 3SFWA 2GDUA 1W9DM 3B04A 4XD4A 3GG1A 3DHDA 3C8FA 3W22A 1OVDA 4C6CA 1E3ZA 4V2XA 4EX4A 1BQCA 2Y5EA 2G3NA 3TC3A 1N8WA 3DHFA 3EWUA 3BLEA 4QEEA 2DZAA 3AIUA 4OJYA 1CXKA 3H6OA 2YQUA 4LUJA 2XH7A 4IMAA 4QDWA 4RV8A 5D8ZA 3THDA 4ACYA 2XVNA 1I1XA 1W5OA 3WK3A 5I5RA 3WQ4A 3BICA 5F2GA 3E5BA 4V27A 2F9RA 1JFHA 2AL2B 3VCCA 3D46A 4EKJA 4LUIA 1YDNA 1UPMB 4CQCA 1X38A 2VUNA 1KFEA 4FDCB 2PGRA 5A1AA 3QJAA 3LHYA 1MNSA 2FQIA 1S5NA 1KW1A 5DY3A 1JUKA 2HWGA 1YXYA 3GNPA 1A47A 4I6VA 3KBMA 3V5OA 4NEVA 3F2DA 4Y90A 4JXCA 3CU2A 4A4AA 2YXGA 2VDHA 5A6LA 3ANVA 1B90A 5E93A 1MW1A 1IWPA 5LHEA 4D9PA 1QASA 3FEQA 3QZAA 2Y4SA 2E3TA 1QCWA 2OOGA 2PDBA 1P43A 1VRDA 1DV7A 3CAKA 2E4TA 3VAVA 2R1KA 1KM6A 1V6UA 3LSBA 3VGEA 4BJHA 4ML4A 1GETA 4WSHA 2WBKA 3ZOAA 4PB4A 1GZGA 5IDIA 4B5VA 1GORA 4AEEA 3MP4A 3N4AA 3A9IA 2ZX6A 4XAYA 5K4XA 3QPEA 3VD9A 1NDYA 4KEMA 3BSMA 3CPGA 2WPFA 2GYIA 4D6DA 3A4WA 1WV2A 5HR6A 2HDJA 3UW6A 1LOQA 3W37A 3NURA 3UY8A 3CUHA 4DUVA 1X97A 4RE0A 5EBAA 3VC5A 3WZ0E 1B2YA 1HKMA 1A50A 2WVSA 3MMWA 4P7OA 3R0UA 2DV0A 2PSNA 4J3XA 1JZ8A 4WKFA 1EC7A 4BWLA 4ZENA 3CB3A 5I3IA 1RCQA 3MHGA 3NDZA 1TJ0A 2I16A 4XZLX 3G1XA 1AL7A 3GKFA 1R8LA 3B0VC 1JPDX 1RQHA 4DNMA 2YIHA 1WZAA 1ADOA 1V7YA 4Q8NA 2RGLA 3B8DA 1UYQA 3L66A 1VFSA 4GNJA 3BQ6A 3EA1A 1B5TA 4PL2A 2ZWZA 1BLIA 2QKFA 5T26A 3NQAA 3NQ8A 3HMCA 2W63A 2YB1A 1B3ZA 3Q4DA 4P7NA 4KS0A 2E7FA 3TTYA 3BH4A 2EPHA 2E3ZA 4NL1A 4HA1A 2JE8A 4W8AA 5M5DA 4TX6A 1LP6A 1CEOA 1VENA 3TDFA 3L5LA 4LRTA 3N2TA 4HJWA 1C8XA 3U9IA 2XHYA 4L7ZA 4V15A 4FX6M 2E8ZA 1GVYA 4KWOA 3ERPA 1POJA 4H4QA 2R91A 5D30A 3B0XA 2BHYA 2HNHA 2HE5A 4MDPA 2GLKA 2E5CA 3TC7A 4HN4A 1OG6A 4GI8A 2J78A 1YTDA 1DWAM 4L1WA 4C6IA 4KIRA 3KCJA 1Q85A 3R94A 2R14A 4PR4A 1TWSA 1XBYA 3RO8A 2GVLA 4K1WA 1KGXA 5JCKA 1W54A 1Z44A 1UKQA 1VJSA 4Z1YA 3L5MA 2C0HA 2VD8A 5BOEA 4JDYA 2ZX7A 1TSIA 3FJLA 2BZNA 3GUGA 5C54A 3NZPA 4DUWA 4JQ1A 1XYAA 3UG3A 3ABRA 4UOJA 1TX2A 1RVGA 2A6LA 3MW7A 3QFBA 2OEJA 5CPSA 3TFCA 2Z2BA 3DYOA 4UB9A 1YIXA 1XIIA 2DZTA 2HBXA 4HNLA 5JCLA 1Q63A 4JTKA 3VNJA 4H4SA 3QPZA 3GRIA 3PZ9A 3NZQA 3A24A 2XISA 5D32A 3R0KA 2ISDA 2DZSA 3EB3A 2IPJA 1XIEA 2LLEA 5DQPA 4FX8A 2FPYA 5H6HA 2V0TA 3LXAA 2E1DA 3H2CA 3M0KA 4UTWC 1W56A 1CB7B 1E4MM 4EPEC 4QG6A 2D0GA 3GE7A 2Y24A 4MFEA 1GOKA 5CZ0A 1L8PA 1K8CA 3REQA 1H51A 3NZRA 3TN5A 2PS2A 1N62C 3W1PA 4PMVA 3NO5A 3VDCA 3SCNA 4S3AA 4NJGA 3LHVA 4WD0A 5F2IA 5LNUA 5LA0A 3N4FA 3W38A 1R86A 1H4PA 3MU7A 1US0A 3M0ZA 1DORA 2BGSA 5TBOA 1QDSA 4KRZA 4DUOA 3M4HA 3TLLA 2Z00A 2PD9A 3WDRA 4XK2A 1VDVA 1VPYA 4HPGA 4IL0A 5EPDA 3QV6A 3CZKA 2OWCA 3G1RA 4L9XA 2PDCA 1JCYA 3PUOA 3EX2A 3HN3A 3MCOA 3SRFA 1M7PA 1FWBC 4XBSA 5LIXX 4I5RA 2VX7A 8XIAA 4QE5A 3ZVHA 4F9DA 3BAKA 4QCEA 3AZSA 1R9XA 3E0VA 3EXSA 4IG2A 1ZBWA 4AMCA 3AI0A 4F0KA 1T40A 4IISA 5CPQA 1PTGA 2WOIA 5C9XA 1BGAA 4I90A 3WQWA 5C0QA 4MMWA 4YWIA 1ODUA 4J5NA 2F6UA 1XLLA 3P80A 3QBUA 3VGGA 2BOGX 2TRSA 3SCWA 3GHSA 4HNUA 1LM1A 1U83A 1W3JA 1TE1A 1FFRA 1GOXA 3N2BA 3KRUA 4RE2A 2VWTA 4RZBA 3SCTA 3I3DA 3GC2A 3B9DA 3HW2A 1E4LA 5GNYA 1N8IA 2Y7EA 4RZ6A 1PTAA 3GU1A 4XV0A 1O1ZA 3MC5A 1GXFA 2DPEA 3AYTA 3CPUA 2BG5A 4PUDA 2GL5A 1OQFA 1NHPA 3L5OA 1KCKA 4CNUA 2VDGA 1GQKA 3OU8A 3P2VA 4D8ZA 4JR5A 4C6EA 2BVTA 3NUKA 3PTKA 1R2TA 4GX8A 4LNYA 4MAVA 2NV9A 2CXGA 4CCZA 1JULA 4XZNX 3S1GA 2FYMA 4D1IA 3QKEA 3R7MA 4BI6A 1K9EA 1E6NA 1QU4A 2YCJA 1Z69A 3EDFA 3WY1A 1X1ZA 2VM8A 1XLEA 1IGWA 3TXZA 3F5LA 1QPNA 3P82A 3ZXWA 1NOWA 1UD2A 1V3LA 1XBZA 3HRDC 3WBAA 4JIRA 3GQYA 4AY1A 3CLMA 2BVYA 1MDRA 2J7BA 1EHAA 4EXQA 1DNCA 1GG0A 3CH0A 3FJ6A 5HK4A 4H50A 1XYBA 1R3WA 3B40A 3L9CA 1GK8A 1VBJA 4JDRA 3CAVA 3LCFA 4JKKA 1TREA 4NG3A 3FDGA 3N34A 3SCQA 2PLMA 1GVIA 3ZJ6A 4XWUA 3T7VA 3TMQA 1ZPTA 4M7SA 1MZRA 4LAOA 2NUYA 1LQ2A 3NOEA 3EBVA 3AIEA 1Z6KA 2E67A 3PP7A 4GYPC 2MANA 3IV3A 1G0CA 1HNYA 2F2HA 1JZ3A 4PMRA 3MP5A 4L4PA 4S39A 4EQRA 2VEGA 4HMEA 1QUMA 3HQPA 5XIMA 5D02A 4K68A 3W86A 1JZ7A 3OLDA 1GRAA 2PPGA 4ICNA 2D69A 2I5GA 3H12A 4DJDC 5KSWA 5C2XA 1TKKA 1SZGA 4TU1A 4EACA 2R1NA 4HZ8A 1BSLA 4NAEA 4LBUA 3NDOA 3TUUA 1R3RA 2INEA 4GQRA 4Y9MA 1E55A 1H7WA 3AMCA 4ZO6A 2FZMA 1DQWA 4GY7A 4Q4QA 1OD8A 4ILSA 3T42A 1LT7A 1PTDA 1K02A 1PZ3A 1K70A 1A3WA 3VUSA 4HTYA 2HISA 3FA3A 4C6FA 4UR7A 3L4UA 2OEMA 5K9CA 2P50A 2PBOA 3KAOA 3W2UA 4DYEA 3YPIA 4RXGA 5B80A 1V08A 3LX9A 4NZ5A 2VFEA 2AGTA 1DWHM 2BDQA 4GQ0A 4LJ3A 3F5JA 4B3KA 2VHLA 1TPVA 2O55A 3HPXA 4PTVA 3TKFA 1FDJA 3IK2A 3AZRA 3ES7A 5JH2A 1RJRA 3NL2A 1XYLA 4P2VA 3QXBA 6CGTA 1ZP4A 1OFEA 3WFAA 3NDYA 2XFWA 3B9NA 1QATA 1DQUA 4DJFD 2DH2A 3DKLA 2VEIA 2GVYA 3C2RA 4MG4A 4IMGA 4AG0A 4QQ3A 2VVSA 1DPMA 4H9UA 1U5JA 4IGSA 1K8ZA 3LEPA 1G4EA 2ISFA 4MKNA 1JDCA 3HMJG 4Y2WA 1AMYA 3NSXA 2VRKA 4FF5A 1ZJBA 4MUZA 3KTSA 5A6JA 4K38A 5CPNA 1UUQA 3CXBA 2XZ9A 3GO2A 5F1UA 2GSHA 2RDUA 4P7LA 3W26A 4BFAA 4MWAC 2NZLA 4E4UA 1R47A 2C15A 3F4VA 1VH7A 4GE8A 1ZAIA 4GYKA 2BC1A 2JK6A 2EKGA 1BYAA 3RM9A 4A3YA 3GNOA 1B9ZA 1HXJA 3SCPA 4LNCA 2PC8A 1EA9C 3UJRA 3C0SA 3HPSA 3LLDA 4DWSB 3TTQA 4YHEA 4UTIA 2J8TA 3QOKA 3FX4A 5FS6A 3QPYA 1YLVA 2Y7FA 1N5WC 1SSGA 1WBHA 2FHBA 1GJPA 1EJXC 3DZ1A 4KPRA 3LZ3A 4FALA 2TAAA 2DVUA 4BA0A 1B3OA 2QCDA 3MA8A 4WDXA 1SFJA 3TJLA 1TV3A 5AFDA 1FFVC 3KEHA 1M01A 4O50A 1A5LC 4W7WA 3BCFA 1I6NA 1RLDA 1RZMA 1WZMA 3GNRA 3LGGA 4JL2A 3GH4A 1DEDA 1K8XA 2GSEA 1XPYA 3C3NA 3H2MA 4CD6A 1FEBA 3GIYA 1E0WA 2CLOA 2NSOA 3IJIA 4HOZA 3WENA 2R9RA 3L8KA 4Z1CA 2A7NA 4HGXA 1R2SA 3M7WA 3QYSA 2BCPA 3LGEA 3MUAA 1N2VA 3AYVA 2E25A 3TW7A 1ZY9A 3CYVA 3WEZA 3S83A 3FJ4A 4BHYA 2W54A 5C2GA 1E43A 1A5CA 7ENLA 1XH2A 2Q6ZA 1C93A 4MY1A 5CJNA 3TIMA 5FSDC 3E74A 4LA1A 4QS6A 1TA3A 2DZBA 4YYFA 1R7AA 4ZQNA 2RJHA 5LXEA 2YDRA 3CMGA 2GGJA 4EPDC 3VNDA 2YX0A 1U1HA 2XG9A 1CGVA 1IT0A 4ZBCA 1Q65A 1GV4A 4I8YA 3THAA 3MMUA 2Y5JA 4E2DA 3N4EA 4S3JA 3BSHA 3RXZA 4L1GA 3T09A 3QMSA 1PV8A 1LROA 3USZA 2W0HA 4H6RA 3W2KA 1CLKA 2WHLA 2P1FA 3I4KA 3E49A 1KCZA 3CZEA 1QOXA 4Y8EA 4NAFB 3U48A 2E6DA 2WO5A 3LPPA 3W07A 4H8NA 3V36A 4GUIA 2PGEA 1JD9A 3VNIA 4AZIA 1WPCA 3OLIA 1KBLA 1XIHA 1PX8A 1UUOA 1YW1A 2HNEA 2ZX9A 4CQ9A 3CYJA 4GUFA 3CL8A 3KP0A 1YBQA 2VJXA 1KM2A 1NJJA 3IVUA 5BWAA 4Q7NA 3DK4A 1FHVA 1OGBA 3GTNA 4M0XA 2XTKA 3T44A 2YCLA 1CTNA 2YZRA 4PTDA 1EUNA 1A5AA 1J5TA 4AZHA 3L65A 4BWLC 1FWHC 4GQGA 3NPUA 4G7FA 2OTDA 3QTPA 1YDVA 3SCVA 4LV9A 3BAIA 4WSJA 4DUXA 4HN8A 4A35A 1Q6OA 2PODA 1ZCCA 2V67A 3S2JA 1UBSA 5G5HB 5BXSA 3UR2A 3W1QA 2PCEA 3OBKA 4PYSA 1PKYA 4UFJA 4LYKA 2J9ZA 4O19A 3S3GA 2POTA 5EA9A 3H54A 4M1RA 3NZGA 4F0HA 1FOBA 5A6AA 3DGZA 3H4WA 3OLEA 3U57A 4NZFA 1E6RA 1MQRA 1XLHA 1AG1O 3QR0A 1GGOA 4LYPA 5D09A 1XFCA 3DFPA 3STEA 2BVDA 5C55A 4A22A 5LGXA 2WVVA 1JVNA 1B3XA 3RHGA 3GXDA 2YPIA 4INFA 2IMRA 3U2OA 1TX0A 4HOXA 2GWNA 2EPMX 3NVDA 2J7GA 4DJFA 4Q6XA 5ABEA 3S2MA 4F3HA 4B9YA 2EPOA 5DXYA 1QHPA 2GJRA 4XBKA 4H4XA 2NUXA 4ZOHB 3HQNA 3EMCA 3CNYA 1BZLA 3W7NA 3QN3A 4F0LA 4A2SA 3C2VA 3BW2A 1FHUA 4Q4MA 2ZUVA 5BOOA 1DE5A 3SGUA 1XHCA 1P7TA 4AF0A 2QJHA 2PURA 1H50A 2PDPA 2BOEX 4B5TA 3C6CA 2F61A 4GY1A 4DLFA 5E09A 3AWNA 1NU5A 2I1OA 4Q7IA 4L6OA 3AYRA 4AZCB 4JTGA 1A4MA 2Z1VA 1XYCA 5A5WA 6XIMA 3AU6A 2BX7A 5HNUA 2YAUA 1YRRA 3GVVA 2GR1A 1DJGA 1CYGA 3GU2A 4DBSA 2CC0A 1YX1A 2AQOA 4CEXC 1NEYA 3A4AA 3S5ZA 2J3NA 4GIRA 2VR5A 2Q09A 3UZYA 3U5YA 2JF7A 2OWXA 3FXGA 1XLAA 2V6AA 1KR0A 3SN1A 3VDAA 1FUYA 5BZAA 2VT0A 4NILA 5G4EA 3OVGA 3R8GA 2D2GA 5I09A 1Q5MA 3GAYA 3NIYA 2XSBA 1RPXA 1RY8A 2X05A 1VEPA 3IEBA 2BY2A 3URBA 1CIUA 2PWUA 2IW0A 1VIWA 4ORIA 4QP0A 3H23A 1S3HA 1OFBA 2CWNA 3E2SA 3H53A 5LNVA 1R46A 1XGZA 1LRNA 5A94A 1BSIA 3VOIA 4I9MA 3FIGA 3U2ZA 4OOZA 4TO8A 4ZO7A 3A64A 1NHSA 1A3XA 3GHUA 2TYSA 2E5DA 1RA5A 3CT7A 4CNNA 4JTRA 1MO9A 5FJJA 3IGXA 1AFSA 1Q2RA 1BVWA 2VELA 1AW5A 1ONWA 2H90A 1I2RA 2OZTA 4EPBC 5DCDA 3KBJA 3M6YA 3SCOA 4MJ4A 3ZIZA 3U2EA 4J9JA 2ZZBA 5ABGA 5LXXA 3VNLA 2PE4A 3S5NA 3FAXA 4KCWA 1FDYA 1XRTA 2VO5A 1Q13A 4YTQA 1K77A 1ZALA 2G96A 2X0HA 3WQ6A 4WGXA 3K46A 2PUZA 4RE4A 1A0DA 3EEZA 5AHFA 4IUOA 5JH1A 3ZVIA 1RJQA 1EF3A 2YVFA 2DZWA 3H4XA 1LL7A 3IAPA 3PK7A 2ZUUA 3EXTA 2VUYA 1OY0A 5F2MA 5DX7A 3TYEA 1OG0A 1X7IA 1ESWA 3M0HA 4H4UA 2X2YA 3M0YA 3NRZB 3KRZA 1GQIA 4KQNA 2A3CA 2AL2A 2F7FA 2PBGA 3S1WA 2YJQA 1SQ7A 3HOJA 5JMUA 4RPPA 4L4LA 1R9ZA 1WZLA 3VFLA 2YA0A 4LUTB 3AMGA 1IEXA 2VCCA 4JEJA 3T2OA 4GXPA 3NEVA 3URAA 2A0NA 1VRXA 1KBKA 2WMHA 1IEQA 3KDOA 3MMTA 3CUJA 1G7UA 2PDNA 4U28A 4YIWA 1ME9A 1NOUA 2GJXA 3WO8A 3LXCA 1U2YA 1TUXA 4S3KA 1MYRA 1VYSX 5CC5A 5TIMA 3W53A 2H6RA 2Y62A 3MSYA 3V0SA 3LBOA 3MMDA 8XIMA 2OJPA 3LM3A 1JZ6A 4XSLA 3LMYA 1E70M 2D2OA 5LA1A 2UY2A 3TJ4A 3K1GA 3WELA 3VD3A 3Q6JA 1F9CA 3O6CA 4FNQA 4EMJA 3LV6A 5D37A 4PUKA 3EKLA 1TV2A 3I3BA 4Q8QA 2VQUA 2X2GA 4B5WA 4X61A 2RGMA 5I78A 2OZ0A 3CQ0A 3RNDA 3T40A 4P7QA 1CNVA 3TN3A 4IPNB 3MUY1 3GYCA 1P0DA 2VFFA 4WGHA 4AHOA 3VM7A 3QMTA 1U1JA 3CK5A 4KF1A 2DEPA 3UR7A 1VPXA 3CV2A 2BTMA 2QJIA 3PS7A 6PTDA 1RALA 4Y8FA 2ZA1A 1Q7QA 5BNKA 4LVAA 5AC8A 4HNOA 2Y85A 3BZGA 4O14A 1DBTA 2D73A 5CG0A 3QMRA 3TW9A 1JEHA 4O1BA 4CU6A 3FKRA 4YTUA 1WQ5A 1ME7A 3M5YA 3ARWA 4H3DA 1KLZA 4HJFA 1V6TA 4MVAA 4TX9A 3QKZA 1T6MA 4NXKA 1YTKA 1QXLA 4J2MA 1JCJA 4DF0A 2CHRA 5DELA 3RIKA 3PR2A 2A7PA 4ZZ9A 2X7VA 4NP7A 3VNKA 5AKQA 3ZJ7A 1ZCOA 3PY2A 1FKWA 4IM4A 4WX2A 4QSHA 1QNOA 4JN8A 3P93A 4US5D 2I9EA 2PDWA 2O4QA 5DXXA 5HMFA 2GFTA 5AYZA 2G95A 5HA7A 2XUCA 5I79A 3AXMA 2OYKA 3GVRA 2CU0A 3OQ8A 4Z1DA 1BEUA 1Y5XA 3V5FA 1IGSA 2QF8A 4IF2A 2OZ8A 1OGSA 5GPRA 1EC9A 3V1HA 2PD5A 4KETA 3TSDA 4XVEA 3GBDA 2FKPA 3CXOA 3UR8A 4M29A 3M41A 3S0CA 1FRBA 1OCJA 2WW5A 3UPMA 1KCLA 3OP2A 2Q3RA 1MFVA 3CO8A 5A2CA 5FF4A 2ABBA 3PZVA 2QPSA 2OMAA 1YYAA 5TD4A 3SM0A 4BQ3A 2Z7KA 1UZHA 3QEZA 3MBFA 2ZZ5A 2YBUA 5ABHA 4ASTA 5J04A 3A6OA 1EWEA 2BHUA 2CHNA 9CGTA 4H7VA 3CV1A 1KFCA 3P81A 1GVSA 3NQGA 5I77A 4W8LA 4AVOA 3I6RA 4XIAA 4QCFA 4IH3A 1LRTA 5BXRA 3PAJA 3VVGA 1HUVA 3IPWA 4GVIA 1EIXA 4GWEA 1UP3A 1R5YA 5KETA 2A5HA 3CB8A 3TFXA 3LU2A 5E0CA 4RW5A 5FL1A 4IMDA 4XKYB 2WKJA 3T07A 4AB4A 5HMEA 2A7RA 3EWWA 3W2JA 2YDSA 3G3MA 3W7QA 2IKGA 2NVDA 1XINA 2D0HA 3WDJA 1W1B1 2VNCA 4FX7A 4F66A 1O4UA 1ONEA 3AXKA 6XIAA 5J5DA 2I9UA 1V3MA 3IARA 3WLRA 1BPLB 1NFGA 1S5WA 2OQYA 4J3TA 1ECEA 3GB6A 2C1IA 1GUVA 4S38A 3SN0A 1KRCC 4UTLA 2ZXQA 4DWSD 2AAQA 2F84A 1LLWA 5HJYA 1JDFA 3BJFA 3PZIA 3ATZA 3LG3A 1ZNNA 3GH5A 3EB4A 1LTDA 3NQMA 2WPGA 2W4XA 4MUPA 3VX0A 1KTBA 4J28A 2YLAA 4L4OA 3KHJA 5I7GA 2QCCA 1ICQA 1CGYA 4U5KA 2WWCA 1QI4A 1DWFM 2GUYA 1ME8A 1XWYA 1U22A 2GQ8A 5CPMA 4LS1A 2OLHA 1DIDA 5FJTA 4Q8UA 1CENA 1W9XA 3STFA 3U6WA 3MO4A 3ITXA 4D8LA 3G6LA 1RBLA 2OT1A 3CL6A 4JL1A 3ALGA 2ZCGA 3BV4A 4HA0A 5HWMA 1XLCA 2XWEA 3SGGA 1O66A 1O95A 1C8YA 3V18A 1OFAA 3VILA 1KBIA 3UZXA 1W5PA 3R5EA 4YCOA 3OBEA 4IIFA 3QFWA 1BG9A 1YEYA 4ZCWA 4O11A 4JQ3A 3NQCA 4CVUA 4LU0A 3WH7A 4UQCA 3FA5A 3SR7A 4HU4A 3QFAA 3G1SA 3Q2DA 4JIQA 4YN5A 3QFEA 4JQ4A 3L4ZA 1JOAA 3UWVA 3AS2A 1PCWA 5CAKA 4JTDA 4UOZA 5LIWX 4AX7A 2OKTA 3H24A 4W5UA 3LB8A 4EQSA 1A49A 3QQ1A 4C1NB 4A3RA 4AYGA 1OFDA 1FVPA 4A05A 1IEIA 1IXNA 3M1ZA 5D05A 1NWUA 3LERA 4TVYA 2D23A 4JDBA 4GO8A 1FWEC 1R2RA 1ZFJA 1CPUA 4FXFA 3QH2A 2ZKMX 3NAVA 3BLKA 4ZQOA 1HKJA 1NFBA 4NNBA 2V9DA 4DPQA 3AXXA 2C0AA 2QLYA 3TQ0A 4YCPA 1PZ0A 4NYYA 1HJSA 3UA3A 2NV2A 3EKZA 2VEFA 4MSSA 3L12A 3NS1B 4QEHA 2OVLA 2GJPA 3F4CA 3VZYA 3VIIA 5KINA 1EQPA 2YOCA 4I9AA 1AH4A 1F76A 4UQAA 4LCQA 1FCBA 5D2XA 3VOGA 3W7MA 3MP3A 5CZJA 3C2YA 3WLOA 1IWAA 3P7YA 2D2JA 1BXNA 7REQB 3FJNA 1XH1A 4AMAA 2BNJA 1JPIA 3CMFA 3K8MA 1P0KA 3O0FA 3DHUA 2X41A 3ICJA 4JTCA 4NNAA 4MJMA 1JPMA 3E3HA 3EX3A 4QBXA 2HE8A 4W7VA 3ITLA 3MB9A 1QNSA 1LVLA 2HBVA 4ZOEA 3PZMA 5CBBA 5BRQA 5HUPA 4O54A 4US5A 2FZNA 4TV5A 2E6YA 3K2GA 3A4JA 1HQTA 3D47A 3WJSA 3PZOA 4DRSA 2Z25A 3SUTA 3PBGA 4UBPC 1HKKA 4LC6A 1XV8A 5M2FX 5CZTA 1K7EA 1VCFA 1W5QA 3K4AA 4ZA0A 1LUCB 3A5FA 3WQOA 2CCRA 2W3SA 5A8NA 4S3EA 1IXQA 2BXVA 4NASA 1GESA 1JCXA 1ZRQA 4XUGA 3BLIA 3GTXA 2QJGA 4F2UA 5MHBA 1KBBA 3A7UA 3XINA 1Z48A 1FWCC 4GABA 2AKZA 1DTNA 3E1F1 3BVJA 4PRTA 3W2MA 5A2BA 6ENLA 3OGRA 4G1KA 4LGXA 4QFUA 4ZOCA 5DMLA 3SUWA 1QK0A 1BYBA 2X8RA 2QV4A 3ARTA 4UQBA 4R9OA 3UXKA 1EXBA 3PJXA 4KIEA 3M9YA 3G5EA 5B7ZA 4DJFC 1J5SA 3MKVA 1IZKA 3AO0A 4E2BA 1N7KA 4HK6A 1J01A 4DZHA 4B5UA 4IZGA 1TQXA 3CL7A 2DZPA 4N2YA 4B15A 2A21A 4M6QA 2ZX5A 5FEZA 3R07C 1LF1A 1G5AA 3V16A 1MVYA 3WLKX 4NRRA 4FF7A 4J4KA 1CB2A 1R87A 4HMNA 2CWXA 2DH3A 4HTBA 3SUVA 4Z42C 3T4WA 3W1RA 3GNDA 3C0JA 3PTDA 4K2SA 1RBAA 3BLPX 2ZA3A 1EUAA 3E6EA 2CBVA 3SR6B 2X1RA 1XDMA 1I45A 1ZGDA 1NHQA 2PU0A 1UROA 9XIMA 4AZ5A 2WXDM 1BQGA 3DCPA 4IQJA 3UZ5A 5JCMA 3DFQA 1IEVA 1OGGA 3TQVA 1OC5A 1TJ1A 4J3SA 3B03A 3NQDA 3APGA 4HBKA 3DFHA 2ON3A 3LBCA 2EQDA 2BWGA 3EPNA 2DSKA 3N9KA 1ALDA 4J35A 5JUVA 3H55A 4DWSA 1FTXA 1S39A 1IXPA 2DSZA 1FWIC 5LNSA 2NWRA 2PDHA 2WZEA 3L4XA 1UHVA 2PDXA 3B9AA 4F48A 4RKAA 2OSXA 5AYBA 2DJLA 2FMOA 1TTQA 4O1AA 4Q8VA 4H4RA 1SJAA 5KVIA 4HHLA 1KM4A 4Y9AA 1MQPA 3LRKA 4U33A 5HQLA 1EEPA 3VU2A 1KGUA 4MYXA 4DHGA 1VQZA 2UY3A 3AM9A 3B06A 3E12A 4NRSA 5JCNA 5D2TA 3B8WA 1TRDA 2YBVA 3S8HA 3IVTA 1GKQA 2WNQA 5DN1A 2WK2A 1D2KA 3B4UA 3ABSA 3W2LA 2ZRYA 3RMJA 2P8BA 2A79A 4PMNA 4EF9A 1G1YA 3V5CA 5C8BB 7PTDA 3QM3A 4LFYA 1SGJA 5H8UA 3BAYA 4QJ1A 1VCGA 1RD6A 1Q45A 1U5HA 3W1TA 3H2FA 3WF4A 2EBNA 3U0HA 1OT2A 5FMHA 1NAL1 1TIMA 4H6EA 1JL8A 2BHZA 3WKZA 4MZ8A 1VBUA 5GVJA 2PTWA 3O6YX 2NQ5A 1K8YA 2VZTA 5IFTA 2HK0A 2JGYA 3FSTA 4GHRA 3O6DA 4O1CA 4AZGA 2DQWA 2PTYA 2DP3A 5BCAA 4E6MA 3ELFA 1PYFA 3KDNA 5CSRA 4O16A 3WG6A 2FVMA 4PUJA 2EQ8A 1C9DA 2J66A 3LS9A 3GNXA 2ANUA 4E5TA 3AHZA 3RR1A 2UZ9A 2CETA 4F2TA 4HP5A 5HNNA 2DY3A 4H4IA 4V33A 2G97A 3WLPA 4AY7A 1E0TA 3OW1A 1TVNA 4OWGA 3SUUA 5DMMA 3GR8A 3KOFA 2ZUSA 4DF1A 2OOFA 1T8QA 4K1GA 2HRWA 1H1NA 3I6TA 1CGTA 2AAMA 3KWSA 1FO4A 3HQOA 2ZC1A 3OVPA 5GQBA 4B92A 2HVOA 2WJEA 1O5XA 5FF3A 1XANA 3ZM8A 3W1NA 1M65A 1MW2A 4JNMA 3WLJA 1ITUA 4I9TA 4PCFA 1FP8A 4NAFA 3KL3A 1V6XA 3OZOA 3W70A 1A5BA 2AAAA 1R6WA 4GOAA 4I9JA 5T8GA 1S2TA 3KW3A 3UXDA 2WMGA 4GFIA 3T0CA 3ZYZA 3TR2A 4HNTA 3MS8A 1PYMA 5HPCA 2VZVA 5FI8A 4JFUA 4HZMA 1L8NA 5G2WA 4AC7C 4PB3A 3SJ3A 1S46A 5C6MA 4RNJA 3RU6A 5A6MA 1E1EA 1EP1A 1MO0A 4KKXA 1EOMA 4JIIX 3ZWSA 4CQ8A 3S6TA 3S1UA 2PDUA 2ZOXA 1PE1A 3UNDA 1UR1A 2IXVA 3UPWA 3GDLA 3A9BA 1UG6A 4FNSA 1FWGC 3WQ5A 3PF3A 1AUSL 1Q6GA 3VOCA 3NQEA 4ACZA 4GI4A 4FNPA 1F3XA 1UWAA 1UOZA 3VO0A 2DJXA 1QI2A 4ADUA 2CESA 2ZRUA 3F2CA 2MNRA 3APYA 2C3CA 2ACQA 2CPUA 3LXDA 4O18A 3OHMB 3WYZA 4LYRA 2GOUA 4HSNA 4TX8A 3GXTA 4NZCA 5DO8A 3PWGA 1GRTA 1O60A 3G8EA 4FOUA 4AY8A 2O9OA 5I3GA 2VX4A 1QTWA 5CXPA 2QCGA 2XDFA 3CASA 4HHPA 4PMZA 3T78A 1F73A 5K9DA 3S6OA 3TQKA 1L6SA 3H7VA 2QV5A 2GQWA 5BWFA 4HHMA 3H2AA 5A69A 5IBXC 1YE6A 4HU3A 1XS2A 3QW4B 2EXOA 4ML9A 3L7RA 4AAJA 1RP9A 5LHFA 1IHIA 4LWWA 1YNPA 4ZR8A 4AZ6A 2V82A 4PTWA 2GWGA 1UJPA 4MY9A 5IOBA 3T4CA 2NQ9A 3B9EA 1B57A 4NT0A 4Z0SA 4ALDA 3VE7A 1UD4A 1BWCA 1GOMA 3RMEA 4E8DA 3DGHA 3UNTA 3M0MA 3FHAA 1EDGA 3OTRA 1H41A 3LTYA 3MO7A 3W2NA 5D2YA 3ANYA 2C18A 1XYZA 1DOSA 5CGMA 1QI5A 1DIOA 4XD3A 3ME3A 4ERIA 1EDTA 1REQB 1PO9A 1I60A 4JNZA 3OYZA 1W1YA 1UR8A 1FWFC 4X0VA 4FX9A 2CKSA 2XH2A 1XYFA 3H4KA 1EJUC 3LHZA 3LDVA 4W85A 4XTDA 3NSMA 4DXVA 1HKVA 3BV7A 1GG1A 3E38A 3MVTA 4NJIA 5BW6A 4H4ZA 2WJFA 4MHBA 1G69A 3E2QA 3URHA 3HGRA 3V35A 3G1VA 2ZX8A 3W85A 5E0KA 3WNLA 1VFTA 3ZMRA 1H60A 4H9MA 2Z1KA 4O4VA 3RCNA 5DMYA 3USBA 4X60A 2TSYA 4AW7A 4NZ3A 1HGYA 5HBFA 2WWDA 3CGCA 4AD1A 4A29A 3SQSA 2DIJA 3W7CA 3H26A 1WXYA 3BOXA 3IUIA 3WQEA 4XVDA 1SW0A 2JEQA 2WMFA 4JIHA 1QO2A 3GW3A 4O8RA 3TVAA 2RUSA 4IXHA 1TIWA 3ISIX 3RM4A 1O94A 3W29A 2WC3A 5DBUA 4K37A 3FDKA 3GZ3A 3HB9A 3J7HA 4KBXA 4TVWA 3AMZA 3I6EA 9RUBA 3A5VA 2KX9A 3KHDA 1F3PA 3LK6A 2QPUA 1E0XA 2GUBA 2J7DA 3EANA 1M68A 5AHIA 3ZZ1A 3NOYA 3VDGA 3QHMA 3LGDA 5I3JA 1AH0A 4WJXA 4FXJA 1XM3A 4MNKA 1M03A 2F6XA 3R89A 4Q8WA 2UY4A 1W3HA 3EWBX 1KQZA 4PULA 1ZHAA 4WJEA 3KX6A 4S3BA 1FWWA 4AC1X 3BGJA 3MSRA 4NEWA 1L6FA 2PRHA 3RG6A 2GH5A 2V68A 2DU2A 4GBUA 1ZAJA 3N14A 1U30A 4XQ6A 5H1WA 2HSAA 4H7ZA 1KD0A 5BMWA 3EF6A 4R53A 5C9RA 2V3DA 4JTUA 4K6AA 1O68A 3S9YA 1HT6A 4UC5A 4DZIA 3THCA 1V59A 4Q8TA 2XVPA 2YL6A 4LUTA 5AHEA 3KZPA 4BQ4A 2WOVA 1MOKA 3MBDA 4X9SA 4R85A 1KFBA 5BU6A 2FGBA 5C2CA 1NH6A 1TWWA 1QWGA 4B5NA 2FB2A 2DDXA 3STCA 5AB3A 1WX0A 3FV9A 4D71A 1S2UA 1YXDA 1V3HA 2Q8ZA 2ZRZA 2ABAA 1X1OA 3PSWA 2WHKA 2Z2AA 1XBVA 3T81A 4JYDA 1UD8A 3GY1A 5SWUA 3OC4A 4BF7A 4H4YA 4YXGA 4NIRA 5M17A 2QDEA 1C29A 2QCNA 4LUSB 3DK9A 3SIZA 4GC3A 4H1ZA 3W1UA 2VVNA 1M3UA 4R27A 2BV9A 4O17A 1JQVA 5C71A 1YXCA 4QLKA 5D03A 1T96A 1SFSA 2PU1A 4GJIA 4PRWA 7A3HA 3W83A 2WSYA 1VFHA 4OQVA 4WXZA 3N1AA 4H8HA 5AVHA 3B0YA 4G2DA 1Q1RA 3W72A 2W91A 4HYVA 4IFKA 3FG2P 1YQZA 1EWDA 1GVEA 2VQTA 1E72M 4L4MA 4M80A 4HOWA 5DCEA 4C6PA 5JIPA 1OFOA 2ZVIA 1BGGA 2PFHA 2W6RA 4UQ9A 1UUMA 4X22A 2ZZ7A 4ZSTA 3B4YA 3G3DA 1CDGA 1WDRA 2HQMA 3IGHX 3ZJ8A 3LCHA 2QULA 1GVQA 4CLMA 2VC7A 4ERAA 4Z2GA 3VIPA 1TR1A 4IPLA 1OK4A 3VFCA 1M7XA 1O7AA 3I4EA 4US6A 5EKYA 2G3IA 4LEQA 3GK0A 2EQ9A 1W3LA 2RHGA 3K30A 3KTCA 2WNWA 2XVKA 1O1HA 2ZDSA 2FDSA 3CUIA 4ES4A 2E6FA 2IUZA 3A22A 2WQPA 2E40A 5AZ1A 2EG8A 1OWQA 3V4BA 1NOFA 3JZEA 4K8HA 3PPCA 3CWHA 1Y8BA 4EQXA 1FWTA 3FYOA 4RR4A 4MNLA 1SB3B 3ARVA 1E5JA 3G1HA 1OCBA 1WZKA 3TTEA 5CGQA 4YTSA 1L9WA 5CEWA 3W9ZA 1F6KA 1GPWA 3CHVA 3PHAA 3EGJA 1MZHA 2YL9A 3WDQA 3RR4A 1M6IA 3U4FA 2XPKA 3TH6A 3SFKA 1JDEA 3MDWA 5AYYA 4PL1A 8CGTA 3AJXA 2E5AA 3CTTA 3VKAA 3INPA 3O6AA 3C0QA 3HO8A 5M3WA 1EL3A 4OIFA 1P6CA 2NQLA 4D6EA 1H0GA 2Z7GA 4HPXA 4N7QA 1Z89A 3OZYA 1X98A 1WNOA 2BXYA 3AMDA 3PPHA 1OC7A 4BKNA 1XLMA 4IMEA 4QITA 5LA2A 1UZDA 4Q3MA 4EXAA 7XIMA 2I5QA 4D6GA 1ICSA 2F8QA 2R24A 4ADTA 3WJXA 1CGXA 2FFCA 2PI6A 4O0QA 3IJ7A 2PDMA 4GUJA 3C8NA 5AC6A 4HB7A 4RDZA 4GUHA 2O4MA 5DFAA 4XZHA 4PN2A 1VS1A 1XD0A 4XKYA 1P1MA 5EU9A 2B7OA 1FHLA 4LALA 2WHJA 2JIWA 3SECA 2G5WA 2ACSA 3W7RA 4CUCA 4NQ1A 1Q1WA 3MSGA 1ZJIA 3AS0A 4AWSA 3TYCA 2HS8A 1BKHA 1QOPA 1OB0A 1L6WA 1IWBA 2ZXDA 5EY5A 2W79A 2Z1WA 1JQXA 1V0KA 1IV8A 3UF9A 3V1PA 4DWSC 3NTYA 3L2MA 5GJMA 3UCQA 3OIXA 2VOMA 5JRBA 2AMGA 1WKYA 3R13A 3RM8A 3WNPA 3LYEA 4GISA 3CGBA 2DZXA 3ZR6A 4HNNA 1ZXIC 3M7SA 2J7EA 3W3OA 4JTTA 4DB7A 3DIPA 3MYPA 1LCOA 3LD5A 1OF8A 3EWYA 1HG3A 1A0EA 3SEPA 1Q6FA 2PDYA 4FIQA 2XU2A 3ARYA 4XD6A 4QGCA 4QDPA 4EVZA 5CJ5A 3VABA 3OGVA 1WCGA 1P0EA 2ODOA 3QQ0A 1WYGA 5A8QA 4TQTA 2H8ZA 4JFWA 5D4YA 5FIPA 1W5NA 3K8KA 3Q65A 1XCWA 2OLSA 1TE6A 3AIBA 4S23A 1S2VA 4AD3A 4JPGA 1DHPA 1NF7A 3EWXA 1W6TA 3HG4A 2YW4A 3TSBA 1LPFA 2O7SA 5A8MA 3BTNA 2WP5A 1MXDA 3VA8A 2P5NA 1NDAA 4P8VA 3G77A 3OG3A 4S3DA 3TX9A 1JR1A 1FEAA 1B1YA 3MCNA 3WMLA 1SMAA 3KM8A 4RCXA 4L6HA 2YLLA 4Q8PA 4C1NA 1N60C 3DFYA 5G2IA 1GOQA 3VOFA 4AD5A 3W81A 4HIBA 1CLVA 1QK2A 3IJDA 5D9NA 3RX2A 4F9JA 2INZA 5T9CE 2GQ3A 4LIIA 2YL5A 1UQZA 1QPQA 4AD0A 1MMFA 1BRLB 1KTCA 4WF7A 4POCA 3PAOA 1MRQA 4KCTA 3GVQA 2WV8A 1J0YA 4GVFA 3WL0A 1XGDA 4QNEA 3NGJA 2GVEA 3M5ZA 4XAZA 4UTMA 4DAFA 1TTPA 2QMKA 1YKWA 3MWAA 2KZHA 4A6GA 3SQMA 1GOIA 2I5IA 4HMCA 4O28A 3IVSA 4LAMA 3EAOA 1QHZA 1W1IE 3CQHA 4QHRA 5LIKX 1UWQA 1JDDA 3MHFA 1C8VA 1UD6A 3UWQA 1H1ZA 3WQPA 4QDMA 3WBWA 4Q4OA 1V3JA 2WQDA 4YU1A 2GR0A 1YPXA 3E0FA 4M52A 2EO7A 4V28A 1E1CB 3JS3A 3PWIA 5GRTA 4CU7A 3OODA 4QROA 1CBGA 1S38A 3C2EA 1NPXA 1OYBA 4G6CA 1HVQA 4MPKA 3H7RA 3N2XA 3RN6A 3TJIA 3DOPA 2QEZA 3DBNA 4OV9A 3UGRA 3UXIA 4B90A 1OX4B 1F3EA 3BJTA 8RUCA 3DYMA 3SRDA 4PUNA 1RSCA 3CT2A 4ZMGA 3ABXA 3OLGA 3VK5A 1J79A 3SQLA 4C6JA 3HG3A 2ZYFA 4Z2KA 2EKCA 4PZVA 1QNRA 2O9RA 1LUCA 4KWWA 1OHLA 2E68A 3QZ6A 3QY6A 5M1TA 3UCDA 1I0BA 1QT1A 2WSKA 1VAHA 1XIJA 1A4LA 5LKYA 3L67A 2GRTA 1JEZA 4ZQMA 3TYDA 1EX1A 3L2IA 4UQDA 4ONVA 1K1DA 3W0KA 4WKHA 3O0KA 3OHIA 3WBEA 3PG8A 3G1FA 1EA0A 1OIFA 3ZT5A 2JKPA 4GCXA 1E0VA 2ACRA 2UBPC 1LBLA 5EFFA 5T91A 2CZEA 3M6DA 5A6KA 2POZA 4N9CA 1Q7MA 4AWEA 2VYOA 2YDAA 2WANA 1C7TA 4BCEA 1P5BA 3NA8A 1A80A 1SJDA 3A4XA 4URIA 2E9BA 3LHWA 2OKOA 3EDDA 3G6MA 1NFPA 3EA3A 3VNMA 3Q67A 1D7YA 4XIMA 3A13A 5CZKA 3G2GA 5IM51 4W5ZA 4H9XA 3EWDA 3QYQA 3CAQA 1QR7A 4AXNA 2WHMA 1B0IA 1P0BA 1RPKA 2CXEA 5DT7A 5EMKA 4QJ4B 1H7XA 4J7RA 1ZP3A 4QRNA 3U2CA 2VFIA 3O07A 3BJSA 2OSYA 2EG6A 1BVZA 1SW3A 4FHAA 3A3XA 2QHAA 3GBEA 5G1MA 3IIPA 4RNFA 1IT8A 2EQ6A 3AXHA 4UTFA 3NQFA 3C56A 1A5OC 3SGZA 1H0IA 3CZGA 4AVNA 5GJPA 1ZX9A 1ENUA 4DYKA 4YWSA 3LPGA 3K4DA 1OFQA 1E40A 2GR3A 4FB7A 4Y9PA 1S2WA 4PUEA 4G8TA 1VFUA 1UD5A 1X2HA 1JGMA 4P7RA 2X40A 5G2HA 3MKCA 4IQLA 3BMXA 3W84A 1QHOA 5DEZA 3TOYA 5FJOA 3VMNA 3W7IA 3JW7A 2ZUMA 1FFUC 4YWOA 7ODCA 4D72A 1DQXA 2I7GA 3D3AA 4WHBA 1XC4A 2E9MA 3AIQA 2CBJA 5BYWA 1YMYA 1TZZA 3UWEA 1LT8A 3R11A 4DO6A 1SO4A 3ES8A 2OT0A 1NWSA 2FGLA 2C19A 4PFMA 3PG6A 1M53A 4ROQA 4U2ZA 5E6ZA 1VD6A 3GTIA 1E9LA 1EP2A 3I10A 1X8FA 1Z41A 3L4YA 3O2LA 4HMDA 2OYLA 1NIUA 1RV8A 3LLXA 3MUCA 1QBBA 4ZODA 3KVMA 5E70A 3NL6A 3PUEA 1GEQA 3QGAC 1AL8A 1TO3A 3D5HA 1GRBA 1POKA 1PEZA 3UWUA 3S5OA 2IKJA 2XN0A 1GPFA 4Y9NA 3UY7A 2PWDA 1NELA 5E0FA 3MANA 1GEUA 4GGBA 3NFUA 3H8AA 2P0OA 3PPFA 2HPMA 1LQ0A 4FXRA 4OUIA 4FI4A 1J2WA 3NO3A 2NT1A 2DSVA 3CH9A 1SW7A 3FVMA 4JFVA 3WD4A 1XUUA 1BWVA 2CLIA 4H83A 4F8XA 1VPQA 3DH9A 1HJQA 3RILA 5GNZA 3SCUA 2WNNA 1Q6DA 2X0SA 2CNCA 4O8AA 5TR3A 3CBWA 1I4NA 1RM6B 4KMQA 1IE7C 3KUMA 4YJ5A 3SJNA 4AH7A 2ZRWA 1H3GA 1C7SA 3H7UA 1M7JA 2WPCA 1WDDA 3DECA 1R85A 4M51A 2A85A 3EOOA 4YMZA 4IG2B 3IWPA 4R88A 1Q6RA 5DANA 3MY9A 1BD0A 3PG9A 4IJCA 5I2UA 2OGYA 5U1OA 1MEIA 4YTRA 1M41A 3BW4A 2WSRA 3MZ2A 1XKJA 3ARQA 4H2HA 2PAJA 3RPDA 1J0JA 2BS9A 3GXFA 1XLGA 4IIGA 1RUSA 2ZDRA 3WH9A 3TC6A 2WM1A 3OB8A 5CJMA 2WJDA 1WDPA 5KVHA 2GR2A 2P10A 1D3CA 4O13A 2FTYA 1ZSXA 3K1DA 1Q6CA 4IJRA 3R0DA 5CSYA 5CC7A 4QLJA 1JCMP 3GC4A 3ITVA 2VD9A 1CXFA 4KCVA 2CLEA 4D2JA 2BMBA 1CECA 3FK4A 3T08A 1VFLA 2ZE0A 1TPWA 1BG4A 3GR7A 3WH8A 3RNMA 2XIMA 4H7CA 5HAOA 2PDGA 3BOFA 2A6NA 2VGFA 3SCSA 3MQTA 4PBGA 4C6BA 4YVVA 1JRCA 3TA6A 2EPKX 1OX5A 1IYXA 4KEZA 5HINA 5EFDA 4J3UA 3AHVA 5KZEA 3DEQA 4MF4A 3S6DA 5F4XA 2ZRXA 4HZ6A 2Z1SA 2PP0A 3WSUA 1DVJA 5FOOA 1EIBA 3IAQA 3VTRA 1D3HA 4S2BA 2Z28A 2VFDA 3PM6A 2Y89A 1UZ1A 1QFEA 4GA8A 5CAHA 1ZBKA 4UUIA 5EBKA 3P60A 2GGIA 3NCOA 2FZBA 1F7BA 3PFRA 4F40A 1V4YA 2R1PA 2A4AA 1E71M 3WNKA 5IHSA 1PZ2A 3VIJA 1J18A 5FESA 1OSEA 2BY0A 5G4WA 3TAKA 4JQAA 3ABOA 1V97A 2RABA 1DJYA 1H7NA 2P0IA 3CQJA 4UMCA 3DI0A 2XIOA 3MCMA 1FWDC 2OXNA 4S1FA 3UEQA 3UWYA 3WF1A 3TNOA 2WMKA 1PX3A 2NUWA 1J0ZA 4RDYA 1KM3A 1DE6A 1XSIA 3LMZA 1UPPA 1XDLA 3V3WA 3VD5A 2WPBA 3W6MA 1EOKA 1STZA 3U8GA 2GGGA 1VFFA 1EO5A 4M19A 1TZ9A 1HKWA 2R9ZA 3CEPA 4DXXA 3RK8A 2QUNA 5F2LA 4BS0A 2BB0A 1LBMA 2DW7A 4RUBA 1REQA 3WLIA 3EMZA 5JCIA 2PA6A 4GZ7A 1ZQ5A 4U2YA 4EANA 3WLLA 5EL1A 4ZSUA 3A7RA 5C5YA 1W9PA 4G5DA 1EQCA 4RK8A 3GDBA 1JRBA 4HD5A 1JCTA 4NX5A 4WQ6A 2HPIA 1MW3A 2Q02A 1ONXA 3QC3A 2WAGA 4DQWA 3VCRA 5KITA 4PB5A 1J93A 1RP8A 2FJUB 3L2LA 1KXTA 3M5XA 4RLIA 2E0PA 4EWJA 4QE1A 4E8CA 4TV6A 1FH7A 4M3PA 1JXKA 4IPJA 5FF7A 4MYAA 2VFGA 3WLHA 4HVXA 1MUMA 4EPKA 1MI3A 4JTIA 2PWEA 3HZ3A 4JS3A 3R8HA 2PWGA 1X7FA 4O0ZA 2Q3OA 3I7SA 1BTCA 5CPTA 1D7FA 4PSRA 4JKLA 3R8RA 1IR1A 1LG1A 2H8XA 4GO9A 4QR6A 2ZZ6A 1GTEA 1XQLA 3CHDA 2HXUA 2XJ7A 3O3RA 1TUFA 4CVWA 5BMXA 2VTFA 3MHUA 3SZ8A 4NU7A 3WQGA 4AZBA 1KB3A 3G18A 5HJLA 1SMDA 1YPFA 4NY2A 1H2JA 4FOKA 1G94A 4O1EA 5CLTA 1G67A 4YTTA 1U5VA 3N2OA 3B9JB 4XZBA 4DIAA 4S3CA 1P1XA 4LV4A 5D38A 3PSVA 3P67A 4QQUA 1BKSA 4IGHA 1V77A 3C4UA 3KBWA 1QRQA 4CNTA 1PWMA 1XIGA 4JNYA 3FW6A 1BYCA 3SY1A 1C8QA 4UTWA 1FWNA 1CI1A 1CLXA 4I7WA 3GFYA 1ZU8A 2F38A 3POCA 1SU5A 4NJHA 4RDWA 3T1GA 2B7NA 2AL1A 4WJ8A 1VLWA 3PTMA 3RPTA 4DO5A 2V5JA 2VGGA 4FLQA 5FAJA 3SDOA 4EMWA 4X0NA 2QQ6A 3BCDA 3ALFA 2QUMA 3BAXA 3EKGA 1F8IA 3VE9A 3ZT6A 1EFZA 1RCOB 3SURA 4ZB5A 1KQYA 4GRTA 1ODZA 5HPOA 3FA4A 1UA3A 2OEKA 3C2OA 3M5VA 4H4TA 4GY0A 2FTPA 4PCNA 1H7OA 3GVWA 2QR6A 4QISA 5ABFA 1U1UA 4R7WA 1KCXA 3UERA 3UPBA 4DEFA 4LS0A 4WRHA 3LN3A 3IRSA 4XSMA 1FECA 2HMCA 2J9XA 3CIWA 4LCRA 4Z1AA 2E09A 3PFMA 2Q01A 2B81A 3WUFA 2X42A 4AD4A 3NL3A 3O06A 2V2HA 3LUTA 3T55A 1N5XA 3SY8A 4JTLA 2GVGA 1J0HA 1NM9A 3IJ6A 4JFSA 4JTFA 4P8WA 5FJUA 5K4ZA 2TPRA 2X09A 1TPFA 1TMLA 1SO6A 1N55A 1RXOB 3LI0A 4FO4A 3EWCA 1VR6A 2CEQA 4AYSA 1R3VA 1UR2A 3T05A 2EAWA 4ADWA 5CSUA 1TPUA 4XG1A 1DWIM 5BRPA 1V6VA 1WA3A 3FNDA 2H9AB 3EX1A 1MW0A 4OKDA 1W8GA 1UCWA 2OPJA 1CXHA 5DMNA 3GS6A 4NKCA 1D3GA 2PDJA 3E0IA 3CEUA 5A8OA 1SO5A 3ZS4A 5HULA 4UR8A 5EMUA 3GD6A 3TR9A 3UJSA 4CD4A 5K3VA 4WXYA 5FJIA 2A3LA 3NWRA 3UJ2A 4XZWA 1ZUAX 2FJKA 5C9UA 3WMSA 4A8RA 3KLJA 3M0JA 4U3CA 3TAOA 1ISYA 1KXVA 4WR3A 4PCPA 5PTDA 3NYZA 4L80A 4M56A 2HEJA 3A47A 3GTFA 3H22A 3DAQA 1EBDA 3UG4A 3VIOA 1ZBVA 1GOOA 5AVNA 5C7HA 4RZ4A 2QCHA 4D6CA 5FF2A 4ZOBA 5AYXA 1CXEA 1KGWA 5K7JA 4AHQA 5I3HA 1F3TA 2WBAA 2HS6A 3FAWA 5TAOA 1XIMA 1ZENA 1EF2A 1SM9A 2PLKA 1C9WA 2G50A 2PZ0A 5KTLA 1DJHA 2NWSA 5AECA 1JG9A 4KWUA 1A5MC 1RK6A 4AD2A 3GD4A 3OJGA 2QNEA 4O15A 3M0IA 4AWUA 3VD7A 4JCMA 3GG8A 5TNVA 1NVMA 1GYNA 3W7HA 1QAPA 5G1TA 2WLYA 4XB3A 3AS3A 2JQXA 4TVDA 4OTKA 1UR4A 1KRAC 3VMPA 1VBGA 5FS7A 1JYVA 4GQBA 4KRUA 4WDWA 4GD0A 4PUMA 3BUVA 1LLOA 1KO0A 1VGAA 2HTMA 1EJRC 3G1YA 2J75A 3RCYA 3RITA 1UBPC 1WE5A 2YYUA 1W5MA 1SPQA 2ZA2A 4ECLA 1CT5A 2BLEA 2XH0A 5JBEA 2VMFA 3GIQA 2D20A 3M44A 4K8DA 3BANA 1V8EA 1XFBA 3LLFA 5FS9A 3DKJA 1A5KC 3L68A 4JX5A 1UWTA 4Q4KA 1QBAA 4Z08A 4BV6A 5FKYA 1WOAA 1HO4A 1YPIA 3VIHA 4UFKA 2QW5A 1T5AA 2WVVB 4N4QA 3WFZA 3NL5A 1U33A 4HCHA 3N73A 2X8GA 5ABTA 2ZADA 4MKSA 4JYEA 7TIMA 3II1A 1B3VA 1EZWA 5RUBA 2NLYA 1O5KA 2WMJA 2YR1A 1Q8JA 3UD6A 5HQMA 1RHCA 1OBAA 2ZZ2A 5E1QA 3WF2A 3ONBA 3QSRA 1UA7A 4MM1A 4OZOA 3W6YA 3D9XA 1QNVA 2BSLA 3O05A 2X7WA 4D6FA 1MUWA 1TMHA 4DBEA 1KFLA 2VWSA 4GGHA 3W87A 2BGQA 3N25A 3AROA 1H49A 2EJAA 1VHNA 1OK6A 3BZJA 2HZGA 1W1PA 4S3FA 4B5XA 3BWWA 4MJZA 1BTMA 3IIXA 2PDFA 3KZSA 3HF3A 3LSCA 4U4MA 3VZXA 3UYCA 3WJZA 2NT0A 1TV4A 2QCEA 1JFXA 1BAGA 4JICA 2RDTA 3P8JA 5A3HA 2XGBA 1H61A 5HATA 4ATDA 2UV8G 1EP3A 3UG8A 3GIPA 1J0IA 1Q6QA 3TYBA 4I5UA 1CZ1A 3FXYA 3ZO9A 2VGBA 1CW2A 3STGA 4BEQA 1KM0A 1HF6A 2Y8UA 1HX0A 3NNTA 3OYXA 4LRSA 2VL4A 3E0LA 3NXLA 3NVZB 5REQB 1FIQB 4AZ7A 4CCEA 4DLMA 2YSWA 4J27A 2ZXBA 3QQWA 4HKPA 3GR4A 4NSBA 3VGBA 2J6XA 3BOLA 2XIIA 4EXBA 5M03A 3ARPA 4XX6A 1HGWA 3KOZA 3WNNA 2C3ZA 1UD3A 5MKGB 1HL8A 4RPQA 1E73M 3EOLA 5XIAA 2BASA 1JCLA 4LB4A 3RLGA 3BMVA 3EX4A 2WMIB 3EOSA 2DT1A 3W7JA 3NPVA 3ZSSA 2BC0A 2G41A 3KFTA 4GLEA 5IXEA 4QG9A 4IWWA 1XICA 3A21A 3WLMA 3EOUA 1EHNA 2DUXA 4X63A 3PNZA 1GZ1A 1FBAA 1O12A 5LIUX 3CHCA 1N61C 4OBTA 1WBJA 2BXZA 4H6QA 5A95A 1BRLA 5CCZA 1XXXA 2YXXA 2A3EA 2JK2A 3RDKA 3ARRA 4IXXA 2A8XA 3BO9A 2R8WA 5AC7A 4OHQA 2FHCA 2NXHA 1DJZA 4I6KA 1Z32X 3IUHA 4CEUC 4HA3A 3CV6A 4HPHA 3KCOA 1J9YA 3KRSA 1EXPA 4FLOA 4I5XA 2V3GA 1EGVA 4LCSA 1WP6A 2OQHA 2C16A 4QAIA 2IKIA 4Q4PA 3VNYA 3CUFA 3ENLA 2O9PA 3FYYA 2A3BA 5J8LA 1HJVA 4B2DD 3GX9A 3M0VA 1P48A 4HHHA 4OBSA 1QO5A 3OVRA 4GKLA 1R3YA 1W1A1 1XCXA 4ICCX 3WH6A 2EPNA 2V69A 2XN2A 4NJKA 1VHCA 1K9DA 4JZ5A 3KOWA 1E1CA 3BLDA 3AUOA 5D33A 1KBJA 4AU0A 1TPDA 2CIPA 4ZQRA 4Z0JA 1Q7ZA 1XHGA 3C2FA 3WIJA 4PC8A 4UTTA 3EYPA 3N11A 2GJXB 3GG7A 1W91A 2NX9A 1RBOB 3RX4A 4HU8A 1QPOA 1G4SA 2VX6A 4J1OA 3LENA 1KKOA 1UP0A 2VOTA 1OX4A 1Z8AA 2WB5A 2V2DA 2J77A 1DTUA 1L2QA 1TB3A 2J25A 3PBYA 1SFLA 1WXJA 3B05A 3E9AA 1UKOA 4JQ2A 3I7QA 4KGLA 3ONCA 1EPXA 3IGSA 5IRPA 5T9BG 3HJZA 5DF0A 4R34A 1PDYA 3ZLHA 2TODA 4CNOA 2YDQA 2GOKA 1PIFA 4W9TA 1S5TA 3SCRA 4LVBA 2HK1A 4XBJA 4YVPA 3QY7A 2C1GA 4XUYA 3R6IA 2OQLA 3B8UA 3AIRA 1EDQA 2C91A 4B4HA 5F4SA 5C7VA 3ITYA 4E2OA 2FMNA 3ZSTA 1VZWA 4UR9A 4JHZA 3KL0A 3BGAA 1NP2A 3BPWA 3TNBA 1PWLA 3CWNA 3UA4A 3HIJA 1XIFA 1KRBC 3RLHA 1JRPA 4LC8A 4S3GA 4DBDA 1EYWA 2YXOA 2CFFA 2AOSA 3IJ9A 3TK7A 1HL9A 1PAMA 2DT0A 2NQHA 5CPOA 1WKEA 3RAOA 5JIWA 1THFD 1OT1A 5LYRA 4H19A 1UMYA 2C6QA 4R7JA 3BLOA 4I7UA 3OA5A 1TR9A 3PZUA 4IP5A 4L65A 1NWTA 4DO4A 2BOFX 2ADAA 5D2VA 1LYXA 4CCDA 2C3DA 3T0BA 1E51A 4ENLA 2ZXAA 4UNIA 4LT9A 1WB0A 4ZXOA 1I2PA 5EGRA 2IQ0A 2WSQA 4EE9A 2NVAA 3XIMA 1XLJA 3N19B 4M81A 1DWJM 1I75A 3E0WA 1EJTC 1LBFA 2QMJA 2Q71A 1V3KA 2NVCA 2HCVA 3TEVA 3ID7A 4GJJA 1I8JA 1C91A 4G7EB 3CIVA 5A6TC 5FSEC 3GRTA 4J3ZA 4FP1A 3AICA 2ALRA 1X2GA 1KWGA 3VGHA 1MEHA 2WZTA 2WLZA 3VGFA 1MXGA 3TOPA 1R3SA 1VEOA 3BURA 1V93A 5EMLA 2OWWA 4C90A 1W1VA 3RYSA 4MKVA 4MNJA 3L0KA 3KOYA 5ECUA 3S2LA 1W1TA 4MADA 3B8SA 1HL2A 2TMDA 3MZNA 1LOLA 4IFOA 1EJ7L 2C1HA 3NM3A 3QVQA 1B54A 1XSJA 3TA9A 1OF6A 4UFMA 3HFTA 3S9ZA 1VFOA 2DGAA 4QNWA 3NQ7A 3P74A 4C91A 1AZ2A 1GRHA 1GVRA 2VZUA 1WO2A 2J27A 3W00A 2YA2A 1DXIA 3CM4A 4XZIA 4Z2JA 4NZ1A 2X30A 1TELA 2XFFA 4OOUA 4TIMA 1RK5A 3DBPA 2QJJA 4WOQA 5U25A 5LZLA 2X8CA 3K5XA 3W1LA 4QS5A 1UZ4A 3AHXA 4W4QA 4J56A 1LWJA 4FOJA 2OZ3A 1XLIA 3WDPP 1DHKA 1TV8A 3PNUA 1JIBA 2MUCA 2VRQA 3A3HA 2VCBA 1WXZA 1VIZA 4AIUA 5H8MA 4PE8A 5HR7A 4BI7A 2BY3A 3TMLA 3CZLA 2Z2UA 2NXGA 3DX5A 4TOQA 3T0DA 1OC6A 2D3LA 4UOQA 1E0UA 1J4EA 1JNDA 1UWRA 4FLRA 3EPMA 2XFRA 2YL8A 4LUYA 1ZL1A 3KRBA 4J57A 3WBYA 1FHDA 2GJNA 2ONEA 1OEPA 3P0XA 1CX9A 1AQFA 4UZSA 3UVAA 2GUUA 4CQDA 2P53A 1XF0A 4M6PA 4AFYA 2NXIA 2FDMA 4FZIA 2F6KA 4UTUA 1E4NA 1K4HA 3SAZA 5CLWA 4XAPA 2QS8A 2P88A 2V3BA 4JBRA 2B4GA 3CPRA 3TTOA 1SJCA 5DCBA 5E6YA 2PZNA 1FCQA 3AZTA 3HPZA 4WDTA 1AW2A 1XPGA 3FOKA 1JAEA 4PODA 4B3ZA 1TTJA 3KS5A 3NVYB 3O1NA 2GDVA 2PWHA 4B2DA 2VR4A 3PPGA 2D3NA 3GZAA 4ZB0A 3R43A 3E2RA 3BC9A 1ML1A 2WSPA 4IT1A 4FA3A 3STPA 4N6EA 3FSUA 4H4VA 1C92A 3EUB3 2DQXA 1E6QM 1XQKA 2J62A 3NQ2A 5BU9A 2PTXA 3ORWA 4NUWA 3AFBA 4G1NA 2QGYA 3TCEA 1JD7A 3GH7A 5DBTA 4JFTA 2JF6A 3PZTA 4JQ9A 1JYXA 3IJ8A 4ZO8A 1UWSA 3L4VA 1OCNA 3BXWA 4LF2A 3MI3A 2CZ5A 3R1ZA 1J0KA 1JUEA 1AJ2A 5D9PA 4U31A 4PEEA 4MTVA 1AQHA 1HJWA 1ITQA 1YHTA 3QC0A 4N02A 1TJPA 1PIGA 3WEOA 4HNCA 4GH1A 2CERA 5FEPA 1JI2A 4PGLA 4OECA 1DL3A 3HURA 2GSJA 3UETA 2NQJA 4GK8A 2O56A 1VBHA 3QOMA 3WH5A 2X1UA 3OIHA 2ZC8A 5A8GA 1HJXA 4GJ1A 3F03K 3O7UA 4MB1A 1VFMA 5I6SA 1B9BA 1KM1A 3QR1A 2OX1A 4N6FA 1W9VA 4KFOA 1KR1A 4GG9A 3VKJA 1TQJA 1I2QA 3IRDA 4K7VA 1EGMA 2Y7DA 2QGHA 2DT2A 3HU7A 3BSGA 3ZR4A 4W87A 1UW9A 5I03A 4KEUA 1EO7A 4IUGA 3N18A 4K7YA 1ISVA 4WY0B 2QAEA 2ZICA 3VDHA 3IANA 1PJ9A 1JCNA 3S1VA 1QOQA 3DUGA 4DVOA 1A53A 2GK1B 6REQB 3PJWA 2W92A 4LX4A 2B7QA 3VXGA 1W9UA 1T41A 1K3UA 3H70A 1JJKA 2W5FA 4C6LA 3ARXA 4H01A 2Y6ZA 4WZHA 1V0NA 1I0DA 3UBPC 2W3ZA 3DENA 4NX0A 5D04C 1ADSA 1S1RA 3PUGA 1AOGA 3GHTA 1GVFA 2Y61A 3CV7A 3WJWA 1Y65A 3U7VA 2OLAA 2V5LA 5DY2A 2IPWA 1BYDA 1DKWA 2O0TA 4Y9OA 3AHYA 4HYRA 1FY6A 4JY9A 4ZO9A 2CYGA 4QAWA 4CNPA 3S42A 3MJMA 3DXIA 3UZJA 3LB0A 2ALDA 4BY3A 1NTHA 3LA4A 1IR2A 1ZAHA 2I17A 5EMMA 2I57A 3WK1A 5BOFA 3MWCA 3PBUA 4WOZA 1JPHA 3AYSA 3DG6A 1IXOA 1GRFA 2PDKA 3TTSA 3N2CA 4K39A 1A5UA 1E6PA 3O63A 4KT2A 3SSJA 3W7LA 3BK0A 3W75A 5LGZA 4PUUA 2PGFA 1OIMA 1R9YA 4OT7A 3ZT7A 4K36A 3QZEA 1FP9A 1M04A 3O8AA 4PBEA 2Z1BA 1WUEA 3AMKA 2J9YA 5D2WA 2V81A 3R58A 3GSMA 1RD5A 3N6QA 4M1BA 4NYUA 1G9HA 1NHRA 2V5CA 4DXKA 1SR9A 4GIEA 3WLQA 3P5YA 2WCGA 3WBXA 3CS2A 3A7AA 4C1KA 3AWOA 2E1WA 3H21A 4LVGA 3HJEA 4DM2A 4W8BA 2DZVA 4DZAA 1GYLA 1PZ1A 3A3WA 5K9XA 3W7OA 1DJNA 1HVXA 2X16A 4CQBA 1XLBA 3M46A 2QUUA 3K4WA 1IQ8A 4LTSA 4PEKA 1B3WA 4JCLA 2PLJA 1LORA 4G9PA 3T8LA 1WKDA 1OZMA 4BR1A 4Y6GA 4KGJA 4WLCA 1W17A 2DORA 5A8PA 2F2KA 3P0WA 3G0SA 3QLDA 2TPSA 1LL4A 3T9PA 2Y70A 4LW7A 4O12A 4ADSA 4YYCA 1CXLA 3H2OA 3LHUA 3TSMA 4IPPA 2CLKA 3EMQA 1TYGA 3K8LA 2OSWA 3W25A 3B9OA 3FKKA 3NXFA 3VZZA 5E9XA 1HJUA 4HNVA 1US3A 1X8CA 3QSTA 2E28A 2J7HA 2VZSA 4F2BA 2QF7A 1Z42A 4E3VA 4HU0A 1EKOA 4H00A 4Q8MA 1E4IA 1XUZA 3LI1A 4XKMA 3P6LA 2H3BA 3KVJA 4MY8A 3HPFA 3U5UA 5FCZA 3HGOA 2RFGA 1V6WA 4GZEA 8A3HA 1VEMA 1DJQA 4YLWA 2VX5A 4C6NA 2OYMA 3N04A 1DXFA 1VJIA 3PWAA 5CC3A 1VJZA 4JKMA 2ZZ1A 2JBMA 4KFPA 3N9SA 1F74A 3AS1A 2NQZA 2G8ZA 1E9YB 1PSCA 4UQEA 3UCCA 2VP8A 3HA1A 3N12A 2ZUNA 3DK8A 3EDJA 3BG9A 4AX6A 4FXSA 2FZ9A 2C13A 3M47A 2CBUA 4L9YA 4EP8C 4TTUA 4W89A 3W1MA 4H4PA 3IIVA 2YYTA 1JZ5A 2CLPA 5I0DA 3SQPA 4H2CA 1TV5A 4UWMA 3M64A 1XRSA 3UWWA 1LLZA 3IS4A 3VCNA 4XO7A 2H9AA 3HBLA 4Q4RA 1FH9A 3BARA 4GC4A 2FTWA 3AIVA 3N17A 3ZJKA 1H11A 2D0FA 3F4DA 3KBNA 4JX6A 2NLIA 3TP4A 1I2NA 2JIEA 1VCVA 1E5NA 4FR6A 3H4GA 4JX4A 3P14A 3T0TA 4AHPA 1Q6EA 4UTTC 4PTMA 1NP0A 2DVTA 3VI2A 3VIFA 1W3NA 3ZLGA 4AQLA 4UTKA 3PVFA 2BODX 5IHRA 2VZOA 4B4FA 1JAKA 4RDVA 1GKPA 1Q2SA 1MQQA 1IT7A 1TCDA 1XI3A 3W6LA 4OVXA 1G01A 3AOFA 3IUDA 1Y5VA 7CGTA 4LF1A 5LSMA 1NQ6A 1I2OA 1ZLPA 4ZL1A 1UC5A 3THQA 4F0RA 1KN0A 4REQB 1QMLA 2XVLA 3NQBA 1KTNA 4IP4A 3ARZA 4ROPA 2B7PA 3KBSA 4DAIA 2XWDA 4UTJA 4W93A 3VINA 3TYAA 4IOTA 4Q6JA 5H91A 2IQDA 4DN1A 1AJ0A 3N3MA 4M7TA 2EPLX 3II4A 3R25A 1EJSC 2D2HA 4AEFA 3PBMA 3LCGA 3ABQA 4RNIA 2OO6A 5U7SA 3GHRA 1E1FA 3V0TA 4H8UA 1TYPA 1R38A 1F07A 3WF0A 3NVVB 3G1DA 3BCJA 3TCSA 3ARUA 3MDUA 4ACZB 2C14A 3BMWA 3TXVA 3W88A 4GYJA 4K8GA 2G3MA 4KERA 2P76A 1GTHA 4JTAA 4E4FA 3HGSA 3GXIA 2AQVA 2RAGA 1X6UA 1ISZA 3ITCA 4XAFA 4ATLA 2J8GA 2XIJA 4TR9A 1H2IA 1TCMA 3GKAA 2DFAA 5CH9A 3WNOA 1WAUA 5CZSA 4RE3A 3AJ7A 3WMCA 3BQ5A 1WDSA 3NO1A 4CCCA 3MT1A 4DI9A 4P61A 4P8UA 3SRHA 1YE4A 3KTXA 3FEMA 5ENLA 4JHMA 3ITOA 3O9NA 1QW9A 4UCGA 4U10A 1X6LA 4M6VA 4QG8A 1LWIA 1T8XA 4XTIA 4DI8A 1GJWA 1XIBA 4KW2A 1L6GA 2YVGA 4F4RA 1Z3NA 3W24A 1QVBA 4N42A 4WVXA 2VI0A 3UP8A 2QUTA 1CWYA 3A12A 4LS2A 5KEZA 4TMCA 4MFDA 1T3QC 2FZ8A 4KWSA 1GW1A 4LANA 1FCUA 4P8XA 4LVDA 2AMXA 4OFCA 4GFSA 4HA4A 3LRMA 3HQ1A 1GRGA 3VDBA 3HM7A 1WOBA 1PBGA 4NZ4A 1PKNA 2D22A 4H8VA 2X8HA 2G3JA 4QIUA 4X9YA 4GRSA 3WQVA 4ATWA 2CZVA 4B9ZA 4GNKB 3CMJA 2CLFA 4CQAA 5BXTA 4GUGA 3EB2A 1W32A 1H62A 5LNWA 1TPC1 1GT8A 1PKLA 4PSPA 5HMDA 3NPXA 2G4FA 1W2VA 5CSSA 2RDXA 3TYZA 4O52A 4MB3A 5A2AA 2CFYA 1AZ1A 4FPSA 4WDUA 4KFNA 1G7VA 5F1VA 1F5ZA 3L0GA 1QI0A 2W66A 4GIAA 3FGCB 3QF0A 4W84A 1PHQA 3WQDA 2W62A 3GDRA 4L5ZA 4CN1A 1TJ2A 4N9BA 1TTIA 3B0UX 3R79A 4DPPA 3SN4A 5HQEA 3W23A 1PL9A 2P3EA 5REQA 2JEPA 1L0PA 1R0MA 1FX6A 2CZFA 1J6PA 1E56A 5FACA 4AZCA 4DBWA 3W74A 1ISXA 1W3IA 1LDCA 4R9XA 4MPQA 5CPLA 4XZMX 1T99A 3EA2A 2OODA 1JNEA 3LCIA 5MKGA 4QSFA 3DERA 2CZDA 1BXCA 1NWRA 3MV11 2PRMA 2WMIA 3EAUA 1IEWA 5CGTA 3OA3A 3MYOA 4QM1A 3DFNA 3ATYA 4LAKA 4IX0A 2WM0A 4EWND 1FDZA 4DY1A 1S7MA 2DSUA 2ASHA 2OG9A 1CXIA 1K9TA 3POHA 1G4TA 3BDKA 1PIIA 2G4JA 3MPGA 4JD4A 1CGUA 3RX3A 1BXBA 1M6JA 3WQCA 3MI6A 2VKZG 2FZDA 4JN6A 3F2BA 1LG2A 4FNRA 1J96A 3L4WA 4E2VA 2VEPA 1W3TA 4FS9A 1X96A 3KS6A 4LAZA 1ZB5A 1ZDLA 1PUDA 4LYQA 4CN4A 3MVIA 2WZMA 1ZS2A 3WD2A 2QDGA 1N82A 4KCUA 3HG5A 3NM1A 3KOXA 3UR5A 2O92A 4RL3A 1UWIA 4V1XA 3LZ5A 4Y7EA 2GGEA 2A3AA 2XZ7A 1D8WA 4W7UA 1ZTVA 1UASA 5JXQA 1GWJA 2REQB 1ONRA 3C61A 3RJXA 4C5ZA 1B30A 3E96A 1RVKA 1F6YA 2J47A 3M16A 3LXBA 4JHOA 2E6AA 1Q3NA 4JIPA 4ZE4A 2YVJA 4RX0A 5HOSA 5E9AA 2WYSA 4C60A 4C6QA 4MNMA 2J79A 3GDMA 1AW1A 1VYRA 3AQUA 4GCAA 4Z17A 3ITTA 4A8IA 2AKMA 4I3GA 3NG3A 3K13A 1D9EA 2QDHA 2NSXA 2OX4A 2YA1A 4UNKA 5JBFA 1HKIA 2XINA 1BF6A 2QCMA 2Q8XA 3LM7A 4FK9A 3ZLFA 2PRLA 3UZWA 4EF8A 1S5VA 2CLMA 3VIKA 1X6NA 1RQEA 3S5SA 1BVNP 2FHFA 1RLCL 2XIBA 3LHTA 1NQKA 4GYFA 1TVLA 3LPFA 2VURA 2VCAA 3KWXA 1EX5A 4CD8A 1P4CA 1YTEA 5GJNA 3GW0A 2Z24A 2J8FA 3S5YA 4WUIA 4M24A 5FS8A 3RF9A 4GI6A 4IFKB 1V02E 1EB3A 1EZ2A 2QAFA 1UIOA 3COTA 3JRKA 2YKKA 4GQQA 4MAZA 4JYFA 4PMJA 1YADA 3PULA 2Y0FA 1ITXA 4IIDA 4C7FA 3C52A 4FEZA 4QX4A 4XO6A 4RJEA 1ZJHA 4R7OA 2JKEA 4UZUA 1A3HA 2VGIA 4CKQA 1W2PA 3L4TA 2ZVRA 3CUXA 3BLFA 1B4EA 2W0UA 1SUXA 3CGDA 3BAWA 3IIZA 4AEOA 3UG5A 2W9MA 4O0KA 2HVNA 1UB3A 1K7XA 3IJLA 2X1TA 2XSXA 1GNXA 1RJPA 4LBSA 4JY8A 4W86A 1FWRA 2CHOA 3GNNA 1SZNA 3GYEA 3CLWA 2XM1A 4TMBA 3WUGA 2INFA 2WCAA 3SB0A 3HV8A 3Q58A 1ELSA 1H7RA 2DW6A 2OFJA 4LXFA 1NY1A 2X0YA 4DELA 3F1QA 4E4PA 4BQ2A 3UESA 2W55A 2GPTA 2PC4A 5IBXA 4PH6A 4MWAE 1VLIA 1KLYA 1JROA 4IMFA 2XH4A 4BURA 3PJUA 1KNWA 1GVOA 1JXJA 4G7EA 3HPAA 2ATSA 2H3DA 2QCFA 3CC1A 3QV9A 3VIMA 2FVKA 3UWZA 3CO4A 3V0UA 4B5SA 5KZMA 2PGWA 2X99A 5HNTA 2V2CA 1AD1A 1W3KA 1H1YA 4K7ZA 2J4GA 1V51A 3DHPA 5I24A 1XDIA 5EBUA 3LCXA 4UXDA 9XIAA 4E38A 2VRJA 3M07A 3LNMA 1O5QA 1G4PA 2YBTA 1Q4NX 3ZWTA 3P62A 4FSAA 1Y5WA 4YVXA 2CDUA 3WN6A 5CG7A 1SZEA 4BF9A 2V5KA 4CNSA 3U7BA 1DIKA 4D6JA 3AALA 3URQA 4HSHA 2ZZ4A 1QJWA 1XRFA 1EPVA 3DFOA 2CW6A 2Z29A 4R3UA 4APNA 1NDWA 1MSSA 2WJZA 5XINA 2Y8KA 1XYMA 3VNZA 3CQKA 1YQ2A 3WCZA 1F8WA 3NSNA 1EGZA 1YDYA 1JDAA 4D6HA 1ZKQA 3C5QA 2FH8A 4UFIA 2Z0IA 4DJED 1E9ZB 3AU2A 4H9TA 3S4TA 2PDLA 1CCWB 1SYTA 3KBVA 4LPCA 4MGGA 3WDHA 2R94A 2E77A 4Q22A 3DESA 4TXEA 3LCWA 1F4HA 4Q32A 1TJRA 4IMCA 1A5NC 1NARA 4RXFA 2EF9A 2C79A 3GTHA 3ZR5A 3W82A 3WUBA 2GQ9A 1P6BA 3U4AA 6TIMA 3LQLA 4FR1A 3WQFA 2Q8LA 4IQDA 4ZEPA 4JN7A 1HZYA 2XFYA 1RH9A 2IPFA 4ZQPA 3CHFA 4HSOA 1UH2A 4AISA 2P8CA 4QJ5B 4OU1A 4PFHA 5JU6A 1JZ4A 1N8FA 2O7QA 1XIDA 3P5ZA 3VUPA 4GKTA 1WDQA 5C9ZA 3LCLA 1TPEA 2EGZA 1ISWA 1HP4A 4XD5A 4M6UA 3W28A 5JVLA 3AXIA 4A8LA 3VGDA 1ZBCA 3F4NA 2WKGA 2HVMA 3LY0A 1XLKA 3TZNA 5C9WA 1WYIA 3DU0A 3CZ8A 4MDOA 3TONA 3LQGA 5AC4A 1EH9A 2QCLA 2CKRA 3UYIA 3SI9A 4C7DA 2L5HA 4NI3A 6ALDA 5DRCA 4JGDA 4DO7A 3SY5A 4G56A 3OOQA 4GR1A 1HO1A 2PWVA 2V6OA 1LRQA 2NV1A 4R5EA 3XISA 4WK9A 2VENA 1WDWA 1IZCA 4MWAB 4LH8A 5MF5A 1K4GA 1DJIA 2BP1A 4LOCA 4OUEA 5KMYA 3NPWA 4OBRA 1H6VA 1HIZA 2ESCA 3S1XA 3T2QA 1J11A 2PMQA 1VP5A 5HXMA 1LWHA 4GACA 4MZYA 4RZ5A 1GOWA 2V38A 3O15A 4A3HA 2RKXA 2X1IA 1R7OA 3GM8A 3UGVA 2ATMA 3JR2A 3IJQA 3IACA 2FGZA 4Z2LA 1PB0A 4E0CA 5BRBA 1AODA 3QGVA 3KP1A 4NNCA 1TRIA 4O1FA 2QAPA 1ADDA 1GONA 2BBFA 4HK5A 5J5RA 3UFYA 3NYDA 3TLQA 2GVJA 4MZ1A 1IF2A 1UR3M 2FPVA 1NDVA 5BXPA 1KXHA 1X39A 4Q33A 4H6KA 3MTWA 3WLNA 4F0MA 4NI8A 1A0CA 1UKSA 4CU8A 5AC5A 2E9LA 3DGBA 3OZPA 1Q8AA 3PBVA 1TYTA 4BEUA 3WFLA 3ABZA 4DM1A 3OBAA 1AH3A 5H2ZA 2G37A 3ZFHA 1TWDA 4ZVJA 1V5XA 3B0PA 3W1AA 3B8IA 3DJGX 5A6BD 1S5MA 3VKDA 4WY0A 2V8ZA 1SSDA 1SFTA 3VKKA 2DSWA 1UWUA 3F5KA 2ZZCA 5AZ0A 1V0MA 3S2CA 1RAKA 4PRRA 2OO0A 2GK1A